4HALA

Multicopper oxidase cueo mutant e506i
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHIDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506I
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA03
2AANA 2OJ1A 1SHWA 3IN0A 4A67A 1OOWA 4GP4B 1GY2A 1BQ5A 2BO0A 2PPCA 3DIVA 3T71A 4YSPA 1XB3A 5I6PA 4DP6X 2QPDB 3BQVA 4A2GA 1R1CA 4YSQA 1KGYE 4AX3A 1ASQA 2UX6A 3V9CA 4F2FA 5I6MA 1CYWA 1DZ0A 1OE1A 1OCOB 3V9EA 1ET7A 4X4KA 4PCYA 2H47C 3NJLA 3X1NA 2XX1A 2HXAA 3NJFA 4ENZA 2FQGA 5FC9A 1QHQA 2VW6A 1NDTA 2WSDA 1E5ZA 4AKQA 5I5JA 1V55B 1JXGA 2RACA 3NJKA 4HCFA 4UAHA 2XV2A 1AIZA 2IDUA 4DPCX 3DTUB 4CSPA 4HHGA 2BP0A 1L9OA 2PP7A 3AZUA 4CSZA 2DV6A 2IAAC 3ASNB 1KYAA 1FWXA 2FNWA 2IH9A 2LLNA 3PAUA 1BXUA 2XUWA 4BXSV 2J55A 1L9QA 2XLLA 5I5IA 1ZV2A 2XX0A 3DKHA 3H4FA 2FQFA 1EZLA 2WO2B 2JKWA 1AACA 1J9RA 3ZDWA 4DP7X 3S8GB 2JFCA 3T6VA 4YSEA 1ZDQA 3GYRA 1N70A 5AKRA 4JKNA 2R7EB 3NJNA 1AZNA 5E9NA 4P5SA 3RYMA 1OCRB 3IEAA 1AOZA 1BEXA 2UXGA 3S3DB 1J9TA 3WNJA 4F2EA 2CBPA 4G7QB 1M9WA 2IWEA 1AZRA 3AG2B 3CVCA 3OM3B 4AZUA 3SQRA 3CDZA 1KCWA 1URIA 1SFDA 2DWTA 4YSDA 1OE2A 3PXLA 4NB7A 4QLWA 5I6OA 2P80D 2IDFA 3OMNB 2WO3B 1J9SA 3FSZA 2BZCA 3C75A 3FSAA 2QPEB 1GY1A 1JERA 1VLXA 2I7OA 2XYBA 3D12B 3QJUB 1E67A 4HCGA 3WG7B 3X1EA 3FS9A 1DYZA 4BDVA 1SHXA 2GB2A 1JOIA 5D4JA 1PF3A 1OV8A 3OMIB 1ETJA 1AS8A 1SJMA 3WI9A 1OCZB 3PPSA 4GYBA 1CYXA 4L0PB 1FA4A 3L45A 2YAMA 4Q8BA 2VM4A 1A4CA 5I28A 2PPEA 1WA2X 4EF3A 6PAZA 3UGEA 5PAZA 4W1TA 2EINB 1L9PA 4JHUA 1WA0X 5LDUA 3CZUB 2JXMA 3HEIB 2Y1AA 2QDVA 3NJHA 3SBRA 3AG4B 1QLEB 3WIAA 3FU8A 2B3IA 2YXVA 3IBOA 4YVNA 4P5RA 3X2QB 5B1JC 2YAEA 1IKOP 2J5WA 1EHKB 1AG0A 1HAWA 2XV3A 1F56A 5TK4A 5EHFA 4A66A 1WS8A 1CURA 1ADWA 3FQ1A 2FTAA 2VN3A 3AG3B 3NJJA 1HFUA 2PPDA 4M3HA 1GW0A 2XU9A 1KV7A 6PCYA 2I85A 2DWSA 3OMAB 4KNUA 1MG3C 1RCYA 3JTBA 3ABLB 4DP5X 2VW4A 1JZEA 4BWUA 2CUAA 2ZONA 1SNRA 3UABA 3UAAA 4N8UA 1KDJA 4UF7C 9PCYA 1N68A 3WKQA 4A2DA 1GS6X 1A4AA 4ZK8A 1GYCA 1JVLA 4DP0X 4HZ1A 1XB8A 1M57B 1GSKA 4KNSA 4TXVB 3ABKB 2XV0A 2AZUA 3NP3A 2H5UA 4E9YA 1AG6A 3UAEA 4KOCA 3NSFA 3NJIA 2R7EA 1YLBB 1HAUA 3S3CB 3H56A 2BW5A 2PLTA 1PZBA 4YSCA 3NYKA 4BK5C 2YARA 3EH5B 2MRYA 1A65A 1E30A 1KBWA 1AANA 3BVDB 3H4HA 1X9RA 1AQ8A 2EIMB 5AFAA 4DP8X 1ET8A 4HALA 3ABGA 1NIEA 3X1BA 2CCWA 3OQRA 1PAZA 4N4YB 1CUOA 4YSTA 4E9SA 1T5KA 3AW5A 3FSVA 3PLYA 3PAVA 4DP9X 4YSRA 3QJSB 1JXDA 1I53A 3FU9A 1NPNA 3AG1B 3ERXA 1NIBA 3G5WA 3ZIYA 3FPXA 1ID2A 2H3XC 4E9VA 2XXGA 3AY2A 2YQBA 1XB6A 4BWWA 1PNCA 3QJRB 4YSOA 2HX8A 3QJQB 5A7EA 1SDDB 3X1GA 2BW4A 4K9JA 3SBPA 4G72B 1RKRA 1PNDA 3ASOB 2BWIA 1PZAA 3CG8A 1ASOA 1ILUA 4DP1X 4YL4A 2PCYA 5F7BA 3T6XA 3FQ2A 1BQRA 2GIMA 1BYPA 1ET5A 2GC7C 1AAJA 1NWOA 1IBYA 1JZHA 2CJ3A 2PP9A 2IWFA 1MZZA 3KW8A 5D4IA 1QNIA 4UANA 5ANHA 2HZHA 3QJVB 4A2EA 5B1BB 4MFHA 1NIFA 2UXFA 4G70B 5D4HA 2YAHA 1J5DA 4GP8B 2FWLB 2XXFA 1KDIA 2Y69B 3NJGA 1AR1B 4PAZA 3GDCA 2AFNA 4Q89A 4G7SB 4GXFA 2HX9A 4E9RA 2HRHA 2HRGA 4YVUA 5I26A 2HLEB 2QT6A 3QQXA 1NICA 1NZRA 2OCCB 1AZUA 2GSMB 2YAPA 3OD3A 4FAAB 2DY2A 5IY5B 1E5YA 3IN2A 3EHBB 2FQDA 4AKPA 4W9ZA 1W8EA 2GI0A 4F7KA 2PPFA 1M56B 4KOBA 2BHFA 5B3SB 4KO6A 3N2JA 3EH4B 2VSKB 4E9TA 2HX7A 8PAZA 2ZXWB 3MX0B 3FYIB 4KO9A 1A3ZA 2FT6A 2GC4C 3FU7B 2IDTA 2CAKA 2X87A 5B7EA 1E65A 1ZDSA 1ASPA 1BXAA 1NIDA 3PCYA 1NWPA 1TEGA 3CVBA 1B3IA 2NRDA 5I6KA 1W6LA 2DYSB 4GY4A 5F7AA 4DP2X 4A68A 2OV0A 1JXFA 1RZPA 1W6WA 3MBWB 4YSSA 3ZX1A 7PAZA 3TBBA 2TSAA 3T6ZA 2IDSA 2VW7A 3JT2A 3X1FA 2BP8B 4E9XA 4WKXA 5B7MA 2I7SA 3WNIA 3TBCA 1PLAA 2PPAA 2IDQA 2QDWA 2DYRB 1ZPUA 3FYEB 1WA1X 1PLBA 3FQYA 3UACA 4HIPA 3TASA 1L9RA 1BYOA 2EIKB 1ZIBA 5PCYA 1OE3A 4NAJA 4YSUA 2MTAA 5TK2A 7PCYA 1SDDA 2EIJB 2P80A 4GP5B 2YAOA 1MG2C 3NSCA 3UADA 1PY0A 2EILB 3NSYA 3TA4D 3SBQA 3TU6A 4DPBX 5B1AB 1L9SA 1MZYA 1BXVA 3FPYA 1IBZA 3WKPA 3CVDA 2ZWNA 4WTQA 2N0MA 1JVOA 3QJTB 3ZBMA 3S8FB 4YSAA 1PMYA 1NINA 1GS7A 2Q9OA 2VSMB 1V10A 3N55A 3U25A 3EF4A 1NPJA 4RH4A 2VMJA 3QPKA 1J5CA 1JZGA 4KO5A 2YAFA 2BP0B 2A3TA 4G7RB 2FT8A 1TKWA 3T6WA 1ZIAA 4A2FA 1KCBA 2FT7A 2AVFA 1CC3A 2B08A 4DPAX 3NSDA 2E86A 2UXTA 2FJSA 4E9WA 4KNTA 1AZCA 4E9QA 3KW7A 2YXWA 4AI7A 2UX7A 4AKOA 1GR7A 4QKTA 1NIAA 5I5MA 2W88A 1PCSA 2CALA 3S3BB 1A4BA 1V54B 1UATA 1PLCA 4KO7A 4A2HA 4DP4X 1SF3A 1SF5A 2PCFA 1OCCB 2AZAA 5B7FA 2W8CA 3CDZB 1FFTB 1AS6A 4NERA 3ABMB 2FQEA 2ZOOA 4HHWA 4M4RB 1WAEA 2VM3A 2J57A 4FA7B 2IWKA 1ILSA 3FU7A 3T9WA 3NT0A 3IE9A 1IC0A 1OF0A 2XWZA 4HCIA 1J9QA 1X9UA 2PP8A 1JZFA 4BXVA 3PAZA 5I6LA 4BWTA 1JZJA 3FT0A 2GBAA 1AS7A 1JZIA 5B1JA 1L9TA 4BDVB 2IH8A 1KBVA 2Q5BA 1NTDA 2BWDA 1BAWA 3FSWA 2BZ7A 3HB3B 2BP8A 2GHZA 3GXUB 1RZQA 2J56A 1AZBA 1TU2A 1WS7A 5B1KA 5I6NA 4G71B 2TSBA 2YAQA 4JHVA 1PZCA 3NJMA 1XMEB 2XVBA 1IUZA 3EH3B 5AZUA 1SFHA 4HAKA 2UXVA 1A8ZA 3NP4A 1BQKA 1GS8A 2X88A 1MDAA 1TEFA
chains in the Genus database with same CATH superfamily
4JY6B 4NSKA 4U1NB 5KSAD 1P6WA 5D2LE 3O6FC 4MNQB 4YSPA 5TFSL 5C0AB 4HJ1A 4J1UA 4P46A 1IC5L 5MEOB 1KPRB 5DRXB 2OQJA 3VGDA 1DZ0A 4FF9A 4IW4C 2L4OA 5ISZE 5I1JH 5AOMA 4W9HC 2IAMC 3QJXA 4MNGE 2QLYA 4RX4D 4G43B 3REWB 3TZVA 4X5XB 3QNFA 4MJIA 2VW6A 4MJ6B 5C09D 4LZKA 5AD0B 3QZWG 2X9YA 3K6NA 2DICA 4K9EL 3NZUA 4DPCX 2EUZA 3DTUB 3KXFA 4NNXB 4ZXBA 3US1A 3ZTDC 4M4PA 3CHRA 3IDJA 4OLVL 1JNNH 5TE6H 2UYLA 5E4OA 5HHMD 3FH7A 5D7JA 4JFFD 5K5YA 2X6UA 2CM6A 1JFHA 2EUVA 5AOIA 1ZV2A 2Q76B 3HI6H 2HLFC 4AW4A 2I07B 1U8IA 4JPIB 3TIEA 4UTBH 1J9RA 1SN0A 4NT6A 1NCGA 2JFCA 2ZOKA 3OL2A 2VLJD 1U91B 2VAAA 3MR9B 2E46A 1KB3A 4LSQL 1X5YA 1I3RB 3FULA 2DQUL 5DUPL 2EVJA 4J6RH 3BD3A 5A16B 4P5SA 3U30B 1PX8A 2NR6A 2QQQA 4FN0A 4QHLB 4QJ3B 1M9WA 5HDOA 1MW1A 5HYSB 4GG6A 4MLIA 2YD8A 2X0UA 4NO0D 2R0ZH 3WFEL 5EO1A 3B7SA 4YFLI 4QDGA 3F58H 1T0OA 1ZVHA 2GY7B 3A0OA 3CE1A 1DCEA 3QDMA 2NUPA 3L5XH 5A6LA 2CO3A 5DYFA 4N68A 5J13C 1CFTB 2A73B 2FYYB 4X5LA 3FRPA 1JERA 1YEEL 5BV7L 1MFEL 3DV6A 4K94C 1E67A 4ZX6A 1S9WA 1QVOA 3SDAD 2FJGA 3EOTH 4LKXB 1SHXA 1TQCB 4G6AD 2WTRB 3IXTA 3LEVH 1HKLL 3S34L 3WE6A 4ONFL 3FB5B 3C6LA 4FI6A 4GRWF 3FTGA 3R4DA 5A6MA 1F4WH 1ETJA 1Y1DA 1A5FL 3GMNA 1RLWA 4YZFE 1XBRA 1ZHBB 2ADFL 1SJHA 3DUSB 4GQ9H 4ZMVA 4AQ8C 3D2UA 1IGYB 2FE0A 3QGVA 4Y19E 3RWGB 1IT9L 3CZFB 3CFJB 3GRWL 5C07E 2HWZH 5GJTH 2BHYA 2OULB 3IF1A 3ZE2F 4JKMA 4Q9QH 3FN0L 2YFOA 1BG1A 5KSBB 3MC0A 4WUUA 3QT2A 1L6XA 4M43H 3JV6B 4XCYA 4F92B 1NGZA 4JANB 1L9PA 1YMME 1S7TB 2ADIA 2DQCL 4M02A 3VI3E 5TPWH 4AGQA 1DBJL 2BRRH 2W94A 3RUGB 5LGHL 4ODBD 1HE7A 4WCYL 3EYUH 2QDVA 4P4KD 4XAKE 5JIHA 3WIAA 5DFTA 2D8KA 1NCTA 1QRNE 2IANA 1I8IB 2GTZB 3EFOA 5B1JC 3X2QB 1IKOP 3M8OL 1S9XA 4ZUWA 4KTGA 3S4SG 4JN2B 1N5AB 1QO3B 4PJEF 4XCNB 4KROD 4F1SA 3P0YL 3QEQD 1SVZA 3MCLL 1CURA 4PVNA 3ZL4H 4ZS7H 2ITDB 3BKJH 3APDA 3C8KB 2BIIA 4Y2NA 2F15A 1KCRL 1U8OA 5EZJA 2QV2A 3GBEA 3ISRA 4JE0A 3VG9B 3SDYH 4CVZA 1AFVL 5IF0B 2BVPA 2DWXA 2DEYX 3NTCH 2W0PA 3KPMA 3UAAA 2YWYA 5E1GA 1MVUA 5F9JA 3QARA 1N68A 1OAXH 4N3UA 5JW4M 4JFDE 4H1LB 4IMKA 3MRMA 1JRHI 4UDUB 4AC2A 2VZSA 1EK3A 1UA7A 2YD3A 1UHVA 3DUUB 3I9IA 2CO1A 4TUUA 4DEUA 2OMTA 1D7BA 4LXFA 1C12B 1Q0YH 2XQBL 3ULUC 1QI3A 1J1XL 1HL9A 1U8QA 1XXFC 4CADB 3QCVH 2H9GA 3HS0C 1HAUA 4XMLL 2D03L 1CGVA 3H56A 4XP4L 3RZCA 1MHPH 2OL3A 1LHZA 4X6EB 4ZMNA 4WI2A 3DDGA 3FBKA 4MLSA 4X6CB 1IAKB 4J3OF 1N2RA 1IVLA 5FK9B 3FK3A 1IGJA 3T0EC 1HSBA 3D3VD 1KGCE 4EI5A 4N2CA 2QGDA 4JM2A 4PJCE 3ZR6A 3TA3C 1MCFA 2JI1A 3MNVB 1MJJA 2WAQA 1OP5K 2CO7B 1T6BX 2ZUYA 2IADB 1RFDL 2VDRB 2PTTB 5HJDA 2CH8A 3MDJA 3R18A 4HFUL 2YXMA 1JD7A 2GTWB 4MAUL 3N85H 3CXDL 3K2MC 4G80B 4KJYB 4A2MA 4BINA 4F15B 4F93B 5EU4A 4PIBA 4P49A 1A66A 1F2XK 1SOSA 3ERXA 3KHQA 3MNZB 4LCUA 1FH5L 1IAIH 2QV4A 2F58L 3MV8D 2JQMA 4Z0BL 2QKIC 3KNBB 4PJXF 4G1MA 4UOQA 3RPKA 4RRPG 1JS4A 1CDCA 2X6AA 3ZO9A 3ABZA 4I3RL 3NFPB 3MYZA 3QJRB 1CBVH 2NXYB 4QY8A 2NW3B 3WNKA 5EIQA 2R9HC 1CZ8H 5EUKA 5LN8A 3X12A 4FQ1H 1RAMA 1DQDH 1BFOA 4ANVA 1JYXA 3S36X 2Y2TA 3ZTNH 3DBXB 1J86A 5IFJA 4WFEE 2VH5H 4KDWA 1G94A 5KBNC 5L9DH 5IT2L 3MJ9L 1BYPA 1M9SA 4KBPA 4HULB 3BQUC 5AVYB 5SX5K 1KENH 3PY9A 3OAYH 4L8CB 5DJYB 4LLMB 4UTBA 1QSEA 1T7WA 1MOEA 5E00A 5E4EB 1IL1A 5H94B 2W0FB 1FJ1A 3FCSA 4HUCA 1AHWA 1IQDA 2Z0BA 1EHNA 2HZHA 3IFLL 1JPFA 1JTPA 3WHXB 2OJEB 1H3UA 3HB3C 3ETBJ 5CD5C 2UZPA 1CE6A 4F9LC 1MFDL 3SE9L 3VXSB 3OLDA 2HTLC 3UFIA 4TUKL 4P2QB 2X6VA 4L2YA 1I4FA 1QTYT 1MAMH 3GT6A 2UZIL 2OSXA 2XA8H 1ES0A 2PR9A 2X4NB 4HKZA 2HX9A 2GK0B 2A9NH 1BA9A 3FFDB 5F7HA 4G9FB 4RGOL 4H88L 4UB0L 3APFA 2W91A 1MY5A 4P5MB 1AZUA 4S1RH 4HEPA 1K3ZA 4PJIE 3RWFA 3LN4B 4CN4A 3FTXA 3PWPD 3ZQWA 2B1AH 5K1JA 5CSGA 4MDJB 3LHPH 5M7QA 1CO1A 3VW3H 2BHFA 3F65A 2Y1YA 4JO3L 2CA4A 1BEYL 4YH6A 3QRLA 1GYUA 1YEKH 2HX7A 4PWJA 1ECYA 2V9TA 5C0RH 1A3ZA 4AVHA 2Y06H 3FU7B 3HZ3A 4WV1C 5IQOA 3VXTA 2H2SC 5IQ9A 4LOFA 1ZA3B 4NHUB 2XN9A 1SDYA 4ORZC 4TN9A 5CU5A 1SEQH 4OGXL 3WXWL 1MKFA 3FB6B 4DFIA 4QF1A 5TDOA 4JO8A 5C70A 1OPOA 1FGNL 4PV8A 1IM3A 3P0VH 3NPZB 2AK1H 1EWHA 4AJYV 1R3LB 1EX0A 3H9SA 4JPWL 2UY7B 2E56A 3B2VL 4DZBB 1S9KC 3NVQA 4LLYA 3RHWF 3OKLB 3QFJD 4WKXA 4DCQB 1PLAA 2QDWA 2YC1A 4XP6L 3QJOA 3UAFA 3LNIA 4GT0A 1IKNA 3C5SB 3UACA 2F6AA 2PYEA 4JFWA 5AEAA 3ZKMC 3D25B 3Q3GB 4LLVB 4BRVA 1X3DA 3VSQA 4TNVK 4H8PA 2X4OA 4OF5A 4RGMB 5HHPB 4OLEA 3EOBB 1SUHA 3QPQC 3TBSA 1ML0A 5C3IA 5A2CA 1NJ9A 1CFVL 1T1ZA 2OI9C 4M7ZB 2BIHA 4LRIC 2YOCA 4ALAL 4Z3FA 3QCUL 4M5YL 2FECI 1E7VA 3NJXA 3BAXA 3NFSL 4U2YA 2C9RA 1I8LC 1QFUH 2O93L 1S7UA 3AREB 3FC8A 1CTMA 1KNOA 3FU5A 1X5AA 3IFPA 4R7LA 1JN6A 5EOCL 2ROXA 2W9LA 3BH9B 3QJFB 4L5FH 3GI8L 3BP7B 3ZYOA 4HJEA 4TNEA 3LN9A 4HGWB 4KDTA 4PJIA 5D9SA 2ZP0T 4UT9L 2Q86B 5FYJU 3C8HA 3P11L 1JK8A 4JO4L 1GC1C 4JY4A 2WZAA 4DKEL 3LRMA 4XOBA 3QRBA 2Z3FA 1U58A 2V8LA 2V2XB 3C2AL 1YNKL 3AY4C 3MROB 4QHPA 2CJUL 3SE3C 3JZYA 4YFEA 5L6YH 3KJ4C 5DC9B 1LEIA 1G7LB 3Q1SL 4R26H 5DUBB 4XODA 4U0RB 3TEZA 1FC2D 3B2PA 4ODHL 3SBWC 3C6EA 2J20A 1S7XB 1UD8A 2GBTA 2ITCA 3ARDB 3K2UL 4FFYA 2X2JA 3FT2A 4IK6A 1QR4A 3UZVA 2YLHA 2R1XB 4JDTH 4H26B 4KAQL 3VNZA 2DRUA 3KPRA 4OW6A 3KLLA 3OR6B 2FGWH 5GGTL 3L1FA 1N0LB 1P1ZA 4NN6C 1GOHA 1CBJA 3HHSB 4PQXA 2ZOOA 5JMRA 4PJAE 3U1SL 3OXRA 3RIAK 1UUSA 4JL2A 5F96H 1G9HA 1UJ3B 4QRUA 5DEFB 4WWKD 1C8PA 3C60A 3P40A 3JWNH 1XH2A 3DNKA 5D1QC 4EDWL 2NT0A 3BCDA 1HL8A 1HDMA 1KLGA 4B9KC 4J3XA 3ZUNC 3ZPDA 3MLSH 4YHMH 1AJ7H 3DSFH 2Q5BA 2CDFB 4PJDA 2VLRA 1FG2A 4BCXA 3RJDA 2RHEA 3RDTA 4GAGL 3M1BB 4P23D 2OXHB 2FZ3A 2WBXA 3V8OA 5IJKA 3HNTL 1SJVA 2J56A 4UIKL 3RWHA 4DZ8B 5JA8B 3M17A 5H37H 2EC8A 3GHBL 5CBAB 1Q94A 4OCXL 5GPRA 1QATA 1G9NH 2P5EB 1GIGL 4ZBJA 4U4IA 4Z1PA 1CTOA 4CNIA 1CXLA 3EH3B 4TTDC 3RKDC 1Q1JL 1Q8MA 1A8ZA 1GXEA 5E7BA 4X6DA 1UQSA 1PD1A 5G55A 4KPHL 3L3OB 4GQQA 1F00I 4HD5A 3ZO0A 4NKOA 4G8IA 4F57L 5ISZD 4MMZC 5T1KB 2EADA 5D2NA 2JKNA 4Y4KB 4HQQL 5I19L 1X7TA 3CPUA 2FD6H 3SPHA 4AX3A 4UNVA 5I6XC 1EEQA 2Z64C 5KS9A 5E0FA 1FIGH 4LSPL 1PG7L 3DXAA 5FHAL 3VXRB 3COOA 4HS8L 3GKWL 5I30L 4G7VL 4AV4A 1TF4A 1UASA 4LLDA 2E5EA 2KZBA 3V4PH 3RP1A 4HUXB 1CVRA 3UBXG 5FLVA 3HMXH 4L1HA 5AUMB 2LU3A 4R2GB 3S2AA 4JFEE 4IRJC 1KYAA 3KHOA 1P7QB 3VFSA 4BFFA 1TVHB 1XBDA 2LLNA 1Z5LA 2XUWA 4WI0B 5I0YA 4OJAA 1PZUB 1KGWA 1EZLA 3HBZA 3MRLB 4KQ4H 1FVDA 4W9FC 5K59E 2WZPA 4XMTA 3CFCH 1HYSC 3TO4D 3UTPE 5LWYH 3RX8A 3ALXA 3GYRA 3ROOB 1EGJH 1P5VB 3ZKSD 1AZNA 2A9DA 2IPUK 2VL5A 2XBTA 3WUWG 2HLAB 3PF2A 3TCLA 4BD4A 5IW6A 3PWUB 1I7TB 2AXJA 3V6FB 1Q72L 1QEXA 4K7FB 4F2EA 2LR4A 4IS6B 3QQ4B 4H44C 3BGMA 3ARYA 3WY4A 3ULVD 2L04A 3O6MH 1WRFA 3BGAA 2I5YH 4N2FA 1URIA 4MVBC 3MJ8B 4WUKH 4TVUA 1V7NL 3VFNA 1KN2L 3GXMA 4MXVE 5HTSA 4IKNA 4L8SB 4CRPA 4Z7VF 5C0EA 2A9BA 4Y2LA 5CZXD 1S7SB 1RP8A 3LRSA 1NEUA 2QPEB 5D7SL 4KI5F 1DVFC 1WBXB 4O2FB 3FQ4A 5LG6A 3CBJB 3FS9A 5IVNA 3F8UB 1JPTH 5E8PB 4L4TB 4J28A 1QW9A 2M8XA 3GM8A 4XP9H 5C07D 1ODUA 4NJ9H 5IVZA 5AB1A 1ZVYA 1TTRA 1M1XA 4Y16A 1FA4A 1YMMD 3GSQB 5FAAA 5HD8C 5KVGE 1DFBL 3DV4A 3WN5A 2F19L 3RZCB 4GW1A 3OMZA 3FQUB 4W81A 3PHQA 1EV2E 4FL4C 1E8ZA 3I6KB 5LGYA 5KJRH 3PGCB 2X40A 5C08B 5DRZA 2UWEE 5TGBB 2R2EB 4K8RC 4ELDA 1LO5A 3SBRA 4OQTL 4UYQA 1Z6JT 1WAAF 4LCIL 4XN5A 5IBLC 2CO6B 2EEDA 2OMBA 1FNSH 3CLFL 1DLHA 2MIZA 3ULVF 5JDSA 3EHBD 3ZSSA 3QUXB 1IGML 5ACZA 4KHXL 4KNUA 2DJMA 4TQHA 1C5DA 2CIIB 3HZKA 3EGDB 4EUPA 2G9HB 1XH1A 3BN3B 4JFDD 4NRXA 5CR8A 1QNZH 2P48B 2VW4A 4FXTA 4U6TA 5FO7B 5ICXA 1T20A 4S2SA 5CGYD 1AYOA 2ZONA 1T89A 1ZY9A 5FLUA 3ZKNC 4ICXA 43CAB 4OGQC 3VFUB 4JVPA 4DJMA 2J8UF 1EMTL 1JFQL 3FUHA 1C1EH 3TVMD 3VH8G 4GXUN 4KJPD 4N3TA 4H25B 3OAYK 4KMTL 5I74B 3ZRCC 2K8MA 2XIBA 5F3FA 5J12C 2EYSA 4K3DL 4GBXB 4QTIL 1O7DC 2IV9A 5F9WB 3TV3H 4YX2H 5C09B 1FZKA 4I88A 5E5UB 3WOVA 1MHEA 1A0QH 4GRWB 1G7MB 2Q3XA 3S3CB 3IU3A 3X3FH 3BFOA 4HIEB 5HVFB 4ZAKD 3OF6D 1AO7E 2EXSA 1KGCD 1C9SA 3HIZA 1BJMA 4NNYB 3MLXL 1N7MH 4QPEA 5H37A 5HHMB 2FBJH 5EC2A 3ZT5A 1E50A 1DQJB 3BE1H 3C5ZC 3DHJA 1XL4A 3DBSA 4WW2A 3ZE2B 5AFAA 1JL8A 2WC7A 3Q5YA 3QUZD 5D7EA 3WEXA 2G3XA 4N25A 4QO1B 1MWAL 3W11D 3ESPA 2L0DA 4D0DB 1G7QA 1VGEL 4QD2E 4MAZA 1HZHH 3QEGH 3VFVA 2HFGH 4XN4A 2Y5QA 3PV6A 3TH2T 4G6AC 3OJVC 1EO8L 2XTLA 2VJXA 2A5UA 1FNGA 2NXZC 1K5NB 3FRUB 5GGUB 3N5AA 4TLKA 1XGYH 3HPLB 3R06B 1GGYA 2ICEC 4KKPA 2VR9A 3VFOA 4BH8B 4PJEB 2J1KA 1ID2A 5DMIL 3S88L 2DM2A 2OMWA 2V7HA 3BVTA 4WTXA 5LCVH 3RZWA 1YPZA 5C9KA 2AMGA 5F6IC 5T1LD 2XG5A 1ZGLP 1I8KA 4C4KO 4Y1AA 1NLDL 3CLWA 2FH6A 1IM9D 3UJTH 1P5UC 4YO0B 5IWLA 4XPTL 3EO0B 4PLKD 1H5BA 3RNKB 1S2EA 2BWIA 2Z1KA 4HXBH 5CMAA 5B38G 2Z31B 3OHXC 2NY5H 5KYWB 3TYFB 1X6LA 2GUYA 2JJTA 4YUEH 4JPKL 5EOTB 4WF7A 2GJRA 5DD1L 3APMA 1GJWA 2WQWA 3FQNA 4XXCA 3UTTE 4YGAB 1AAJA 1CT8B 3CZEA 4OF3A 5L8LB 4LOUC 1RL1A 3I85A 4H8VA 5EC1A 2HRLA 4ODSL 1HH9B 4KROC 4PJGF 4CW1A 3O2DL 2AAAA 3CFDA 1MZZA 1UUNA 3T4AA 1E3FA 4MQXD 5D4IA 2XWCA 1SXNA 3R8BB 1EGJA 5F7DA 2VDMH 5J6GA 1PG7W 4DGWC 4LSRH 4X4MA 1BFVH 4QXTA 4U6HA 1NIFA 4L3EB 1UA6L 2XXFA 4PJ9A 1O7SA 4MDRA 2VSCA 1KN4L 1L3WA 4FHJA 4GKZB 5C2UB 1AQKH 1TTBA 5T5NF 1JE6A 4D0CA 4J3TA 2FJFB 4HLZH 5CWSB 5CFAA 4FFZA 4F7TA 4AGNA 2FSEA 4P4KB 3P4NB 3QUGA 3O3UN 4ZNEE 3EIFA 5DJ2A 2EDMA 4Q6IB 5DUJA 1NZRA 3KPLB 1SLUA 3N1PC 2DY2A 3PYCA 2BINA 1DEEA 4WI6A 2CZNA 1UT2A 4QXGH 2WLZA 4YPJA 5HHVH 2NW2B 3KVDD 4IDJH 4I2XE 1UWXH 4PJXB 1KEML 3R1GL 2WXJA 2X70A 5EOQL 4K3JH 4MA8L 1YY9D 3VRIA 5ITBL 4K2UH 1PLGL 1TQBB 6CGTA 1YNTF 2DQEH 3LQZA 3ELQA 3GJFH 4GW4B 1D5XA 4AUYA 2ODHA 3VXNB 3H2QA 4PLOB 6TAAA 1NLBL 5L2JB 4HH9B 4WO0A 1CICB 3OAUL 3HBPA 3OWEA 3MBWB 4TNWF 2R8SL 1LNUA 1VPOL 1Z5YD 2GAZA 3EFFB 1M7DA 4W6YB 3T6ZA 3X1FA 2NYKA 3TN0B 3TBVA 2BP8B 3QB7C 1UH4A 3MUHL 5C0JB 4XAWH 2X2YA 2R29H 1TJHH 3JV4B 4MD0A 4NDMA 3T8VA 2J8HA 5IGXH 1QTSA 4HHAB 1P53A 3GSXB 1L9RA 4UNUA 3IJHA 3D3VB 2EDJA 2GFBA 1I85A 2XBZA 4BFIA 1SDDA 3SJVA 5FKPB 1BXXA 2CKBH 3SKUD 1T03L 1YAIA 2PW1A 3DSNA 1G6RB 1CDJA 3VFTA 1D9KA 1A1OA 1NMAH 5HHOE 4YHLH 1UEYA 1WF5A 1CU4L 2C3HA 4YR6B 4U1IA 1NAMA 1JGEB 3MV8B 4OZHA 2J6EL 3BN9D 3P77A 4KXZI 1S7RA 4XVTL 1YJDL 4HJ0C 4Y2DB 3X11B 4HBCL 3V4UL 2L7EA 2FEJA 3HZVA 4P57A 2EDDA 5I1IH 4GSRA 3U0WH 3L3JB 1JZGA 2YKLH 2BP0B 1ZRUA 1FH2A 1QBLL 3D0LA 4JRWA 5GRJH 1DQVA 2FT8A 2B0SH 4AZ8B 2WWNA 1ZIAA 3BGFC 5DVOA 3V9FA 1WH0A 5ELIA 1TZGL 3CZKA 3DTXA 4FQXA 1MQKH 2GUOA 3CFNA 4PWFA 2IFGA 1DJXA 4DUWA 2I60L 3HAEA 4AM0Q 1CB4A 4QKTA 1J5HA 1S3RA 4HUVA 4CBPA 4R4BB 1KYUA 1J5OH 1A4BA 3BT0A 4OQ1A 4PJFA 2ZKHL 1LO0H 4LB8A 3SCMB 3DROA 2Y36L 1HI6B 2IH1B 2CE6A 1XH3B 2HKHH 1AIFB 2IQ9H 4HJTA 3TFBA 4B9JA 2F53E 4AYEC 5D72L 4DTGH 2XA3A 1M7IA 5LCVA 2FQEA 1MHCB 2VT0A 3CK0L 5ADPH 4XNQA 1HL4A 2DWYA 2WLKA 1W91A 5D1XB 2MMXA 4YJZL 3QWRD 1RVFH 1THCA 1XIWC 4TVPL 2KUTA 1R5WA 3H3KA 3E1F1 3ZSTA 2NY6D 5KJ4A 5ID1B 3AS1A 3KWVA 4BDVB 1YY8A 2HT4D 1W72L 4ACTA 1FUNA 3VXQB 1RJLA 5EG6C 1ZLSL 5CCKL 4LCCA 4IQHA 5EEYA 2VMDA 1N19A 1LP9F 3FAXA 4WU7B 5I6NA 3B9KB 1D5ZB 3G5XB 5EU6B 3QC5X 2XVBA 4JR9L 4XMPH 4Y9GA 2AI0H 1S5HB 4UTCA 5DZNA 2Q8BL 2X4SB 4HW6A 2QSCL 3WGUB 1PQZA 4F27A 2I9LA 4PR5B 1CLYL 4FD0A 4YOKA 4AEIL 3ARWA 4OZFB 2CHXA 2MQCA 4N0RA 3L5WB 2QADD 1Y6KR 1OP3K 5I73C 3RWDB 2KLTA 2VDOB 2VLKB 3U1QA 3BQVA 3W9DB 3B6SA 4U3SA 3P4MB 1Z0NA 1R46A 5TE7H 2OMZB 1IJ9A 1OE1A 3G04A 5IJVA 1LDPH 2V5YA 4X6BA 1J7VR 4Q9CA 4GUOA 2W9DH 1XF5B 1SXAA 2DH3A 1E6OL 4JRYB 5D7KD 4JFED 4N9GB 1HEJC 3HG3A 4RGNB 3KPOB 4B6ZA 1NGQH 1UM4H 5CU9A 1UZ6E 5J6HB 4HIQA 5AL0A 2IAAC 3A22A 4PJ7F 4N2NA 4GUQA 1E9OB 3VGFA 3L1GA 4JDVA 4CGUB 2BZDA 3V0JA 3OAWA 3VXME 3Q6FA 4L1TA 3GJFA 2ZE0A 3L2LA 5DHVH 4UYPA 4PS8A 4RAUA 5CN2A 3LZPA 4IOFD 3SKNA 5D7JC 3DC0A 3GZQA 5AVQB 4IHOA 1XCTA 4FLOA 4JKNA 3JTSA 5CFHA 3BPCA 4HKJA 4K94L 2BNRB 2K3HA 1YQ2A 4KK6C 5J57B 3WTWA 5DZOA 4B7IA 4QT5A 4IBUA 2OMYB 3WLBB 2DL9A 4EZJA 2X89D 4P2RA 4F8PA 2R29A 4AYGA 5D4QA 2H32B 1EUUA 4ZQTA 1IC4H 2PO6D 4RCAA 4WWKC 4Q2ZB 1EXUA 4YSDA 5B3JE 3ARPA 4MA1B 3VO0A 2H0PA 5TQ0H 2WO3B 3UIYA 3L3DA 5B39G 4P3CL 4K5MA 1FN4A 3OSVA 1ZA6B 4GRLB 1FBIH 1WE5A 2YS4A 2E3VA 2NX5B 2VTFA 4K3EH 3RTQB 1OB0A 3F83A 2CKBA 1YN7B 3QJUB 3FZUD 4JHWH 3WG7B 3X1EA 1S7QB 3QYNA 5D4JA 4W4OA 1QR1A 1A6UH 3VXUB 5J11B 4JRXB 3GSUA 4GYBA 1IC7L 4OZ4A 5HGBA 4G8AC 1E9PA 1OK8A 3P9LB 3REVB 2HG0A 4L0PB 4PGBA 1MNNA 2FHFA 3V0FA 4IGBD 1PAMA 3K3QA 1IEHA 1KOAA 3C6LC 1A6VL 1RD6A 2EZ0C 4B3EA 4JKPH 1WIOA 4FQHB 4N2GA 4NM8L 4XOAA 1OGPA 2CBQA 1WA0X 4FQJH 1AR1D 1YECL 3ILDA 4DWHA 2ODIA 2WIMA 2Z91B 4AYSA 4XPAH 1FZJB 3CZUB 3GO1H 5EORH 4EI0A 3NCYS 1LK3H 3BFWA 1NCHA 4RLDA 5FDWB 5JO5B 3UTSE 4MASA 4P23B 4EIZC 1R3JA 3QWNA 2H6PA 4NZDA 1JRHL 1QPKA 2YXVA 4RNRB 4X80L 4ZPTB 5ESAB 1EBPA 1SDAB 5DWUL 4YK4C 3T08A 2ZF8A 1NOLA 2BDNL 1EHKB 2XV3A 4LKCA 3P73B 1GAFL 1GH7A 1DUYA 2D7PA 3N0PB 1XX9C 5JW4N 2VOTA 1ESOA 3QA3A 5TFSH 3ULUL 4PYGA 3MUZ1 1IC5H 1BFSA 4XVUD 4ZFGL 1B4TA 2CRIA 3OR7B 2I85A 4KTYA 4PHXA 3CN4A 2F8XC 2JCCA 3WTUA 2H0EA 1I7UA 3JV0A 3ZE1F 4G6MH 4BWUA 1P1VA 1Y0LA 1ZEAH 4G9DB 3TH4T 3VYPA 2G3ZA 4NO5B 2Y7QA 3BPNB 4I1NB 3QIBD 2Y07L 4M1CC 4K9EH 4Z7VB 1A4AA 4FLQA 3DX7A 4NZJA 1XB8A 2CRMA 3MPCA 4OLVH 1IU1A 2WWMC 4RMQA 4A7QA 2EDQA 2H5UA 5C0BA 1N59B 1AG6A 1ORSA 5C0IB 2AK4A 4PTUA 1RULL 4FZ8H 2MQ0A 5ECGA 5F0MB 3PPEA 4NPYB 3SPGA 4IU2A 2RA1A 1UB5B 1RZ8A 3NCWA 3RWCA 2LV4A 5HPMB 5DS1A 1RH8A 1DE4A 3KZ8A 1CGTA 2Y5TB 5GSVA 3L2NA 4HIHA 1I3VA 4BK5C 4QRTB 1DTUA 4PBXA 5C0CE 4L4VE 1RLBA 3FW6A 1NCAL 1IBGL 4LSQH 5FO2A 4O5LL 5DUPH 3BP5A 5AVUB 4Z18A 3T1FA 3Q48A 2XNAA 3ABGA 5HVHC 5LJYH 4NQXB 1UZ8B 3RU8L 3SY0A 3ARBA 1P7BA 4XH2B 5FHBL 2ATKB 3WFEH 3D6GA 4GKSA 1KEGL 5HJGA 3L95B 3WIFB 4XMWA 1AGBB 4ONOA 3QJSB 3QDGE 2YGPA 3BEWA 5FOJA 1HILB 2OM5A 5HDQL 4HPHA 1YEEH 5BV7H 5BS0B 1MFEH 3QUYB 4MBOA 1NOFA 3H53A 1UVQA 3IJYB 2YR3A 4P5TA 5FYJL 4NAQA 4LL4A 3S96A 4H8HA 1KLUB 2BVQA 1JWMB 1J0KA 1HKLH 3AWGA 4ONFH 4ADIA 1ZT4A 3MOBL 1A5FH 5D93C 3IFOB 4I3GA 1RJZB 1CD8A 1JGUH 2ADFH 1MW3A 5AW3B 2Y9RT 2HPOA 3B37A 3UMTA 4W9EC 4DVBB 5T3XL 1IT9H 2J8UB 3GRWH 2F54E 4JDEA 3K7UA 5EWIL 1MNUH 3VWKC 4PREA 4PRIE 3FN0H 2D2CC 2WBKA 1XGUB 1JI2A 5CEZE 5JW4Q 2PP9A 4K23L 4Z3IA 1K3IA 1KB9K 5DHVA 2DQCH 3OKNA 1BQHA 1OTTD 1DBJH 4UANA 4QRRE 5LGHH 4WCYH 4RISH 4MFHA 1OW0C 4FTVE 1IBHA 1NGYA 3IJ7A 3MRNA 2HG5A 1RK7A 3GB7A 2YEZA 4XB8A 3BX7C 4Z7UA 5E56A 5CGYC 4JG5A 2DKSA 3M8OH 3TJPA 1EEYA 5EU3A 3U0TA 3KL0A 2WSKA 3P0YH 2FR4A 3FB8A 1K8IB 3MCLH 1SVCP 4YNYB 1I75A 1JZ2A 2VZOA 5HJ3A 5DXWA 3VU1A 3C5XA 1KCRH 5KTEL 4FQPA 2HLEB 3HUJA 1M7XA 3WIIH 3KEHA 2Q7YA 3OC8A 3ISWA 1S3KL 5LQBL 4KH9A 2G30A 1N5YH 2BNQA 3QUMA 1IE4A 4DUVA 3EHBB 4PGJA 3MLRL 3CFEA 4ZNCD 1NFDE 3KBHE 4GMSL 1J05A 4R0LA 5CP7A 2PCFB 5MENB 4A2LA 5MP6L 5ID0B 2B59A 1ITCA 4HWZA 4MGXA 4WO4D 3WENA 5JHMA 1TR7A 4NWTL 4P2OB 2VDLH 3OKEB 1S46A 1U3HD 2XQBH 4BELD 2FT6A 1J1XH 2BSSB 5JPMB 4IRZL 3ZHFA 3D5OF 3ZDYF 2E6QA 3V5DA 1I1FA 2P8LB 4QCIA 4XP4H 3W11C 1E4KA 4AIZA 3IS1X 2Y1ZA 3NN8A 2LU7A 4QXUL 1XR8B 3A4DA 3C9NA 5IMLB 1RZPA 2XKNA 4NN5B 4LCWA 5FO8B 4HJGA 1XF4B 4OGAC 1DQIA 4PJGB 4ZAKB 3NABL 1JZ6A 4N2OA 1W80A 2P5PA 3V4VL 1BD2E 3FTWA 4PMFA 4OJCA 1ONQB 4HDIB 1F11A 3C8DA 4MAUH 4Z95L 3CXDH 5DR5L 2XWTB 1KTRL 4PLKC 3QUZB 2NZ1A 1TLMA 5DFAA 4N5EC 4DGVL 2AEWA 4CVUA 2EIJB 3E0GA 3BWAA 5DD6B 1MG2C 2DIEA 4UUJB 4Z0BH 2EVGA 2F58H 5HHOD 3AM8A 3EYQD 4ANXA 1GC1L 2IAMB 4Y2OB 3U6XA 3NSYA 4FQQA 1IKNC 1PFOA 3ROLB 2HT3D 2BRQA 5GGSY 1XH0A 4HCRA 1RIVL 3KG5A 1CE1L 1TCMA 1B6DA 1TYEB 4FXLA 4I77L 1E4WL 2OP4L 4K3GA 4XPFL 3HW7A 1XDTT 2NNAA 3HZMB 4U1KB 1Z1WA 5CLZA 2O5NA 4QYAA 4W6WB 3GSWB 4JFPB 5CLTA 5IT2H 3MJ9H 1V7MH 3CLEL 5CJOL 4ZSOA 3L4VA 1JHKL 3IBEA 1ICTA 5F7MC 1TQWA 2YK1H 3AJ7A 2JV6A 4R7NB 5E8OA 1HSAB 3HLAB 3MRJA 4R4FL 3FUFA 4V33A 5DI8B 5DK2B 4KDTC 2WXIA 2KKQA 1YNTB 1LL1A 5GS2H 3IFLH 1Z2KA 4X0NA 2G5UA 5DJ0A 1H3VA 4NFBA 1RHHB 4JJ5A 4AI7A 3N3EA 5MEPA 4BK4A 2W38A 2R4SL 1MFDH 1WWBX 3SE9H 4G7YL 3GMRA 5HYJA 5KWYC 2CALA 4JGMA 3MMEB 3W39B 1AP2A 3DUHA 1ROWA 5EO0B 1PLCA 2UZIH 4C47A 3F5WA 3OPZH 2F53D 1TTAA 3RJQB 3MRBB 4XXDA 4I0KA 1RURL 4N2LA 4RGOH 4H88H 4UB0H 1CFSA 2A6KB 3S7GA 2AZAA 1OLZA 4NP4L 2FEEI 4J4PC 5JOPE 1AQMA 2LFEA 5GIRA 5T1MA 3VSUA 2R2CA 3ABMB 4F8OA 1BV8A 1AQDB 2AJXH 3ES6B 4GO9A 4JKLA 4N0YL 4X5QA 1SYSA 2BVOB 4IOIB 3TIDA 4KKQA 2N0KA 3NT0A 2DQFA 3CSYA 1GGBL 1DBAL 2NY3D 1JZ8A 4MBRA 1FL6B 2FB4L 4JO3H 2JI2A 3ATDA 4UM8B 1BEYH 3BW9A 2VR8A 2QPUA 5CJQL 1OGAA 3DARA 2O26U 3AADB 4K5LA 2DWEA 1H0DA 1CGSL 3TBWA 2X7LB 1FNEB 3GRWA 2J88L 4F33B 3L17A 1QFWM 4IRSD 3O11B 1ZS2A 3S37X 3WXWH 5GISL 3BP4B 3O41B 1B4JL 3M1CA 5GGRB 5B1KA 4L1DA 4G71B 4WO4A 1FGNH 4FADA 5GGVY 4M9OA 5GS1B 2YPLE 5D1ZA 2F74A 3CFBA 3U4AA 4JFHE 3OQ3B 4JPWH 4U6YB 4KKRA 4MNHB 3O9WC 1E5BA 1HCVA 1SFHA 2LOEA 2PCPB 2QVKA 4HAKA 5E6IA 2Q0ZX 4Z77A 4EN2A 2YA2A 5I15L 3VGAC 4XP6H 5DJZA 4OZIF 2Z8WC 1D5MB 4YGVB 3CQPA 1JGDB 1SHWA 4AY0A 4OFKA 5G2NA 3TNNB 4X7FC 3DIVA 3WJLC 3A67L 2X6CA 3DOIA 4ZW5A 1LQSR 2WIIA 3EW3B 1SQMA 1FL3A 5JPNA 5JR1L 3BN9C 3B2XA 1AKJD 4JCMA 1YN6A 1CFVH 1QLRA 1F8TL 1H3PL 4ALAH 1OCOB 3QCUH 4M5YH 5SWZB 1AXTL 4ADGA 3D52A 2DYPB 1EHLL 1L7TL 2HXAA 4APQA 1BZDA 2YBRB 5JW5A 3L3IA 5D2NC 1OALA 3UOAB 3QR1A 4IEFB 4AEEA 2V2WB 3SDDD 1J8KA 1AIZA 3D39D 1JNLH 5EV7A 4F7MA 3G08A 5IW3A 3L4XA 4I13B 4ODXA 5EOCH 4HG4K 1V3MA 3JVGC 3GI8H 4CSZA 4Z7WF 4MQ7B 3VXMD 3V5HA 4B60A 3DX8A 3MLPA 5FW7A 4UT9H 1J12A 3CSGA 5IB1B 3HS0B 5AW7B 3MUY1 4TUOB 5C0GA 1T3FA 3P11H 1UEMA 3QORB 4JO4H 3B5GA 5LAPA 4Q58C 5CJXA 1JK9B 4X9GA 4DKEH 2X4QB 3S8GB 3C2AH 1YNKH 4PJHE 5HYQA 1ZDQA 1USQA 4TLUA 3QWOA 3NIDF 5ABZA 2HJLB 1ZGLA 1O9WA 2DQDH 1DUZB 5MEPB 4A7VA 2G75B 1JHTB 3B7TA 1ZLEA 3UBXI 1J9TA 4ODHH 1INDH 1LP9B 3HC4L 1OM3L 3MYJA 1IO4C 4JDZA 5E8NB 3W5NA 3K2UH 4PJ5E 1A6AA 4LVOC 1WO2A 3D0VB 3D8MA 4B9CA 1SUJA 2IDCA 4FXGB 3N1QC 4Y7MA 3SEPA 5FKAB 3OLGA 4G8GA 1UCTA 3MLUL 3VGGA 5GGTH 2NY6C 2XKSA 1NDMB 2MHAA 2WNXA 1GY1A 3NH7L 5DMGD 3U1SH 1XGPB 4TUJA 3QC6X 4RDQG 1W2KT 3WLWC 1UZ6F 2Q1EA 1J8HA 3DJZA 2WQXA 3ZQXA 4K8RL 4EDWH 1A9BA 2A1WL 3SKMA 1I8MA 4JM4L 4M48L 3ZGIA 3MFGB 4WWID 1U8LB 1G1KA 4NO3A 4N86A 4FQCL 1XEDA 3BRDA 1DN0A 5DVPA 3R0NA 8FABA 3QYMA 3MJ9A 4PGDA 1T4WA 5EN2A 4HC1A 3L45A 4QRSA 3K72B 1E4XI 1MLCA 4YFDB 4B9FA 3AROA 1NCBL 1HQ4A 4IIQB 5EFIB 3HNTH 4MJ5A 3PQYA 4PJ7B 3LKPA 4UIKH 3MRHA 2OMUA 3UTSD 1NCUA 3GHBH 1HOCA 2EINB 4OCXH 1GIGH 1VADB 4Y9FA 4OKVB 2HJFA 3K8MA 5E1QA 3CDCA 2JTDA 1ZXKA 5CCJA 1O75A 2A2QT 4ZUUA 2FNBA 3WUWB 2G5RA 4N20A 2MH4A 3DX9B 1Q1JH 3Q8AA 2VZTA 5EU5B 3FU8A 2Q8AL 1J0IA 4YVNA 5AZ2L 4GG8A 2HA1A 3FTZA 4DGIL 3PUUA 1S8DA 4NQCA 3LZLA 3M46A 2IFFL 5DFVD 4F57H 4W9IC 4PJHA 3ETBF 4Y5XC 2CHDA 1E5CA 5KYUA 4I5BB 2CGYA 2AQ3A 5L0QB 1HXYB 4DP5X 2KC0A 1D6VL 3BSZL 3QAZB 1HEZB 5J9PB 3BMVA 3ARFA 4LSPH 3ZXAC 1PG7H 5FHAH 1KDJA 2D0GA 2QADB 4HS8H 1UXWA 3GKWH 2JJUA 1T1WB 2XJLA 4G7VH 4X9FA 5I30H 5BZDA 5KVEL 2VN7A 4QRQB 3U6XS 3SOBL 4QRAA 2Y72A 3TNMA 4CC0A 3BZ4A 2HKFL 1RSYA 2VZVA 3LPGA 5C97A 2W1NA 1T89C 2VLLB 1QBML 1XSIA 4LIQE 1KGIA 3NJIA 4ELMA 1PEWA 4NQEE 5C0CD 4L4VD 5DVMA 3LRKA 1DVYA 2NY7L 3SKJL 5EBLA 2E7LA 4H0GA 3G6JF 3LKQB 2WJ5A 5H4ZA 3LS5L 5G4OA 3R7QA 1I1YA 2A74C 4P99A 4XPHL 2PO6C 3DJRA 3BMWA 3GSVA 3L3GB 3KGRA 4K7PY 1G7PB 2VMEA 4OZGE 4LPXA 1BWMA 3O3EB 4AVKA 2B15A 4TSAL 4KVCL 3RE0A 2CCWA 5IV2A 3QDGD 3HR6A 3IMWA 4NKQB 1OAZL 5DURD 3MUUA 1HQRB 4P04A 4CN6A 2D3VA 2ARJA 4UQCA 2EXWD 4EVNB 4WW2C 1V7NH 3PNWB 5FW8A 4LDOB 3QI9D 4EJ1C 1KN2H 1JXDA 4P46D 3ECBA 4N26A 5ANME 5IROA 1P4BL 4LHJB 3L7FA 4JZOA 1W0WB 2OI9B 4OI9A 1NBCA 1VFUA 3EYSL 3TZVD 5D7SH 4EXKA 5BRPA 1EHAA 4X99B 2FL5A 3FUKA 3RGVD 1XCQB 2HVBA 4JHAL 3AS3A 3I6GA 3V4VB 2EQDA 1MJUL 4UI2A 3GINA 1FCCA 4P05A 2F54D 3VH8B 3C6SB 3ZE1B 1IGCL 3HCVB 4PRID 1DSWA 5AAWA 1LEGA 3KPPA 1UM6L 5E6ZA 3AT8A 4J6IA 2AGJL 1ZHLB 1LEKA 4RVBA 3FO1A 5EUOA 1DO5A 2LW3A 5DMJB 1DFBH 3O45A 3E9TA 1TCRB 2F19H 3MRKB 4QRRD 5DHYB 2X4UA 3A4EA 4WJ5A 4XX1E 4LO9A 4FTVD 1GKEA 1A7OL 3EOYG 4N5UA 3KW8A 4P2AA 1SXSA 1RK1A 4XVUC 3IKKA 4XXCC 3NCMA 4OT1H 4OQTH 5DJ6A 1BZ7A 1U8MB 4LCIH 1GJIA 1JCKA 5LBGA 2ZICA 5CSZB 2BP5M 3CLFH 2YRZA 4UWQB 3S3SA 3T4AC 4UTAH 3PL6D 1AR1B 3B2MA 4PAZA 1TQUA 1UD2A 1L4IA 3T5WA 4OD2A 2NSMA 3CHOA 1E4HA 4RIRB 1JWSB 2JIXB 3FT3A 3CQFA 4GXFA 4NOFA 4OZGA 2C7UB 4KHXH 4NI3A 3GD1C 4XNXL 3V6OE 4PJ8D 4BSVB 1CFQA 1OAYL 4AITA 4EDXB 4FAAB 4MAYA 4WQOA 3FMGH 3VGBA 1I1AA 3WKML 2AJVL 3F64A 3PDGA 3CU1A 3AB0C 5IP4A 4W9ZA 2X53A 1HZKA 1EMTH 4IBZA 4M8QB 1JFQH 4B0MM 1SYVA 5AKTA 1B0GA 2ZKMX 3NESA 2ZWZA 3DGCR 3RWJA 3NRFA 4URKA 4KMTH 4E9TA 1CFNB 1IFGA 2GVYA 4W4NA 4QTIH 3L5HA 3DK2A 1U8NA 4FFVD 2CAKA 3QIBB 4N8VG 5MEQB 5E51A 2IO5A 4YDLB 1E65A 1NIDA 5F3HA 3GUTB 3QXAA 2YSTA 4F2MA 2X1PA 5KYXB 5IUCA 1OTSC 3CVHB 5I9QC 5F89A 1TZIA 4DSYA 2XV6B 2KT6A 2EKSB 4XX1G 1BD2D 2B1OA 1JF1B 2IDSA 1R3KB 2BSRB 2X1WL 4JFOA 2IAND 4PRHE 1ZOXA 1MWAH 1TU2B 3DJTA 3WTSA 1OF2B 2W60B 2BS71 1VGEH 1OSPL 4GG6F 1DJYA 2C9AA 4AQOA 3MJ7A 1EO8H 3NDYE 2O61B 2EP6A 5SWSA 1NC2A 4H2AA 4LGPB 4E41B 5LDSA 4KTDH 5EZIL 2V9RA 1ZV5A 2WLLA 5DMIH 1PZDA 3TURA 4AGLA 1ORQA 4L23A 5C9JB 4ZJ9A 4ELKA 1L9SA 1MZYA 2ZCLH 1P4LB 4OLUL 4ZUSB 4S11A 3MCYA 4HZLA 4TRPL 3RWEB 1FFNA 4QOKE 4XPTH 4NQSA 4X4ZA 1KZYA 5I1EL 5BRZB 3IDIA 1E9QB 2BVYA 5DQJB 1KB5A 2WXQA 3GSNH 3FO2A 4JPKH 3UBGA 5I18L 2XPZA 3JWNE 4JAMA 4LPCA 3T09A 1J1PL 5DD1H 3U25A 1UT9A 3H9ZA 4PRPA 1M05A 1YCSA 5GZOA 3WFHB 4L1SA 4UNTA 12E8H 1B0WA 2QPSA 2XZQL 1UOLA 4ODSH 1PDKB 3CDGA 4IOSD 4BHUI 1NA8A 3ZDYB 1B9ZA 4MCMA 4EI5D 1UA3A 2FJSA 4TOYL 4DK6A 3HBGA 3K6SB 1BBDL 4MSWB 3LSOB 5KSVB 2C1PB 2ZUUA 2OSLA 1Z5HA 3SB3A 4LRNL 4Q4IA 1TETL 4FQIH 3E38A 2D7MA 5MERA 5C0DA 4ES8A 5K9OB 4Q6KA 1TG8A 4RBPH 2CDEB 1KWGA 1GVIA 3VFMA 3SHSA 4S1DC 1MUJB 4FOMA 4I18A 1A7BA 3QISA 1DVFB 4NZFA 3HTLX 3MX0A 5CEXB 4BFNA 1EEUA 4PY7A 3ATAA 2CLVB 4HF5L 4U3HA 1X9UA 3NK4A 4BXVA 1FORL 3EYOB 1KEMH 5ERWB 4LGSB 3R1GH 1F6AB 5EOQH 4AM0B 5DC2A 3RX5A 4C83B 4MA8H 1AS7A 5DYOA 5GS3A 3O4LE 4I0PA 3A23A 3UO1L 2A6JA 4AG4L 1RUPL 5ITBH 5DJDA 1PLGH 3VFPA 3C09C 1HJBC 1NTDA 3QNZA 2BWDA 4G1EA 2B4CC 3DDFA 4QRPE 4RSYA 3F7YB 3JWNG 1UB6A 1NPUA 1QKZL 4DEWA 3HE7D 2D4FA 3K91A 1QSED 4GT7A 4L29B 4QOKA 3GXUB 2DKUA 5C7XL 3MBEC 4FL4B 3OAUH 3DOSA 4ODTH 2YD4A 1U3HB 1DQQB 1PIFA 3QEHA 4HIXL 5ICYB 3QIWA 2R8SH 1VPOH 4F58L 2Y7NA 1XMEB 2L7QA 4QR7A 1KPUB 2L7JA 4LCCC 4X8JB 4OQTA 4JM2F 3RPIB 5H2BA 2NTFB 3NP4A 2NCEA 2HT3C 3S9DB 2DN7A 2RCSL 3ESUF 1U2HA 4NRZB 1FVEB 1U21A 4UTAA 5IMMA 4A7UA 3GSOA 3J27A 1UTDA 1RUAL 2IMMA 1OARH 3CPLA 3WL9A 5D7LB 2ICWA 4C59B 3V9CA 3ZW3A 1Y18A 5L4JA 1T03H 2XX1A 3NZ8A 5GGSA 4LEOB 2K7PA 3SDCD 1UT1A 2BERA 2NY2D 2RACA 4HCFA 1EFXB 5DO2C 4K5OA 3QQDA 4MS8D 1CU4H 2IGTA 2V5MA 3U6RB 4JO2L 5CXPA 4XVTH 5HHOB 4S0HA 1YJDH 1TXKA 4IM8A 4P5KB 3STZA 2IH9A 4HBCH 3V4UH 1WICA 3HG0A 1HN1A 3FFCE 4JFUA 3RRQA 3O8XB 1QBLH 2XZAL 3DA0A 5GSRA 4H7VA 3DURA 3GUFA 5IREA 4V2CB 5L7XL 1TZGH 4H20H 5AKRA 3VTMA 3C5ZB 2YD9A 4LOVA 3O4LA 2XWBB 4N90E 3MAWA 4PJ5D 3L9BA 2WLMA 1OCRB 2I60H 4JQVA 1SBSL 3FAWA 4BFGA 2VRQA 4U1LB 2HVKA 4J39A 1MWAA 4AWJC 1U8PA 5AVVB 1NC4B 2O5YL 3PGFL 2FWOB 2DB8A 4WNSA 3JQOB 3BXNA 2ZKHH 2BSDA 4IU3B 4G6FD 1U0QA 5FYKU 1J11A 2KPNA 3PXLA 5F6HJ 2Y36H 1BAFL 2H6OA 2ICEB 2YSSB 1GCFA 4OZIB 4KKZA 3OV6A 1CIDA 3LKNB 1QLFA 3FUDA 5D72H 4K71C 3IGAA 1TNMA 2BK8A 2RALA 3TO2A 1THAA 3CK0H 4CMHC 1P0SE 4OJYA 4WDIB 5I17B 3V6ZA 3ESMA 1BVNT 2X1QA 3ME0A 1OTUD 3WNPA 3MGTB 2YZ8A 5HHNA 4ZFOL 4FNPA 4HX1B 1P5UB 3G6DH 4TVPH 3QPXH 5T5FL 2DWDB 3JV5A 1XF3B 5GRVL 4C4UA 3VXPA 4PY8I 1L6ZA 3Q5OA 4KKBC 3VI4A 2LABA 1X5IA 2QR0A 3GSNA 1W72H 4O02B 1AR2A 4PFEA 4W4OC 1ZLSH 5E9DE 5CCKH 3ZE0E 5H35A 1WA2X 1MPAL 2ENJA 3UCQA 4EF3A 4G59C 4Z7WB 1FGVL 3PE9A 4KRPD 2O5ZL 3NPSB 4JHBA 2UZYA 2EYRB 3EZJB 2MOQA 5C1MB 4JR9H 1VFBB 5D6CB 3BO8A 5JUEH 2MNWA 3U2SA 5AVZB 5IZ7A 3OKKA 3MLYL 4J12A 1QLEB 3OZ9L 3DMMA 3EG9B 4IRSB 4TULL 3T4YB 2QSCH 3V7AE 4FFWD 3FT4B 4JEGB 3Q9PA 2J5WA 1CLYH 2OMNA 2DQGL 3NIDB 3X3GL 4AEIH 4DK3A 4FABL 1OXYA 4NYLA 1WS8A 2ADGB 1HHIA 3H3BC 1NMCC 5I8EA 5TE4L 3FUIA 1IQWL 1HT6A 4OFVA 1SLVA 1WBYA 1EAOA 4HWEL 2J2ZB 3T8XA 4KZEL 3KBEA 2ALAA 3NIFF 2XG4A 3KLAB 1DSYA 4UM9D 3FU6A 3PIQB 4Y4HB 3V0VA 4A63A 4CVXA 5I2IB 3UABA 2YMOA 4UF7C 3CH8A 5KBLA 3ECWA 1GYCA 3AT0A 2EE0A 5IMOB 1IJNA 2ED6A 3QWQB 4NQED 3EJZD 4YIQA 4UQEA 4ETQA 2J12B 3I9GL 3NP3A 4GAYB 4N8PA 4R3SB 1D6EB 1JWUA 4KOCA 3TT1L 2VXSL 3VXOB 1OAJA 3QHFL 2YOAA 3UIZA 2GTQA 2EIEA 2Y22A 3LEXB 4DETA 3JWDC 4QHMA 4A6YA 3D39B 2M26A 4HFWB 2P8MA 2E59A 5L88L 2Q10A 1INQB 5I1GL 4G42A 4U1MB 2W95A 4W70A 2GT9A 2O6CA 5E2VH 4MNQE 2F9BT 1Z66A 4K94H 3H4HA 5C0AE 2KZ1B 4J2QA 4UDTA 1TENA 3T2LA 1A6PA 4MD4A 1FPTL 2OJZH 3X1BA 4FLRA 4EN3C 1BOYA 2BSBA 3OQRA 3P3TA 3HPJA 4M8UA 4LOEA 2BFVL 3G7TA 1B2YA 2VUKA 4QTHA 4HKBA 4X7DC 5C71A 1DVUA 3BPOC 1PBYA 3ARGA 3BIKA 2MCPL 4P3CH 3ARBC 4WI9A 5ALCL 2H8PB 2CDGB 3LS4L 3RGHA 3TX4A 4BGDA 2XXGA 2XHNA 1T21A 1OM9A 4PS3A 5HXMA 1JNNL 1XB6A 5TE6L 3H85A 3HI1B 5LVEA 4UQAA 3HJ0A 2F8VA 4D7PA 2RAMA 3QDJA 3MO1A 4QHKI 3HI6L 1AZVA 1PZ3A 1NFIB 3WV0A 1IZKA 1ASOA 1CXIA 5FDYA 1QACA 4Y5YC 1IC7H 4EIBA 4OI7A 2GIMA 1JTOA 5E5LA 2OMXA 2YEVB 4AXWB 1MRFL 4PJDF 3LVTA 1A6VH 5DGQA 5SV3A 1HC1A 3DX6B 1JDAA 4J6RL 5FWQA 4ICWA 5DFVC 4BCZA 2VN4A 1YECH 3MUGB 1HINL 3BYYA 1L5GB 5ANHA 3K1DA 3RNQA 1V27A 2AABL 3G6JB 2BVTA 1TKWB 2BPBA 4X80H 1JRHH 3Q9QA 1WCQA 1FLTX 1VFAA 1ITBB 2BDNH 3L5XL 4X6DF 1RZJC 3GPSA 5IHZB 1GAFH 5KEZA 1KJ2B 3GDCA 4GSDH 3ULUH 1ZT1B 3MJWA 1T5XA 2WKGA 2VLME 3WKNA 4IBTA 4LF3A 2AQTA 4ZFGH 5MI0C 2HRGA 4LEXL 5AKSA 1WDAA 3KGSA 3O2WL 5JW4R 1F4WL 5T8IA 2CHWA 3OAZH 5KS9F 5DJAB 1QSVA 4OTXL 2Y07H 1W8EA 2A38A 3KPNA 4HLZG 2FWUA 4F7KA 3TH3T 1MCIA 2BIQA 2XICA 2Z4QA 3OHMB 4MMXA 5KSBE 3OVUB 1JPGA 1KTBA 1Q9LA 2XN2A 5GJTL 4B27A 5K9QI 5CGTA 5D5MA 1B90A 2J21A 3VA2C 4Q9QL 4YBHA 2LTQB 2DM7A 4M43L 3RUGE 3VWJD 1RULH 2DMBA 1FYTA 3FONA 3NCEB 4LQ1A 5FCUL 1W72A 3T0DA 4L0YA 3PCYA 1ZDSA 1ASPA 1MCKA 3O6FA 2NNXA 1NWPA 2ZG3A 2Z93B 3U7YL 4OV5A 2XXMB 1XD1A 1I9RL 2EXWC 4X98B 3QI9C 1NCAH 1IBGH 5I0DA 4O5LH 5CN1A 4N0CD 3LKSA 1K9TA 4WTZG 3NEEA 3QJZA 5CCGE 3D85A 3RL1A 4U4BA 3ZL4L 1IAOA 3O3BB 3ULSB 4C56B 5B7MA 4OIIL 4Y4FC 5FHBH 4EI6A 3T77B 4IDLA 3ZY7A 1KEGH 3GZPA 3QW9A 1MCDA 5JHBA 4PGEB 3QNXB 4JG0H 2W9EH 3RGVC 4XWGL 5IW1A 4O51A 2EC9U 1Q9OB 5PCYA 3IGFA 4PLJD 2MTAA 3G5YB 4UT7L 5HDQH 4UU9B 4XCEA 4OD3L 4NSKB 1W15A 2TRYA 4WIQA 5FYJH 1ZHNB 4PJBA 4IJTA 4ORGA 3INOA 5DZLA 1BXVA 4J1UB 4P46B 3KVQA 4PV9A 3WKPA 4CKVX 2ENPA 2OQJB 3STLA 3MOBH 1BHGA 3ZL1A 4X6CE 1ZTMA 4F37F 3DX1A 1MSPA 1WIPA 3UG5A 1MHPL 3TZVB 2VABA 2AHIA 3B5TA 4KUZL 5T3XH 1NSNL 3GTVA 1IGYA 5EWIH 3CFJA 1QSFA 4XMKL 4F7CA 3KXFB 4ZXBB 4LAQL 3VQLA 1AMXA 3IDJB 1IGIL 4G7RB 4JHZA 2D7TL 2UYLB 3PL6C 5KW9L 2VERA 4PYHA 2FEEL 5D7JB 1WWWX 5JHDA 1M42A 3RVTC 3RVVD 3EJTA 3KLSA 2E86A 4NLAA 2ZP9A 4FFYL 4E9WA 5J1TC 2V37A 1U8IB 3TIEB 2AJZA 3TPKA 1BIHA 4NT6B 3K6DA 4FP8L 5FIEA 3RTLA 3CX5J 2ZOKB 3LDBB 4ZUTA 5I23A 4U6VL 2VAAB 4EBQL 3MRQA 3S3BB 1YEJH 1XSKA 2ICWJ 3WMQA 4DKTA 4G5ZL 4F20A 4P3DA 3D4CA 4AQ8A 1T1YA 5DA4A 5KTEH 2W80C 4HOWA 5I0ZA 1PKQA 1CZ8L 3KWXA 3SD5A 4C54A 4GG6B 2W8CA 4FQ1L 5EO1B 5LQBH 4FFVC 2BSED 3MLRH 1KGUA 1KTJA 4MRBA 4GMSH 2MCG1 1ZS8A 5CAYB 5DGRA 5MP6H 2FLRT 1BJ1J 2NUPB 2X9XA 5CJBA 3T2QA 1JJUA 3EYVA 4Q4EA 3TONA 3LMJL 5I6LA 5KG9A 4PJ8B 2Q3AA 3EDDA 4NWTH 4QRPD 3FRPB 4XZ4A 3KPSA 1KBKA 2JB5L 1TYRA 3DV6B 3GHEL 2D3NA 2WMPA 4PRBA 4AUUA 1S9WB 1QVOB 5B1JA 5GXBB 2FJGB 2R56L 3L1OL 4GXVL 1OB1A 4IRZH 3DHMA 3IXTB 3POCA 5BO1L 3WE6B 2JSFA 3C6LB 1LWHA 4OUUA 3FTGB 1BAWA 2DIBA 1NEPA 2HTKD 5I24A 3VXSE 4AK2A 1OT1A 2GIXA 3GMNB 4XT1C 4QXUH 2VKWA 3QIUD 1WS7A 1EZVX 1SJHB 4P2QE 1U3NA 3D2UB 4FNQA 1E27A 2VR4A 3IF1B 1CIUA 3NJMA 4WW2F 4G9FE 3D09A 3FO0L 1CGYA 1TT6A 1T7XA 3J07A 4LLQA 4WUUB 3VAEA 3NABH 1IEAB 1V5JA 4XCYB 3V4VH 4HU8A 1NGZB 2WBJD 3EO1A 4NPKA 2ADIB 3CU7A 3HNSL 3NK3A 2FBRA 1VJSA 4Z95H 2C9VA 3FOMA 4XHJD 5DR5H 4GP4B 1DQML 2KS0A 4KJYA 1BVOA 1EJ8A 4U1JA 1KJMA 2VDQH 4DGVH 5SWQA 4N0UA 2Y7LA 2IANB 2EVIA 1KGYE 4MQSB 2XQ0A 4KK9D 3ML9A 5BZWA 1S9XB 1XMWA 1P69B 4ZUWB 1GC1H 4XRCB 3T2NH 5LXGL 1JV5A 1BZ9A 3VTTA 1YPZF 1RIVH 1R4XA 3D08A 3HHMA 1SJEA 3UJIL 1CGXA 1E4WH 1VACA 3ALPA 2XIIA 4L18A 4NIKB 4XPFH 1U8OB 5EZJB 3T0EA 1N6UA 4ZMTA 2JMRA 3F84A 3D1MC 4CVZB 3D33A 4OLZL 3IMRA 4JGNA 3OBAA 2VWEE 4FHBD 2BVPB 2BY3A 5ACMA 1YYML 3BWUC 3TA3A 3KPMB 5F9JB 2GCYA 3CLEH 5CJOH 1JHKH 3MRMB 2Z7WA 1ZPLA 1FRGL 1LO3L 1PSKL 2OMTB 3GZOA 4C4BA 5HDBF 1U8QB 1Y6MR 5TQ2H 5FCSH 2H9GB 3N41F 4LNRA 4W9LC 5DHDA 3K2KA 4LK4A 5E9NA 2ATAA 5F1NA 5HVHB 2PXYD 2OL3B 2BY1A 4RMBA 1G0XA 2X4PA 4AL8C 1EDYA 2R4SH 4K55A 4G7YH 5JXEA 1AZRA 4GFXA 2XFXA 2X10A 4AZUA 5LKNA 5FFOA 2XVKA 4GFTB 1KBBA 1N2RB 5LXVA 5LAXA 1IGJB 1HSBB 3MRIA 2RQEA 3EDJA 4KK8D 4EI5B 1KIPA 3QUKA 3OLIA 1RURH 4JM2B 3SJVD 3BQUA 1MJJB 1E4XL 1F6FB 3B9AA 4NP4H 3VM5A 3FSZA 4FKEA 2YPVL 3B2UD 4N0YH 3BPLC 1VEMA 3MLTB 2C9QA 4TNWK 4I1RA 1GGBH 3VRLF 1DBAH 1AE6L 3HE7C 5EU4B 1C08A 5AB0A 2FB4H 1OV8A 2B7DT 1MIEL 3JWOC 3K4AA 4KFMA 5GQBA 1PGRB 4LCUB 5D93B 3K6OA 3LN5A 5CJQH 1D5RA 1AS8A 5E9DD 3QCTL 4G1MB 2V3DA 3WI9A 1U3YA 1Z32X 4F9LA 1BZ8A 2QQNL 5AOJA 4QY8B 1MHHB 2GJPA 3HE6C 5EIVA 3LZOA 4QRFA 2J88H 3B3BA 2E9IA 3X12B 1AOHA 5FA4A 1Q38A 4NUPA 5GS0C 1BFOB 3JYBA 5G4MA 1LWRA 4RAVA 3UGEA 5GISH 1S5IL 1B4JH 5IFJB 1VZIA 4FQXD 3NOIA 2CKNA 3KCPA 2M83A 4TM9A 4GLRI 4YDMA 1JMZA 3WGVB 3F3HA 5CNHA 2UY7A 4XNBA 3US9A 2B3IA 1QSEB 4JDTL 5I15H 5E00B 3HG1D 3IPFA 3FCGA 1IL1B 3SDCC 3FCSB 1FJ1B 1F56A 1BMWA 1AHWB 1X6NA 3B1TA 1DLFL 2NY2C 4RMRA 2VQUA 1JPFB 3A67H 3D25A 2V8MA 5CINL 1MCOL 4MS8C 4WV1A 2QTEA 3ILQD 2WTPA 3KD4A 4XE5B 5F96L 1CE6B 5JR1H 1IGTA 4LEEA 4F3FA 1H3PH 2GK2A 3W0WA 1X44A 2RB8A 4ERSH 1L7TH 1I4FB 4HXAH 1ES0B 4HS6A 3WKQA 1AJ7L 2WWKO 2MSPA 5IVXA 1W8NA 1YA5A 2P5WA 4DP0X 4FYRA 5AZEL 4TXVB 4KKAC 1ZHKA 3GQFA 4OZHF 5E95B 2P5EE 1WV7T 4R97B 1CI5A 2FUQA 2HSIA 2H3KA 2K1MA 4HLEA 4JBSA 1KGXA 4IRZA 2ITFA 2B3RA 4YN3A 5FGCB 1A9EA 4GW5A 3FUMA 5C0AD 4WENB 2Y0SA 1AMYA 3TGXA 5KVGL 1H8OA 4X4XA 1BVLA 3VXTB 2K6WA 3P3YA 1RMFL 4BYHA 3ATBA 1UXSA 1AANA 4LNVA 4U7MA 5IQ9B 5E6SB 1T66D 2B9BA 4QHUA 2E7LC 3VFRA 1NIEA 2XN9B 1I8LA 1OM3H 3KE0A 4M6OL 4QF1B 5TDOB 4L8DB 5ENWA 4PV8B 1IM3B 3EO9L 5I1AA 3VXRE 2XWJA 4AEHL 3H9SB 4E9SA 3WS3A 2SEBA 4LLYB 1FIGL 4OFYD 3KL3A 4Y5VC 4OKDA 4H26A 4MB3A 3U9PL 5BUGA 3MLUH 2YC1B 3K74B 4NIYE 4FHKA 3NH7H 1WG3A 2PYEB 4CDHA 5CJ5A 1X5KA 4G6FB 2X4OB 3AY4A 3LPFA 3IWUA 3QE5A 3S5LA 1T2XA 2FRGP 5IROC 5A7EA 5F88A 4K8RH 1HTYA 3KMDA 3TBSB 2A1WH 2ERJC 3NIFB 1NJ9B 1OGTA 3L4ZA 1T1ZB 4JM4H 4KRPC 4L05A 3MACL 2X3BA 2YN5A 2J4WL 1A21A 2E7CA 2YGVA 1IIIA 1PVHA 2BCKA 3CFCL 4YL4A 3WIHL 2WK2A 1FCGA 1TLKA 3FQ2A 3IKCA 3F2LA 4QAWA 4I9XA 3DTDA 1S7UB 4M56A 3MV9A 1OSZA 2OA9A 1EGJL 1KNOB 3IFPB 3MV7A 5KYYA 1AY1L 3MCKA 1JN6B 3EGXA 4EMZA 4JJOA 2C9XA 4G8EA 1P2CA 3U48A 3AMKA 5D9SB 3UEQA 4NFCA 3KH3A 5CIPH 5L8KB 3M86A 5FA3A 1T0MA 4JPSA 4QHNA 3QJVB 4BFEA 1JK8B 3DWTA 4MMYA 4WUKL 1EAPA 4FFZL 3TL5A 4JY4B 2Q8AH 5AZ2H 3TJHD 2FWLB 2ZAGA 2VLMD 1OLLA 4DGIH 1I8AA 2DW5A 2LE9A 3BD5A 3L3OA 4OCMC 4J3WA 3RKPA 1A02N 4M62L 3ZMEA 1LEIB 1LD9A 1GZPA 1S9YA 3HR5B 2OTUA 2YRPA 4L4TE 3GS4A 1RK0A 5IEKA 4G7SB 1R24A 2WKLA 3BSGA 5CGBA 5L2KE 3IFNL 3JUYA 2QT6A 4FLHA 1D6VH 2ITCB 3BSZH 4XP9L 4AIEA 1WLHA 3FT2B 4MWFA 2R27A 3UZVB 5I1CL 4NUQA 4KOBA 4EAEA 3KPRB 4Y9BA 1NM4A 1U2YA 3SOBH 43C9A 1P1ZB 4I0CC 3AXHA 2HKFH 3LPPA 1I1AC 3TESA 2FATH 1QBMH 3OXRB 5C08E 4Y1SA 5CJ8A 2C3WA 4QRUB 4TVSa 2AQ1A 5KJRL 3SKJH 2NY7H 3C60B 1JUFA 4MMZA 3BWZA 4FKKA 1HDMB 3LS5H 1RUML 1KLGB 5KN5A 3CVBA 2NRDA 1E28A 4N87A 2APWA 2XETA 4NZTL 4A68A 1DCLA 5DCCA 2D2OA 3GPEA 3ETTA 4TKWA 1GZHC 4PJDB 1KBPA 5IB2A 1P5VA 1FG2B 1FF5A 1UXMA 1YEHL 2VLRB 4TSAH 3RDTB 2HLAA 2ZX9A 4KVCH 3U79A 4Z76A 1CF1A 2FZ3B 2EJ1A 2O6PA 1X7SA 4F7EA 3TFKD 3N9GH 3QBTB 3RWHB 2VN5A 1FIEA 1OAZH 5E8EA 3M17B 3AWEA 1E0OB 1Q94B 3IDUA 3WTYA 1PLBA 4M00A 3K81A 1A1NA 1XTMA 1N6VA 4IRJA 4UILL 4CNIB 4WI7A 1TTFA 3BVNA 4U05A 3LNGA 5E0QA 2X09A 3O3DA 4X6DB 1UQSB 3RDJA 4R84A 3EYSH 5AW6B 1TQVA 1NAML 3GWJA 2JTYA 2EILB 1BWWA 4NKOB 4G8IB 5C09E 4V1DD 5B1AB 1O6SA 3DVGA 3OKDA 4GRWE 5D2NB 1ED3A 4CU6A 5I75C 2VQ4A 4JHAH 3H2PA 4YX2L 1MJUH 1J0ZA 2B5IB 3IXAA 2WP3O 3S36H 1MFCL 1M6OA 4PPTA 1IGCH 5HHME 4OCSH 3ZBMA 2JKSA 5KS9B 4XB3A 3DXAB 3ZE2E 1UM6H 2AGJH 2H3NA 5INDA 3RWIA 1WEJL 1YDPA 4LLDB 5E99L 4RWYL 2WZ0A 1BZQK 4Z23A 2H1PL 4RQQB 3VFSB 1A7OH 1P4IH 2ZPKL 5FYKL 3I50L 1Z5LB 1U3JA 1C5BL 3QEGL 1KYOJ 1JZ3A 4ZX4A 5GZOC 2R2EA 3DOHA 4F80A 3M45A 3IDNA 2NXYD 1FVDB 4QKXB 4E9QA 3KW7A 4PJEE 3WNMA 5E1IA 3WHE1 2ESVA 1J0JA 4MRCA 3GTNA 1G9MC 3IVKA 2VL5B 5LCVL 3ZDXF 3N40P 3TCLB 4A2HA 4ZFFA 1OGSA 4F8NA 5IW6B 2NY4D 3O3AA 2N1TE 4MCZA 2ZCHH 4XNXH 2DQIL 2B4CL 3BGMB 4BQCA 1OAYH 2JCCF 1FLRL 1K2DA 4NWUL 3VWJC 5I66B 5T33L 3WKMH 4P5TD 2AJVH 2X4RB 3D4ZA 3EKCA 1KJVA 3F05A 3VFNB 1JPST 2J57A 2WQAA 5KSAA 1ILSA 2P9RA 4YUEL 3IE9A 3KYKL 1OF0A 2XWZA 5C0EB 4X5PA 2TAAA 4B5ZA 3CFMA 1G7JA 4PRNA 4H25A 1HHGA 1JV2A 2R1YA 3VXSD 4RX4A 1M2VB 3U83A 3HRZC 5E6UB 4FMKA 4JZJA 4DKAA 1U95A 3PUCA 4L3EE 3AGVA 2DI8A 2APXA 3WEAA 3S37L 3ZJAA 4DEPB 5IVZB 4LSRL 3FHQA 4G9FD 4YWGL 4AJVA 3WO3B 1M1XB 2LGNA 4Y16B 4JNXA 1NM9A 1ETZA 4JFFA 5KANI 2R4RL 5CIPA 1H8NA 1AZZC 1F2QA 1MI5A 3F6JA 3DV4B 3WN5B 3EBHA 4R4NC 1SRDA 1VFOA 2DIAA 4MZ2A 1FI8C 2BMKA 1OSPH 3PHQB 4D2NA 2Z7ZA 4KXZH 4JN1L 3CCHA 4JO1H 2VLJA 1DQTA 2GJ6A 1JNHA 3FCTB 4QNPF 1GY2A 1LO5B 1PS3A 4YDKL 2DTSA 1FSKB 2FJHA 1K5NA 2C26A 3CUPA 4BA0A 1WQVT 2BIOA 5DJXA 3KS0H 3GBLA 1DJZA 4PJXE 4QXGL 4R90L 4X83A 5EZIH 5IMKA 2RR3A 3AS0A 1DLHB 1AGFA 4NO0A 1CFMA 5CLWA 5ACZB 5JDSB 4M7LL 2BIPA 4GIOA 4UOW1 1IILE 3T3PF 2WNWA 3ZMNA 5AOZA 3V0AC 4OLUH 1QZNA 1SMOA 1OP4A 4TRPH 3NJKA 4OFIA 5I1EH 1C5DB 3HZKB 4JG1L 3ZDZF 4CSPA 4EUPB 4NRXB 2BNUA 1L9OA 1Y7VA 5ICXB 5E5RB 1AXIB 1T20B 4FZEH 3A6BL 1FZOA 4S2SB 4ZOEA 2VR6A 3II1A 2W81C 5I18H 2EYTA 5J4MA 1J1PH 3CC5A 1WGOA 1BXUA 5J6SA 4MB4A 3SDAA 3TBTA 3KLQA 1MDTA 2ENSA 3ZHKA 1CI3M 2ED7A 4ZYKA 4KU1A 4O4YL 3HC2A 2WAHA 2XZQH 2ARJQ 3VA6A 4HSQA 1LE9A 4LPWA 5FM5M 2EYSB 4CU8A 2AEOA 3PJLA 4FG0A 2VB5A 4YBQD 4J3OG 4LCWD 35C8H 5IOKA 1FZKB 4JREC 4OIAA 3D3VE 1QEWA 4FQ2L 1MHEB 4TOYH 1BBDH 4TYUA 3IU3B 4DGUA 3BDBA 2UXGA 3S3DB 2F0CA 2EO1A 3ULAB 3VFGL 3ARED 1JXKA 1E42A 1GHFL 1YVLA 4Z7UF 3DIFA 3SQRA 1TETH 4NN7B 3OHXA 4WW2B 2XT1B 4N1HB 5KVDE 3WEXB 4JQVC 3OGCA 1SOXA 4N28A 4NUJA 4DKDC 4FNSA 2YD1A 3ZOAA 4YHLL 2FGZA 3HUJF 5HVGB 3FSAA 3GXNA 3PV6B 4FCAA 5AYQA 2XYBA 4N8CH 3EJQA 3SDXA 5HGGS 3QEQA 1GL4B 1FNGB 1TVBA 3DRTA 4QIRA 1K5WA 4HF5H 5CM1A 4X0KA 2FO8A 3MLVL 3QIUC 3T2OA 2CGRL 3VFOB 3QG6A 3KBFA 2OMWB 2V7HB 2ZTBA 3EGSA 4R7XA 1YPZB 3WEOA 2EDEA 3UO1H 2WQ8A 1I8KB 4AG4H 1RUPH 4Y1AB 5CUSL 5AW0B 2K78A 1T7ZA 3ARDD 1CYXA 1XZ0A 2VISA 4U0QB 4BRJA 5C8JA 2F8IA 1H5BB 1QKZH 2VM4A 2WBJC 4OBSA 6PAZA 5C7XH 2CLZA 5A2BA 4XHJC 2CBTA 2I26N 5EF2A 2ARWA 4HIXH 4JHUA 3QNYA 2Q2LA 3AGWA 2A7BA 4F58H 4NUGL 1HYRC 1BBJA 1J5OL 3FQNB 4WWPA 1OAQH 2ZKYA 1T7YA 3D2TA 3FQXA 1XSOA 1QFPA 3BD4A 5EC1B 2AJUH 2JKTM 5HDBB 1TYJA 3SZKC 4CW1B 4LP4A 2YAEA 3L13A 2F7RA 2IQ9L 1OHZA 3EAKA 4BSJA 3N41B 3WTTA 5D1XE 5D7IA 5F7DB 5J6GB 3FUNA 1ADWA 3FF7A 1RUAH 4QXTB 4U6HB 5ADPL 2XFGB 4HKXB 2XQYA 2XU9A 3DMMC 4PJ9B 3OMAB 1YZZA 3GXPA 4LVHB 2C7FA 2AF2A 4HOMA 5JIPA 4A55A 2Q87A 5D96B 4D0CB 3Q2LA 2DMKA 1G6RA 5GZND 4F7TB 2FSEB 3VMOA 3FKUS 1GS6X 4XMUA 2D7OA 5DJ2B 4ZK8A 2AITA 3A6CL 4JO2H 4GEJA 2P7TA 3E6FA 4KJQD 5GJSL 3E2HC 2WVTA 3G5ZA 3MV8A 2LU4A 2QL1A 4AGPA 1DEEB 3VRJA 5C0ND 2VN6A 5EU6E 3IETA 5KVMC 1YUKB 3NSFA 4HZAA 2OSYA 2GW5A 2PXYC 4GPVA 1UKQA 5DEGA 3VGEA 5AAPA 2DLHA 2XZAH 5T1KD 3S35L 1V3JA 5AVTB 3MKKA 1MXDA 1C16A 2X70B 2WYHA 2XTJB 1W0YT 3ESNA 1I9JL 2ZUSA 3FDWA 1DQLL 3EH5B 1U42A 2XY2A 3Q2WA 4MXWL 5D1ZD 4KK8C 2YD6A 1R5IA 3VRIB 3I3EA 1EDHA 5IVOA 2VLKE 3ZYZA 3MBXL 3LQZB 1D5XB 5SX4I 1SBSH 4O9HL 3QQNA 1UOVA 4G6JL 1XO8A 2O5YH 3PGFH 4JRYE 3I6SA 4XP5L 4ODUA 2GAZB 2ZYRA 4JG9A 1M7DB 1P7QD 2F5AL 3FSVA 2NYYD 2ZIDA 3MI6A 4RGNE 4XI5D 1BAFH 3TBVB 1NBZA 1R33A 5CGMA 4TSCL 4FJYA 4MD0B 4NDMB 3UPAA 2EEFA 2E74C 2VZUA 4PP2A 5BNXD 2ZXEB 4YAQA 3U1PA 4N0FA 3IJHB 1IFHL 1PNCA 1KELL 2GFBB 2IH3A 2SODB