1S5HA

Potassium channel kcsa-fab complex t75c mutant in k+
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.
pubmed doi rcsb
source organism Streptomyces coelicolor, streptomyces lividans
molecule tags Membrane protein
total genus 48
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA01
2CDEB 3VRJA 2P4AB 1JGUH 4E42B 2F58L 3EFFB 1IMHC 4HCRH 2CSPA 1DBML 1TFHA 3QG6A 5DZOA 4GRLC 4U1KA 3D25A 3FTGB 5F7UA 5D1XD 1II4E 3HNTL 4HBCL 2Q8AL 3LB6D 3QNYA 4G9FA 5GS1B 4YGVB 2EZ0C 3QUZD 3MUZ1 1KIPB 5J6HA 2VXSH 1V3LA 2ICWI 5DXWA 2YEZB 3KYKH 1JF1B 2HG5A 5K9KA 1TCRA 3RDTC 1IC7L 3MV01 4C83B 5LAXB 5HVHB 2X4NB 5H35B 1J8HE 4UQ3A 2BMKB 4HCRL 2NW2A 4FNLH 1CLYH 3EGSA 2ERJB 3T2NH 5ETUB 3PWVB 5D7LD 5JZ7C 3VXPB 4HZLA 4G8GA 3VCLA 4UUJA 2VXSL 4BELD 2J4WH 4R4FL 5HVWA 2JIXB 3QWRA 1CL7L 5I8OL 1K5NA 2F53D 5C6WH 5FV1L 3IDIB 1S7XB 4JPWH 5IHZA 5IT2H 3S5LA 1UM4H 4DOHB 5IFJA 1BIIB 2W60A 3E8UH 3P9MA 5FFLA 1UH4A 4P4RA 4HLZH 4FNLL 1F02I 1MLCA 2WIIB 3HFML 4AEIH 4BFIA 3SDAA 3KDMB 4HKBB 5MENA 4H26B 1UB5A 5TGBA 1IEAA 2FATL 2R2HA 1QSFE 3BIBX 2J4WL 4PG2A 4BH8B 4BK5A 4LRIA 4AM0B 3KYOA 4U4BA 3UTQA 3B43A 4M7KL 4XCNB 5IT2L 3VXRB 1B0GA 1UM4L 4LLVB 3E8UL 2VLLA 1QPPA 4AEIL 1P9MA 2GITB 3QIUA 3HA0A 5IBUB 4FN0A 4RCAA 3VGAB 3IDNA 1FC1A 1YEKL 5C0BD 3UZEA 3D0LB 5DS8B 3KYNA 4HMEA 2Z31A 4PJGB 5DQDH 2C3XA 2FJGA 4W6YB 4ODBD 3WO4B 2BSTA 3CH1A 1KSRA 2CR3A 4M8QA 4B50A 5CEZH 3N1FC 4YXHH 1T21B 2AK4E 4ZQKB 3P11H 5IEKA 5C0DB 4H5SB 3ARED 4NZRL 2GJ6B 3QNZB 1OTSD 3EYQD 3D18B 2LU3A 3SGEI 5ICZB 3D9AH 3NFSH 4YHKH 4JREB 1CGXA 3ZL4H 1C8PA 3IF1B 5J1TC 2BVPB 2CGRL 1IGMH 2VITA 3UZQA 5DQDL 2EIBA 1NEZA 5GRJH 1ZHNB 1MCOL 2OL3L 1I3RA 4FFYH 2QJDA 4WHTA 2DL9A 1BZ9B 25C8L 3P11L 4R2GB 4HIJA 1G7IB 2KQNA 2Q7YB 4TUOA 5DVOA 1AY1L 1H0DA 2AABL 3AMKA 2J5LB 3D9AL 3QDJA 4QXGH 5C3LD 1O7SA 4YHKL 3MJ8A 5KSVB 1JZ2A 4Z7WF 1JWUA 2W9LA 1KTLA 3VMPA 4A6YA 3TT3H 2YSSA 2EDJA 5E99H 5DJXB 2LAAA 2VXUL 4HJJH 4MNHB 4DN4H 1XGQA 4WV1C 3P73A 4KK9C 3RWHB 4WY7L 4Y19A 4PRHE 4KPHH 5EN2B 4IRJA 4HUNB 3ZDXE 3E2HC 2F8XC 1D5MA 3L6FA 4QXGL 3HR6A 1WIOA 1A6ZA 4P9ML 5E99L 4H20L 1BPVA 4NP4H 4NQVA 2Q3ZA 4RDQF 4OZHE 5I74B 5E5RB 2EDEA 3O2DH 2PYFB 4P3CH 3WIIL 4MQTB 3Q3GA 4TVSa 1FSKB 1KJMB 1FCGA 3DV6B 2VLME 2WWKO 3AB0B 2V5SA 1FORL 4YLQT 1JZ5A 4KJPC 5E1AA 1LK3L 1RIUL 2X5PA 5FKAA 4OV6F 1RK0B 4NP4L 4HMDA 2BVOB 3CPLA 1EZVX 3FKUS 3O6FC 1FZKA 1NUDA 4MCYA 5D5MF 4U0RB 4XP1L 4NBXB 1MCWW 3D85B 1DVFA 2K7QA 4P3CL 4E41A 2H1PL 1HI6A 1VFBA 4RAUA 2MCPL 1FVDB 3PP3H 3BH9B 3GKZA 3DVFA 3WL9B 1FFQA 4O4YH 3V6ZB 3NPZB 2D31B 2DI9A 5E56A 4OCMC 2AV1B 4DKEH 5C0CB 3REWA 3T0EB 1FFOA 2IBGA 4Z7WB 2H6PA 2XA8H 4OBRA 5JQ6H 2Q6WA 4L8CB 1I3GH 4LPXA 3DX6A 3DROB 2H26A 3O4OB 3QEQB 2KH2B 2YMXL 3BH8B 3IS0X 1ITCA 2OS7A 2AXFB 3V7MA 3W0WE 2FIKB 2R0WL 4GBXA 1DQLH 3TBVB 1JUFA 2ORBH 2M8XA 3LPGA 3HC3H 2IPKA 4L4VE 1FL3A 4BFBD 2K1MA 2I07B 5HDOA 4F7PA 1LQSR 3BDBA 2XA8L 2AS5M 2RJMA 2WINA 2WQRA 3R0NA 4C54A 2VDKL 1AHWA 5F21B 1I3GL 4Y4FD 4M93B 3RWEA 5D4QA 3BJLA 3E0GA 4LDEB 1IGTA 3TBWB 3I75A 5FOJA 3GMQB 2E5EA 3MRJA 1C5CL 1DQLL 1I7TA 5DRXA 4UDTA 3SDDD 4KROC 5L8KB 2ORBL 1JYVA 1MIMH 3F12B 1BJMA 3HC3L 1X4YA 1XT5A 2A1WH 2P5EB 4M6ML 4KJYA 1XF3A 5LGKA 3OJ2C 2GTWA 1DQQB 3CLEH 2FX8H 3ES6A 3I02A 3QDAA 5BZDA 2CKBA 2ZUXA 5CHNB 3MJ9A 5MEPA 4X6EB 5I8KH 5F72S 5D5MB 1XCQA 4K71B 4OCLC 1AGCA 1S7TB 1OTUC 3IU3A 2UWEE 4OD3H 3OG4B 3RVXD 2VISB 3WHXA 2JCCE 1J1OL 3O3AA 3ARFC 1MI5B 4HEPG 5I6XC 2A1WL 4PB9H 3K8LA 2JELH 4TQEH 5I17A 4QRUB 1XAUA 2GUOA 2XZQH 4I18B 2EXWD 2GW5A 1U8QA 5J1SC 5E2UH 1TVHB 3W39B 5DTFB 4QRPB 5E00A 1CXLA 5J0BA 1FZOA 1MRFH 3BQUC 5SWSB 4DGVH 4HIEB 3DVIA 4F7TA 3S88H 4PB9L 3GJEB 2B5IC 3MYJB 1RZFH 5D1QA 2XZQL 2P8PA 3JV6B 3F5WB 1QG3A 4JZNA 2VIRB 1XF2B 1V7MH 1KN4L 3FQUB 2FYYA 4FMKA 5FO7B 5BS0A 5BOPA 4GXVH 4C55A 4P57B 4HD9A 4QRQB 1IL1B 5GSVB 5FECA 3D69A 1DQDL 4Z78B 3RY4A 3HI1B 3TIDB 2V17L 3BKCH 4DGVL 4N9GA 4ODTH 5KN5A 1E4KA 1FGNH 2YBRA 1K4DB 3SKNB 5IB1B 3S88L 4ELME 1CICD 1TITA 3BP5B 1P7HL 4WTZG 1V7ML 4LHQB 1Q9OA 12E8H 3VWJA 3MBEA 4KMTH 4QT5A 4I2XA 3ULUC 2IQAB 4OUUB 4HPYH 1QACA 1S8DB 3VFPA 1NDGB 1I8KA 3BKCL 4XMLH 4HGWA 3L3OB 5F71A 2NY3C 4DQOH 4K94C 1MF2H 1MPAH 2IANB 2PO6B 3RWCA 3SDAC 5ESAB 2CJUH 1AGFA 3V52H 1MREL 1P2CB 3LDBC 3VGDA 3EO9H 4P0DA 3CU1A 3MYZA 2FX9L 1Y0LB 3SQOH 4MJ5A 12E8L 1NCCL 3HG1B 4KMTL 4PJFE 4N8VG 1NMBH 1VB9A 1F3JB 5TF1H 1WV7T 3LEYH 4HPYL 4NT6A 4EDWH 1HNFA 5D7IE 3REVA 3HAEA 3FQXB 3ETBF 2VZ3A 3VFVA 2VLMD 3U0WL 1MF2L 3QQ4B 2FJFA 1R5VB 1TQBC 4DUXA 1P9MC 1FC2D 1FN4B 3GSRA 2CJUL 3AS0A 3EO9L 5CSBA 1R3KB 5HI5D 3U6RB 5B39B 4OF3A 1CE6B 1CXEA 3P4OA 4LEXL 2W9EH 3QCVH 4ZPTA 43CAA 4JO1H 1NMBL 5I76A 1D5BA 3LEYL 3KR3L 4UT6L 4CADA 4EDWL 5GIRA 1ZKAA 4GW1B 3VXOB 3KPOA 1DBKH 2IBBA 3TJEH 5JA9A 3IDMA 1X6NA 3LQMA 1F58H 4NUGL 3NFPB 3V6FB 4UDUB 1G9NC 4OZIF 3VXSA 1AKJD 1FVEB 1HCFX 5EBLB 3O11B 3IFPA 3SKMA 3RX5A 2W9EL 3QCVL 2AQ3A 4XPFL 1EHNA 1VEMA 5C0AD 3QNXA 4XGZB 2X4RA 4HS3A 4NQDA 1MVUB 1DBKL 3PWPB 2BOCA 1EAPA 3GIZL 2XTJB 3L5XH 3Q6FB 4LSQH 5GGVH 2VZUA 5SX5K 2NY0B 3UZVB 3W0WD 4JKLA 1RHFA 3PGCA 1LO2H 2UZIH 2XFXA 5EDXA 1B4JH 1ZTXH 3QDMA 4NC2B 4X98A 5D96C 3FFCB 5T5FH 3MREA 2FECI 3MV8E 4WRLA 1D9KD 3EOYG 1U8MA 4ETYA 5EFIA 5HYJE 3PL6C 2PW1A 4S1QH 4MZ2A 3CZFB 4CJ0A 5DQ9A 1LEIA 4APQB 3L5XL 1OHQA 2XN9B 2EIEA 3BPCB 5T1LB 3WSQH 4D8PA 1BWMA 4IRJC 3J7HA 5IGXL 4P5MA 4LCYB 5D7KE 3DUSA 4OGAC 2N7BA 4YBQD 3ARZA 3BPOC 4Q0XH 2B8OT 4LDLB 5F97E 1WT5C 2CD0A 4HKXB 1SYSA 1NCTA 5DJ6A 2EIZB 1RZ8B 1AD0B 5IB2B 3H2WA 4OLUH 3ZHKA 4RAHA 3BGFB 3R0MA 2YWYA 4LIQH 4JDZA 5EUOB 3DTXA 4IRSA 4X6CE 2MQ0A 4AMKH 3ARBD 1N2RB 3D39A 4MAYB 3CSYB 4ZOCA 2ZCHH 4HIIA 3WDHA 3PJSB 4OZFH 3SGJA 1P7QB 3QT2A 4OZIB 3KJ4C 4GKSB 4I0KA 3BW9A 4HFUH 2EC9U 1JP5A 4PLKC 1W0WB 3RNKB 3P9LA 1X5GA 2HJFB 4I0PA 4MNQE 5ESQA 4UU9B 4ZUUA 2NY5C 3ZDZE 4F15C 5LKNA 2CLVA 4NQCA 3PDGA 3VXQA 4LKXA 2ZCHL 4GW4A 4RQQA 1LO4H 4BQCA 1P4LA 5A43C 5FDWA 2ITCB 4J3VA 2NXZC 1XF1A 5DWUH 3ROLA 5ICXA 5GS0L 4HZAA 2B0SH 3QH3B 3G6DL 3QI9A 4X99A 4N1EA 4Z77B 4P5TB 5DEGA 4OGXH 4NZUH 3H42H 4OSUH 2R4RH 2Y72A 3RI5F 1MVFA 1FZJB 4HGKC 3L5WB 4WWKA 1F2XK 3O8XA 4GBXC 5CINH 4X6BA 3ULVL 3PP4L 2JK5B 3QZWB 5H2BA 3LN9A 5EU4A 2EIDA 4OF6A 1MAMH 4P2QA 2R0LL 4AL8H 2Q86A 3AS1A 3JV5A 2ADIB 1MCBA 2BC4A 5KSBA 1AHWC 2F8OA 3OX8A 4OSUL 3P4MB 1NFDA 1YJDH 4QYOB 5CP3H 4BKLB 2QR0A 1VFOA 2VL5B 3AMLA 4F7MA 3KPMB 3ARDB 4YHIA 3FO2A 5ECJE 4P2OA 4HUKB 1WBZA 2X4UB 3HR5A 4I48A 4OZFB 3CSPA 2F9BT 5DJCB 5FV2A 1MCPH 3T77A 2O26U 3D2UD 3M1BB 4Q2ZB 4F7EB 3KPRE 2ZSWA 2N7AA 3C6SB 4ETQB 3T4AA 1YJDL 4JG0H 1ZHBA 1MH5A 2JJSA 2VQTA 4XH2A 4HJ0D 2XG4A 1ES0B 3H9SE 3O4LD 5D7JA 5IF0B 3BP6B 1DLHA 1NFIB 3EJZD 4X7SH 1T0NB 4F7CA 3TZVB 1OPGL 1F3DH 3MRBA 7CGTA 1FO0A 2NY7L 2OP4H 3MXWH 1T3FA 1HKLH 1MCPL 3FOLA 5EIQA 5INDB 3GB7A 1PSKL 4WI6A 3D5OF 4PJAA 5FYJE 3GHEL 4DN3L 2HH0H 3BMWA 3OQ3B 4LBEA 3QPXH 3PGDA 4WO4A 3WXVH 3O81A 3K7UA 1KPRB 4NPYB 2GYSA 5K9JH 3BZ4B 3OKLA 1N59B 5HHVH 4XNYH 1T1ZB 4PBWD 3MCKA 4UIKH 1D7FA 1C12A 3TBYB 1YQVH 2R1XB 4KXZH 5I15H 4CN6A 3KYAA 3WNMA 1HKLL 1YNTA 4P9HH 4EOWL 3WLWC 4HUUB 1JV5B 5T3ZH 1SYVB 2OMNA 2EC9T 5AAMA 3QPXL 1P69B 1GGIH 3ZDYE 1QBBA 4U1SB 3T0DA 3QULB 2DBJA 5K9JL 5MHSE 1YY9D 2ICES 4HKZB 3DMMA 4XNYL 1UM5H 1B0RA 4JFPA 4UIKL 1KB5H 3UX9B 4GG8B 4X4XB 5FGRA 3KPSA 1SJHA 3HE7B 5JPMB 3MJ7B 4G8FA 1FP5A 1FVCA 1JI2A 3O2WH 1R3HB 5EU6E 1C5DB 3JTTB 5T3ZL 1I8IA 3MBEC 1GGIL 2ESVD 3SPVB 4NQUA 4LSPH 4NZDA 4W4NA 4ENEC 3CFDB 3GBLA 1DEEA 4MJIE 1HEZB 3GHBL 1UM5L 2ZWLT 5C9KA 4S10A 1WIPA 5ALBH 1KB5L 1IM9B 1L7TL 3D3VE 4WW2F 3UTSD 2FSEA 1IC4L 3MNZA 1EFXA 1YMMA 3C6LC 3WXWH 2NX5B 2YPLE 1T1XA 5JMRA 2H2PC 3QXUA 4I5BA 5DI8A 4GKOA 3VH8A 3O2WL 2DRUA 1RMFH 4JFFB 3SHSA 4LSPL 3WUWB 2CIKB 2ICWA 1CT8B 1UB6A 1TJGH 1IC5L 4NKOB 4GOSA 4NCDA 2MCG1 1DSFL 5JLZA 4FTVE 2IPUG 3FRPG 3DVNA 3JWOH 3WIFB 1EUUA 3S6CA 3WXWL 4KKBD 1HQRB 4EN3D 5K9OA 2A6IA 1F6AB 3IVKA 2NW3A 2EYTB 3PQYA 1NCDL 1RMFL 4G9FE 3SDXE 4NO5B 4WNQB 5H37G 4JLRB 2EEAA 2X6MA 4M61B 4CN4A 3MFGB 1TJGL 5IKCA 3MNVB 5B8CA 3Q5OA 3E3QC 5EORL 3LS5H 1CZ8H 2R56L 1CFNA 3QIBB 2BY3A 3OHXB 3O9WB 5HBBA 4M6AA 1VKXB 2ZUTA 3MRQA 1VEPA 1RFDL 1U8HB 4QRRD 1PG7X 4G8GE 2JJVA 1FL5A 3RL2A 4TVPH 4NO3B 3NCYP 4NKMA 4JPIA 4XPGH 3B9KB 4M00A 5IBLD 4OV5B 1QA9A 3LS5L 2A9NL 1CZ8L 4CU7A 2XZZA 3RQ3A 1WISA 3O3BA 2O93L 3QXWA 4PFEA 3LQAL 5C0FB 3QO1A 3KNBB 2I9LB 4WW2B 1CDHA 1MCKA 1TXKA 4NN5B 4PJIA 4JAMB 5MENE 4OFDA 1U8OA 2MPAH 2IAMB 4J4PD 5F3BB 5J56B 2DJSA 2AV7B 3AS2A 5IW1A 3U79A 1CGSL 5EPMB 4H1LB 2FGZA 3AXLB 1R0AL 5KSUA 4PPTA 4KHTL 4XPHH 5TDOA 5FGSA 3WCYA 4FQXA 1G84A 2R15A 1SJVA 3QUMH 3ROOA 4Y4KB 4LLYA 2XY2A 3QDHA 4ZO8A 3JVGA 4NSKA 3NCBB 3L7FA 1ZLSL 5C0JA 1UQSB 2M2DA 2P5WA 8FABB 5IFHL 5CP7B 3V5KA 2NZ9C 1DE4B 2K7PA 4Y4HB 3SE3A 3IDJB 2WAHA 1IAIM 5E8NA 3GDBA 3H9SD 4NCC2 3QO0A 1RZJC 3QUML 4K23H 3RUGF 5IR1A 2DQJH 3GMOB 3RTQB 4XHJC 1WC7A 1HHHB 3QFJA 4UBDC 4AIZB 1A6TB 3ILQD 3OXRB 4HS6B 3SGJC 3U4EB 4RRPA 5FHAH 1KCVH 3BIKB 5IVXA 5IK3B 2I9TA 4L4TD 5FYJD 5HVGB 4LU5H 3QUYD 4I0PC 2IADB 1ERNA 2XKNA 5DMIH 5F1IB 3SDCA 2GJJA 1M7XA 3VXUE 3CDGB 1BVKB 1XH3B 4L1HA 2BXYA 4XP6L 1R24A 4YE4H 3QDJE 5E2TL 3S96A 2ARJB 4HH8A 3C8DA 3MRMA 3WDJA 2EYRA 3TA3D 1TPXC 2R0KH 4JE4B 5HGDB 4RMVA 2X1QA 2HJLB 1KIQA 4KC3B 1U95A 2EE2A 1GZQB 2NR6D 4LF3A 4Y19E 4AIXA 5ITBH 5EOQL 2PXYD 5MHSD 3JV4B 3WNLA 3I3EA 1MCIA 2VH5H 4NZJA 5BJTA 5DDHB 4KVCH 3EIFA 3Q48A 2Y06L 4ZO7A 3O8XC 2GFBA 1RPQA 1XZ0A 1JGLH 1TJHH 4YE4L 2HVJB 4G43A 4KHXH 1U2CA 3PIQA 1UXSB 5HI4C 3EDEA 3U9PL 4UIMA 2VXTH 3C09B 4OCNC 2L7JA 4OT1H 4Z7OF 3DURA 3C2AL 2R0KL 4OCRH 4O58L 1XIWA 3GO1H 2A77L 4OLZL 1NAMA 1YPZF 4Y16D 1HINL 2O5ZH 5EZJA 4MJID 4YDIH 3CXHJ 4IMLB 1ZHKB 1BIHA 3NAAH 4JPVH 4KVCL 1ZA6B 1EX0A 2LVCA 5FKPA 4PREB 5C86A 4P2OC 1NLBH 4M7JL 1A2YA 3RUGB 4OLWH 5CFHA 1K9TA 4HHAB 3VDBA 2YPLD 5DD3L 2J6EA 2DIBA 4M6NH 1MCRA 4OCRL 3U7WL 5JW5A 4RMSA 4WTWA 3GO1L 2KBGA 3QA3B 4PGBA 2O5ZL 2WQ8A 2DB8A 5C0RH 2XICA 4YDIL 2NTFA 2JJSC 3T8XA 2ADGA 4CRPA 4E41E 5JOFB 4JPVL 3NAAL 4J3XA 5D7JC 3GSNL 1AR1D 4EZMA 4FTVD 1DUZB 2YHGA 1NLBL 1T83C 1PGRB 4Y8AA 3CVIL 4OLWL 3ARGA 3TFKD 1MHPL 3P30H 1T89C 3OWEA 1DQMH 4UINH 2V5MA 1FNAA 3G6AB 4M02A 3RNQA 43C9B 3S4SB 4ALAH 4G9FD 5HYEA 4FXGB 1EO8H 2ENYA 3U46B 2D7MA 3ALXA 3BZFA 4V2BA 3WFEL 4WO4C 4MD4B 3OZ9H 2EH7H 3FQTB 2AAVA 3WFHB 4MVBD 1OQXA 2PCPA 4YHZL 2Q76A 3L5IA 4L3EA 1IAKA 4R0LB 3NCCB 4O2CA 5FB8B 1J7VR 1DQML 1G7JB 2UZYB 2ZUYA 3GSVA 1EEZA 1IARB 4JY5L 2CRMA 1AO7A 1EO8L 5CILL 3TC9A 2HVKA 2P49B 2RFXB 5C7XH 1ZGLM 1WFUA 3MLYH 2OTUB 1YPZB 1D5XA 4JRXB 2PTTB 5A40E 1H8OA 1MFNA 2EH8H 4MJ4A 2PW2B 2C1OA 2L7UA 5MI0C 1MY7A 3I6GA 3C8KA 3WDIA 5ID1A 1XGYL 1GYAA 2QADD 2A6KA 4R7NB 3S36H 2ED9A 1U93B 3DXAA 1A7RH 4CVWA 1Q9KB 5I0DA 1N5YH 5DVNA 5C7XL 3QJHA 3MLYL 4HAFA 2FX7L 3TM6A 2LVEA 3X13A 3WKML 2H2SC 4X8JA 4U6VL 4EVNA 1T04B 3VFOA 1LGVA 4PRNB 4MD5B 1FE8L 3EFFA 3FN3A 2FB4H 2Q1EA 1GC1C 1MHCB 2B1AL 3QIUD 3S36L 4CVXB 3SGKA 4M1DL 4FG6D 5GS1A 3PV7A 4YGVA 1KIPA 2F5BH 2Z31D 2E6JA 2YEZA 1DFBH 3FB8B 4RMUA 2PYEB 3O3DB 3VRLE 1KF9B 1ZEAL 4MLSA 1T66D 2NTSP 5D2NB 2BMKA 1H3WM 3SKOB 2FB4L 4QRSB 1HSBB 1HIML 3GSQA 4KXZI 5BO1L 4CW1A 5GS2D 3OKMB 4JHAH 5EZIH 2G9HB 2LFGA 3BD3A 2FEDD 5D1ZB 4P3WA 2IBZX 5JOPE 1KLUB 5E6YA 2DWEB 2OR8A 1G7HA 1XF4B 4XVTL 1QR1B 1PVHA 5BS0E 5BXFB 3LY6A 4KY1L 4WFHE 4Z18A 5JHDA 3KYMB 3IDIA 3MCG1 4P48A 4PTUB 4FFVD 3WN5B 1FZMA 3R8QA 4MS8D 1NSNL 5EZIL 1T1WB 4R2GD 4DGYL 1EVUA 3TN0A 2E7LA 1PD6A 5KSAC 4HF5H 3WFCH 1MQKL 1IGJB 1F4XL 2BY0A 2D0GA 1INQB 2E9JA 4NHCL 2IPTL 4I2XE 4OQ1A 4Y19D 4NKIH 1MFCH 4LEOA 2Y7QB 5E6IA 3GI8H 2NY2B 5HDQH 4DJMA 3KLHD 1JFQH 4HCRA 5J6GB 4HF5L 4HFWB 1W72H 3PP3K 5IB3A 5ID0B 1GRWA 1UVQB 3BN9D 4HGMA 4RWYH 3MZTA 4NKIL 2FWOB 4PD4J 3TP4A 4ZQKA 4HDIA 2YOCA 4AIOA 4G6AD 4L8SA 1OAZL 2GJ6A 2WM0A 1YEJH 2ZOLB 3LKPA 5HDQL 2KQMA 3QNZA 3VI4F 1JYXA 1JFQL 3L3IA 3MV9A 5B3JF 2BNUA 3WJJC 3QWQB 3INUH 4KTDH 1W72L 5CIPB 1B6DA 4M6OH 4WCYH 2YPKB 1UENA 1WBXA 1ORQB 3BHBB 3ZTJG 5DJDB 1H5BB 3SE3C 1ZHNA 5J13C 1P5VA 2IH1B 1DVFD 1UWEH 1YYMH 1U92B 1XR9A 3MRIB 1FV1B 1X44A 1YEJL 15C8H 1HZHL 1GGBL 4FQQB 4KTEL 5F9WC 3PHQB 2GSGB 4BQ8A 2YD9A 5FYKU 3VDCA 1EZVY 4PR5A 3KXFB 5KS9F 2VDLL 1WSST 2C7UB 2DICA 5CSGA 1XGUB 3QHZL 3PDOB 3VXSE 4WCYL 2YKLH 3NCJH 4PJEF 3KJ6H 4JQXA 5A2FA 1YYML 4LCUA 1JPGB 3KPPA 3BKYH 4NQDE 3BRGC 2APWA 2P7TA 1HH9B 4YAQB 2FGWH 3MGOB 5E4IA 4NQEB 5GZOD 1A6WH 2HT4D 4D3CH 3CH8A 4YDVA 4AH2B 1IKFL 1MSPA 1HILB 3P4LA 1OAXL 3P0GB 4LLDA 4ZOAA 1UWGH 3EOBA 3OJDB 1AIFB 4R97B 3QDME 1R3LB 2YKLL 3QEQD 2J88L 1CCZA 4BM7A 4F3FB 5CEYA 3KJ6L 1J11A 1NGZB 1FGVH 4YIQB 3MA9L 3BKYL 2DMCA 3BXNB 3JTSB 2ATPB 1NBVH 1IVLA 1CYGA 3CFBB 2OL3A 4D9RE 3FQRB 1KJMA 4FMFA 4G9DB 3UJTL 4RGMB 4MCZB 1CDUA 4X6DA 4YDLB 3O45B 2AW2A 1A6AA 4GSDH 4CVUA 1A7PH 2QQNH 4NNYB 1P6AB 5E9DA 2ZUWA 1RK0A 1Y18B 1X7QB 2BVOA 3FZUD 3TBSA 4P99A 1FGVL 4XWOD 3C60A 2JF1A 4NBYB 1UKTA 5EOTB 4B53A 4JKPH 3RZCD 3ET9F 2BNRA 3OKNA 1ACZA 2P5ED 4ZUSA 1FVDA 2A6JB 4FQ2L 4K3DH 2G5BA 1G9MH 5SWZA 4HV8A 2R8SL 1KCUH 4M1GH 4ERSH 3D39E 2QQNL 3MV7B 4H88H 1GZPA 5C07B 1CGYA 5IROA 1U8KB 4NNPH 3T0EA 5KS9B 3LHPL 3BRFA 5GGSB 4CN1A 4OZ4B 1GOFA 3FB5B 2FEEI 3NACL 4PJEB 1MI5D 4G80B 4AEEA 1IFHH 3DROA 1TZHB 1AE6H 3CSBA 4E9LA 1RIVH 4URTB 2QV2A 1KCUL 4M1GL 4NQCE 1TJIH 4H88L 3ARGC 4Y2DC 5JNYB 3TBVA 1P53A 5KVEH 4ZSOA 5D1QD 1HNGA 3HTLX 5CWSA 5JOPD 5F3HB 3IKCB 4NM4H 1WLHA 5A3ID 5BS0D 1IFHL 3MLRL 4JFYB 3O2DA 4WFHD 5C08B 4OFVA 2DM2A 3TBWA 4JQVC 3LKRB 3GMQA 3JUZA 3QIWA 1TJIL 4V1DA 2FL5A 3MOAL 3FO1B 4P23A 3DO7A 3IETA 4BQ9A 1D5ZB 2HKHH 2K9UA 5T1DH 4UV4H 3F7QA 2AERT 3TV3H 5DHVH 2OI9C 2DJUA 4P2QE 1W0VB 4PJXA 4NM4L 5F6IC 3BVNB 3GSXB 5E8PB 5EOCJ 5KSBE 2NXYC 4XVJH 5D5MA 1BD2A 2X7LA 1X5AA 4PJCA 1R5WB 1IGIH 1Q8MA 1B4RA 1S7TA 1NFDE 3STLB 2MWCA 3RWGA 1NBYA 4NRXA 2EKSB 4JFOB 1SMAA 4ZS7H 5FHBL 2WWMC 3DSFL 4UV4L 4G7YL 2C3VA 3IJYB 4Y5VB 4QRUA 1MRDL 4HK3J 4HWBL 3MLPA 1CQKA 1JZ3A 4I18A 5IB4B 1CBVH 1ZLUH 1HDMA 1TVHA 3U4AA 1RK1A 4XVJL 3X12B 1SEQH 1FDLL 1RZKH 3ZE0F 5BQ7A 4AT6A 2X4PA 2R2EB 3HG1D 4L9LB 4ZS7L 4D9LH 5HJ3A 3T08A 35C8H 2HP4A 3MYJA 5C70A 5EIVA 5CD5C 1QSEB 5HYFA 1CBVL 2Z92A 3NFNA 3TJHC 5GS1C 1XF2A 1X4ZA 2ZUVA 2CK0L 4PJAE 4P57A 1SEQL 4R96A 3T65A 1IL1A 4TUKL 1Z9OA 5JMOC 5C0GB 3U9UB 3HI1A 3TIDA 3L3GB 5HVHC 1ZV5A 2OXHA 5HYSG 2A38A 3ZKSD 4MJ6A 1IQDB 2HMIC 2AJZB 4G6JH 5DQJA 5FYLD 5F93C 2ERJC 3C2SA 1IZKA 2GCYB 3BWAA 1EGJH 1MIEL 1U3YA 4XCEB 3T3PE 4X9HA 5HD8C 4OAWB 2VKWA 1U8PA 5DHVB 1L0XA 5F1NA 5I1LA 3CXDH 1U8IA 4G8EB 4LKCB 4XPBL 4PJ9A 3WJLA 3E6FA 1OP5K 3VRIB 2HTKC 3QXAB 1S8DA 2G75A 3T2PA 4JRYA 4KGJA 1DBJH 1JF6A 4JDVA 5MERB 3UC0H 2GI7A 1QO3A 2IANA 4S1RH 4X7EC 5K93A 3GIVB 7FABH 1ONQA 4C58B 2UY6A 1WAAF 3SKJH 2D2OA 3KPSE 3CFJB 4YHOH 3PWPD 3P77A 4PV8B 3BKJL 3P0VH 4JR9H 3L5HA 2E7LC 4UOW0 2HJKB 4LNRB 3RU8H 1DN0A 2NY0D 3HPJB 1GXEA 5BRZB 2WBJD 1LNUB 1L0QA 2YD5A 4JO3H 4QF1A 5I75C 1CTNA 4D9RD 1N4XL 4N5UA 4NQXA 1JNHB 1YYLH 3SN6N 3FFCD 5JA8B 1PKQB 2W59A 4AYFA 1DBAL 7FABL 5E8DL 5DR5L 4Z7VF 1FN4A 4B7IA 3MUY1 3HC0B 4TSAL 4APQD 1YMME 3DVGB 2D03H 5B39A 3VGAC 4PY7B 5T3XD 3S35H 4R26L 4WUUB 5IJKA 1FYTA 1ZA3B 2J8HA 2MFNA 2X10A 5I0ZA 3BP4A 5KOMC 3WO4C 4Z76B 4GW1A 3DETC 1YYLL 3VXOA 3IB4A 3Q6GL 3UMTA 4IRSD 3QAZB 2DQDL 5TH2B 1AD9B 4YXKH 3L9RB 5DK2A 3L3KB 1Q94A 1CVRA 2XT1B 5T1KA 4X7TB 5JORB 1Q9LA 5F7HA 1S5HA 4JREC 1FNEA 1N6QL 3BSZL 3BUTA 4FFVC 3HZKA 4HPOH 3PQYE 2B39A 2FHCA 5ERWA 5BCAA 1U8LA 2ZPKL 2YN3A 3QJFA 3RI5K 4G6KL 1PEZA 4ODXA 1QLEH 1FG9C 2AK1H 3EAKA 2PNDA 1ED3B 3C9NB 3MA7B 4LARL 4OM0H 4NQCD 5E24E 1YY8B 2GEEA 3LEVH 4QCIB 1MFDH 2J5LC 3LKSA 1QHPA 1FPTH 3WBDA 2Q7NA 3K4DA 5FF6A 2BDNL 1CDIA 1CFSB 1S9VB 4ONGH 1ZANL 4Z95H 4GMTL 3LIZL 2VERN 1GVIA 3QI9D 4MXQD 4JQXC 1ZLWH 4L9DA 1QLEL 4PRAB 5HHOA 5IW6B 3CZFA 1XGPB 3WS3B 5C71A 5D7SL 2XN9A 4MHHG 2AK1L 5EO9A 4NRZA 3UJJL 4WWKD 5KVDL 2KZWA 4LSUH 4LCYA 1RUPH 1J0JA 1U8JB 3K2UH 4ONHB 2NY6D 3R1GH 1NCAL 4Z7VB 1M7IA 2W0KA 3NPSC 4J3WA 4K94H 1NBQA 1JPFB 4PJIE 2EDFA 1S7VB 4Z95L 3LPWA 5AYQA 1F6LL 3GK8H 1BAFH 1EFQA 5I74C 2RBLA 1KJ3L 4EBQH 4GQ9L 5I66B 1IEHA 4X6FA 2EXYD 1FSKC 1QTYT 4LHUB 4RMQA 2XTLA 4C59B 5JOEA 3AB0C 4S2SB 2AJVH 4WJ5B 3ULUL 4MAYA 1T7WA 3K2UL 4DZ8B 1PDKA 4NN6B 4K94L 3CUPB 4GUPB 1FFNB 2BNQA 1U3JA 2P5WE 3GK8L 3X14B 1W0WA 4DUVA 5D2LB 4U0RC 4UAOB 2R1YB 4QEGA 4MA3A 2HJFA 1BF8A 4D94A 2CDFB 3RPKA 2P46B 4OTXH 4PG9B 4DFHA 1QSZA 1ZVSA 1JZ7A 1KIRB 2HFFB 3VI3E 3LN5B 4NYLA 3GBMH 3CX5J 4WTXA 3QFJE 2PTUA 1KNOA 2AEPH 4FZ8H 3T0EC 1VPOH 5HHQA 4OF8A 1HOCB 1MCSA 4PJ7F 5IVXE 3VGHA 5CCKL 1FNGB 3MRHA 4P5TA 3RKDC 5DJ0B 5M95B 4OTXL 2W65B 3O4OC 2XZCH 4JJHA 5CEXB 1J05A 2I25N 1JWMA 4M5ZL 5TE7H 2BSSB 3WIHH 5I71B 3L5WA 4LCCA 4ZFGH 3SBWC 2E7MA 3GBML 5C6PB 2YRPA 4ELKA 3ZE1F 5ENWB 5IM7B 4FZ8L 1VPOL 3QZWA 5F9JA 4ZAKB 4OLYL 3PABB 4HIHB 1G9NL 4U7MA 5I8CB 4NJ9L 2XZCL 1OCWH 3F7PC 4N0FB 5BZWB 3VJ6A 1YMHB 3TWCH 4QXWA 2VABB 5DUML 4QYOA 4XWGH 5TE7L 2DLEA 3FZUC 5EBWA 3OF6A 3DMMD 1R5IA 1MCNA 3EYUH 3SE4C 3V4UL 5HDBE 1U6AH 4KK6C 4OZFA 2Z0BA 3FN9A 5D1XB 3FO9A 2Y1VA 1MEXL 4YXLL 5CJ8A 3QUZB 9CGTA 3M1BA 4EI6B 3MRCB 1NEZG 2YUWA 1T1YB 3O3EB 3V5HB 4E5XB 1K8DA 2Z4QA 4A6YL 5T33L 4EQ3A 2YN5A 3TWCL 4WI9A 4K71C 4XWGL 4XNUL 5CJXA 2R0ZL 4JG1H 4CL7A 4JFDB 1IC1A 1NFIA 1S9XA 3BESR 1H3PH 5DRZA 3MJGX 4U0QB 4PJBA 5I16A 2OR9L 4E0RB 5D7LB 5CAYB 4F57H 1I1AA 3BRDA 1KPUA 2Z8RA 1EFXD 1YMMD 1DLFL 3V5DB 1YEHH 1OT2A 1EEYB 4I18C 4PJHF 5IHUH 2DQEL 3B5TA 4H0IA 5INDA 3UAJC 1IM9D 2D9CA 5ILTH 3LEXA 4PJ7B 4YHNA 3ELAT 2FDBP 1RURL 1K8IB 4JM2A 4HT1L 3SJVD 3UEZA 3QRFM 1CI5A 1NAKH 1H3PL 5KANG 3I2CH 3CGTA 3O41B 1T1ZA 4U3XA 3D6GA 2X1WL 2HT2D 3TBYA 1S9WA 2HLAB 2NY5H 1CDGA 3L7EA 1CWVA 1YEHL 4K8RD 5IHUL 3E6HA 4IHOA 1JMZA 4QXUL 4HUUA 1YEFL 3PQYD 1WEJH 2AJUH 4BK4A 1JV5A 1YEGL 3NABL 4KWUA 4LASH 2XWBB 4Q6IA 5J11B 1INDL 5TF0A 1KJVA 2R2BB 5CP3A 4YPGA 2YUVA 4OCXH 3OXSA 4GW5B 4NGHH 1YQ2A 1V7NL 4WGWB 4ZXBA 1CD1A 5CMAA 3R06B 4L3EE 3T4YB 2NY5L 4YR6B 2Y4SA 1MWAH 1QQDA 4XI5D 5C0BB 3MJ7A 4LP5A 5JW3L 2VDOH 2AJUL 5H37H 1ZXQA 5E2JA 1A9EB 1AO7E 3PXHA 3MRDA 2RQ8A 4Y1AA 3CFDA 2GTZA 3OKOA 3AREB 1TNMA 4OCXL 1HEZA 4YQXH 4NGHL 5C6TL 4KDTA 5FUOH 4PY8J 4XMPL 4K2UH 4O2FA 5T1MB 2X9WA 4L4JA 2PO6C 2P8LB 3OGCA 4HKJA 4JN1H 2IWGA 3G5VB 4AEFA 2Q8BL 5TE4L 3VFNA 3KPTA 4TSBL 4KKLD 1CLZH 4PV9B 4F9PC 4PJHB 3DXAE 4JFFA 4EUPB 1ULVA 4FQCL 3Q5TA 5J57B 5EIIB 4YQXL 5DJAB 4CMHC 2ADFL 1MFBL 1XCTB 3ORJA 4FQHB 4K2UL 4LSRH 3UPRB 5DMGC 1KCRL 5FO8A 4G42B 1HHKB 4FQXD 5I9QB 2VDMH 4AG4H 2XNAA 3MR9A 1MFEL 4D2NA 1DBBH 4ZUVA 4JFZH 4PGEA 3F6IA 5DVKA 5HY9B 5I19H 4FQ1H 1IM3B 1KENL 3FCTA 3LN4B 4FQPA 5IJKC 1OT1A 4W4OC 4V2CB 4X9FA 2O5YH 2L0DA 2CKBL 3CCHB 3EYSL 2OQJA 4U1IB 4IMKA 5TQ0L 3GI9L 4AG4L 1KB5A 3LKOA 4Y4HD 2GIYA 1T4KA 4ZFZB 3O9WA 3QUXB 1MWAB 5I19L 4FQ1L 1NGQH 4XVSL 2H8PB 3RTQD 1RUAH 4NQSB 1LILA 2E7BA 1C16B 4HEME 32C2A 3PDDA 1EUTA 1DANU 4MNGB 4Y5YB 1DDHA 2XTJC 5JHDE 5GRVK 3SDCD 4LLWB 2MSPA 3IU4H 4TPRH 1YEIH 2COQA 2I60L 5C0FA 4K7FB 4OJFH 3UTTA 4OFIA 2VB5A 3QDGB 3BT2H 2IAMA 2AV7A 4WU7B 1JN6B 1HQ4B 3MACL 5GGTH 4NJAL 3IJSB 1FIGL 2DQFB 2DQHH 3WHE0 5DRNA 5IMLA 4XMKL 3IU4L 4TPRL 1XF5A 1KB9K 4OJFL 5CJOH 1EEQA 1UA6L 2EEDA 3V4PL 5AD0B 3PWNB 4U05A 4YUEH 1LE5B 3VFTA 1X5XA 2CLZB 1A1MA 3GM8A 8FABA 3RAJL 4N5ED 4XRCB 4MSWB 4QHLB 1HYRC 4GKNB 3J8F7 1XIWD 1DZBA 2DQHL 3L1OH 3BGFC 4HK0B 4POZC 4QHKJ 2Y6SC 1TQCB 4PBXA 5L2KA 1J8HB 1RJCA 3QCTH 3DPBA 2GJ6E 4XX1E 4MAYC 3OKDA 3MV9E 1EO5A 3S3JA 3KPQB 4AIZA 1GAFH 3H7BB 4PJ8A 5I1JH 4O51B 1JPTH 1IT9H 4R6UA 1QUNA 4EI5A 5LGJB 2VDRL 4UILH 4C57C 3LSOB 5ISZA 4NC1C 5ADPH 3BD4A 5F1IA 3GGWA 5GZNC 4ZODA 1B6UA 1KT2A 2HN7A 1XH3A 3SDDB 4BZ1L 3A6BH 3DHJA 1CXHA 1JPSL 1EJ6A 3RGVB 1JPTL 4YJZL 3EOTH 3H3BC 2HWZH 1R3IL 4ZDHA 1OAUH 1T22B 2X4TA 5DJ8A 2V5RA 1MELA 4P5TC 3V8OA 5CKAA 4CAGA 3LH2L 1RJYB 4ZNEA 3MLTB 1J0HA 1GZQA 3HAEG 3EYVB 5D70H 1QSFA 2DLTA 1JHKH 4XNZB 4JY6B 4LCCC 3QUMA 5C09A 4HUWB 4L3ED 4IIQB 3EOTL 1KTDB 2HWZL 2HVJA 3MCLL 1FIEA 3NA9H 3BD5A 2WIMA 5F6HJ 4QOKA 3BP7A 1S78D 4WFGE 4KKAD 3BUYB 4YX2L 2V9TA 3G5XB 1DUYB 3MRKA 3TO4A 1AXIB 5D70L 1X5FA 2XWTA 2EDXA 3QWOA 5CEZE 5DMKB 1J8KA 5JIIA 1E4XH 1RQ5A 1DANT 2R1WA 3ARDC 3DUUB 5E8EA 4X6DE 3B5HA 3MO1A 3D0VB 3MOBH 3NA9L 2V7HB 5GRUL 3HLAB 5E9DE 1M05B 3VU2A 4YHLL 2CLRB 5DT1H 3G5YA 4MWFB 1ZT1A 2C9AA 1MJUL 3DXAD 3GJFH 3UDWC 2BNRE 3BEVB 3HZVA 4NKDB 5CJXC 3QHFL 1JZ6A 3VWKD 5EU5B 1X5IA 5SWZE 1CICB 3TZVC 4P46A 1I9IH 3HN3A 3TBTA 2ITDA 4LCWA 3WUZA 4Q9RH 5KJRL 1A9BA 1RZJH 5DT1L 5J1AB 4K9EH 3G6AA 3T0EE 1QVOB 3S4SA 3U7AA 3DI3B 4ZUTA 2FBJH 3CMGA 1WQVT 3KLAA 4MDJB 4XZUA 1UJ3B 4MD4A 1I8MB 4LOUC 5I1DB 3MMEA 3DGGB 2HA1A 1N3NA 2QKIA 1HHIA 3TYGH 1N6VA 5FUCE 4R0LA 1NUFA 1JK8A 1V8HA 2NLJA 5FB8A 5E2WH 2PYED 1RZJL 5JIPA 2XZAH 4NUJA 1CFTA 2E7HA 3FMGH 3MZGB 4ZSOE 3MNWA 4OZHB 4DFIA 4R3SA 2VZVA 5TQ2H 3TNNB 3VMNA 1FL6A 4JRXA 5JHDD 2PW2A 4GS7B 4ZPVA 4C4KO 4V1DE 5E2WL 1F97A 2DTSA 1ZVHA 3IXTA 3TCLA 2XZAL 4G7VH 3HE7C 3MGTB 4XCFH 3CK0H 5F7LB 3TN0D 3SDYL 4N8CH 3QEGH 1JHLH 3HRPA 4I77H 1U93A 4BZ2L 1KEML 1QFWH 4DEPB 1NC4A 3L95A 3BPLB 4PJXE 2OK0H 1KCLA 2P43B 2AEQL 5TQ2L 2YXMA 3GJFB 5D5ME 1BD2E 2JCCF 4I3SL 3KLSA 4KDTC 4PJCE 4KK8C 3GUTA 3MLUH 5IMKA 4P59L 1E28B 1I7UB 1T04A 4PRNA 1RAMA 4MD5A 2BHZA 1IEBB 2CDGA 1A7OH 1QBLH 4NKQB 4G7VL 1AKJB 1SY6H 2NY4D 1A3LL 1PYWB 1LK2A 3CK0L 4RA3A 4XCFL 3TYFB 4GRMB 2F54A 1P7KB 5HGHB 4L3CB 3QRGL 5C0AB 1MCWM 4JO2L 2X4SB 1HHGA 5FGBA 4XNMA 1F90L 1D6VH 1X5JA 3TO2A 3HZYB 3THMH 4ZMAT 2VXVH 3W0WB 1NMCB 4R4NC 2D4FA 3F7RA 4DW2H 1AGEB 4NZTL 2BFVH 5L0QB 4BFEA 3MV9D 1SY6L 1G6RL 1C1EL 4CDGC 1LO3H 4M7LL 3QEUB 4OQTL 4UV7L 3IDXL 3OKMA 4PP2B 5B21A 3AU1B 1D9KB 4P9HC 4WI2A 1HYSC 5BVPH 1XF4A 5C8JB 2XPGA 4HUMB 5BXFA 5GRXG 5EC1A 5FXCH 5HHPB 3KYMA 5JO5B 4ELMF 1U3HA 2PETA 4DW2L 4NHUA 2KUTA 2BFVL 4IMKC 4TOYL 3QIBC 1MLBB 1WFTA 4ODSH 1KEGL 3QBTB 3O9WC 2MKWA 1N7MH 4X5XB 4X80H 3LCYA 2P24A 5F7DB 1GGTA 5C0EB 2ADJA 4KQ4L 2V2TB 1SBSL 1CU4H 1WBYA 1OM3H 3ZTJH 1ZT7A 1AC0A 1VESA 3U0PB 1MUJA 4OKVB 4PLJC 5SX5H 3B4NA 3B9KC 2UWEB 2VNCA 3GSUB 3N9GH 4JRYE 3ARBB 1F11B 3CAFA 5IMMA 2JCCB 2F19H 1DQJB 1N0XL 1CFQA 3ZE2F 5AZEL 2IANE 1N7ML 4NWTH 5MEOB 3ZMRA 4OD1L 4ORZC 1K4CB 4WW2C 4NN5C 4Y7MA 4ONFH 5E8OA 4ZO9A 5FA4B 3OKKB 2UY7A 4NQED 3UJIH 2QLVB 1OM3L 2IAMC 1I1YB 5KZCD 3WFDL 1RJLB 4RSVA 2H9GA 1SJEA 3U0TA 3NCMA 1J1XH 1F4HA 2JB5H 5L6YL 2DF3A 1FNSL 1UEYA 4YDKL 3RWIB 4YO0A 5DJ2B 2ZOLA 2F19L 1I9EA 5EZLA 4K3GA 4F37F 4Y4KC 4TUJA 3JWOC 4NWTL 3VFRB 3HB3C 1T20A 5C9JB 2W92A 4HJGB 2ICWJ 4GO6B 1G7PA 2EYSB 4I0CC 5E9DD 1JHTB 2BCKA 1P84J 2VE6B 4DVRH 3UTZA 2A9ML 1J1XL 4YBHA 2JB5L 4JFEA 3BHBA 3C60D 4XXCA 1GOHA 1H5BA 3M17A 4MA8L 1FYTE 5E95B 4EXPX 5I1AB 3KS0J 2SEBB 2BNRD 5CZKA 1AI1H 2Z9TA 1JGEA 4PS4H 1T0MA 1A02N 2NY1D 4ELMB 3N06B 1C08A 3PHQA 4J7RA 1JGDB 2GSGA 4XVUD 3UP1A 2MTPA 3KXFA 2W9DH 4QO1A 1XGUA 1J0ZA 5KTEH 5LG1A 4ZD3L 4L8DA 4RGNC 2AI0H 1SQ2N 1S7UB 4UT7H 1FNHA 1JPGA 1AI1L 1YDPB 4PLOB 4FRWA 1HXMA 3LOWA 3MRPB 3HE6D 4P5KB 5EBMB 5KVGL 2HT3D 1PLGL 4LSTL 4QRTB 3IFNL 1AGBB 1VEOA 1J10A 2V5TA 3CC5B 3MRFA 3RZWA 5I2IB 1MNUL 1WZMA 2VR9A 4JJ5A 2C3GA 3EO1A 1NC2A 5L7XH 3VH8G 3D2UB 1W72A 4F2MB 3V7AG 4NNXB 4U49A 4IS6B 2YD6A 3U2SB 1HH6B 2AI0L 3U1SH 4WU5B 1JMXA 5D7IB 3PWJA 5L8LB 1QLRA 2OTWB 3OAYH 5JR1H 1CXKA 2GSIB 3IFOA 3CFBA 5HHOE 1BWWA 1HHJA 2XN9E 4G9DA 2XACC 5LXGL 2XKUA 4YHPB 5I1CH 4BUHA 1M71A 3QIWD 1ZLUK 4V1DD 1VADA 3OB8A 4O9HH 4P23D 1YUHA 5IFAL 4YH6A 1AXSA 3QPQC 3W9DA 1TLKA 1X7QA 4QTIH 3BE1L 4X7FC 4JFHE 4NO0A 3IJHB 1W8NA 3U1SL 4XXDA 1MAJA 1D6EB 4X6CF 1S7RB 1QYGL 3GSWA 1JRHH 5F7NC 5ESVA 1BD2D 1JWSB 3I50H 1QKZH 1BX2A 3V0WH 5DGQA 5DZLA 3ZYZA 5I1CL 3U36B 5C0NC 3N85H 1KV3A 5L9DH 1DEDA 5LQBH 1E6OL 3MV7A 4AENB 3RDTA 1A14L 1U41A 3LKQA 1TNNA 4DVBB 2BNQE 1MRCL 4KKCD 5HYQB 2R69L 2O5XL 1WWBX 3ZDZF 1AFVH 3FB5A 1IGCL 3BAEL 2MHAA 2Y07H 1QKZL 4ZNCD 4UB0H 2OSLB 1NGWB 3QQ3A 2VXQH 4M62H 4WDIB 2BSRA 1FRGL 1DP0A 4NRYA 2C1PB 1RHHB 5JNYA 1ORSB 5D71H 1A4KB 3DX8B 4NDMB 3GSOB 3Q0HA 1BZ7B 5HYJB 2ESVB 3P4NA 4M9OA 4LSSH 5FA3A 4QNPE 1M6OA 5C0IA 2AJYH 4JFYA 1HXYA 1NL0H 4UB0L 5C08A 1NCWH 3K4AA 4G8IA 4HS8H 1QSED 4G6ML 1NGXA 2I24N 1X5KA 3HPLB 3DRTA 3MLWH 4N68A 1I7ZA 1ZT4A 2CKNA 4R0LC 3NTCH 4H1LG 4OCYH 4U1GC 1FYHB 4PGDB 4UTBH 5JXEA 4LSSL 1KBGH 2WUCH 4MA7L 3QG7H 4D0BA 3BVNA 4FFWC 3QUKB 1ADQH 4PJ9D 3TPUA 1NL0L 5F9OL 4OIIH 4GT7A 4X6CB 2WLYA 3BGMB 4JRYD 3STLA 3FQWB 4LIQE 5EOCH 1F4YH 4G3YL 3NTCL 4EN3B 1BM3L 4XNQA 4PP1D 1ND0A 3IJYA 1VDGA 4HXAH 2EEBA 3LV3B 4RRPG 2P1YA 3OJMB 2XQBH 1GGCL 4LRNH 5DLML 3PHOA 4Y5XB 5IEHA 2B2XL 4JDTL 4XBPB 4FHBD 4R8WH 1F4YL 3I6KA 5CBEB 4J6RH 5BRZD 4BSWB 3H0TB 5I1KL 3TPKA 3CFEB 4QRRB 1WJ3A 4Q9QL 1OTTC 3VFUB 4LRNL 5FYJH 5E2VL 4ZFOB 3FT3B 3ILPA 1RV6X 1QRKA 5FGBC 3S37X 4WHCA 1FYTD 1RUKL 3OKYA 2BRRL 4GAYB 1I1CA 1P1ZA 5GRZA 1EXUB 3S35X 3KHOA 2X42A 4XAKD 1UZ6E 4WV1A 3E2HB 5D2NC 1OB1B 1C7SA 4MMZC 5FYKL 4PTTB 3VA2C 4X0KB 5T1KD 1ZLWK 2GCYA 4KJQC 3NH7L 4OGYH 4OAWA 4HWBA 5DHVA 5D1ZC 3B83A 3ZZ1A 4U1MB 3U82B 1T7YA 4MXWH 5E7FA 4M1CD 2YRLA 4CNIB 2DWDB 4G8EA 4XAWH 4XNXH 3GMMA 3C5ZD 4M43L 3PGFH 5FOBB 3VFWB 4DKFH 3VFMA 2JB6B 4RISL 5HYSB 1ITBB 1WTLA 3OKEB 3WN5C 2J8UA 3KPNB 4X4YA 4KI1A 1EJOL 2V2WA 1QR4A 3CFJA 3CVHL 4PJ5A 3VXNB 1LEGA 1QFUH 2AXHA 2IALA 3FRUB 4JZJB 5J12B 2HJKA 4MXWL 2HRPH 1PZUB 4XAWL 5IIEB 3PGFL 4DKFL 3H9SB 4Y1AE 5HHOD 3DRQA 3KPRA 4PRDB 4HH9B 2CRYA 1MJ8H 3WHE1 1BEYH 4Y89A 2NY2C 4OB5H 4XBGB 2J12B 5DJZB 2VDQL 2BERA 3U4BH 5KVFH 1QFUL 3HCVB 2ICEB 4ZS6D 4WUKH 5F1OB 3DVGA 4ODUB 4ORGA 1KCKA 2AJSH 4DZBB 4L4TB 4JFHD 5EUKB 2ED7A 1U58B 4N8VA 4PRIA 4HWZA 2YD7A 2H45A 3QUYB 4N8PA 1HSAB 3SE8L 2DYPB 4Z6AT 4LNVA 1A6VH 4JFFE 1TCMA 4WHDA 2DLFH 3CFCH 3GMNB 1GPOH 3UTPD 3IAPA 1BEYL 4OB5L 3HI5L 3AAZA 3RY6A 1VGKA 4D9QD 1AD9A 3L9RA 3BKMH 3U4BL 1A7NH 3EYFB 5KVFL 2VLKA 2W0FB 5BVJB 4OCWL 2AJSL 3B3IB 2WV3A 3TA3B 4LHUD 1U8NB 2BNQD 4IBLT 5GJSL 1ZSDA 4OLXH 5HGBB 5HHNB 4U1LB 5SWQB 3T0XA 4XXCC 4RFEB 5KG9A 1H5BC 3GM0A 2VLJA 3CFCL 5T3ZE 1BBJA 4EDXA 1GPOL 2PXYB 4LLUB 2BZDA 3RVWD 3DX7B 4D0CA 1NGYB 3FL7A 2NYYD 3BKML 1A7NL 2G60H 1KELH 5TPWL 1J1PH 2PTVA 4P2RA 4DCQB 1WAAA 2QQLH 5EO1A 4F9LA 2X1XR 2ZUSA 1Q9WA 4QTHB 5AWNH 1MJJB 2FZ3A 3O6MH 4Y16B 4MJIB 3RWDB 3BO8A 3WS3A 2P44B 5FO9B 4S1SH 3VG0L 3WE6A 1KELL 5TDNB 4FABL 3ARFB 2OX5A 2YPLB 2CUMA 5DD1H 4KJWD 3UTTE 3O6LH 5DEFB 5EO0B 1FAIH 1F8TL 1QNZH 1S7VA 2H32B 5F1KC 5ELIA 1NBZA 3MLXL 2FD6H 3VXMA 3IGAA 3S7GA 1Y6MR 1ZWIA 3OPZL 1KYOJ 1KACB 5EC2A 4CBPA 4QHUA 3ZKNC 5IMOA 4YPJA 1ETZA 1T80A 5E08L 5JUEL 1XGRB 4FTVB 1J5OH 3VGBA 4J1UA 2VUYA 3VRJB 4RGMC 5IP4A 5J9PA 5FCUH 5SX4I 4YHMH 3OF6D 1CGWA 2BOBB 5DD1L 2P8MA 1YNKL 4U1KB 3D25B 2R39A 3DUHA 3O6LL 3QNYB 1WWCA 4G9FB 4C56A 3ARTA 3IKKA 3X14A 5J6HB 4HXBH 4LVNB 1FCCA 5GS0D 1XGTA 2R4SL 3TVMA 1ZS8B 1TCRB 2CDFA 4HUXA 4PJGF 1Z3GH 3PWUB 1J5OL 2GQHA 3SDXA 2C4FU 3VFSA 5L2KE 5CGYD 4UQ3B 2GHWB 2NW2B 2R9HD 4P4KA 5TDPA 5GS2H 3G08B 3LN5A 3MLVH 1I1AD 2KL6A 2FH8A 1JGUL 3ULVD 2IG2H 5CJ5A 4HZLB 4JFDD 3VCLB 1SM3H 3ZT6A 1KCSH 4UUJB 3RVUC 2IPUK 4LVOB 4WW1A 4RGNE 5DJ0A 2W07A 1K5NB 4IOFD 4TVPE 3ZTNH 2X70A 5CEXA 4JM2D 5ISZE 5IHZB 3PF2A 3S5LB 1UM6H 3UCRA 1WFOA 2BSSA 5IFJB 2W60B 3P9MB 1WCBA 4P4RB 4TTDD 3KYKL 4W70A 1MLCB 4BFIB 3WLBB 3MLVL 2RHEA 2X4QA 2QADB 1FHGA 1YECH 2IG2L 1UB5B 3H8NA 5TGBB 1IEAB 2XXMB 1D5IH 2R2HB 1VACB 4HIHA 1CLYL 3FFDA 3T2NL 3KYOB 3RWJA 3UTQB 2N4IA 1YMHA 3CMOH 4ZNEE 1IJ9A 1UWXH 2VLLB 1U91A 4OCSH 1S7SA 6CGTA 1NLDH 2YXFA 4ZXBD 5C09E 1WF5A 1BJ1J 3QIUB 3QFDA 4JPWL 5EBGA 5D1XA 1WUNT 3RIFF 4PLNC 3IDNB 3QXVA 4PRPA 3G6JA 3L3JA 3PXJA 4QOKE 5D72H 5JXEC 3KYNB 2Z31B 1BQHG 2FIRT 3O3EA 4E5XA 3F58H 2BSTB 3CH1B 3RVVC 4M8QB 4U6XA 1JRHI 3O0RH 4Y1AD 4I4WA 2VTFA 2FECL 2XG5A 5IEKB 1G9MC 4OCSL 1NLDL 4YFDB 5I18H 5D7LA 5CZXD 1PX3A 1HN1A 4X9BA 5D72L 4LP4A 2VITB 1NEZB 4PGCA 3N50A 4PJ7A 2F53A 4FTVA 3RP1A 3O0RL 1I3RB 3LMJH 4WHTB 5CLTA 3B2VH 2DAVA 2VDNH 3IFLH 3OR7B 4HIJB 3V0VB 4TUOB 4OM1H 1S9YB 1A3RH 1H0DB 4L9LC 4N0CC 4XTRC 5CEZL 5I18L 4YXHL 1IAMA 3MJ8B 2HLAA 4WGVB 3UO1H 4LCWE 1A1OA 1JWUB 1KTLB 3VXUA 2YSSB 3WD5H 1XGQB 3NFSL 1I85C 5EULV 2DQUH 3ARSA 4Y19B 5T3ZD 2XWBA 4MQXC 4U6HB 3ZL4L 4LLMA 3IFLL 3K2MC 5DFVD 5B22A 1IGML 4OM1L 5GRJL 2BXZA 5DA4A 4GW5A 3N1MC 2HTLD 4IRJB 1I7RA 4KAQH 5J3HC 5E03A 3PL6A 2PR4H 1D5MB 2AXGA 3L6FB 4FFYL 2FH6A 1A6ZB 3UYRH 3UO1L 1U36A 4L1DA 5FM8A 3BPOB 3WD5L 1M7DA 4QWWC 1FH5H 4NQVB 5DMJB 1MHHA 2ZSVA 5L88H 4Z7OE 3TT3L 4N9OB 3QUXD 5A1AA 3Q3GB 4EIZC 4HJJL 4DN4L 3I6LD 5LVEA 1WT5A 4JRXE 2PR4L 2DI7A 3SO5A 3MBXH 1K3ZA 4U6TA 5FUZH 4JFXA 1S7QB 5E1AB 4KPHL 5FKAB 1FH5L 3CPLB 1A7QH 4OIBA 3NIDE 4LGPB 1KJ2H 1FZKB 2OJEB 1RU9H 4MCYB 1MAKA 2D7QA 3AROA 4PV9A 4PJHA 1DVFB 2UVEA 2HFEA 4E41B 1VFBB 4RAUB 4U2YA 1RZKC 1Z9SA 4XBEH 3DV4A 4RZCA 4HX1A 3QDGD 4U31A 4JHWH 3CX2A 5FM5O 4G42A 3RVTC 3O2DL 5FM5M 2DIJA 1RI8A 3RBSA 3REWB 4PB0H 5E5UB 1FFOB 2CMRH 2F54E 2H6PB 1RU9L 4PYHA 3GZKA 2MNUA 3EYOA 1T03H 2Q6WB 2Y5TB 3DX6B 4IDJH 2H26B 5F88A 1I9RH 4L5FH 2YPVH 5L2KD 3PV6A 3W11D 3FRPA 3RY6C 5IOPA 4BZYA 3LS4H 4XCYA 5IV2A 2KKQA 3W82A 4ZFZA 1L6XA 2IPKB 4PB0L 1FL3B 1BFVH 3NA4A 4PJ8D 1J8HD 2D7OA 3MTRA 4EI5D 4MD0A 4O4YL 4GKZA 4Z0XB 2WINB 4DKEL 3RWEB 4IDJL 1E27A 4GAJH 3VGEA 5ACZA 1MHEA 1IGTB 3MFFA 4MJ2A 3I75B 5I8EA 5LBSH 5JW4Q 5JQ6L 3MRJB 1KLGA 3LS4L 1I7TB 5DRXB 4UDTB 2RR3A 4ISVA 5C2UB 3KHQA 1BFVL 3SY0B 3C5SA 3TH4T 2GTWB 5MP6H 3B9AA 5DYOA 4F9LC 2GT9A 3ES6B 3I02B 1KJ2B 2LE9A 3RZCB 5BZDB 5IG7A 4XC3H 4GAJL 5MEPB 2VDPH 3RGVD 1XCQB 5CJBA 1RJZA 3CXHK 3JBG7 1LEKA 3IU3B 1QLFA 3QHTC 2BVYA 1QSFD 2VQ1A 3WHXB 1LO0H 1I8LC 4RFOH 3O3AB 3K1DA 2DD8H 5L2JA 4IRZH 5I17B 5AD0A 3PWNA 1NQBA 1YN6A 5MP6L 2GUOB 3GJFK 2E7CA 4QLRA 4QOKD 1UKSA 1U8QB 4MSWA 3AM8C 1MIML 1L7IH 4MZ3A 3GEWB 3EOAB 2IFGA 4GKNA 3OR6B 1BLNA 3I3BA 5E00B 4KMLB 3HAEH 3GMPA 4MHHI 3CLEL 1FZOB 2FX8L 3QQNA 3TO4D 5E4EB 3ARXA 1MY5A 1R3JA 2F74B 3MLSH 4RFOL 5I8KL 1VENA 4KI5E 4F7TB 4IRZL 2AK4D 4NN6C 1K85A 5D1QB 4OD3L 5JDSB 5AUMA 2A74A 4XPTH 4ZFFA 4OI8A 3ZKMC 4JZNB 1B88A 3U30B 1NKRA 1CK0H 1V3KA 2B1HH 2FYYB 4Y4FA 2DQGH 5BS0B 4UAOC 2JELL 4TQEL 2R23A 3HRZA 4JFEE 3TVMC 5FECB 5FAAA 2X41A 3D69B 3HS0A 2VJXA 1X5HA 5E2UL 4MXVE 2JKXA 3MLSL 2FR4A 4N9GB 5KN5B 1BVLA 1OSZB 5FYLH 4P4KC 1MRFL 3K81A 4H0GA 4LCWD 3KXFE 1T22A 3NIGE 4Z7UA 1Q9OB 2DQGL 3VWJB 3MBEB 2EKJA 2H41A 3BDXA 2QEJA 1RZFL 4QT5B 4I2XB 3L5JA 2ZKHH 3VFPB 1PZ5A 1Y6NR 1I8KB 3EHBC 4CJ1A 4KRPD 4HGWB 4MQ7B 4GXVL 3WNKA 5I71C 2C5DC 1S3KH 1XR8B 4PRHD 3TLRA 4POYA 1BOYA 1AGFB 5D93C 1QEWA 3QQ9D 2AXJA 1LD9A 4ODTL 1FGNL 4ZAKC 2HLFD 1UCBH 2QHRH 3NGBB 4MJ5B 1A47A 3MRNB 4M7ZB 3ARVA 3C6LA 2ZKHL 4NT6B 3REVB 3HAEB 1CDYA 5MEQA 3DO3A 5IJVA 3EJYD 4GMSH 5DMKA 4R9HA 4XC1H 1S3KL 3GSRB 3H9HA 3EO0A 4XMLL 3VI4E 1OF2B 5CJQH 5D1XC 4DQOL 4KZEH 5B3JE 3WEXA 3LB6C 2BY1A 1MPAL 3P4OB 5T3XH 5JW4M 2E8YA 3QUZC 2OM5A 4OD2A 4I13B 5I76B 3V52L 4QXTB 5GIRB 1NC4D 4YC2B 3SQOL 3KPOB 2ZG2A 3JWDC 3H3KA 2DI8A 5CGMA 5TF1L 4UTAH 1IBGH 3M45A 3CU7A 1CICA 1URLA 5EUOF 3NZ8B 1TMCB 3VXSB 4Z0BH 2X1PA 4KZEL 3MV7E 4QGTA 3IFPB 3VXTA 1TENA 5B38A 3RL1A 3QXTA 3T1FA 1YN7A 1TZIA 4JVUA 3CJJA 1KG0B 3W9EA 2GJZA 2X4RB 4LFHD 4RFNB 3H3PH 1UJ3A 3AUVA 3LVEA 4U7SA 2BOCB 2WWKT 3LQZA 1EAPB 5SV4A 4JO1L 5I1DA 4UTAL 1ZAGA 5DRWA 5B4MD 3PGCB 4H25A 5IESH 2Y23A 3DX9A 3K0WA 3TJEL 3FN0H 3K1KC 4X98B 5AZ2H 1F58L 2WBJB 2HFGH 4J2XA 3IDUA 1A64A 5KBNC 5EA0H 3HZMA 2PW1B 4L4VD 2VQUA 1LEIB 5DQ9B 5J11C 3PHSA 3QSKB 4JEGB 5KANI 5C08E 3HUJF 4D8PB 1U3HD 4OF7A 1G7QB 1KLFA 4Q9CA 3OAUH 3IXAB 4P5MB 5ALCH 5GGVL 4LSQL 3U83A 3MGTA 3GRWH 5AZ2L 5F70A 3SCMD 4BH7A 4OKDA 4LHUG 5HI3D 5KSBF 2HFGL 1LO2L 2UZIL 3F65A 4HUVB 1B4JL 1ZTXL 1OP5H 1SYSB 4PUBH 5DJ6B 1QRNA 3TF7C 2EDQA 1A1NB 1OGAA 4PD4K 4G5ZH 5T5FL 2EDWA 4JDZB 3ZHDA 4F37K 1WVZA 3AREC 2XA3A 4IRSB 4FZEH 4FA8A 1OTSC 3EYQC 1I7UA 3D39B 1VFUA 3P0YH 1K2DA 4S1QL 1GSMA 5ALCL 4HIIB 3GRWL 1PYWA 2A0LD 3WSQL 1IE5A 3NVQA 5GGSY 3V2AR 4PUBL 5C0AA 2XOTA 3ARPA 3P9LB 1EHLH 5I30H 3BPNB 4Q0XL 4KUZH 3BEWA 3MROA 5ESQB 1AGDA 3G04A 2CLVB 2BY2A 4NQCB 1K6QH 1NCNA 5E7BA 4IJ3B 4LKXB 4KI5D 4GW4B 4OLUL 1IGYA 1LHZA 2QSTA 2E27H 4LIQL 4NN7B 1P4LB 5FDWB 3HMWH 2X09A 3T2QA 2CUIA 2Z8VC 4AMKL 4DK3A 4PP2A 1T5XA 5ICYA 3ROLB 4NC0B 4QHMA 5ITFA 3QI9B 3VFGH 4XP4H 4X99B 1AXTH 5I30L 2QSCH 1DL7H 5DEGB 3G5ZB 4JFED 4KK5D 4HFUL 4LDOB 2QTEA 5BW7A 4OFPA 2WW8A 1U3ZA 4WWKB 2DQCH 4KKNA 3EZ8A 3HUJB 2NY6B 5I1GH 3BGAA 4GG6F 3X3GH 5M94B 3HC4H 4X5XA 2Z93A 3OAYK 5H2BB 5EU4B 2CQVA 2J2ZA 2Q86B 2E6QA 1LO4L 5KSBB 2BC4B 1DL7L 4LVHB 5GGUA 1BQSA 3FOMB 3OX8B 3IYLW 4WEBH 5DWUL 3L3DA 4XPAH 2IJ0C 3X11A 2B0SL 2LAGB 5D6CB 4Y5YC 4F7MB 4G6FD 4YHIB 4HIXH 3FO2B 4OGXL 3MRRB 4NZUL 2NNAA 3H42L 2J8UE 2R4RL 3HC4L 3WFBH 1WBZB 3HR5B 4I48B 1SY6A 1G6RA 5TFSH 4PY8I 4OQTA 4LHJB 4BFGA 4PJ5E 2EE3A 1NC2D 3T77B 4AZ8A 5CINL 2ZSWB 4CMMA 1JVKA 1JGVH 1ZHBB 1MH5B 4XPAL 1RZGA 1MAML 4XH2B 1VERA 3M07A 4AL8L 3RWIA 3KWWA 5D7JB 4DTGH 5EG6C 4Q9BA 4F7CB 4ZUWB 3ZE0E 5TFSL 2NZIA 3MRBB 4HJGA 1FO0B 4QGYA 2EYSA 4A2LA 1T3FB 3FOLB 5E94A 5HDLA 2DM3A 3GB7B 1T83A 4R4BA 3KPLA 4PRIE 2AQ2A 4LK4A 4LBEB 5DHYA 1T89A 1AQDA 3PGDB 1OAKH 4GRLD 2GK0A 5B3NA 1TQCC 1I1FA 3OSKA 1MCEA 3OKLB 2ARWA 5JHLH 4K7PH 1WZLA 3NBNA 2EZ0D 1SEBB 3MCKB 1Q0YH 4JG0L 1C12B 3AS3A 1T2QH 4GXUM 1EMTH 1QBMH 2VLKE 2Y5EA 1YNTB 2OXGA 3RDTD 4GG6B 4X7SL 1OAQH 1EERB 1JTPA 3FO0H 1GH7A 4Y4FC 1S7UA 1OAKL 2OP4L 3MXWL 4B41A 1HWGB 5JZ7D 2VLJE 3WNOA 4P5KA 4RAVA 3DMMB 2HH0L 1FBIH 1B0RB 4HC1H 4JFPB 1AGBA 3CD4A 3SDDC 1T2QL 4L8BA 3WXVL 1QBML 3CC5A 3CFKA 3DYPA 1CGVA 4AJ0A 2VLRA 1Q1JH 5HHVL 1OAQL 4J8RA 4G8FB 1N64H 2WP3O 1Z9MA 3FO0L 1FVCB 4P2RE 1WAAE 1NDMA 3FQNB 1AH1A 2FJHA 1YQVL 4RIRA 3T3ME 1PAMA 5I15L 3EDFA 4WU5A 1T5WB 4ODWA 4P9HL 1DEEB 1AR2A 2QQQA 1U2HA 3O4LA 3LKNA 3MV8D 3RVXC 1IKNC 5JPNA 1JYNA 4XNZC 1Z5LA 4Q97A 4JY4A 1UT9A 5HYJD 4YHPA 4K07A 4EUPG 4Z5RA 2FSEB 4PJIF 4IIQC 4ZYKA 4U6YA 3MNZB 1Q1JL 4NFDA 1EFXB 1YMMB 4WFFE 1T1XB 5DI8B 3VH8B 4UZGA 2EXWC 3IDGA 4QHNA 3MODH 5D7KD 1E6JH 1L4IA 2ICWB 1QFWM 1S7RA 3VXME 3SJVB 5A2IH 2FHFA 5EZOH 1UB6B 4NO2A 5FDYA 2VAAA 3F62A 1BVZA 5ANMB 2O61B 3GBNH 3DVNB 2EDOA 5EWIH 4H1LH 4QHKI 4AENA 3FONA 1A4JA 4ONOA 3STZB 5ALBL 5K9OB 2A6IB 2NW3B 3PQYB 4DVBA 4WI4A 1YEDA 4C56E 4WHYG 4B5EA 3OGOE 2ZCLH 1UZ8A 3TCXA 5IKCB 5B8CB 1BBDH 3VI3F 1WK0A 3GBNL 1CFNB 4WDIA 4WI8A 3VG9B 3UBXG 1CICC 2EDNA 4MNQD 3GMRA 5IVXF 1A4KA 1A21A 5E5MB 3MRQB 1ZLVH 1J0IA 3DOSA 4KFZC 3JWOL 4H8WC 2ESVA 2W1NA 4NKMB 4JPIB 4U1JB 5F96H 1UJ3C 1OP3H 5IB5A 5KSAA 1ZK9A 2M26A 3O3BB 1VHPA 1MFAH 3UTSA 1NMAH 4KK9D 3HMXH 3QO1B 1P4BH 3ULUE 1CE1H 4WEUD 3S3PA 3X3FH 4PJIB 4LAQH 1U8OB 5K9QG 5FK9A 2V7NA 5IW1B 3X17A 2CO6B 1JPST 2A83B 4TNWF 3VMOA 5IQ9A 1OLLA 3FQWA 3PUCA 5EU7C 4TVPL 4FQXB 3ROOB 4GS7C 4XPGL 2P48B 4LLYB 3HMXL 4P3DA 5DD5H 4EN3A 1H3GA 3X3FL 5HI5C 4KZDH 3L7FB 3M8OH 2UYLA 5C0JB 3FT2B 1A8JH 4PJ5D 3BZEA 2DS4A 4PRPE 4JM4H 3G6JE 3V5KB 3WJJA 4B7LA 4DEPC 4KMQA 3BPLC 3FT4B 2Z35A 4KJPD 4Y5XA 5E8NB 2P42B 3LZFH 2X4OA 2MPAL 3QO0B 3RKPA 3O6FD 3QR2A 3MX0A 3HI6H 3KPRD 5IR1B 1FLRH 3TNMB 2IFFH 1WC7B 4KZDL 3QFJB 4XPHL 4BJLA 3BDYH 5D7LE 5BV7B 1M1SA 4QRRA 5IVXB 2WSKA 4K9EC 2I9TB 4ZFOA 1OGTA 1AQKH 5B4MC 4EJ1C 4PRID 4IOIA 4PJ7E 2F53E 3LZFL 2BVTA 2XKNB 1VFAA 3SDCB 3WMSA 1NMCC 1F2QA 2ENSA 4JPKH 3SGDH 1ODAA 5DA0B 1OB1A 1ZGLA 2DYPD 1KXTB 4JFQA 3QEHB 3S96B 4MDIB 3B9EA 2VLKD 4K23L 2DQJL 1D9KC 3MRMB 2EYRB 3B6SA 3ZE1E 5DD0H 1KIQB 3BFOA 1U95B 5FOBA 1ADQA 1G7LB 3VFWA 5FHAL 5IW3A 1KCVL 2VLJD 4LF3B 5F7EH 2EE6A 3N1QC 2JB6A 4LCIH 5BW7C 5HYSA 5BJTB 4LU5L 2FEEL 1AP2B 1CDJA 2GFBB 4Q6YA 4YBQC 4RNRA 1EA9C 1XZ0B 2G2RA 5DMIL 4G43B 3PIQB 1AJ7H 3F7YA 4UIMB 3FRUA 4P2RD 4TN9A 3DURB 5GRWA 2DQTH 1XIWB 1H3XA 5IIEA 1RZIA 4KROD 4YK4C 1NAMB 5F7EL 5EZJB 2NPLX 4LCIL 3CNKA 2X40A 1SVZA 3P3YA 4BSVB 2HYMA 5EU6D 3ARBC 5FKPB 2EDLA 1A2YB 5ITBL 3RPIA 2OBGA 4LQ1A 2VH5L 1OTUD 2ZUQB 4DZBA 5JW5B 3D3VD 1JGLL 1TJHL 4PGBB 4KHXL 5CBAA 3QUYA 5C92A 3ARFD 5GRVL 4PJHE 2VXTL 2NTFB 4OT1L 3GMNA 1RVFH 5GSRA 4Q74A 3F7VB 2VAJA 5IVZB 4N0UA 4CU8A 1HK6A 3CX5K 2DMBA 4JGUA 5GGRB 1B3JA 3BQUD 3CVHA 3RNQB 4LLQA 2IMNA 1GGYA 4TRPH 4C56D 5SWQA 4Y2DA 4U1LA 3BZFB 4L29A 2IH3A 4M6NL 3WNPA 4LLUA 1VGEH 4N0RA 2Q76B 4IM8A 1KFAH 3K8KA 4L3EB 2EDTA 5C0RL 3OJVC 2ZP0T 1Z2KA 4ZO6A 5F9AC 2CUHA 4JQVA 4ESKA 1JNJA 5D6DC 3A6CH 1EEZB 3GSVB 4TRPL 1AO7B 1UWXK 2QQKH 2FLRT 4Y16A 2LU7A 3LRSA 3P30L 5F89B 4UINL 2VC2H 1G7MA 2HVKB 4M7LT 1N8ZA 3DBXB 5IUSA 2B4CH 2N1KA 4ALAL 1D5XB 2I5YH 3KGRA 4CVZB 2FO4A 4NOFA 4G8GD 1WCQA 4UMGA 3RIFK 1QZ1A 1O5DT 3C8KB 3FB6A 3I6GB 5TDNA 1KPVB 3ULUD 3OZ9L 1D3CA 3QWRD 2EH7L 5ID1B 3OG6B 1JE6A 1JI1A 4TNVF 1NJ9A 2NY3D 3HNTH 3DXAB 3ZYOA 2NMSA 3SDAD 4LFHG 1GIGH 1PQZA 5CS7A 3QJHB 4KRNA 4HJ0C 3OTTA 2I5YL 4HWUA 1FLTX 4ZG1A 5MEND 3X13B 1IC7H 5F7FA 3EJZC 4X8JB 3VWKB 1NUGA 4AQOA 4EVNB 1BFOB 3ISWA 3VFOB 2DKUA 4FXLA 2BOBA 3L3HA 1FG2A 1IAOA 2EH8L 1PY9A 4F33A 2CDEA 4MX7B 4E42A 4PRPD 1GIGL 4R4FH 3MV11 1CL7H 1ZS8A 2DLHA 3FTGA 2UV3A 5I8OH 4MA1C 3PWUA 4Z9KB 3MRGB 1A7RL 1N5YL 2FCBA 3ZKQD 2W0LA 3GSQB 1T6VN 1JF1A 2XV6B 3G08A 3HFMH 4CW1B 3S3SA 4TTGA 4C83A 5LAXA 2X4NA 5H35A 2KPNA 3ZYIA 2DMKA 2FATH 2CXGA 1G7HB 3BIAX 5ETUA 3PWVA 4LSVH 3VXPA 5CIPH 5JHDB 1YY9C 4M7KH 1LDSA 5DC4B 2F5BL 4EKXA 1FZMB 1DFBL 2JIXA 2Z8WC 3WLBA 5AAWA 1S7XA 2XKSA 3TN0B 3VXUD 5D9SB 3DIFB 1BIIA 2LTQB 1YEKH 1QSVA 4Z7UE 1VACA 2F5AH 2WIIA 3KDMA 4LSVL 3QDJD 4JHAL 3PG2A 1OARH 4HKBA 5I75B 4H26A 4LEOB 5E6IB 4BH8A 4NZRH 3EDJA 4AM0A 2NY4B 3PL6D 3ULSB 3DI2B 4XCNA 3QP3A 3VXRA 2MQCA 5LJYH 4LLVA 1UH3A 4TSCH 1ZGLP 4AQ1B 4YHYB 5IB3B 2CGRH 2F5AL 4IRJD 4M3JA 5HHXH 1BJ1H 1HCVA 2GITA 4GAGH 1S9KC 1OARL 2ZOKB 4OGAD 4NIKB 1MCOH 2BVEA 3IDYC 2OL3H 4X6DF 3ZLQC 25C8H 4HDIB 3WFCL 3D0LA 4L8SB 2X9YA 3MC0A 5DS8A 3LKPB 4PJGA 3L3IB 1AY1H 3MV9B 2BNUB 4HG4J 2AABH 4KKBC 5K59F 4EN3C 1MFCL 1T21A 5DK0B 5DVLA 5LGHH 4TSCL 3GI8L 1A3QA 5C0DA 4H5SA 3MSPA 1N0LA 1BQHB 1WBXB 2VXUH 3D18A 5HHXL 5ICZA 4GAGL 4DGIH 4WY7H 4Y5XC 4JHZA 3IF1A 3OR7A 3V0VA 4BSJA 1XR9B 2BVPA 1S9YA 2YA2A 4PLKD 4RWYL 1X5LA 1L9MA 3I9GH 4DUWA 4PR5B 1J87A 4E41D 1BZ9A 5LGHL 4P9MH 1G7IA 2Q7YA 3E3QE 4H20H 5J89A 1VFMA 3VW3H 2PUQT 2EO9A 3INUL 2JE8A 4DGIL 3NCFB 5KSVA 4KTDL 4LCUB 2QBWA 5IBLC 3KPPB 4U6HA 1PW3A 4M6OL 5FYJU 1CLCA 2P7TB 5DJXA 2NXZD 5GRYA 3WIIH 4MNHA 4YDVB 3I9GL 3RWHA 4LLDB 3ZSSA 1UWEL 1FORH 3EOBB 1REIA 15C8L 3H9ZA 1LK3H 2AEWA 1RIUH 3NPSB 5EN2A 5K33A 3VW3L 4J4PC 5KZCB 5CEYB 2DLIA 4LGSB 4JVPA 1NCBH 4XP1H 4GBXD 3R8BB 1EVTC 4U33A 2H1PH 2OL3B 3NCJL 5H94B 2MCPH 3QISA 4X6DB 5EU7E 1A6AB 1PKOA 2VZOA 1RZ7H 2PYFA 1S7QA 4GJTB 4YWGH 2FGWL 4W6XB 5E9DB 1A6WL 4D3CL 3DV6A 4PJXF 2MOVA 4POUB 1DTUA 4JZJC 4K3HA 5J12C 1BP3B 3TBSB 1UWGL 1NCBL 4X9GA 2OJEA 3C60B 4PJCF 4K3JH 1QRNE 2BNRB 3OKNB 2YA0A 3RHWF 4ZUSB 1OGAE 2NY1B 2G5BB 2YMXH 5SWZB 3MOQA 4HV8B 3QB7C 1RZ7L 3D85A 1NBVL 4YWGL 2D7PA 3ILQC 1GZPB 2R0WH 2XWJB 1F13A 2A73B 3BH9A 4YZFF 3WL9A 2HAZA 4GSDL 3V6ZA 5C0AE 4K3JL 1A7PL 1QP1A 2D31A 3QUYC 2VDKH 2AV1A 1TVBB 2Y5TA 5C0CA 1NCUA 5DVMA 3HE6B 4Z7WA 4JKPL 3SGDI 4F8QA 4L8CA 1OP9A 1C5CH 4Z7NE 2FLBT 4K3DL 3QEQA 1G9ML 4ZSOB 3BH8A 4M6MH 1QBAA 3TA3C 2AXFA 5CWSB 4JANB 4ERSL 4Z0XA 3SBWA 2FIKA 5I1EH 4NNPL 2NR6C 2I07A 2IEPA 2PXYC 2JTDA 1UEMA 1CGUA 3WLWD 3QIWB 4V1DB 2FL5B 4P23B 3DO7B 1J9CT 3IETB 1J1OH 1AE6L 3SY0A 3ZSTA 4X7DC 1RIVL 1BGXH 1KJ2A 4PJXB 3SE4A 5I1EL 3RZCA 4Y16C 3F12A 5CLWA 5KVEL 5I1IH 1CDBA 5GISH 1BD2B 2P5EA 2X7LB 4PJCB 1MJ7H 1DQQA 4YEEA 1ACYH 3RWGB 1NBYB 4NRXB 1L6ZA 5I1HH 5BMFH 2BHYA 5CHNA 3VWJD 3MBED 2KDGA 4X6EA 2B20A 4ENED 4R7DB 2C3VB 5GS3A 1BGXL 2VISA 3FHAA 1JNLH 1NANH 2WBKA 1HDMB 2HKHL 1XMWA 3PNWB 1KN4H 5GISL 1RK1B 1MI5A 5I1IL 3EOAA 5T1DL 3OR6A 3C6LD 1MJ7L 3TV3L 3S98A 3V95A 2H2PD 1A22B 5BQ7B 1ACYL 1AR1C 1DQDH 4R90H 4AT6B 5I1HL 5BMFL 2F74A 2V17H 2X4PB 3W39A 5HJ3B 3TFKC 4PGJA 5DTFA 5A2LH 2JJTA 4NBZB 4QRPA 1IGIL 5DURD 5JDSA 3BJ91 1SVCP 1JNLL 5SWSA 2Z92B 4HIEA 3NFNB 3GJEA 4LVNC 4R96B 3T65B 2E9BA 3JV6A 3CDYA 3F5WA 4YNYB 4R90L 4KV5F 2VIRA 4MVBC 4M5YH 1TTGA 3FQUA 4O2EB 5FO7A 3V0AC 4MJ6B 1OSZA 4QRQA 1RZKL 1G1YA 5DQJB 5GSVA 4Z78A 3BWAB 5DC0A 1MREH 4D9LL 1U8PB 4X5WB 1ZHLB 5IB1A 3SKNA 1K4DA 2FX9H 5F1NB 2BVUA 5I1LB 35C8L 1U8IB 1NCCH 3QYCA 4LVOC 4PJ9B 5EH1A 3E6FB 4CU6A 3BP5A 3VXSD 2G75B 4JRYB 3S9DB 4M5YL 5DUPH 4MQ7A 1RD6A 4BQ6A 4JDVB 3U0WH 1QO3B 1XR8A 1ONQB 2IQAA 4NQDD 4OUUA 1NDGA 2QADC 4P2YA 3P77B 4UT9H 2VLRE 3L3OA 1BREA 1F4WH 3ZE2E 5CGTA 1DN0B 4G6JL 4LEXH 4PG2C 5A2JH 2PO6A 4LRIC 3MRNA 5ESAA 3QDMD 4QF1B 1EGJL 3KR3H 4UT6H 3TT1H 1P2CA 4UQ2B 4CMHB 5DUPL 4PYGA 4NQXB 1Y0LA 3O4LE 3CXDL 1F45A 3T0VA 3HG1A 4F9PA 1F3JA 4HAGA 4NUGH 5IWLA 3FQXA 4UT9L 3QIUC 1F4WL 1OF2A 1DBJL 1KXQE 3RJQB 2GAZB 3UC0L 3QQ4A 4FG6C 3W5MA 4S1RL 1R5VA 5HHME 4XPFH 2Z31C 1FYTB 3SKJL 2D0HA 3ARYA 3BP4B 3TT1L 1QRND 4YHOL 4JKMA 4QXTA 1R3KA 3P0VL 3S37H 4JR9L 1CL7I 3U6RA 5GPRA 1JZ4A 1OGAD 4KU1A 3RU8L 1CE6A 2DM4A 1T66C 3GIZH 1V5JA 4JO3L 4W4OA 2NZ9D 2YK1H 4HQQH 5DK2B 1Q94B 1RUQH 1T7ZA 3HHRB 3NZ8A 4RBPH 5T1KB 1GOGA 1Q9LB 1Q0XH 1S5HB