1S5HA

Potassium channel kcsa-fab complex t75c mutant in k+
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.
pubmed doi rcsb
source organism Streptomyces coelicolor, streptomyces lividans
molecule tags Membrane protein
total genus 48
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA01
2AJVH 1S3KL 2EDQA 4ZTPL 1NC2A 3V8OA 1RULH 4BYHA 1E28A 4G42B 1OAYH 4OF6A 4ZUVB 3PABB 4P46A 4PJIE 3MRPB 4X8JA 2Z9TA 1KJ3H 4GW1A 4OZFA 4OCXH 3IFPA 4QO1A 3PL6C 4OCSL 2VAAB 4DCQB 4U1NB 4XZUB 3AAZB 2YKLL 3C9NA 1UG9A 4TNWF 4AQOA 4PJEE 3PXHA 5GRWA 3HI6H 1HSAB 1XF2A 5I71C 2JK5B 4G5ZL 4WW1A 3KLHD 3K46A 1YECH 3R0MA 4NQUA 3DV6A 1T0MB 3FB6A 4LLVB 15C8L 2BNQA 1TJHL 3UTZA 1SY6H 5E4EC 4ZD3L 1WBXA 4FQLL 3FRPA 4B50A 4NCC1 5FDWA 3RBSA 2CGRL 2DQDH 5DURB 5TPWL 1DN2A 1FO0B 1I4FA 3AFLA 4M5ZH 4MHHI 4JKKA 1WT5C 3UAJC 1KIPA 4LL9A 4NQED 5DRZB 1PY4A 1I3RB 4JRYD 4YDVB 4EDWH 1UQSA 1HHKB 2VDPH 4KVCH 1WZ1H 5C0BE 3QO0B 3P4OA 3U0TB 2EDNA 3VGFA 3PWVB 4PJ5A 3MLYH 5HPMA 2AJSH 2I9TB 4HXAH 1LO3H 1EAJA 5I8EA 3HAEA 5EPMA 1GPOL 3RQ3A 4LEOA 5CKAA 1CG9A 1MCNA 3HC4L 4DJMA 4JPIB 2FJGB 3MV8E 3FRUA 4IHOA 4P4RB 1D5IL 4JFDE 1UM6L 1G9NC 5F3BA 4MA7L 4LKXA 3DO3A 1H9VA 3DX6B 4LIQL 3QDMB 5IHUL 1EO7A 2R69L 1IC7H 2HLFD 5EOTA 4Y19E 2VNCA 1NGZB 3JV6B 3FFCB 4RMWA 1W72L 3IF1B 5IEHB 3RNQA 1KT2B 3QO1A 4EXKA 3K74B 5CIPH 1EZVX 3LMJH 4AEHH 3KDMB 4LDOB 2D7TH 3KPSA 4XNYH 4FNLH 3SJVB 4F8QA 3LKSA 5D2NE 4P23A 5ERWB 3GSOB 1H8SA 4P57B 3L7FA 4YHIA 5JA9A 3CSYB 2H41A 3BIKA 4PJCF 1EHAA 4Y2DC 3R1GH 5EO0B 5FK9A 3VFRB 3TBWA 1S9WA 3OXRB 3RGVD 3OGCB 2YUXA 4X99B 3R06A 2WLZA 1RUQH 5DJ2B 5J11C 1WICA 2V7HB 2Z8VC 3P73B 4J3UA 4DKFH 2XZAL 4IS6A 3S96B 3BN9D 1RUAH 3EHBD 3WXWL 1NC2B 5CJOL 3ARQA 3V52H 5FYJU 3BW9B 1P4LA 2YK1H 5FDYA 1NGQL 3KJ4B 3KPOA 2FGWL 5IEKA 4TVPL 4U1KA 3HZKA 3L3DB 4GW1B 4OZFB 5EIVA 4JHZA 3IFPB 4Z0BH 4YUEL 1AXTH 2A9NL 3WNMA 2WBJD 4HMDA 2DL2A 3RX5A 4PYHA 2VXSL 1I9JL 1XF2B 5DUML 3TZVB 1J8HE 1X7QA 4QRPD 1CIDA 3H9YA 3MJ8B 2VYRE 1U2HA 3QRFM 4WW1B 2P5WA 4QXUH 3FQUA 3FB6B 2VDNH 5DD3H 1OPGH 4H0GA 1WBXB 4XC3H 5FDWB 3E0GA 4KI5D 3O3DB 3QWRD 4JFQA 4OUUB 3O6KL 4YNYA 3WFHB 1KIPB 1WAAA 4E0RA 4R2GC 3ZE2E 1M7XA 1U8IA 3DRTB 3NAAL 4JO1H 3TESA 1A6WH 1X9QA 3UBXA 3P4OB 4U0RB 2R39A 4ACPA 3I50L 1S7UA 5HPMB 3SDAD 1INEH 1KPUA 1F4WH 4WO4A 5I8EB 4LLWA 5GQBA 3HAEB 1B6DA 4ODTL 1RZGB 1NAKL 2H45A 2J8HA 3OBAA 1CG9B 4GFTB 3NCCB 1CDBA 1IGFL 3WFEL 3IGAA 2PR4L 4WV1C 2DQJH 2VTFA 1F58L 5F3BB 1ZGLM 1MFCH 5MERA 4HKJA 2W59A 3FKUS 3EYQD 3U0PA 4MB5A 3ZKSD 4PJDF 3W0WD 1IFHH 2Z93A 4MJ5A 5C09B 1ORSA 4TTDC 1UWGL 3ZYJA 4Z7QF 3VGHA 2YD8A 3TBYA 2OS7A 3RNQB 5IROA 5I1JH 2NY3C 12E8L 1ONQB 1T21A 1C16B 2G60H 3ZE1E 1HYSD 5GGSB 1E4JA 4YHIB 4JN1L 5JXEA 2YRLA 4HUMB 3BIKB 2DJ4A 4CVUA 4CGTA 3NFSL 3QHZH 1SYVA 4GRMA 1S9WB 4FFVD 4JDZA 5KSAA 5A43C 3RZWA 3H3PL 1K4CA 4XGZB 2I07A 3R06B 4HIJA 5ESAB 4POZC 3LEYL 3BPLB 2BRQA 3NIDE 4IIQC 4IS6B 1U3HD 3DI3B 4FQIL 1NFIB 2GYSA 4LSTL 4RAUB 1AD0B 3VRLE 2HVKA 1KJ2A 4M5YL 1T66C 2RJMA 3GK8L 1P4LB 4PJBA 3E6HA 1IGTB 5DJ0A 4R4FL 2V2XB 5MEQA 3KYNA 3PP4L 4U1KB 1CCZA 3HZKB 2MHAA 3RVWC 1UWEH 3T0EE 2BHUA 5ESQB 5T1MA 3RDTC 3ULUH 4XNUH 1GGUA 3KLDA 4ZS7H 4MZ3A 4TVSa 1IBGL 4HEPG 5CSGA 3NBNA 4IOFD 1DEDA 5IIEB 3F6LA 2AV1A 1MCSA 3F7YB 1U3JA 1X7QB 4JZNA 1GGYA 3KNBA 1MCQA 4WFHE 4JFED 1XIWB 3FQUB 2MWCA 3O8XD 5HDBE 2XQYG 5GGRB 4N1EA 3L7EA 4KKAD 3BESR 4JQIH 3IU4L 3T2OA 5DMIL 3O2WH 2YPVL 4YH6A 2KQMA 3D2UD 2XWBB 3MZTA 2OYPA 1YPZF 5EOQL 1MJ7H 1TPXC 1U8IB 4I13B 1KG0A 4L3CB 1FPTH 2LQRA 1RUPH 5E1HB 2MPAL 4Z7WA 4PJHA 1B90A 1T83C 2GEEA 2NY4C 3ARPA 4CADA 2IBZX 1S7UB 5E0QA 4UNUA 3PL6D 3DWTA 4M93B 1KPUB 3OF6D 2XY2A 4RMUA 2HN7B 5GS0C 2EKSB 2F53A 1OOAA 5EO9A 1MCOL 1SY6A 3O2DH 5D71H 4WY7L 4P9MH 2OK0L 3IGAB 2OJEA 1AP2A 3VRIA 5MERB 4HKJB 5ANMA 1P6FA 4ZUUB 3U4EA 4XCNB 5B8CB 4HDIB 3BN3B 1SVZA 1ORSB 3AY4A 1T20A 1QO3A 3SQOL 1BFVH 1T1YB 2HWZH 1F2XK 4ODXB 2H3NB 2YWYA 1OQXA 1MCKA 2XN9A 3EO0B 1J1XL 1I8KB 3X3FH 3UAJD 3RHWK 1K2DA 1LP9A 2DLEA 2XYCA 5FYJH 1JF1A 4MJIA 3DSNA 4R97B 3QYCA 1I9IL 2EDHA 4KKBD 4XWGH 5K33A 1SYVB 1CN4A 4GRMB 4JDZB 5CHNA 4JB9H 4Z8FH 4KUZH 2I07B 4HIJB 1UEYA 1QA9A 4IOIB 1H3WM 1FE8H 3Q2CA 1FP5A 1IQDA 4O5LH 3FL7A 4NQTA 5IB1A 3LZFL 5ETUA 3SE3A 1VPOH 3VDAA 1CFQB 3CX5K 5CIPA 2RQ8A 1X5KA 2I60L 1KJ2B 4JRWA 4Q6IA 4YK4C 3VFPA 4Y16A 4UI2A 1B0GB 4HWBH 4FQ1H 3KYNB 4ONFL 3N85L 5I30H 5GZOD 2MHAB 5D7LA 3DMMA 1CGTA 1SJHA 2BVQA 1W2KT 5T1MB 5D8JL 2FO1A 2CR6A 1SEQH 3HS0A 4LQFL 3VD9A 4NGHL 3UTTB 2WWKT 2FX7L 4P5TA 5DF0A 2EDBA 5F6IC 3V0WH 2OJZH 4LSVL 3P4MA 2AV1B 4QLRA 1BLNA 4GAYA 3L5WA 5HGHA 3O3EB 4Y2DD 1T5XB 3BRDA 1HK6A 3DX9A 1KCUH 1F5WA 3KNBB 4JZJA 2F54A 5C0IA 1MHCA 3WNOA 4KXZH 4N5EC 4KZDL 3L7EB 3WN5B 1CLZH 4NKIH 4QRSA 3MBEA 1A2YB 2AXFA 3MRBB 1RZFL 3QCUH 2EIZA 5FHAH 1MVFA 3E8UH 5CMAA 3CFKA 1UADC 3EJJX 4Y5XB 2OL3L 1A14H 1GXEA 1T1XA 2H1PH 1WIPA 2V17L 1D5ZA 3WIHH 4NM8H 2CMRH 2O5XH 2AJ3A 3MLXL 5GGUA 4L8SC 3SO5A 4PLNC 2R8SH 4Z7WB 2OMBA 5HXMA 3S35H 2CUIA 2DQCH 4RAVA 1A7OH 3MACH 1UCBH 2VRAA 4KRPD 2GSGA 1FZKB 5HDQH 2F53B 3MC0A 1I8LC 5IFHL 2R2BA 4Z5RA 1AP2B 3VRIB 2X1XR 5ANMB 2IPUG 1Q9OA 3ZTNL 1OARH 4RWYL 2Z31C 4JQXA 3L5JA 1T20B 3MTRA 2L7JA 2VIRA 3MOBH 2XRAL 2C3WA 4N8CL 1S7VA 4Y4KA 1HKFA 5EN2A 3KXFD 4JFYA 4R2GD 1K2DB 1LP9B 3MNVA 4X9GA 2E6JA 5IFJB 3K1KC 1BJ1H 4XCFH 1JF1B 4MJIB 1U8QA 4U31A 4DOHB 4HWEH 4KK9C 4UAOB 4H88L 1EBAA 1WV7T 4KPHL 4NSKA 5C09E 4MJ2A 5EORH 1G6RH 3MRMA 3RWDB 2GY7B 4HKZA 1QA9B 3WJJA 5FM4A 3G5YA 4WUKL 4ZO7A 3P40A 2J7LA 2FO4A 4OM1H 2EDJA 2VSDA 2WBWB 2P8MA 3SPVB 4RDQG 3S3SA 5I76A 5CIPB 4P2YA 1U9KA 3UJIH 1RIHL 3U79A 2GJ6B 4YDIL 1CTOA 3VFPB 1FLTX 2EDRA 1XH3A 1FRGL 5EZIH 1G7IA 3GSNH 4TTDD 5D7LB 2CDGB 1I8IA 1FNAA 4X6DE 2R0WH 2NY3D 1SMAA 2NYYC 3B6SA 1FJ1A 1DQLH 4ENEC 4PJ7A 4TRPH 2VDQH 3ARGA 1RURH 1ZANL 4RA0C 5TE6L 4Q9RH 3P4LA 1PZ5A 5D5MF 3P4MB 5TE4H 1M1SA 4GAYB 3EFDH 3OL2A 2A2QT 2A6JA 1HQRA 2X4RA 4BK5A 3CNKA 3P0VH 5FYLE 5C0IB 1T3FB 1JYNA 2HVJA 1OLLA 1UZ6E 4WNQB 4LVOB 4V1DA 4EI5A 4POZD 3MBEB 4FQXC 3WMSA 1SVCP 2EIZB 2E8YA 2UV3A 5ILTL 4HAFA 2G2RA 1T1XB 3GSXA 3OPZL 4XP9L 4BFBD 3B8SA 5L8JB 1D5ZB 5FV1L 1KV3A 1T66D 4P99A 2AJ3B 3HCVA 1WTLA 1WFTA 4PJAB 4GKZA 1YMMA 4G8EA 5DVOA 1WSST 3RVWD 5HGGS 2J4WH 1S7RB 3BKML 2X1QA 2NY7L 2Z4QB 4KXZI 5E2VL 3RDTD 3QA3B 3FO0H 1VFBA 4HKBA 4B5EA 4HUNB 2GSGB 3I02A 1EK3A 1T1ZA 3G5XA 1OY3B 1ORQA 3BSZH 4FFWC 1CZ8L 2A6KA 2J8UE 1BJ8A 4FQHA 4JFHD 3EZ8A 4PRIB 2R2BB 3VW3H 4Z5RB 3P2TA 5CILL 5IFAL 1SBSH 2M2DA 2P24A 4JQVC 5D6DC 3NTCL 4G6KH 1Z3GH 4YX2H 3HHRB 4J6RH 3WIFA 3QDJB 3H9SD 3TA3A 2VIRB 1AGFB 1C5BH 1N3NA 4D0BB 4X6FB 5I66A 2VN7A 4DN4L 1A0QL 1S7VB 2OQJB 3KJ4C 5EN2B 4YHOH 2PCPA 4JFYB 3TBTA 3ZKQD 1CQYA 1V7MH 3MNVB 4DGYH 3P4NA 2NY4D 3O2DA 4ZOBA 1P53A 5HSFA 1QBML 4O51B 3VXUE 1GAFH 1MFDH 2HTKD 4IRZH 4NSKB 4AIXA 5TQ2L 3BKYL 5GS0D 1EDQA 4KRNA 3G5YB 3QFDA 5LBSL 2BHZA 3JTSB 5CLTA 2FO4B 2LU4A 4OD3H 5ALCL 3HNSH 5HHVL 5I76B 1A4KA 3ARDD 1OTSC 3L1OH 3MV7B 5D96C 3PWJB 1EO8H 1NEUA 2JELL 3VGEA 2YZ8A 1YEJH 3PP3K 1RZIA 3Q0HA 1GGIH 1SM3H 1XH3B 1NCAH 2CLZA 2Q3ZA 2DQIL 2GAZA 3UO1L 1I7RA 1I8IB 4KDTA 2NY6C 3QFJE 4PB9H 1YMHB 4QYOA 1N5YH 2PYEA 1I85A 2HAZA 4ZFOA 2HJFA 3MV8A 1FJ1B 3LQMA 4JDVB 4PJ7B 3ARGB 1E6OH 5AG9A 5TF0A 1MY5A 1PZ5B 3V79C 4ZSOB 4WUUA 4XCEA 1D5MB 2AS5M 1BOYA 4RFNC 5DZLA 2X4RB 1HQRB 3GI8H 2ZOLB 2VDRL 1WJ3A 4X98A 1DUZB 3WXVL 3QUXA 2HVJB 2JIXD 5HY9A 2A9MH 4HWBA 4EI5B 1OP5K 1TXKA 4LRIA 4HJGA 3OJ2C 4J3TA 1JTPA 3UTTE 3IYLW 1P5VA 2OCFD 1LO0L 5I17B 4DTGL 2FR4A 2YOCA 1U36A 4OTXH 4OD2A 4U3HA 3NH7H 4X6CE 5FKPA 4GKZB 5INDA 1YMMB 3O4LA 1C1EH 4I8DA 1QPXA 1I75A 1CVRA 4ZYKB 1CK0H 4HKBB 3ROLA 2IG2L 2EICA 5CP3H 5LWYL 4PJFA 1T1ZB 3RAJL 5CCKL 2AEQH 3G5XB 4NC1E 4JPVL 1YY8B 4QXGL 4WWKA 1CI5A 4FQHB 4QXWA 5DHVH 3QUZB 3SKOB 1U3YA 5DGRA 1FL6A 3FQXA 5EH1A 3P30L 1U8LB 3BPLC 4R90H 2PNDA 3T3MF 4OZFG 1UEMA 3V95A 4N5ED 3W5NA 1W0VB 3JVGA 5JLZB 1PG7X 3TA3B 1TETL 4MX7A 4N8VA 1N3NB 1KJMA 1JFQL 4KY1L 2YD6A 1J8HA 3FONA 4D9LL 1QG3A 1EGJL 2D0GA 2QV2A 5C92A 2PCPB 4OFIA 4RMTA 2FJFA 3P4NB 4S2SA 2W9EL 3TO4B 4M3KB 1HKLH 4Q9CA 3CFCL 2H2SC 3LEXB 5EUKA 2Q7YA 1EEYA 5D93B 3FRPG 4PJ8A 3MUY1 1OLZA 1VKXB 3Q5TA 3QFDB 5BOPA 5C2BH 5AYQA 2EXYD 3C60A 2P7TA 4HF5L 4F57L 3RNKA 2R1YB 1A4KB 3Q6GH 2AQ3A 3BVNA 4POUB 4X5XA 5E99H 4CDGC 1Y0LB 3FQWA 2Z31D 3MZGB 2CLZB 2V2WA 3MGTA 2GAZB 4UB0H 2HFGL 4QYOB 2AJVL 2PYEB 3HAEG 4N0UA 2ZCLH 4ZFOB 2HJFB 1NQBA 2ZKHH 4K9EH 4KUCD 5DJYA 3TH3T 1OAYL 1G6RA 1MAJA 4WUUB 4XCEB 1KJ3L 4M93C 5ESVA 5DMJB 4WO4C 1DSFH 4U6XB 4KK9D 4X98B 3QUXB 3GMQB 5BZWB 1VADA 3HI6L 4MA3A 1G7MA 4N9GA 3U9UA 5I2IA 3EFFB 5DD1L 3GSNA 5B3NA 1KPVA 1FYTD 3N1GC 2A6IA 3L3JA 1TZIA 4LCIH 5DRWA 1JJUA 1YECL 1F3JA 5SWSE 5D2LE 3O81A 1IAIH 4LCUA 4OD2B 3ME0A 2BNRE 1PX3A 5FKPB 5IROC 5INDB 3O4LB 5DURD 5DJDA 5FHBH 1CIUA 2DQDL 3VFTB 3ULVL 5SV4A 1CD8A 4V2CB 3U7WH 4PRAA 2NYYD 3WNKA 3ROLB 1EMTL 5KVFL 1TJGL 4YZFE 4ENED 4EDWL 1MFNA 2XT1B 2B1AH 3AS1A 1MH5A 5GGTH 4X83A 1EJOH 1WZ1L 4LEXH 5FYLH 3UPRA 2GTWB 3IDXH 3MLYL 5DD5H 2AJSL 4WRLA 4MDIB 3WS6A 4KI1A 4HXAL 5I18H 5CEZE 1LO3L 3TIEA 4JFFB 4TNVF 2EIBA 2X40A 4MA1B 1WQVT 3IU3B 1WITA 4GT7A 2MKLC 4FQXD 3LKRA 4MX7B 3G04A 1KJMB 1YA5A 4JO3H 1F45A 3QDMD 3FONB 1NGYA 3IKKA 1IC7L 2FJFB 1BD2E 3WLBB 4PRIE 4S2SB 3RWEA 3FN0L 4I9WE 3EYVA 5EUKB 2FHFA 3DPBA 3LMJL 4AEHL 2Q7YB 2D7TL 2WIIA 3SJVD 2G75B 5T1LD 4FNLL 5I15H 3KLAA 4CJ1A 4XPGH 3WBDA 3IXAB 2D03H 2ZUSA 4FFWD 4ZOAA 3C5JA 3HNVH 4OF8A 5FYKD 2X05A 2P7TB 5EU6A 4EBQH 3R1GL 2DYPD 3RNKB 4R7NB 3WFDH 1MVUA 2JCCA 1CFBA 4MHHG 5DMKA 2NCMA 3OAZH 1RZJC 2ARJA 1RUQL 3FQWB 4DKFL 4NYLA 3RY5A 5HHMD 2JJTA 4X9HA 2V2WB 2VN4A 1DANT 1LK3H 1NC2D 4N0UB 4X4YA 4PY8J 2NZIA 4XB8A 4F2MA 4GG8A 1N6QH 5IVXF 5HD8C 4P46D 5F7EL 5ID0B 3JUYA 4WI6A 1D6VL 1EVUA 3NCMA 1UKSA 4Z0BL 3Q1SH 5ESVB 1AXTL 2W65A 3MV7E 4XP4L 4YC2B 3VCLB 4UDUB 5T33H 4MA3B 4NZUH 1CLOH 3U9UB 3GSNB 5ICZB 1TZIB 1S9XB 3TNMB 2AK4E 3B83A 3R0NA 4OLYL 4AT6B 2VZTA 1QHOA 1OTSD 1WBYA 4QXUL 5IB3A 4LCUB 2VDNL 1IT9H 5DD3L 4PGDA 3PNWA 1OPGL 3BUTA 4Z78A 4ZSOE 4BFGA 4E41A 2Z0BA 3VXNB 1J05B 3LHPH 2Y23A 4U6YA 2NY6D 2VH5H 4PG9B 4F37K 3DBXB 3BUYA 5E6IB 3D25A 4O2EA 2CJUH 3STBA 4JO1L 4QHUB 3SDXE 4P5MA 5KSVA 1A6WL 3GMMB 4PJ5D 1RD6A 4S1RL 4MQXC 2GW5A 4MZ2A 1ZGLP 4JY6A 1F4WL 3SHSA 1ZT7B 4QNPF 5GRVK 4U1MB 2OSLA 1XT5A 4G9DA 1X4XA 4LAJH 3KYKH 3SE3C 1U2CA 4ZUTA 2MCPH 2Q8AH 4LOUC 4PGZA 5DT1L 3LKRB 1L6ZA 3G04B 4NBZB 4NOBA 2BOBA 2ZG3A 1MFCL 3I84A 4Q6IC 4XI5C 4Y16C 4KTYA 1NGYB 3UMTA 1LGVA 3FQTA 1IFHL 4NUJA 4L4TA 5CP3A 1N59B 1XCTA 3T8XA 1IE5A 2F5AH 3RWEB 5CBAA 2Y9RT 4OQTA 1D9KA 5I1JL 3EYVB 5DS8B 3DARA 1MF2H 2OLDA 4PR5B 4DUXA 3F7RA 1PW3A 3EOYG 4P5TC 2WIIB 1UACH 3RL1B 5E56A 4I2XA 4C4KT 1J0YA 3BMVA 3KLAB 2G60L 1T4KA 3I75A 5I0DA 2Q3AA 5EU6B 3CUPA 3QUYA 4JZJC 3LQZB 2JCCB 1LDSA 4LVOC 3MBEC 5C71A 1HN1A 1KBGH 1CU4H 1MCFA 1QBLL 3AMLA 2UYLA 3VWJA 2CUHA 3L5XL 4ODVH 2VXQH 1YEFH 5GSRA 2CO6B 1FV1A 4F7TB 5F9OH 4PJDB 3NIFF 3UC0L 2VC2H 2X4NB 4IEFB 4LPUA 4XC1H 3VE0B 5CEYA 2B4CC 3NABH 4UV7L 1MFAH 3B5HA 1F6AA 3U36B 1J18A 1MY7A 1GC1H 3ULUL 4XNUL 4HUVA 2H2SD 4NO0B 4ZS7L 3HG1A 3PDOA 4G8IB 5E5MB 1I8MA 4X7DC 4XNZB 4XAWL 1ITCA 4OGZA 2PW2A 2XOTA 1MLCA 1QZ1A 1UM4H 4MS8C 1DQJA 5HTSA 1WBYB 4JQXC 3REVA 5IB3B 2BVUA 5KSBE 4RBPK 5D1XA 4YEEA 1F6LL 1MPAH 3H42H 4E41B 2RHEA 5CP7A 4JQIL 3T1FA 3TCLA 1AO7E 3H7BB 2BVOB 4U6YB 3O2WL 4KI5F 4Q2ZB 2C3GA 3B9EA 2Y07L 1MJ7L 3BUYB 3ES6A 1PAMA 1FPTL 4BKLB 1RUPL 1PZUB 3EIFA 1A8JH 5KSVB 2AJXL 5MHSE 4OLXH 4X7TB 3HPLB 4Z18A 3UP1A 1S7QB 5EZJB 1GZPA 4GW4A 2AV7A 4WO4D 1YN7B 5JDJA 4G9FB 1A6TA 4M02A 4H8WC 3WJJC 2WAHA 1AGCA 2OSLB 3T3PF 4YEFA 1P7KA 1KGCD 2XFXA 3O2DL 5D71L 3A6CH 4CVXB 1QYGH 4HS3A 4P9ML 1DL7H 2DQGH 3CAFA 1ZHBA 1AGBA 2WP3T 4GG6A 3BZFA 1ZA3A 4QRRB 2V5RA 2ZZUT 4WU7A 2O5ZH 5TE7H 1OCWH 3FT2A 1DQTA 4M62H 4UQ2A 4DGVH 1J0ZA 3FQTB 4NUJB 4JE4B 3G6AA 1BZ7A 1XCTB 3T8XB 1BFVL 1NGPH 5CBAB 2W92A 1FN4A 3BXNA 3CLEL 4N1CA 1D9KB 4E9LA 3K81A 2PUQT 3GMRB 4JFFE 3FQNB 3ARGC 1YPZB 3X3FL 2Y25A 3MRFA 4I2XB 1DBKL 3WHXB 5DYOA 1G9MC 3ZYIA 4YHKH 1T4KB 5JXED 3HR5A 4KWUA 3I75B 5C6WH 1WBZB 3F7VA 4N9OB 5CJ5A 1DBJL 3ZDYF 3QUYB 4XWGL 4N68A 5KSAD 4LRNH 4LCYA 5FCUL 3QT2A 4JB9L 3U0WH 4Z8FL 2PYFA 4F7EA 4EI5C 2CD0A 2N56A 4KUZL 5F8RC 3BH8A 3MUGB 1FE8L 1IM3B 3ZE0F 4O5LL 4UV4H 1KFAL 3ULUC 1VPOL 5IV2B 4RGNE 2UYLB 4YHNB 1FV1B 4N1HB 5HDLA 4AIZB 4HG4K 3CDYA 1OVZA 32C2B 1C5CH 4HWBL 4FQ1L 5E24E 4PJGE 2XICA 3F8UB 4J3SA 4WEBH 5I30L 4U7KA 5F6HJ 2CLVB 1F6AB 5JORB 1DR9A 4MXVF 4QCIA 3LKOA 3QAZB 5IQ9A 3HG1B 3L95B 3HPJA 2ICWJ 2ICEB 1I8MB 2NTSP 2DQTH 4OZGA 4HX1B 1AD9A 5IBUB 3V0WL 2CDFB 3QNXA 3BD4A 2GQHA 3T0VA 2R56H 4PBVC 5DTFA 4D9QD 2PW2B 4M4RA 3IS0X 3B3IA 4IM8A 5LGJA 3LS5H 5IKCA 2YXMA 4G43A 2XWJA 4G7YH 5D1XB 4RSVA 4KJPD 1INDL 3TA3C 4NQCA 1CLZL 2C1PA 2J88H 4NKIL 5GSVB 5T5FH 3QCUL 1N4XH 4DUWA 3T1FB 1A3LH 5FHAL 3E8UL 3NGBB 1FNEA 4KKLC 4X6BA 3BZ4B 2H1PL 3DXAB 3ES6B 3WIHL 4NM8L 2CMRL 1DEEA 5F7HA 4P3DB 2R8SL 3TO4C 4PJCE 5HD8D 2BC4B 1S7SB 3S35L 2XTLA 4JG0H 1IC5H 2BDNH 2DQCL 1I3UA 1A7OL 2X4SB 1UCBL 4LP4A 3AVEA 3OR7B 1GZPB 2DQUH 4QGTA 5JA8B 2AV7B 3O41A 1A1OA 4Y5YB 2D4FA 4TYUA 4RQQA 3WS3A 1AGCB 2F53D 4DVBA 5HDQL 2FX8L 4FQJH 1KCVH 5FXCH 3V6OA 2VLMD 1VGKA 2QJDA 5DXWA 1X6LA 4PJXF 4GG6B 3BZFB 1ND0A 4YGAB 3JUZA 1KPRA 2O61A 4FZEH 3G6AB 1OP3K 4LPWA 4KDTC 3F6IA 4Y1AE 5HGDB 1I85C 4EIGB 3MOBL 5DJ6A 4ELME 3AU1A 1FN4B 5I1IH 2XN9D 4H5SA 3MFFA 3I3EA 1V3KA 1ZHNA 4X7EC 3VJ6A 1WZMA 3MRFB 4PLJD 3V7AG 1R5VA 4HUKB 5A40E 4MJID 3HR5B 4FMKA 4XCFL 3F7VB 1HCFX 4J12A 3ZHDA 1ZSDA 1VEOA 5EB9A 4HWEL 4TTGA 4MQXD 1W0YT 3QUXC 5F70A 3KPNA 1FNLA 4LCYB 4HJJL 5EORL 2A6DA 4F7EB 1G6RL 3LH2H 3D39B 4U6HB 4LRIC 1A6VH 2ATKA 1HILB 4OM1L 2IADA 4LOUD 4YDKH 3LVEA 3VGAB 3BE1L 5E8EB 1QLEH 5FECA 3QDGA 2Q6WA 2D7NA 2X70A 4JRXB 4Y16D 2VJXA 3FQRA 1OD9A 2XTJC 5LCVH 5D7LD 5CGTA 2EE6A 3DMMD 5EZIL 1KXVC 1XR8A 1ADQL 3BH9A 4P2CG 3AXLA 2JLLA 1JHLH 4WI8A 2R0WL 5JW3L 2UY7A 1RQ5A 4WFED 3MJ9A 3LKOB 5IQ9B 4M7LT 1DQLL 4P5TD 5FM5M 3LN4B 2BJMH 2VDQL 2QEJA 4WWKC 3VFGH 4Q9RL 4OZGB 4L8DB 4JO2H 3LIZH 5TE4L 5EOCJ 5DTFB 3KWWA 7FABH 3B3IB 4M1DH 5LGJB 3ZYZA 3EFDL 2F54D 3JWOH 4PJDE 5JDSB 4NN5C 2GITB 4G43B 2XWJB 4Z7QE 2YD9A 2JKXA 3JVGC 1CICA 2A77L 1NC4A 3MBED 4NQCB 3D0VA 2C1PB 3CLFH 4WI9A 3MRLA 3NCFB 1KIRB 4X6BB 5JNYA 1JF5A 5GS2H 2X4QA 4X6EB 1DEEB 3DX7A 4MD4A 3QWOB 3QXWA 2RIKA 4GRLA 1ZLWK 2ID5A 1UJ3B 1P9MA 4MXWH 5E8DH 2J4WL 1JHTB 2CUMA 4GBXA 3ZKXC 4S1SH 3QULA 4QRUA 4QOKB 3O41B 4PJ8C 3SOBH 1A1OB 3FO0L 1CL7H 1GJIA 1D6EA 4RQQB 1M7DA 2D31A 4DVBB 4O00A 2Z8WC 3BSZL 1IGYA 3C60C 5D5MB 1V3MA 3ZHKA 4M48L 3JTTA 4HKXB 3SGDH 5LVEA 4BUGA 1QSEB 3QQ9C 3MLTA 4MS8D 5H94B 5F7MC 3F58L 5GXBB 1BZ9A 1KPRB 4G6KL 1Z3GL 2B8OT 1CD0A 2O61B 4YX2L 3SDCB 1GHFH 4J6RL 4K3HA 2BSRB 2DICA 5DJ6B 3AU1B 5LQBH 5E6ZA 4G9FE 1C5BL 3MFFB 1F02I 1PX4A 1HI6B 3VJ6B 5FB8A 1TZHA 4YHOL 4OF3A 4YPGB 1V7ML 4RNRB 3FB5A 1IAOA 4DGYL 3G08A 4IBLT 3KPQB 3SN6N 3H0TA 4QRRE 5D2LA 4AM0A 1GAFL 2VXUH 4CDHA 1GOFA 2W9LA 4M6OH 4YC2C 1UH3A 3SDDA 1XZ0B 4IRZL 2IAMA 2A6DB 1KCRL 2DF3A 2ATKB 2I27N 5ACLA 4JHBA 4HPOL 4OD3L 4AMKH 3HNSL 3HNTH 3BGAA 5FOBA 3O3BB 5ICYA 4PRPA 3L1OL 3QDGB 2ORBH 1YJDL 3IDMB 1EO8L 1C08A 5ISZA 1YEJL 3PQYE 1QR1A 1GGIL 1SM3L 1CE1H 5BZDB 3T2PA 1NCAL 5IG7B 5AYUH 1XR8B 2MQ0A 3BH9B 1Z0NA 4HHAB 3O45A 2QSQA 4PB9L 5E8OB 1XGPA 5C0AE 3TT3H 1CLYH 1CD1B 1KB5H 3HUJA 2BHYA 2C1OB 3ARGD 3OJDB 4ZOCA 3TYFB 4U33A 3MJGX 1E6OL 3MRHB 1T7VA 2KPNA 4OLVH 4Y2OA 5GRUH 3VI4F 4N8VG 4MVBC 1QLFB 2W0PA 1F11B 1JIBA 3GRWL 3WS6C 5CINH 4OCRH 5DC0A 3VD4A 1G0YR 1BD2A 4HBCH 3GI8L 2CXKA 1T04B 5HHOA 2A9ML 4GO6B 4EI5D 1CICB 4R7DA 1NUDA 3D0VB 1NGWA 5DJAB 2IFGA 4RFEA 3MOAL 3MV9E 1JGLL 3MRLB 4HIXH 3ULUD 4A6YL 1B0RB 5D7SL 5TQ0L 1PGRB 4U05A 5EG6C 4DGIH 2X4QB 4EDXA 3DX7B 4MD4B 1MJ8L 1YMMD 2WINB 3NH7L 1PVHA 1ZVYA 3IJSB 1C1EL 3DROB 5GZNC 1U8HA 1UJTA 4XVTH 1RFDH 3GJEA 1BP3B 4GBXB 4QRUB 5F7KC 5F1KC 1CK0L 3EOTL 3RWHB 5J9PA 3ZKMC 1BQHA 2AEQL 2A83A 3W9DA 1WFOA 4NO2A 1IGYB 3GNML 5KAQG 3I9GH 3JTTB 3KJ6H 3PV7A 3DXAE 2HLAA 2R0KH 3PG2A 1MWAH 4R90L 2JJTC 3TA3D 3MODL 4U2ZA 3SGKC 5K9KB 1CL7I 2J8OA 3CPLA 5H35B 3IAQA 1A6AB 2GK2A 1INQB 1GOGA 3H3KA 4OZ4A 3RU8H 4KKLD 1QSVA 5FB8B 1FGVH 3B5GA 1TZHB 2C4FU 3SGDI 3GKWH 3FB5B 2J6EH 1IAOB 4GAGH 1HKLL 3VD7A 1A1MB 2Z8RA 1F90L 1PDKA 3QPXL 4NFDA 4XNZC 1OF2A 3RWCA 4LCWA 1KLGB 3QJHA 3KHOA 4ZAKB 4TPRH 1OGAA 1L4IA 2A74B 5E00A 4KKCC 1L7TH 1DLHA 4FTVE 4LK4A 5C0RH 5FOBB 2ILLA 3GGWB 3Q6GL 1CF8H 3HMWH 2B5IB 1C08B 5ISZB 4OQ1A 5E99L 3P11H 1OP3H 5FYJD 1GH7A 4QT5B 4YLQT 2VXVH 3G9VA 3O45B 2PYED 4MNGE 4UB0L 5B39A 5FO8A 1FFPB 4G8FA 1XGPB 5F7YC 2E3VA 4XPFH 5HYJB 4UTAH 3TN0A 2ZKHL 3D39E 4K9EL 4EIZC 4NN6C 1YYML 2EDOA 4WUUD 4G6AD 4JKPH 1N8ZA 4JRXE 4ZO6A 1DSFL 5C0FB 5T3XE 3PIQA 3V8CA 3QUXD 3EO9L 3RZCA 5C07E 1RVFH 4R7DB 2V5TA 2XWTA 4RFEB 5IF0A 1ZA6B 4X5WA 4LCIL 2VITB 5BJTA 3O2VH 1NBZB 2FX9L 5IM7A 1LE9B 3BQUB 1IAIL 1WK0A 2DM4A 5LGKA 1NDMB 3O4LD 2XTJD 1D9KC 1U3ZA 5IR1A 5FHBL 1OL0A 2HH0H 1U8HB 2WNGA 2N7BA 1J7VR 1TVHA 3S37X 3U7WL 4GAJH 2ADGA 2QQQA 2D7QA 4RDQF 5HYFA 2B1AL 4WWKD 3BD5A 5GGTL 5LG1A 1BQHB 1HHIA 1EJOL 5FYLL 4NO2B 3INUH 2Z35B 3EYOB 4P2QB 3QUYC 3ZDZF 2ITDA 1OB1B 3IDXL 5DD5L 3ZL4H 2HLAB 5I18L 5JTWA 2Z92B 1KN4H 1S9KC 1HDMB 5GRZA 4V2BA 4WHDA 1FBIH 5BS0E 2GCYA 3CH1A 4U49A 3FMGH 4ZFGH 2ZPKH 5D1ZA 3CPLB 3VWJC 4XPTH 3EYFA 4QOKE 4R3SB 2V9RA 4N90D 2IQAA 4JO3L 2ZJSH 1NBQA 5C9JB 4GQPH 5EUOF 3S4SA 3IDNB 5D5ME 3ARFA 4K94L 1CGVA 3OTTA 1Q72L 2GY5A 2AABH 1KENL 4ZPVA 3UYPA 1QSEE 1LO5A 3GB7A 3QAZC 2H6PB 1H8NA 2CSPA 5E95B 4K7PL 2D7OA 4PJ8D 1D3CA 2Y4SA 3RWCB 4LCWB 2YD7A 3LKPA 4XPGL 5DJXB 1JI2A 2D03L 3NA4A 2DM7A 3C60D 1YUHB 3UTOA 5LXGH 3VXTA 3HNVL 1I1FA 3KPRB 4JFZH 2P44B 4HUUB 5E00B 4Z7NF 5L9DL 1PKQA 1XR9B 3WFDL 4HIEA 1NEZB 4FXGA 3QQ9D 5D1XC 1FZOA 4APQB 1M05B 5EIQA 2YN5A 5BO1H 4QHNA 1JWSB 3UZVB 4N0YL 3NGBC 3C5ZA 1DQML 5IB4A 3TN0B 4W4OA 1N6QL 4WTZA 5BRZB 3KPLB 1KEML 4KUCF 4I18A 5EU7C 1BFOA 4FP8H 1N8ZB 2C9AA 2N1KA 1BOGB 5BV7B 1D5BB 4XXDA 3V7MA 3WHE1 4WIQA 5F71A 5C8JA 3GIZH 5T33L 4NZUL 2BSED 2IWGA 3LKQA 1T1WB 5FKAB 4QTHB 4N0CC 5IF0B 4W6WB 3QIWB 2DD8H 1E4XI 2YR3A 1GGTA 4D9RE 3LRGA 4WJ5A 5IM7B 1AQDA 4LAQH 1KB5A 1ZV5A 2D0HA 1MRDL 4MB3A 2DWDB 2VISA 1S8DA 1G1CA 3N50A 4OM0H 3VGGA 3S34L 5IR1B 1NFDA 1ZHLA 1UKQA 2EDDA 2OM5A 3LHPL 2FL5A 4UINH 1S3KH 2VH5L 4LFHG 1TVHB 5KTEH 3G5ZA 3L6FA 2ADGB 4RGMC 2DLGA 2CJUL 3TJEH 1GCFA 4DK3A 1UCTA 1XFPA 5IT2H 4MVBD 3VXSE 4JO4H 3CVIH 3M17A 2ITDB 4U6TA 2FWOA 4PJGA 4KHXL 2NY5H 1LEIA 1RHFA 1RV6X 4I3GA 4F7CA 4L9DA 5DK2B 3TO2B 1M6OA 4X7CC 2GCYB 5HYSA 5MENE 3CH1B 3KYKL 4MSWB 2BSTA 3GO1L 4J1UA 2MCPL 2Q8AL 4NDMB 4P0DA 3T2QA 1H3VA 2IANA 3LS4H 2IQAB 5GJTH 3DSFH 2YEZA 1M71A 1QFWM 4XNQA 5IBUG 2YHGA 2EYSA 3EZJB 15C8H 3X13A 1TJHH 4KJYB 3X14A 3IS1X 1CGSL 3QIUA 5CSZB 1UENA 2F5AL 3BP5A 4ZPVB 1LO5B 3WEXA 2VDOH 5GZND 1MF2L 1N2RA 1LEKB 3K2MC 1UACL 2P46B 4NQEB 1MWAA 1MEXH 1I9EA 4Y5VA 5F96H 2APTA 4JRYB 2YXFA 1JPST 2F8VA 2GJZA 3L3KA 3ZKMD 3Q5OA 2PTTB 5EU6D 2Q86B 5F7WC 1X5ZA 3VXTB 5I9QB 3C6LB 1I1FB 3SQBA 1PKQB 4HIEB 4FXGB 4LPTA 4ZUSB 1FZOB 2WK2A 1GPOH 1LE5B 2Y7QA 2P8PA 4ODSL 1H0DB 4QHNB 3HC4H 2J6EA 5E8PA 1RJLA 4LLAA 4X4ME 1KBGL 1CU4L 3C5ZB 1UM6H 4GXVH 4U1GB 5HHPB 3NACH 5IB4B 4NHUA 2GTZA 4ODVL 2VXQL 5ITFB 4ETQA 4ZS6D 3HRZA 5L0QB 2OR8A 3D5OF 5F9OL 5IHUH 1X5HA 4JJHA 5C70A 2ZSVB 2HTLC 4PREA 3IDIA 4I18B 1MJUH 4TSAH 3NABL 3RX8A 5I1HH 1MFAL 3M07A 1BFOB 1W72H 5AUMA 3CJJA 3NFPA 1GC1L 4CJ0A 1KB9J 2UVEA 3T3ME 2R2HB 4ELMA 2P43B 3B9DA 1TTGA 5C8JB 5C0CA 4GRWH 3V6OC 2XIDA 3MBXH 5D70H 1KIQB 2WWMC 5HYJE 2HYMA 1UM4L 1X5FA 3P77B 4KKCD 4P2RA 1VA9A 5J1AB 25C8L 4WJ5B 1AQDB 3PWLA 4XMPH 5DQDH 3SDCC 2VISB 4E41D 1B88A 1MPAL 2XZAH 1X5YA 4H1LH 4CNIB 1F97A 2HT4C 1KYOJ 1DDHA 4JANB 2DI8A 5ELIA 3G5ZB 5T3XH 4U1IB 1XGRB 4XBGB 2O26U 1T2QL 1A7BA 1XCQB 4OLXL 3OR6B 4YGVA 5D7KE 3M17B 3J8F7 4YUEH 4G80A 1EX0A 1G7PA 1LEIB 1R24A 4F7CB 2E5EA 1HHHA 1M6OB 5DC9B 1YEGH 5HYSB 1IMHC 3GZKA 1XGYL 1QYGL 5HGBA 2BSTB 2DQGL 4J1UB 3O6MH 5DJCB 3T0XA 1MHHA 1K9TA 4QRPB 4CL7A 2DTMH 4WFGE 5D7IA 1OCWL 2YUZA 4F8TA 5GGSY 2EYSB 1QNZL 4L4TD 3X13B 1T7WA 2E27H 1NGPL 1D9KD 3DVGB 3WEXB 2B7DT 5MEPB 4Q9QL 1N2RB 4Y4FA 5EA0L 2K3TA 3MYZA 4MCZA 1MWAB 5F93C 4O02H 5CEZL 4YHKL 2GJZB 1U58A 3L3KB 5I1AA 3NA9H 5IQ7H 3QUYD 3RVUC 4GUPA 1EVTC 1H3GA 1WTGT 4L4VE 3SDAB 4LRNL 3U0WL 1CICC 2BVEA 1NAKH 5J12B 5JOFA 3C87A 2P8PB 1KJVA 1X5GA 1MI5A 1RJLB 5GS1B 4PRHE 4RMSA 2FGZA 5C08A 1F58H 3VWJD 1FG9C 1U91B 4YXKH 4PV9B 5CJQH 5I1GH 2GTZB 1FSKB 2HFFA 4ETQB 3LY6A 1AR1C 4GKSA 1NCCH 1CDHA 3L5IA 1C5CL 1DQQA 3IDJA 3OKMB 4TUOA 4X7SH 3W0WB 3IDIB 1P9MC 2GKIA 1Q9LB 3KPRE 3OX8A 1DFBH 4WEBL 3QI9A 2X2YA 1K8IA 1ZMYA 4OV6F 1GZQA 5AUMB 4GBXC 5JUEH 1T5WA 3NFPB 5E9DA 3BJ91 1K85A 1IARB 3R8QA 3HG1D 2G9HA 3K8LA 5GGRY 5C0CB 1G7QA 2DQTL 2G5BA 4PP1D 1PD6A 1DVFA 4P9HC 4K7PY 4NJAH 1KULA 3PGDA 1JNNH 2R56L 3VFWA 3RKDC 1F00I 3LS5L 3I6GA 4F7MA 5L7XH 5K9OA 5DZOA 3H3PH 3PWLB 5D1XD 2YZ1A 4G7YL 4XT1C 1O7SA 1AHWA 1OGTA 3VXRE 5DFVC 1N4XL 35C8L 4HWZA 1A3LL 1YQVH 4FQIH 1U3HB 5B3JF 3PHSA 1DCLA 3GSQA 3RA7H 1WAAF 2FEEL 3MNWA 3GK8H 3IVKB 4RGOL 4LU5L 4YHYB 5L2KA 4OLZH 1XGQA 3EW3B 1U8KA 3FFDB 4JG0L 1IC5L 1MUJA 4YGVB 4PRBA 2BDNL 5DLML 1OTUC 3B2UC 3SDDC 4G80B 2DQUL 1U8MA 2JJUA 4U1HA 4F15C 4WCYH 1ZTXH 1R24B 1IBGH 3UZQA 3MO1A 1R3IL 4FQJL 1KCVL 5HGAB 1YZZA 3IJYA 5HGBB 1UWXH 4KC3B 3HN3A 4N0CD 1T2JA 2V9QA 1G7LA 2D2OA 5D7IB 1H5BA 2B5IC 5IVXE 2AXGA 5J7CC 2NTFB 2B0SH 4JFEB 4CRPA 3UPAA 4M1GL 1GL4B 4FZEL 4OCLC 4R0LA 3IU4H 2OTWA 1LK2A 2QADB 5DMIH 3RUGA 1CE6A 3B8YA 5DQ9A 5I1IL 1S7WA 4GLRH 4NT6A 1MCRA 4QEGA 5EBWB 3HC0A 4MCZB 2X1PA 3DVIA 4HK3N 3IFNL 1XMWA 1IM9A 5HJ3A 5J4MA 1U58B 1OW0A 3SE8L 3ABZA 5BCAA 1CFSA 3DNKA 5J1SC 4L1HA 2R15A 1BBDH 4W68A 3VD5A 4M7ZB 1BIHA 3QUML 2R2CA 3ARBA 3ZHLA 5JOFB 5EIIA 4K23H 4EUPH 5I71B 2LTQB 1QLEL 1E0OB 3BQUC 2X4UA 4L29A 5CSBA 2MCG1 2ARWA 4P59H 4GKSB 2QQKL 2VQ1A 5LCVL 3OX8B 5E2TL 2KQNA 2L7UA 4NM4L 3SQOH 3DGCR 1JHLL 1MNUH 1Y6MR 3REWB 2AJZA 4QNPE 3UTSA 2J1KA 5EU5B 1J1XH 2G9HB 4O4YH 1FVEA 2BJML 2IALA 4PV8A 5I16B 1G7QB 2NXYD 1VSCA 2V2TB 3LIZL 4ZTOH 3VFWB 4JVPA 4DKAA 7FABL 4M1DL 4Z7VA 4ESKA 3VFNA 1JGDA 1A7QH 4U4BA 3JWOL 2EE3A 4DAGH 3B5TA 4F7MB 3MV01 5GIRB 1WCBB 2MKWA 5F88B 5GJSH 3UPCA 2VUOA 4NQCD 1OGTB 4WW2A 3QSKB 1A1NA 3CLFL 1W72A 4FABH 4NWUH 3G6DL 4NOFA 1OWWA 3GSQB 1AFVL 3K3QA 3CH8A 1XF4A 3LD8C 3MNWB 4FTVA 3AREA 2EE2A 3SDYH 1BVLA 4Z7WF 4EZMA 5L2KB 2HTLD 3AB0C 3N85H 1U8KB 4RCAA 4MXWL 4QXTA 2V5SA 5I0ZA 1HXYA 1K4DA 4S1SL 4UOW1 2ZUTA 5MEOA 1UB6A 5CFHA 3MO1B 2WWKO 1FIGL 4Y0GA 2GT9A 2VZUA 1KF9B 3MRQB 4H1LA 3V5HB 5AD0A 4M8QA 2B39A 5ABDE 2ENSA 3NIFE 4OZIA 4BM7A 4Y2DB 43CAA 4KZEH 1H5BB 2AXGB 1ZS8A 3SY0B 4IRJA 1IVLA 3SDCD 4MD5B 2CRZA 2G5RA 3F62A 1GHFL 1RZFH 5J11B 2OTWB 3ILPB 1XF3A 5LQBL 3RUGB 1CE6B 1TVBA 5DQ9B 3TN0C 4TUKH 1S7WB 4NT6B 2VE6A 1MCBA 4XBPA 2V17H 3NCYP 1ROWA 1WUNT 1LP9F 1IM9B 4NKOB 1W8NA 3QEUB 4QRPE 2ZUQB 2BSSA 3D3VA 2LU7A 3X3GH 5CJXA 3EUUA 3RZCC 1QVOB 5GRYA 3FCTA 4KRPB 3ARBB 3NZ8B 1G7JB 4XX1E 3V0VA 1FVCA 5EIIB 5DJ8A 1AGEB 4GLRI 4K2UH 1JBJA 3L9RB 4KI5E 4AEIL 2NZ9C 3WCYA 5CZXC 4AMKL 3HNTL 4HZLA 5C6PB 3QDGD 5AAMA 3BGFC 4OIBA 2X4UB 1BQHG 4L29B 5F1IB 3JXAA 1WIOA 2ORBL 3ZTNH 3ARWA 2WUCH 4RWYH 3GSUB 2YUWA 2VQ1B 3QXDB 1CE1L 1BHGA 2DWEA 5AYUL 3WDIA 1LEGA 2X4PB 4HW6A 5BS0A 3TT3L 3JWOC 5JOEA 2AJZB 3UTSB 3T3PE 1KB5L 5IWLA 1FVEB 3CC5A 2J5LB 3RI5K 3KXFB 4PV8B 4R2GB 4OLVL 4NJ9L 5GRUL 3T04D 4PUBH 1F3DJ 2Y36H 2DQFA 3ARTA 4K8RC 5CINL 4OCRL 2E9IA 5T1KA 4Z7VB 2C7UA 4HBCL 2JJWA 3L3GA 3RVUD 1QRNA 3UTPE 3VFNB 2ESVA 2HRPH 4GSDH 2AXJA 1PEWA 2NX5A 3W0WE 1FLRH 1CTNA 1V05A 4NUGL 1IAKA 1CICD 1NC4D 1E6JL 5GRXG 4WW2B 2HKHH 2OXGA 1W72B 5EBLA 4HIXL 4WV1B 4KHTH 4H0HB 4DGIL 4EKXA 3MGOB 5CGYC 1AR1D 3AREB 4HSQA 2BCKB 3ZDYE 4GRLD 1FRGH 4PJAF 3CMOL 3DIFB 4HULB 2VO5A 1NEZG 2W07A 2DMCA 1JPGB 4QRTA 4GBXD 2JF1A 4QXTB 4OV5B 1HXYB 4XVTL 1RFDL 5FO9B 1VFAA 2CR3A 1FNFA 4NKDB 2Q20A 5MEOB 1Z0MA 1JGUH 3ZE0E 3QR2A 4M4PA 5B39G 1ZKAA 5I9QC 3C6LC 3PGCA 1LNUB 3I9GL 3KJ6L 4OCYL 4H1LB 2QKIA 5AD0B 1L7IH 2H8PB 4M8QB 4OZIB 1KTLA 43CAB 2R0KL 2HFEA 3TBSA 1CDJA 2KH2B 4XMKH 2J12B 5KW9H 1PSKH 3FHQA 4CU7A 4BSVA 4K3JH 2IQ9H 4HMCA 3C5ZC 4HS8H 4U1GC 2Q7NA 4WWID 5DFVD 2MSPA 2YA0A 4JGMA 1MREL 2XKUA 1TVBB 5KN5B 5L0QC 2BOCA 4W4OC 3NCEB 3RU8L 4XBPB 1FGVL 4I18C 4ELKA 1N6VA 5D9SA 2YD3A 4JG1H 1WWAX 1DE4A 1FL3A 1QTYT 1JK8A 5CD3A 1EXUA 2A73B 1OTUD 3B2UD 3SDDD 5I8CA 2E7MA 2IAMD 2IH1B 1YEIH 4XVSL 5JW5A 4HIIA 3GUTA 4XXCA 1CZ8H 5IMOA 4JZOA 4TPRL 5K9JH 2LAAA 1QACA 1CGUA 1FL5B 1F4AA 1P7QA 4HZLB 4N0FA 4PRPD 3D9AH 5ISZD 2EDKA 3HMWL 1ZLVK 3P11L 1UGNA 3GMOB 5DMGC 1Z5LA 5AAWA 3WUZA 3U4AA 1U93A 2VXVL 4J8RA 5TDOA 4HUXA 4X7FC 4YHPB 1P2CA 4XPFL 3WJLC 4DN4H 4UTAL 1HXMA 3N1MC 2YPLA 3CC5B 4PJ7F 3QJFA 3X12B 4PJXE 1CDYA 2P4AB 4JKPL 5SWZA 5IK3A 5T1KB 1EIBA 4EUPA 1B4JH 3S4SG 1QRNB 2OI9B 5H2BA 2ESVB 3MYJA 1A5FH 5HHOD 4XCYA 1U42A 4QHMA 5TQ2H 1RVFL 4IDJH 3HZYB 4MNQA 4PGCB 3I6KB 5LBSH 2UWEA 3HZVA 3KLSA 5EBLB 4AK1A 3O2VL 3ULUF 4X0KB 2ZCKH 1SMOA 2CLRA 2EC9U 3ARDB 5DVLA 4JPKL 2FD6H 4S10A 3QIUC 4LMQE 2VUYA 3T4AA 5BOZG 2ADFH 4HFUH 3U6RB 3QH3A 2CIIA 1E4KC 2HH0L 4QRTB 1R3LB 4M6AA 4H26B 4LSRH 3TGXA 1VFAB 4XRCB 4HT1H 2ZUXA 4TUJA 2B20A 1RIUH 4HIHA 3MCKA 4GAJL 2YD5A 4ZNEA 2V7NB 4NQDA 3INUL 1UXWA 3PGCB 2E7CA 2QKIB 3SDAC 4WTZG 3CXHK 2HFEB 3MNZA 1KN4L 5FUOH 4NO3A 2FHBA 3V5KA 1FBIL 2JIXB 4BSVB 2JB6B 3FMGL 1Y18A 4ZFGL 1UB5A 2ZPKL 5KS9B 4XPTL 1FSKC 2BOCB 2HMIC 2ZJSL 3Q3GA 4J4PA 4C56A 4O2FA 5D9SB 4R4NC 4YK4B 1DE4B 1FFOA 1UFUA 3CD4A 3MV11 1JK8B 2QR0A 3DTXB 4L3EA 5CD3B 3T0AA 3WIIH 2XKNA 3JV4A 5I8CB 3JBG7 4BZYA 3VG0L 1TVDA 4LCWD 4AENA 1DBMH 2R1XA 4PTUA 3RAJH 5CCKH 4GW5B 5T5NG 4NC2B 4JPVH 4QXGH 3MA7A 4LLMB 5IMOB 1OGAD 5F6IB 4W4NA 2JB5L 4JFZL 1PQZA 3H9HA 1P7QB 3A6BH 4LSQH 1U95A 2WV3A 3LV3A 4ODBD 8FABB 3GMPB 3PE9A 3GSVA 4FXKB 4JKLA 1A3QA 5DWUH 5IW1A 1FGNH 3UEZA 3PHQB 2BVPB 3MLUL 1Z9MA 1ZT4A 1U93B 1RJCA 5D1QA 3TN0D 1RZ7H 2I25N 5EUOB 1HXMB 1GGBH 5HYSG 2YPLB 1EGJH 4OB5L 4QHKI 5BRZD 4YHYC 4OCWL 3GSRA 3QJFB 3CDGA 5CUSH 1R5WA 2UUDK 1Q0XH 2W9EH 3JWDC 4F9PA 2E7LC 5D6CA 4FP8L 5SWZB 3CFCH 4W6XB 4MLSA 1B9ZA 1Q1JH 4E42A 3RZCD 4XCYB 3TIDB 4IOFC 5DGQA 1FNGB 2HJLA 3GIZL 4MNQB 2OMNA 4K71C 4P5KA 1EJ6A 3ARVA 1ACZA 2LAGB 2NZ9D 3P9MB 2UWEB 4NQXA 2DD8L 5CZXD 4HF5H 3WD5L 3CSBA 3FAXA 4PRNA 2CLRB 5A2KH 4LAQL 1CFTB 4KAQH 1A7PH 5JHLL 4OM0L 5IW6A 4L4VA 1JHKH 2Y06H 2QADC 4F58L 2HRLA 1PG7W 2CIIB 2HFGH 4UINL 3T0DA 4HFWA 4TUJB 5KTEL 4LIQE 4PRHA 5TDPA 3MCKB 3TJEL 4PJFF 5JZ7C 2NW3A 4IDLA 5IT2L 1FNSH 1UXWB 4JO4L 4ZUWB 3CVIL 5CBEA 4K8RD 4PGBA 1R3JA 4M7ZC 2NY5L 4Z7UA 2GFBB 2LV4A 2CIKA 1TQCB 1VFMA 3GFUA 4NO3B 1Z9SA 1S7TB 3V5KB 4M43H 3CVHH 2YD1A 4UT6L 3VDCA 4QRQA 1ETZA 5DD1H 1UB5B 1SEBA 2LTQC 3STLA 4DFHA 1FYTB 3LS4L 5GJTL 1I1CA 3DSFL 5E5RB 3CSGA 3VI4E 4I48A 1EHXA 4C56B 5CGYD 3QI9C 3CZFA 3F5WA 3RIFK 2H2PC 3ULVH 2VDOL 1ODAA 3UBXI 3JV4B 3G6JE 2BNUA 3BPOB 4URTB 1EMTH 4CMHC 5KVFH 1F4YL 1TJGH 1MEXL 1I7TA 1DVFC 5F96L 2ED8A 5DUBA 1A9BA 4X5LA 3C6LD 1I1YA 2R1WB 4KKBC 4MAYA 5HHQB 1PQZB 2FBJH 3DHJA 3OXSA 4YXLH 5IMMA 5EOCH 1U95B 2VZSA 4XNMB 2OL3B 5T3ZH 4C54A 1AHWC 1RU9L 3GSVB 3SE9H 5HI3C 3OKLA 5IW1B 4OZHE 2V6HA 3EOAB 1JMZA 5E08L 1FZJA 4MWFA 3C5ZD 3RKPA 5CZVL 4GXVL 4FQXB 4YE4H 3NACL 5KAQF 3ALPA 1MLBA 3PWNB 5IB5B 5JO5B 1K5NB 1U8PA 4JFXB 1QEWB 1UKTA 3BP6B 4FFYL 2OTUA 1R5IA 3CDGB 2ICES 5I1KL 1MJUL 3HE6A 4JFHE 4LHJB 4TSAL 5GZOC 5IJKC 4S1QH 5I1HL 3FN0H 1DTUA 3OHXA 1BAFH 5D6CB 2PXYA 4U0QB 1N5AA 5EULV 2YC1B 4E42B 3FAWA 1B0WA 4UNTA 5T1LB 4YFDB 3MBXL 1IGMH 5D70L 3H9SE 1ZOXA 4P5KB 4MD0A 1H5BC 3BP7A 1S5HA 4NQXB 4BFIA 4YFLI 1TCRA 1JWMB 2DYPB 4PRNB 4HK0B 4XMPL 1CT8A 5DQDL 3TNNB 2VOTA 4JFOB 3K2UH 1ZLVH 2XZZA 5EBGA 4BELD 5DMGD 4OGAC 5HHMB 2IBBA 1D5XB 1MCLA 5KG9A 3RRQA 1HH9A 2FH6A 2XQBH 3PHOA 1ZWIA 1E28B 1KLUA 5TDPB 1OW0C 5T3XL 2ZUQC 4PGEA 2NW3B 4P46B 5F7EH 3BIAX 2VLKE 1D6VH 4X8JB 1CDIA 2LU3A 5HYQA 1RAMA 4Z7UB 4YDJA 3MPCA 4KRPC 3ARBC 3OKOA 4XP4H 3C9NB 1YEGL 1QQDA 3T65A 4QRQB 2GI7A 1CDCA 5FGBC 4XAKD 3O6ML 5HVHC 2IAND 2R29H 5KJRL 2DTML 3BEWA 4OLYH 3RWFA 3DV6B 3PWUA 4I48B 3BHBA 2BNQB 3I2CH 3QIUD 5D96B 3UTZB 2E27L 1OAXL 3CZFB 1L0XA 3EKCA 5C0JA 1HSBA 1I4FB 3TFKD 4S0SD 5DK0A 2NY6B 2J5LC 2L0DA 1A6ZA 2BNUB 1PBYA 1G9NH 3ZO0A 1UQSB 3FTGA 4JN2A 4O02L 4DZBA 2XXCB 3NA9L 3KG5A 5IQ7L 5DHXB 4S1RH 4PJ5B 3QXUA 3RBGA 3OXSB 5BW7A 4RFNB 2JCCF 2VLJA 5EPMB 1GIGH 4WW2C 4LEOB 3QCVL 3FRUB 4IHOB 5DT1H 4YXKL 5CJQL 5I1GL 4LKXB 1FFNA 4G3YL 1MLBB 2HMID 3AREC 1U8PB 4RMRA 4F3FA 1NCCL 4HQQH 1NLBL 4NKMA 5EOTB 3ZDZE 2D4DA 4X7SL 1BJ1J 1R5IB 5AEAA 1EERB 1DFBL 4R4ND 3FOLA 2H26A 3OHXB 2VZVA 5JUEL 3QO1B 3AS3A 3BZEA 1AR2A 4ONOA 3CSPA 4Z77A 3QXAA 1K6QL 3VXPA 3KPSB 5C0CD 1LD9A 3LKSB 4P23B 4JCLA 4YPJA 1RIVH 3L7FB 4AYFA 4NJAL 1JNNL 3TYGH 4NRZA 4P2RD 3BP7B 5EUOE 5AG8A 5FK9B 2LVEA 1TCRB 2DOCA 3TBWB 5ADOH 1Q9KA 4IRJC 4ODHH 5I6XB 5L7XL 3DUSA 1EGJA 2EKJA 2DDQH 3RHWF 1ZXQA 1RMFH 4BFEA 1YQVL 2DL9A 4GKNA 1QBLH 1QFWL 5I8KH 2BY3A 1EEZA 3L5XH 2EC8A 1J0HA 3LQAL 3HE7A 3RA7L 3UC0H 3HR6A 3ILQC 3KPOB 5AZEH 5IEKB 4OLZL 1YNLH 4HJ0C 4Z7NE 5DQJA 4UV7H 2UUDH 2KZ1B 3VFUA 1NLDL 3MCLH 4LCCA 5CJXC 2Q76A 4DKEH 5HYQB 1EV2E 1CFVH 4YDJB 4WCYL 1J12A 1ZTXL 3WFCH 1QQDB 2BP3A 4XAWH 3TJHC 5KVDL 4KQ3L 4MDJA 4C58B 5C2UB 2X1WL 3BEWB 1EEUA 2P5WB 5DI8A 1ZK9A 2CXGA 3PWUB 2B0SL 3BHBB 3KVQA 1CDUA 3OQ3B 2NY1B 3S36X 5A1AA 3UCRA 4FS0A 5I73B 2QADD 1F2QA 4KGLA 4UU9A 5GGVY 4JFQB 5C0JB 5IWLC 5CZKA 5DK0B 4YNYB 3FO2A 3I6LD 5DEGA 1A6ZB 1RHHA 4E0RB 5FEBA 2Y07H 4JN2B 3VXMA 3GBML 3PWPA 4D94A 1CGWA 5JZ7D 3CVHA 4LDLB 2AJXH 3UBXB 4EN3A 2DM2A 1FYTE 2OI9C 2FH8A 4U7SA 2ZOKA 4Z95L 1I9RH 2HTKC 3QEQA 4B41A 2ADJA 1BBDL 4X4XA 2VLJB 4WO4B 4LLWB 4M3JA 2EDTA 2XG4A 4I77H 4IMLA 2D7MA 1MI5D 4M7KH 4K23L 5C08D 3IJHA 5EWIL 1HHGA 5CLWA 2NXZC 1HOCA 3NCBB 3ARDC 3ALWA 1NMAH 3U0PB 2FLRT 3RY6A 4F3FB 4P59L 2Z93B 4MJ5B 4NKMB 4H1LG 5TH2A 5FUCC 3VFMA 3QI9D 3TBYB 3FOLB 2VKWA 1AI1L 2H2PD 3CLEH 4KROB 1DJSA 1MNUL 4YQXH 2A38A 5E9DD 3U46A 3BZEB 5DA0B 2ZSWA 3Q48A 2R23A 4O4YL 5AWNH 3O9WA 4EJ1C 1DBKH 1T21B 2ATPA 2DI7A 1LD9B 5E2UH 1DVFD 4XBEH 1U8NA 4RRPA 4ZTOL 1DBJH 7CGTA 4FZ8H 1B3JA 1J1OH 4JM2A 1KNOA 2JJSA 1A7QL 3QDME 3DETC 4DAGL 1P84K 3QB7C 5FCUH 1Q9WA 3U7YH 5KSAB 3DUSB 2OXHA 3B4NA 1K4CB 3RIAK 5GJSL 3FFCE 1MELA 5HI3D 1JRHH 3QPQC 2YRZA 3S3PA 4RFOL 1QFHA 1KFAH 4OFDA 3V4UH 5JHDA 4FABL 3K4ZA 4GKNB 4NWUL 3SJVE 4UT7H 3BT2H 5GGQH 2HVKB 2GUOA 3D2UA 4ORGA 4XHQA 4PJBB 3RVXD 5L2KD 1S9YA 3E6HB 5DJ0B 3SDYL 5MEQB 5IHZA 3MUHL 5DQJB 2EIEA 5FYKE 2W0FA 4L3AA 3VFUB 3DX8A 5C0DA 1CXFA 2Q76B 1UYWH 1A21A 3NPZB 2DN7A 3BO8A 3PDDA 4OKVA 2APBA 3QQ3A 4XXCC 4MQTB 1E27A 5HHME 5IOPA 4NKQB 5KVMC 4MDJB 2X42A 4JZNB 3VGBA 5DJZA 4HUWA 3CX5J 3HZMA 4GG6F 4EI6A 4KZEL 3DUUA 3G5VA 4NHCH 2P5EA 3A67H 1INDH 1CYGA 4BQCA 1HNGA 4U3CA 2DBLH 3VFVA 4OGAD 3IXTA 4ZPTA 4TUKL 4QY8A 1NUNB 2YBRA 3FO2B 5DEGB 2MOVA 1RHHB 1YYLH 5ADPH 1KG0B 3VXMB 1IM9D 2M8XA 3CFBA 3ARYA 4L5FL 1KUMA 4PJHB 5F21B 4CADB 5EC2A 4ZXBA 3ZSSA 3X3GL 2GSIA 3QEQB 4D0DA 2ADJB 2IPTL 4X4XB 2NPLX 4KRMB 4B7LA 3ARBD 2XA3A 4IMLB 1F13A 5EO9B 3U2SA 2FX8H 1P4IH 4OSUL 5JOPD 4K2UL 2EXYC 2OJEB 3IJHB 3SGEH 2R0ZH 3CZJA 4LPXA 2QQLH 3MRRA 5J13C 2APWA 2WUCL 3U4EB 4UMGA 5DSCA 5TH2B 5EZLA 4PJ5E 1QO3B 1XGUA 1QSZA 3UTSD 4CVZA 2OZ4H 2XN9B 2ZSWB 5ICXA 2QLVB 1HINL 1VFOA 2ATPB 1JZ2A 3SKMA 3V4VH 2AEIT 4BK4A 4OZGF 1U8NB 2PO6A 4PUBL 2Y36L 1F8TH 4F9LA 2A0LC 4UDTA 3EDKA 1TQCC 2EZ0C 4JM2B 1QLRA 2HRPL 4GSDL 1FZMA 4HJJH 1FLRL 5CHNB 1VERA 4B53A 1X5XA 2RB8A 3SKJH 2HKHL 5B21A 2VLRA 1IQDB 3CFJA 3H9ZA 1J0IA 1NAMH 5IB1B 5ETUB 5AZ2H 3M1BA 5JHDB 4J4PC 3HC3L 3BE1H 3D85A 3GM8A 1WGOA 4KHTL 3QG6A 2NLJA 1MCIA 1ZLUK 4FTVD 3ARED 2VXTL 4Q6IB 4Y16B 1WISA 2PW1A 1S9YB 2X7LA 2VB5A 1ADQH 2W0FB 3DMMB 1MJJA 2B1HL 5GPRA 5C0DB 1SJHB 2BVQB 3BPOC 5JW3H 1M7IA 3HS0B 1JRHI 3VGDA 1JGUL 3BYTA 4P5TB 3V0AC 1J10A 1E27B 1QSFA 3SEPA 2DTSA 1BLNB 3L5WB 4HUWB 1UM5H 1L7IL 5HGHB 3LPGA 3U4BH 4LASL 4EI6B 3EGSA 3DX9B 4JZJB 1HWHB 2F54B 4XMKL 3DGGA 1MHCB 4IRJD 5KW9L 1MFBL 2P5EB 1PSKL 1H3TA 1GYAA 4L8CA 2A77H 4TVPD 4K3JL 2IQ9L 4EUPG 4QRSB 2AXFB 4HS8L 5D1QC 4OIAA 2AQ1A 5CMAB 3CFKB 4QY8B 3T2NH 4S11A 4GOSA 1I7ZA 5GGUB 3CFBB 2LFGA 3ILQD 4JG1L 4F9PC 8CGTA 3FOMA 3D3VD 1RPQA 4HJ0D 1TTUA 4RAVB 4OFPA 3KYOA 4G8GA 1YEKL 4PD4K 4ZXBB 3BWUC 1ACYH 2OP4H 4C83A 1A9EA 1KC5L 1WEJH 1YEIL 5I8OH 3LB6D 2FSEA 2EIDA 5B3JE 4M48H 3TJHD 2O5YH 2VWEC 5K9JL 3FO9A 1NCWH 1WAAE 4KJWC 4P2OA 3KPPA 4PJIA 2JJVA 3B9AA 3F58H 3LEVL 3D9AL 2AEPL 2CKBL 3MRRB 1Q9OB 3OAZK 2W38A 2W60A 5DSCB 5EZLB 2FECL 3K4DA 5E6YA 3QZWA 2F19H 3SCMA 5BS0D 4PJEA 3GBNH 1QFPA 4RX4A 4P4KA 5FM5O 5ICXB 4Y4KB 4OLEA 4G7VH 1KGCE 4P46C 3SGEI 2PO6B 2RAMA 1MIEH 3OSKA 1CXLA 4Q97A 1U8QB 5T1KD 3PDGA 1QRND 2ESVD 1B4JL 1UC6A 1CS6A 3KR3H 2NX5D 2YPKA 1QLRB 1RZ8A 3U83A 1A5FL 1FYHB 4RIRA 3EDEA 1A7RH 4JJ5A 4TOYL 3MRMB 1KCSH 4IDJL 1EFQA 4HKZB 1KCRH 3G6JA 3VU2A 1TLKA 4ZFFA 3KAAA 2RFXA 2K9UA 3CFJB 1YC8A 3M1BB 5HVFB 4HPOH 2NXZD 2P8MB 5C0BA 5IGXH 4IIQA 4WHTA 2ZCKL 2NLJB 4HS6A 4OD1H 1YJDH 2FD6L 3RTQA 5FFLA 3K8MA 1IL1A 1T7XA 5C0EA 4OGXL 2ADFL 1DQDH 2X7LB 5JW4Q 4HFUL 1CXHA 1G7IB 4OBRA 4OZHA 1G9EA 4LSRL 1M7IB 4HT1L 1RIUL 5K59F 3B6SB 4JFDA 2E9BA 2KDGA 5KOVC 1P5UA 4PLOB 3WSQH 3GRWH 3FT4A 3FB8A 1PY9A 3O11A 2XXMB 4Y19A 2A6JB 4U3XA 1KTDA 3EGSB 5ITBL 1IC4H 2FBOJ 3DETD 4ISVA 5FUOL 3VRJA 3BGMA 3LCYA 5DDHA 4V1DB 5C1MB 1ZHKA 3QPQD 2DB8A 3MOAH 5D2NA 1JGLH 2XZCH 3SGJA 4A6YH 2G2RB 5D7SH 5TQ0H 2EYTA 3GSXB 4LSDA 3TH4T 4UOW0 4BSJA 1I7UA 3HE6C 1BX2A 3HCVB 3OMZA 1MJ8H 5EZOL 4D9QE 2PXYC 4G8EB 2CDEA 2ZUYA 1ED3A 4UILH 3KYOB 4G8GB 1T83A 2IGFH 3WIIL 4LGPB 1VFBB 3PJSA 4P23C 3EOTH 3I02B 4LSSL 1DBML 1ORQB 4KQ4H 2A6KB 3GNMH 4YBHA 1P7QD 1ZGLA 5I6XC 3BISA 3RL2A 3A6BL 4P2OB 5EU3A 2LABA 2PETA 3C08H 4PJIB 2P24B 4LSQL 2VLKA 4Z7WE 5A2IH 5HHNA 3WIHA 2W60B 4KTDH 5DWUL 1FGNL 3MLZL 3MODH 3QZWB 3SCMB 3WIFB 4RWHA 5BQ7A 5FA4A 4U1LA 2D7PA 4P4KB 3ISWA 4KV5F 5I66B 1RZ7L 2YPLD 3DRQA 1GGBL 3HUJF 2F53E 3TBTB 3X11A 5CUSL 1X4ZA 2VLME 3KPTA 5F9JA 4YXHH 5SWZD 1Q0XL 4KDWA 5CEXA 5L6YL 4F33A 5ANME 1F90H 5EFIA 1RZ8B 1Q1JL 3MMEA 4RIRB 3QPXH 4JJ5B 4MNQD 5LAXA 4ZFFB 3DUHA 2RFXB 4I0CC 4PLKC 4XP6H 2XN9E 1L9NA 3QEHA 4PS4L 1OAZH 1IZKA 1N7MH 5F7NC 1HEZA 1R6VA 1PJ9A 1LP9E 2NY1C 4KAQL 4NQVA 3HAEH 1NL0H 1A7PL 4MJIE 1RZIB 5M95B 5I73C 1T22A 5C0EB 2VDKH 3JV0A 1JHKL 2Y06L 1KXTB 4DOHE 2BXZA 3LSOA 1I7RB 2ZWLT 4LHQB 5SX4H 4Y8AA 3MV8B 4DZ8A 2FDBP 3AUVA 4NQDD 1YYMH 3UTQA 4DK6A 5DUPH 1YC7A 1U41A 3OG4B 4CW1A 1AXIB 3IETA 3LPFA 1FNSL 3FT4B 3FB8B 5BW7C 4EVNA 1NAMA 2A0LD 4Y19B 3W5MA 2EZ0D 2GJ6E 3OAYH 4ISVB 3EO9H 4PGJA 1LO2L 3BGMB 3VRJB 5HY9B 1JWUA 1VDGA 3LKNA 4M43L 3CVHL 2AQ2A 5DDHB 5D7LE 4NQSA 3IDUA 1VFUA 3FJTA 1ADQA 5D2NB 4WFEE 2Y5TA 4HJGB 2FX9H 2EYTB 4J4PD 3MRJA 1ZLUH 4C56D 2FR4B 1I7UB 1ZLSL 4QTIL 1PYWA 1BX2B 2FRGP 5C7XH 4DKDC 1J11A 2DQHL 4KROC 5I1CL 5JPNA 2CDEB 2XTJB 3WL9A 2K1MA 4L3ED 1ED3B 1BVKA 4L8SA 2F54E 3WO3B 2GHWB 1BJMA 3LRHA 4CUCA 3OZ9H 1NCDH 3B43A 4PJFB 1EZVY 5JXEC 4EEEA 3FT3A 4WWKB 3MJ7A 5A2LH 1MFEH 1TTFA 3T09A 4WI5A 2FBJL 3RL2B 4YXLL 5EOCL 1FL6B 3FQXB 5KSAC 4U2YA 5T3ZL 1V3JA 1MOEA 4Z0XA 3MRDA 3T0EA 1I1RA 2Q8BH 4PJAE 5HHNB 4F37F 4NN5B 3SE9L 1V8HA 5CAYB 4BJLA 3UYRL 5HI5D 3MSPA 5BQ7B 1J5OL 5D1QD 2FJHA 4N8VB 4U1LB 3K4AA 4YE4L 2I5YH 3RX7A 4BA8A 3K1DA 3DRQB 1J8HB 2MQCA 4G42A 4LF3A 3X11B 4K94H 5DA4A 1Q72H 1B2WH 3NVQA 3NOIA 4S1QL 5F9JB 4ZUVA 1KENH 1BAFL 1P7HL 2E7BA 4NPYA 5FAAA 4K7PH 1JE6A 4R26H 1EEYB 3MMEB 3QRGL 1T2XA 3ZKXB 4NZRH 4PJ8B 4DCQA 4U1NA 1UXSA 3AAZA 4XZUA 1VENA 3QDJE 4CU8A 3F12A 1IGML 4I5BA 1JNLH 1HSAA 1IGCH 3C60B 3QEHB 5L9DH 2ED9A 1HEZB 2JK5A 4KJWD 1NCBH 3QEGH 3UBXG 5J8OA 4NQVB 3BVNB 4KJPC 3K2UL 1FH5H 4X5XB 4L4VD 1U8OA 4LLVA 4N0YH 3MGTB 5DEFA 1DQMH 5JMRA 2XQBL 3HFMH 4MAUH 3C8DA 5DJYB 4EN3C 4DQOL 1KEMH 5DRZA 3MLSH 1G6RB 3UTQB 1I3RA 4YDVA 1OQOA 2ARJQ 1HHKA 4NNYA 4UBDC 3IETB 3O6LH 3MA9H 3U0TA 3PWVA 5IHBA 1JWUB 4OT1H 1VADB 3LKNB 4ZO8A 4NQSB 5CWSA 1G7MB 4N9GB 5I2IB 2EC9T 4MB4A 3ULVC 1V7NH 2FJGA 1KPVB 5JQHC 2A6IB 2Y5TB 2R29L 3L3JB 4MJ4A 5DRWB 4D3CL 2DM3A 3N1QC 3DLQR 4PJ7E 2FIRT 1KEGH 3RY6C 3IB4A 5IESL 1F3JB 3MRJB 4OI8A 2BNQD 2F15A 3AY4C 1MRDH 1CR9H 1Q0YH 1PYWB 3I2CL 3NN8A 3S34H 5JPNB 1NGZA 5DJDB 4NFCA 3GRWA 2FB4H 1BVKB 3FFCA 3IF1A 3DVNA 1KT2A 4PRAB 5DZNA 1BF2A 3GM0A 3ARRA 1G9NL 2ERJB 4PLJC 1KJ2H 4OLUH 4WI4A 3V7AE 1MH5B 3UPRB 4JM2C 4MAYD 2JJSC 3ULUE 3UJTH 1F3DH 1IAII 4MGXA 4KHXH 3RFZC 4A6YA 4BQ8A 3VFRA 4Z0XB 3T0EB 1GIGL 3TIEB 1NANH 4HAGA 4FG6D 1DN0A 1YMME 3ARSA 3OGCA 1AY1H 2ZUUA 4JKMA 2IMNA 3GO1H 4UQ3A 4BQ6A 3CCHA 3CK0H 1TZGH 3NZHH 2QSVA 2VKXA 4Q7DA 4HQQL 4LF3B 3HE6D 3BW9A 1CGSH 3DMMC 2DRUA 3MXVH 5JW4N 1RZJH 2PXYD 2QHRH 3L3DA 4Q6YA 5DHVA 4NPYB 1O0VA 2YS4A 3KPSD 1XF1A 5FV2A 3BX7C 4P23D 1UXSB 2NY2B 1RIVL 1FNHA 3F12B 4I5BB 2BMKA 1LMKA 3C5JB 3TYGL 2BK8A 3TZVA 2HT2D 3MJ8A 1MVUB 5ADOL 4ODHL 1JZ4A 5DMKB 3T0WA 3WFBL 1Z2KA 1DBBL 2ARJB 3U1SH 5E7FA 4ODSH 1U8OB 2DDQL 1X5IA 2R4RL 4NYLB 1RMFL 4M6NH 1NFDF 5T5NF 5DEFB 4XHJD 4X4YB 5I8KL 3O3DA 2Z91A 4OUUA 1FORH 2ZCHH 4F2MB 4GG8B 3N0PB 3WFHA 4HZAA 5AZEL 3DRTA 2YSSA 1YNLL 5FO7A 4TSBL 4ZXBC 2APFA 4NNYB 1T6WA 4BQ9A 1QBAA 3MCLL 2NW2A 4DKEL 3ZMRA 1N0LA 2KUTA 4PJGF 2W65B 1CFVL 4NCC2 4JLRA 3WFCL 3PXJA 2IBZY 5FYJE 2RGSA 1RZGA 5CWSB 3BKCL 2PYEE 1GVIA 4NO5A 1HHJA 4PLKD 5IMLA 2P5WD 1F6FB 2ZNWA 1YY9C 25C8H 4M9OA 4XVJL 3W39A 4FFZH 1SQ2N 4RRPG 2NY1D 4PGDB 3PNWB 4Z78B 1GGCH 3C2AH 4LGSB 4WUUE 1IC1A 4XP5L 4AG4L 5C09A 3NN8B 3U7AA 1HIMH 1C7TA 5C9KA 3DVNB 1T0PB 2JTDA 4Y4KC 1ONQA 4WFFD 3H2WA 1ZVSA 2UZYB 4DW2H 2PO6C 3D25B 4O2EB 2LE9A 4JR9H 4F9LC 4P5MB 1C16A 1T2QH 4I0KA 4NN6B 5GGSA 2BERA 4C57C 1I9RL 3RWJA 1RJYA 2VLJD 4A6YB 4JY6B 4FN0A 4I77L 3OKYA 4JREB 4X6DA 1DN0B 3O4LE 3C8KA 4G9DB 2D3VA 2XTJE 1C7SA 4XGZA 2PF6A 1XGYH 5ESAA 4M7KL 4ZUTB 4UQ3B 3ZTJH 5JW4M 3CCHB 4HK3J 2BOBB 1AXSA 4FQ2L 3JV5A 1NMAL 1CFNA 1NFIA 1VGEL 3DURA 4PJFE 2EH8H 1QNZH 1AD0A 4RAUA 4L4TB 4TNWK 5GGTA 1BQSA 1IGTA 4KROD 2V2XA 1NANI 5F7FA 4YQXL 5DHVB 4Q9QH 5ESQA 5EA0H 5IVNA 5AWNL 4ELMF 5KANG 3AS0A 4OFVA 2H9GA 5E2UL 5CEZH 4XBEL 3WV0A 5IIEA 4I3RH 2PKDA 2BMKB 2OR9H 4N90E 3H7LA 2KKQA 4FZ8L 1J1OL 3CUPB 3RVVC 2B4CH 2L4OA 3F7YA 3VMNA 1EH9A 1N64H 4BZ1L 1KIUA 2W1NA 4HWNA 3U7YL 3IRZA 1XIWA 3NIGF 5I1EH 1PG7L 1JRHL 5ID1A 5GGRA 6CGTA 5D7JA 3V4UL 1OAUH 2CKNA 5MI0B 4X9FA 2DJUA 3VWJB 3HE7D 4HPYH 2Z91B 2J8UA 4D2NA 4UT7L 3BT2L 3BAEH 2EO1A 2XWBA 4ONHA 5GGQL 5GSRB 4L3CA 4YFEA 2YSSB 5FO7B 5CEYB 1JZ8A 2NW2B 1RUKL 1NH6A 4WGWB 1A7NH 1UYWL 4HUVB 4JLRB 5BVPH 2C3XA 2YRPA 3PDOB 1AE6H 2W91A 3MLRH 2HN7A 2ITCA 2EKSA 2IJ0C 4N0UE 3WKNA 4NO5B 1HHJB 4P2OC 1MLCB 5IMLB 2KBGA 2M1KA 3KHQA 1DQJB 5D7IF 3W39B 4HG4J 1MRCL 3HRPA 4C59B 4NHCL 3REVB 2R2EA 2UZXB 5DEZA 3UTPD 3VXUA 1TIUA 3KS0H 1G0DA 3A67L 3SCMC 4ZUUA 4HWUA 4H8WH 4XCNA 1CXKA 5GS0L 5B8CA 5CP7B 4HDIA 35C8H 2DBLL 3TCLB 4P4KC 2AJUL 1T1YA 3E3QE 5DD6A 4ODXA 2H3NA 1YYLL 1ZVSB 3VXMD 3EO0A 5ADPL 3PWPD 4RISL 1I8KA 3V6FA 3V4PL 4RGOH 4LU5H 4EN3D 1Z6JT 1JYXA 5L88H 2VDLH 5DLMH 4UBDD 3QEQD 4GW4B 3RWJB 1RJYB 1A6TB 2YWZA 3QFJA 4FA8A 1I3GH 1H3XA 2FYYA 3NCJH 4X6DB 1P7KB 1K8DA 1R3IH 3C8KB 2YMXH 1P4IL 5J56B 2XFXB 1EUUA 1MIMH 2PN5A 4IOIA 4HS3B 2IMMA 4K3DL 1G9MH 1ZHBB 1R0AH 1AGBB 3ULVD 3O0RH 1ZA3B 2R0ZL 1AXSB 4WU7B 3RTQC 1CFNB 1LO4H 3DURB 3FT2B 1CFQA 2QQLL 4UQ2B 4M1GH 1X6NA 3BDYH 1J0KA 1BZ7B 1UA6H 4RA3A 2NY0C 1B0GA 3BXNB 3S37H 3WUWA 4LDEB 2OZ4L 3T1WA 5T3ZD 3O9WD 3ZDXF 2EDFA 4X80L 3M8OH 3B9KA 4MXQD 2H9GB 5DYOB 4XPHH 3V4VL 3UTTA 1MHEA 3IFNH 4X9IA 4RGMB 4G6AC 3SE8H 1F8TL 3MRIA 1J9CT 2AK1L 2R0LH 4JM2D 1UZ8A 2NQCA 4X6CA 4YHZL 3O3EA 1T5XA 2PYFB 3QUMH 3BH8B 3SKJL 1L0YA 5D2NC 5ID1B 4JPWH 1NAML 3SGJC 5JHDD 3WN5A 5AZ2L 5D7JB 1A2YA 3MRBA 1A6PA 2RBLA 2J8UB 4Y5XA 4ONHB 5CJBA 2QQKH 3DYPA 5E2TH 5EU6E 5CJ8A 4NM4H 2JCCE 1NBYA 4QCIB 3OG6B 3HPJB 2FLBT 3I85A 3QZWG 1FZKA 3MCG1 1FCGA 3CU7A 1AD9B 3PF2A 1QPPA 2ITCB 3QNXB 2NXYB 3U30B 1UM5L 3U4BL 5IKCB 1QKZH 3NPSB 2P5ED 3TH2T 2R2EB 3VXUB 1UVQA 1VEMA 4NBYB 3RUGF 3OV6A 3G6DH 5DD6B 1EFXA 1FNEB 2Y5EA 3T2NL 2CQVA 1AFVH 1R3HA 2IC2A 2CO7B 3V6FB 4OF7A 2HG5A 1ZEAH 3TWCH 2E8ZA 4ZXBD 5IFJA 2BFVH 1ACYL 5HVWA 2OP4L 2CRIA 1F4HA 2EDLA 1WEJL 5E8NA 5DRXA 4HEME 5HI4C 3QFJB 3WS3B 5GS3A 5I8OL 4E41E 3ARZA 2FYYB 1FIGH 1K8DB 3AC0A 1JP5A 3RWDA 4NNXA 4KMLB 1VGKB 2O5YL 4H20H 2FEEI 4RMVA 1NCWL 5E94A 1ND0B 2V5MA 3EOBA 4HXBH 1BIIA 1YY9D 4JGJA 3SPVA 4AZ8A 4BQBA 5F9DC 2GJ6A 4QGYA 2DJSA 4KMQA 2F19L 3WE6A 3QQ4A 3WUWB 3GBNL 4H5SB 2CDGA 3BMWA 4UZGA 1ZHNB 4NIKB 4OJFH 4Y4KD 4Y4HA 3B9KB 1R5VB 4G7VL 2PO6D 1MHEB 5J89A 4GMTH 3TV3H 1MIEL 1HH6A 1IQWL 3MRIB 5SWSA 3RY4A 1ZSDB 1UZ8B 4Z7VF 2BNRA 3E3QC 1FO0L 4YHLL 3KR3L 4X6CB 3KPNB 4L4TE 1A7RL 1KCSL 1T3FA 2VLRD 3V6BR 4DVRH 4WW2F 4WNQA 1U8JA 4AEIH 1YPZE 2IADB 3MRNA 3D85D 1HYRC 4IOSD 3EDFA 5IGXL 4I2XE 1BFSA 5FECB 4OD1L 2Q6WB 1DUYA 2X70B 3FQRB 1ZE3C 1NMBL 1TDQA