1OOAA

Crystal structure of nf-kb(p50)2 complexed to a high-affinity rna aptamer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
313
structure length
313
Chain Sequence
b'GGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTDREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLETSEPKPFLYYPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA aptamer
publication title Crystal structure of NF-kappaB (p50)2 complexed to a high-affinity RNA aptamer.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/rna
total genus 64
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00554 RHD_DNA_bind Rel homology DNA-binding domain
A PF16179 RHD_dimer Rel homology dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ooaA02
2.60.40.340 Mainly Beta Sandwich Immunoglobulin-like Rel homology domain (RHD), DNA-binding domain 1ooaA01
4Y1AA 3WHXA 3HMXL 2AEPH 5HSFA 1L7TL 1RZGB 1ZGLA 4QF1A 5CP3A 43C9B 3MRFB 4EIGB 1S7UA 4HS6B 3INUH 3CXDL 4GXUN 2IALA 1G0DA 3ARTA 5EIIA 2ICEB 5I9QC 4DGVH 1BQLL 4JGUA 1MFAH 4PJXE 1ZWIA 4HGWB 1UB6A 4NBXB 4BK4A 3WNOA 1K4CA 3GMQB 1GZPB 5JHDE 2Z35A 3IXAB 2BVTA 1C5DB 1LO0L 1CR9H 3ARPA 3VRLF 1UC6A 4PRHB 3MMEB 1J8HE 4OTXH 3TO4C 1JTPA 2YEZA 5T5FH 1TLKA 2CUIA 1DANT 5FO7A 5L88L 3LAFA 5FFLA 5HGDA 4P5MB 4FFWC 3FN3A 5GS1A 4UQ2A 4X5WA 2VZUA 4HUUB 5HDQL 4FQHA 4DWHA 3QRGH 4JO3H 4R7DA 5C9JB 3FQRB 1OP3H 5F1IA 1M7IB 3OMZA 1QOKA 4PG2C 1E28B 2AJ3B 4GBXA 4LARL 5C71A 3VXRA 2CK2A 3BXNA 2GT9A 5KS9B 2I9TA 3QUZB 2HJLB 1MRCH 3BQUB 1HHHB 5GIRA 1H3XA 4RMRA 1T7ZA 1FL3B 3ZKMD 2LAAA 5DURB 4POUB 3QJFB 3PDDA 4CJ0A 3O4OB 4NN5B 4CVXB 4TN9A 3KDMA 5D5MB 2E6JA 3QP3A 1K3IA 5EA0L 1P7KA 1EFXB 5FCSH 3NFNB 1JGEA 3BP5A 5MERA 4KK8C 4NQSB 4ENEC 4XBPA 2PW1A 3EDEA 2I27N 3ZYZA 4G7YH 1Q72H 1S5HB 2R0LH 4GW5A 1G9NL 4GXUM 3SKJL 4RX4D 4MJ2A 2DQEH 2PCPB 4NBYB 2OK0L 1C7SA 4PJDF 5B4MD 1S3KH 1VDGA 2Z0BA 3VWKA 2B5IB 1DBMH 4S2SB 1FVDB 1ZTXH 4LHUG 1WF5A 3MV8B 2Y5TA 1RMFL 5BS0D 9CGTA 3T2PA 4I0PA 2IMNA 2IPTH 1FFNB 4U2YA 4LLDB 4HH8A 5HHPB 2AK1L 3HG1E 4K7PX 1BZ9A 4QXGH 3BJ91 4RZCB 4ELMF 4RAVA 5C0CE 4HKBA 1EERB 4UOW1 2W91A 5D71L 4OCWL 4JFFA 5T1KA 4JFXB 2XRAH 1YY9D 1T1YA 3SCMD 3IJHA 1HXYB 3OGOE 5JNYA 5JHLL 2HFFB 3MSPA 4NZUL 3B6SB 2PXYB 3FAWA 3EAKA 1MJ7H 5A2LH 2XPGB 3MLPA 1RVFL 4LPTA 3UBXA 3QQ4B 2Q1EA 4K07A 2NX5E 4HS8H 1UB5B 4JDZA 1HINH 1XGYH 4XPTH 5DD1H 3MBXH 2C3GA 3PWPE 1N6VA 4MAUL 2EDQA 4R8WL 4Y5VC 4XPGH 1WJ3A 5IW1A 3M1BA 2DIJA 1CDCA 3BGFC 2FR4A 2UYLB 1BVZA 2BSED 4HWEH 5BOPA 2XG4A 3ULUH 4LHUB 2PW2A 5JHDB 2WIIA 5I1IH 3RVVD 3E8UH 1IM9B 2DBLL 4HW6A 1PAMA 3GIZL 4XH2A 5KVMC 3Q2CA 4PV9B 1FN4B 3O6KL 1BF8A 1J8HB 1UJTA 1VEMA 4OJFL 1UCBL 1QKZL 1RPQA 5D6DA 1JNLL 3KNBB 4J3WA 1V8HA 3GSUA 5KTEH 3OGCA 3RP1A 4C4KO 4PFEA 4LP5A 4FFWD 5C7XH 1KTLB 1YMME 3CFKA 5KVDH 4OLVH 4GW4A 4M8VA 1KIRA 2ARJA 1EGJL 3OKEA 4YXKL 5I1AA 5F6IC 4X4MA 2VXUH 1JGVH 4PUBH 2NY4C 1CL7H 1TJIH 4JM2F 12E8L 4WJ5A 4U1GB 1VACB 5DGRA 3QWQB 5IM7B 2X4TA 3I75A 2A1WL 4G43A 4MJ5A 3D2UD 1HSAA 1BGXH 4QRPD 3S4SA 3SKOB 1FYTD 5B39G 4JO4H 2DMBA 1T1ZA 2B39A 5ISZB 1DQML 1T20A 5DD0L 3RWHA 4M6OH 4E9LA 3MFFA 2CLVB 1LO3H 1E27A 3E0GA 4ZUUA 3A6BH 5E5RB 4KGLA 4HWZA 2XXCB 1B6DA 3QUYD 1U8MA 2P5EA 4XCCH 3FZUC 3LZFL 4LSQL 2I07B 4X9FA 3HE7B 4MNGA 5IW6B 4UILL 4MNQD 5MP6L 3P30H 3ARUA 2FEDC 4CMHC 4NP4L 3V8OA 4BQBA 2QQKL 3RRQA 4PY7A 2YRPA 4GAGH 3LOWA 3DSFL 2BVPB 4OSUL 3FO2B 4P46B 1LEKB 4WTZA 3S6CA 4R2GB 2VQ1B 4NGHH 2C4FT 4BSWB 4F57H 1QYGL 5A40E 5BV7C 4YPJA 1JK8B 4WI2A 1KBGL 1QFWI 3X12B 1N6QL 1HCFX 5T5NF 5C3TA 3B9VA 3FCTB 5HDBE 4QHMB 4LLWB 4RSVA 2CXKA 3M17A 4YR6A 3O3EA 3T0XA 2H26B 4LQ1A 4U1IA 4Z6AT 3GBNH 4D0BA 4UT9L 3NGBC 1CXLA 3ARFC 4TSBL 5C0CB 2EO9A 4JR9H 4U1NA 5INCB 3LQZB 4YPGA 5HJ3A 4YAQA 4J1UA 3ZE0E 1CLOL 1WFOA 5D7IA 5D7LA 5BW7A 3GHBL 4RGMC 4TVSa 3T3MF 1P69B 4R97C 5F97E 1PZUB 1XGTB 4Y16C 2BVOA 3T2QA 4JFYA 4AEIH 2EE9A 3VXNA 2D31A 3P2TA 1MWAA 1RK0A 2V5MA 4Q9QL 4ONOA 1OOAA 5TF1H 2C26A 3IDMB 4K94L 2DWDB 4MAYC 1RUMH 1YEFL 3LN4B 5D2LE 1OF2A 2ZNXA 5J4MA 3K4ZA 4L8BA 2D0HA 1FCCA 3EYOB 4NOBA 2PTUA 3P40A 4MNQE 1X9QA 2MTPA 2V9QA 3QIWC 2K7QA 3KJ6H 1KCKA 3MRPB 1WAAA 4LVNC 4JZJA 3LHPH 4K71C 4OF3A 3RVWD 3WNLA 43CAB 2V2TB 5FUOH 4MD5A 5CINH 3MLSH 2ZCLH 4LPXA 1GC1C 3MZGB 4AH2B 5C08A 3HZKA 3QG7H 2GTZB 1MPAH 3V95A 5DVOA 1FC1A 4J3VA 3KS0H 1CVSC 1U93B 4Z0XB 3UYOD 3IF1A 3RPIB 3LRGA 2UZIH 3GSWA 3JTSB 3QULA 1FGNL 3HFML 4KTEH 2X9WA 3RX8A 1DBAH 3TIEA 2CR6A 2PF6A 3RX7A 5F7WC 3LV3A 1QSEE 1IGIH 1P53A 3DHMA 3D3VB 1DLHA 1FBIH 4UU9A 2DQDL 4NC1C 3HI6L 3QUXB 4YDLB 4XBGB 3T77A 3GSVB 4WW2F 1A64A 4XMPL 1GJIA 1V7NH 4NNPH 1AHWA 5EIQA 3O4LD 4O00A 4O4YH 3IFPB 4OIBA 3B9KA 1A3RL 1MIEL 1T89C 4JFOB 5HHNA 5F1OB 4PJ8D 3MGOA 1Z0MA 3B83A 1CFSA 2FX9H 3RWIA 1NBZA 4RMWA 2ERJB 4JDTH 4JY6B 2X4OB 3RZCD 3BUYA 2NY2B 1CG9A 2DRUA 3HR5B 1OQOA 4GRMB 1X44A 5IB1B 4LSVH 4GRWE 3V6BR 4HPYL 3MV11 3U36A 1KN2H 1X5LA 5I9QB 1CN4A 1HIML 2H41A 4KROC 5K9QI 3QHFL 3ROLA 3WV0A 1B6UA 4MJ6B 3O3DA 3ARZA 4DZ8A 5E94B 1KXQE 3DROB 4CW1A 3MRIB 4V1DE 4MQTB 2OR9L 2ICWA 1MVUB 2W60B 3PQYA 3BP6B 2FJFA 4ZOCA 2GJJA 4QWWC 5EUKB 1F4WH 1TTUA 1KYOJ 2R0WH 4KFZC 2Y4SA 3EHBC 2Y9RT 2CKBH 5DJDB 5J1AB 3QIBD 4L3EA 4PJHA 1KB5L 3ABZA 3UYRL 4L9DA 2EYRB 3QQ9C 4FQQA 5I73C 5J6HB 1G9MH 3L3OB 3QI9B 4Y4FC 3WE6A 3WFBL 4N0UB 4LRIC 1JN6A 4XP4L 4PGJA 3GSQB 5T1DH 4ZTPH 5JORA 2DS4A 2C4XA 3SQOH 2DWEB 3RNQB 3RI5F 3VFTB 1CIDA 2QHRL 1MFCL 2P5WD 4PRPE 4XPBH 3VGDA 5JA8B 4FFVC 3T0DA 1YYML 3JVGC 3TIDA 3ZL4H 5HDBF 1A7BA 2Q7YB 3TEUA 5HYQB 3WLWC 4MJIB 3GMRB 4LQFL 2H6PA 5KSAA 2ICWJ 3HNSL 4JG0H 3SE8L 3VG9B 4N9GA 5I74C 1EHLH 4IDJH 1KPVA 3HC3L 3LIZH 4NKOB 4LSTH 5DUBB 5JTWA 3VRIB 5CZVL 1XZ0A 2E8ZA 3WFEH 3DTXA 2B1AH 2HJFB 3ZE0F 3C60B 3IGAB 5D2LB 5MEPA 4PLKC 1KJ2H 4LLVB 4XVSH 2P46B 4EIZC 4MA8L 3ES6A 1CVRA 4OFDA 3BW9A 3O6MH 1EA9C 1U2HA 2B2XH 4QXUL 1NBQA 1JIBA 1X6NA 3P11H 1XH3A 3BVNB 4WI3A 1BPVA 1G7HA 1KUMA 3N1FC 4LFHD 4UB0H 3O6FB 5D2LF 3UTQA 1ADQH 4LPVA 1A5FH 2YZ1A 1EMTL 1QA9B 3QUML 4BYHA 5DEGA 1GAFL 3C6SB 3VU2A 3KR3L 1NKRA 1RK1B 3SHSA 1ZOXA 3CMOL 4P4KD 3ESVF 3R06A 4TTDC 4Y19A 3RWFA 3T4AB 4BQ9A 1M71B 2CD0A 3LKNB 3QT2A 1RZFL 3CFEA 2XWBA 5EZJB 4K55A 3X11B 5D1ZA 3PL6D 1HDMA 1NQBA 3ARWA 2EIEA 1KTDA 1QSEB 3VXQA 1RU9L 1ITCA 5GGVY 5DRZB 5HHME 3P4MB 5KSUA 3U4EB 4P48A 5IBTL 3VXMA 2VDPL 5DDHB 1D5MB 5CBEA 4E41A 5D2NC 3KXFA 2NPLX 4YHKL 1ZT1B 4UIMB 1DQTA 2VLKB 3K7UA 4PJEE 4S1RH 4NQED 3QNYB 2ESVE 3EJJX 4O2FB 2EDWA 1NGYB 3PP3H 5IBUG 5I1KH 1T2QL 1NCNA 1MJJA 5EULV 1INEH 3WN5B 3SY0B 2WLZA 1WZLA 3ORJA 3K4DA 2DYPA 3BE1H 2WK2A 4X8JB 1KCUL 3C8HA 3GHEL 1TXKA 4XPHH 2CGRL 2Q86A 4DAGL 1NC2D 4Y5VB 1INDL 1PJ9A 3OSKA 4KROD 1YZZA 4MCZB 4P4RA 1EH9A 4H8WC 1J9CT 4JJ5B 1BBDH 4WI7A 4W6XB 1IGFH 1T7YA 3TT1H 4J7RA 2F19L 4Y2OA 3WIHA 4TRPL 4D9RD 4RDQF 4HGWA 1H0DA 4ORGA 3KPQB 4GRWF 3RNKB 2QKIB 2HKHL 3BKMH 1GZPA 1KEGH 1B0GA 2L0DA 4BQ8A 3CNKA 1JPSH 3S4SG 1X5XA 2VMFA 4TVPE 1C5DA 3EHBD 2BC4B 4LIQE 3BESR 4PRHA 3ARBD 1HHIB 3QQ9D 3BSZL 1U8KA 5GISL 4LCCC 4PTTB 3BFOA 3Q1SL 4KK9C 4Y4FD 4OI9A 2PTTB 1YDPA 3ARSA 4F7EB 3BGMA 4P5MA 1N5AB 5JIKA 2E7HA 5EBLB 2NXZB 4PJ9B 1R5IB 4PRPB 4LK4A 1ZA6B 4LGRB 2QV2A 4NN6C 4P9HH 2FO1A 2EICA 1N0LA 1E28A 4FFVD 2VDRH 1TJGH 2Y07L 3STZB 1IC4H 4CNIB 1DL7H 4GQPH 1HHHA 2I9LB 3GDBA 3HI5L 3T0ED 3AB0C 4KY1L 4F7PB 3QEHB 5CKAA 3IU4L 3EYQD 3P0GB 2BZDA 3QA3B 4YLQT 3QJFA 5SWSD 1IAKA 2VR4A 3MJ8A 4TUOA 2N7BA 1D5ZA 4PJDA 3RKDC 5K9JL 3V0VB 1UWXK 2JJSC 1NBVL 4YHML 4YNYB 4CMHB 1EFXA 1WWCA 3F7RA 3OAYK 2GJ6D 2Z93B 3MNWB 3FMGL 1AGDB 4KK5D 4GMSL 4NQSA 1HK6A 1ZHLB 1RZJH 1IM3B 3HPJA 2ZOKA 6FABH 4JVUA 5CEZL 2Y36H 2EDJA 1S5HA 5DI8B 3AAZA 4P57A 4RGNC 1YEDB 4OD3L 5BV7B 5SWQB 2WINA 3RA7H 1EHAA 3QRFM 3VFNB 4ELMA 3FN0H 4S2SA 4EI6B 3GMOB 4OIIH 3TN0D 1F4HA 4OV5A 5T3XD 3PV6B 5D70H 2AQ2A 3W0WB 4ODBD 4S0TD 3MJGX 5DRXA 5JQHC 2G75A 3C08L 1FFNA 4LLDA 2KL6A 1JI1A 5HHPA 1D9KB 5HHMB 4LNVA 3UPCA 4V2BA 2D7QA 1LO5B 3V52L 4RGMB 1RFDH 3FN9A 3KHQA 1EVTC 4KTDL 4IOSD 4R97B 4L8SA 3O9WB 4L4VE 1A6UH 5A43C 3BT2H 4MCYA 2VDNH 2AJUH 4Y16B 1BAFH 1DQQB 3CX5J 3FO1B 3H42H 3O8XA 1L4IA 3SN6N 4PJEB 4POYA 4UDUB 2HTKC 5J13B 1A02N 2XTJC 1EUUA 3ZHKA 2ESVB 5KG9A 3IYLW 5TJWK 5I8KH 4R4FH 1NGPL 3B6SA 4QY8B 2R0KL 2MHAA 2PXYA 5CEYA 3V6OE 4LCIL 4NKMA 4M5YH 3R1GL 4E42B 1TVBA 2DLHA 2XPGA 2WNGA 4NRXB 2XWJB 4BZYA 1MHPH 2DQJH 3RU8L 4LNRB 5D7JD 4P5TD 2GTWA 5DJYB 1UB5A 1WISA 4PJEF 1XMWA 3EO0B 5KVFL 1A7OL 2ADIB 3CFBB 4FXGB 4CADA 2J6EL 3MLWL 4HUXB 5JMOC 1T5XB 4DEPC 1U8PB 2EDFA 4HIIB 3QFJD 3KPRD 3WFHB 1AGFB 5D1QC 2W38A 3QWRA 4I9WD 4PJXA 1HILA 4GMTH 3CJJA 1ULVA 3QQ3B 4G6AC 1QQDB 4M61A 3I50H 4HC1L 2X89A 5D93B 3DURB 1UZ8A 5GXBB 1MOEA 1B2WH 5DMKA 3S34L 4R4NC 2KH2B 1D6VL 4KJWC 1G7QB 3UTZB 4C83B 1J8HA 4N1EA 5C2BL 3B2VL 4JM2A 2EE3A 4LEXH 2YD4A 4G5ZL 4NKDB 1XEDA 2VYRE 4KK9D 5JMRA 5KVGL 2A9NH 1GGTA 4PYGA 5CJQH 5CSGA 4Z95L 3KNBA 5L0QC 3QCTH 3VD4A 3GFUA 2RAMA 4NNXA 4QGYA 3VWJB 3IJSA 5BMFL 5ID0A 5AZEL 1OSPL 4LGPB 1J1XL 4FP8L 4GT7A 2EH7L 1HNFA 3ARDC 3T65B 2AXFB 3MLYL 5HXMA 2J8UE 2BFVL 1MCIA 1JNJA 4K3DH 4OLXL 5DUML 3SDDD 3WS3B 3L3JB 5FKPB 2DMKA 4X6CE 4N1CA 3DVGA 4JAMA 1CCZA 4QRTA 5F3HB 1DANU 3EO9H 5GJSL 3DVNA 4JFEE 4CJ1A 4BFEA 3SKOA 2PNDA 4KH2A 1MLBB 1WBZA 3PDGA 1IBGL 4PG9A 2J5LB 4LLAA 2CLVA 3IFNH 4O02H 5GGVL 5FECB 1D6EB 1DUZB 4ZAKB 1FNAA 3ILQD 2ZUXA 3RKDD 1P7HL 1UH4A 5DHVA 2OTPA 5JIIA 5KW9L 3DI2B 2AABL 3B2UD 4JREB 3ZDYE 3I6LE 3U7WL 4CVZB 3VXTB 4D2NA 2P48B 5C09D 1Z9LA 1U42A 4LLQB 1JTTA 4WI8A 5GGTA 3FT2A 1G9NC 1U3HD 3D87B 2IQ9L 3UZEA 3NCEB 5I73B 5MEOA 3LKSA 3CSYA 2BVPA 5T1MB 2EXYC 2OM5A 2VQ1A 4H0GA 1MRDL 2XZCL 4B7IA 4B7LA 4FQLL 2DQGL 2ZCHL 1JK8A 4D0CB 2A6JA 2QEJA 3NIDF 4UBDC 5TQ0L 5JW3H 2OP4H 2BCKB 1KJVB 3FCTA 5IVNA 4KMTH 4UTAH 2FJGA 5IIEB 3HG1A 3IU3A 1YPZE 2H26A 3QPXH 4R90L 3MNVB 1P7QD 1KCVH 4J3XA 5C0CA 4EUPG 4L4VB 3LKPA 2FZ3B 5F7KC 1AQDB 1LEIB 1R0AH 1SJHB 3WS6C 4P23C 5I75C 4JHAH 4P9MH 1MI5D 3U79A 3P73A 2H2SC 1NAML 4OLYL 5T3ZE 1T0PB 4U0QB 2XIDA 3QO1A 3QZWB 1Q94A 1E6JH 4S1DD 1PY4A 5TDNB 3BKCL 5TQ2H 3MRHB 2EDHA 5DJAA 4M7LH 3N1PC 1IL1B 3JWDL 1T04B 4X5XB 5B3NA 2IG2H 4Z8FL 1E4WH 3L3HB 3S7GA 1NL0H 5T33H 2LVEA 2NX5A 5EZOL 4TQEL 2ZJSH 5FUZH 5ACZA 3EYOA 2VNCA 1I7RB 4XNQA 1AO7E 3MLZL 3PWPA 5EOTA 3MRPA 2FHBA 3C6LA 1NGZB 4LBEB 3ULSA 4RX4A 4RGNE 4Y4KB 5D1QD 5EPMB 4Q6IB 1A21A 4ONFH 4RAUB 4HHAA 2V2TA 5ERWB 4M62H 4DGYL 4AH2A 4IMLB 1JWSA 1NCDL 4KHTL 4PP2A 2VE6B 4DN4H 1E6OL 3W5MA 1J1PL 1S7WB 4R4ND 2DQFA 1CDBA 1I8IA 5ICYB 4WW2A 4TULL 3ZMRA 3N1QC 1OSZA 1TCRA 4HFUH 4M6ML 3EFDH 3RPIA 5JW4N 1JHTA 5FYKD 4EUPB 4NWUL 1OAXH 1QFPA 2DIAA 3H9SD 4E5XA 1TITA 1YMMA 4TOYL 1P4LB 4HF5L 2YA2A 3NAAL 5IMLA 3GSNA 4KKBD 2VXTH 3EDFA 3MC0A 1U3YA 3QUXA 3PDOB 4XBGA 3UZVB 2XTJE 2YUXA 4WY7L 2CXGA 4X0KB 1OT2A 2BK8A 5IB3B 3IFPA 5IB2B 4WUKH 5C0AE 2FBJH 1JHKH 5CSZA 4K7FB 5HY9A 1TETH 1N5YH 5D72H 4D8PA 32C2B 3OKDB 5TF0A 1KC5L 3RIFF 1G7MB 5CMAA 5LGHH 4KV5E 1XGQA 4E0RA 3PWNA 2E9JA 2X4OA 2FEEL 2G5RA 4U0RC 4PLOB 5I30L 2J8UF 3HR5A 3NMEA 4LHJB 5DMIH 2EYSB 3MV9E 1J05A 4K9EL 1F90L 3KYKH 4OLEA 4X6CF 1EEYB 4P2RE 3L7FB 5JPNB 3G04A 3VD9A 1JRHI 4MJ6A 4KJYB 2VITA 5E94A 5E2TL 2CRZA 2EE2A 3BPNB 3DROA 5TDPA 3MRIA 2CK0H 3QIUB 2CSPA 3QDJD 1QZ1A 2JK5A 1NMAL 1MVUA 2W60A 2CDGB 3BP6A 2FH6A 4M7KL 3TO4A 2WUCH 4ZDHB 5K33A 4G3YH 5DJDA 5HGHA 3P9MB 3MOBH 3ZDYF 5J11C 4YHOL 5BXFB 5L9DL 2I25N 4OLUL 2HT3C 2UY6A 3N0PB 2G5BB 3LPGA 4AQ1B 5M94B 5D1XD 1CGSL 1YPZB 5F96H 1QR1A 1GGIL 2ZP0T 5HI3C 4XBEH 4CBPA 1KIPB 3GIVA 1UWGH 2DWEA 1J12A 1WBYB 3MODL 4EUPH 4PG2A 4CL7A 3RNQA 3QHZL 3V4VH 4GG6E 2YPLB 1F00I 2JKXA 4JQXC 3VFTA 5F7DB 3QDMD 5KOMC 4AL8L 5CJOL 3ULVH 2QQQA 1H3VA 4Y2DC 2C4FU 3X13B 2H2SD 2Q7YA 4C58B 1IT9L 3NA9L 2W07A 3L1OL 1YPZF 3RY6C 4PRDB 1F6AA 3EYUH 5FYLH 4MNHA 5HHXH 3U6RB 4CVUA 1A4KB 1JZ6A 2APXA 4WUUD 3LKQB 2R2HA 3U0WL 3ZYJA 1KACB 2HJFA 3C60A 5EO0B 4K94C 3MOAL 5D2LA 4GQ9H 1NCWH 3Q3GA 4HV8B 1AGCB 3VFWB 4MNQA 1DCLA 2WP3T 1TIUA 2KKQA 3K1DA 1SY6L 5E5MA 3QG6B 1NC4D 4JRWA 4S1SH 2I5YL 4ODUB 4PYHA 2BSTB 5GGQL 4OD1L 1H9VA 4EN3B 1WWAX 3PWJB 4PGCA 1YUHB 1HOCB 2IPKB 2QQNH 3BVNA 3MZTA 1DSFL 3G5YB 2CRYA 4FXKB 4MHHG 1UM5H 3FRPG 2D2OA 3T0AA 3IKCB 3C6SA 4DN3L 3VGAC 4ONGL 3SKNB 2CR3A 5SX4H 3R0MA 1P4IH 3K1KC 1RIHL 1U8LB 2DLIA 5JXAL 3RZWA 5ANMB 3MACH 3OF6D 1QSEA 1YEIH 4RGOH 2OJZL 3UCRA 4G80B 3P4MA 2FB4H 3VXUD 1A7QL 1OHQA 1B9ZA 2GIYA 4MDIB 2B1HL 3G5ZA 3DJ9A 2X1PA 4RWYL 4J6RL 2BVQB 1MJUL 4GRLC 2VDKH 4P2QB 1JZ2A 5E03A 3SE4C 5IT2L 2Q20A 2GCYA 5C0AB 3P0VL 4FQ2H 3FTGB 4JO1L 1EJ6A 1O7VA 4IRJB 4YDIL 5I6XC 3TNMA 1NGYA 2Z91A 2IFFL 3CPLA 2VXSH 3O41B 4BUGA 3U30C 4I1NB 3GRWH 1S7TB 3V79C 2AK4D 4WCYH 1AC0A 1KCRH 1KLGB 2R9HD 3QDHA 4GLRH 5IV2A 1UWXH 1Q0YL 5A2FA 4PJFE 3PWVB 3VMPA 4Z7WB 4Y5VA 2BNRD 4F37F 3OAYH 3D0VA 3LB6D 4LPUA 1D5BB 1FL6B 4OGYL 1ZLSH 1BFVL 4NFCA 4AENA 4V1DA 4KV5F 5JIHA 1MVFA 1I1YB 1QFUH 3I9GL 3O2WH 2BRRH 4MQXD 4JJHA 3VDCA 2DI9A 1XF3A 2QKIA 3FQNA 2W65A 25C8H 1NANH 3VD5A 2OJEB 2BNUA 3UZQA 3CXHK 4Z7WF 2QJDA 5F9DC 3SOBH 4YUEH 1MHHB 2P47B 3BD5A 4XNYL 4H88L 4Z7OE 5CILL 2HT3D 4XCEB 5HGGS 4JFZH 4IOFC 3S5LG 2JF1A 2EC9T 1CQKA 2PYFB 1S9XA 4NDMA 2PTTA 4J2XA 5DK2A 3WXWH 4F7EA 1NUNB 3T0BA 1AJ7L 1UM6H 4HWBA 3QXAB 4OAWB 1C5BH 1PX3A 4GG6B 1BOGA 3O4LA 5D4QA 4QT5A 3ILPA 3L3GB 4PJ9A 4PRPA 1R5IA 1ZA6A 5ADPH 3KPPA 5I0ZA 5E2VL 1RQ5A 2VWEC 5E00B 3VI3F 1Z5LB 5GRUH 1URLA 5EH1A 3STZA 4YGVB 2RBLA 4CNIA 4FFYL 4KRPB 4F8TA 4G8EA 1AXTH 4IIQB 4OFYA 4GG6F 2DIBA 1MFDL 3V5KB 3QEHA 5CD3B 4JKPL 3MJ7A 5ESAB 1R6VA 5CCKH 4IS6B 4XVTL 1MCLA 5CS7A 4R3SB 1XF5B 1WEJH 1VCAA 1LQSR 5I1HL 1AY1L 4I0KA 4XPAH 3GMLB 5F88B 1R3HB 2Z4QB 3MNWA 1PG7X 4CMMB 4PRAB 2VDQH 3RIAK 1AGDA 4PJGE 1CGTA 1VFMA 3H8NA 2C1OA 3BO8A 3S37L 5HGBB 4N90D 1X5AA 3RFZC 4PY8J 2NZ9C 4QXTB 4WDIB 1CD0A 2JB6A 3EOBB 4DFHA 1KCSH 4WI6A 2BERA 4F58H 4KKNA 2RQ8A 3IDXL 3HS0B 4EI6A 3WCYA 3D6GA 5FYJH 4I77L 1B4JH 4G9FE 2X4UB 4NZRH 4U3HA 3ARFA 4G6FD 3M07A 4HIHB 3K3QA 3NFPB 4MD0A 4HUWB 5GS2H 4K3JH 3S36H 3DRQA 3BIAX 4WWKC 4DKAA 1LO5A 1NGXA 4NQTA 4HXBH 3VDAA 3VE0A 2HVJA 3O9WA 2CJUH 1BFOB 4R26H 4JG1H 4Y16A 2JJWA 1DQQA 4KTYA 2IAMD 1F3DH 1N59B 4OM0L 3VH8B 4PJEA 3BKJH 3WFDL 2ESVA 5HYSG 3IFOB 4MAYA 2DDQH 2VLLA 4X6DE 3HHRB 3CDCA 2O5XH 1C1EH 3HZVB 4JZNB 3CFCH 3NPSB 1OTUC 5JOEA 5EOQH 2XWJA 3QIWA 4U6HB 5IHUL 4Q9RL 4LNRA 4PJFB 4X4ZA 3T3PE 4M7JH 5GS0L 3VRJB 4FXGA 3LQAL 1M7DB 1T22B 2IBBA 1IGYA 4N90E 4BSJA 3HZYB 1AGFA 1Q0XL 4WHYG 3S96B 2LTQB 3QQ3A 1QQDA 4Z0BH 2F8OA 4HH9B 5JOFA 3DX9B 3HLAA 3DURA 3IFLH 1RD6A 4PJFF 4HEME 4AG4L 2WZPD 1IEBB 3SDCC 4W81A 2GK2A 1JVKA 5E7BA 4OGAC 1R5WA 4C83A 4Z78A 5C0RH 4M43L 4YXLH 5ENWB 1FDLH 4YDVB 3UXFA 2AXGA 1MFAL 5T1LD 4HAFA 3D85D 4HSQA 1FNEB 1LO4H 3VWJA 3MBED 4LU5H 3MO1B 3P0YL 1R3IL 5HTSA 3RWDB 3FRUB 4F7TB 5FK9B 1T89A 5F1KC 4Z7OF 4NQCE 4OTXL 5BRZD 2R1XB 3WJLC 1F45A 4OCYH 2E5EA 5DJ6A 1KT2B 3TZVC 5F3HA 4TSCL 2VLRE 1X5KA 4CRPA 5CBAA 4IJ3C 5GRXG 5DC0A 3IXTB 3ZDZE 1G6RA 5JDSB 4KMQA 5F9JB 5E6YA 1RZ8A 4JO3L 1A0QH 2XZQH 3FT3A 3MLVH 5IB4A 5FGBC 5GSRB 3VFRA 3AU1B 1DUZA 3TWCL 5KANI 2GJZB 4NRYA 2CDFA 5MHSE 4MD4B 4NQVB 1GZQB 2W9DH 4QTIH 4GW1B 2XN9D 3VFOA 5LJYH 3V7AG 5HVFB 4HPOH 5EZLB 1VSCA 1HQRA 5E8EB 3WUWB 3SGKC 2NY1C 4P59L 4F9LC 1QVOB 3D69B 3IDYC 3VXPB 2HP4A 2VXVH 2E8YA 4LRIA 2O93L 4ZTOH 2OZ4H 5AZ2H 4D0CA 3FO0H 2BCKA 1BQUA 4WGVB 1WK0A 1OARL 2WM0A 2R0LL 3MRBA 2DQEL 3MNVA 4WWKD 4LOUC 3JVGA 5B3JE 5C07E 1S3KL 2VWEE 1V3JA 4L4VA 2FZ3A 1LEIA 1AQDA 3PNWB 2CMRH 3DMMD 4H5SB 2KUTA 1CU4H 3O11A 2IPTL 2GHWB 1S7RB 2FATL 3CVHH 2OMNA 3QZWA 3U9PL 1FPTH 5IF0B 4HS3A 4M4RA 1IGCL 4OB5H 1PD6A 3IDGB 3CLEH 3MR9B 5EU6E 4WHCA 3V6OA 5J12C 1KCLA 2IAND 2CUHA 2X70A 3BZ4B 1J88A 1RUQH 4BKLA 1CXFA 2P8LB 4DVRH 3L3HA 2J8HA 4QHUA 1Y6NR 2FEEI 2RGSA 2XRAL 3GSNH 3DIFB 2YUZA 3D2UB 4YH6A 3O3BB 3W39B 1FYTB 3RGVC 5HI5C 4ZSOE 4WFGD 1Q8MA 2BJMH 4WHYH 1QFWM 4EDWL 5EORL 4UUJA 4X6DF 3RY4A 4Y4KA 4X7TB 4PREB 5JR1H 1MJ7L 5J3HC 1SJEB 2Z31D 5I2IB 4R0LC 2MPAH 4NNYB 3QUYB 2VE6A 3SDCD 3T3PF 4KZEH 3VG0H 3DECA 4PJ7E 3QEQD 1XGYL 1RZIA 5DD1L 3MBXL 4Y4HD 1EJOH 2Z8WC 3IVKB 1KV3A 5HYIA 4JKLA 2PO6C 4QRRD 4DOHE 3ARGD 4HWEL 3ULUL 1HKLH 3DV4A 4F9PC 1ZLVK 4AM0A 3F7QA 1UA6H 5I1IL 3BPOB 5DZLA 3E8UL 1UKSA 5D2NA 3TM6A 2HFEA 1EO7A 5CUSL 1JUFB 4NO0D 1JPGB 3PDOA 4OKVB 4NQCB 2J8UA 3BPLB 5DHYA 4POZD 5I6XB 4N0YH 4X0KA 5JW4R 4PRIE 1KLUB 4W6YB 5IB2A 3U30B 3MV7E 4X6CA 1B4RA 5E6ID 3K74B 3G08A 2E6PA 1T21B 4XC1L 3AXLA 4H1LB 2YN3A 4X7SH 3OKDA 1T1XB 3BRFA 4JFEA 2XZZA 5KVDL 2BRQA 4KDTC 1G1YA 3NZHH 4XGZB 4KUZL 1G7PB 1WITA 3CSGA 4JZOA 4XCYB 5FHBH 4U6XA 1UXWB 2VXUL 1JGVL 4GO6B 5EIVA 1ED3A 4PUBL 5B8CB 1CL7L 1CF8H 3ZHLA 3KPRA 4YDKH 2EYSA 4KKAD 4XMKH 1EEYA 2OTWB 2AJYH 3Q6GH 1CTNA 5JPNA 2E7CA 2J88L 3KWWA 4GUPB 1BGXL 3ZDZF 3OKOB 5SWZE 4U3CA 1HH6B 3GZKA 4M6OL 3HB3D 1VA9A 5M95B 4FG6D 4OGZA 2GAZA 2D4FA 3VCLB 4LCCA 4NQXA 3WIIH 1U8HB 3P9MA 5HDLA 3D1MC 4XCCL 4AIOA 5I8OH 5FAAA 4WVRA 4HBCL 3TV3L 4EOWH 4C59B 2VERN 4HKZA 2I26N 1R3KA 3U82B 3P30L 4PV8B 3AREC 1YPZA 4JVPA 4HCRA 2NXYC 2QQLH 1CZ8L 5FGCB 2NW3B 3O6LH 5CFHA 4GAGL 2VISB 1M6OA 4FTVD 2H32B 3BN9C 5C07B 1UXSB 4HJGB 4LF3A 3PE9A 5F7DA 4NGHL 3LVEA 4HMCA 4F57L 2I60L 4I2XE 1OAUH 4IOIB 4PGBB 2WWKO 3DXAE 3BEVB 2A38A 5GGSB 3W11D 4HK0B 5E99H 1TZIA 1GH7A 4PRDA 3UYPA 5K9OB 5EU6B 4HJ0D 4MA1B 4C56D 4LSRL 3GBNL 5B3JF 2DQHH 2EDYA 4D9QE 2NY3C 4LLYB 3JWDC 1PYWB 4HIEB 1J0YA 2JJSA 1A3LH 3PGFL 3HNTH 4J8RB 1CFVL 3D25B 4MQ7A 4XP1H 1AGCA 3VFWA 5ILTL 1AO7A 3DX8B 1CD8A 4ZSOB 3RGVD 5HHOE 5HI5D 3QG6A 3RZCB 5FKAA 3X3GL 3RBSA 5J56B 4ODUA 5CEZE 5DUPH 2JIXA 4EN3A 1UQSB 1YUHA 2DL2A 4OF8A 5E9DD 5J3HD 3B9DA 3GK8L 3T04D 4APQB 35C8H 1RUML 3G5YA 1BD2D 1A6AA 1KENH 1VADA 3NFSL 1T0MB 3WYRA 4Z7UE 4PJ7B 5H8DA 5I15H 3QISA 3SKNA 5IKCB 3DUUB 1U8LA 3LHPL 3BPCB 5F71A 3QR2A 1CICC 3BZDA 4U49A 4U1JB 1KJ3H 3MLSL 3IDIB 2ZCLL 3F8UB 1T4KA 4BZ1H 3WSQH 5AWNH 1I1AD 3QIBB 3QXDA 5EBWA 4TYUA 4LFHG 3I6KB 4ZXBD 3DBXA 1NJ9A 4YHLH 4J23A 5ID1A 4PJ7F 5GGTL 2KPNA 4MDIA 3RDTC 5EFIA 2ITCB 1A3QA 4CUCA 4DZBA 3EOYG 3UTSE 4RNRB 5KJRH 1YMHB 4PRIB 2H32H 5J1SC 1AI1H 3DYMA 1D5IH 1MAML 3MRDB 5C0AA 4G6MH 3FTGA 4KTEL 2FGWH 3G6DH 3NCBB 1UJ3B 5TGBA 5AD0A 5IGXL 2O5YL 3ZTNH 1N26A 4JRYE 3CUPA 3HMXA 1S7TA 1S78C 4U6YB 5I76B 2VSDA 3ZYIA 5C0GB 4M02A 4G42B 4HWBH 4NNPL 5FA4A 4Q7DA 1Y0LA 3MV9A 3IJYB 3J7HA 4O4YL 4P5KA 1JGDB 1QPPA 4K9EC 1PY9A 4GKZB 4P2RA 3L3KA 4HXAH 3TPKA 1L6ZA 3KAAA 4JN1H 5EC2B 3VFVA 4TPRH 4L9LB 1D5BA 4K3HA 2A74A 3JV4B 1HHKB 2NY6C 3C2AH 3A6CH 4JRXE 4X6EA 5SWZB 5IR1A 4JDTL 1YEJH 4X83A 4YX2H 3U4AA 4G8GE 1A6WH 3WO3B 4LSVL 3FQUA 1PBYA 2OJEA 3QFDB 4NJ9L 4Y0GA 1U92B 3TCXA 3TFKD 2VOTA 1QLRB 3UJIH 1T66C 2FL5B 1A1OB 4K23H 4NN7B 1KFAH 4Y1AD 3LCYA 2VXQL 5KOVC 3LQMA 2PYFA 8CGTA 2DKUA 2YS4A 3ARDA 2EXWC 2NXYD 2VZ3A 5DQ9B 3ZKSD 1F4WL 2VSCA 4P4KB 2R0WL 2R1WB 4OAWA 3WHE0 4HDIA 1UURA 4GG6A 5IG7B 2IF7A 3PGCB 3TZVB 3QDGD 1FZMA 4LEOB 3BOVA 3PL6B 2OMBA 3DXAB 3KPNA 4FXLA 4OZ4B 1H3PH 3G5XB 4YHPA 3OBAA 4YGVA 3CGTA 1IQDB 2YMXL 1MEXH 4C4KT 3RTQC 3QXUA 4KDWA 4P3CH 2VABA 4RFNC 5K9KB 1KTKE 3NABH 1KELH 2C7UB 3MJ9L 3V5KA 4NRZA 1IQWH 5CD3A 4NPYB 4FQPA 5ESAA 3RUGE 4NQEB 4GJTB 4XPBL 4B50A 4JQIH 4R3SA 5ESQB 3ZL4L 2AGJH 3NA4A 4Q58C 1UYWH 2WBJB 1A14H 1U95B 4AT6A 2OL3B 4QOKE 4JG0L 5F88A 1EHLL 4GBXD 1X4YA 3TBWB 3LIZL 2NY1B 3VXRD 2ZUQC 4LSTL 5F9WC 1H3TA 4X98A 5DRWB 3WFEL 4JDVA 2B1AL 3TJEH 1NC2B 1J0KA 3BWAA 3HTLX 2VKWA 3HI1A 4JHZA 1J86A 4XPFL 4Z7UB 1KJ2L 1SJVA 1Q38A 1EEUA 1MHEB 3REVB 1CT8A 2X4QA 1I7ZB 2QBWA 3U0TA 2BXZA 5IK3B 3H7LA 1CICD 5D7SL 1P5UA 2H8PB 3P11L 2F74B 2XA3A 3FQXA 4HQQH 3PP4H 2OSLB 4HG4J 4K2UH 4UB0L 1GC1H 1U91A 3QDGE 4PJCB 1LE9A 3WS6A 1HSBB 4NT6A 1A5FL 4P23A 4XNZB 5BJTB 4Z7UF 2FX8H 4XP9H 4NJAH 1UT9A 5F89B 5IMMB 3RDTD 4Z5RA 3UTSB 1BFOA 1INQB 3OL2A 4XHJC 2VZOA 4TVPH 3VWKD 3VH8A 1OTTD 2B7DT 4GOSA 3GKWH 1Q9KB 4PD4K 1D5XB 3SEPA 5J12B 4WUUA 1VEOA 2DTMH 2CLRA 4EBQH 5FOBB 1ZA3B 4I0PD 4PJCF 1RHFA 2DQIH 4BSVB 1IAIH 2D0GA 3DARA 4N0CC 5FHAH 2DICA 4PD4J 4N8VB 5I17B 3HZVA 1U8QB 1IEHA 5HI4D 1QO3B 4DQOH 4TNWF 1GIGH 3HE6C 1XCQB 4PJFA 5CWSB 4S1RL 1U8IB 4JFFD 4LCYB 5T1KD 3T0EB 2V7HA 4WFFD 3MA9H 4FABH 2ADJA 4JRXB 5I1KL 4IHOB 2Z8RA 2OI9C 2RR3A 5SWSB 3WLBA 2HN7A 3EOAB 4AIZB 3MRGB 3MCKB 5IFAH 4Q74A 5DTFA 4XPHL 1IEBA 4I5BB 5F9OL 3KLHC 3WUZA 1A1MA 3V5DB 1DVFC 1BBDL 4MB4A 5JIPA 5ENWA 2G9HB 2WQRA 4WW1B 1IGFL 1ETZB 4OCXH 4K7PY 3TT1L 3O0RH 3O2VL 1EGJA 1FZOB 1F4XL 4Y5YC 1EUTA 1FNEA 2EXWD 3IETB 1LO2H 5D7KD 1KEGL 3CDFA 4OLWH 5J9PB 5DZOA 5JQ6H 2EYTB 1A2YA 3LKRB 3TVMC 3RWDA 4OM1H 1BQHB 1NMCB 2VL4A 2MMXA 2AEQL 3KYAA 5A2JH 1NFDB 4EQ2A 3AS2A 3LEYL 1WCBA 1I9JH 2Q3ZA 2M26A 5AAWA 1J5OH 1P2CA 2YXFA 2HLFC 1KT2A 4OGXL 2V2XB 1KN4H 4ZPVB 1DQLL 2O61B 4ZFZB 2EC9U 4GXVH 3ZKXC 3O3UN 2EEBA 5F7NC 3U0PB 3UTPD 3FB7A 4JE4B 3IXTA 5EU7E 3NVQA 5JDSA 2EDRA 4MGXA 1QFOA 4XX1E 1T7VA 5F9JA 4LPCA 5TE7H 4QRQA 1NLBH 4P9HL 4P99A 3S35H 4JPIA 5CJ5A 2VDRL 1TJGL 2KQMA 3DV6B 1IC5H 1IC4L 3PGDA 1DL7L 2DLGA 1AHWC 3NN8B 3MROB 1L7IH 5GRJH 4PJGA 4DW2L 4EEEA 1A7NH 1C5CH 1U8OB 4L8DA 2AV7A 3VFUB 5ALCH 4PS4H 5EZLA 1PG7H 2QADC 5E8EA 3RUGF 5IEHB 4EVNB 3WUWA 1YN6B 2CIKA 3IKKA 4LMQI 3HPLB 3OQ3B 1NEZG 1NDMA 1I3VA 1QVOA 1A7RH 2JCCA 4UINH 2ZSVB 5BQ7A 3AREB 4ZYKB 2WV3A 4G9FA 1K4DB 5B38G 3QAZC 2C3WA 3PJSB 3RWJB 1X4ZA 3FOLA 2P5ED 2R15A 1ZLVH 1FSKC 1XR8B 4JQXA 4HUVB 4XXDA 1FL5B 2FECL 5I16B 3RA7L 4Y2DA 1BBJB 2COQA 2D7MA 1JWUB 4JN2A 1NAMB 4GAJH 4WFHD 3QXWA 2R1YB 5EUOB 4YHIA 3TF7C 5D70L 2YD7A 2R56H 2V5TA 5DMJB 4H5SA 3L95B 4PB0L 3W9EA 5HYJE 5C0BE 4QHKJ 1SMOA 5IF0A 2NY3B 4U1HB 1C12A 5IQ7H 3F5WB 3IDGA 1JFQH 5JZ7C 3GJFK 4X6DA 2RFXB 4YO0B 5CIPH 5I0DA 3BZ4A 1LNUB 2BOCA 2HKFL 3SDDB 4WTXA 5EUOF 4FQ1H 5KSBE 4ELKA 3OKLB 4A6YH 1BAFL 4WI4A 4LSSL 1Y18B 4U1KB 3V4PL 1RUPH 1T5WA 1KGCD 2R29L 2ZCKH 1CL7I 5GS0C 1KJMA 4ORZC 1A8JH 5D7LD 3LQAC 3SGDH 5IQ9B 3UMTA 2HT4C 5DD6B 1T1WA 5FF6B 2VH5H 1QNZH 1F58H 3UTTE 1E4XH 3MREB 3F12A 1QBLH 1MHPL 2DQJL 5EWIH 4ODSH 3EBAA 4WO4C 3SE9H 5B38B 3LMJL 4Y5XB 3IAGC 2LU4A 3GNMH 3E6HA 5C09B 1N2RB 4H8WH 3CDGB 3MUGB 2DTSA 1W0YT 3P77A 2GSGA 5F1NA 5E8DL 3JWNC 3C5ZC 1KXVC 4GG8B 5I1CL 3T09A 4GMTL 1HZHH 1ZT7A 1J7VR 3DETC 3I50L 4PRNB 1CLCA 1XCTA 1DBKL 4GSDH 4GRLA 1ZT4B 1B2WL 1ZHBB 1MCFA 5DR5H 5DYOA 3SE4A 1AQKL 2IPUK 5IBLD 2EO1A 1JPGA 5C08D 4KPHL 4GFTB 4NQCA 2P24B 4QCIB 5A1AA 3K0WA 4LEXL 5GJTL 1KLUA 1FZJA 3HC4L 4UDTB 4ZFOL 4KVNL 1DBJH 1P7QB 2A9NL 5CJQL 1K2DB 1MFBL 2VLRA 3QCTL 5DJZB 5B21A 4H1LA 4D94A 2VAAA 3CK0H 3BMWA 1Z9SA 1S9YA 1TQCC 2X4NA 3FOMA 4ZUVB 1AE6H 4X6FB 4FZ8H 4XGZA 1G7PA 4XCYA 3FL7A 2EH8L 3DRTB 1UXWA 2H9GB 4UT7L 4BQ6A 4YWGH 4K3DL 5EOCH 4MLIA 3GM8A 1IAMA 1NAKH 2YPKA 3JV5A 4WU5B 3U46A 3EO9L 4NM8H 2J4WH 5JXEC 4YIQA 1DQDH 2LFGA 4G7VH 3B9KD 4YHNB 4KHXH 1NCAH 5I8CA 2H3NA 2YXMA 2AJZB 1HH6A 1PLGL 2ZZUT 3FB8A 5CGYD 5J06A 2YBRB 1KXTB 3IFNL 4O02L 2VDOH 3VXSE 3O3AA 4Y7MA 2R4SL 3DVIA 1U8HA 3PHOB 2YUVA 2C3VB 2P42B 3U1SH 2O26U 1SYVB 2HLAB 2AJSH 4MA3A 1UEMA 4JY4B 4I4WA 5DD5H 3PHQB 4HX1A 1CFBA 2NNAA 5E2WH 2NW3A 3OJDA 2VISA 3PQYD 1UXSA 1U6AH 3V6ZB 4Z7VE 1QSFE 3S3PA 4KI5D 1BVLA 1UADC 3DX6B 4MS8C 5TFSH 2C9AA 5J89A 3H9SB 4PGBA 1CTOA 5HPMA 5HYJB 4LIQL 4RFNB 5D9SA 5JW3L 4L3ED 1FZKB 3MUY1 4KMTL 3VFMB 1RHHB 1I85C 5EU6A 3QPXL 1MY7A 1CFNB 3BIKA 1MRFL 3JSSA 2C5DC 3QH3B 1KCVL 1KG0A 1FAKT 4K7PL 2IBZX 1PVHA 4XXCC 1A1NB 4ZO7A 5C0FB 5C8JB 1R0AL 1KEML 4JHAL 1FVEA 1ITBB 1XF4A 4P9ML 4LPWA 2AI0H 5DVMA 3MUZ1 1OAQL 4URTB 3KPSE 1BIIA 4ZSOA 1E6JL 5DFVC 1OWWA 5FGRA 5IB5B 1FNFA 5I71B 1OGAD 1CDUA 4M7LL 4WFEE 5FA3B 5KSAD 3QUMA 5C0DB 3QUZC 4I48A 3BQUC 2IG2L 4QRUA 3JV6A 4WI9A 5KSBF 3BZEB 4APQA 1B0RB 1NL0L 1YNKL 5KVEL 1T0MA 2ZJSL 1C08A 4XHQA 5FUZL 1H8SA 4PJ7A 5IHZB 1DEDA 4YBLB 3O4OC 3CXDH 4NN5C 1I7UB 3BPCA 1VPOH 1QRNE 3C5ZD 1W0VB 2A0LC 1BQLH 2PTVA 4WWKA 4C57C 4ONFL 4ESKA 4O9HH 2OLDA 5KN5A 1SVZA 3FHQA 4HIXH 4M62L 3QWOB 1MCWW 4OZFB 2SEBA 3C8KB 4M6AA 1V7MH 1G7LA 1LO0H 2X7LB 5D1XB 1EPFA 3L3IA 4PRIA 4Z7QE 3MV7A 2B5IC 4LAQL 5FYKH 2F8XC 4PJBB 4Y19D 2Y25A 3DPBA 5FEBA 4NHUA 1WT5A 2OTUB 2V7NB 3LN5A 4DVBB 5D1ZD 4KZDH 5HDQH 1MAKA 2BNQE 2VXTL 4HULB 4K8RL 4Q97A 5I76A 4O5LH 3IDJB 2KQNA 4G42A 2KZ1B 1BQSA 3U83A 3IJYA 3VXMD 3S3JA 3D0LA 2FBJL 1JHKL 2DF3A 2X44D 1E4KC 4E41D 3KXFD 3RAJL 4H26A 3RWGA 5E8NB 1MHCB 1HHKA 2W0FB 3FO9B 5LGHL 4YFLF 5SWZA 4MMZC 4CU6A 5I18L 4AYFA 1SQ2N 4XCFH 3ELAT 4NO3B 4Z7NE 4ZS6D 5IOPB 5DMIL 2EEDA 2XWTB 1X5FA 1Y6MR 3VXSB 4B41A 1KIQB 3KYKL 4U1LB 2DYPD 2ZNWA 4NYLB 1BJ8A 3EYVA 5HGAA 1ZEAL 2AS5M 4MDJB 2CK0L 1DDHB 2W1NA 5DJ8A 1R3JB 2V5RA 3UPRB 1EAPA 5DQ9A 5LWYL 5DQJB 3AMKA 2WUCL 4WI5A 5FO8B 3F7VB 4G3YL 4Z7VB 1L0XA 4RQQB 2DQUL 1OP9A 2XQYK 3HAEB 3TZVA 3MOBL 4I2XA 4KQ3H 2NY0D 3TBYA 3DXAA 3ZKXB 5DLMH 1FV1B 4PP1C 2YUWA 2X4RB 4PRHD 3VGGA 3TBSB 1P84K 3OJVC 4ETQB 1FG2B 5FGBA 3ZT5A 5K9KA 1UWGL 2ENSA 4RRPA 2C7UA 2YD1A 3V4VL 5L2KE 2P49B 4Z7VF 2ZG1A 1ZLUK 2F54E 4UZGA 5D71H 4WTWA 1X3DA 5I8EB 1QLFA 1RJLA 1YEEL 4WGWB 3X17A 3L5XH 3CFIC 2L7JA 2G2RB 2HG5A 3GSRB 3KPSB 5HHOA 2WBJA 3Q6FA 2QADB 3LKOB 4DTGL 1U95A 5FYLL 4U1GC 5HHXL 3CFJB 3DGGA 2AVGA 2AK4B 3TBWA 5I1EH 3D39E 1J0JA 4I3GA 5DRWA 4F9LA 4OZIA 2BNRB 3EFFA 4XVUC 1BJMA 3I6GB 1MCPL 4GQ9L 1HEZB 3V9FA 4Z7UA 1NCWL 3MV01 5E2UH 1BF2A 3EYSL 1MHEA 3E6FA 1IKFH 4OUUB 5E8OA 3REVA 1RULH 4XTRC 3TBTB 5BO1L 2R0ZL 4N5UA 2LV4A 4MAUH 5TDOA 5IMKB 2ZOLB 3QCVL 3WIFB 1I7ZA 5C0EB 3G6JE 5IK3A 4R8WH 2QL1A 2W0LA 3MRRB 4YE4L 4HMDA 4FTVA 4CVWA 1OW0A 3WDIA 2F74A 1EFXD 2YSSA 5CEXA 2QQNL 2OSLA 3TJHC 3HE7C 4O2EB 4PBXA 1N8ZB 1W8OA 2IPUG 4TUKH 2DBLH 5IMMA 3RL1A 3UTSA 1A9BA 1IEAA 1WTLA 1P4IL 2EC8A 1MFNA 1TQBB 3EDJA 3KLSA 4ZS7H 4OJFH 4P46C 4LVOB 3R8BB 4R2GC 3MACL 1QKZH 2VZSA 1D5XA 1DEEA 3MV8D 4NIKB 2CDEB 5BVJA 3PWUA 1ZV5A 1HHGB 1CD1B 1CXIA 1YEIL 3N1MC 1OWRM 1DQJB 4JRYA 2FB4L 4QHLB 1JWMA 1EXUA 3MRQA 1U8QA 1DFBH 1IMHC 2GI7A 5E6ZA 2J6EA 5MENE 4Z7QF 1FO0H 1XCQA 3MLTB 12E8H 4HKXB 1Q9OB 1OQXA 5A3IC 4FFZH 3DYOA 1U8IA 1WBXB 1CXHA 5KS9E 4LMQE 3O8XD 1F3JA 3EZ8A 2VXSL 4JRXA 4R0LA 4HC1A 3S3SA 1UVQA 4NCC2 4TNWK 5I1DA 4RIRB 3WNPA 1IRAY 3GRWL 2BVEA 2M2DA 2X9XA 4G8GA 4HUNB 4W68A 5ICZA 4WCYL 4XRCB 2JB5H 2PXYD 4I5BA 3X14A 1ZSDA 5D5ME 1DR9A 2RHEA 2PO6A 3K2UL 4G9DA 4LSQH 4KK6D 4F9PA 4M1CC 4BFGA 3ULUE 2G9HA 3MGTB 4WW1A 5EZIL 1QFUL 5L7XL 2BRRL 5MP6H 4ZG1A 4QGTA 2YK1H 1FJ1B 1X5YA 3IETA 5GS2D 3QWRD 1R5VB 2Z92B 3K81A 2ZG2A 4OSUH 1BQHA 2FECI 2NTFB 4YUEL 2X89D 3PG2A 5JHDD 2FIKA 5TH2B 1QYGH 4XP6L 4L4TE 1ZK9A 4G6FB 5D6CB 1N6QH 1BM3H 3MUJA 4KDTA 1J8HD 1V5JA 2ZUWA 4LVHB 3GJFH 4JM2D 1A6PA 5INDB 1PQZB 3IS1X 1AXSA 3B8SA 3SDAB 1UM6L 4JFQB 1I8LC 4JFPB 3DSNA 2BMKB 1K8IA 1T7XA 5L2KB 2IAMB 4TSBH 5LKNA 3OKNB 3RUGA 6CGTA 1WSST 5ADPL 1BFSA 1K3ZA 3UROR 4UOW0 4YDLC 1PZ5B 3FFDB 5GRUL 1ZS8B 1OY3B 4PY8I 4QOKA 1T2XA 2ED7A 3CFDB 1ORQB 3MROA 1WZ1H 3UEZA 2MQCA 1PKQB 5A16A 1BREA 5GRVL 2AKRB 4X6BB 1C16B 5AG8A 4JANA 4EZMA 4Q9QH 5IEHA 3LEXB 4YZFE 5HD8C 1YN6A 4YEFA 1YEFH 2RB8A 2ERJC 5CLTA 5FCUL 2NYYD 2NY2C 1K6QL 1WEJL 4LVEA 4JGJA 2ZSVA 1U58A 1FG9C 1G9EA 3AREA 2X10A 3G6JB 3DUSA 3HCVB 2Q76A 3PJSA 5CZXD 3RWJA 1YC7A 3MJ6A 2YC1A 3QEUA 3B5HA 4K3GA 1XR8A 5AUMA 3TJHD 2HA1A 3HE7D 3QDGA 5I16A 2HFGH 1KCSL 2ZPKL 5C0NC 2GITB 4P2OB 2WAHA 4F58L 1SVCP 2EEAA 1JWUA 1NAMA 1I1CA 2R1YA 5T1LB 3OR6B 1HXMA 3G6JF 5HPOA 5FYJL 1B4JL 1BJ1H 4P46D 2R8SL 4I13B 2FGZA 3MBEB 4KJQC 4R2GD 4FQXC 4NZRL 2ATKA 2X4SA 3VFSB 5C0JA 5DC4B 3RWCB 2ICES 1FGNH 5IJKC 3F5WA 4HK3J 4PJIA 3FHAA 3QI9C 3S36L 1EK3A 2IH3A 3OX8B 3SJVE 4YO0A 3HG1D 3IRZA 2AJVL 1V3MA 3HI6H 4CN6A 3QUKA 1AIFA 4R26L 5MENB 5IFHL 1DBBH 4JG1L 5ETUA 4Z76A 3NCYP 1ZAGA 5C0CD 1Y18A 4U1KA 2VL5B 1K8DB 5A3ID 1G7JB 1I3RB 3BP7B 1A3RH 1LP9B 4O2CB 3HRPA 1OGTA 4LLMA 5ALBL 4B53A 2D03H 1YQ2A 3FQWA 4NKQB 5DD6A 1FFPA 2O5XL 1C1EL 3MREA 5ISZE 1MCJA 3VG9C 4YQXH 2Y5EA 3F58L 5GQBA 5EOQL 1LK3H 4CU7A 1MH5A 1JF6A 1IGTB 4Y5XA 1I9IH 4M7JL 4PLJC 1CICA 3C60C 2D3VA 4OD2A 5KS9F 1N2RA 2DLEA 3QEGH 3QHFH 4OCMC 2NX5D 3OG4B 5ACLA 2IBGA 3CDGA 3AS1A 3PWPD 4MB3A 2OR9H 2PR4H 4XAWL 4QRSB 3C6LD 3C5SA 5LGJB 3RDTA 1PKOA 4Z0BL 1XGPB 1NGQL 2IADB 4PRNA 3SDYH 4RFOH 3B4NA 3FQTA 5FDWB 5DVLA 1K5NA 1ZHBA 5D5MF 1FNHA 2GUOA 2WLYA 2NY5H 4OI7A 2XQYG 3O6FC 4QCIA 2F53E 1DUYB 4WRLA 5C0RL 4L4TB 1S8DA 1KB5H 3ETBF 5IESL 3ULUF 3T3ME 2QR0B 3CIQA 3EGSB 3WFBH 2D7TH 5DRNB 2NR6C 1MCSA 3D18A 1LO4L 4ZUVA 3C8DA 1OM3L 4GKNB 2R23A 3DMMB 1JL8A 3JV0A 3NTCH 1YMMD 4HJJL 1YEKH 3DRTA 2H9GA 5MEQB 2EIBA 4P9HC 2VC2H 1LD9A 1VFOA 5DA0B 4OCYL 2FJHB 4JCLA 3QUXD 5J8OA 3MPCA 1JE6A 3GO1L 4WV1B 5AG9A 4GS7B 3HNSH 1HYRC 2VO5A 2MCG1 3P9LB 3HC3H 4NHCH 2A6IA 3DHJA 4KAQL 2UUDK 3TO2A 3TBVA 1A0QL 1RUAH 3MLVL 2ZWLT 1AKJB 1EO8L 2YBRA 4ZFGH 1QP1A 3VJ6A 1VKXA 1H5BB 3GUTB 1CXEA 4ZPTB 3WN5C 1MCHA 5F21B 3PIQA 5LCVL 2NY2D 3VD3A 5E8PB 4N0RA 5JLZA 3MQIA 3LS4H 3RL2B 3PHOA 2C3VA 1JZ8A 3PXJA 2FO4B 2A73B 5AAMA 2HRPL 3BDYL 4QXUH 3DLQR 4WEUD 4OCSL 5ADOH 4YZFF 2DKSA 5FM4A 3QEQB 1UENA 2LAGB 2VLJE 1P9MC 4Y4HB 5C0ND 2AJXH 3OHXB 1KNOB 3FFCB 3KR3H 2YD8A 1BZ7B 3MRCA 4P0DA 2VXVL 1IGMH 4F7CB 3TO4D 1S9VB 3DX7A 3ARGB 3RTQA 3WKNA 3FO0L 5GGSY 4OI8A 2VIRA 5HYJA 5C0BA 1FLTX 4DJMA 4Q0XH 1A6TA 2HWZL 1RHHA 1RU9H 3E3QC 3L5WA 3SJVB 1A6VH 3D3VE 3QH3A 2IJ0C 2ADGB 5IBTH 4IRSB 3OR7B 5EO1A 5C0FA 5C8JA 5KSBA 1CDHA 5E6IB 4U6TA 3MXVH 1SY6A 1CU4L 1NPUA 2NXZC 4PJ9C 3CVHL 4XAKE 4LDLB 1FPTL 2X6MA 2XFXB 4OB5L 3CLEL 3UTTA 5FA3A 1VENA 4L29A 2FSEA 1RUQL 5C0DA 3C09B 4XMLL 3WEXB 3RWEA 5LXGL 1B0RA 4XC3H 3MRKB 1Q9WB 1SEQL 1YN7A 3BEWB 1X5ZA 1CE6A 3BD3A 2CGRH 4OCRH 3C60D 4BUHA 4H25B 5EN2B 5EU5A 5BZWA 3VFPA 2DI8A 4HZLA 4KK8D 1Q1JH 2GK0B 4DKEH 4ENED 3BH9B 1W0VA 4PRBB 2A9ML 2F19H 3KLAB 5JR1L 4TRPH 1RJYA 1PW3A 4MX7A 3KYNB 4UV7L 1JZ4A 3QWOA 3W9DB 3G9VA 4ODXB 4XI5C 5CP7A 4KZEL 3VG0L 5SX5K 2F53B 2R39A 4XVJL 4YHZL 3KLDA 5DVKA 1EJOL 3H6JA 1IGJA 2Y06L 4H0HB 2V9TA 4N0UE 3O45B 5DK0B 4HMEA 4OUOA 3OXSB 2V7NA 3GMPA 4PGEA 4PJ5E 1ZLUH 3HE6A 3NZ8B 4KQ4H 3GEWB 2B20A 4X7EC 1Q9LB 1QSED 1D9KC 1CFQA 2PYEE 3KYMB 2ADFH 3IDJA 4N0YL 3QPQC 5B39B 4JB9L 4C56B 3O9WC 1VESA 1I8MB 4NUGL 4MJIE 2GEEA 4X7SL 3RX5A 5J13C 4EI5B 1FIEA 5ITBH 1WICA 3KJ4B 1LK2A 4D3CL 2ITDB 4M8QB 4NO3A 3IU4H 2YD6A 4JM4L 4NUJB 2I24N 4W4NA 3ZDXE 2DN7A 1DVFA 2XWTA 3VXSA 1KIQA 4XMKL 5K9JH 1W72B 3TP4A 4NYLA 1MNUH 2AJYL 2YWZA 5DGQA 5E9DB 1DE4B 3L9RB 5ESVB 4Y5YA 4MDJA 4GMSH 1H15A 1BD2B 1DDHA 3IDNA 3L6FA 2VUOA 3TVMA 2WIMA 2XZAH 1R3JA 2CKBB 3OZ9H 4V1DD 1LMKA 3UPRA 2Q8BL 3STLA 4OD3H 1J18A 4PIRF 4ISVA 2VLJB 2VLME 3TCLA 4TTGA 4UT6H 5FO8A 3KPTA 4OZHE 4Z7VA 1QSFA 4RQQA 4BA8A 5D93C 4NO5B 4TUJB 3V6FB 2DQCH 4I18B 2DL9A 5I8OL 1GXEA 5C0IB 4EOWL 4QTHA 1AP2B 2P44B 1EEZB 1HHJA 5SX4I 1I1AB 3OKMA 2X4RA 4ZXBB 5FOJA 1VGEH 3SKMB 4JCMA 5LBSH 1NBYB 5DEFB 5EO9A 1R24B 3V52H 1TTFA 2QLVB 1WC7A 1JF1A 2L7UA 3VWJC 4R96B 5I8EA 2NY4D 3T1FB 1HQ4B 4KKLC 1OAUL 3E1F1 3HZMB 2P4AB 3OXRB 4PJ9D 4PRPD 5IJVB 3KPSA 2VLKE 4AMKL 5E99L 5DJ2A 3LKOA 3SGEH 3WXVH 2BY2A 3SDXB 3VMOA 2VQUA 1NGPH 2R0KH 5FM5O 3MUHL 1HCVA 1KJ2B 4LCIH 3L3DB 4NC0B 3R1GH 3LDBB 1BOYA 1A3LL 2HJKB 5H35B 2AV1B 4DUVA 4OFYD 1JPTH 3RU8H 3U2SA 4GLRI 2J5LC 5KVFH 1A7OH 2XKNB 1T3FB 5JO5B 3QJHB 3FZUD 4ZAKC 3H3KA 5IMKA 5F3BA 1KYOK 1QRNA 3WIFA 5C0EA 1W72H 5JPMB 5DUPL 1I1FB 1SBBA 2OR7A 4JREC 2FEDD 1IARB 1TZHA 3D9AH 1BVKB 1F2QA 4ZFFA 35C8L 4XCNB 4HC1H 2BX5A 1H8OA 1N8ZA 1BLNA 4MA7H 4XI5D 4Y1AB 3WHXB 4NO2A 3S34H 15C8L 4FQXB 1S7UB 3B2VH 4DCQA 1FLRL 2IALB 3A67L 3WNKA 3MRLA 1YYLL 5EIIB 3VGFA 4G5ZH 3MCG1 3E3QE 4HGKC 1ORSA 1MJ8H 2ICCA 1UB6B 1HHGA 3WSQL 4PJ5B 5AWNL 1K4CB 4H0IA 1CD1A 3LH2L 1YNTA 1DQJA 2Z35B 3ARFD 5AZEH 4YHLL 2BNQA 5E24E 3T4YA 5LAXA 4HT1H 2PYEB 5HHMD 5CAYB 4K8RC 4PR5A 3MLYH 4XZUA 5KJRL 5CD5C 3JWOH 1AI1L 1MLCA 4X4YA 5DJ0A 4HKXA 1WWWX 1OGAA 1AD0B 5DUMH 3O9WD 4N5EC 4Y16D 5HDOA 1WBXA 2CPCA 4JPWL 1HNGA 2FGWL 4OQTA 5HGDB 4KRLB 1X7QA 1S9WB 1RURL 1ZVSA 4WHTB 1N4XL 5GS1B 4UQ2B 1N7MH 4X5WB 2ESVD 4WO4A 4RIRA 4FQHB 5CJBA 4R7DB 5E0QA 1A4JA 1IBGH 1F8TH 4MAYD 2HMIC 5F1IB 4PTUA 4XRCA 3V6OC 3VI4F 5GGVH 4X4ME 4ZOBA 1JRHL 2IH1A 4GBXB 3C5ZA 4HXAL 4YBQC 1P1ZA 3QIWD 4JN1L 3T8XA 3VXRB 3BRGC 2WP3O 5KW9H 3NH7H 2GT9B 3GI8L 4NSKB 4JQVC 2I9TB 3U7WH 4FHBD 1RUKH 5GGUA 3N9GH 1YEJL 3B9AA 4ZO9A 1FJ1A 4YC2B 4Y4KC 3ZDXF 4Q6IC 1A22B 1R5VA 2Z92A 5HVGB 4OZHB 5J1TC 2C1PA 4P3DB 4YDJB 3KDMB 4MHHI 4YFDB 2NTFA 3EOTH 1MRDH 4YK4B 3GMNB 1P7KB 4K23L 1KFAL 2DQGH 3UBXG 3W0WE 4TVPD 4HEPG 1JGEB 3BP5B 5MERB 5CP3H 4I3SH 2E7BA 4FQCL 4M03A 4XBPB 3CZFB 3S36X 2VN4A 4J3TA 4UNUA 5INDA 1I8KB 4X8XA 3SDAA 2HVKB 4GW5B 4JFQA 4UQ3A 4R90H 5DZNA 5DO2C 4OZHF 5L2KA 1TJHH 2F54A 3VWKB 4X9HA 3VWJD 1AH1A 3LSOB 2Y5TB 5B22A 4CDHA 4D0DA 5JXEA 1WFUA 4I0PB 1PZ5A 4OLYH 3FFDA 1ZS8A 4JFHE 1KPRB 4HKJA 1SYSA 3AS3A 1MEXL 2XICA 1IILE 3GSXB 3RGHA 1VFUA 4NQDE 3SBWC 3D39A 5I19H 1BZ9B 2AKRA 1MUJA 4RAVB 3JWDH 4HKBB 1HI6A 4Z8FH 4KUCF 4S11A 4WEBH 4JFFB 5D96C 5T1KB 2Z9TA 4O58H 1F6FB 1YJDH 1RZGA 1T1YB 2AGJL 43C9A 3MRFA 1QSZA 4L1DA 3IJHB 1S7XB 3GGWB 4HS6A 3TPUB 1OD7A 1A14L 3RQ3A 5JNYB 2ICEA 4YHYB 3ZTJG 3QB7C 1NLDH 3MLRH 2IFGA 3TJEL 3BPNC 7FABH 3GMQA 4QWWD 1V3KA 5L8KB 3QIUC 3UBXB 4TNVF 3IXAA 3MX0A 4BELD 2LE9A 2GITA 1E6OH 4P2OA 2QTEA 5EU3B 1FFOB 3MMEA 3RVXC 3MXWL 1WAAE 1I85A 5E1AB 4M6MH 3QCUL 5E2JA 1MCDA 1SJXA 2K7PA 1MIML 1P5VA 2WBKA 1NMBH 4XXCA 4HQQL 4K2UL 4UTBH 1FCGA 4S1QL 4QKXB 1C7TA 4TSAL 4HUUA 4J3OC 2FX8L 1CS6A 4XP9L 5C9JA 3FQRA 4XH2B 4RISH 4K8RD 1M7IA 5MENA 5IBUB 4WY7H 3WNMA 2AJ3A 4DK6A 2V17H 2WWKT 4JY5L 4L4VD 3WLWD 3GKWL 3KPOB 1I3RA 2RCSL 3BP7A 3ZZ1A 4WTZG 2J12B 2OXHA 5KS9A 2G60H 1QLEH 3GSUB 3QUZA 2HJLA 4EBQL 3BQUA 1KC5H 2UUDH 1FL3A 2DQIL 2VUYA 1IAIL 1MCBA 1WUNT 4GW4B 1KIRB 2ARJB 4JFDE 2E9BA 2YRLA 5I1AB 5I30H 3VA2C 4DQOL 2XV6B 1GIGL 3NCFB 4PLKD 1FH5L 5L6YL 4CVXA 4WJ5B 5D5MA 1TVHB 1F90H 1G7IB 1QFHA 1UEYA 3L5JA 4X9IA 4FABL 3NFNA 3I75B 4G43B 4MJ5B 1HSAB 5GRWA 3S4SB 1OPGL 3NIDE 2H45A 2OL3L 1G0XA 2JE8A 1T20B 5LGJA 2XY2A 1DJSA 2FD6L 1TNNA 3MFFB 4Y4KD 2PCPA 2V5YA 5IFAL 1E27B 4EN3C 3WFZA 4M7KH 4ZUUB 3S8WA 3C5JB 2X1QA 1FVDA 4HWZB 4ZFOB 3SPVB 1OB1B 4LCUB 1MF2L 3MV8A 4TTDD 1DUYA 3UO1L 2P5EB 4YHOH 1NUGA 4L4TA 5L9DH 4OLUH 2QR0A 4OCXL 3EGSA 3NBNA 1REIA 4OV6F 1GGIH 3CX5K 2O5ZH 4OLWL 5CGMA 1XIWC 2EZ0C 5JQ6L 3MODH 4GKNA 4RZCA 3LPFA 1CIUA 2FHCA 1E4KA 4JFXA 3L7EB 1I9JL 1CGXA 5GHWL 2FJHA 4M93B 4PGZA 4CN1A 1VEPA 4NM4L 1IT9H 3NA9H 1GVIA 3QSKB 4YR6B 1HXYA 2XA8L 4NQDB 3TH2T 2HFFA 3BI9X 4KKCC 1WIOA 3P9LA 4D0BB 1XF2B 1M05B 4IRJC 1CK0H 4HD9A 4YPGB 5TE7L 4JFED 4FQJH 3NACL 1TFHA 1AKJA 4YAQB 1NLBL 4J1UB 1FVCB 3QQ4A 4MB5A 4ZD3L 3M8OH 3S35L 3GUTA 3HA0A 5GGRY 3HMWH 3H9HB 5E8PA 5L8JB 1IC5L 1NCTA 2EIZB 1H8NA 1SY6H 2BVOB 2FO4A 2AAVA 3ZTJH 1L7IL 5MI0B 5GRJL 1ZANH 3DI3B 1A7NL 1C5CL 5GGQH 4JFYB 3P9WB 1VFBB 2IGFL 4OD1H 1L0YA 5DSCB 5ALCL 3VXNB 1TVDA 2D31B 2UYLA 1PG7L 3I6LD 1MWAB 1WQVT 4OF6A 4FRWA 4FZEH 3LN9A 3KPLB 4LHUA 1AR1C 5JHDA 2E27L 4R6UA 1BWMA 3HN3A 5SX5H 1IM9A 2D0FA 1OF2B 4QHKI 4L5FL 3CH1B 3OHXA 1KNOA 1A7RL 4PV9A 1FN4A 8FABB 1KB9J 4LASH 1RIHH 4JZJB 5JXAH 1X5JA 3VXOB 1G0YR 3F6LA 1UWEL 1WWBX 3U7YH 4MVBC 4F15B 1NSNH 1L0QA 1KTLA 5I1JH 2EDOA 4XWGL 5C08B 1NEUA 3A0OA 2OJZH 3HZKB 5KAQG 4RFEB 3UJTH 2ADGA 3ULVE 4IRSA 3OR7A 4GAJL 4FN0A 3OKYA 3QXTA 2B1HH 5T3XL 1CE1L 1WAAF 3IF1B 2J3SA 1TENA 5FYLE 1VACA 3GSWB 3QULB 5IM7A 4BH8B 2M8XA 2P45B 3TIEB 2XFXA 5IQ7L 4YDIH 1CLYH 5T3ZD 3LV3B 2IFFH 1JFQL 1DLHB 4UU9B 4JFDB 5ISZA 4KRPC 2K3TA 1QBAA 4NFDA 4U6VL 3T77B 3WEXA 5F7YC 2N1KA 1A6ZB 4IIQC 1Q0YH 3BEWA 1MCRA 4XP5H 3ZE1E 1RUPL 2ZCKL 2X09A 3B9KB 4H25A 1GOHA 5EN2A 5HHNB 1PX4A 4DGIH 4OGYH 2I07A 1BFVH 3MGOB 3HE7A 4UV4L 2V2WB 1AO7D 5IW6A 3BH9A 3RWIB 1F58L 1NBZB 1E4XL 4PRBA 4N8PA 1JI2A 3BUYB 1QTYT 4KVCL 4RGND 2W9EH 2JIXD 4ODSL 4EN3D 1LVEA 3SE9L 1MWAH 1PSKL 3FO2A 4P46A 1LEKA 5E4EC 4BSWA 2F53A 3GNML 3UTOA 3O3DB 3X12A 5CILH 3V0WH 4CW1B 4QHMA 4LLWA 3TYFB 2XACC 1HZHL 1ZKAA 5CKGA 3CCHB 1AJ7H 4CKVX 1T03L 4LSDA 3UJJH 2D9CA 3VFGH 2EZ0D 4M9OA 3WMSA 5INCA 1Q9LA 3LQZA 4Q9CA 2YPLE 2BY0A 3KYMA 4L3EB 4PJHB 4BM7A 1TCMA 1GL4B 2UZYB 3WO4B 4FQQB 2HTKD 2XTJD 1DBJL 4ZO8A 3WE6B 1VFAB 5K59E 1I8MA 1XGTA 2B4CL 1EIBA 3S98A 3TNNB 4FFYH 5D8JL 4JKKA 1OTSC 1OAKL 3CK0L 4KDVA 4KKCD 5C0AD 5JORB 2GSIB 1AE6L 4FZ8L 4EDXB 3KS0J 1KPUB 2ITDA 3REWB 4M8QA 3IDMA 2DWDA 4WWID 4XVTH 3LN4A 5EOCL 3NPSC 3TIDB 1UGNA 1J0HA 3HUJE 5I1HH 2H6PB 5KSAB 3MV9D 4NM8L 1DE4A 2J4WL 5ESVA 4UNTA 4G7VL 4P2RD 1NFIB 4KHXL 3ZKMC 3TA3B 3LS5L 1FORL 43CAA 1FC2D 2BSSB 1XZ0B 1SM3H 4G6AD 3U48A 3ARYA 3NCCB 5A2KH 2DM2A 3EKCA 3TT3H 4NCDA 2X40A 5C70A 2YOCA 2VLJA 1QR4A 2GTZA 2LTQC 3H2WA 5BVPH 1MQKH 4KJWD 5AEAA 1U8JB 1U93A 3BW9B 4Z0XA 2XG5A 3H3PL 1QBBA 1Z3GH 3U1SL 1I8LA 1MFEH 4L1HA 3JTSA 5ANME 2AJSL 2X1OA 1XH3B 3MJ9A 4HWNA 1J1OL 4MVBD 1G7HB 1NUDA 3UTQB 3D3VA 3RKPA 2RIKA 4KU1A 2VDML 4PLNC 1U6AL 5DEGB 3ARDD 1OCWL 2EDNA 3GSVA 4YBHA 2NTSP 3T1FA 4Y19B 3R06B 3RWFB 4P2QE 4FA8A 2MKLC 2Y23A 3OXRA 4JFOA 4RMTA 3WFDH 5D1ZB 3CAFA 3JUYA 1KTDB 1T6WA 4N1HB 4C55A 3VXQB 2NW2B 1FGVH 5D96B 5KSUB 3ULVF 4JY6A 1IZKA 1FYHB 4NKIL 1I3UA 1KJ2A 3VXMB 4KRPD 1LILA 5TE4H 4GRMA 5IB1A 2QSCL 5ECJE 4UAOB 4E41B 4Q2ZB 4Q9RH 2AI0L 2HAZA 5DT1H 1YY9C 5C86A 4LSPL 2ZKHH 3SCMC 3BYYA 4Z7WE 3SE3C 2XKNA 3BRDA 4D9LH 2ORBL 4JO2H 4FMFA 3BHBB 3ARVA 5JPMA 1Q0XH 2GYSA 4OF0A 1I1FA 1MJJB 4K3EL 3VW3L 1UM4L 1Z0NA 3DWTA 3NCMA 5EUKA 3ZE1F 3R0NA 3ISWA 4AG4H 2Q86B 2EXYD 5FYJE 4NZTH 5J1AA 3H7BB 4FQXA 4P4RB 4M43H 1LGVA 1O5DT 4LCWE 2EYRA 1QD0A 5IJKA 5BOZG 5J6HA 1VPOL 4UBDD 3VI3E 2ATPB 1FFRA 3L3OA 3QI9A 2F9BT 4N0UA 4O9HL 1AFVH 3CX2A 3GSQA 1H0DB 4ORGB 2CRMA 4HIXL 4PJ5A 1BEYH 5EB9A 1FNSH 4R9HA 1B0GB 3RVVC 2NY0B 1V7ML 1I9RL 3P0YH 1R3IH 2PYEA 1CLZH 4ODVH 5FV2A 4P23D 4U1SB 1F4AA 5HYQA 1U8KB 1AD0A 4XNUL 5FYKL 3DGCR 4MJIA 3GMRA 3BP4B 1YDPB 3RI5K 1WIUA 3UPAA 4H20L 2C3XA 3BGMB 3I85A 4TSCH 1S9WA 1OTSD 4WHTA 3GI9L 4NKOA 3X3FL 5DUBA 3VRIA 4KZDL 3BYTA 3WNNA 4DUXA 1JNHB 2N7AA 1F3RB 3IGAA 1YEHH 4O5LL 4AJ0A 3ZYOA 3TWCH 4LLVA 2X4PB 5K59F 1W2KT 3HUJB 5GSVB 5KZCD 4NSKA 4MXWH 1RZKH 3HNVH 4M1GH 3V5HB 1HYSC 2MCPH 3ZHDA 5IVXE 3PP3K 4XCFL 4DUWA 1NCBH 3O6FA 1JPST 3GBML 4P59H 1IAKB 3MJ8B 1QA9A 4OZHA 4TUOB 4P3DA 1D5ZB 4IRZL 4PJDB 4YDJA 1MY5A 2F5BL 3HUJF 1RK1A 1JGUL 4M4PA 3QUYC 3T4AA 3GMNA 1UH2A 4NZDA 1M71A 3LKNA 3CZJA 5EZJA 1XIWB 3X11A 3CZFA 3HPJB 2FCBA 2ZOKB 5DS8B 1OARH 2YZ8A 1I8KA 4UI2A 1FE8L 5IROC 3STBA 5DRZA 3AAZB 4P57B 2HVKA 3U4EA 2WINB 3WIHH 2APBA 5DDHA 5KBNC 4ELMB 1D5MA 3WKMH 1I3GH 3BPOC 5M7QA 3O2DL 1JZ3A 4OV5B 4KQ3L 1WV7T 3LSOA 1ZT1A 4UIMA 5DLML 5DRXB 2VLKA 2G75B 3QNYA 2FATH 3BPLC 3U9PH 1XT5A 1KPRA 4U1MB 4O2FA 1IGCH 3GSXA 1JGLH 2YD2A 3GSOB 4KJPC 3BDXA 5C1MB 3WN5A 3SY0A 4F7MB 4L8SB 1IAII 4X8JA 4MCYB 3L5XL 3O8XB 4MCZA 1S7XA 3GGWA 5B8CC 3TPUA 5KG9B 3BISA 4R7NB 4JJ5A 2Q3AA 4EDWH 5EORH 2J2ZA 5I1EL 2MHAB 5CEYB 1P9MA 4G6KH 5DXWA 4NKMB 1TVBB 3KPQA 4NC2B 3RNKA 4XWOC 3M45A 2P7TB 2GTWB 4BH7B 5E2UL 2FYYB 2BC4A 5EU3A 1IKFL 1FFOA 4CADB 3N85H 1HHIA 1RULL 4LCWB 2M1KA 5E1AA 4PTTA 3RVWC 1RJCA 2YD5A 4TNVK 4PJXB 1HILB 5HI3D 1FIGH 4G9FD 4M61B 1UZ8B 1N5AA 5T5NG 5EBLA 4TUKL 5DMKB 5BS0E 5CUSH 1E4JA 2HRLA 1AGBB 2DD8L 4JM2B 4Y2DD 4ZS7L 3N06B 3KPOA 2QSVA 4PJXF 4LRNH 5HVWA 2UY7A 5DQDH 4XC1H 2I9LA 4NNXB 3IJSB 1J0ZA 2KZWA 5ID0B 4F7PA 4KUZH 3S35X 2VZTA 1J0IA 2A77H 5CHNB 4MA1C 1DFBL 3U4BL 3QA3A 4B5EA 1KLFA 1FO0L 2AEIT 3I84A 2VDLL 3UDWC 4DKDC 3V0VA 1TVHA 1G7IA 4FFZL 4YNYA 3MA7B 3DVGB 4JAMB 4QRTB 2Z93A 1CGVA 2J88H 4PJ8C 1RV6X 3DVNB 1YY8B 4Z77B 1ZHLA 1IM3A 5IVXB 1HYSD 3N50A 3RZCC 5E4EB 1WBZB 3RVUC 3ARQA 5DI8A 4PG9B 1YEDA 2JB5L 5SWQA 3W2DL 3S5LB 3VFNA 3C5JA 1BZQK 2ZG3A 5DHVB 4APQC 3SPVA 1TZGH 1U36A 3GMOA 4ZFOA 1OB1A 4LCUA 3PV6A 2EDDA 3BH8B 3W0WA 3TV3H 4HBCH 3BKYL 5IVXF 4M5ZL 2YK1L 1AD9B 1D9KA 4HZAA 5F9AC 3FT2B 4JHWH 1CZ8H 5HYFA 1FNGB 1RIVH 3EUUA 5MEOB 3LKSB 3CSYB 3F7PC 5F1SA 1IE5A 1LHZA 3PF2A 1N64H 1YNLH 2CLZB 3QIBC 2I60H 4GRLD 4NBZB 3FO1A 5L8LB 3L7EA 1RIUH 4UDUA 2A6JB 2YRZA 1BM3L 1GOGA 4NQCD 1F4YH 5E70A 2FJGB 3HG1B 3IU3B 1XR9B 4NQDA 3RHWF 2UWEE 4QY8A 4LSRH 4KJPD 1XF2A 3F7YB 1M05A 2VLRD 4E42A 1UJ3C 1WT5C 4NRXA 3LKPB 5E56A 1FVCA 3PGFH 1JCKA 1MREH 5DJYA 3P73B 5H37G 1CFVH 4LAJH 4XNXL 3EO0A 3V7AE 3H9HA 2ADIA 3CFBA 3QO1B 4QRPE 3EJYC 5ILTH 4HUXA 1Q94B 1T5XA 2JELH 2EIZA 1FYTE 1U8PA 4HIIA 3NPZB 3X3GH 2BDNH 1WZ1L 3WFHA 3KHOA 4YXHH 5FB8B 3IRPX 5DJAB 2ZUUA 4MZ3A 1VFBA 5DSCA 3SGDI 5DWUL 5MHSD 4OQTL 1P6AB 4L9LC 4A2MA 1CBVL 3KPLA 1YECH 1AC6A 3GK8H 1E4XI 2IQAB 4XWOD 1A7PH 2NX5B 3RPKA 2AEPL 3NFSH 4NOFA 3R8QA 1WGOA 3CH1A 5ACZB 1K85A 8FABA 1G7QA 4XNQB 3UTZA 3ME0A 3INUL 3PWPB 5EOTB 2DAVA 2XKUA 1J87A 3C6LB 3AM8C 3VXOA 4DGVL 4NKDA 4IOFD 5DHVH 3ULSB 4J3UA 4NN7C 3BAEH 4HHAB 4JKMA 1JWSB 2HFGL 4S0SD 1WVZA 4PP2B 4RFEA 5BS0B 1CR9L 2E9WA 5GGTH 3T65A 2AXFA 2DQFB 5HYSB 1I8IB 3CVHB 1P4BH 4WW2B 4P4KC 5C07D 3OB0K 5T5FL 4WEMB 1OSZB 1TCRB 3WS3A 1MAMH 3L3JA 5FKPA 1JHTB 1JYVA 3AROA 3WJJC 4OFPA 4BH8A 3WFCH 3PL6C 2WUBH 3GB7B 4M7LT 2VQTA 4E5XB 4ALAH 1YMMB 3PABB 5IGXH 1TPXC 3R4DA 5IMLB 2O5YH 2V9RA 3GSNB 2ID5A 1MLBA 4JFDA 3QRGL 1BHGA 4I3RH 5FUCC 3SCMB 1EZVX 1K9TA 2VJXA 5EU6D 5EBMB 4AZ8A 5FECA 1D6EA 1DBBL 3T2NH 1A6ZA 4ZAKA 4YJZL 4NZJA 1UACH 2AXHA 3B5GA 2XQBH 3RY5A 5CSZB 5FXCH 5HY9B 4CVZA 1MRCL 4D8PB 3VXTA 2D03L 3ALPA 2V2WA 1GGBH 5CMAB 3QHTC 4LLQA 2WBJC 1XGQB 4E0RB 3V4UH 3PWNB 4YQXL 3RVUD 2NZ9D 1LK3L 1PEZA 2P43B 2EKSB 4EXPX 1NFAA 4NJ9H 1J05B 1I9IL 5T1MA 4APQD 5E08H 1U0QA 3QEGL 3G04B 2AEWA 2FWOB 2VITB 5TDPB 2VXQH 1KJVA 2XY1A 2JK5B 3TYFA 2PR4L 5IIEA 4G7YL 1Q72L 1NH6A 2IBZY 4HFWB 5FGCE 3CCHA 3SDYL 4RFOL