4HALA

Multicopper oxidase cueo mutant e506i
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHIDTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506I
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA03
4A2GA 2CALA 2DYSB 5D4IA 1M9WA 1L9OA 2BWDA 2GBAA 4E9YA 2CBPA 1OCOB 1OCZB 3SBRA 3OMAB 4WKXA 5A7EA 1SF5A 2HX7A 3EH4B 3QJTB 4QLWA 3PCYA 3FU7B 1BEXA 2VM3A 4KOBA 1GY2A 9PCYA 2PPDA 3AW5A 3UABA 1BXUA 1NIFA 1PLCA 2BZ7A 3DKHA 1E30A 3FS9A 1GS8A 1BQRA 2H47C 3WNJA 1X9RA 1IKOP 3T71A 1XB8A 1SHWA 4AKOA 1V55B 1JZEA 1WS8A 1OE3A 2Y69B 3NSDA 4A68A 1JXGA 3QJSB 2UX7A 7PAZA 1TKWA 4AI7A 1PF3A 2QT6A 1AOZA 4A2EA 1ID2A 4AKPA 2Q5BA 2IDTA 1ET5A 1PLAA 3GXUB 1YLBB 3MBWB 4F2EA 1W6LA 1R1CA 4BWTA 1NWOA 1MZZA 1PNCA 4DP1X 1ET7A 1CC3A 5B1AB 1NWPA 1PY0A 1WA2X 1F56A 3IEAA 5I6KA 4HALA 4A2HA 2BW4A 1TU2A 2IH9A 1BYPA 2J56A 1A4AA 1OE1A 2QDWA 1QLEB 2GI0A 1SDDB 4UF7C 1KBVA 4PAZA 3NJFA 4YSAA 1AANA 2FNWA 4YSSA 2A3TA 1ZIBA 2FT7A 4YVUA 1UATA 3PPSA 3ZIYA 1NIDA 3FU7A 4N4YB 2YXVA 3QQXA 4FAAB 2EIJB 2ZWNA 4JKNA 2TSAA 3FU8A 1AS7A 3G5WA 3QJVB 1AZRA 1JOIA 3T9WA 2IDFA 3CVDA 1AS6A 2VSMB 4P5SA 4WTQA 2IWKA 3NP3A 5F7AA 2XUWA 2PP9A 4AZUA 2BHFA 1SNRA 3FQYA 4ENZA 8PAZA 2PCFA 1ILSA 3UACA 2FQDA 2YQBA 1ILUA 4FA7B 2RACA 5E9NA 1NPNA 3WKQA 2IAAC 4YL4A 3HEIB 3ZBMA 1SFHA 2XX1A 3QJRB 2GC4C 4JHUA 3ABKB 3C75A 1OE2A 3EH3B 4KOCA 4HAKA 1BXAA 5F7BA 1W6WA 2VW7A 3OMNB 2VW6A 1W8EA 4DP2X 1KBWA 2P80A 1NIBA 4NAJA 5I28A 2EIKB 4E9VA 4HHGA 2VN3A 3EF4A 1MDAA 4HCFA 4BXSV 1AIZA 2Q9OA 1SDDA 1B3IA 3OD3A 4KNUA 2UXFA 2IDSA 3NT0A 1E67A 3PAUA 4GY4A 1KDIA 4E9WA 2UXVA 1WAEA 4DP9X 3T6WA 1PZAA 2HXAA 1AZCA 3EHBB 2BO0A 7PCYA 1QNIA 2XYBA 2UX6A 1JZJA 1N68A 5EHFA 4PCYA 3ASOB 2XV2A 2CAKA 1JZIA 2XVBA 3ABGA 1BQKA 3RYMA 3T6XA 1ETJA 1E5YA 2LLNA 2AZUA 2YARA 3NJIA 1PMYA 4W9ZA 2H3XC 2HX8A 2VSKB 3PXLA 1ZDQA 2IWFA 2FQEA 4ZK8A 3UAAA 4GYBA 1SJMA 3AG3B 4DPBX 1A4BA 2HRHA 2HRGA 1NINA 2AVFA 4HCGA 2XV3A 4DP8X 2PLTA 1IBYA 3T6VA 4A2DA 1ZV2A 2BWIA 3GDCA 2FT6A 2HX9A 1X9UA 1CYXA 1WA1X 3X1GA 3FYEB 3AG2B 3AY2A 2J57A 1JXFA 1WS7A 4KO5A 4DP4X 1CUOA 1NDTA 1RCYA 2YAPA 1ASOA 4DP0X 2DWSA 2GSMB 6PAZA 1CYWA 2GB2A 2UXTA 1VLXA 2VW4A 1KGYE 5TK2A 3UGEA 2VMJA 5PCYA 1ZIAA 3N55A 4N8UA 2J55A 2YAMA 1A8ZA 1PLBA 2PPEA 2PCYA 3BVDB 3EH5B 5FC9A 1DYZA 3WI9A 2GC7C 1SF3A 1OV8A 3CVCA 2ZXWB 3L45A 3FQ1A 4G72B 1M56B 1L9SA 2YAHA 3V9EA 1J9QA 3NSFA 3CZUB 3NJNA 2JXMA 2VM4A 3X1FA 4DP7X 2EINB 2P80D 1OF0A 2PPAA 2YAOA 2UXGA 4YSQA 1WA0X 4A2FA 1AR1B 4KO7A 1J5CA 1AQ8A 3IN0A 3JTBA 4YSCA 5B7EA 3QJUB 4CSZA 1AG6A 3AG1B 4G7SB 4YSEA 3GYRA 1AACA 3S8GB 5I5MA 2YAEA 3NJGA 4DPAX 3TBBA 3FQ2A 1E65A 1BAWA 4E9RA 3S3DB 1JXDA 3ZX1A 2XXGA 4GP8B 1T5KA 4Q89A 1KV7A 2I7SA 2OCCB 4BWUA 1IBZA 4L0PB 1M57B 4K9JA 3OM3B 3NSYA 1KCBA 3V9CA 1NIEA 3TASA 1PAZA 4DPCX 1SFDA 1PZBA 3OQRA 3X1BA 4YSUA 1QHQA 3FSVA 4G71B 3OMIB 1NIAA 4NERA 2XXFA 4X4KA 1ET8A 1A4CA 2CUAA 3MX0B 3AG4B 1IUZA 2DYRB 2FTAA 4RH4A 4GP5B 5AKRA 5I6NA 1JZFA 1PZCA 4YVNA 4A67A 2AZAA 3FSAA 1J9TA 1HAUA 1L9PA 1N70A 5B7MA 2BP8B 2CJ3A 3NJMA 5I5IA 3NSCA 4HCIA 1EHKB 4HZ1A 5ANHA 4HHWA 3IN2A 2IWEA 4YSTA 1JVOA 5I6OA 4G70B 3SQRA 1NTDA 2PP7A 3FT0A 1XB6A 1J9RA 3D12B 5B1JA 1PNDA 1AAJA 3T6ZA 3UAEA 2W8CA 2IDUA 2AANA 2JKWA 1J9SA 1EZLA 1GS7A 2WSDA 3DIVA 3NJKA 4E9QA 2GIMA 3FSWA 3PAVA 2FJSA 3NJLA 1BYOA 4DP5X 2I85A 2GHZA 4EF3A 2MRYA 1BXVA 2JFCA 3H4HA 3S3BB 2FT8A 2XWZA 1JZGA 2PPFA 3ASNB 5LDUA 1GYCA 1A3ZA 1HAWA 2DY2A 1L9TA 2XV0A 1AG0A 2FQFA 3X2QB 3AZUA 3NJJA 3NYKA 5B3SB 3KW8A 1V10A 3CDZB 4GXFA 1TEFA 4M3HA 5TK4A 4P5RA 2OV0A 4G7RB 2YAQA 6PCYA 2QPDB 4F7KA 2AFNA 3DTUB 4GP4B 2BZCA 4CSPA 3KW7A 3X1EA 1JERA 2B3IA 3TU6A 1JZHA 3NP4A 1FWXA 1BQ5A 2R7EB 3FYIB 1KCWA 5D4HA 1IC0A 1AS8A 4NB7A 1GW0A 3HB3B 2Y1AA 1RZQA 5I6PA 2BP0B 4HIPA 2ZOOA 1KYAA 2BP8A 1AZNA 1FFTB 3X1NA 1MZYA 2XLLA 4BXVA 1SHXA 3WNIA 5AZUA 2YAFA 5I6MA 2QPEB 1V54B 2TSBA 3WG7B 1L9QA 2WO3B 2IDQA 4E9XA 1E5ZA 3S8FB 4JHVA 3WKPA 3PLYA 1PCSA 4BDVB 5B7FA 4UANA 4AX3A 1NICA 1GS6X 2IH8A 2HZHA 2XX0A 2B08A 3QPKA 4UAHA 1OCCB 2W88A 5IY5B 2BW5A 2MTAA 4KNTA 1AZBA 4QKTA 1NZRA 5I5JA 3FSZA 3CVBA 1MG3C 2X87A 3N2JA 1ASPA 3UADA 4BK5C 2YXWA 1URIA 2CCWA 4DP6X 1ADWA 4KNSA 4YSRA 3TBCA 1DZ0A 2DWTA 1NPJA 2E86A 5B1JC 2PPCA 1GSKA 1TEGA 1XB3A 4M4RB 2DV6A 3ABMB 3TA4D 2OJ1A 3S3CB 1AZUA 3CDZA 2FQGA 2I7OA 4YSDA 2H5UA 2QDVA 4AKQA 1MG2C 3WIAA 1I53A 3FU9A 1ASQA 1KDJA 1CURA 4YSOA 2EILB 3U25A 4KO6A 4F2FA 4BWWA 2EIMB 3JT2A 3SBQA 1GY1A 2R7EA 5B1BB 1OOWA 2ZONA 3FPYA 5AFAA 1XMEB 2NRDA 3ERXA 4Q8BA 1ZPUA 2FWLB 4E9TA 2BP0A 1RZPA 2WO2B 4G7QB 3H56A 1A65A 4A66A 4KO9A 2N0MA 1OCRB 1ZDSA 3ABLB 2HLEB 1J5DA 3CG8A 2PP8A 3IE9A 5I26A 1JVLA 3BQVA 2X88A 4E9SA 2J5WA 3SBPA 1L9RA 5D4JA 1FA4A 5PAZA 4YSPA 3H4FA 1HFUA 3NJHA 4MFHA 3IBOA 4TXVB 4W1TA 5B1KA 4BDVA 2XU9A 5I6LA 1GR7A 3ZDWA 3FPXA 1RKRA 3QJQB 3PAZA
chains in the Genus database with same CATH superfamily
2FIRT 4Y4FD 3SKMA 1HI6A 1M05A 4NNXA 4WFHE 2C1OA 4KQ3L 3BCDA 4JJ5A 3LB6D 3QRGH 2PXYC 1ROWA 4N0UB 3ULUH 2A6JB 2R2HB 3FT1A 4IKKA 4IEFA 4YFLI 1CTOA 3GJFA 1G5AA 3VNZA 1OT1A 2DQFB 2X12A 1ZLSL 1KV3A 5F6HJ 3MTXA 4M4RA 3FU7B 4KX8A 1R5VB 2EYTA 1NM4A 1EEUA 4KHXH 1EEQA 1XO8A 2X3BA 3ARFA 5BJTB 1OK0A 1HH9A 5DMYA 3DHUA 5HHOA 5HBBA 1MHPL 1MQKH 5DS2A 5AOJA 3UABA 3EO1B 1F41A 5DZOA 4XBEL 3CK0L 3UAJD 3B9DA 1GOHA 3MAWA 3HG0A 3PV6A 1X9RA 2VKXA 3IDXH 4DVBB 4F8LA 3I02B 1NH6A 1JHKH 4KTDL 5AENA 4LLMA 4L3ED 5BMFL 4JPVH 1BZ7B 2CLVB 5LWYH 1XEUA 3K4AA 1BV8A 1EBPA 2VXTL 1PFCA 3DPDA 1BLNA 5FHBH 2BSRB 2AJYL 1RPQA 4LKXA 4K3DL 4MJ6B 5E1AA 1IGYB 4EN3A 5B8CB 5IMLB 3DI3B 3JZ7A 1U8MA 5J12C 4AK1A 4P3CH 1U8NB 5DURD 1O7DC 1I4FA 4NZTL 1ID2A 1PSKH 1HHJB 2G3XA 1QRNA 1MRCL 5D1ZA 1AQMA 4DQOH 1QSEB 4XI5C 5K9QG 1VGKA 4F20A 4WO4B 2K9UA 2MCMA 3ARVA 4JFOA 1FZKB 1IGCL 4HIXL 3NIDB 4DZ8A 3SJVB 4JY5H 1I8MA 2X4PB 4I9WD 2ZUQB 3MUHL 3LMJH 3ZT6A 4LVNB 1ZS8B 4DO4A 4PR5B 3S2CA 4NO2B 1KTBA 2X42A 2XKUA 4OZFH 1TVBA 2W65B 3FH5A 1O7DE 4HX1B 3KDPB 5JHMA 5IHLB 1SZNA 4JKKA 4MQSB 3IPFA 2G4GA 3BMVA 3TFKD 1OAKL 2P47B 5ELIA 4KK9C 4ZO7A 4IBSA 1U8JB 2YK1L 2IH1A 3P4MA 2JJSC 4GS7B 2ICWA 5KZCB 4Y5VA 3W0WE 2C9VA 3MOBL 3PWUB 1P4LB 3A4FA 4G7VL 3SYOA 1ZHNA 1E8XA 1IGTB 1T6BX 3DURB 3NPSC 1EANA 3NJXA 1E5CA 1YN7A 1CE1H 1KB5B 1XCTB 1OAXH 4FXGC 4AZUA 4PV9A 4NQDB 3QCVL 4L9LB 4AGNA 4TSBH 4ZMNA 3D0AA 1ES0A 1D5ZA 2P45B 1DE4B 3KYKL 3NIFB 3IXTB 3PV7A 2APFA 3QIWB 5IB4A 3V4LA 5C0AB 4ZD3L 3WKQA 3V0WH 4YL4A 4HK3J 3E2HB 2C3XA 2ZUSA 5HJDA 3QRLA 3IFPA 3HNSH 3QJRB 5GGQH 4OLYH 4MB1A 4JM4H 2NCMA 1AHWB 3RU8H 4ZNCD 3VFNB 4HAKA 1BXAA 4XMVA 3HMXA 1JWMB 1A6PA 4Q6IC 5FCUL 1CFSB 3EBIA 3VXUA 2X05A 4C56A 1K5NB 5HSFA 5DJZB 4TPRL 2BSCA 2D0GA 1MCLA 3V0EA 1JHLL 1ZV5A 2DEXX 2OS7A 4CVZB 4O58H 4YHZL 4U3XA 3OD3A 3ARPA 4L4TB 4U6TA 2B7DT 2XWCA 3ARBA 4X80H 1FVDB 1ZLUK 3RVXC 1RFDH 3P30L 4FF9A 1F6AA 4HH9B 1EO7A 2W9EL 3O2DL 2QGCA 4PGBA 3MRLB 2Y5EA 1IAMA 1OK8A 2XFXB 2XWXA 3GBLA 2Z31B 3CFBB 1SJXA 1UKTA 3HA0A 4MAYA 4X8GA 3SQOL 5IFHH 2NY2B 3BJ91 3JVFC 3KAAA 3LEXA 4RZCB 1E5YA 3AS3A 3KEDA 5LO7A 1G7IA 1HXMB 2C9QA 2EYRA 3L6FB 5SX5K 2IWFA 4B9FA 3EJSA 3MCLH 1JZDC 2PF6A 4GG8B 4HGMA 2DH3A 3QXUA 5FM5M 3U0WH 2R69L 5C0BA 4DPBX 4LEBA 4JM2F 4D94A 4XCNA 5I19H 3EYQC 1C5CH 2XZAL 2ISDA 5KYXA 1NLDL 1KTKE 1MFCL 2P28B 3S4SG 4EDWL 5KJRH 2F8VA 2O61B 5HI5D 3OKMA 4DGWC 5JORA 4N90E 4NP4H 4S2SA 4PJEB 5E5LA 4FQHB 3D18B 5IIEB 3COOA 3ULUC 4AQAA 1PYWA 2VLKB 3WTWA 1Z3GL 3FYEB 2IALA 1T2QH 2Z7WA 5K33A 3IB4A 5CAYB 4MCZB 2J57A 3K2KA 1FL3B 4OGYH 3VMNA 3D0LB 3NFPA 4F7PB 4RRPM 4XGZB 5I71C 2AEPH 2WHVA 5HHMD 4OI7A 2CCVA 3ZGIA 1MIML 1KGYE 3MJ9H 5IV2B 2YD2A 5KS9F 5ALBL 3ZOAA 3FFDB 1EERB 4Y2OB 3VI4E 3G6JB 3ULUE 2OR9H 4PIRF 5CZXC 1K8DA 3IDNB 1B90A 3RTQA 4ES9A 3BD5A 1Q9LA 3PWLA 1KN2H 2HKAA 5CGYD 2FWSA 2Z8WC 4XPBH 4WU5B 1EXUB 4G72B 1ANUA 1KELH 3NZ8B 3M6DA 2V2XB 4XNZB 3K91A 1TETL 4JO2L 3VSVA 4R97C 5C8JA 2R39A 1IC1A 1NAML 5IB3B 4YBQD 4WJ5B 2LTQB 3KPSE 1N59A 1KBKA 2O5XH 1P9MA 4LLYB 5T1LB 3AACA 2HMIC 1MH5B 3CHSA 1SYVB 4NKQB 4DGVH 1IT9L 4MA7H 1X5FA 1T89C 2K6WA 4NQED 3TPUA 43CAB 4ZPVB 4AIEA 1U8LB 4ODWB 4IKIA 4NO5B 2ZCZA 3BLBA 5KTEL 3L1OL 3NJGA 3RGVD 3TCTA 3LNIA 4HBCH 4NYLB 3DJRA 1RHHB 3O3EB 5TH2A 1TZHA 5C0CD 1JXDA 1NBVH 3B34A 4PJDE 5L9DL 1EVUA 1FFOA 1QRKA 2JI1A 2Y23A 4AM0Q 4YBHA 3FO0H 1TTUA 1A3QA 4GSDL 3WDJA 1IBZA 4QI3A 3C5ZC 2GJ6B 4X9BA 4YQXL 1MW2A 1COBA 3QXAA 2X4OB 4OZHE 3RUGA 1DCEA 2IOMA 3LRSB 5KBKA 3DETC 4LSVH 4DPCX 4KRPC 3CZJA 4YSUA 1GZPB 3C09B 5HDBF 3C5SA 1A1NB 4XX5A 4XCEA 1X9QA 1D3CA 2LAAA 3QDJB 4JPVL 4NERA 5J3HC 1WSST 1JGEA 2FATH 2JQZA 1FV1B 3DI2B 3FQUA 4X7SH 4X6DB 4POYA 3CU7A 2V9RA 2YQ3A 3OKNA 1IGFH 3BD3A 3LD8C 1BD2B 1OHQA 4JGNA 4P5MA 4EE2A 1PZCA 4P3CL 4PG2A 1T1XB 1I8UA 1PSKL 4P2RE 4Z76A 2Y07H 4B95C 4HD5A 5AW8B 4FG6D 3TA3A 4PJ5D 1RURH 4TF4A 2F7OA 3HS0C 3MR9B 5F9AC 3SGDH 4M8RA 2JE8A 5ANHA 3V7AG 3A6CL 1UVQB 3MCKA 4MDJB 1G0XA 2LVCA 5F0LB 1I7TA 5GRYA 2ZCHL 1ED3A 4I77H 1TFHA 1R19A 4KV5E 3F05A 3T2NL 1UOWA 2ENYA 3CLWA 4I7ZC 5L4MA 2CDGA 4PJ9B 3PJLA 1U4FA 2RFXB 4UT9A 1NLBH 2VDLB 5D8JH 2DIAA 1QATA 4Z7VF 4MAZA 4YC2C 4LF3B 1J9SA 4LCCC 3IBEA 2WD0A 2FGWH 1DDHA 1F3JB 1MHEB 4NUPA 1DHKA 4R4BB 3Q06A 3JTTA 5GRJH 4KK6D 1MJUL 4EI6A 2C9RA 3GIVB 3VDAA 1AKJD 2G5RA 4X6FB 2DBJA 1EPFA 3AQYA 1H8NA 3MV8E 5HI4D 1JNHA 4B96A 5KVFH 1ZXKA 4AE0A 4O2FA 4NIYE 3ELQA 1ZVSB 1RZ8B 4RISH 5AOLA 2KZWA 2OV0A 3RWGB 3UZQA 1PX3A 2AEWA 2OMBA 5EG6C 2JKRM 1CXEA 1QTSA 3TVMB 4YHLL 5DD5L 1TQUA 2HVJA 4NNPL 2OYPA 3TCLB 2O5ZL 4UZUA 3V0WL 1T5XA 4UOW0 4HIPA 2BCKB 2EIEA 5GSRA 5EIIB 4K5NA 3WMQA 3FL7A 4XPGL 2WNKA 4NN5C 4PVNA 1RZIA 1M2VB 2YLKA 1AZVA 5GJSH 1A6TB 2GCYB 2Y3AA 3RNQA 2TSBA 4QHPA 4GFXA 1YMHA 4OD2B 2OK0L 4UZGA 3SE8H 4U1LA 5JHLL 2R27A 1M3IA 5FK9A 4JHWL 3EO0A 2IV9A 1SRDA 3V6OE 4OCRH 4LPVA 1A6WH 1NGPL 3UTTE 4MMZC 4X80L 2BIIA 4WTXA 4EKJA 2FUTA 1ZT7A 4JG0L 5DUPL 3WTSA 4JX0A 5GXBB 2FRGP 4N20A 1QG3A 2V9QA 4YSRA 4LCWA 1F00I 1OGAB 2E7DA 1H6TA 4JM2D 2IOOA 3EGDB 2BDNH 4IM8A 2WWMD 2IDCA 3KWUA 2AJXL 3G6DL 3DK0A 1VCAA 4FQ2L 2AQNA 4TS6A 1NMBL 4OLUL 3VMPA 2JCCF 1RLBA 4A7GF 5FYJL 2OMTB 1PTZA 4E36A 3CXHJ 5BQDA 4F2FA 4FKHA 1VB9A 4JHBA 4OZGF 4LCIL 2WO4A 3UTSB 5BRZB 1HXYA 3EOBB 1QVOA 4GRLD 2L8AA 1IBBA 3GSQB 4NP4L 1X5MA 2NR6C 4LAQH 1U8OB 2CD0A 1P1VA 2Q6WB 1P0SE 5F1NB 1RAMA 1I8LC 4N2CA 4WJKB 1IC7L 4GMSH 3SBPA 1QLRB 4IIQB 4OGXL 4J6IA 5JQ6H 3SGJA 2WP3T 2WUBL 4MFHA 3TV3H 4O02H 2D31B 4DWHA 4F7EA 2OBGA 2EEFA 3PAZA 2J25A 4H40A 3DX7A 1N18A 4CMMA 4ZUUA 3FRUA 2NY4B 3Q8BA 1BX2B 2HFEB 4NRZB 4F8TA 2Z4TA 4LE8A 5DJAB 2XQBH 4N5ED 1T4WA 3FO9B 3UAJC 5IJCC 2OR9L 1YDPA 2K0RA 2G2RB 1KEGL 4HS8L 4GKLA 4PUBH 5A7EA 3V6ZA 2H32H 3H6JA 4XPBL 4DCQB 1KELL 1QSFD 3QORB 3ZMEA 4KROD 3KXFE 2ZCLH 3P4NA 5EU6D 2JKLA 1F4WH 5EO1A 3H1ZA 2FE0A 4NWTL 3P2DA 1P7KB 3RVVC 2ALWA 1JDDA 2BZ7A 4AIOA 5T1KB 2IGLA 5BZWA 1GS8A 4FS0A 5MERA 2BVOA 3BDYH 5EBGA 3O11A 5IJVB 2J4WH 3E7JA 1D9KD 1YYCA 5KBLA 1KCUL 3WS6C 2EVFA 4X4YA 4JRYA 1IU1A 4AVKA 2WWKT 3VX0A 1PLGH 5J12B 4LMQI 2RB8A 5MP6L 4AZ8B 3VQ1C 1VPOL 2MTPA 3K3QA 1HS6A 5TF1L 4ZYKB 4AI7A 2R2BB 3HAEG 4ODVH 3DBXA 3UEZA 2WTRA 2FR4A 2MMXA 2QQKL 3JUYA 3O41B 4ZUTA 5JOFB 3LH8A 4HQQL 2AJVH 1MW3A 4BFIA 1ZLWH 4DOHE 4U1MB 5EOQH 1I7UB 3W0WB 2TAAA 1F56A 2VRQA 2JSFA 2V8LA 5FFLA 5K1NA 3GSXB 1UD3A 1XHHA 2IH9A 1SJHB 2J56A 1KYDA 2VC2H 2CDEA 2UZXA 3CFKA 4WUUA 4YUEL 5KYUB 3C5XA 3QUMA 5SWZD 4HF5H 2ZIDA 1O5PA 2GI0A 3BSZH 1CLOH 3BAWA 1KBVA 4GI6A 2WNXA 1Q0YH 2P3YA 4X7SL 4FEIA 3RY6A 2KYIA 3FKUS 2X89D 1IGFL 1TQBC 4P4RB 3WFEH 3OAWA 2R2EA 2VMFA 1SXCA 1XAKA 1H6UA 3GSNH 2CPCA 2WZ6A 1FFNB 3AWEA 2WW8A 2TSAA 3H7LA 4TVPL 2PO6B 3UERA 1AZRA 4NQTA 3FB7B 5F1OB 1NUNB 5KVFE 1FNLA 1OP3K 4U6XB 5AAWA 1F8TL 1YPZE 1TJHL 2IAMD 1CXKA 1MHCA 3WCYA 3ZQWA 1F1GA 2XWTA 2MCPH 4JDVA 3IJSA 1RZJH 3LZPA 1XR9A 3FUIA 4FA7B 5D8JL 1LNUA 2GSIB 3UBXB 1YYLH 5KVEH 1TTBA 3SGEH 1UEYA 2GC4C 1FZJB 1MFEH 3F6IA 5ESVA 1HHHA 1A4JA 1YNKL 4QNPF 4ALAL 2BH0A 1X5AA 5JO5A 4JKWA 4KOCA 5J13C 5JXEA 4Q6IB 5I1HL 4FULA 1ZWIB 2VW7A 3OMNB 2WBJA 3HG1B 3L4UA 3VFVB 3VYNA 1DBJL 1T4KB 2HRPH 4OIBA 4Q9BA 4UNUA 3VXRE 5JIDA 5DLLA 1TLMA 3TBSA 3WN5C 4X99A 5L4JA 3SBWC 1HJBC 3NFSL 5DCCA 1TJIH 1UOVA 3QUYC 4RISL 3ARDA 5MHSD 4LSDA 4FXKC 1XCQB 4GY4A 3BX7C 2F74A 1KDIA 1DLFH 2CLZA 3HE6D 4X6CE 4D2NA 5DVKA 3KD4A 4EIGB 3O0RH 1H3XA 1H3VA 2IANA 1G9NC 5BQ7B 5IW6A 4M5ZH 5EHFA 4MXVF 2XJLA 1CFNB 4IMKC 5TE6L 1WF5A 2L4OA 5DD6A 1XH0A 2VUKA 2ARJA 2EEBA 3KEHA 1E3XA 3MBXL 3OJDB 4LDCA 1NAMB 2WINB 5DWPA 4RGOH 3SPHA 1TZIB 1XH3B 5D1XA 1MCHA 2C9AA 3GRWH 2E7HA 4GYBA 5F7HA 1S7UA 3AG3B 4NHUA 3GIZH 4AVHA 1JF1B 2QFPA 4OCRL 5IJKA 3VFGH 1GGTA 2H41A 5T3XD 4YHKL 3R8BB 4F27A 3VI4B 1N67A 2APBA 3GHEH 3QB7C 2O5NA 1CLVA 2BWIA 2OTUB 3CSBA 3LRMA 2WQWA 3VXQA 4PRPD 2ZKYA 3VU2A 5DR5H 4U1IB 4DEWA 5CGYC 1Q4NX 4NKDB 5DHYA 3DIDA 4UIKL 3TT3H 3HR5B 3KPSB 1YMMD 5HHME 3MYZA 2AC0A 5LAXB 1JF5A 2MKWA 3RWDA 1L6PA 4JFFE 5CILL 3R18A 1T7XA 5GHWL 3V0FA 2ILLA 2YSSA 3MRFB 1DVZA 2FZ3B 1JVKA 4NN6C 1R3JB 4WV1B 4HUNB 2R1XB 2OMUB 3L54A 1OB0A 2F54E 4FFZA 1HYRC 2X4QA 4YXLH 4OZ4B 3Q3GB 3GHBL 4XNQB 3BP4B 4KI5F 4C4UA 4FE9A 4JFVA 4X42A 5D7IE 3NSFA 4RLDA 5D9SB 1KYUA 1JPTH 2EDTA 1CXIA 1NSNH 3RGVC 5IWLA 1TTFA 2R9HD 1WBYA 2K6YA 2CUHA 3MGOB 1U95A 2JIXB 5I2IA 3TV3L 4HPOH 4PRBB 1UM5L 4OZHB 4OJEH 1IB5A 4POUB 4Z7WF 5LXVA 4KZEL 4ERSH 2KS0A 3AG1B 5CJXA 5J8OA 1CG9B 1GMEA 3MUGB 2AXHA 4PJFF 1RJLA 3I6GB 3HVDA 3HJ0A 5CJQL 2VZ1A 4MJHA 4OZFB 3MJGX 4PB0H 4PUBL 4E9RA 2ATPB 5JDSA 1JK8A 4MXQD 4RWYH 4Y7MA 4E9LA 4MYWB 3VFMB 5L8LB 1CLZL 3C5ZB 3O9WA 2FEEI 3QZWA 4XBGB 5C0CE 3PGDA 3OKOB 2VNCA 3UC2A 4JM0A 4O2EA 8FABA 4G6FD 1WAAA 1KXQA 1YEDA 4P2RB 3V2AR 5EF2A 2XWEA 3VFTA 2WB1A 4PS3A 4XC3H 5CIPA 3K72A 1PAZA 3TASA 5LVEA 3ROLA 3W2DH 3QP3A 2GVYA 4I8DA 1LEGA 3L3KB 4PRID 1RUKL 2IG2H 3LEVL 5LCVA 3S96A 4TN9A 3CX5K 4P04A 1TJMA 4NRXB 1IGJB 1QA9A 4QHUB 3UZEC 2YHGA 5IVXB 2R1YB 1CWVA 4EBQL 1RZJC 2DJ4A 3ZTNH 2K8MA 2FJGA 5LHDA 4HU2A 3ME0A 1VFOA 5B7MA 2NZIA 4NSKA 4L2LA 4GAGH 2AJVL 2WLJA 2YPLA 4BRVA 4HC1H 5C0EB 3K4DA 1V7NH 1MCSA 2AW2A 2Q86A 3BIKB 1NFAA 1J86A 3IF1B 2OAAA 3T0WA 1FFPB 2APTA 2ERJC 2B59A 4KK6C 3UYPB 1HT6A 3HUJE 5JZ7D 5L0QC 2FEJA 1CTNA 4R26H 5T1JA 1R3LA 4BCXA 3N43B 4HF5L 2KZ1B 3P9LA 1BOYA 4XN9A 3BSZL 2JJTA 1A6UL 4YC2B 4LOFA 4ZAKA 1AMXA 5HI4C 5ACZA 1C16B 3GGWA 2WOBA 4KK8D 3K2MC 1E27B 4N8CH 1HHGB 3FB6A 1M7IB 4Z77B 4OLWL 2HFGH 3P4OA 5KVEE 2DLFL 4XPAL 2DM7A 4J5VA 2GHZA 4ZFZA 3T4AA 1F4XH 2X41A 4E5XG 5HYEA 1GGYA 3EYUH 2W1NA 1XAUA 3MJ6A 5BOZG 3VJ6B 4GXUN 3F12B 2AQQA 3ZY7A 2VN6A 5FYKH 4WWKB 1DQMH 3GSWA 4TVSa 1JFQH 3C60B 4UM9A 4Y19A 3JSSA 1VKXB 3CDZB 3MA7B 1WBXA 3NIGE 1KTDB 4GEIA 5A43C 5ENWB 1EBAA 4J6RH 2G9HA 1W72A 2F6AA 4K9EC 1JERA 1S3KH 5IJDC 4N2OA 5E9DB 4KGJA 2AAAA 4DUVA 4MQTB 2X4RA 3UTTB 1YZZA 3EJQA 1AS8A 1KLUA 1YO4A 1HVXA 1YC8A 5BXFB 3K6SA 3X1NA 1WTGT 4XR8C 2NY0D 2ZYHA 3Q6FB 5F3HB 2ZOKB 3THML 3WNIA 5JW4N 4DK6A 3LQZB 4OB5H 4XCYB 4LSTL 2PXYA 5H8DA 4EO5A 5E2JA 4QRTA 2FJFB 5D1QB 5C08E 4JDEB 4Q97A 4JHVA 1AVAA 4CNIA 4JM2C 1RIUH 1NICA 1GS6X 2B4CH 5E6UB 4JO3H 4IU2B 3PS6A 5IQLA 1BGXH 1QMUA 2BS71 2WWMC 5I1LA 4EQ3A 1USQA 3CFDA 3K5SA 4ZMVA 2X87A 5HYSG 4ZPTA 4WI0B 2HVBA 4GI9A 5E8DL 3O0RL 2AP2A 3RVUD 3K71A 1OZUA 5EU4A 3HZMB 1ADWA 3V4PA 4IKLA 1DEEB 3H2WA 4TMPA 3P73B 3D3VA 3TN0B 4YGAB 1C5DA 4YHMH 3ZE0B 5CGTA 4HLEA 1UD6A 4GRLC 1CB4A 4AV4A 5CSGA 1HL4A 2I9TB 3BVTA 3QNXA 1DVQA 4AEFA 4RGOL 2CKBH 3MV9D 4ZW7A 1B0GB 2H5UA 1MG2C 3GTTA 4HKBA 3RWEB 1Z9OA 3GRWL 1KN4L 2XPGB 1IBHA 3ATDA 3S98A 3JT2A 3Q5OA 5SX5H 1JZ6A 1FI8C 1N8OE 3QAZC 4P8QA 4AC2A 3ELAT 2A7BA 5EOTB 3RA7L 3CZEA 4ONFL 4HSCX 1KULA 1E9QB 5E6ZA 5IW1B 4KKQA 4H1LA 1WZ1L 3Q48A 3KL5A 4LSSL 4N8VB 2IADB 4YL9A 4N5EC 3NACL 2J5WA 3EGXB 5DR5L 1JGLL 1NBZA 3LSOA 3W82A 3KXFB 5DK3A 1FSKC 3NDZE 1Z7JA 3HG1D 4BSWB 3CUPA 4TXVB 1NAKL 4HKJB 5C3TA 4ELMB 1MJ8H 4F8PA 5DF0A 4DTGL 3HMWH 1DVFB 1TIUA 1E5BA 4KROC 1KIPB 4PLJD 1AD0B 1PKQE 2DD8H 3LZLA 4KI5D 5D7JD 1I82A 3BEWA 1E28B 3AQDA 3GHPA 3QDGD 4KAQH 3EYSL 3NBNA 3DRQA 4UB0H 5ECJE 3GMMB 5CFAA 3SBRA 3PWPB 2JJSA 3LIZH 4OFIA 5EBWB 5BZZA 3Q8CA 4JRXE 1J1PH 3POHA 4MNHA 3WS3B 2VLRB 3B7RL 2WQXA 3MUY1 4ODTL 2YMTA 5DEFA 5B22A 7FABH 1WVZA 1WCBB 4M7LH 1QFPA 3T8MA 4QJ3B 5DRXA 4X4ZA 4FXGA 1QSFE 2VISB 2BP5M 4ZMZA 3DX6B 5EU6E 3OPZH 1EO5A 4MJ5B 1E30A 3GKZA 5DJCB 4P23A 5FR3A 4A6YA 1HHKA 3DVGA 4AENB 2E0PA 5B1CA 1GGCH 2YD8A 4ODXA 4ZQKA 3WY3A 4P2OB 2PTTA 4B7LA 4TSAH 3RNKA 1EGJH 1WAPA 1E40A 4XN1A 2CCLA 4HKZB 2NY5H 4KGLA 3T3ME 5FM4A 2CXKA 3C9NB 3ZL4H 5EO9B 3W9EA 3D52A 4K4KA 2Q5BA 4OQTL 3BGFB 4XVUC 3UPRB 4PU2A 4NENA 5HDBE 4BKLB 1NGYB 1FNGB 4U1HA 2IQ9L 3FDWA 5T3ZH 3WJMB 1U8HA 2MFNA 5DHVH 3CN2A 4EVNB 4YGVB 3VXSE 5HDOA 4G43B 4D3CH 1IGML 1XGTB 2B9BA 2BW4A 2I07A 3GXPA 3HHSB 1YPZB 2AMGA 3F5WA 3Q2LA 1FNHA 3L3GB 1LO0L 5GGTA 3PWVA 5LGJA 3K8LA 5EA0L 4PAZA 1TQBB 5AW6B 3TT1H 2FNWA 3C6SB 1INQB 4IBZA 2IAMC 1PZ3A 1FO0A 1FFQA 3O6KL 4PJIF 2DPKA 3CHOA 1DUYB 3GS0A 1HCYA 4TULH 2Y1ZA 4LSQH 3WLWD 3DX1A 3BUYB 1RULH 3CLFH 4V2BA 3VH8B 3X12B 3U2IA 1AS7A 4YDZA 4QHKI 3QJVB 2W60B 4KKLD 1L7IL 3H3PL 3H9YA 5FYKE 2IDFA 2AK4D 3BWUF 3T9WA 1F4AA 1V7NL 2YKLL 5C0IB 1CMOA 1Z9PA 3IWVA 4GMTL 3VFUA 3VXRB 4YE4H 4HFWA 4P3DA 2DS4A 5ESAB 2BHFA 3Q1SL 5K9KB 1PL3A 4XRCB 1MRFH 3LH2L 4OM0H 4L1SA 2F2HA 2R29H 2XNAB 1IAII 2RBLA 4MNQD 4YHPA 4N8CL 2IAAC 4L8CA 4BJLA 4K8RH 4BQ8A 2HFGL 3DYMA 2FSEB 3O2VL 2ZKWA 3C75A 1T0PB 1A4KA 2IFFL 4TKWA 3HE6C 3TO2B 3ECBA 3DX9B 4RBPK 4L5FH 2YC1A 4HETA 1UJ3B 3TURA 4H0GA 3CZFB 1UZ8B 4E41D 3QUYB 3FQNA 4E9VA 1FC2D 1MJJA 2Z35B 2V7HB 2A77L 3ATBA 5FWQA 3ESVF 1DQJA 1AIZA 2AQ2A 4QYOB 5HJGA 3T1WA 4KNUA 1XF4A 2X0UA 2UXFA 2WY3B 4ADIA 3NT0A 2ED9A 4Z7QE 4AM0A 1S3KL 1K4DB 2B1OA 3QO0B 4AMKL 4UTAL 2C4FU 4P4KB 5TJWK 4GAYB 3T2PA 2RGSA 3EYVA 2J1XA 1EHLH 1AKPA 4ODSH 4PJDA 1VFBB 4CC0A 4QHMB 1QNIA 1DJWA 4PCYA 3PWNB 3W3BA 4U0QB 1HOCB 3VUAA 5HHQA 4UV7L 1FGNH 5FGBC 4PFEA 1T89A 1XH1A 1XIWD 4WLCA 1DANT 2QSTA 3CH1A 3DSNB 3UJIL 3LV3A 3UBHA 1EO8H 3VACA 2A1WH 1HIML 1ROCA 3LKOA 4LL1A 3O45A 4RRPA 4ATTA 1JK9B 1KJVA 4Q2ZA 2B4CL 4G1MA 3E80A 4JO3L 1UA3A 4N28A 5E5RB 1W0YT 2HT2D 4IOSD 1G7MA 4FQJH 1OSZA 2YRBA 5IMMB 4JFFB 4RMRA 5J6HB 1ZOXA 2PLTA 1FZMA 1N4XH 5GZOC 1OD9A 3IFOA 1GSMA 4PRHB 8CGTA 4L8DB 3NRPA 4NZJA 4X5XA 1X9UA 3QULB 3SKOA 2F54B 4A2MA 2ZX9A 3X1GA 3HLKA 5DJ0B 1T0MB 1U2HA 3FFCB 3ZE1F 5CEZD 4YHML 2MEJB 3SE9L 2Q7YA 3ZLQC 2F7IA 2DF3A 4L4VE 3C60D 4OZGE 1BMGA 2DWSA 4I48A 1GL4B 3FOMA 1JI2A 3U6RA 2UXTA 3MLVH 3TZVB 2XN9A 4HG4K 4WGWB 4NOBA 2YS4A 1A9VA 5GJTH 1YMME 2G9KA 2V3FA 4PBVC 5FYJD 3SO5A 5JIPA 1WFUA 4MB3A 2YOCA 5JNYA 5I8KH 3QR1A 3TYFB 1AO7A 1T7VA 1A1MA 3RB5A 1F2XK 4XO9A 3GSUA 4AMWA 3AREB 1ZANH 3U1QA 1L9SA 3X14B 2NY5C 4HUWA 4X7TA 2EDJA 4CL7A 5JR1H 5CN3A 3MV8A 4JFEB 2BY1A 3VMOA 2DRUA 4Z0XA 3B7YA 4MXQC 4PJGF 1ZSHA 2I25N 4Q9CA 4OR1A 1MJ8L 3B43A 3G6AA 4MJIA 3Q2CA 4XNMA 2GK2A 3HMWL 4W93A 4YLCA 4CRPA 4G83A 3ZN6A 3TC9A 5JXAH 4KBPA 5F93C 3JWDC 4LCCA 4MXWH 5B7EA 3MGTA 3ZU8A 3L3OB 4KAQL 5MENE 4R7DB 2Q8AL 4KFZC 3I75B 4JFDD 2GSGB 4Y0GA 2IBGA 2HT4D 5L6YL 2AQRA 4KTEH 3GSVB 1EV2E 4OT1H 1UG9A 3VWKB 1BFVL 1FFRA 1UB5B 4UWQB 1KCSL 7FABL 3TN0D 5FKPB 1GC1H 1GXEA 3ARSA 2EAEA 4OY9A 2XG4A 3GSNB 3MNZB 1BHGA 5C9KA 3FT9A 3HW7A 1E4WH 3ZO9A 3PHOA 5T3ZE 2JELL 4GAJH 1BVNP 2I60H 1PD6A 1S78D 2V0AA 1JJUA 4QWWD 1CF1A 4X98A 1FYTA 2HLFD 4JFYB 4Y1AD 3ZR5A 4I5BA 1OLZA 2L04A 3HUJB 4PRIE 3BP6A 1OPGL 4O4YH 3LX9A 1EGJL 1ZGLM 1IM3B 4UM8A 2HN7A 5BVJA 4KMQA 1MNUL 4FQXD 5CF3A 1SN0A 4RMWA 1AJ7L 1E9OA 1KTLB 4KZDH 4JUSA 1WDAA 3FSAA 4EUPA 3JVGC 3L7FA 2CJ3A 4KK8C 1FBIH 1QABA 4GW5B 1YQ2A 4HCIA 1KCRH 4OIIH 4PI2A 2CRIA 4QTFA 5AYTA 4RNRB 4MMZA 3LZQA 4MASA 1Q94A 1G87A 4D3CL 3I2CL 4I18B 1FLRL 1GIGH 3EGSA 4OD1L 5B39A 1U58A 4WY7H 3VE0B 3BKMH 4URKA 1PG7H 3NIGB 3UG5A 4CADB 3ESNA 1JGUL 3B2XA 5GS0H 3CU1A 3ATEA 1QWNA 3DV6B 3GMQA 3GB7A 3TT1L 3FBQA 1YEIH 2UV3A 2WLLB 4BM7A 4HJEA 5D7EA 4DW2H 4U7SA 1UH2A 2I85A 2EVIA 5LUMA 1RULL 1J9CT 2ZXCA 2NYYD 2ZSVB 1UT1A 3N5AA 4ZSOE 4L5FE 1I3UA 2WLKA 4TVPD 3CN1A 3B3IA 3H9ZA 1GYCA 3TH2T 4OLXL 5B3SB 3QZPA 1CFBA 2NY0C 5C08B 1ZT4A 3ZKQD 3O3AA 4Y4FA 2X3CA 4Y16D 5FYKU 2N59A 3RVTD 1OP3H 4F7KA 4KRLB 2XY2A 1HSAB 1I8LA 2P7TA 1YAIA 2BZCA 4U1GC 4BK4A 1YVLA 2XETA 4ESKA 4QNPE 3FUNA 3FYIB 2J1YA 4ATWA 4GXUM 1U3NA 2FEEL 3UTZA 1UOKA 4YHYB 4UQ3A 1I7RA 2ADFL 5AYQA 5IQ9B 3JV4B 4OCSH 1TUPA 1FFTB 1EUTA 2H3NB 3FQTA 3BZFA 1ZEAH 2AHIA 1EMTL 1B3JA 2W81C 2YAFA 5I6MA 1SPDA 2KT6A 1WK0A 4XMUA 3BGMA 4YH6A 1YEFL 4N2DA 2XA8L 3AUVA 3GM8A 3UAJA 3SDAD 3M7OA 3VX1A 1T04A 2EXYD 1DVYA 3ECVA 3PLYA 3UBFA 3KVQA 3V55A 4IRZH 1N26A 3QPKA 2KMWA 3TONA 4L3EA 3K6NA 1AZBA 4ZTEA 5IB2B 4UI2A 5CP7A 5ADOL 1P5UB 2KQNA 1QBLH 5J11B 1FIGL 4IHBA 5EN3A 5JW4M 2YXWA 1FNAA 5J1AB 1AP2A 2UZYA 1EHLL 1OF2A 3BP5B 4ODSL 3RLSA 4Y2DA 2MNJB 4PGJA 2E6QA 4A63A 5J4MA 2ZYRA 1BZDA 3KYOB 1F42A 5B38A 2CLRA 4QIRA 1VDGA 5AW1B 4F2ME 2JLLA 2QSCH 3ULSB 1BW8A 1FGNL 1T66D 2P46B 5AB9A 3AAZB 3WS6A 3M1CA 5BOPA 2YEQA 1A1OB 4BKTC 2K1MA 2OJ1A 2K4AA 2V8MA 2E7CA 4P05A 3I74A 4PJHF 5CJOL 4Z3FA 2E9GA 4GRWH 3WNLA 5H37A 3HI5H 5DYOA 3RWJA 2WIMA 5IR1B 1CURA 3CCHA 1IAIH 1MW0A 1UT2A 2R7EA 3FPYA 4NEHB 4QF1B 4U1KB 1XMEB 1ZPUA 2IBBA 4B60A 1R4XA 3QPXH 4PLJC 3MLRL 3X3FL 3P0YL 4M48L 3AABA 4JRXB 5D7JC 3O6LH 4K94H 5I16A 4JL2A 4AJWA 1S7WA 3VRJA 5FO7A 2NY3C 5DRWB 1FSKB 2XRAL 3LKPB 3QFJE 3B2PA 3BFWA 2MQGA 5D4JA 4FNQA 4NN7B 4WFEE 4YSPA 3LNFA 4XN4A 4ZXBD 4KZ0A 3VD4A 5KN5B 3FONB 1G6VK 5DT1H 5AUMB 1DBBL 3KZ8A 3QQDA 3VG9B 2GW5A 2BNQD 2RCSH 3KPRB 4F1SA 2CWRA 4TV3A 1E4JA 2WJ7A 3EJZD 1JPEA 1CN4A 4LCYA 1UB6A 5E8PA 2GABA 5LG6A 3X11B 1I8KB 3PJSB 3LNHA 2NXZC 3MLYL 2H0JA 2CNZA 1NDGB 1OCOB 1PGRB 1Y1UA 4FQ1L 5K93A 3WJLC 1OCZB 1CT8B 1FAKT 3AMLA 3QDGE 4KH2A 4R3SA 4YZFF 5AW3B 1ZK5A 5I8KL 2YD0A 5A2FA 4H5SA 4FLQA 2J72A 4G6MH 4JO1L 4KHTH 3BUPA 4MVBD 4N5UA 4WI2A 4X6BA 4DKTA 4HEPA 1MCIA 3T3MB 1A6ZA 4XPTH 3SPJA 2VR7A 3PNWA 2R83A 4FNLL 4JANB 1ZY9A 2J1KA 4Z7WE 1Z9MA 3RL2A 5FAAA 1F4HA 1MDTA 4J39A 1GMIA 5JW4Q 2B2XL 4PJ7E 1T3FA 3SDXA 4GPVA 4MD4A 4QHLA 3WBDA 2WMPB 1MHHB 4QRFA 2EDDA 3VXSB 4R9HA 2V5MA 3PQYD 1EAPB 5FKAB 3VW3H 4MXWL 2B5IB 4X6CA 1F1DA 3DARA 4R4FH 1OT2A 3D4GA 1QLEH 4Y9BA 2XZCH 5ERWA 5AW9B 1MY5A 2L7JA 1KGJA 2AJUH 3BHBB 4F57L 5IK3B 2D7PA 4NO3A 2FO4B 2YD5A 3QJSB 4HAGA 3BJLA 5GS0C 1C7SA 1XF5B 3ZR6A 5HVWA 4Q0XH 5K9OA 3WN5A 4OM1L 4OZIE 1YEKL 3SBWA 2OKMA 1GC1L 2GYSA 1HQ4A 1RU9H 1W6LA 4FXKA 1R1CA 2B1HH 1ZT1B 3V5DA 2R8SL 3VFSA 2HT3D 4IDJH 3EOYG 4XP6L 4HALA 2ZKMX 1I75A 2G3ZA 2J6EA 1NEUA 4KKLC 2BS9A 4NKOA 4C57C 2DMHA 2BNRE 2QHLA 1FCCA 3MRRB 5DJ6B 4ZRGA 5HI3D 2DW5A 3HB3D 3F58H 3OKKB 3PGCB 2OL3H 2FT7A 4P46D 1BQHB 4H4NA 2YXVA 4HJ0D 4TNGA 4JR9H 1NGZA 3U4EA 5AVUB 3AT0A 5ID0A 4J3VA 4O02A 1CJYA 2HWZH 1JOIA 1FBIL 1KCRL 2IF7A 1FPTL 1I1FB 4LSPH 2NDFA 1S9VB 4G80A 4YHNB 1C9SA 1CU4L 1EJOH 3QI9B 1ZHBA 4GSQA 5F7MC 2VJ8A 1A7PH 4WEBH 1GIGL 3L3HA 3ZYJA 1VGEH 3D30A 4F33B 4WY7L 3B9KD 3S0PA 1WGVA 2ZUTA 3FQYA 4ENZA 1PG7L 2H2PD 3M45A 4N2BA 1JWSA 3AXHA 2CJUL 4WNQA 3WAJA 4NAQA 2DIJA 3UACA 1KBBA 1ILUA 4AH2B 2KC0A 3SDDD 4S1SL 3SKJL 2H32A 4OGAD 3MC0A 1YEIL 4H8VA 1XD1A 5DLML 3IU4H 3SOBH 4Z7QB 5MEQA 2XKSA 5J89A 4Z7UF 4L4JA 2XX1A 1AFVH 1F02I 3QNFA 5EO0B 3U9UB 3RDJA 3MRMA 4LLUA 3QWQB 1I8IB 5D93C 2F8OA 2EH8L 3FNKA 1YEHH 2VXQA 4JLRB 3ARWA 4Z95H 3JZYA 4K0OA 3BZ5A 1KBWA 3IGAA 3QXWA 1GRWA 4LLQA 4C47A 3DOSA 2H9GB 2ZP8A 4AGMA 4E41E 1MDAA 4K2UH 5ITFA 4NQEA 4PTUA 3I9GH 2X0WA 2JB6B 2X4UA 4PMFA 5IMKA 4HOXA 3BT0A 1AE6L 3GLEA 1U6AH 1DQDH 2ZSWA 1OXYA 5LBGA 3RGVA 3FCTA 3P3TA 4G3YL 2F53D 2A0LD 3ULAB 4EOWL 2XKNA 5C0CA 4CILA 1LP9E 1M7XA 1GTFA 4JFHD 4PV8B 2VDNL 1DBAL 3VG0L 2YFNA 3MRHB 3WFBL 3ABGA 3RWIB 2HG5B 4PWKA 5DI8B 5HHVL 4JDTL 4P5KB 3DX8B 5D7HA 4AQ1B 2F68X 4QY8B 4GRWE 2VSKB 1CICD 2D3LA 1A7OH 1F45A 3A4DA 2ORBH 3FO2A 4L4VB 5DUBA 4OZGB 1T2JA 4NJAL 1ETZB 3TCXA 1I3GL 3CFIC 1DZBA 2W92A 3O2WH 2HRGA 4ZMOA 2Y36L 3FZUC 2XN1A 1NFDB 1QBLL 3MRCB 4ZUSB 3T6VA 5AVYB 1S9YB 3QS3A 4Z8FH 3QC5X 2FD6H 4F15C 1WA1X 1MXGA 2CGRH 3UGXA 4JN2B 5EMYA 2LFGA 4P57A 4PJ5A 4ZUWA 5CEZE 1WS7A 3CNKA 43C9B 1T21A 3TBVA 2BMKB 4DP4X 3U2SB 4K7PH 4MX7A 5E94B 1AD9A 4WNSA 6PAZA 3HI5L 2VW4A 1NDMA 4NP9A 2YO3A 4XX1G 4E42A 4HUKB 1WH0A 3I6KB 2XWBA 1UCBH 1IAIL 3HHRB 4GLRI 1JXJA 3E6FA 4CVXB 3DYOA 2GAZA 4F7CB 2COQA 3MACH 3A0OA 4NUGH 5G5DB 5MENB 3GXNA 2VAAB 3NCMA 4O2CB 5DJ8B 4MHHI 3O6LL 1SLVA 1P5VB 1GYVA 2GFBA 3CZUB 4X5QA 3E1F1 3RB7A 1KCKA 3UZVA 1MVYA 3OAYK 5I17A 2NQDA 3DTXA 1AKJA 2VM4A 3LDBC 5DSCA 3AXIA 3S88H 3UYOD 2VITB 2XV6B 4OJDH 2WYTA 4I3SL 3V9FA 2RCSL 4QTIH 3NA9L 4C8XA 1AHKA 1N6QH 1ERNA 2JKNA 5DHVB 2C4XA 1JYVA 1ITCA 5MEPA 2D7QA 2PW2B 1J7VR 2VZSA 4BHUA 3QJUB 1BZ7A 2IPKA 4G7YH 3NEEA 3BLPX 3GYRA 3IFNH 3L7EB 4DPRA 3FUJA 5ICZB 3UO1H 3UTQB 2BSRA 2YPKA 2BFGA 1NCWH 5GGRB 5GRVK 1S78C 3ZTJG 2BFVL 3OB0H 4QWWC 2Y7OA 3VGBA 3U7WH 1Z0MA 4GP8B 4NKIH 4RDBA 3EJRA 3ROOB 5DA4A 3W38A 4G9DA 4ICWA 2KBGA 4K7FB 1YYML 2JKXA 5ESQA 3N41B 2VABB 4FQXC 2WQUA 2DQGH 4WWNA 3NABL 1RV6X 1X44A 5DJDB 5DJXB 5C0GA 3V52H 4EIZC 3OKEB 4ZOAA 4ZFGH 2HTLD 5L2KD 1RQ5A 3PU7A 4G9FD 1LWHA 3OHXA 3UYRL 1SLUA 3WKYA 1QNZL 3D2UB 1T6WA 4DGIH 1KJ2A 5IHUH 4HX1A 1N8ZA 4KPHH 4MZ3A 3M46A 3MV7D 3H7BB 1IUZA 2NYKA 3HCVB 5BUAA 1H0DA 3OG6B 5AZ2H 4ODHL 5TQ2L 2DWXA 4APXB 2ZTBA 2WP3O 1XTLA 2J21A 1TQVA 2OXGA 2QKIC 4JM2A 1BJ1J 3EFDL 1NGQL 3BWUC 4PTTA 5IT2L 1PD1A 4ZSOB 3JV6B 4IMLA 4WKZB 3OGCB 3T1FA 3BZEA 4IDJL 4X9HA 3FTXA 4R90H 5EWIL 2NYYC 1XF2A 1FE8H 4UV4H 3UCQA 2F7QA 5D2NC 3L1EA 4PJIE 5IF0B 2FL5B 4JHZA 3V10A 2N7SA 2JJVA 3ZKSD 4XE0A 5L8JB 1A6VH 5BO1H 2GTZB 4GRLA 2FX7H 2OMXB 2C5DC 2XVLA 2GIMA 1DVTA 4Y16C 4I0KA 3RVTC 3PAVA 4X9YA 2FJUB 5F7LB 1YNTF 3SPIA 4BFKA 4DP5X 4FQLH 5I75B 4BD4A 3KYNB 2JFCA 3H4HA 3LHAA 5FDWA 5KS9A 3P9MA 1H3PL 5D4QA 5A40E 1Y18B 1XXDC 1JWMA 2HWZL 1NC2D 4AEIH 1CFSA 4AL8H 5JW3H 2XV0A 3VA2C 1PKQA 4GB9A 5DJZA 3QEGL 4J3TA 4BIKA 1MCCA 1EJOL 2YEZB 5IGXH 4M3HA 1A7PL 2OXHB 4WEBL 4ALAC 5A6IA 1EJFA 1VGEL 3ARQA 4U1GB 2J2ZA 4K5OA 1P4IH 1UXSA 4U0RB 3VD2A 5HVHB 2EZ0C 2EO9A 1OIOA 2G60H 5KYYB 3FUMA 3SDAC 2EXYC 1BQ5A 2NTSP 1QO3B 3KLAA 2OZ4H 1IAOA 4FI7A 3WNPA 1JHTB 4NM4L 1AFVL 2CKNA 4QXVA 1U8PA 2BP8A 3QCUH 1QSFA 3II3A 4FFVD 5EU6A 3BWSA 4GW1B 1LQBC 1QEWA 4Z95L 3V4VL 2LOEA 3OR7A 1OT4A 1UM6H 4QAMB 2D03L 1BJ1H 2DB8A 3MXVH 4OCLC 3RVWD 3ZDZE 5FECA 5IHWA 1SLXA 2EO1A 5F88A 3HRZC 4AOFA 3LIUA 4D0CA 1MF2H 1D9KA 2XICA 1T66C 4K5LA 2B08A 2EEDA 3PP3K 2IPTH 3I9GL 2BW5A 1G9MH 2Y2YA 3BWAB 3TBWB 3ZUCA 1MPAH 4UIMB 2B1AL 5I5JA 2YKKA 4YLQT 3PHAA 2O61A 3TNMB 1D5MA 4FADA 1ECZA 2WXIA 3GWJA 3RJOA 2EXTA 5IVOA 2YD4A 4I2XB 2GITB 4FABH 1N5AA 4HBQA 4K55A 2NX5B 4HGWA 2N7BA 1OQXA 5DMGC 3US0A 2HJKA 1TEGA 4ICXA 2QFRA 2DJUA 3BT2H 3QFJB 2DDQL 3TO4C 4OLVL 3JT0A 1MREL 1OGTA 3SO3C 1BAGA 2X4NB 1AR1D 4J2XA 4H0LC 5IFJA 2DI9A 5DK0B 1HZLA 1XX9C 3WIAA 2AEQL 3IJYB 3HN8A 5CSBA 5INCB 5SWZA 4ZXBC 1DQQB 4HUVB 5AKSA 4OGQC 5CCKH 5I74C 3CZKA 3ZE1E 3SQBB 3EJZC 2XPZA 1ID5I 1PZ5A 2X89A 4KO9A 2NY3B 5K59F 1OCRB 1J1OL 4JDZB 2FD6L 4NXSA 5ACLA 3D06A 4U4BA 2V2XA 4G5ZL 1KJMB 3TX4A 1N2RB 3FQ4A 3EZJB 2CGRL 3FOLB 2VL5B 3GMOA 3KPLB 2GUOA 4FTVB 3CC5B 3MRIA 4K07A 2EKSB 1YY8B 1KGCD 4MVBC 3NESA 4WIQA 5EUKA 4W9GC 4AITA 2JI2A 2ZYSA 4RX4D 3NJHA 4OD3H 2M83A 2XU9A 3L8QA 3CHRA 4F9LC 4Z7VA 3MA9L 4ZZFA 2NUPA 2DQTH 1A5FL 4MRBA 5GS3A 2ICWI 4PJ7B 2E59A 2IAMA 2BNQE 1BDYA 3KL0A 2QMKA 4KH9A 2ATAA 5JPNC 1M9WA 1UCBL 3SY0A 2YJQA 4F92B 4MNGB 3NCEB 5GISH 3KGUA 5D71H 2RA1A 2WXPA 4FZEL 4NUGL 4NHCH 5H4ZA 2VDRL 5FA3B 4XPFH 5FO8B 5FB8B 3CBKB 4HXBH 2JF1A 3SE4A 2ITCB 2VIRA 1YN6B 4WHTA 4XP5H 3FRPA 3SDYH 2VM3A 2OM5A 3BXNA 4OZIB 4HWZA 3NCBB 2X4OA 3F7VA 1NCJA 1F11A 1KNOB 2EE3A 2ROYA 3AW5A 2UYLB 4HIEB 1BXUA 2O4EA 4MRCA 3S88L 1X3DA 4C4KT 1MLCB 3SDCB 3N04A 4HUXB 3WNJA 1R5WA 4M93C 1SHWA 1UZ6F 4M43L 3APFA 1Z1WA 4LP5A 3HE6A 2HT3C 4LCUB 1OE3A 2BNRB 3DUUA 4TTDD 4X9FA 3VFWB 5CINH 2X4TB 2UX7A 4LOUD 4YR6B 2ID5A 2DMCA 3NFNA 4AXWB 5IVZA 4NZUL 5E6SB 4QRPB 3S4SA 3WENA 4RMUA 4PVBA 3P3YA 1YY9D 2A83B 1D6EB 2IDTA 5HI3C 2O5YH 3HB3C 1PW3A 4U49A 1MFDL 4P46C 4W81A 2CKBA 1LDSA 3B2VH 4GJTB 2ED7A 1ZA3A 4NZ8A 3U30B 1CVRA 1CD1A 4N2LA 1L9MA 2YWYA 1NWPA 4HJ0C 1CDJA 4JK0D 5I8OL 4H20L 1UUSA 3S37H 3E8UL 3WIFB 3WNNA 1KBPA 3FT2A 1KF9B 2X9ZA 2R0ZH 4MZIA 1JUFB 3BFQG 2N0KA 2BIMA 4R8WL 3MKGA 4IBVA 1SVCP 3TYGH 1CLYL 2VXVH 1BLIA 3B9KC 1OAZH 2VERN 2PR4H 4LRNL 1J0IA 2H2PC 2F58H 5H35B 2JCCA 1MKFA 3LXBA 3NTCH 2KL6A 3OZLA 4A7GA 4BV1A 4PRPA 1CBJA 3AU1B 2VDNB 3VSUA 4HDIB 4QKXB 4OGAC 4OF7A 3D2TA 2P24A 1IARB 4GG6B 1G7PA 2FUQA 4IRJB 1Y0LB 1E8YA 2QBWA 5DMKB 2PWHA 2BS8A 5SWSE 5AOZA 1X6NA 5I1EH 2PYEE 2VSMB 1PVHA 3MRDA 3B8SA 5C07B 4XHQA 1C08A 1YMMA 2Z91A 3NP3A 1ZVSA 3AY4C 4G1EA 5DZPA 2PP9A 1H5BB 3QUZB 2EDFA 2PCFA 4PJ8C 2OMWA 3LIZA 2Q7AA 4HA1A 3FCSA 1A6AB 2SEBA 5I24A 1G9MC 2FJHB 2JJUA 4BZ2H 5I76B 3PGFL 4U1JB 1V3JA 4MAYD 3C6LB 1LP9B 1JPGB 3DMMB 3MTRA 5I6XC 4XMLL 5F7BA 4WF7A 4ZTOL 2GY5A 3EO9L 2R4RH 4LKCA 1JPSH 3H54A 4AL8L 4U7MA 1NANH 5E1QA 1X5JA 2D2OA 5EZPA 5LGKA 1OB1B 3JWNG 4GRWB 2WLMA 4Q52A 4Y5XB 2YGOA 3REVA 1P69B 2Q9OA 1RY7B 4KKCD 3QR2A 1A2YA 1FAIL 1P4IL 2OMVB 4A7SA 1SOKA 1ACYL 4GXVL 1SOSA 3OC5A 1CICC 3MODH 4UDTA 3D0VA 3LNDA 5CD5C 3LTVA 4JW3A 4PM1A 4NT6A 5EZLA 1WZMA 2OULB 2QZ5A 4RDQG 2ZYIA 3B7SA 4V1DD 5CBAA 1K4CB 2BVTA 5D5MF 1G43A 4TRPL 5KG9A 5E99L 2AJSH 5C9JB 3VM7A 1UM6L 2JXMB 1OANA 4MA8H 3RIKA 4OLZH 4TQPA 3MXVL 4RVBA 4WTZG 1Z3RA 1A47A 1CE6A 1OTUD 1KCLA 2F0CA 4UQEA 1SJMA 4MDIA 4UBDD 4EZLA 4PRIA 2IPTL 3OXSA 4ETQA 2CO4A 2KUTA 4KMLB 1A7NL 2NLJA 5HJBA 4L48A 4PBWD 4PJCF 2Y0SA 5D7KD 1CR9H 4JPIA 2CQVA 4FQPA 5IQOA 2ADJA 1E6JL 1BPVA 2QLYA 2BNUB 2X6UA 1PAMA 4CBZA 4P2AA 5E8OB 1K2DA 2LGNA 3KPNB 3L81A 5IKCB 2EJ1A 2IPUK 2ITDA 5DZVA 4XMKL 3OG4B 1UD4A 2HA1A 2OQJB 1R0AH 1ASOA 3ZTDC 1CYWA 1DTUA 2RIKA 4XMPL 3WO4C 3A22A 5E7BA 3DROA 3RPIA 4WW2B 1V3KA 4IBUA 2KDGA 3ETBF 3GQFA 1HHIA 3LS5H 4M7LT 5A2KH 2I5YH 2DQCH 4K71C 2YWZA 3VD5A 2MNUA 1KPVB 1RXLA 5JOPE 2PCYA 1OAUL 1KXVA 1T20A 4LP8A 1DYZA 3E6HA 2N01B 1Q90A 4D7PA 4QRSA 4PVLA 2ICWJ 3GJFH 2VQUA 3F7YB 2COVD 4YNYB 2BIQA 3V5HA 2IPUG 1HZKA 5DQJA 5ECGA 5JLZB 3WJJA 4BA0A 4B7IA 2P80D 1QKZL 3LS4L 1E9PB 3TBYB 1RIHL 3JTBA 5J1SC 2AV1A 1G1CA 1HWHB 4QRUB 2JKTM 4X5RA 2CHWA 1CL7H 2AXGB 2NW2A 2QQNL 1HEZA 3STBA 4AMXA 5CSZB 3A24A 5SX4I 1U8IB 4DPAX 2HTLC 2XTLA 3HZYB 3VWJD 4DHLA 1U8KA 3OKDA 2OL3B 3ZX1A 1ZGLA 1SXNA 4GKSB 1DO5A 3FHEA 4P2QD 2NX5D 4IGBB 1IL1B 4P2YA 4Q89A 4XPHL 4H88L 3BH4A 3MRBB 4BWUA 4LBEB 3DXAD 4XO3A 3TF4A 2D0FA 1XGQB 1DJGA 4U1MA 4PGCB 3WO3B 3W9DB 2XIBA 4JMXA 4ONHA 1IC5H 2BY0A 1ZHLA 3BUDA 1EEYB 1TPXB 2X70B 5HPOA 3NQIA 5L2KE 4DH2A 1HH6A 1Q0XH 1NBQA 1KPRA 4UINH 4L1BA 4OBRA 1UASA 2UZPA 4S1QL 4NUJA 2FTAA 2ESVD 3MV7E 3O2DA 4F2MA 1S7SA 1I8AA 5AKTA 2BC4A 1HAUA 4F7MB 1RK1B 4RAVB 4BUHA 2Y22A 1JPFB 2GUYA 4XBPA 4R96B 4BH7A 3IMTA 2DQUL 4HZ1A 2W0FB 4JY4B 3MV9A 3MBEB 4C59B 1DVSA 2UY6A 3RDTC 3GC3A 2G75A 3TNNB 3FT4A 1FVEB 2GT9A 1KFAL 5EU3B 5FFGA 3FT0A 1P2CB 4L8SC 1XSJA 1MJ7H 2LQRA 1AAJA 3MFFA 5E2TL 1WQVT 2GSIA 1F0LA 3MLSH 4JPQA 3BE1L 3OZKA 1OAZL 1VZHA 1OM9A 3D39D 3NTCL 2D7NA 3VSQA 1MCWM 1O6SB 4LPXA 3F7PC 5GGSA 4PJXF 4N0YH 5D6CB 3ARRA 2OCJA 2Z64C 4FFYH 1KB3A 3CLEL 3GK8H 3U36B 3HG1A 5HYSB 3HMXH 1ZRUA 3LNEA 1PDKB 5IBUB 3U1SH 3UOAB 1WC7B 3WEOA 4HV8A 1QACA 2I26N 1IEBB 1AG0A 3KLQA 4LHQB 1AQKL 4M8QB 1LEIB 1A66A 3KW8A 4QXGL 1TEFA 4FFVC 4J27A 3ZDZB 4JRWA 5IB5A 1B88A 3FB8A 1N0LB 1R5IA 1XGYH 2BSSA 3RX8A 4Z7UE 4LU5L 1WFOA 5D7JA 4B9IA 5K9JL 3CC1A 3NZHH 3QIUB 1XCQA 4RDQF 4M9OA 3KW7A 1BQLL 2B3IA 2JCWA 3LEYL 4NWUH 3RVWC 3TU6A 2NNXA 4P0DA 1AGFB 4AQ8C 5GS1C 3HS8A 2EICA 2ZWYA 2OX5B 1FIEA 2K45A 4RGND 3K74B 4Y4HD 4ZFFB 2Q20A 1YJDH 3QDME 4UOJA 3RIFK 2N56A 1FF5A 3CMOH 1J8RA 4B9GA 1BF8A 4Z7WA 1KT2B 3KWWB 5C0FB 5DEJA 4AVJA 3BISA 2G5BB 4RFEB 5FHAL 2C1PA 4HIIA 4PJFA 3HAEA 3E38A 2IDQA 1IFGA 3EBAA 3S8FB 3LH9A 3T4YA 1G7JB 2FECI 4NCDA 1O6VA 5E00A 1JV2A 1SBSH 5HGDB 2MCG1 3BH9A 4XN5A 5EBMB 2GJJA 2DYPB 2XTJD 1IJNA 1AR1C 2Z9TA 4MCNA 4UQCA 1A9BB 4BK5C 1Y1DA 1CDGA 2HFFA 3MODL 1JGVH 3HC0A 4UQDA 1R3HB 3QFGA 4QOKB 1VENA 1X4ZA 3L95B 4QMEA 5AYUH 2CIKA 5JHDD 4YPGB 3GSOB 2JI3A 5JQIB 4ZFQA 1CGSL 3X17A 3TO4B 1KEML 5ADPL 1GSKA 1JF6A 4YN3A 1UXWB 1T6VN 2QJDA 3KCPB 1PPIA 2FQGA 2I7OA 4MA8L 2HPOA 2MHAB 1MCOL 1I53A 5LAXA 3OAUL 1G7LA 2A6IB 3BRFA 5EDSA 2VDPL 4LEOB 3S3JA 1H3WM 5I74B 1SBBA 3W37A 1HESA 4EZMA 5AFAA 4PJBB 3H0TB 1BM3L 3FQWB 4KKZA 1KWGA 5T5FH 3GDBA 4XNXL 4BQCA 4I0PD 3HC3L 5LBVA 1O9WA 1OWWA 5I26A 3S2AA 4W9HC 3KHQA 1AIFA 4E9SA 4PRAA 2MSPA 3H4FA 4PP2A 5HHOE 2AK4A 3LVTA 3MGOA 1FJ1B 2P26A 5DQ9A 3IJ7A 4E0RA 2A73A 1MCBA 1KGCE 2FK9A 3WUWB 4B0MM 5D1ZC 1MCNA 3WUZA 1MVFA 5AAMC 1RUQL 3VXTA 3T0DA 1VADA 1FQ9C 2E56A 4JKLA 4A2GA 4BINA 4IRSB 3RTLA 1WAAF 4JRYD 3LS5L 1TU2B 3DUSA 1ZK9A 3WFDL 4WJG3 1XL6A 4QO1A 4PJAB 4YXHL 2WVVA 1S9XB 5F9JB 3CSPA 1ZMYA 1DJZA 2X2YA 4MNQA 1T5WA 1IO4C 1BJMA 1KJ3L 5EIVA 2CGZA 3ARTA 4PWJA 3MLXL 3LKSB 3UO8B 4EN2A 5F0MB 3GMRA 4ZG1A 1HCZA 4PG9B 3TIEA 4XC1H 4TTDC 1QRNE 4ZS7H 4FYTA 5MEOB 3AUWB 3BC9A 4LOUC 1DQTA 4YDVA 3CFJA 4M93B 2EXSA 4K23H 4E41A 4H2CA 4IRZA 4JY6A 1YY9C 4U2ZA 5JW5B 1VACB 2OMNA 3OAYH 4TYUA 3AM8C 1PFOA 4G8GB 3SN6N 3KGSA 3FFOA 4PI0A 2NNAB 2PN5A 1XB8A 2GHWB 1EEZB 3B2MA 2E46A 3I50H 1WD9A 3N9GH 4M9PA 5AW0B 1IGJA 3VSTA 2EIZB 5F89B 4YDMA 5E1GA 1BZ9A 1PEZA 3VI3F 4AYFB 1JXGA 3AITA 3AQXA 5HDWA 4XXDA 3MU3A 7PAZA 4X4XA 4JAMA 4P3WA 1UT9A 1AOZA 4B53A 4RAHA 4PGEB 2RHEA 1OCWH 1NL0L 2E8YA 1KIQB 1UA6L 2EDHA 1X5XA 2B39A 2GK0A 1XIWA 4U1SB 5IOPB 3QQ3B 1MZZA 3UROR 2IXQA 4IW4C 3VXNB 4IJTA 5CO1A 4HUUA 5I1IH 5JHLA 2AMUA 3IF1A 5SWSB 1W2KT 3MNVB 1SHSA 2PYEB 3FO1A 1RJZB 4NZRH 2QDWA 3EFFA 4FTDA 4IOSA 3US1A 1N5YH 3EOAA 3O6FD 5EDXA 1D2PA 4P9MH 4UT9H 2EVJA 3G7TA 1KXHA 3L5XH 3T04D 4KWUA 3WIIL 3UMTA 3KJ4C 3PUUA 3ZIYA 3B4NA 5H2BA 4XP1H 2FVNA 2X4SA 1UWEL 1YECH 1NEZG 3RZCB 3FUKA 2EIJB 1IKFL 2EC8A 3QUXB 1YJDC 1L5GB 4U3CA 1JD7A 1X5GA 2ENJA 3P54A 3M17A 5I1CL 3VXUE 3C60A 1NBYA 2OMYB 3A23A 1I1YB 4MAYC 2NUTB 4DKEH 2XQYK 2X2HA 2UWEF 5DO8A 12E8H 2WYHA 3AROA 3QNZB 3FN0L 2Z3FA 3HIZA 2OTWA 1H15B 5FYLL 4HWBA 5JIQA 1B4JH 1DJHA 3L4VA 3BQUB 5KSAB 2RACA 1R3KB 1G0DA 5A1AA 4KKCC 3TJEL 4B9JA 3OKLB 1Q9KB 3MO1B 5G55A 1R3IH 3MBWA 3QHZL 3IGFA 4AEEA 2VR3A 4N0YL 3WL9B 2ADGB 3ARGD 3WNKA 2A9AA 4HAFA 1KG0B 3TV8A 2Y7QB 1W8EA 3HMXL 4H8WH 2FJFA 2XQYG 4YEFA 2OSLB 3PP4H 4JJOA 4NI3A 5EUOB 4ZOCA 1AGCB 3Q7JA 4Z6AT 1XGPA 4PREA 5C0BE 4WK4B 4XTRD 3IDUA 3RIFF 5J57B 2FYYA 3PAUA 4ELKB 4JFDA 1BBJB 1WAEA 2VDQL 1HE8A 3OMZA 3VDBA 2ZG1A 1OTUC 3SB3A 1UC6A 1NC4D 1WISA 1U93B 1JWUB 4DESA 2VLLA 3ASWA 3ETBJ 4LLWB 1DEEA 3QNYA 1DBKH 3Q6GL 2FB4H 1JZIA 4PW9A 3TN0A 3LKRB 3O8XD 4H26B 3QEUB 4AYID 4HWEL 4UMSA 3MZGB 5A2AA 2EUZA 5JIMA 4QPEA 2J3SA 4POZD 5I8CA 5DVNA 2BHZA 2IH3A 2G3NA 2YFOA 4WHCA 1ZKAA 5GQBA 2YD6A 4LSRL 3ZZLA 4R4ND 1A4BA 1GGIL 5EBLB 2HRHA 4WQOA 5CKAA 3IRZA 4Y1AA 1NINA 4M6NL 1GAFL 3G5XA 4BFOA 4XOAA 1I9RL 4Y1TA 5ITBH 4FQXA 1QZNA 1TSRA 4XX1E 3VRIA 2JQAA 1LK3L 1P1ZB 5A2JH 4F8QA 2IADA 4XMZA 3HPJA 4LNRA 5DZ9A 4ANVA 3VXMB 3U4BL 5FF6A 1SEQH 5GIRA 1KIRA 1LEKA 5KW9H 4CGUB 4E5XA 4R6UA 3ISRA 1FH5H 2VKWA 3LKNB 4HIJB 3S3SA 4PJIA 5IFAH 2ITEA 1AD0A 3QJHB 1P53A 2P8PA 3O81A 4QTHB 4W68A 1IIIA 1KC5L 4XNYL 4MCYB 3WGVB 1D7CA 4GAAA 3L5WB 4NNYA 2J55A 4AIZB 4Y5YC 5D2LF 2QKIA 1UACL 1VA9A 1FL6A 3BH8A 4XZUB 2EQDA 2X7LB 5HGHB 3CVCA 1I9JH 5BRQA 1DL7H 2DMGA 2FO8A 3ZDYF 2H8PB 4JE0A 2VXSH 1HOEA 1IGIL 2WZAA 5D2NA 2PWGA 3GMLA 4PRNA 5DD0L 1Q72L 3VWJC 2R1WA 4JGJA 2EH7H 2UUDK 2BY3A 4YLBA 3DTDA 4FQQB 2XG5B 1E2ZA 4YIQA 3TA3C 3OZ9H 1MI5D 1ORQB 4Y16A 4Y89A 3RI5K 4G7SB 5A2LH 5I1GH 4ISVB 4BSVB 2OI9C 2BSTB 3MN8A 2CA3A 1OO2A 2YAEA 4DT2A 3DSFL 4TOYH 3EFOB 1KIUA 1VIWA 2HH0H 3AS1A 3HPLA 3L5IA 3H9SD 3SIKA 2WIIB 3CXFA 5HHNB 2HYMA 3B9AA 4YJZL 3OR6B 1D5BB 5HY9A 3HNVH 5DDHA 3ZO0A 1PY4A 1MCPL 1HKLH 3F3HA 1UZ6E 3NSYA 3GXTA 4UNIA 1KCBA 3SCMB 4M6OH 5E6IB 2PTUA 3SDAA 4K23L 3RFZC 2CHZA 3P2BA 1E2WA 3VFRB 3VQLA 4G8IB 5L88H 3IE4A 3FSVA 2HLAB 4OCYL 4CW1B 3FW6A 2A9ML 4A55A 2EDEA 1FNEA 3OMIB 1G6RL 1X6LA 2ZKHH 1U3YA 2O30A 2V7NA 3M1BB 4N0FA 3GZKA 3ISWA 1P84K 1XBRA 2XWRA 1TCRB 4Q58C 4HEME 3ZZQA 2GIXA 3II1A 3C8DA 4KQ4H 4XP9H 5DUMH 4JVWA 2ESVE 3BKJH 3NN8A 3X13A 3HRZA 1J9TA 1OCWL 1SM3H 1QBMH 1CDHA 2GBUA 4HWUA 3IMRA 2C3WA 2FHFA 1EFXB 5IM7A 1BVNT 3A6BH 2Z93A 1OOAA 3RDTB 1LE5A 2ZUYA 3MDJA 3C2AH 5D70H 1QASA 2CDFA 5DJYA 2Z6FA 1VFAB 3V79C 2PW1A 3BEVA 5BS0D 5L4FA 5DHMC 5I6OA 3V8CA 5I30L 4CN6A 1CS6A 4H25A 4MQ7A 4G70B 5HGBA 4H8WC 5HD8D 5CCHE 1LLAA 2V2TA 2ITFA 5MI0C 1GYWA 1ZCRA 5DO2D 4UT9L 4PV1C 4XBMA 1S4IA 2Q76A 3AU0A 5KOMC 5HDQL 2X09A 2WSDA 3FCGA 3S35H 1BOGA 3DYPA 1T1YB 4XP1L 3VD0A 1RPUA 3OB8A 1WE5A 3QDMB 5IBTH 1CFVH 1NOLA 5E4OA 5FO9A 3D39E 3SE3C 4IS6B 1R24A 4KDTC 5KSVA 4ZXBA 1OL0A 4PMEA 1UM4H 4Y4HC 5DS8B 1CF8H 2BNQA 2VZUA 5F9OH 1ODAA 5IEKB 1E5UI 1T7YA 2BRRH 4XVTL 4DKEL 3O3BA 4RAUB 3CFEB 4YWGH 2VQ1A 3BO8A 1AC6A 3LZNA 1LO4L 3ETSA 4YHIB 2VDPB 2PMZA 4PB9L 4CSPA 1B4JL 1RK0A 2DQEL 4D0BB 4KUZH 4PP1D 1CQYA 3FAXA 4PJGA 3ZKXB 1O9VA 3QUKA 1SYSB 3ZZ1A 3RY5A 1QWHA 5A2CA 3C08L 4F9LA 1BFTA 1KYAA 5BOJA 2JB5L 3D3VD 3OSVA 4FXTA 5EH1A 1JN6A 3TBTB 1NPUA 2X9YA 5CMAB 1JV5B 2BVEA 2N4IA 1JCVA 2P8MB 2XI9A 5JPNA 3ZQ9A 4KRNA 3CTTA 4KKRA 2OSXA 1MWOA 4ZUVA 5FA4A 5ISZB 2WUCL 3PP4L 4BDVB 2Y7NA 4UANA 5I1JH 5DFAA 4UAHA 2XX0A 3PQYA 3HNTH 3OX8B 3L13A 4FP8H 3RX7A 3SKMB 3PABA 1M05B 4NNXB 5I18L 3P0VH 2C1OB 3HFMH 4M5YL 2IO5A 2HKHH 4JJ5B 1FORH 4ABQA 1ZTXL 4TUKH 2F5AH 1H3UA 5C0JA 1A8JH 4NPYA 3UBXI 1SY6L 5H94A 4LOVA 1IEAA 3Q5TA 4YFDB 5KSBF 3TBCA 4IEFB 5JHDE 2FX8H 2EVHA 1NPJA 1DBKL 2FB4L 5LBSH 1E4XH 3GJFB 4J12A 2EDNA 3JUZA 4M4RB 4Q9RL 2EYTB 4JN1L 5FPIA 2F08A 1LD9A 2ZXAA 3ARFB 1JTOA 1HH9B 5HHOB 1SN2A 1IBFA 4AUUA 4FMKA 4PJCE 3ATFA 3OJVC 4FRWA 3B6SA 3BAEL 4FLSA 3PV6B 4BWWA 1OOWA 3SKNA 3HE7D 1K6QH 1CD0A 4FJ6A 3UJJH 4LLMB 4Q8BA 1W91A 1WIPA 4G7QB 4P46A 4L37A 4FLRA 3F7QA 4APQD 1BLNB 3CG8A 4IQHA 4LKXB 4PS8A 5E1AB 2XOTA 5C6PB 4EN3B 1U8MB 1LL1A 3H9HA 3NRQA 1FNSL 1L9RA 1I4FB 5EC2A 3MUUA 5D7SH 5D1ZB 1HL5A 1QRNB 2Q0ZX 3OXRA 4JGMA 1HC1A 4DVRH 3AGWA 1WHPA 1VGKB 5D7LB 1QFWH 4JFOB 4DZ8B 2M26A 5F70A 1I8MB 4LPYA 2CALA 4ZDHA 2EYSA 3APCA 3B9KA 3CVIL 1AGEA 1QUNA 3QDAA 2QEJA 4DAGH 4JRYE 3UG3A 3M8OH 4P5TD 4BYHA 2OZ4A 3SDDA 4FMVA 2H1PH 1TTGA 5FCSH 1M1XA 1TVBB 4J7RA 4A1RA 4UQBA 4KJWC 4YDKH 1DL7L 1U3JA 2VXUH 3WXWL 5KBNC 1DFBL 2B15A 2A38A 3AY4A 4DKAA 3MQIA 2VR8A 5KSUA 1DQLL 3RI5F 2FECL 3P4MB 1KB5L 3MXWH 4H0HB 5D72H 2EH7L 1ZD6A 2ICWB 4PGDA 1ADQL 2VN4A 2A2QT 4I3GA 4Y5VB 3STLB 2Y3NA 3VO0A 4WGKA 2A9DA 1ZHNB 4LVHB 5AVZB 4DEPC 3C8KA 1YN7B 1UCTA 4WUUE 3TH3T 2CO2A 5LCVH 3WKML 3UFIA 3L3JA 1V55B 4GT0A 5AAWC 4JB9L 3KJ6H 4PV9B 2K78A 4LVEA 3INUH 3LN4A 4GQ9H 3ZTCC 1BA9A 3QAQA 3T8XA 2L0DA 2AI0H 1ES0B 3P77A 1D5ZB 2F53A 3D6GA 3F2LA 4HJJL 1EXHA 2HH0L 3R06A 5IB4B 2NY6D 2ZOUA 1VFUA 1JRHI 3O6FC 2CBTA 3EADA 4FGMA 1MSPA 3IFPB 4Z0BH 4HCRL 1QWUA 2P43B 4MQXD 4PJ6A 1YLBB 4ACTA 5CN2A 4EXKA 3KLLA 1M1SA 3MRNA 3N91A 3UC0L 4DQAA 3QW9A 4K3HA 1CICA 3IEAA 3CXDL 3V0VA 5KVDH 1MFAH 3VXUB 1VHPA 1ACXA 3DX0A 3NGBC 1HWWA 1A4AA 3UMNA 2WBJC 4C56B 4F9PA 5L7XH 4QRBA 3GTVA 3QUML 3R7QA 2DBLH 1FL5A 4NJ9L 2I9LB 4MLIA 4H8UA 3BMWA 1KOAA 1TZGL 1D6VH 3ARBB 4PJHA 2WN3A 2VDQB 3PPSA 3UAFA 1F6AB 2V4LA 4KQ4L 5DK2A 4PGBB 3P11L 3QQXA 4JZNA 1PS3A 3JWNC 1SM3L 1QBML 4XAWL 2VUYA 4ZODA 2KPNA 1I1AD 2AKRA 2WNWA 4NFCA 1E43A 3LEXB 4LPUA 4L23A 4JCLA 5D70L 5F6HI 4WWID 3BPCA 1G7IB 4NC2B 2BSBA 2IWKA 2EYRB 1NOAA 1T0NA 2WLIB 2B3RA 1B0IA 4QXTA 1YEJL 8PAZA 1W72H 32C2A 3E3QC 3EOTL 3SGKA 5C0BB 4IBWA 5D1XC 3GJEA 3QEHA 3GNML 4XCNB 2AV7A 5KYXB 2JTDA 3JWNE 3OKMB 5A3ID 1JI1A 2ICEC 2PYFA 4S2SB 3K8MA 4NIKB 4N25A 4BH8A 5JOEA 1QOKA 1J0HA 1YRKA 5CD3A 3D85D 1CFVL 2NOYA 4G6KH 2XWJA 3D9AH 4AQAB 1PYWB 3VGDA 2IALB 5IESL 4JQIL 3HS9A 4AYSA 2WQAA 1UM4L 1LGVA 4NQCD 3T0ED 4IIZA 4TLUA 5F9OL 2GBVA 3E3QE 4AJYV 3NFPB 5F71A 3STZA 5D1XE 2ZOWA 2D7TH 2BRRL 4M6AA 3O8XC 4M7ZC 2D9QB 4DFHA 2JKJA 2HSIA 3PFQA 2CBOA 1LYQA 1IVTA 4QXUL 1ETB1 2O72A 2ZP0T 1L7TH 1IE5A 5I0XA 1AHMA 4POZC 4OKVA 1JIBA 2O6CA 4KUZL 5ABAA 4KX7A 1OM3H 1AZCA 4A37A 1FH2A 2PWEA 7PCYA 1K8DB 3DPBA 3RTQB 1Q9LB 2ZF8A 1M71A 2VZVA 1AZZC 3PWLB 5FUOL 3V4PH 3ULSA 1E4KC 5AOIA 5IREA 4ZS6D 3EYOA 4O00A 5HYQA 4P06A 4WGVB 5C8JB 3NJIA 3RBGA 1OGPA 4W9ZA 1JNNH 2EXWC 1RHFA 3CFCL 5IWLC 1J0KA 1N59B 5L2KA 5C09D 1S5IH 1XF3A 2ZUXA 5I1JL 1HCFX 4G9FA 1NCAH 1OSPL 4S1RH 5F7DA 3U48A 2H26B 4U1KA 2W9DH 4XCCH 2R2CA 3TPUB 1LJMA 2HKHL 1SJEB 4UQIM 1SDAB 1J88A 1RSFA 3MV7A 4HU8A 4TQEH 1A7QL 4A2DA 1NA8A 2Z65C 1SQ2N 3WSQL 1GPOL 2I27N 2HX9A 4KC3B 4N9GA 5LQBL 4HWNA 2D4FA 5TH2B 5E4EC 1TZHB 4G6JL 1RZKH 1I3RA 2JLPA 2B77A 1FFOB 2IC2A 2Y7LA 1JXFA 4GBXB 3N1PC 4FXLA 1EAJA 2NY1B 3O9WC 1DUZA 3U46A 3QXAB 1IM9D 4HLZG 4RGMB 4N2MA 3ULVL 2DQHH 3RUGB 1X4XA 2YJLA 4XCFL 1S3RA 4LASH 2FYVA 1ZE3H