1S5HA

Potassium channel kcsa-fab complex t75c mutant in k+
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
211
Chain Sequence
b'DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title A mutant KcsA K(+) channel with altered conduction properties and selectivity filter ion distribution.
pubmed doi rcsb
source organism Streptomyces coelicolor, streptomyces lividans
molecule tags Membrane protein
total genus 48
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2004-01-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s5hA01
3RBGA 4ZQKA 1L7TH 2AGJH 4NGHH 4U0RB 2YA0A 4OZGE 1AH1A 5E9DB 1A22B 5T1LD 3MA7A 3O6ML 3WJLC 1B0GA 3V4UL 3VFRB 4HMEA 2AJYH 4MS8D 2JE8A 4XBEH 3IS0X 5B39B 2IJ0C 3E1F1 1E6JH 1NLDL 3D85A 2GTWB 4NOBA 3D25A 5C0RH 4XGZA 1D5ZB 4FZ8H 3F12A 1AXTH 5KBNC 3DGGA 2ESVE 4F9LA 1X6LA 3S4SG 1RV6X 4I1NB 3GIZL 1CLZH 1FFNB 3O2DH 5CILL 3IVKA 3BPLC 3O6KL 3R06B 4FQHB 2BSSA 4JGJA 4N5UA 3X11A 4ENEC 1KJMA 3L5IA 4BJLA 1F4HA 4Y2DA 2BRRH 4XXCC 4KKCD 2L7UA 4OM1H 3NACL 3AAZA 2AABL 3DUSB 2AXGB 2VLKD 3CXHJ 5HHXH 4UNTA 1HK6A 2B4CH 3LMJH 5ETUB 4YX2L 3HZMB 3UEZA 5HYEA 2EEBA 4HJ0D 3GDBA 4MAYC 5E8OA 3S4SB 2FO4A 4BKLB 3FO1B 5EUOB 1VADA 1U36A 1I9JH 1RHFA 3RGVC 5LJYH 1D5XB 3O2DA 1DBMH 4IHOA 2Z8RA 3OR7A 2EXWD 1L0YA 3QCUH 4A6YB 1V3KA 4U1IB 2NLJB 4HS8L 1VFAB 1J0YA 2P5WA 1RFDH 4TRPL 4JQVA 1C7SA 2NW2A 3C6LA 3BO8A 3ECBA 5K93A 4RAUA 1MCHA 3RI5F 4QY8A 4OFKA 4E42B 4AH2A 4Q58C 2GJ6B 1T1WA 1HOCA 4UV4L 2CDFB 2QHLA 3OKDB 5ERWA 2EICA 3QG7L 3E6FA 5FYJD 4KK5D 1OP9A 3VFOA 1AGEA 2DYPB 3V4VH 1G9NH 3B43A 3PHQA 4RZCA 2EDXA 4K9EL 4MJ2A 3PDOA 4PLOB 1VKXB 1S7UB 1BJ1J 3QFJA 1T83C 5IJKA 1DUZB 5KVEH 4MS8C 3VD7A 4BQ9A 4W4NA 5AWNH 3KXFE 2NY1D 4NZJA 5JHDB 4ONGH 5GSRB 3CCHA 1HCVA 1IGYA 1P2CB 1DE4A 3E8UL 1FBIL 5I71C 2NY5C 3RVWD 4ZPTA 3CFCL 1KB5H 1OGTB 3O0RH 1FGVL 5C07E 3C87A 2R1WB 5JHLL 4Q9CA 5C0BD 1BFOA 4F3FA 1IEHA 4ZOBA 2Z91B 2ZNWA 2Z4QB 1AIFA 4DW2L 1WUNT 2GTZB 5EH1A 3VGAC 4NM4L 2XZAH 1MUJB 4WFFE 2OZ4L 4HXBL 4KQ3L 3TPKA 4FXGA 3FOLB 4F9PA 2EE9A 3ZDZE 4DGIL 2QQNH 5ALBL 2RQ8A 1WWWX 4KKCC 2IAMB 5D2LB 3RWJB 5I1IL 1XF3A 4JN1H 1S5HB 4Y5YC 5I75B 2UYLA 3WEXB 1A1OB 5CEZH 2Z0BA 4RNRA 1JV5A 3EYVB 2IFFH 5FECA 1KB5A 2ADJA 3GSUB 4PP1C 1T6VN 3ZYZA 1A6WL 2VXQH 1PAMA 3H2WA 1KN4H 3QWRA 4L8SA 3MLYL 1YNKH 2AQ2A 4LLWA 4PGDB 5GS1B 4LSSL 3FO2B 5FKPB 1HKFA 1UM6L 4G6FB 1MHPH 5IQ9A 3UPAA 2Z8VC 2YK1H 2NY2D 5JUEL 1N8ZB 4ELMF 1HXYB 2IH1A 5K9QI 1NAMB 2VJXA 4BQCA 4KV5F 3G6AB 4U6HA 4MZ3A 1QSFA 2E6JA 2R9HD 2DLGA 4HLJA 1K6QH 1KOAA 5IBTH 6CGTA 1E4XI 1S7VA 2NNAB 3V52L 6FABL 2VLKE 4NQDA 4AYFA 1EZVY 4KK5C 5ITFB 2UY7A 1BM3H 5AYUL 3WDJA 1RZKH 4OD1H 2P8MA 2CUHA 2FZ3A 3MRQA 1S3KH 3CXDL 2VDML 3T0EB 5I8CB 3VFNB 2NY1C 4L8BB 3B2UC 1XAUA 1LP9E 5GJSH 4UINH 3OKEA 3RVWC 5C0DB 2APVA 5CGMA 1LHZA 1FV1B 1KF9B 5D8JH 4RMRA 3NCYS 1F6AA 3VWKA 3ARDA 4NUJA 5ID0B 2IPKB 4PJ8D 5L8KB 1OL0A 5EA0L 5FM8A 1KFAH 1BZ9B 4YHLH 5FYJE 5EOCL 3VFTB 4TOYH 2G2RA 2O5YH 5J12C 1EMTL 4JFHD 3FQWB 4N9GA 1UACL 1KLUA 1AD0B 2QKIB 1QBAA 3D2UD 3ZE2E 3KPRB 3IDNB 2PO6B 4QRRD 1OGAB 2B2XH 1NPUA 3FQXB 2R2BA 3MJ6A 4HV8B 5EU4A 1G7HA 4NT6B 1NCAL 2XQBH 5DQ9A 2NY4D 3S37X 4M93B 3WD5L 1T2JA 4IOSD 2NY2C 1BF2A 5MEPA 5EUKA 4EQ2A 4GKOA 5C0BE 5CP7B 1CD0A 3GI8L 2B1HH 1XZ0A 5C0AA 3TIDB 5E2UL 2XFXB 1ZLVK 1CGUA 4F37F 3WNPA 4N68A 2VISA 5GGUB 4YK4C 3MV11 1O7SA 4JJ5A 5KS9F 3ARQA 5IB2A 1PKQB 4JFDE 1IQDA 2BHYA 1K8DB 5HVHB 1TPXB 3CD4A 5AAWA 1GIGL 5DJ8A 1ZHLA 3KPLB 3TBSB 1JNJA 4DGYH 3GHEL 4GW1B 1DANU 1WBZB 4KKLD 5CHNA 2VLLB 2R23B 5HHQA 2FIRT 3V6BR 4F2MA 3M1BB 2X4OB 2Y36L 1ZKAA 1PSKH 4DFIA 1RUMH 3LS5L 3VXRB 3RGHA 5E9DA 1EEYA 2HKFL 1T20B 3UYOD 5HDBE 1U8HB 1ZLSL 3ZT5A 3VFRA 3KWWA 2JJUA 2FLRT 5IW6A 2LVCA 3D1MC 1N6QL 1T7WA 2QSVA 4O4YH 4QF1B 5B38G 1OQXA 1DJSA 1FYTE 3QDAA 4P99A 5J89A 1KGCD 4PJ7E 2FX7H 1I8KA 4YHYB 2GTWA 4XTRD 3BAEH 4GKSA 2UVFA 1D5ZA 5DQDH 1IFHH 2W65B 4WW2F 1W2KT 1U3HD 3NGBC 5F88B 2A77H 3IU4H 3Q6FB 2NXYC 2A9MH 1FZJA 3FRUB 4FQHA 4P4KA 3BW9B 3UAJD 3QPQD 4KK9C 5B38B 4LARL 3DUSA 4EDXB 2B5IC 1UQSA 4P4RB 1ZXQA 5GRUH 3TJHC 1NEZG 3SKMB 4EIGB 2Y5EA 5CUSL 3HZMA 3HC3H 4X98B 4BSWB 5JQ6L 2QQQA 1MCSA 5D72H 2GY7B 3FO1A 4OB5L 5EUOA 1E27B 4L5FH 1A6AA 3IDYB 3KPSD 2VC2H 3GNML 1D5XA 2I26N 1P7KA 2J8UF 5D5MB 1YEHH 5TGBB 2I07B 4FQXD 1CFSA 3ARBD 1HE7A 1JNHB 2IPUG 2YOCA 3ZZ1A 5HPMB 4M00A 4EI5B 1I1AC 2L4OA 2NLJA 3G5YA 4PGEA 1NEZB 4PREB 3FO0H 2HT4D 1W0VB 3DI2B 1B88A 1YQVL 3RTQD 1WZKA 4FMKA 1NMBH 4U1NA 5I15L 1A9BA 3EO1B 5JW4M 3WL9A 2DN7A 4HDIA 4HUVB 1HYSD 4JFHE 4OLYL 3WS3B 3CVIL 5IB5A 3OKDA 4PJXF 1WWCA 2DQUH 1FG9C 4QRRE 5ILTH 2FSEA 1U91A 3ZYOA 2DIJA 4GMTL 3OAZK 2BMKB 2V9RA 3GGWB 4M6OL 1WFUA 5EFIB 4BZ1L 3BEVB 1DUZA 5E95B 3TO2B 1N5YL 4HUNB 1KIRB 4MNQD 2NXZB 3GSVB 2ICCA 4PRIE 3X17A 1T66D 4B5EA 1P2CA 2HFEB 4IBLT 5CCKH 1MAJA 1OGTA 1ZHNB 4JY4A 3SGJA 4XTRC 2BVOB 1NMCC 2AEQL 2UZYB 3M17A 3V0WL 1IC5L 5IBLC 3SQOL 5DUPH 4JZJC 3BGAA 5LG1A 2CIIB 4C58B 4JHZA 3U7WL 1QHOA 3LDBC 2EDFA 2UY6A 2FB4H 1MUJA 3HUJF 3HR6A 2RAMA 3FOLA 2IQAB 4M62H 3RWJA 1PLGL 2G9HA 4J3OC 5DD1H 1TETH 2P24B 1HINH 5T1DL 4GSDL 3MRGB 5C86A 3AB0C 3OWEA 3OAYK 4ZXBD 3G6JF 3TT1H 4TTDC 4L8DA 4K3JH 5FGBC 1KGCE 1GAFL 5DGQA 2VH5L 4FQXC 4R2GC 1JPSL 3ARBC 1N8ZA 4KROD 2F74B 2Z8SA 4I8DA 2HT4C 5J6HA 3RTQC 4JJHA 3IU3A 5D2NE 5C2BL 2K7PA 5CBAB 3D18B 1ZT1B 1DBAH 3QAZB 5GHWH 2DLFL 1UYWH 1OAKL 1JF1A 3T09A 4KU1A 1RUAL 4K7PL 4Z7WB 3MLPA 1EGJL 2NNAA 3H3KA 3J7HA 4X6BB 2NQCA 4GAFB 2UWEE 3VWJC 5ISZB 3RWCA 4MSWA 3C08L 1OAXL 3ULSA 2P44B 4OFIA 3ARGA 5I19L 1KELH 1KSRA 1M7IA 3RIFK 4OZHA 3NIDF 3CX2A 3KPSE 4K23H 1MLBB 4LGSB 4KY1H 3L3OB 4F7EA 3UJJH 3AREB 5J6GA 4YHMH 1INQB 1KCRL 1ZTXH 3ILPA 1AFVL 2VZVA 2IGFH 4JRXA 1CICC 2A83B 3FOMB 1ZGLB 1U8QB 4NRXB 2WWMD 2AXHA 1P5VA 1T3FB 2R1XB 3UTTA 2DLHA 2P8PA 1TENA 4GG6F 4K3EH 1WV7T 3OPZL 4M4RA 5ID0A 4QGTA 2EKSB 1S9YB 3OX8A 1MFAL 2D31B 3BUYB 2BSTA 2EEAA 5LQBL 1BZ9A 1SYSB 5EC2A 4Y5VB 2P5ED 3VFTA 4LSDA 1GGCL 4JFZH 1BVLB 4WFGD 3ARVA 3FQWA 1BPVA 5JIIA 4GBXB 5BV7H 3GB7B 1QQDB 1AGDA 5D1ZC 5ADPL 2C26A 3MNWB 2PO6A 2OSLB 1XGRB 1AO7B 1NGZB 1OGAA 5EN2B 4Q9RL 4PJ9D 2NZ9D 3MBEB 1JTOA 1I9IL 3VXSB 4MNQE 4UTAH 4ZXBC 4JE4B 4H1LG 4M61B 3RWHB 5F7KC 2FL5A 3FT3B 3SE4C 3LQZA 2WP3T 5FO8A 4G5ZH 1OP3K 5CP7A 3QIUC 4JANB 5DJDA 4QTHB 2LTQC 1A1MA 5GGUA 2QHRH 4XPBH 8FABB 4H1LB 4WI6A 3I50H 3MACL 1KJ2B 3EYQD 4G8GB 2XV6B 2AJ3A 4I3GA 4HS6A 3PGFH 4G42A 1GGIH 4GW1A 3FFDA 4OKVB 2VLLA 3JV4B 2R23A 4MJIB 2Z93B 5F9JA 5FDWB 3M1BA 2X4OA 3TWCH 3BSZH 4BK4A 2ZUYA 3P73A 1VENA 1NCUA 3S7GA 5HHNB 4G7VL 1CFVH 3VXRA 4BYHA 3H3BC 4POUB 1U8HA 5C0CE 4ODSH 1UH2A 4WI7A 3C2AL 4WUUB 3OKKA 3HNTL 1UXSB 2DL2A 2OM5A 2X4UA 4QF1A 2WSKA 2F53D 2DI7A 1KG0B 2X7LB 4XCNA 2BNUB 5DURD 1T2QH 5FUCC 2ITDB 2Y9RT 2HLFC 5E56A 1FL6A 5DT1L 1DEEA 4HFWB 4ZTPH 3D48R 4X7EC 5IWLC 3JV6B 4P57B 5LGHL 1CVRA 2W65A 3TBYB 4PG9B 5F88A 3SDDB 3G5XA 1T0NB 1YPZB 5D1QC 5D7LA 5E2TH 2ZG1A 4JY5L 4G8FB 3CK0H 4K3DH 5BVJB 1T1XB 3V7MA 1WAAE 3KDMB 4EDXA 1QFWI 1DR9A 3HG1B 4LLUA 4P4RA 3U0PB 2AAVA 3RJDA 4JVUA 4PJ9C 2NZ9C 3B9AA 3IAGC 1M71A 1RIUL 4XPGH 5D96C 5MEQA 1MIEL 2ATPB 3KLHD 1PJ9A 5KSAB 1QLEH 4WO4C 4HUKB 4LSVH 4JM2F 4J3UA 1XMWA 5I9QB 1YY9D 4G8EB 5CJQH 1OSPH 3DRQB 4YBLB 1C12B 2B39A 5HPMA 3D39B 1BJ1H 2BX5A 2JELL 4JPKL 1P4BL 3O4LD 3S5LG 4ZPVA 3MV7B 3WDHA 1YMHA 4AEHL 3QUYD 5CJOH 5DUMH 4P3CH 4OCYH 2P5EE 3X3FL 1H0DB 5E6ID 2OJEB 3MCLL 4GLRH 4U6XB 4XI5C 5F21B 1I7RA 4WFGE 5IIEA 4HUVA 4RDQF 3WS3A 1CF8L 3HZVB 5EOTB 1FCGA 5HY9B 4UU9B 5ADOL 5I2IB 3B3IA 4L3AA 5IEKB 3VFSA 2HJKB 1K5NA 1MFBH 2WIMA 4JDTL 3GGWA 2ZUVA 4WCYL 2RCSL 1ZK9A 1KTRL 3FAWA 1KCUH 2BY0A 3TO4D 3SKNB 2Y72A 1FN4A 5EFIA 1GHFL 4U31A 3BEVA 5I16B 1JNLH 2HWZH 1Q9WB 2AKRA 1C1EH 5HHMD 3TO2A 2N56A 3LKPA 4X80L 4YDKL 3GSVA 4LCWD 5MERB 1U41A 3HMWH 1NMAL 1U3ZA 5I18H 2HFEA 3L5XL 2DQCH 5FYLH 2ADFL 4X99B 5DRNA 2NY0B 3BJLA 1FORH 1XR9A 2BJMH 4PBVC 2K1MA 1IEBB 5IHUL 2WAHA 5FYJU 3DX6B 5D1XD 3BZFB 4M6NH 1A14H 4YR6B 3U0WL 4EI6A 2XACC 3BGFB 2VDKH 3QIWA 1EEUA 1RVFL 1VERA 4DN4H 3HRPA 1A3LH 4L4TB 2GAZB 4U7KA 3MRGA 1HZHH 4RFOL 4KTDL 4NZTL 3EOYG 1LO0L 3ORJA 4NZRH 1UZ6F 1Y0LB 1ZE3C 1SM3L 3SDAC 3B2VH 3HMXA 1YY9C 4R26H 3OKNB 3CZJA 4HWEL 1DZBA 3GO1H 5HBBA 2DWDB 1CGWA 2FX9H 4GKZB 5DK2A 5ALCH 4TVSa 1UCBH 4OGXH 1YDPB 3QUYC 4DJMA 3MRJB 4OCMC 1MCBA 1ZT1A 3O81A 2H6PB 1IZKA 1MWAB 3MA9H 2BVQB 2PYEB 1QKZH 1GZQB 4I5BB 2C1PA 1DFBL 4LDEB 5EUOF 4XAWL 3WLWC 2Q8AL 5T3XH 4EN3A 3RNKB 1ZA6B 2X70A 4PLKD 5ESVB 3HZKB 4R4FL 5F97E 3PABA 5F7UA 5HHOB 3QFDB 2X4RB 3Q0HA 4OZ4A 2DQGH 4L4VD 1MLBA 2FD6H 1WIPA 5J8OA 1IGFL 3AREA 1KUMA 1INDH 4HK3J 1K9TA 1WICA 4JKKA 4FQQB 3S35X 2A83A 3FOMA 4POZD 1U8QA 1ZGLA 2R1XA 3FFCD 3O4LE 1FFOB 1NGWB 3B83A 1IGMH 3GSOB 3PL6D 4GG8B 2YD9A 2EYRB 3QNZB 4IIQB 3H9YA 1S9YA 2ICEB 2ZUUA 1YN6A 4R9HA 5C08B 1IT9L 4TUJB 3QUMH 5EORH 1ITBB 2CDGA 4ZOEA 5C0IB 1SYSA 5D1XC 2XZCH 4Y5VA 5C0EB 3NPSB 3WS6A 4RGMB 1BVLA 1IJ9A 3JV0A 4RGOH 3K80A 3FQTB 3HRZB 4WTZG 2G5BA 5DI8A 4XH2B 1I3RA 2Q3ZA 3GB7A 3QB7C 3RQ3A 1UVQB 4OZIF 2OSLA 1XGRA 15C8L 4UUJB 5EN2A 2VXUH 1WTGT 4H1LH 1DN0A 4X4XA 1KJ2H 3BMWA 4LCWE 2YPVL 3IDGB 4X9IA 1B2WL 4PG2A 4UDTA 4E41D 3QUMA 3UYRH 1N4XL 5E2VL 3ROOA 3A0OA 2P42B 5D7KE 4ZAKC 1M7DA 5IT2H 3VI4E 2WK2A 1L4IA 3MRBB 5CSBA 4Q74A 4Q2ZB 4ZO6A 5D2LF 4KRPC 5I73C 4QTHA 3NH7L 1SYVB 4B7IA 1JRHL 4PJ5A 3EDEA 5BRZB 1E28A 2CKBL 3ILQC 4D3CL 8FABA 4GXVL 1C5BL 3LRHA 5AD0A 1YQ2A 5JW4R 2GJZB 2WINB 2DTSA 4NO5B 4OGYH 4MJIA 3UC0H 3PQYA 2Z93A 2MQCA 1I9RH 4XCFH 3WIHL 3BDBA 3D3VA 1OAUH 5DRZB 1MAMH 2X41A 1OD7A 5L7XH 1SQ2N 4XWGL 5EWIH 5EO0B 1ULVA 4HFUH 2CRMA 2DBJA 1G7JA 1Y6NR 8CGTA 3G9AB 5KVFL 1A21A 3FJTA 2BNRB 1YJDC 1UXSA 4P48A 3TNMA 3ULUF 4WU5A 1WZ1H 4NIKB 3OF6D 3O4OC 2X7LA 1JGUH 1MREH 1NCWL 4J8RB 4BFBD 3QCTH 2ZUWA 5SWZB 2VDPH 3GMNB 2ZUQB 3PL6C 4IDLA 5FUZL 4NRZA 4PB9H 1DQMH 1UB6B 1X5JA 1QLRB 3DURA 4P57A 2I9TA 1CL7I 5JIPA 3SDDA 1OARH 2PYFA 1T0NA 1YPZA 2EC9T 3A67H 1DBKL 2BSED 1A7RL 1JPGA 3DXAB 3TA3A 5CKAA 4X4YA 2HRPH 4LKXB 4XCEB 1Q94B 4OZGB 5BVJA 1T1XA 2W0PA 4AIZA 3DO7B 1L0XA 1ZT7B 4X9HA 4IMLB 2GSIA 2NY3C 4L4VE 3QH3B 4XPAL 4I0PD 3W9EA 4QRQB 4OD2A 3NFNB 2B0SH 1R3HA 4D94A 5LAXA 2OP4L 1GGUA 3HE7B 5DJAA 4FQ1L 5JOFB 5KSAA 3DX8B 5EZLA 1SJHA 3FFCE 1U2CA 3QHFH 1KEMH 2YPLA 4NHUB 5FA3A 2YZ8A 2A2QT 1TTUA 4P9HL 1UJ3A 4ELKB 3DRQA 2GITB 4HH9A 3D39A 4G8IA 4P5KB 1MJ7L 3JWDC 3VD4A 2UUDH 5B21A 1D5MB 4XC3L 1S7RB 2E6QA 1CDGA 3WFCL 5CZKA 1CTNA 3PHOA 4KHXL 5TDPB 4U1KB 1GOHA 1QFWL 3THMH 5K9QG 4X83A 2JTDA 3SCMC 4Y2OA 1BIHA 1OB1A 5I1CL 5K59F 5DD6B 4P23D 1U8MB 3O3UN 3S5LA 4JRYD 4OCXH 5EBLA 3WJJC 1S7WB 4FQLH 3TVMA 2P45B 4E41E 2E7LA 1CE1H 2ICWI 1NBQA 5B3NA 3F5WB 5BZDB 4AEEA 3RY5A 1PZUB 3LV3A 1TNMA 1BOGB 1JZ8A 2FJHB 4DZBA 2NX5B 4PGBA 1FO0B 1YN7A 5IVXE 1ZWIB 4JN2B 2OL3L 1NUDA 1P7QD 5F7EL 1MFCH 4ZO9A 4PGCA 3WSQH 4IJ3C 3H42H 1CK0H 4HIIA 1IEBA 2HVKB 4Y1AA 1NGPL 3QBTB 3MYZA 3KJ6L 3TN0A 3H8NA 4MDJA 2F54E 1N59A 4MAYB 3S37L 1MJ8H 3EJYD 3RGVB 2OXGA 1CDCA 4L4TA 3HC0A 5GRYA 2GAZA 3MJ9L 4PGJA 1MWAH 4G6MH 1Q38A 5DFVD 5E08L 3KPOB 4KI5D 3B9KD 3RL2A 1NDGB 3RVUD 1Y0LA 4MJ5B 4FA8A 4IS6A 1Q9LB 4DUXA 3ARYA 3W0WB 3QRFM 1BGXL 3QI9B 3OKNA 1KB9K 3LKNA 1EVUA 3U0TB 3PHSA 3RKDC 4JO4L 3C9NB 3U9PH 1BVKB 5DDHB 1YDPA 1Q72L 2XWJB 3MRJA 4KXZH 5CJ8A 4KV5E 1MWAA 2WANA 5L0QC 3U6RB 3FL7A 2CJUL 3V6OC 1AY1H 3P0VH 1F2XK 4MA7L 5T1LB 1ONQA 4YHNB 1K4DA 2IBGA 2UV3A 3BD3A 5ESVA 1HSAB 3B9DA 1H5BA 5D5MF 4HJJH 3K2MC 4YE4H 5HHOA 3QFDA 3MLTB 5TQ0L 1W8OA 1B6DA 1CXHA 3WXVH 4AM0A 1K3IA 5I71B 3P11L 5CSZB 1U8KA 3L5WB 3QNYB 5TPWL 4Y4HC 4QO1A 3WNOA 3ARFC 2FH8A 3E3QC 3KLSA 5GS0C 3U2SB 1AKJD 3AS0A 1FL5B 1H8NA 3VGAB 4HWZB 4DN3L 4IRJD 5K9OA 3TCLB 4P2OD 4XPFH 1FFOA 4GG8A 4HK0A 4ZD3L 3QNZA 2FBOJ 4IIQA 4ZS6D 4BUHA 5L6YL 4LF3B 1OCWH 2ICEA 4Y5YB 1QG3A 1RPQA 2EYSA 4DTGH 2VLKB 2EIZB 5C1MB 4M4PA 1T5XB 5IOPA 3KYOB 4Z7UE 2OX5A 3LEYL 2RFXB 3O3BA 1I8LA 4YHOL 3HRZA 5IG7A 3I75A 3O8XD 2CIKB 3WN5B 1MCWM 1EO8L 4OCSL 4Y8AA 1UVQA 1FZMB 4NKIH 5DQJB 5FO9B 4AQ1B 4C83B 1B0WA 2VLJE 2FHBA 5E5MB 3WFBL 4EUPG 5IB3B 5D6DA 5DFVC 3CPLB 2X89D 4JO3H 4NM8L 3B9KC 1QYGH 3ZYIA 3RVUC 4B50A 3BZ4B 4HCRL 1FG2A 1F00I 2QQKH 2W1NA 5JORA 3FZUD 3OQ3B 1IC4L 3RPKA 2ZKHH 3IDXH 3MRBA 1T03H 2P7TA 3ZDXF 3BP4B 5EOQH 2FATH 5FB8B 4GRLA 1OSZB 2ORBL 1SYVA 4GFTB 1WQVT 3MYJB 4EUPB 3IGAB 5F1NB 4JFPA 5TDOB 4HAGA 5CEYB 3UZVB 3UTSA 1QBLL 2NYYC 1D9KD 3MV9D 2R8SH 2GJZA 2X1XR 5J11C 2WINA 5KS9E 5DVNA 4ONFL 5DRZA 3HPLB 4MD4A 4M9OA 3VXPA 3BOVA 1T0PB 3UYPA 3EDKA 5BXFB 4S11A 2NY1B 5LBSL 1FLRL 4KI5E 3BDYH 3RJQB 4Z7NE 4PRBB 3OZ9H 1DUYB 1S7SB 1TTGA 5B8CC 2OTPA 4JCMA 1EUTA 5HVGB 3JUZA 1RJLB 2MHAB 4PBWD 1MH5B 4Y4KA 5C0BB 2E7HA 1BJMA 1F6FB 5DK0B 4HUWB 4IRJC 4OLUL 3T3MF 2VLMD 4Z7WF 1ACZA 2F8VA 4P2OC 4J8RA 4QTIH 4YO0A 5C6TH 2JCCA 2YKLH 4FFWD 2R0ZH 3LQAC 2GYSA 4ZS6C 1EZVX 3VJ6A 1Z2KA 3C60A 3QCVH 5J12B 3TZVC 1QLRA 2OR9L 4Z7QE 4QHMB 2DDQL 5JPNB 4K55A 1T5WB 3PNWB 3IFOA 3DXAA 4YPGB 3QDJA 4LKXA 1HIML 1Q94A 4BFGA 3O8XC 3DO7A 3V5HA 3OKYA 2XI9A 4UT9L 5ACLA 1ZT7A 1IM3A 4IMLA 5B4MD 2CRYA 3T2NL 3PWVB 3QH3A 4YEFA 4QRQA 4G6KL 3NFNA 2NY2B 1EGJH 1BLNB 1N64L 2R56L 1R0AH 5EPMA 3T0WA 4YDLC 4M7LL 4PJ7B 5DHXB 4NBYB 3DX8A 4OLWH 1N6VA 3FZUC 4YK4B 4HWBH 1YEEL 1YC7A 3QHZL 4KUZH 2P5WD 3H7LA 4LNVA 4XAKD 4UQ3B 4P5KA 1CFQA 3C6LD 4G3YL 4H8WL 3IFLH 1CL7L 3HFMH 1WSST 3I3BA 3EYFA 1H3PH 2J8OA 4YDVA 4OCWH 1HHGB 3WXWL 5KVDH 3BQUA 3GM0A 1KIPA 4LCYA 2JB5H 4W68A 5FCSH 2W38A 1D9KC 1HEZB 3VDCA 1BMGA 2VDLL 3ZSSA 1H15A 1R3IH 1VEOA 4KJQD 1FO0H 1T1ZB 1I1YB 1E4XH 1X7QB 4HWBA 3SO5A 1U8MA 1NFDA 4PJXE 3QFJD 1K8IA 1RMFH 4HIJB 3I02B 1EEQA 1S7WA 1WBXB 2EDHA 5C09B 3EBAA 1BBDL 2NY7H 3GSWA 4UTBH 4HHAA 1QD0A 1AE6H 5KVMC 4F58L 2A9NL 4FFVD 2HMID 1Q1JL 2FJHA 4PJ8B 4X8JB 1MQKL 3DX9B 1MHCA 1FO0A 4L1DA 3MXVH 3DUUB 3NZHH 4Z8FH 1XGPB 4FFWC 5IQ7L 2VZTA 3UJIH 3LN4A 1FL3B 2B5IB 2HVKA 2JLLA 3RL1A 3N85H 3MXWH 3Q6GL 4LU5H 1A7NH 4RBPH 4BZ2H 2JK5A 4X6FA 4ZFZB 2YD2A 2PW1B 2KH2B 4BZYA 4RFEB 2Z8WC 4YAQA 3BRDA 1KXTB 2NY4B 4EOWH 5LXGH 3I6GB 3QWRD 2A0LC 4U1HA 3IKKA 5I8KH 5DVLA 2VAJA 4NC1C 3AROA 4M1GL 3GMPA 1AGFB 5CGYD 2VB5A 1W72L 4GRWE 1AR1D 3O3DB 4M5ZL 3VFUA 5GSVB 2FJFA 1BFVL 4MJ5A 3WFDH 1MCDA 5E5UB 2HLAB 1UWXH 2VLME 3PJSB 2AK1H 1G7MB 3G6JE 3MPCA 2HJFA 3W0WA 1I1FA 3TJEL 2BFVH 2XXCB 1CXIA 2FNBA 3UPCA 2FECI 5TE7L 2H2SD 4NKMB 3F7VA 3C9NA 1WZMA 2LU4A 1T04A 1IEAB 4FP8L 5I8OH 1KTLB 4BFIB 3HNTH 3BN9D 1J1OH 1I3VA 5D6CA 3GI9H 3QDMB 2AEPL 3MLUL 4NQDD 4P49A 1J1PH 3GSNL 3VXQA 3MQIA 2BDNH 5C0GB 2ZP0T 3MNZA 1P4LA 2OCFD 3DO3A 3GKZA 1HSAA 4ODWB 5I1JL 4XMLH 5E1AB 3SY0B 4PJEB 4AQOA 4DCQB 1CI5A 3MLTA 1CE6A 5HHPA 5IJKC 1CU4H 4YHZH 3MR9B 3L5WA 3QNYA 1RURL 4FG6D 1RUQH 1NMCB 1DQLH 5D93B 4ZDHB 4JZJB 3U2SA 1MCOH 2P5WE 4XAKE 1J0KA 1AGBB 1FL5A 4HWZA 1U3HB 4ORGB 1AD9A 4ZFOB 3TCLA 3ARDD 3VWKD 4FHBD 1FQ9C 3R0NA 2IFGA 1MCCA 5C9JB 1IC1A 4GMSH 3V7AE 3VFGH 1NC4A 2QR0B 1FZKB 4LF3A 2LFGA 3HE6C 2PTVA 1XGTB 4LP5A 3N0PB 1MCPH 4FQIH 4DGVH 2FCBA 3KYOA 3TYGH 1HHHA 4X6EB 2C3VB 1H3VA 4YXKL 3AB0B 5BO1L 5AZ2L 1NGXB 1W8NA 2CIKA 2A6DB 3QFJE 2VABB 4TQEH 1I3GL 3GSXB 3KPSB 5DQJA 5FYJH 1XF2A 4EUPH 5FO9A 3M8OH 1UM4H 4FQXB 4LCIL 1F8TL 5T5FH 3WLBA 5E5MA 4R2GB 3ARBB 3ARUA 1A47A 4OTXH 2QEJA 3P0GB 2DD8H 1AR1C 1QOKA 2VQ1B 5DMKA 5I17B 1RUKL 3BMVA 3RTQB 3DVGA 2EZ0D 3EYOB 5GGSB 4NWUL 1MVFA 3B9EA 3CFDB 2GQHA 3MLXL 2DQJH 4M03A 1FVEB 2RHEA 3QRGH 1IKNA 1S9XA 4OIIL 5FB8A 3JTTB 4Y89A 1OSZA 3S98A 4XVJH 2PKDA 5F1SA 1KBGH 4EUPA 4LHQB 4K94L 5F1NA 2XNAA 3BVNB 3BWUC 5HSFA 4I3SH 4OF0A 2CLZA 3DX7B 1UCTA 2EE3A 3Q3GA 3QISA 3U9UA 4YGVB 4ONOA 4LSRH 1U95A 4FQCL 4O2FB 1F02I 5BXFA 4MNQB 4UIKH 2MCPL 5FV1L 2XG4A 3VMNA 4NZUH 2R0WH 3X14B 4WJ5B 2ITCA 3H9HA 3VD5A 1TJIL 3N1MC 4EXKA 4FG6C 3AU1A 4JKPL 1RJLA 2FJGA 3QO1A 2V17H 1E6OH 4LLDA 1QSFE 5DK0A 1RZ8A 4R90L 4QGYA 3LN5B 4NO0A 1PEWA 3JWOL 5KJRH 2QV2A 4N8CH 3Q5TA 3L3KB 5GQBA 5JPMB 4J3TA 2DTML 4NQDE 4P4KD 2DQEL 4QHMA 4Z6AT 3ZHKA 1ZVYA 3BH9B 4LIQH 4N0YH 3SOBH 1NC2A 5D1ZB 3SO3C 4YPGA 4JO1L 3SDXB 3HI6L 1G0DA 2VAAB 4ZXBB 1A7PL 4RGNC 1DSFL 4QCIA 2NW3B 4TULL 2ICWJ 1UA6H 2LU7A 5DS8A 2R4RL 1BX2B 4O02H 3BP7B 5C70A 2UVEA 1BLNA 2AK4A 3KPTA 4KROB 4DKFL 1MPAL 1TITA 4APQA 2DM4A 3I2CH 4HEPG 4Q0XL 2Y5TB 1MHEB 2LTQB 1BEYL 5F93C 3VG9B 1BQLL 1ADQA 2XA8H 4JPIA 4NQSA 4UQ3A 3ZKXC 3OJMB 3CLEL 2AJVH 2VXTH 1T0MB 3O45B 4NKDB 1NLBL 1HHGA 2V6HA 5H37G 5L2KD 2GEEA 5F6IC 2WW8A 2MMXA 1HHJB 4RISH 4GUPA 1UZ8B 2F8OA 2WIIA 4J12A 3U48A 1R3KA 1HEZA 2O61A 5E94B 4M5YL 2VLRA 3VGFA 2Y07H 5M95B 2CSPA 3UTZB 1F3JA 1KJ3H 1BHGA 2O5XL 3CXHK 3QQ4A 3NIFE 2GW5A 3LB6D 1X7QA 1CDHA 4C55A 4OGAD 4FFZH 5T1KA 4KVNH 3S35L 2R0LL 2FR4B 1Q9KA 3I02A 1WBXA 4PRAB 1MFDL 5C09A 3L3DB 2N7BA 4PV8B 5JR1H 3TNNB 4NKOA 5C0AE 1OM3L 1IVLA 3G6DH 2QTEA 4V2BA 3VRJA 3UROR 3DX9A 2YPKB 3EYSL 1FRGH 3DUUA 2X4SB 3TV3L 1XGPA 4ALAL 1SBSL 4HKXB 3NABH 4XVTH 1ZANL 4O5LL 2I9LB 3C5SB 5TFSH 3RU8L 1U58A 3K74B 5IFAL 3EZ8A 3TEUA 4DAGL 4OJFL 1HWHB 4XBPB 4PJ9B 1BVZA 5E9DE 1X5XA 4PJBB 4U2ZA 4NCC2 4RFEA 4CNIA 2VL4A 3MODH 5FM5M 5D96B 2IPUK 4M43H 1C08A 1DQJA 1QBML 2YA2A 3T2OA 4P2QA 3ZKMC 1SMAA 4WEBH 3F58H 4Y16C 2APBA 4HXAH 4LASL 1JFQL 1HI6B 4Z7VA 1AGFA 2ARWA 4KDTC 1CIDA 1LK2B 1NCCL 4PLJC 1I1AA 2J6EL 3O3DA 4MMZC 5GSVA 4PFEA 3ARZA 2HLAA 2C7UA 3AXLA 1G7MA 5TE6L 1RHHA 2D3VA 4K2UH 2VXSL 1INEL 3FCTB 4G43B 5GZND 1S7QB 1C5CL 1DQQB 4NKMA 5KN5B 3BE1L 4OZGF 4YFDB 3RWEB 1YECL 2IEPA 1IEAA 1JZ2A 2B7DT 4QHUB 5HJ3B 2IPTH 2XTLA 3HA0A 1F58H 3VD9A 3QDMA 1XGUB 1J86A 3NVQA 5FUOL 2NR6D 3C6SB 1MCRA 3UP1A 5GZOD 3ARGD 3WIIH 5EUOE 3ZE1E 3LB6C 5EZJB 5E1AA 1X4YA 4PJEA 1X4XA 1H8SA 4GAJL 2VKWA 4YIQA 4OGAC 5GJTH 4UQ2B 2F53B 4XVSL 5JXAH 5DURB 3D69A 5DJ0A 3MR9A 1YEIL 2M2DA 3CLFH 4JRXD 3TLRA 3QUXC 4JVWA 4D9LH 5ICYA 4ZDHA 3UTTD 5A16A 4HPYH 2D7TL 1AGBA 4HT1L 3TPUB 1CG9A 2VO5A 1NAKL 5C9JA 4AL8H 4LDLB 2QR0A 1FZKA 5HGGS 2PR4H 5GGSY 1GSMA 2N1KA 2BC4B 1A7QH 2QQLL 2QJDA 1YZZA 3GBMH 1T21A 5I1KL 3EGSB 3QIBC 4U1MB 3MRMA 3RFZC 4P9HH 5KSVA 4PUBH 5L2JA 1OTSD 3T3PE 2PO6D 1DL7H 2A6DA 2X9XA 5DYOA 1OGAD 2VABA 4DVBB 4TSBL 3L9RA 1MCEA 3KAAA 4OI8A 3WFCH 2AJXL 5LCVL 4ETYA 3Q1SL 5IKCB 2IADB 1CFBA 5KSUA 3ARBA 4N5EC 1MCFA 1GPOH 4ZFGH 4XHQA 4OD3L 1MI5A 1MAKA 4PYGA 1EFXA 4PRNB 3RTQA 1CFTA 4U6YA 3U4BH 3CFDA 3QUYB 4M1DH 1H3UA 5GZNC 2ZSVB 5BQ7B 1XCQA 3EHBC 2AXFB 4HJGB 2F58H 3JTTA 1GZPB 1CT8A 2R69L 4KDWA 4QHKJ 3VWJA 3CDGA 1EJOH 2DM2A 2R0KH 4G7YL 5IFHH 2NR6C 1YEFL 5BVPH 4UT6H 1U8IA 2X4PA 3TO4B 1VGKA 2ZOKB 1QNZH 2ZPKH 3ARGC 3HB3D 3VXRD 1RU9L 4WWKA 4LLVB 5HHMB 5F3BB 4O2FA 5KW9L 4PTTA 5CZVL 2DQTL 3B6SA 4LCWB 1LO5B 4GOSA 2YS4A 4MWFA 1CICA 3OJDB 3KPQB 2AVGA 4WJ5A 2WUCL 5DMIL 4XCCH 3ZKQD 2X05A 1L7TL 1SEQH 2AGJL 1X5KA 2AXJA 3GJEB 4HZAA 4NGHL 3HAEG 2E9WA 4WUKH 1LE5B 2C1OB 3FB5B 4XCYA 4BH8A 3IFPA 2AJYL 5D1XB 4XBEL 5HI3D 4CU7A 3LY6A 1N5AA 2HA1A 4MXWH 3LIZH 5D7LD 5T1MB 5JW3L 4J3WA 4PS4H 1E6JL 3ULVC 5D1ZA 5C0RL 1CDUA 4RRPG 3MROB 3VCLA 3HAEB 4FZ8L 3NFPB 3SDXA 1A3RH 1AXTL 4Q6IC 1CLZL 3O2DL 2A6IA 4JM4H 2ICWB 2NW3A 4WRLA 1Q0XH 4K8RC 2BRRL 3VI3E 4ZAKB 4OM1L 3FAXA 3OKOA 3BP7A 3I6LD 4JRXE 5DA4A 3FB8B 5MHSD 4WFHD 3D0LB 1MFEH 2EIDA 4R4ND 1ZVHA 5HHXL 5J56B 3QIUA 4KRPB 5I73B 1CGSH 4KAQH 1VDGA 3RIAK 2B4CL 3SGDI 1U8OA 3LMJL 3TBTB 1F45A 3PWLB 2VDNH 5D71H 4XWOC 1JGEA 1I9JL 4H0GA 4FQJH 5H37H 3O45A 3OL2A 3ZHDA 4G80A 3RP1A 4BK5A 1DBML 1Z0MA 4LVOC 1G1CA 4LEXH 1N3NA 3QCUL 4D0CB 4I48A 2VE6B 2Z31C 2EC9U 3RWIA 5E94A 5JOEA 5DGRA 1RFDL 3UTZA 1OGAE 3TBWB 2WQRA 4L4VB 2GCYA 3KYKH 3O2WH 5C8JB 1G7IA 3HB3C 4XNMB 3ZT6A 1MF2H 1Z5LB 4JFXA 5F96H 1XF5B 5BOPA 2FR4A 3O4OB 4HC1H 2V7HB 4ZO8A 3HS0A 1RD6A 2HP4A 2J5LC 3FFCB 3V4VL 1G9NL 3H6JA 3MCKB 3PL6B 5JNYA 5DFWH 2XXMB 4G6JH 5IMLB 2LVEA 1F42A 5B3JF 4ISVA 5IWLA 5CD5D 4JQXC 1OAZH 4C54A 1OAYH 1MY7A 3CSYA 2IQ9H 1IQWH 3QXDB 3NZ8A 5C0NC 2ZCKH 5D1QA 3ZE2F 5KVEL 2AV1A 4LPUA 3T1FB 1U8LA 5AWNL 4HKXA 1RUPH 4ONGL 1WK0A 3C5SA 4HC1A 1KB5L 3O0RL 1IC4H 1EA9C 3QIWD 2NY3B 4KMLB 3R8BB 4XNZB 3ZTJG 5DRXB 3VXRE 4PJ9A 2E7BA 4PJBA 1MCIA 5CBEB 3BH8A 4XNYH 2XZAL 1KPVA 3GSRB 4E41B 4WO4A 1A1NB 4XMPH 4S1DD 3RX8A 1U93B 4ZUUA 2LE9A 2QQNL 4OT1H 5F9DC 1HI6A 4JN1L 2C3HA 2DQHH 2UUDK 2J4WH 5CEZL 1RIVH 1LK2A 4PJGA 4R4NC 1RQ5A 3ZL4H 2DWEA 2IFFL 5IVXB 3MRDA 2V5MA 5ICZA 2VXQL 3OKMB 3KLAA 1KN4L 5J3HC 3GHBH 1CTOA 4G43A 1MY5A 1S7QA 3KPNB 5KN5A 1NCTA 1XGQA 1A8JH 1IILE 1MHPL 4E9LA 1HILA 5D7LE 3RWEA 4X5WA 5EZIH 4GAYA 2EEDA 5HDBF 1XIWA 3P9MB 3SCMB 2YK1L 3VG0H 5DJXB 4YPJA 4GS7C 3VXNB 1XGUA 1A2YB 4HKZB 4EN3D 5ID1A 1URLA 4PJ7F 2BNQA 1K6QL 5LGKA 3T0XA 5IBTL 1YUHB 3OAZH 3EYUH 3I6LE 5FGSA 1W0WB 2V5YA 5JXED 3MRCB 5MHSE 3QEQD 4WFHE 4S1SH 3ARED 4X7SH 5K33A 2IANA 5IB4B 5HI5D 2VZOA 3QDGA 2JB6B 1BM3L 2OS7A 1JWSB 1RZKL 2EDQA 4IJ3B 1I3UA 4KRLB 5D9SB 4JZOA 2H9GA 4MQXC 4O51A 4NJAH 4OD1L 4LCUA 5L9DH 5CD5C 5IEHB 1S3KL 3ABZA 5T3XD 4GW5B 1WC7A 4P46C 3TPUA 4D0BA 5IFJB 4M1CD 4OGZA 3G9VA 1OT1A 2I5YH 3DMMC 2MKLC 4J1UB 4PTUB 3QWQB 1R6VA 4UINL 4NFDA 3DROB 1IGTA 5FGRA 1JUFA 5D8JL 3PWNB 1YEEH 4JHAH 4H26B 4I0PB 1J7VR 1KIQB 4LLMA 1PD6A 1CL7H 2X1QA 2YUVA 3VA6A 2HN7B 1KFAL 1QO3B 2IF7A 4YHLL 3SDAA 3KPPB 4S1DC 4TOYL 2O5YL 4L3ED 4MNHA 1S7XB 4W6YB 1UADC 2IADA 5HI4D 4JAMB 5T3ZD 1CGYA 3OAYH 5F3HA 3BZEA 2QADD 3FTGB 4DZ8A 12E8H 2B2XL 1F90H 1TZHB 3V5KB 2YWZA 1QRNB 5L0QB 5C6PB 5BQ7A 3H9SB 2XTJD 4I2XA 1N6UA 1X9QA 4NN5C 4WNQB 4PJ5D 1NKOA 2XQBL 4HJGA 1IAOA 4NO2B 5DZLA 1O0VA 4QYOB 3T4YA 2Z92A 4Y5XC 4Z7UB 2EXYD 3ZDXE 2DKUA 4CVZB 4O58H 2C4FT 2MSPA 2B1HL 3N9GH 4MJID 4JRYB 3PQYD 5DJZA 3D3VD 5FYLE 1JZ6A 3MRHB 2J88H 1FC1A 1ROWA 43CAB 4KTEL 1FH5H 2VN4A 4OF8A 5F3BA 1KPUB 3MLRH 1YYMH 5JXEC 3L3HA 2FYYB 4DGYL 1OW0C 2APXA 3EJJX 3UBXA 5BW7C 3HAEH 1P7QB 4ODBD 1A6UH 4NUGH 3U7YH 1PSKL 4ZO7A 1RUML 3BHBB 5DMIH 2LU3A 3S9DB 3FB5A 2WM0A 1JF5A 2YRLA 4WI4A 1D6EB 1EV2E 3T3ME 1F11B 4O4YL 4OFYA 4O2EB 1T22B 4R8WH 3TA3D 5E8DH 5FEBA 2FX7L 4LHUA 3BAEL 2SEBA 3HAEA 3NFPA 1WTLA 3HI1A 5DQDL 1T1YB 1IFHL 1FHGA 1CGTA 5HGDA 3H0TA 3W5MA 3B9KB 2NY6C 1LO4H 2A77L 1G7LB 3IU4L 1EAPB 1LQSR 3QUKA 2ICWA 2A9ML 1OP5H 2HVJB 4X0KB 4GQPH 3IJSB 5DJ6A 2FH6A 1ORQB 4ZAKA 5HI4C 3LZFH 4GRMA 5KSAD 5K9KA 2NCMA 2WMPA 4JHBA 5IV2B 4CU8A 5K9JH 5I66B 4RRPA 2PXYD 2YPLD 1VCAA 5T3XE 2OLDA 5GRUL 2UWEF 4MLSA 1GGYA 5J9PB 3D39D 3HC3L 5D72L 1KNOB 3MRLB 1YJDH 4UAOB 4L5FL 1CGVA 4JKWA 4NKQB 3O11B 2VC2L 4RMVA 5J11B 2W07A 4LK4A 4X6CA 2MJWA 4FOMA 1YEHL 4ZUWA 3HNSH 4ZS7H 1J1XH 1QFOA 3DHMA 2F15A 4LGRB 2GFBA 2IALB 1D5BB 4JKLA 3SN6N 3FO0L 3MBXH 1GOFA 1VFUA 2DOCA 1B0RB 3LEXA 5I74B 3V6ZB 1NMBL 4JFYB 5B8CB 1HNFA 4BQ6A 3DSFH 4XNMA 2F19H 3TVMD 4CMMB 3EO0A 4DK3A 1AKJB 2WUBH 5JTWA 1I85C 5IP4A 4IRJB 2DQUL 2Y7QB 4Y7MA 4P2OB 4AY0A 1VFOA 3CMGA 2VOTA 1T7XA 4WW2C 5ILTL 3GKWH 1BZ7B 1CD1A 4PJCA 5DJCB 3N06B 2W9DH 3LRSA 4L29B 5BZWA 3FB7B 2V2XA 4S1QH 3TZVB 5KVGH 1MLCB 3PV6B 4XP9H 2XTJE 4LDOB 2Q86A 2HTLD 1EK3A 2NY0D 3ES6B 4BQBA 2WWKO 3MCG1 4QRTB 3OKLB 3IFNH 1X44A 4ZMAT 5EO1A 4Y1AD 4JPVH 4JFQA 3WO4C 3JWDH 2XZZA 4LRIC 3O8XB 3TA3C 4WW1A 1FGNH 3TN0D 4MJIE 4LCCB 5CCKL 4PIRF 3PQYE 5CWSA 3ZTJH 3D3VE 4N8VB 1JMXA 1KN2H 2GHWB 4NQXB 5MP6H 1KLGA 5DUPL 4QXGH 4L4TD 5CBEA 2FB4L 4YDLB 3GSRA 4OBSA 4LRNH 4M62L 1PFCA 3MUJA 5DD3H 3QULA 4YWGH 4ZTOH 1N7MH 5HDQH 4LVHC 5DD1L 1TETL 1HINL 1I7TB 1IGIH 1LO3H 2PXYC 3VFMB 3V0VA 5A43C 3NTCH 2A6KA 4CL7A 1XH3B 5EDXA 1TXKA 2R2HB 2MTPA 3F7YA 2VDQH 1D9KB 1UGNA 3KPNA 3MV9B 3TT1L 4F7CB 1YPZE 5EU3A 4W6XB 4K3JL 3WE6A 4ZQKB 4JKPH 4NNPH 3QUZC 3SCMA 1G7QA 3MLZH 3K8KA 5DJXA 1NH6A 1MJUH 3K4DA 3VXNA 4L9LC 2ZUTA 1JL8A 4I18C 3WJJA 2WBJA 4LLQA 2FGZA 5HHOD 3DVNA 1DBAL 5GHWL 1UYWL 3G04A 1YUHA 3CFEA 4GRWB 1YYLH 4NSKA 3D25B 1M6OA 2YPLE 3X12A 3DGGB 2JB6A 2FX8H 3D39E 4LPYA 1WGOA 3WIFB 1KELL 1HDMA 5D9SA 3IVKB 3HR5B 5IEHA 3X11B 4K23L 3MZGB 1KJMB 4P2RD 4RBPK 5EIVA 5HYJA 4KY1L 2YD8A 3UJJL 3MTRA 2A74A 4NYLA 3RDTC 4YHML 3JWNC 5LVEA 1ZTXL 3UJTH 4ZOAA 4J1UA 2IGFL 4ZUSA 3IXAB 4YZFE 3TN0C 3DROA 4QXTA 4YBQD 2EIBA 4LLAA 2FO4B 4K3EL 2J7LA 3DNKA 1KIQA 3D0VA 5C0JB 2COQA 5FV2A 3PP3H 4N1CA 3V7AG 1UWXK 4IHOB 3OR7B 1RZIA 2RBLA 5A3ID 4FQ2H 1QO3A 2J2ZA 2D7PA 4ERSH 1S7XA 4JFZL 4X9FA 3RNQA 4B7LA 1CLCA 1A7OH 4JAMA 4QEGA 2KPNA 4HG4J 5BV7L 3C6LB 1NSNH 1ODAA 4HUXA 4KK8D 2X2YA 5DRWA 4TPRH 1TZHA 1T1WB 1QRNA 1SEBB 1HOCB 3LD8B 5H35A 4GRLD 1O7VA 3BD5A 1P69B 3BP6B 5ERWB 4UTAL 3H9SA 3V6OA 5GS0H 4HQQH 4Y1AE 3I3EA 3OR6B 4NO2A 1J0ZA 3WFHA 3VFOB 4QYOA 3BP5A 3UTSD 1DQTA 3PHQB 5EO9A 4G5ZL 4RZCB 4CADA 3QFJB 4JRYA 4L4TE 4ODUB 5TQ2H 1KEGH 32C2A 4NQCD 4X6DA 2QHRL 3G5VA 3H3PH 1A9EA 2XA3A 4HX1A 1AQDA 1I8MB 4XPBL 4Y4HA 3NCYP 4Q9QH 3CCHB 3I50L 3AMLA 1DE4B 3ARFA 4Z5RA 3WUZA 4TVPH 4B41A 1LEGA 3PGFL 5CLWA 3RWFA 1GGIL 5FYKD 1HXMB 1CXEA 1F4YH 4Y4KD 1BFOB 4PJAB 4KFZC 3PGDA 1AIFB 1P7QA 3GMMA 3TWCL 3BSZL 4QRUA 3K3QA 1CFVL 3BHBA 1TCRA 4IRSC 4AEIL 1YEJH 3HE6B 1K2DA 4IRZH 35C8H 4ODSL 1KXQE 3VE0A 3C60D 1KV3A 2UYLB 2VDOH 5CJ5A 4RNRB 1JV5B 3U46A 1TVBA 5HD8C 3WNMA 1GGBH 4FZEH 5I8EB 5FECB 1KB5B 3QDJD 4YBQC 1SJXA 3DRTA 1MVUA 3QEHB 3T65B 5HHOE 1T1YA 4ZTPL 1A0QH 4U4BA 43C9A 4PPTA 4KDVA 4FTVA 3TH3T 1EAPA 4Q6YA 4X7TB 1IAIH 3IJSA 5E2TL 5I1LA 3MFFA 2MOVA 3UTQB 4Z0BH 2IH1B 4U1JB 3CK0L 4K3DL 1WJ3A 4PJFA 25C8H 5IV2A 1ES0A 3C09B 1WT5C 3OB8A 4AIXA 2Q8BH 5J9PA 1S7VB 1NBZA 1KNOA 3MRLA 5JW5B 1QZ1A 3O6FC 4XPGL 1RZGA 1TCMA 4NQDB 3AM8C 1NUGA 3BQUD 1BWWA 1QLEL 4PRHA 4LSVL 4IDJH 2LQRA 3N1FC 1HHIB 3LQAH 5CJQL 1OSPL 2FZ3B 3MRQB 5JO5B 4CGTA 4YBHA 2OTUB 3FHQA 3VFWA 4JFYA 1CZ8H 5CJOL 5DUML 4P3CL 4OCYL 1EHXA 3OKEB 2DBLH 4KUCD 3M45A 1F6AB 3MJ8B 4IRJA 1IGJA 3DARA 3ARDB 1ZA3A 4P2OA 4RAHA 4UILH 5F70A 3VWKB 4NUJB 5D7SH 1U3JA 1MFBL 2D0FA 4L29A 1J12A 4NNYA 3TZVA 3PV6A 3QQ3A 1KCUL 4JY6A 2BY2A 3EOTH 3SHSA 3VH8G 1JNLL 2HWZL 3SO3B 1C1EL 3UTSE 2VZ3A 4N9GB 4JFOB 3P4MA 1R3LA 1JGVH 3HMWL 4HUMB 3U1SH 5I18L 1JHTA 1HH6B 2GT9A 2W0KA 2DQCL 2NTSP 5TDNA 5FYLL 5GRXG 2R2BB 1B4RA 4RGNB 5EU4B 1AHWC 4NQXA 1UM5H 3TCXA 1IGCH 5D7JC 1FORL 4YUEH 2E27H 4JFDA 5DQ9B 3VI4F 2BJML 3DECA 3WKMH 4JM2C 3UTOA 5CGTA 2FO1A 4OKDA 2ID5A 4WGVB 4KPHH 4M6NL 1A14L 5MEPB 5FYKE 2A73A 4KXZI 5EUKB 3SKJH 2PTTB 3OJ2C 1MEXH 2VDKL 5I1HH 3BIKA 3CH1A 1XZ0B 1EHNA 1T7ZA 4XPHH 4F57H 4DN4L 1I7TA 1A3LL 2BVUA 3VFMA 2JCCE 4QT5A 5IB2B 2OI9B 1HZHL 4NN6C 3RIFF 5F6IB 4WTXA 5DJ8B 1XH3A 1ZHLB 1BQHG 5CHNB 3MV9A 1NJ9A 4N0UA 5HHQB 4KJYB 1XR8A 4F2MB 3DXAE 3QDJE 3ARSA 3B2VL 1RZFH 4RIRA 4R26L 5IB1B 1EEYB 3L1OH 1TLKA 3NAAH 3GO1L 3KWWB 1A64A 1DLFH 2OJZH 4MA1C 2FX9L 3T08A 5IW6B 5ALCL 1UCBL 4OGXL 3GEWB 2R29H 1U2HA 4CN6A 2WNGA 2YBRA 5IROC 2ZOLA 4LHJB 3MA9L 2X5PA 4ZUVB 1QKZL 4OFDA 5JW3H 2OMBA 1WBYB 1HKLH 2X4TA 3OXSA 1I4FA 1I8KB 3ZE0E 3T0BA 3CFIC 4MLIA 4GKSB 5T3XL 3P9LA 4XNUH 4CDHA 4U0RC 1CFNA 3WIFA 4P5TA 2VITA 3HR5A 1FZJB 4P4KB 2DJUA 2DQGL 2FD6L 3OTTA 3RZCA 1KLFA 2IMMA 4FS0A 1NC4D 5DMYA 2X44D 1INDL 3BFOA 1UQSB 4QXUH 3IXAA 3RBSA 4PP1D 1ZVSA 5KAQG 3L7FB 1IGML 1NFDE 2FEDD 1A6AB 2OK0H 5C0JA 3DIFA 1P7KB 4O00A 3QUML 5EORL 5CEXB 4AZ8A 1CFSB 5DTFB 2XZCL 1E4JA 5IESH 4L9DA 1EX0A 4KMTH 3G5YB 4RGOL 1UH4A 3CGTA 4KRMB 4PGEB 1O5DT 4LP4A 5T5NF 5C7XH 2NX5E 4U1NB 1A9BB 2AS5M 1YY8B 2KL6A 2VZSA 5D7IA 5EBMB 5L2KB 4UB0H 3WL9B 4PJDB 4HDIB 5BJTA 2VXUL 1SEBA 1KJ2L 5IB5B 3BP6A 1FSKB 4PRIA 4OV6F 4UV7H 1YMMA 1U8NA 4GH7B 3OR6A 1H3XA 3UYRL 2FSEB 5EB9A 1U91B 3BPOB 4JZNA 5IT2L 4DUWA 1F3RB 4X5LA 3UZQA 2CRZA 4WGWB 3IRPX 5CIPB 3JV5A 4ODUA 2LAAA 2D2OA 3C5JA 3GM8A 5IVXF 1I8MA 3B2UD 5HXMA 3QUXB 4WDIB 4JY4B 4C56A 1CVSC 1HXMA 4OGYL 5T33H 3W0WE 3M17B 4HKBB 4XCFL 3UC0L 1I9RL 4PJAA 3WIHA 4QHNA 1OAUL 1MAML 5L7XL 4DUVA 5I0ZA 2IBZY 3KR3H 3QR2A 3SE9H 5EWIL 1N0XH 2GKIA 4NO0D 2EIEA 3Q5OA 1JMZA 1V3MA 4HFUL 2HKHH 3HE6A 1CXFA 3QIBB 4XXDA 4CJ0A 2G9HB 2YMXH 2F5BH 2D03H 1WZ1L 5HVWA 3B5GA 1NC2D 4P59H 1JGUL 1IKFH 1YEDB 5I8EA 1MREL 5F1KC 3QCTL 4S0SD 2VUOA 4NRYA 2VDPL 3QEHA 3T65A 3LAFA 1Z9MA 4JCLA 4PB9L 1DQML 2FEDC 1IMHC 4UOW1 3RAJH 5AUMB 3ZKND 4DQOH 4L8DB 2AJZB 4XPTH 2BCKB 4JHWH 4JQIH 1OARL 1KPRA 3A67L 2CRIA 2V9QA 4X7TA 1J5OH 2EH7H 2IAMC 1A6PA 2CKNA 1QSVA 2AK4D 3UTQA 4BM7A 2HRPL 4U1JA 5I75C 4Y4FD 4APQD 4KZDH 3U36B 2G75A 1QR1A 5J6HB 4PY7B 3IU3B 5F89A 5GISH 1KULA 3IS1X 4KJWC 4BSVA 5DWUH 5HDOA 4NQTA 1JF1B 1IKNC 5GS1C 3WFZA 3JXAA 2B0SL 5JW5A 3D5OF 3RWCB 4ZFFA 4MSWB 1JHLH 2O5ZH 3UXFA 1NFIA 1H3TA 1CWVA 3QHFL 1KEML 3STZA 3ULSB 3ARGB 2VLRD 1HHIA 1M7IB 4U6TA 3B9VA 4HD9A 2ADIA 3QHTC 4OZHB 3N1GC 3AC0A 3DPBA 1DP0A 3K2UH 5JO5A 4GKNA 1LDPH 2IC2A 2E3VA 1EJ6A 3VU2A 4F7EB 5J6GB 2OTUA 3ULUC 2QSTA 5T1KD 3ILPB 4JRXB 1JZ7A 5C09D 3THML 3UTTB 1HQ4B 2P8PB 3QXUA 3MJ8A 2PCPA 4Z7UF 2HRLA 4KZEL 3OX8B 2Q76B 4OIAA 4F7TA 2BSTB 4LQFH 4OCXL 2NXYD 5EC2B 1FPTH 1ZS8A 4FQLL 1OTTD 3T0EC 1QLFA 3U4EA 2XZQH 1CE1L 2UZIH 4KK9D 2QSQA 2AERT 5B3JE 1JZ3A 3KJ4C 3UCRA 4LSUH 1QFUH 4WHTA 4JFOA 1AGDB 2BOCA 4YXHH 2XY1A 2VTFA 1ZAGA 3TJHD 1LO2H 1HH6A 4M6MH 4Y8DC 2OL3A 1MFCL 3WSQL 4OCRH 3H42L 3KYNA 5GGRB 3ZKNC 1CK0L 3I9GH 4P2QD 2FL5B 1MCKA 3WO3B 4JG1H 5FOBA 4JVPA 4MVBD 3VH8A 1T7VA 3LQZB 1TFHA 5SWSD 3W11C 3MLWH 5FO8B 2W9LA 5ESQB 2G60H 2PTTA 1I1AD 1SJEB 4Y4FC 3S36H 4QKXB 4APQC 4O2CA 5DJDB 5BV7B 3ARWA 4R0LC 1RJZA 1MJ8L 1A1MB 3MLSH 4UOJA 1X5LA 4KTEH 1UKTA 1MWAL 4G6ML 5DC0A 4PR5A 5EZOH 2AJ3B 1U8JA 4HS6B 3MLVH 4G42B 2Z31B 3FFDB 3EOBA 4KJYA 2AQ1A 2EDOA 5F9JB 4KI5F 3ME0A 4HW6A 4MA8H 2X9WA 1RZ7H 4Z7NF 4RAVB 3QDMD 3P73B 5DMGC 3PDGA 5IB1A 4Z78B 3OB0H 4AMKH 1UXWB 3U9PL 3CVHH 1OLLA 1LD9A 3OKKB 3AS3A 1BFTA 5E4EC 4DKEH 2X4UB 1BQHA 2AK4E 4ZUVA 1TPXC 4DEPC 1VPOH 4XCNB 3VMPA 4OI7A 1WBYA 1AY1L 2P8LA 4GQ9H 4HGWA 3P0VL 4LIQE 4XX1G 1WAAA 5DVMA 1RI8A 1RZJH 3CFKA 4Z7QF 4YHKH 1UH3A 1FL6B 4MHHI 1DEEB 1R5VB 4P9MH 4UBDC 5IBLD 1OOAA 1QHPA 2V2WB 4HJJL 4KVCH 4YE4L 4LEOA 3G5XB 2VWEC 5D7LB 3SPVA 1OTTC 1FNHA 3WXVL 3CVHA 3LCYA 4FRWA 4N1EA 2YXFA 5KZCD 2VLRE 1EUUA 3DYOA 5FO7A 4PGZA 3DVIA 4LLUB 3ISWA 2CMRH 4YHYC 2YRZA 4XPFL 3L7FA 4X9BA 5DVKA 3PWPA 1Z9LA 4Y16A 2YSSB 1M71B 1DANT 4WI5A 1I7UA 2I24N 5MEQB 1OCWL 4TTDD 4HSQA 4KDTA 5C09E 4I77L 4Z95H 3AFLA 4DTGL 1WF5A 4JDVB 4MVBC 5CEXA 4OSUH 3ALWA 5I1GH 5DTFA 4R2GD 3RX5A 4NHCH 1TVHB 4JFEA 4TSCH 1NUNB 2EYTB 4H88H 1MI5D 3WHE1 5LGJB 4KQ4H 1EFXD 1HQRB 5CIPH 4ZPVB 2ZUSA 1YMHB 5FHAH 2VWEE 2HT3C 4NKIL 5DD0H 3VXMB 1JWMA 1YY8A 5EBMA 4YDIH 5L2KA 1I7RB 4PJDA 5IIEB 3S34H 4YH6A 1WIUA 3IDYC 4JO3L 3IDIB 5DEFA 1X5YA 5AG8A 4TSAH 1QYGL 3VWJD 2EDTA 5C6WH 3PGCA 3B3IB 3SGDH 3VFSB 3LKQB 2QQKL 1K5NB 3QXAB 2JKXA 4MD0A 2ZKHL 1Q9OA 4EI5C 3IDXL 4U7MA 1T03L 5EOQL 2FATL 3R0MA 1FN4B 5CIPA 1MRCH 4P2QE 5EU7C 4OUOA 4WWKD 2AKRB 3P3YA 3LKPB 3DV4A 3QJFA 3MRNA 4Z7VE 1OF2A 3FQRA 1CXLA 3V5DB 5HGAA 2OTWA 1CICD 3QUXA 3EOAA 4WDIA 2R8SL 2ZCHH 2HG5B 3QZWG 5DRNB 4NQEA 1FNEA 2A1WH 1H3WM 4HKBA 1GC1C 1XR9B 4Z7OE 2O93L 1JZ4A 3E2HB 4OFPA 2DQDH 3DMMB 4PV9B 4PRPA 2XWBA 2DAVA 3BDYL 4HEME 4MB4A 1ZLUH 3OZ9L 4D9RD 4EI6B 3QIWB 5AZEH 3QIBA 4J4PC 3QDME 2VDRH 1ORSA 2CK0H 1FNSH 3QZWB 1ZGLM 2MQ3A 5D1ZD 3MOBH 1YEDA 1CIUA 4GRWF 3MOQA 3WMSA 4E0RA 4MD5B 4QTIL 5C6TL 2ZZUT 3NA9H 4PJEE 3MSPA 2YKLL 2R0ZL 2YC1A 4QWWC 3QCVL 5AUMA 4OBRA 5A2IH 2AJZA 5GIRA 2BCKA 5FYKU 1UWEH 1G9MC 1ZT4B 3TIEA 1SY6H 2DF3A 1HH9A 2R2EA 3QIUD 4G6AC 3U36A 5DK2B 4PY7A 1JI1A 2NTFA 1OD9A 3FONB 1B90A 3O6LH 4R4BA 5F1OB 3RWDA 2GSGB 3RUGA 3WUWA 2C1PB 1DDHA 1CLOH 1R0AL 2P48B 3TFKD 1YNTB 4EN3B 5DUBA 2X70B 5IVOA 4C4KT 4OLWL 4TNVK 3S3PA 3PABB 4NN7C 3EFFB 4U05A 4HWBL 2EO9A 4IMKC 1SY6A 4KUZL 4OZ4B 5CJXA 4G9FA 5FM4A 3IFLL 3HFML 4CVWA 3CFBA 1AI1H 3P77A 4LKCA 3QEQB 1AP2B 1H3PL 3QXTA 4WWKC 3TT3H 4OCWL 3MJ7B 3ULVH 3QAZC 5KVDL 4XHJC 2JB5L 5HPOA 1QSEA 1MI5E 4R3SA 1R3IL 4HWUA 2HLFD 1HQ4A 2PW2A 4HIXH 1LK3H 1FO0L 2FIKA 5GGRY 1E4XL 3SDCC 4K8RH 2W0FA 1YN6B 1L7IH 2Q76A 1EERB 5MENA 2CDGB 1RMFL 5D1QD 3UO1H 2ERJB 2NY7L 5F44A 4UTBL 2FEEI 5IMOA 5DI8B 2G5BB 2MCG1 5D70H 3BKCH 4R97C 1AE6L 1I3RB 4Q6IA 1MFNA 5IM7B 1OP5K 5KANI 2ZJSH 2XN9A 2NY6B 4AK1A 1ITCA 4JPWH 3MXVL 3NBNA 3NZHL 2DS4A 4OF6A 4Z8FL 1DN0B 2IMNA 4X4XB 3VD3A 3CSPA 4L3EB 4PJAF 5GGRA 5KOVC 4UDTB 3ESVF 3UJIL 1OLZA 1ND0A 3QUMB 4WO4D 1WCQA 2QADB 1NCDH 3ROOB 3TF7C 1M7DB 3N85L 3MXWL 4ZODA 4LU5L 1FDLH 1E4KC 1A7NL 5ESQA 4ZUTA 4KKNA 4BZ2L 1SJEA 3CAFA 5C0FA 4D8PB 1C7TA 2XTJB 3P40A 4NJ9H 3QO0B 4PJ5B 3VGEA 1YEGH 1E28B 4EOWL 5LXGL 1VGEH 4D9RE 3DUHA 5I8KL 1KCLA 3MBEC 5AD0B 4XI5D 3BISA 1X5ZA 1JPST 1ZEAH 4LAJH 1X5GA 1W72A 2Z31A 4YXLH 1B4JH 3TFKC 1XIWD 2DKSA 3WFDL 3QXWA 1E4WH 3PQYB 4DVRH 2R4SH 3D3VB 3SDXE 4RAVA 3LH2H 2AK1L 4HPOH 5J1AA 4ODTH 7CGTA 2BFVL 1GGTA 4AEIH 4WHYG 4Z78A 3GMRA 4YHIB 1G7JB 1UXWA 1X6NA 2BNQD 5I8OL 2AEIT 1EHLH 5FGCB 3TNMB 1J1OL 1P9MC 4FN0A 4WU5B 3GI9L 1ED3A 3N1QC 2IAND 4M7JH 1J1PL 2BDNL 4JQXA 4C4KO 1CR9H 3QDGD 4NRZB 3I85A 5A40E 1FIEA 1F4XH 1R5VA 4CW1B 4NCDA 4Y0GA 4K9EC 1FJ1A 1WEJH 3DURB 2V2WA 4XMLL 1QVOA 2I9TB 1J0JA 3ET9F 2PYFB 3V4PH 1CU4L 4LQ1A 3WO4B 4CVXB 4YHZL 1JPGB 1S9WB 3K0WA 3TA3B 4X4YB 2ARJQ 1VFBA 3SKOA 1RUQL 5C71A 4AIZB 2G5RA 1DQLL 4AJ0A 1TZIA 3OGCA 1MCOL 2GSIB 5BMFH 2EDBA 4HUUA 3W9EB 4UIMA 3R8QA 1LGVA 4OD2B 4XP1H 2YSSA 2DLIA 1R3HB 4WU7A 5LAXB 1BZQK 4GMSL 1J05A 3VFGL 4FXLA 5DJAB 5J13C 4LVHB 4UDUB 5L8JB 5EZLB 3SDAD 5FUCE 1SJHB 4JDVA 2Z35A 1DEDA 1MCPL 1WFNA 2PXYB 2YPLB 3EJZC 4FQIL 4K3HA 4LPCA 5FA3B 4DGVL 3VW3H 3TYGL 1TVHA 2FBJH 1UJ3B 4HH9B 4G8IB 2EYTA 2VXVH 3SQBA 1PKOA 5LGJA 5IHBA 2V7NA 1HQRA 5EIIB 4AENA 4TQEL 4Z0XA 3LS4H 4OLXH 1WCBA 5FYJL 3SDYH 3VXMA 3M8OL 1UM4L 3PHOB 3QUZB 4NFBA 5T5FL 3L5JA 2OYPA 2C3GA 3NIFF 4OTXL 1NCBH 3IDIA 3IF1A 3WLWD 1MHHA 2DD8L 4CMHB 5I1DA 3LKRA 1XIWC 3RY6A 3GJFB 2MKWA 4K3GA 2W9EH 4I18B 3LKQA 1OB1B 5EC1B 4X4ZA 3QXAA 5DJYA 1MCJA 4OZFG 4PJBE 2HJLA 4YBLC 3S5LB 1F13A 2DQJL 2HTKD 3PP4H 5EBLB 2DIAA 3ZMRA 3QRGL 3ZHLA 2X6MA 3FRPG 3UPRA 3TVMB 2YD1A 4MJ6A 2RIKA 5CP3A 5E00A 4XVJL 1KBGL 4M7KH 4RMTA 3LV3B 1MOEA 3V5DA 4PJGE 4DZBB 4I3SL 4MQSB 4PGBB 5F9OH 1YN7B 2HG5A 4LSQH 4OZFB 4PGCB 4P46A 1ZHBA 3CU1A 4LSRL 4LSTH 5FHBH 5FXCH 5CKGA 4HIIB 3DMMA 4PV9A 5JDSA 3CSGA 2IG2H 4UIKL 4Y1AB 5L88H 4C59B 3O3AA 4XNQA 2XWTB 3NCFB 3TN0B 4MDJB 4NZUL 2R0WL 3HMXH 1N59B 1G9EA 1ZLWH 4OFYD 3PP3K 1JIBA 3VGGA 1S8DB 2V17L 3QZWA 1E6OL 4LHUD 4N0FB 3HC0B 2A6JA 2AJUH 4YDJB 2BNQE 4ELMA 4MD5A 3QA3A 5KJRL 4F15C 3NA4A 3G5ZA 1FC2D 4S10A 4N8CL 3BKJH 3F62A 3DJ9A 3RL2B 2F53E 3MUGA 1V7NH 1C5DA 4EBQH 3R4DA 3ZTNH 2IANE 4IS6B 4WIQA 2D9QB 4N0YL 4LIQL 3SOBL 4I3RH 2EECA 4ZAKD 3QDGE 3HI5H 1ADQL 5ITBH 1QUNA 1ZT4A 3LKNB 2JJTC 2Y6SC 1I9EA 1G6RH 1KENH 4KRPD 5I30H 3C8DA 5SV4A 4LNRA 3IETB 3W81A 4HIEB 3BPNB 3ILQD 3FONA 4Y5XA 2DB8A 5FIEA 3SE8H 2VL5A 1UA6L 2GSGA 4O02L 1TQBC 4ODXA 2D0HA 1CLYH 3NCBB 2B1AH 3LKSA 3HPJA 3ZE1F 1ONQB 3WNLA 1K4DB 2VZUA 4RFNC 1FYHB 1YNTA 3I2CL 1BD2A 5E8EB 3TYFA 1REIA 1H5BB 2X4NB 3EFFA 2XA8L 1G6RA 2HTKC 1P6FA 3DYMA 2C3WA 4AM0B 2AJVL 2VXTL 1U8KB 5JXEA 4GG6B 3QEQA 1AP2A 3MJ7A 1OW0A 4U2YA 5BW7A 1DQDH 1ACYH 4M8QB 3TGXA 4RISL 2DLTA 3P0YH 4FNLH 4MXVE 5GXBB 3TBVA 5K9OB 4PJDF 3AS1A 2Y07L 4IRSB 1RJYA 4F33B 1KJ3L 5EIQA 4HK0B 1Q8MA 4P2RB 4OQTH 2YWYA 2ZSWA 1JYXA 1B3JA 2R39A 3OV6A 4I2XE 1S5IH 2EYSB 2VLJA 4FFZL 5T3ZH 4KVNL 1NANI 1JPTH 5IOPB 3MRIA 3T3PF 5JLZA 5J0BA 3O3BB 4NNXA 1QR4A 5IG7B 1EIBA 3I75B 5JR1L 1XF4A 5IM7A 4GXUN 4JO2H 3IDUA 1CDBA 3G6DL 2NY3D 4NZDA 4PLNC 2I60H 3CSBA 5EBGA 1FRGL 5HHME 5M7QA 4OQTA 2PNDA 3MGOB 1Y6KR 4Z76A 4L3EA 3NABL 4XVTL 2AJSL 2X1WL 4L4JA 4XC1H 4ORZC 1FG2B 5TFSL 5IK3A 3FQUA 5JORB 2YEZA 3ZO0A 4RGMC 3OJVC 4XP6H 1OHQA 1FVCB 2P7TB 5ICXA 3NIGE 3HNVH 1G0XA 4GRLB 3L7EA 4D8PA 2DLEA 3MODL 4LMQE 4M43L 3QO0A 5IF0B 3CDCA 3GBNH 4QHLB 1BBJA 4JFPB 4U6VH 1EDQA 4QRPA 4WEBL 3F58L 1WWBX 4HXAL 3UTSB 3O2VH 3MRPA 5HTSA 5B22A 2VR5A 1AJ7H 4UNVA 3SCMD 3R1GH 5IUSA 1NGQH 4NQCB 4MD4B 3VXPB 1F4WH 4FFYH 4WHYH 1RK0A 4HLZG 4K2UL 4V1DA 1NDMA 3SKUD 2WBJD 5BCAA 5IMMB 4YHIA 4TYUA 1I85A 3LPWA 5I6XC 4Y4KB 2IPTL 1M4KA 1F58L 4WW2A 3T8XB 3CMOH 4ZFOL 4YO0B 1KTDA 3CFJA 2JCCB 1FE8H 2VNCA 3VJ6B 4CW1A 3C60B 3WIIL 3KNBA 2VZ1A 4OLEA 1LMKA 2YUWA 5GJTL 5HYJD 4X6CE 5JXAL 4CVXA 3FT2A 4OZHF 4LRIA 3IFOB 3STLB 1S9WA 3X3GH 5JZ7D 1IZJA 1JBJA 3QDJB 3CLFL 4RCAA 4XBGA 5FCUH 1QPXA 4D9LL 1AHWB 4KJPC 3V5HB 3IDJA 3VI3F 2EC8A 1IM3B 2EDRA 2J8UA 4HPYL 1LNUB 2YD4A 3KYAA 3N1PC 1AQKH 2OQJB 4W6WB 4LPWA 3SE3C 4JG0H 2HFFA 3ZSTA 5EPMB 4TN9A 4AL8L 2PR4L 5HYSG 4UDUA 3MRFA 1A7QL 3GJFH 3UBXI 4LGPB 3AVEA 4UNUA 3GBML 2PXYA 1I7ZA 2AEWA 1V05A 4PJCE 1JVKA 3K81A 1FFPB 3S88H 4PUBL 1CFQB 3P30H 4IOFC 4MXQD 3RKDD 4XP4H 4O9HH 3EYFB 3LEVH 1DL7L 5EIIA 4QLRA 2HH0H 3BPCB 1P84J 4YDVB 4LMQI 2QSCH 4ZSOB 3ELAT 1Z9SA 2C3XA 2E9BA 3BQUB 1HSBA 1QRND 1IM9A 1KIPB 4LCYB 3KXFD 1MCWW 4MCZA 2C5DC 4HIHB 3QUZA 3H9SD 4H20H 1H15B 5I1EH 3HE7C 1GPOL 4ZFGL 4YQXH 3G08B 1UFUA 4L9LA 3GJFA 4OZFH 4MA1B 4I18A 5EC1A 3ARXA 3U4BL 4U1SB 4KZEH 2CXGA 1NFDB 4UZGA 4PJHB 1JHKH 2H1PH 4M1DL 5E8NB 5F7WC 1K8IB 3I3DA 1PBYA 2WBJC 2X4QA 2F58L 3GSWB 1HHKA 5B39G 4HHAB 3MUY1 1YNLH 4Y4HD 5KG9A 1EJOL 3ARFD 5F7DA 1OTUC 5GS0D 4K07A 2R0KL 5IFHL 3HUJA 3S96A 2JJVA 3GK8H 1MHCB 5IMKA 5BVPL 3BPLB 2DMBA 4UT6L 4OZFA 3MNVA 3T2QA 1QNZL 1L6XA 2F5AH 2ZPKL 4JLRA 4LLYA 5GRZA 3QQNA 4U3HA 3FRPA 3SGKC 3RDTA 3LN4B 3OHXA 4NQUA 5HHVH 3GRWH 3RL1B 5JZ7C 2XWTA 3MOAH 5IHZB 5BOZG 4XCCL 1CDJA 1NUFA 2JK5B 4X6FB 1OAQH 4OM0H 1SEQL 1UWGH 3G6JA 3DTXB 4TVPD 1S8DA 3C5ZC 3P4OA 4YAQB 5CMAA 4WUKL 4N0FA 4Y88A 1JGLH 3MV8A 1TIUA 4LOUC 5BS0A 1KCSH 4U1HB 4YDJA 5E2WH 2X09A 3FQNA 2ED8A 3GMPB 4L8CB 4F7PA 4KK6C 3LRGA 3V6FA 4MXWL 1U8PB 3VFUB 4NQVB 4FTVD 3IXTA 2FJFB 3GRWA 1DVFA 4WY7H 4HMDA 3LIZL 5DC9B 4OLVH 2XQYG 4PS4L 2HJFB 1N2RA 1I1FB 3O9WC 3HC4H 1S9KC 1NGYB 1A3RL 4MCYB 2W92A 4MXQC 3KVQA 3F7VB 4NDMA 4Z77B 2FGWH 1T04B 3IAQA 2FDBP 5HYJE 3IETA 1A6VH 4HIEA 3GUTA 4JM4L 3BXNA 4GAGH 3A6BH 5D6CB 1S9VA 1LILA 3ZLQC 4GT7A 1Q0XL 2NYYD 2WLYA 3VXQB 1GL4B 3RVVD 2YZ1A 4R7DB 4KGLA 1MFEL 4PRHD 3MNZB 1CGSL 4KAQL 5E8EA 1TJGH 1P4LB 1XFPA 3PV7A 5DR5H 2X4NA 3QI9C 2VDNL 3C8KB 4WENB 5D71L 1CE6B 5HHPB 2L0DA 1H8OA 4FQJL 4GG6A 4XMKH 4XP5H 1Z3GH 1IBGH 2XKNA 4M8QA 4ZYKA 4LEXL 4M48H 1WFTA 2DQIH 1LDSA 1AD9B 4IRSA 4F33A 4G9DA 3FN0H 3KYKL 3O2WL 4P2RA 2XRAH 1V8HA 1KJVB 3QEGH 1QRNE 4MX7A 4OIBA 3KGRA 1NC4B 4MNGA 3VXUB 3TZVD 3VGDA 3EKCA 3H9SE 3V6OE 1MF2L 4I77H 5F96L 4N9OB 5IVZA 4OZIB 1D5IH 4LPVA 5FKAA 4HC1L 1DBJH 1HHHB 1AC6A 3ROLB 1X4ZA 4MHHG 5ABDE 5EG6C 3SJVA 2Q1EA 4Q9BA 4JRYE 4G6JL 4OUUA 4NP4H 5HYQB 4X6DE 1OAZL 4H25B 5E7FA 1XF2B 1OAYL 2Y23A 2IQ9L 1IQWL 4WHCA 3WLBB 2ZCKL 2CXKA 4JFDD 4Y19A 3OMZA 3MGOA 1ZV5A 5H2BA 5M94B 1RUPL 3E3QE 1KTKE 5DMKB 1U92B 1KYOJ 3DVGB 2IBZX 3SGEI 3ZT7A 1WT5A 5A2KH 2R1YA 1FVCA 4HJ0C 2ATKA 1HNGA 1S9XB 3WN5C 3NFSH 3O6FA 4XNYL 3AM8A 5IF0A 1U6AH 4QHLA 2XNAB 5FYKH 4D0DA 4XMPL 2M8XA 5DSCA 2EXWC 1FNLA 4OT1L 4YHPA 3IKCA 2CLZB 3CDFA 1FYTD 2DQHL 3Q3GB 2AQ3A 2J4WL 4TVPE 3RVVC 1RIVL 1MIMH 3U9UB 3ZL4L 4HLZH 2V5SA 4NQCA 1U95B 1GCFA 4B53A 5AAMA 3K4ZA 3GHBL 1JPFB 2CH8A 3MMEA 2BY1A 4FTVE 4EDWH 5GGQH 5IMMA 2ITCB 3H9HB 5HGHA 5EZIL 3AU1B 2CR6A 3QEUB 4NO3A 2FJGB 3QO1B 3VG0L 2NZIA 4PJFE 3EZJB 2EE6A 4LLDB 5TF0A 1Y18A 3T8XA 1RZ8B 2ADGB 3ETBF 3VFVB 2QL1A 3VRLF 4NO0B 3BT2H 1H3GA 2YD7A 5TH2A 1X5AA 1JE6A 4P5TD 3KJ4B 3PIQA 4LSPH 5SX4H 3EYUL 1I1RA 4QHKI 3RZCD 1CQKA 1FZOA 1NC2B 4RWYH 4PRHE 2CPCA 4S1SL 4X7SL 3STLA 5IBUG 1B9ZA 3IJHA 4ZNEA 1TNNA 1AHWA 1L9MA 2OMNA 5D7JA 4X5XA 4NJAL 5L9DL 3FT4A 1LNUA 4JM2A 5C92A 1FFRA 1FLTX 2A0LD 4QCIB 4MB5A 2PUQT 2OQJA 5DS8B 1NBVH 2I5YL 2AK4B 4JR9H 4Y4FB 1T2XA 3UMTA 4APQB 1OVZA 2CUMA 4WTWA 5IBUB 2M26A 2BY3A 4R0LB 4JHAL 4JPIB 1FFPA 1LEIB 4NQSB 1BECA 1PQZA 3BPCA 4ZSOA 2EH8H 1KC5H 1GH7A 5C9KA 3UDWA 4GUPB 1QRKA 2WIIB 4HIHA 1Z6JT 4NBXB 1F5WA 1R3KB 4PRID 5HYSA 1YMMD 2O61B 2VLRB 3OB0K 4N0RA 2GUOB 1F3JB 1RSFA 1IARB 3G08A 1D3CA 5DEGA 2R9HC 12E8L 3QQ4B 3W9DA 4U1SA 1F90L 5E4EB 5IGXH 5T1KB 4I4WA 4PJHA 5E8NA 5IROA 3S36X 1Q9KB 5ANMA 4DEPB 4J7RA 4M3JA 5TE4H 1BWMA 3EAKA 1SVCP 1A5FH 1A3QA 1FNGB 1PYWB 1FIGH 3QNXB 4NKOB 2W0LA 4O58L 3WKNA 4J6RH 4C56D 3VRJB 3NGBB 1IC7H 3N9GL 2NXYB 4J2XA 2J88L 2H26B 3JVGA 3QDHA 4HG4K 4JREC 4P5TC 1TMCB 4DK6A 1FH5L 1M1SA 1SBBA 2P46B 3HE6D 3MV9E 4PD4K 5B39A 3MLRL 4N0UE 1YYML 1KCVH 1XGYH 3RZCC 1U58B 3AUVA 2VERN 5GGVY 5IHZA 2AP2A 1IAII 5GGVH 5E03A 1A6UL 4NUGL 3RIAF 3U7YL 3DTXA 4CNIB 5KSBB 3KS0J 5EU5B 1MCNA 1C08B 1DQJB 4PJ8C 4DKAA 5GGTH 4P2QB 1FFNA 9CGTA 3R06A 5SWSB 4Z7VB 3QT2A 4L8CA 3WV0A 4A6YH 1I1AB 1U8PA 4NQVA 2AXGA 3LHPH 3DI3B 3TESA 4R8WL 2C7UB 5E8DL 5KANG 3AXLB 1DN2A 1YPZF 1RHHB 5F7YC 5ETUA 1NGYA 1FAIH 4MCYA 3S4SA 3U79A 4BKLA 4OFVA 4XB7A 1Q0YH 3GMLB 4Z77A 2NY5H 5FA4B 2NY4C 5KTEH 1FFQA 5GGTA 1LO4L 1PG7H 4M7LT 3INUH 4HBCH 2WQ8A 3RA7H 4JB9H 1F3DJ 3LZFL 1SJVA 4A6YA 4U1IA 1S7TB 4R7DA 4J3XA 5E6ZA 1VFAA 5K9JL 3ESUF 5CINH 4NC1E 4YIQB 3C8KA 5A2FA 4E42A 1YJDL 2GJ6A 5HYIA 3VA2C 2P49B 3D69B 5DJ0B 2CDFA 4RX4A 4KKLC 2DYPA 5ICYB 3HNSL 4ZS7L 1J1XL 3MX0A 3BKYH 3TC9A 5A16B 5FF6B 1ZLUK 3QPXH 1L9NA 3LDBB 2HFGH 3QXVA 4OLZH 4J3SA 1CG9B 1VKXA 1S7UA 3MBXL 5D7IE 1NL0H 1YEKH 4YZFF 4TUKH 1OWRM 3D9AH 1KJVA 5GRJH 3DSFL 3VXUA 1JNNH 5JHDA 5KZCB 4U3CA 1YMME 2F19L 5GSRA 4OZIA 4WHDA 1PX3A 3QG6B 1T21B 2WUBL 3MRMB 2W59A 2Y06H 4DOHB 3RHWF 5KSVB 5CS7A 2R1WA 3ROLA 4PY8J 3GKWL 5L2JB 4ODHH 4YC2C 5D93C 2Z91A 2Z4QA 2W9DL 3OG4B 3LPFA 5DYOB 2GTZA 3L9RB 3I84A 4S1QL 4M7ZC 5KVGL 1U3HC 1BOYA 4XP9L 5HYQA 4H25A 3WDIA 4RGND 1P4IH 5D2NC 4CKVX 4PBXA 3UAJC