4HALA

Multicopper oxidase cueo mutant e506i
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHIDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506I
rcsb
source organism Escherichia coli
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA03
4E9XA 2QPDB 2XVBA 2YAHA 1IBZA 1GW0A 1TEFA 4HCGA 3SBPA 3ZDWA 4YSCA 1JZJA 1QHQA 4A2FA 1OCZB 1X9UA 3JTBA 1ZIAA 2PPFA 2YAFA 3PAZA 3BVDB 1E5ZA 1OCOB 4RH4A 2EIKB 3KW8A 2OJ1A 3AG2B 1KBVA 4FAAB 2PPAA 3TBBA 4YVNA 4DP6X 1MG2C 1NDTA 5AFAA 3OD3A 2YARA 2YAEA 1KV7A 2H3XC 2AZAA 2FWLB 2DY2A 4F2FA 1AANA 4WTQA 5F7BA 1E65A 3FSZA 3NJGA 1JZIA 3T6ZA 1WA1X 3QJSB 2FT7A 4DPCX 3NJMA 3ASNB 1WAEA 3N2JA 2P80A 4AKPA 1PLBA 2OCCB 1URIA 4ZK8A 4KNUA 4WKXA 3QJUB 5PCYA 3UADA 2PCFA 5B1AB 4JHUA 2GBAA 6PAZA 1AACA 2Q9OA 1AG0A 4HIPA 2YAPA 3S3DB 8PAZA 3X1GA 4GXFA 3NYKA 5LDUA 4GP5B 1AZUA 2WSDA 1W8EA 3AG1B 2CCWA 4BXVA 5FC9A 4E9WA 3FT0A 2VSMB 3S8FB 1MZYA 2R7EB 1ZDQA 3AG4B 4G7SB 2IH8A 2VMJA 4YSEA 3NJLA 1L9OA 1PNDA 4A66A 7PAZA 4HALA 3T9WA 4DP4X 4JKNA 4A2GA 1ET8A 3FU8A 3WIAA 2DWTA 2XX1A 3NSDA 3PAUA 1NTDA 2FNWA 1E5YA 2UX6A 1NIEA 2XX0A 1J5DA 1XMEB 2BHFA 4YSSA 1SFDA 1KDIA 3DTUB 1WA0X 3MBWB 1T5KA 1SHXA 1NIBA 1OE1A 2OV0A 3WNIA 5ANHA 4GYBA 1JZFA 4G70B 1PF3A 4HCIA 2YXWA 3NT0A 4YSDA 1ZPUA 1GS7A 2GI0A 4N4YB 4AZUA 3UGEA 2CBPA 5TK2A 1KCBA 4PAZA 3NJFA 2FTAA 3GYRA 1PLCA 7PCYA 1AS8A 1JZEA 2ZXWB 1NICA 4CSZA 4KNTA 2TSAA 3QJVB 1OE3A 2XYBA 5I26A 1KYAA 2YQBA 1RKRA 3IBOA 3HB3B 2ZWNA 3GDCA 1PAZA 4GP4B 5I28A 2MTAA 4TXVB 3RYMA 3ABMB 1RZQA 3V9CA 2X87A 1CYWA 1GR7A 2P80D 4G7QB 5D4IA 1GS8A 1A65A 1NWOA 3PAVA 2GB2A 3NJJA 2HXAA 1PY0A 1ZV2A 4MFHA 3OMAB 1OV8A 1V54B 2BP8A 1JXDA 3ABLB 2GC7C 4L0PB 1PCSA 1ASQA 3BQVA 1M56B 3FU9A 3FPXA 2XV3A 3WG7B 2PP8A 5B1JA 4E9QA 1UATA 1PZCA 1A4BA 2IH9A 2QT6A 3OM3B 4HAKA 2BWDA 1NPNA 3FU7B 4JHVA 2BO0A 1ILSA 4N8UA 3KW7A 4BWUA 3FQ2A 3ZIYA 1MZZA 3CDZB 1ZDSA 4X4KA 3IN0A 4DP0X 5E9NA 2AVFA 5I5JA 4QLWA 2FQFA 1AQ8A 4NB7A 2CAKA 2PP9A 3TBCA 1NIAA 2IDFA 4E9TA 2HLEB 4BXSV 2XV0A 2QDWA 2R7EA 4KNSA 2PLTA 4CSPA 1JVOA 3DKHA 1XB3A 3PLYA 1AZRA 1E67A 4GP8B 3L45A 4E9VA 5PAZA 1QNIA 2BW5A 1RCYA 1BEXA 1NIFA 2FT8A 4Q8BA 3EH5B 1A3ZA 2GSMB 1BYPA 1XB6A 2DV6A 1AZBA 1VLXA 1PZBA 2UXGA 3QJTB 3QJRB 3WKPA 2RACA 3X1BA 5IY5B 3FYIB 4M3HA 1WS8A 3NP4A 4G72B 5I5MA 2EILB 1ID2A 3AW5A 2UXFA 3FYEB 1ADWA 3AY2A 2VN3A 2VSKB 3EF4A 3TU6A 3WNJA 3PXLA 2WO3B 4A2EA 4A2DA 1JOIA 1SNRA 1XB8A 4M4RB 2A3TA 9PCYA 2IWFA 2HX7A 4HHGA 5I6LA 3V9EA 2VW7A 4DP1X 2W88A 4G71B 4BWWA 3OMNB 1CYXA 1HAWA 3TA4D 3UACA 1EZLA 2HX9A 2PPCA 5I6KA 1M57B 2YAOA 3EH3B 4DP7X 1SJMA 4YSOA 3QPKA 3WI9A 1BAWA 3DIVA 4KO6A 1W6WA 1IKOP 2CALA 1KDJA 2HRHA 1CUOA 3FU7A 1F56A 3IEAA 1WA2X 2Y69B 2I85A 4E9YA 2I7OA 2TSBA 1NPJA 5D4HA 4YSQA 1TKWA 2FQGA 6PCYA 1YLBB 2B08A 2VW4A 1OOWA 2N0MA 4YSTA 3U25A 2MRYA 3CDZA 4FA7B 1AS6A 1IUZA 1AZCA 2BWIA 1WS7A 2IWKA 1FWXA 2DYSB 2Q5BA 4P5RA 4W9ZA 1ASOA 2IDQA 2FT6A 2HX8A 5I6PA 3H4HA 1TU2A 1FFTB 5B1BB 3UAAA 4AI7A 3UABA 2IDTA 5F7AA 1KBWA 3AG3B 1OE2A 2E86A 2Y1AA 2DYRB 1JZGA 1J9QA 1OCRB 3FPYA 2J5WA 2JXMA 5I5IA 2YXVA 1DZ0A 3ABGA 3FQ1A 1BQRA 2BP0B 1ILUA 4UF7C 4PCYA 3PPSA 1HFUA 2AZUA 3FS9A 3NSCA 1PMYA 2CJ3A 2JKWA 2ZOOA 4G7RB 2DWSA 3MX0B 1M9WA 1QLEB 3IN2A 3NJKA 4DP8X 1OF0A 1KCWA 1TEGA 1BYOA 4YVUA 3CVCA 4Q89A 1KGYE 5B3SB 2FJSA 2X88A 1B3IA 4BDVB 4DPBX 3QQXA 4YSUA 1NIDA 4W1TA 2HZHA 1MG3C 3SBRA 3TASA 3ZX1A 4KO5A 5A7EA 1AR1B 1AOZA 2BW4A 3T6VA 3QJQB 1SDDB 3NP3A 3X1FA 3GXUB 2JFCA 3S3CB 1A4CA 1SF3A 1ASPA 1GSKA 2QDVA 3S3BB 1IC0A 3H4FA 4GY4A 4KO7A 2GHZA 1BXUA 1BQKA 1JVLA 1L9SA 1NZRA 4A67A 1L9TA 3SBQA 2GC4C 4A68A 1V55B 3CVDA 2PP7A 3FSAA 2H47C 2EIMB 4E9SA 2IDSA 2ZONA 4AKOA 4A2HA 1GS6X 3SQRA 3JT2A 4E9RA 1AG6A 2CUAA 2BZ7A 1NINA 1OCCB 4ENZA 1E30A 2XV2A 2UX7A 2XUWA 2BZCA 2NRDA 1CC3A 1ETJA 1JXFA 3T6XA 3FSWA 2YAMA 1J9SA 1JERA 3NJIA 5D4JA 4DPAX 4F7KA 2BP8B 4NERA 2B3IA 1FA4A 5EHFA 3X2QB 2H5UA 2PPEA 2W8CA 2VM3A 1AAJA 4YSRA 3X1EA 2IAAC 4EF3A 1HAUA 5AZUA 2VW6A 1SHWA 1I53A 1AZNA 3D12B 3N55A 3PCYA 2EIJB 3G5WA 5I6MA 1J9RA 3ASOB 1BQ5A 1R1CA 2PPDA 3CZUB 2XXFA 1JXGA 3EHBB 3NSFA 1PNCA 1W6LA 2AANA 3T71A 4HHWA 1BXAA 2QPEB 4UANA 1SFHA 3AZUA 1GY2A 1AS7A 5AKRA 4UAHA 3ABKB 2HRGA 2XWZA 2BP0A 2J57A 3NJNA 2XU9A 5I6NA 4KO9A 4YL4A 1AIZA 1EHKB 4AKQA 1L9RA 2XLLA 4DP2X 3T6WA 1V10A 2IDUA 4KOCA 3CG8A 5B1JC 2IWEA 5B1KA 3IE9A 3FSVA 3UAEA 4BDVA 4P5SA 4BWTA 2XXGA 3EH4B 1ZIBA 1DYZA 2FQDA 4F2EA 2FQEA 3OQRA 1MDAA 5B7EA 4YSPA 1N70A 1ET7A 3HEIB 1J9TA 1SF5A 3NJHA 2GIMA 4AX3A 1SDDA 2AFNA 5I6OA 3X1NA 1GYCA 2EINB 2VM4A 4DP9X 1NWPA 4K9JA 4KOBA 2I7SA 2J55A 4YSAA 3OMIB 1JZHA 2UXTA 3NSYA 3C75A 4NAJA 1GY1A 1J5CA 4BK5C 1A4AA 1BXVA 3WKQA 2YAQA 1IBYA 1L9QA 3FQYA 1PZAA 2LLNA 1ET5A 1PLAA 2J56A 2UXVA 2WO2B 3ZBMA 2PCYA 1N68A 1CURA 1A8ZA 3H56A 1L9PA 3ERXA 4HZ1A 5B7FA 1RZPA 4HCFA 5TK4A 3CVBA 3S8GB 5B7MA 1X9RA 4DP5X 4QKTA
chains in the Genus database with same CATH superfamily
4E9XA 2ZKYA 5C0CB 1TEFA 1KCVH 4ELKB 4Z7WB 3WHXB 1X9UA 2EEDA 1EJOH 1Y1UA 2BCKA 4DNLA 3BO8A 2NXZD 2D31A 3RWDA 3P3RA 4JGNA 4N2IA 4A39A 2MNWA 3FH5A 4FG6D 4DK6A 3QYCA 4G80A 3D2UA 2WQWA 3QDJE 4L0ZA 3S88L 5C0RL 3I6LD 1KTBA 3IPFA 2ESVB 3EFOA 1UZ8A 1VFOA 4LSSL 5CM1A 1N7ML 1AGBA 3FCGA 1CE6B 1IJ9A 3DV4A 4H8HA 5HHPB 4MCYB 4DKTA 4MQ7B 3PIQA 3MRJB 3PUUA 1JGLL 3KPOB 2KQNA 1CDCA 1QLEL 4GMTL 4TNEA 4TUUA 3Q01A 1A3LL 2AK1H 4JO5A 1GYVA 4IKJA 4WIQA 4YUEH 1RZKC 2YIHA 4KRLB 4LLQA 3QCVH 3MFFA 4J12A 3GSNL 5KYXA 3QQNA 4JM4L 3BKMH 3GZQA 3O9WC 3IAQA 4YZFF 5E2UH 1NLDL 2PW2B 3ZIMA 5E8EB 1C5CL 5FO9A 4K2UL 3N2JA 4M00A 1VFAA 2M83A 3NCEB 2VDRL 5LCVL 2HTLD 5JZ7D 2DPKA 4NWUL 2VLJD 3MBXH 1GKOA 3O4LD 4YHKL 2CHXA 1ZHKB 1PD6A 4YDLC 4TF4A 3KYMB 1D5XA 2P49B 1JNLH 3KS0H 1QFWH 5CZVL 2EH7H 3H6AA 2YAPA 2OSXA 4Y4KD 1TJHH 3ROLB 4F8QA 4KPHH 1AZUA 3L5XH 4YBLC 1GZQA 4PJCE 1Q0XL 3AG1B 3E9TA 2QV2A 3ZPDA 2ZXBA 2FEDC 3M17B 4PS4L 3U0WL 3E2HB 3IGAB 1A4KB 3KPTA 4FD0A 4UIKL 1P1ZA 5D96B 4LHUD 2GITA 2VLKE 3S36L 4U31A 3MCYA 3C8HA 3EH1A 2YEQA 1BFSA 1DBAL 3E8UH 3NA4A 4DWHA 4OCYH 5D1XC 1NEUA 5JA9A 1HQ4A 3KLAB 2OPCA 1MVUA 5KYWB 5GZOC 2Y72A 1X44A 2F53B 2CO7B 4GXVL 2E3VA 1PF3A 5DRZA 4FL4C 3MRKB 4NBXB 4OF0A 1BCIA 4GAJH 3WTUA 2JF1A 3WU1A 2OS7A 4Y16A 1OM3H 1JDCA 1XF4B 4PAZA 2QQKL 5BNXD 7PCYA 3QG7L 5F7EH 2I26N 5I1KH 1ZANH 1A9EA 1NL0H 4ES8A 3GBNH 4FXGC 4R26L 5HHXL 3LDBC 1YY9D 2R0ZL 3QPQC 5CD3A 4FFVD 3VXSD 5CMAA 2QLVB 4BFNA 4YX2H 3AC0A 3HB3B 1P7QA 1KCLA 1EO7A 2H41A 1I3RB 4LOUD 1IGML 4HKZA 4I13B 1KTCA 2YLHA 1JHLL 2VDKB 2Y5TA 4UM9A 5K1VA 4AK2A 1KB3A 3LVEA 5AD0A 4WI7A 4ZUUA 3V5KB 1NMCB 4TQEH 4I48B 5F1SA 4PJ6A 3WXWH 4BUGA 1FZOB 1FL6B 3IMUA 4G8FB 2PN5A 5D7KD 1MFEL 1DUZB 1ZSDB 1UWGL 4LRIC 3D9AH 4FQIH 4G2AA 3U82B 2N1TE 1JF5A 3AMKA 3C5ZC 2EC9U 1FYTE 1OIOA 2KQMA 4KUZH 2ENYA 1V7NL 5EH1A 2CO3A 4XNQB 3UYPB 5T33L 3KBEA 1P9MA 3L1OH 4PJFF 1TDQA 2XIBA 5DJ8B 4DW2L 4ZQKB 4TQHA 2R2HA 3SODB 5JXEA 3OKNA 4E9QA 5ISZE 1NMBL 1M7DA 4N6RB 2AJSH 2IWGA 3KH4A 4P2RD 2R2BB 4XPHL 1MPAH 1SN2A 1RHHB 3DX1A 3ZMRA 4R2GC 4BWUA 1I8MB 2VC2H 2WYZA 3CN4A 3RUGE 4OZ4A 4N90E 3IN0A 1I7TB 5IEHB 4BSWA 1BVNT 2WXOA 4DCQA 1HKLH 2FYVA 5ICYB 3L9BA 1HJBC 4P5MB 1HHKB 3L5JA 1N6UA 3A67H 3D85A 4LL4A 2DD8H 4NO0D 1NIAA 2BMKA 3MRRA 4BXSV 1A7NH 4LCWD 2XV0A 4PLJD 1EJ6A 4CSPA 2CU9A 4RMVA 4JN2A 1YC8A 1BQSA 3EO1B 2OTUA 3PLYA 4OM0L 4BUHA 5CKAA 4JKPH 3GXTA 5MEQB 1H0DA 2IQAA 5L4MA 1QNIA 1KY7A 3PDOB 1FYTB 5DUML 1NIFA 4HUCA 4I1RA 4TLSA 4PJ5B 4P59L 5JNYB 2FJGB 4PJ7A 1UH3A 2V8MA 3H42L 1XR9A 1AFVH 4M61B 1AZBA 2Q8BH 3FUFA 3B2XA 2A0LD 1RSFA 3CHPA 4RMRA 4RZCA 5DVPA 2D3NA 3F01A 1QEWB 1WBYA 1XF2B 4QXWA 4I3SL 4RFOH 3FYIB 3X1BA 4G59C 3NESA 4RGND 1J1OH 4NRXA 3WJJC 3C60C 1K2DB 4U3SA 5ALCH 5EBLA 1N18A 1NGQL 4B0MB 3KMDA 2VSKB 1E8ZA 4WEUD 3FFOA 3FJTA 3BPCB 2MCMA 4AGQA 4V2BA 5IMMA 4HGWA 4P57A 5IB3A 3FUDA 3GZKA 2XXMB 5LBVA 5DFTA 4P9HH 4X6FA 2J5LB 1G5GA 4NO2A 4Y9GA 4CDGC 4FQ1H 1X5IA 3F85A 3SHSA 3KBHE 3HE6B 5D9SA 4PRDB 1D2PA 3VXMB 2XN1A 1QX1A 2ARWA 3QQ9C 1X7SA 4E5XB 5HD8C 4PBDA 3ZHFA 2JLPA 3TA4D 3WFCL 5FK9B 1I1AB 3QUMB 3WE1A 3HKFA 4DVBA 1A3QA 3S88H 1WBZB 4UB0L 4BHUI 5C0RH 5CJBA 4BFBD 4OCLC 4KK6C 4LSSH 1JV5A 1N7MH 1FLRL 1R24A 3IJ8A 2A6KA 1G7JA 3SGKC 2CDEA 3QB7C 4ENEC 4N68A 1JGLH 2RD0A 2UZYA 2VRKA 1QLEH 4GMTH 4LCYB 3ZDYE 1W72B 3FRPB 4HIQA 2VW4A 4YSTA 4PJDA 4HVBA 1A3LH 5E08L 3TJHC 5FX3A 2X1OA 5LN8A 5F6IB 2R0LH 5CEZE 4F9PA 4Z3TA 1NEZG 3M6DA 3KVPA 3QAZC 5F72S 4EDWL 1QYGL 3LRLA 2JVUA 4PJIF 4JM4H 3H9HA 1FFTB 2ZT9C 3UAAA 1NLDH 2PO6B 1INDL 1C5CH 3GXIA 4K2UH 2D2OA 3O0RL 2K8QA 5LCVH 2VDRH 1NC4B 1OE2A 2VZ1A 2G9HB 4NWUH 3QRFM 4YHKH 3OKKA 5CZVH 2OJZL 2AV1B 2AP2A 2UYLB 3MOBH 2NY2B 3K6DA 5DJ6A 5DO2D 3RIFK 2MNUA 4NZRL 4H0LC 3ULVL 1QACA 3AUWB 3OAYH 1N10A 3WCYA 3GKZA 3GHPA 3GSVA 4UINL 2X4UA 2A6JB 1U3ZA 4XODA 5JDSB 3U0WH 4MDJA 3GEWB 2OMWB 5KYYB 1GHFL 3ULSA 2NW3A 5EUOF 2FX8L 3BYTA 1MI5D 3KPQA 4W6WB 4OIIL 4HOZA 4UIKH 2XWXA 1BYOA 3K8MA 5IB1B 2HG5A 3LXCA 4PRAA 4GB9A 4XVUD 3S36H 4DZ8A 3QQ4A 4D7PA 3F58L 2PTUA 3S35L 4MXQC 1K4DB 5HGAB 1DBAH 5HVGB 5IJKA 2HZHA 4NRYA 1XH3B 4Q9BA 4L5FE 3SE4A 2NXYD 4XPGL 1IGTA 3QHTC 3V4LA 3GXUB 4GFXA 3KYKL 3MXWH 2PR9A 1GSKA 1ETA1 3MA9L 3U0TA 3ZE1E 2L7QA 4GY4A 1REIA 3EGSA 1P2CB 3LXUX 1IM3D 4P4KC 4WU5B 3GRWA 3KG5A 3WS3B 2QQKH 3QDMD 4IIQB 3QDGD 1ODUA 1Z5LA 3FSAA 4A68A 3FOMB 4EUPB 4A2HA 1RJYB 1NSNL 5I18L 5KSBA 3N40F 4B5EA 3PWPB 3TJEL 5HHXH 2R0ZH 3GS7A 5CUSL 1ZA6A 4NBZB 1ZJBA 5DQJB 2HPTA 3UTQA 2Z6FA 2FLRT 1IGMH 3X3GL 2ZAIA 1JERA 3QFJA 4HHAA 3SOTA 2EACA 4A38A 1WHOA 3MR9A 1LWHA 2B3RA 4Q4EA 1BQHG 3N40P 1MJ8L 1Y6KR 2JJWA 5T1LD 2B3IA 4PJ7E 3GSOB 4PY8J 4ETQA 1MFEH 3RB7A 1KJ2A 4G5AA 3QUZD 1F0LA 3VXPA 2GK2A 2R2HB 1WH0A 4YFLF 3OKNB 3Q5TA 1NUFA 1U2YA 3BP6B 3AU0A 4HMDA 2X6AA 4MZ2A 1MCOL 1V7NH 3ZE1B 3KGRA 4EF3A 3VMPA 5T33H 4EI5B 1I53A 3RY6C 4Q97A 3CFDA 1YEIL 2ATKA 1NMBH 4YEFA 4DUWA 1R1CA 4KJPC 5AEAA 1ACYL 2PPDA 4Z7UA 1DEEA 1DJGA 1O9WA 1SUJA 2HRPL 4XPHH 5DHYA 5DWPA 1JXGA 2P52A 2SEBA 4L18A 5C07E 1N3NA 3QDJD 3M1OA 3N41F 2C9AA 4UANA 3I6GA 5CINL 4OLVL 5JUEH 1OD9A 4ZPTB 5ACZA 1TCMA 3U2IA 1H0DB 2Z3FA 1S9KC 5GJTH 5JOPE 2Y7SA 4L3FA 3VCLA 1YPZF 4NN6B 1YYCA 1VKXB 1OCWL 4RX4A 5AVXB 4OM0H 3UCQA 3MLSL 3U46B 5AVQB 2YSSA 5A2IH 1J0JA 1IGIL 4DERA 4AQAB 4B97A 5CEXB 5DUMH 2Z4QA 1IKNC 1AHWC 1JWSA 1IEAB 1ZIBA 2B4CC 3EG9A 4P59H 5FUZH 3GMNA 3H42H 1GZPB 1Y7VA 3I9AA 3L08A 5DFAA 1UT9A 3HE7A 1GOFA 4I3SH 1FFRA 1I1CA 2DIJA 2BIMA 4NAJA 5C07B 4J3UA 4PJDE 2XN0A 3G5XA 4I2XB 1BXVA 1LP9F 4P57B 1CQYA 1KLGA 1NGQH 1A1OB 5E1QA 1FN4A 1L9QA 1ZOXA 3F62A 5LHDA 4JFEB 2EIEA 2LOEA 3OXSA 4UTAA 1QLRA 4CVUA 5FKAB 2FAUA 3SKNA 3O6MH 1T0OA 4FLHA 3AAZA 5F9JA 4NZDA 4Z78A 2VKWA 5IQ9B 3LRSB 5FWQA 2GY7B 5BW7A 2VLKD 2X1QA 1SEBA 1OB1B 3BZ4B 4JFSA 4XOEA 2VERN 5J3HD 3WY4A 2H0EA 3D7PA 2GSIB 1KIUB 5DVNA 4XMXA 4CC0A 1MHCA 3UZVB 1R24B 5JHAA 5DYFA 3FUJA 5DD6B 4KDVA 1F4XL 5E24E 2NYZA 2A6KB 3WFCH 1ZIAA 4N9OB 3BVDB 4CGTA 3EFFA 4UB0H 4JKLA 3SDDC 1HCYA 1FLRH 2WP3T 2Q3XA 1XAKA 1RZKL 4J27A 2PPAA 2V2TB 4RVBA 5F1IB 4FABL 4PIBA 2EXYC 1U8MA 3L4XA 2J1XA 3MRFB 1IIKA 4KDWA 3LH9A 3DECA 5HJBA 3T0EC 2IALA 1AMYA 2Y7MA 3LNIA 1DEDA 1THCA 3DGCR 1KIPA 3PGDA 3V4PB 3UAJA 4IRJC 1INDH 4XO3A 2NY7H 4L1BA 3O0RH 3FZUC 2J43A 4BRVA 4L8CB 1GC1L 2GSGB 4C83B 2X2UA 2EYTB 3MRHB 2J1YA 3ZZSA 2V2XB 2OJZH 1ZV5A 3OLEA 2JB6A 2CHWA 4WNQA 4NZRH 1U6AL 3CC5A 3BUIA 3SDYL 3ULVH 3WDJA 3O6FC 2X40A 1XGQA 4D7BA 5ISZD 4OGZA 3L7FA 4UINH 3VXTB 5KSAD 3IDYB 5A2FA 2TRYA 4O2CA 2AMGA 1NCAL 1GHFH 1RH8A 4JK0D 3DUHA 5MEPA 3I50L 2FX8H 4IHOB 4N90D 3O4OB 4OIIH 5CGBA 3K46A 1U8PB 2LU3A 1IGTB 4MAZA 5I9QB 5I5RA 2J3SA 5JIIA 2YQ3A 4GQZA 3C5JB 4HCRL 3F58H 2NSMA 3CSYA 3HS0A 1LEGA 3S35H 3VA6A 4HIIA 5H4YA 1D5MA 4JQXA 1MY5A 1YHPA 5B3JE 1XMWA 2APSA 4RQQA 5K9OA 3BPNB 2VN5A 1MJJB 3GMRA 3PAUA 4XPGH 1UURA 1P84J 5FDWA 1OO2A 3VX1A 1OGTB 3KYKH 3O2VL 1U91A 4AH2A 4Z7UE 4JGMA 3MBWB 4QNPE 4O5LL 1P53A 1SHXA 1OE1A 2IH3B 3D2UD 12E8L 4RAUA 3TPKA 5BRQA 1CDGA 1KFGA 2UY6A 3ETBJ 4HU2A 2HUEA 1XBDA 2OM5A 1MHPL 1OQXA 2Q7AA 4QRUA 4UU9A 5IGXL 1C8PA 1NSNH 4N4YB 2FSEB 5I18H 3VGBA 4N2DA 3TJEH 1X7QB 1KCBA 5CUSH 4KRMB 3MV9B 3KPMB 4CUCA 4KK5D 1WP6A 4CSZA 3ARRA 4K8RC 1KN2L 5GRJL 4X9BA 2D0GA 2YLKA 3X3GH 2E7MA 1CFSA 1SY6H 5ADOL 3IXTB 4TUJA 1NGWA 1MJ8H 2EADA 4WHTB 3WTXA 2DYPB 2W9DL 1GVIA 2ICWJ 3QIUB 3EYOB 2AQ1A 1SMOA 3MTXA 4LLWB 1TQVA 1ZRUA 3R1GL 3TBTA 1MCOH 2XBZA 1UXSA 4Y2DB 3TJPA 5FIEA 4O2FA 2QQQA 2KMWA 4L1TA 5AW1B 1N3NB 2P44B 1DBML 1FZMA 1YEIH 4S1DC 3RI5K 4Q6IB 3I6GB 3B43A 4U7SA 2Y1VA 3ABLB 3ABZA 3KS0J 3QORC 4L0PB 2NR6A 2HRPH 2OL3L 1F6FB 3ETSA 1N8ZB 2LTQC 4GRWH 1MFNA 3EGXB 1X5YA 2DL2A 4RMSA 1DQKA 1HE8A 2WN3A 4H40A 4X6DB 4ZT1A 3WDIA 3GGWA 1B6DA 4OLVH 5CINH 3ZHDA 4WW2F 2DL9A 4PV1C 5KBKA 3ZIYA 2E4FA 2YSSB 1I8KA 2Z4QB 3DXAA 5HGDA 1R5IB 1MOEA 2PP9A 1J1XL 1OCWH 3JVFC 4EN2A 3MLSH 5ICXB 2G2RB 5JIHA 3S98A 4PYHA 4KNSA 1T4WA 1IGIH 2DWEA 5BMFL 1RL1A 5LUMA 1GTFA 4YDJA 4BFIA 3ISRA 2WQXA 3QG6B 2BVQB 4KJQC 4F57L 4Y16D 1BAFL 4EN3C 1P4LB 1I75A 2FT8A 2IC2A 3QQ3A 1FN4B 2N59A 4HS6A 4AY0A 1PY4A 3TBSA 3TWYA 3B2MA 2H2SD 5DK0B 3C2AL 5DJZB 5H37A 2R29A 3R06B 4K5MA 1H5BA 2P46B 2O6PA 1TSHA 4D94A 1P7QD 1WS8A 3C5SA 4KZ0A 3L3DA 1PZDA 4NZTL 2BSRB 3CIQA 4UM9D 1OAKL 4NC0B 3HNTL 5D1QE 5EBMA 4F5CA 5SWZA 3RY4A 1RK1B 3ZXAC 1NMAL 4G83A 1U9KA 5KVEH 3BH9B 4NFCA 1MIML 3X14B 1MHCB 4KI5C 5HYJB 4DK5A 4M7JL 3LPGA 4HC1A 4A7UA 4U1GB 2CLZA 3EO9L 3WIFA 4OGAD 4Y1AA 5D55A 4I9WE 4GNKB 4PJ9B 2CCVA 5I6LA 5JXED 2ITFA 4IJ3C 2GFBB 1E43A 4WCYL 3KLQA 5EIIG 3F7YA 3RJOA 4RMTA 4F8OA 1PJWA 1CYXA 1TT6A 5EU3A 5JPMB 2X2HA 2P5WB 2YPKA 4PREA 1Z5YD 4S1SL 2CJUL 4NC1C 2A77L 3QXUA 1TOXA 1UB5A 3QYNA 2EICA 3D85D 3WI9A 5CAYB 3V6BR 4FABH 1W6WA 1HINL 5D1QB 4JN1L 4IU3A 1F56A 1UCBL 4LNRA 5BQ7A 1T1WB 5IVXA 1YLBB 3BVTA 2QVIA 3JWNE 3MOQA 4X8JA 4U3HA 4WW2C 2HN7B 3HPJA 4FQXA 3ARPA 1AS6A 5FM5M 3RGVC 1OHQA 1U58A 3AS1A 3L3GB 4PGCB 2FT6A 2AEIT 4MQXD 1UD6A 3CC5B 4U1HB 2J1KA 4MSWA 3DARA 3SB3A 2LLLA 3QIWB 1UM4L 3UABA 3SQBA 3UEZA 3OHXA 2NDGA 3K72A 3DHJA 3HI6L 2H1PL 4J3OH 4IS6A 1MRDL 3MRMB 3SDYH 4PMEA 1SYVB 3Q7JA 3VH8B 4BM7A 2I25N 4AGPA 1QPPA 3OXRB 3QRLA 2JXMA 5E5MA 3QUHA 2FO4B 1WVZA 2Z91A 1OT2A 1DZ0A 1HXYA 1BEYL 4IRZA 1NCAH 2WMPA 3EJCA 3HS0B 3I50H 1D5MB 4EI0A 5IFJA 3DJSA 2G3MA 5DQ9A 5K9OB 3GMRB 1OW0A 1XGPA 2QQNL 1ML0A 4XNMA 1JRHI 3THML 1A66A 4DJMA 1SHSA 1TR7A 3DVFA 4I1PA 4HCRH 5FB8B 1DDHB 4ZMXA 1G9NL 3HG1B 3FBKA 1PKQA 3RPIB 4UQCA 5JOPD 2ARJA 3L2MA 3FB7B 4LCVA 5B3SB 1UT2A 1BW8A 2VDQB 2D03L 4JFQB 5T3ZL 3ARXA 2YGNA 5GS0D 4M7ZC 2QVKA 4O5LH 2OBGA 2NYYD 5J56B 5BVJB 12E8H 3HG5A 3A24A 3CFEA 3T1FB 1JZ8A 2VIRA 4G8GA 1XCTA 3H4FA 3UG4A 1MHPH 5IGXH 3DETC 1IGJB 3WTYA 3QDAA 2CPCA 4GT0A 2EDEA 1D6EB 1ZTXH 2H47C 2ZOWA 4QT5B 3DXAE 2PCPB 5B39B 5GRJH 1KN2H 3BEWA 4ZMQA 3MJ9L 1FNLA 3KPPB 5E2JA 3PJNA 1MW3A 4U1JA 5ADOH 1M6UA 1XD1A 3ARBA 3ECWA 3QNZA 4M6AA 3NRQA 3WNMA 3TBTB 5AL0A 1SEQL 3BYYA 3FSWA 1KJMA 2W9DH 4HMCA 2XNAB 2P8MA 3F7PC 1I9JL 3GM8A 2P5EA 4LVOB 3VYNA 1A6UL 5J06A 2K3TA 2LU4A 3CH1A 2YPVA 3KXFB 4I7ZC 1EXGA 4ORGA 2VLLA 2X4QB 4X80H 1SMAA 4YDVA 1QUPA 1DBMH 1OXYA 2V7HA 3TX4A 3S5LB 1CB4A 4M4PA 1S2EA 2XFGB 3TNNA 4PIRF 4N86A 2OL3H 1CFMA 2WNKA 2WNWA 2J25A 3II1A 4U6XB 5KBLA 3G5WA 4YHPB 1Y07A 4B3VA 4CJ0A 4F7MB 1RZIB 2D7NA 5C0GA 1I8KB 2JWYA 4F5CE 2CMRL 3LPWA 2JB5H 1H15A 2P24B 4UYPA 4R4BA 3EBHA 1WUZA 2OJEB 2PW1A 1JWUB 2WCPA 2B59B 3AS3A 3B8YA 3D52A 3D4YA 1KGXA 1R5VB 3EJZD 5ICZB 2Y7QB 3QI9B 1NKGA 5DDHA 5E8PA 1QLFB 4YDJB 2XTLA 4L23A 1JYNA 1KTLB 2GHWB 4KO9A 2B4CL 4DGWC 4R7XA 1T7WA 4Y1AE 5E9DA 1R3LB 3Q3GB 2QSTA 3N1FC 3RTQC 5TE4H 2C8NA 2H26B 2PXYA 4G9FA 2FJHB 2I07A 1KF9B 3TBSB 1U8KB 2EJ1A 2QZ5A 2X4NB 3IAPA 4F57H 1BAFH 3JV4A 1MF2H 3BZ5A 3VGGA 1S7TA 1EA9C 4JG5A 2XXGA 3EH4B 3ZLQC 4JDTL 2F5AL 3EXLA 2CKBA 1R75A 1EUTA 2GIMA 4AX3A 2AFNA 2X2YA 3C2AH 1MKFA 1D9KB 4ZW7A 2VL4A 2G3XA 1T2JA 4JG9A 4QKXB 5EFIB 5D2LF 1MCKA 3EDDA 4B9PA 5IVXE 3AWFA 4NZTH 4IBZA 3ZKND 4U1SB 5JMRA 1JF1A 3QFJD 1LD9A 3HNTH 4NZUL 4X0NA 1S9VA 5FYKL 1AQHA 1BZ8A 3C2SA 3MACL 1NMAH 2CLZB 3SDXB 2K0RA 1NKRA 3QZWB 3DMMC 3I6SA 5BZDB 3GS0A 2A7BA 1LL1A 1MIMH 4FKKA 2JTDA 3A6BL 4JBSA 4F7EB 1WTLA 2X5PA 3K7UA 2GJ6B 3AREB 4KJYB 3JWDL 3OKEB 3Q2CA 2FLMA 4M7JH 1PG7L 4ZO7A 4H8QA 5I8OL 1D5ZA 2R59A 3MJGX 4JPQA 1FRGL 1XIWC 1BJ1J 1YO4A 2FEEI 2YR3A 2E7LA 4XPTL 3BWUC 3V0IA 1UT1A 1YUHA 1QQDA 3BW9A 4PREB 3N85L 4OFKA 1A9VA 1A6AB 3AROA 3F7LA 4WCYH 1NCNA 3E6FA 4YSCA 1RU9L 3DA0A 3FCTA 2V0AA 1QHQA 4FFYA 2YBGA 4X8CA 4LNRB 4I0PA 4N24A 4S1SH 4UIMA 2CJUH 5BQ7B 2A77H 5DQDL 5KW9H 4X8JB 3V95A 4NM8L 5DR5L 1YQ2A 1PKQE 5J1AA 1HINH 1NBCA 2CNYA 4JFPB 5DVKA 4P46B 4JN1H 5IT2L 2X09A 3K6IA 1UCBH 2ATPA 3LZFL 4TV3A 4FAAB 3G5VB 4XB7A 4ONGL 3W3BA 3VFPA 2JKLA 4J3TA 3IJHB 5DS1A 5F7LB 5IREA 3VX0A 4JZOA 3BH8B 4XPFL 3ARDB 1CG9A 5I71C 3TH2T 3AS0A 1H8NA 1GA2A 1NCTA 4RSYA 3IWVA 2CLRA 4H8UA 1DJZA 2H3XC 4L3CA 3GS4A 4YHYB 3OGOE 4G8GE 4UTCA 2VDMB 5KZCB 1TQWA 3CUPA 5CLXA 1UM4H 4V33A 2WXNA 4JDVA 2B5IB 2CBTA 1XDTT 3HE7D 4YHML 3HI6H 1HXYB 2H1PH 3FBQA 4MB4A 4XP1H 3MV7A 1KCSL 1MRDH 4LSTL 4MCZA 4WTXA 5T3XH 1JMZA 3HNVL 4BFGA 4CMMA 1F86A 2XTJB 5CZXC 1P7KA 3CV5A 4J28A 3VU2A 3S4SG 3RWFB 4P2OC 3IDUA 3NAAH 3ILDA 4ZK8A 1BEYH 5B1AB 4OZFB 4WKZA 3QW9A 1DDTA 1PKQB 1M3JA 1RIUL 2RTTA 2V8LA 4GXFA 2QQNH 1IFHL 5E2VL 3NIFF 3THMH 4LSDA 1OAYL 2F58H 1A5FL 1FIGL 2P5EE 4NKIL 4TNVF 4XE5B 1E4KC 3WJLA 1G9NH 2NZ9C 2DKUA 3KLSA 3FQWA 1ZDQA 3AG4B 2ARJQ 4YSEA 3AT8A 2P45B 4Y4HC 1U92A 4HALA 2D03H 5T3ZH 1PFOA 1RZJC 5F89B 2A9BA 2DWTA 3TTSA 1XMEB 2F7QA 4JO8A 4YSSA 3HZKA 1INEL 2OSLB 4ZS6C 4R7LA 2HWZL 4URTB 3G7TA 4ICXA 3BEWB 5AW7B 1JE6A 3ZL2A 4CILA 4HCIA 3INOA 4OF8A 2BSBA 1UFGA 2OQJA 2IXQB 1F4HA 4FQ2H 1CL7I 1N2RB 5E9DE 4YBQC 4KTYA 1U30A 1BIIA 3LRHA 4GAYB 4Z7WF 5DEFB 1S78D 5IIEA 5IJVA 4U1MB 4Z3HA 1M53A 1PDKA 2WQ8A 2CO6A 3HHMA 4JFWA 1KPVB 3I75B 4MCMA 2DAVA 4NZ8A 3SBWA 4WEMB 1A6UH 2QEJA 4CN6A 3NIDB 2MTAA 3GNML 2DJUA 3S34L 4TXVB 4WV1A 2FHBA 3ESNA 3SGDI 3B2UC 2EIZB 3EJYD 3EJJX 1DN2A 2PYEA 4ISVA 4G7QB 1WFUA 3MVSA 1G1KA 4AVKA 2FECI 4I9WD 2C4XA 2IFGA 2HXAA 4M48L 4G5ZL 1UB6B 1UGNA 4L37A 3LNDA 5IG7B 4Y5VA 1E5AA 1CD1B 3UPRB 2MQ0A 1CZ8L 3F7VB 4IBQA 5E6RB 2ADJB 2CMRH 2LABA 4B96A 3JTSB 1FCCA 1PTZA 5T1MA 1CGUA 2B0SH 1WZAA 2XV3A 3OB8A 5F7DB 3WLBB 5L0QB 2WKOF 5B1JA 4K3DL 5IMOA 1PZCA 2ICEA 4YGAB 4XTRC 3P73A 2R27A 3GINA 1RZ8A 5IW6A 4XOAA 4WJG3 4XP4L 2OTWA 3JWOL 5C0IB 3VFTB 4DP0X 1LQSR 3KLHD 5I6XC 4CN4A 1CVRA 1SJXA 1DO6A 4K23L 4HP5A 4LB8A 1VZHA 5KS9E 3TONA 2WZPA 2R7EA 4IOIA 4KTDL 1K5NB 3X12A 5I1AB 1MCFA 3DKHA 4BK5A 1UJ3B 2VAAB 2I5YL 5GZNC 5IB5A 4NJ9H 1SLUA 4RAVB 4JDTH 5IHHA 2F5AH 4KMLB 3NPSB 2XY2A 4JANB 3ZY7A 4ZX4A 4BZ2L 4OFQA 4WU7B 5EU7C 3R19A 4FI8A 3GZOA 1S9VB 1E9OB 2GUOB 2X6BA 3D50A 2FJFB 4JLRA 1WZ1L 1U2CA 4V11A 3LNEA 2WYIA 1AH1A 2R4RL 3QR2A 4FEIA 4IMLA 1QVOB 1NDGA 1YYLL 4NZUH 3O3AA 4F8PA 5FYKH 5BZXA 5FOJA 4QYAA 3MACH 3MRGB 1CGSH 2XY1A 1JD7A 5BJTB 1RJLB 3HKZA 4P5KA 4HK3J 4GRMA 4K94C 1MXGA 3PUCA 2D8KA 1AOHA 1ZHNA 3WO4B 3AW5A 4NJAL 1KWGA 3RWJB 4HUMB 4HX1B 1X5HA 3A6BH 3CC1A 2ZX8A 3MRCB 3MRIA 4PWJA 1MCCA 5IWLC 3JWDH 3MA7B 1PG7H 5I8OH 1LMKA 4LPUA 3B9KC 4AOFA 4BKTC 5KS9B 3NK4A 3H54A 5FAAA 2WK2A 2BSEA 1FRGH 4NYLB 4XPTH 4UM8A 3ZSSA 1OGPA 1WQVT 3KYOA 1T1ZB 4G1MA 3O81A 3WN6A 3QFDB 1XB8A 5E8OB 1G7MB 3N85H 2NR6D 3WY3A 2IWFA 3WJMA 1DVFC 4MMYA 5JPNB 2CBQA 1PCXA 4I8DA 1PGRB 2W88A 4F58H 1UXWA 2VR9A 3P9LA 1AC0A 5DQDH 3U1PA 5J12C 3VA2C 3WEBA 4ORZC 4U6YB 5DR5H 3P3YA 4WLCA 1W80A 3SDCB 1DANT 5AZEH 1FGVH 4EPSA 1O7DC 5ALBL 2CPUA 5HDOA 4ZW5A 5BS0E 3DXAD 3LZFH 4ZUWA 5IT2H 3STZA 5LJYH 1OSZB 5G2NA 4ONGH 1P5UC 1TG8A 5D5MB 5F8RC 2GTWA 1H8LA 2BNUB 3SPVB 1JV2A 2BVOA 2SODB 4JAMB 4ONOA 4XPFH 1B2WL 2WCGA 4I9XA 32C2A 1TKWA 5JW4N 1KPUA 5E99H 5LAXB 2D0FA 1ITBB 4AQ1C 4FA7B 4FFTA 4IOSA 4JRLA 4FQHB 3KWWB 4MMZA 2J8OA 5AL8A 4U7MA 4X5LA 4YHMH 1PJ9A 2HLFD 1QATA 1JPGB 4LSTH 1SUHA 2IDTA 5EF2A 1C08B 2ADIA 2QKIC 1CXLA 2WLYA 2DYRB 1YRKA 1JZGA 4RSVA 4NNYA 3FT9A 1OCRB 4W9KC 3EO0B 3D06A 4LBEB 3C5XA 4TKWA 3PGFH 4Z77A 1RIUH 5BS0B 3TO4C 2FCBA 5HYQA 4XHJC 4K7PX 3DOIA 5SWZD 4PQXA 1IFHH 5E2VH 4GKNB 3JVGC 4JCMA 1OAYH 1A5FH 1FIGH 4NKIH 4X98B 3T09A 2ATAA 3H3BC 3NSCA 1MSPA 1CU4L 4HUVA 4MNQE 2ZF8A 4L8DA 4PH8A 4RA0C 2PYEE 3TZVC 1AGDA 1KBBA 4EJ1C 3BUTA 1BBJA 3HUJF 4QDGA 4P5TA 4Y1AD 2ZKHL 4Q89A 3K5RA 3K5SA 3DRQA 2V6HA 4WI3A 4AC4A 3ARYA 1INEH 2OQJB 3TASA 3ZX1A 4HDIA 2HWZH 4UILH 1JPEA 2M1KA 1L0XA 4G6AD 2O93L 1F97A 1XH0A 3P4NB 5IBUG 3MGTB 4D2NA 2R56L 4IRSA 1ZLVK 2H32B 4GMSL 4F1ZA 5IOPB 1SMDA 5EC1A 2E9WA 3W11C 5CGYD 2OCFD 1SOXA 3FDWA 3H7BB 4DKFL 4AM0A 4TPRL 5LGHL 4RA3A 4HIXL 2Y2WA 4E9RA 4HG4K 2IPUG 3R0MA 4FQXD 4F15B 4MNQB 4Y4FB 5I1LB 2DTML 5KVMC 2Z0UA 2WLKA 4ISVB 4ABVA 2NRDA 1CC3A 4AV5A 2YMTA 4B9IA 4RNRA 3S34H 4B9CA 4FYTA 1J88A 3HAEG 3O8XB 4NSKB 4BH8B 1KGIA 2FIKB 3BKYH 3MRDA 2BOLA 3DURB 3Q2LA 4TNFA 2BIQA 3QEUB 4HS3B 5EHFA 2Y6SC 1T1YA 4HKXB 4KXBA 4OJFL 5T1MB 4M48H 4QF1A 3EOBA 2FL5A 1WFNA 1W16A 4UMSA 2WINA 1SZNA 1SYSB 1T6BX 1JZ2A 4PJHA 1WT5A 1YDPB 1CGTA 5GGRB 1CZ8H 3OC8A 5B38G 4XZ4A 3HFML 4XNZB 3PFUA 4MB3A 4HW6A 4P2YA 4P2QA 4JFHD 4PJAF 4XI5C 3VI3F 2GJPA 5K9QI 1WIOA 4WSKA 4Z3IA 1CS6A 4WDIB 3AWEA 3TFKC 4FTDA 1A7PL 2NW2A 2PUQT 4J1UB 4MB5A 1F42A 1KT2A 2G75A 3JWOH 4XP4H 4YLQT 4JY6A 5AKRA 5FS5A 4QXVA 3X13B 3UIYA 3VXUB 4K23H 3GMQB 4PGBB 2HFEA 4ZZFA 3MUGA 3GIVA 1M05B 4JCLA 1MFDL 4RFNC 5L2KA 2XPGB 4G8GD 3FO1A 3LEXB 1ZK5A 4P06A 3VWKA 4WWNA 1MUJA 3VRIB 1KXTB 3FSVA 4GSUA 3WNPA 5E1HB 3W57A 3GSNA 3O3AB 4XCYB 3RFZC 1I9IL 1WZ1H 4Z7OF 4N1CA 3C6LC 1NBYA 2R4RH 5LCVA 4FERA 1N12A 1IE5A 4FG4A 4UBDD 5EF0A 2LQRA 1TTCA 2W07A 3ARBD 3IKKA 3KNBA 4YQXL 1ZT4A 2FZ3A 2EH8H 1T0NB 4M5YL 5C9JB 1Z3GL 1GY1A 4MD4B 3T6QC 5INDA 1EIBA 4QTHB 2X7LB 1KZYA 3C6SA 5HYEA 3EDEA 2P5ED 4NN5B 3VQ2C 2AQNA 2OA9A 5DJYB 4MMYB 4WTZG 1Q9OB 4ANKA 3WAJA 4YFDB 4FLSA 3ALXA 5HYSB 3IDIB 1ZLWK 5JW4M 4GI6A 4JM2B 3V7AG 1RZPA 3RTLA 1C7TA 4FQQB 4N6QA 5D70L 5IVZA 1CYGA 4Z3FA 1ECZA 5H35A 1EVTC 1NANI 2EKSA 2MSPA 1WJ3A 2XG4B 4ZUWB 5DUPL 1JTTA 3STZB 5IF0B 1F4AA 3HRZC 3LQZB 4CMHB 3ZDWA 3MOAL 3WN5A 2XG5A 1DBJH 4B27A 4WTWA 4QRSB 3TVMA 4XX1G 32C2B 3RDJA 3BFWA 3RL2A 5EU5B 2D3LA 1E5ZA 4XCNA 43C9B 2NCMA 4M93C 5E9DD 1QSVA 1UWXK 4J4PA 4F24A 3QNXB 5A7BA 2Q76A 2HVJB 4DKEH 1OGAB 4F93B 2PXYD 4QRPA 4G9FD 1VFBB 1YECL 4Y5YB 1Q94A 4S10A 4XAWL 3HJ0A 2BY2A 3OV6A 3HAEH 2AVGA 1CJYA 3LTVA 3C09C 4RZKA 4U1LB 5D7JC 5T1KB 5TE7L 3H9SB 1AR1D 4KH9A 4W4NA 1KIQA 2AZAA 1H8OA 2FHCA 1ZLWH 3MBEC 3CK0L 1K6QL 3MQIA 3VTMA 1W15A 2CA3A 1CK0L 4FGMA 2A2QT 5T5FL 3K0YA 2WXRA 4Z7VA 1E3FA 5CSGA 4AQEB 4KGLA 4LSUL 4HUVB 1T7ZA 3TNMB 3G6JF 1GGIL 4BE6A 3WNKA 2JJSC 3MGOB 2YD1A 1R3IL 4MS8C 1MCHA 4Y2LA 4X5QA 4P5TB 7CGTA 2DQUH 1GMIA 6TAAA 1CU4H 1YEDA 2B39A 2HLAA 4ZXBA 2WHVA 1UWXH 3NYKA 4L3EA 4AYBA 2UV3A 3MFGB 1IAII 5SV4A 1HOCA 3WENA 4BK8A 2NUPA 2CR3A 4XZUA 4H5SB 3TEZA 4WUKL 3T3ME 4DP4X 1J86A 1EV2E 2DMCA 4PJHE 1S7XA 5LGJB 1AI1L 1M42A 5EC1B 3VFMA 1JN6A 3CFQA 1NEZA 4GSDL 1RD6A 1J5DA 5EOTB 2DIBA 2R56H 4I0PD 2IOOA 3ES6B 4L9LB 2X12A 4GMSH 4KKCD 1T5KA 3RDTB 1ETZB 2G5UA 4G70B 2YBRB 1E28A 3EGDB 1KEML 2KDYA 4DKFH 4TPRH 5LGHH 5ACMA 4HIXH 4N1EA 4NQCB 4AM0Q 2QADB 2VMFA 2XVKA 5F1NB 2DTMH 1AS8A 2BNQA 4M8QA 3LB6D 1HL5A 2XIIA 3FQNB 3VFWB 4OFPA 4N85A 4X7FC 5L2KE 3GBEA 3HRPA 5AVWB 4B9KC 1T1YB 2W9EL 4RDQG 1U42A 1KYAA 4OJEH 4QF1B 4LLVA 3D34A 3K0WA 4AENA 3S3JA 4IK7A 2WINB 5CSBA 2VWEE 2L04A 2NUTA 3VFOB 5C0DB 3MV7D 4IBWA 3REVA 1CFTB 1RZQA 4N0FA 2GTZA 4OJFH 1FNFA 5GISL 4G43B 1JNNL 1I8LA 4PRNA 4KZDL 1UQSB 4J3WA 1NAMB 2V9TA 2NW2B 5EO9A 5CGMA 4K3HA 3HFMH 5C7ZA 1DQML 3HIZA 1E42A 1PU0A 3WHE1 1B6UA 1DQVA 4W4OC 3QULB 1QKZH 4FXKC 3ARGC 3RZCA 1A7PH 2HFEB 3G5ZB 4IHBA 2H45A 3B3IA 3P2DA 2ITDB 3MUGB 4LSPL 3GIVB 3OM3B 4JHVA 4Y5XB 5JOFA 3QUYA 3S7GA 2H3NA 3SDDD 3WHE0 1A6PA 1OAUL 5I66A 4JFDE 4EIGB 4LLMB 3Q8FA 4ZOBA 4U4IA 2G4GA 1X9LA 3T2QA 2IPTH 1MFDH 3ZYJA 4EVNA 2HFFB 3GSNB 4PJ8C 5HSFA 3VGHA 4U3CA 3N04A 5IHUL 4XNXH 3TTYA 3WDHA 4CADB 1N59B 5IUSA 1NDMA 4G7VL 1I9IH 1FG2A 1G43A 1ZT4B 3EYVA 3TCLB 1JBJA 2Y5EA 3DBXA 3I6KA 3TFBA 4R4FL 4XXDB 1VRSA 4QWWC 1OAJA 1OSPL 1RUML 1VADA 1D2OA 5D7EA 5CFAA 3ZKXB 1HZKA 1HYSD 1CIUA 2CRZA 1A9BB 1Z3GH 2LT9A 4AUUA 4M3JA 5EUKA 5AUMB 5CEYA 4GG6A 3CXHK 2BOBA 4H8PA 1Q9WA 1SJEA 4JFDB 1RIHH 3V6OA 5CJXC 1J1PL 2XZCL 4XMLL 1OP4A 1YNTF 3G04B 3WO3B 5ID0A 3KPSB 4HKBB 2PYED 2VL5A 3AY2A 3DGDA 3AGVA 5AYUL 3Q5YA 2V3EA 4MAYB 3P9MA 4P48A 1V8HA 3DC0A 2XXCB 4NXSA 4NDMB 2Q20A 2RAMA 3QC5X 5KVDL 3K1DA 1P6FA 4WK0B 5E95B 5A43C 2XG5B 2F08A 1AZVA 1OTSD 2ZYSA 1ZHLB 4JDEB 1T5WA 2J44A 1ADQL 5DUPH 2ILLA 4QRQA 3LHPL 2QSQA 3MOAH 1R5WB 4ZMAT 2JI3A 3CN2A 1HS6A 5AOMA 5B8CC 3B83A 1E8XA 2NDFA 4L3EE 3WLWD 1M2VA 5I74C 4JPSA 2C9VA 2APBA 4IDLA 4IOFD 2DWXA 4QHNB 5A2AA 3CFCL 2XZQH 2PTTB 4DQOH 3GMPB 2DLGA 5I76A 2IAMC 1D5BA 2WTOA 2WZPD 1GOGA 1YECH 4NENB 3STLA 4QOKE 1DANU 3OAUL 5TE7H 5D7IB 4MJIB 2QVFB 3QEHB 3CZLA 5B21A 2BIPA 2EXTA 2HRLA 5EU4A 3V5HA 3ZE0F 3UTSA 4A7GF 3T8XA 3CK0H 1K6QH 1ASOA 1I7RB 3OHMB 5EDXA 2EDOA 2JKXA 4L8SA 5JLZA 5T5FH 1JWMB 2XN9E 4LGRB 2EEBA 1EEZB 2FYYB 4JG1L 3DX9B 1AXSA 4LSUH 4WO4C 4B9FA 3E80A 4ZXBB 2DQFB 2PWGA 1FJ1B 4R7DA 1I8IB 2B1AL 2CDFA 2RFXA 1GGIH 2BHZA 3QIBA 5CFHA 2WJ5A 3QORD 4G6FB 2G5BB 3OJDA 5IFHL 5IKCA 5TH2B 1CTOA 3MRNB 1MCEA 3TC9A 5I5IA 2Y6TE 1DQLH 3FQ1A 1TTRA 4LHJB 5CP3H 4UF7C 3D6GA 4IK6A 4N5UA 5J89A 2R9HC 5DEJA 2BSED 5FHAL 2AQTA 1SGKA 4QOKB 5FA4A 4FI6A 3SCMC 1X6NA 1CDUA 1NEZB 1U93A 3GSWA 3O11B 2J6WA 2UZPA 4N25A 4WUKH 4UT6H 2QGDA 2H1LM 3FF8A 5IJCC 3P77B 2HJKA 3PXJA 1B3IA 3HCVA 1YN7B 5DGRA 4GSDH 4FP8H 2Q8AL 1K4CA 1IGYA 3CDGB 4W1TA 4YDZA 3ZL1A 1ZT1B 1O5DT 3GM0A 2XN9B 4AXWB 2VDKL 3AU1B 1PS3A 1J7VR 2AJZA 4WVRA 1ZJAA 1Q8MA 3QJQB 2GAZA 2VXTL 2VQ4A 2WV3A 3O3EB 4N2LA 3RNKB 1FE8H 4M8QB 1KEMH 5I0DA 5D1ZC 4KO7A 1HSAB 4QRTA 4X4YA 3FSOA 3U1QA 3V0HA 2EDXA 4FNQA 3HHSA 4HGKC 4M7LH 5C0BA 1QR1A 2HKAA 4F9LA 4QGYA 5IW1B 2O5XH 2WBJD 4PU2A 3A6CL 4LOFA 4YZWA 4X6CF 4IOSD 2UZXA 3BPOC 1G7QB 2GTZB 1E30A 2W9EH 5KYUA 2QTVA 3RVXD 1O9ZA 1ODAA 2WWKT 3O41B 1QBAA 4FNSA 2MFNA 4LP4A 1AQKL 1ETB1 3KL3A 3L81A 5D4JA 1O75A 4Q9QH 5LO7A 1T20B 4PJEF 1TYEB 4TN9A 4ZPVA 4OGYL 1X4ZA 3U6RA 4H0GA 2NY5L 5GISH 4OZHA 3CPLB 1JNNH 2Z8VC 4KZDH 3NFPB 1T7YA 3TIEB 4FADA 1KJ3L 2NCEA 3T04D 4GUPA 2Z0BA 4DIXA 4P23C 2MCAA 5ANMA 3ZW3A 3D87B 3VXNA 4XCEA 3SIKA 1U95A 4QXTA 3ULVE 5I66B 3ATEA 4GFTB 3V6OE 1QTPA 3O3UN 3WGVB 4LSPH 2DIEA 3HNSH 1IAOB 1OAUH 3T77B 2XXFA 1Z9OA 4L4VB 2ALAA 2P48B 2EZ0C 4ELDA 3TN0C 1KLUA 2ZG1A 1UEYA 1AS7A 2OXGB 2NNXA 1A7RH 1BQHB 3PP4L 4HWNA 5JORA 3QZLA 1PD0A 3VRJA 4G82A 1FFOA 3BP5B 3S6CA 4GW1A 4YL4A 5DI8A 1YEEH 3TESA 5IHUH 2R51A 5C09A 3L13A 3HHRB 4Z7IA 2VR6A 4IRSD 5F3FA 4JNXA 3BGFB 1HWGB 4IGBB 4G7VH 4HOMA 3FOLB 1XO8A 4PJGE 2F54B 5ESAA 3WEXB 1IAMA 3IJYB 3RWGA 3L4VA 2Y0SA 4R4FH 3MNZA 1Y6NR 5H94B 1RUMH 1OSPH 2Q0ZX 5J6HB 3VGEA 2FO8A 3LSOB 2R1YA 5I2IA 3KCWA 3BDBA 3QA3B 1ET7A 4FF9A 4FHBD 3X1NA 1RI8A 4DP9X 3EXJA 4KQ4L 1I8UA 2J55A 5ID0B 1FNGB 1U33A 4PCKA 5DVOA 3P9MB 3H3KA 3CX2A 3QXWA 4YHNA 1J1PH 4HISA 2XZCH 4XMLH 3MV8B 3FO0L 3FTWA 4Z76B 4NLHA 3UTSE 3QUML 4H13C 5C08A 1RHFA 4X0KB 1NOAA 2FATL 1A4JA 1S9WB 1XGYL 5AYUH 2IVFC 4HV8B 3FCBA 4GQQA 1H3UA 1TQTA 2UXVA 3VW3L 5F21B 5DGQA 2GBUA 1OAZL 4HCRA 3L3KB 4HSQA 4OLYL 5TGBB 3GTNA 1CTMA 2YUZA 3GJFA 2WANA 2UVEA 2ZSWA 1W72L 3PYCA 4OLXL 4YIQB 5BUAA 3JTTA 3FB8A 4PJGB 3LHPH 4P2QD 2VE6A 4OD2B 5DHEA 5KAQF 1X5KA 4L1LA 3GSRB 4HFUL 2DJ4A 1A21A 4YDKL 1VENA 2YAHA 4PGDB 4S0TD 2W81C 3NCWA 1FSKB 3EYSL 4GRWE 3SBPA 4YJZL 4MXVE 1M1XA 2Q6WA 3W5NA 3GMMA 4EI6A 2ID5A 4CU8A 2YAFA 4HG4J 3CFCH 4JFXA 5IOKA 5GGSY 1JUFB 1MIEL 1KN4L 1NJ9B 1XF1A 5EU4B 5TFSL 2CCLA 2N01B 3TYFA 4AZ8B 3GXPA 5KBPA 1U8OA 2IPKB 4FNLL 5L2KD 5H2BA 3OAUH 4W9IC 4HXBL 1F90L 4MQSB 3VWKD 1NCJA 4XN9A 3BVNA 3EJPA 1TFHA 3IMTA 4DGUA 2YARA 2YAEA 4EQ3A 3OGCB 1YSOA 3LEYL 3PV6A 1GYUA 4PCSA 2FVNA 2CDFB 2X1WL 3S37L 3OG6B 2AEQH 5BV7B 4MNGB 2NY4B 3UBXB 5CEZL 4JG1H 4EXPX 5KSVB 1VJSA 1W0VB 2ZUQC 4WWKB 4X9IA 1E9PA 4WTQA 5C0BE 3S0PA 3FN0L 2B1AH 1JZIA 4QHLB 1WA1X 1EZVY 1QSEB 4KTGA 3ASNB 5IFHH 3BJ91 5F9OL 1U93B 4PJXB 2MPAL 4R3SB 5HI4C 2OL3A 5EIIA 2Z31B 2A74C 3QGVA 4E5XG 2BIHA 4PVNA 5I8EA 5FCUL 3L8QA 2HJKB 3HC4L 5AOJA 3TBYB 3CQPA 3HCVB 1R3JA 4N22A 1B90A 4UOJA 5C86A 5AW5B 1F6AB 1S9XA 1UH4A 4YDIL 4OZHE 4BXVA 1HH9A 1GTNA 4R0LA 5TDPB 1FL3B 5IQOA 3BPLB 4ODWB 2KLRA 4OBSA 4URKA 3VNZA 2YGOA 2Q8AH 1S5HB 4QO1B 4A63A 2C3GA 3N43F 3VJ6A 3FRPG 1BYNA 4M8VA 2GI7A 1O5PA 2VDKH 2FX9L 4NUMA 3FUHA 3P4OA 3VRLE 2YRLA 2VXTH 4HFWB 2LLGA 3US0A 3HHSB 3SGJC 4AYGA 5CSZB 3TVMD 1KBGL 2OX5A 2H6PB 5B1CA 3NMEA 4J4PD 1ICTA 4QCIA 4OV6F 1GS7A 4QRPD 1FAIL 3UGEA 1G7PB 1UWEL 4F2MB 2AK4B 4EDXA 4MDRA 5L9DL 2WQUA 4R84A 5EU6A 3LOWA 3QQDB 4L8BA 5C09E 1RUPL 5DJCA 3HA0A 1U8IB 4ZAKC 2VERA 2EXWD 3HJEA 3LKQA 2W65B 3B4NA 1WPCA 1B3JA 1QPXA 1AZZC 4OFDA 2ZTBA 2GJRA 3LKRA 4OGYH 3IAGC 4U2ZA 2NY5H 4QXTB 5AW4B 1AHMA 5GPRA 1KJ3H 2OAAA 1SJVA 3BMVA 3OKMB 1GS8A 2Y1ZA 4O02H 4IBUA 5AOZA 2HVKA 2DQEL 4ZOEA 2LFEA 3UDWC 1CFQA 1OV8A 5I1DA 4ODSH 3ECUA 3ZTDC 4L3ED 5KSUA 1XZ0A 3KM1A 5IB2A 5C08E 4PJBB 4C8XA 1LHZA 7TAAA 1X3DA 2EDRA 4DZBA 3FU9A 3O9WB 4NQSA 1BLNA 2D4FA 3RJDA 4AVHA 4ETYA 2RA1A 1E4WL 4GBXA 1KYDA 1DQIA 2XVGA 3PP4H 4KKQA 2JK5A 4L3AA 4ZD3L 4EUPG 3WFHA 1KTDB 3MRPA 2WVTA 2BY3A 3DVNB 3CDZB 3D4CA 3PPEA 1FORL 1NFDA 4KK8C 4WI0B 4BFRA 4YDLB 4PB0L 3SE8L 2J71A 4HYTB 4K3GA 5A6MA 2AVFA 4NO3A 5I5JA 4HLEA 1QFUL 1T6VN 2NTSP 2CAKA 5CILL 3II3A 4NHUA 1BHGA 4MLIA 4P2CG 2EDHA 4YBLB 3TA3C 4R4ND 3UBFA 3IDMB 3CZSA 3UBXI 3SJVB 3T2NH 3N5AA 2X9YA 4DFIA 4LEEA 3DYMA 2FDBP 3E6HB 3LNGA 4E9VA 2ENQA 4OCSL 1EBAA 1WCBA 2NY0D 3ME0A 2NXZC 3EH5B 4KQ4H 2BNQD 2ZE0A 2I9TA 1F2QA 1URLA 3MLUL 5F70A 4FG6C 1MNNA 3CN3A 4JRXA 2B16A 4L48A 3QJTB 4NIYE 1QI4A 1TVHA 3FO0H 1KC5H 3IKCA 3QUMH 2OMXA 1OOAA 4PRBB 2FATH 3GJFB 1XGYH 4FL4B 4MA8L 3KLDA 5DJXA 5I5MA 2ZSWB 1N5AA 4L1HA 1AXIB 1ZV9A 2RH0A 3VW3H 4YZFE 2C34A 1OAZH 2Y3AA 2NZ9D 2VN3A 5ITFA 2X53A 4OLYH 2KS0A 3AY4C 1W72H 1IMHC 2E5EA 2IV8A 4FXGB 3RVWD 3LDBB 3Q1SH 2OW7A 1S7UA 4LF3B 5CHNB 5IESL 4NQVB 1GCYA 2YEVB 3J07A 4IKKA 4JFXB 4YDKH 1R17A 3RZCD 1KXHA 4ZS6D 1K3IA 2R1WB 3EYSH 2J1WA 4PVMA 4HK0B 2HTLC 5JZ7C 3V4PL 3NIDF 4KXCA 3QUYD 3KHOA 4Z7QF 2ZX6A 3OX8A 1JI1A 2I9LA 3TYFB 3LJ3A 5TTRA 3NUKA 4F37F 3JUZA 4PB9L 3OMNB 4NO5B 2K78A 4AEIL 4BWWA 1MIEH 4Y4KC 1KN4H 2GY5A 2MQ3A 5TFSH 4B5ZA 1QHPA 3BP7B 1M57B 1W9XA 3GB7A 1USZA 5DCCA 3C5ZB 1JG9A 3GSQB 3G5YB 4FNLH 4TQPA 3FQUA 4F8NA 1AGCB 4HXBH 1F90H 1MREL 5F9WC 3DIVA 2PWFA 5TE6L 2EE6A 4DO4A 2I69A 2VZ3A 4FCHA 3MZGB 2YHGA 3LEYH 3WSQL 2OMUA 5AW2B 2H8PA 4TULL 4APXB 3S37H 1RJCA 3IVKA 3WFZA 2V2WA 4R2GB 4PJIA 2IFFL 5CEZH 4KDTA 3LNHA 3TO2B 3FN0H 2W0FA 1A8JH 1DUYB 5HI3D 3T0BA 3STBA 4QJ4B 1JK9B 2XWJB 1Z9LA 5CWSA 4UAOC 4ZTOL 3ULVD 5EU6E 2MPAH 5E9AA 5CLYA 5MENA 1HSBA 4PTUB 3L4CA 1U3HA 5DUJA 3WXVL 5FCUH 4XC3L 2ED9A 3HC4H 5HYFA 5AW6B 2EDNA 3ZE2E 3DUSA 1YY9C 3LZQA 4FFVC 4XTRD 4EUPH 4OCXL 1IM9B 4YDIH 4AIOA 1I3GH 3HC0B 2VRQA 2ZOOA 2YOAA 3MX0B 4LOUC 1ZPLA 4PN6A 3TBWB 1BLIA 1JCKA 1Z6JT 3VI4F 2YUWA 2J2ZB 1BZ7B 4XPBL 5BQDA 3TBVA 4KKRA 1XXFC 5I0VA 4NKQB 2NY3D 3C60B 4NCDA 5DHVB 4C4BA 4Z5RB 2VNCA 5I1IH 3GRBA 2J8UA 3LKPA 3OKYA 1YUKB 1KBGH 1NBZA 4EIZC 4TVSa 2EYSB 2X70A 2FR4A 1I1FA 1FVDA 3CE1A 2CA4A 3CGTA 4Y1SA 1WE5A 3MRQA 4JX0A 1NGYA 1VSCA 4HSAC 3VXRB 1HCFX 5J0BA 3CVHL 3G6DH 3QEGL 3MNVA 1UWEH 3S4SA 2CGZA 4X8XA 3CXHJ 5CU5A 5L9DH 4PV8B 1J10A 2EIMB 2IDSA 1RUPH 3EHBB 4AJYV 3PWJB 5FYLL 1WZLA 4XNDA 2Z8RA 3UTSD 4ERSL 4ZFQA 1NCBL 2C26A 3BKJL 2D7QA 2WIMA 2EDFA 4MXWL 5C0EB 4PLJC 4HXAL 2ADGB 4WJ5B 5GSVB 5EWIL 1V7ML 3CWGA 2A38A 1AMXA 4XO8A 3V6FB 1JRHL 4PJFB 3DJTA 1NBVL 4CW1A 4HZLA 1OQOA 3GLAA 2DF3A 3NZUA 3QIBD 4LKCA 3D25B 1E4JA 3ZDXE 2DQEH 4JRXE 1KPRB 1DVFD 2BERA 5DHDA 4OU3A 5A3ID 3UL4A 1LLAA 4UV4L 3GHEL 4GBXB 3KBFA 4QRRA 3KAAA 5D7LE 2DOCA 3BQUA 3QAZB 5DMKA 2A0LC 5FHBH 3WFHB 2W95A 2GUYA 2ZP8A 5BUPA 2E74C 3T3PE 3BUYB 2X4RB 2EIJB 2A9DA 4XXCA 4RGNC 3S5YA 4NO3B 3R8BB 5FECA 5GS1A 4ZD3H 2BS9A 4BH7B 3CH8A 3QXAA 3V0JA 1VIWA 1U8NB 3EZJB 1FORH 2OMYB 3VD1A 1KEGL 1SFHA 2IH1B 2D7MA 3SE8H 2WLHA 5DRXA 1Q72L 3REWA 1MLCB 3NJNA 2FUQA 5T3ZE 1ZVNA 2WXLA 4AYFA 5HY9B 3SE3C 1CWVA 5E6IA 3ME0B 2E27L 2BY0A 1RZGB 4L4TA 4OGXL 4X5XA 3F00A 1FNHA 2I9TB 5IEKA 2GJZB 3BP4A 2GK0A 3DJRA 5F6HI 4OCSH 1E27A 2O61A 1OZUA 5C0BD 3RY5A 5D7LB 2WBWB 4Y7MA 3MLUH 4WWPA 1J9TA 3NJHA 3RLSA 1SBSH 1ZVSB 3NFSH 4N28A 5T5NF 4RAHA 1EO5A 1NWPA 4XMVA 1BVKA 4XMKL 4BINA 1LP9A 5ITFB 3UH8A 3TO4D 8CGTA 3AT0A 4MA8H 4XHJD 2R23A 5ENWB 1ZHBB 5I19L 4PJIE 3MLWL 3MROB 5F7FA 4YFEA 1JP5A 4P4KB 1JNJA 4ZO8A 1JNHA 3LV3A 3NJVA 5KN5B 4OUOA 4GO6B 1YZZA 3I85A 1H8SA 5E00B 1DJHA 1BIHA 1OK0A 3PHOB 1FL5A 2CUIA 1HN1A 4F92B 3OX8B 1CXHA 2WZAA 3FO9A 4IMKC 2VMDA 5IK3A 3ZBMA 5IESH 4PWHA 5CJ5A 5MENE 2DQCL 1RMFL 5A40E 4L29B 4KROD 5EPMB 1ONQA 3V4PH 1LWJA 5C0AA 3SDAA 3PQYA 4YN3A 2AQPA 1CCZA 3VWJA 5C70A 4JFZL 5DO2C 4AEIH 3RVTD 1CFNB 4B9GA 1MH5B 3M07A 2UY7A 2R4SL 3E1ZA 3AQXA 4X5RA 1R0AL 1L6ZA 2FH6A 1B4RA 3EADA 1KGJA 2XHNA 1MREH 5SWSA 3B3BA 5TE6H 2CRMA 4PJIB 1T89C 3CSFA 5C09D 1L0YA 3LNFA 5IMKB 3GXMA 3B9EA 3WSQH 4H2AA 4XVUC 1BG9A 3DVGB 4TULH 3UMTA 4YXLL 1MG2C 4ZDHA 5CNHA 3OD3A 4J3SA 2IFFH 3L3IB 2O72A 1TZHA 4NN7C 1L9NA 2BY1A 4JHBA 4NAQA 2NXYC 1DQQA 4FZ8L 1FZKA 4Y88A 4MX7B 4ZTEA 2IDCA 1OT4A 1JD9A 2CIIA 1N67A 3BEVB 3HZ3A 1HEHC 4J3OD 4HIHB 3HN8A 4LMQE 2VDQL 3GRWH 5EO0A 3NJGA 1FZJB 2D4DA 1I7UA 2FEEL 5EUOB 4PJCF 3NJMA 3VFGH 2H3KA 3WXVH 3CXDH 4P3DA 2P80A 4XC3H 5FYKE 3VMOA 5C08D 3FB5B 2PCFA 3LMJL 1UEMA 4LZKA 5CJQL 3SD2A 3WTWA 4HJ0D 1AHWB 4OCXH 4LKXB 1HQRB 3MYZA 8PAZA 4BE5A 4BFFA 1BF8A 5CCJA 2WB1A 3LH2L 5C6WH 4QYOA 1AP2A 5FC9A 3S96B 4WY7L 4XPBH 4F80A 1SXBA 5DRWA 3AVEA 4PS7A 4XOCA 1UD5A 3MJ8A 2QQLL 4KMQA 4A37A 4QRRE 3TYGL 3TL5A 4M1DL 1OLLA 2ZCLL 5AKSA 5IV2A 1THAA 2N7AA 1AJ7L 2FNWA 4ADGA 2XKNB 3N3EA 1QI5A 2UX6A 1ZT7B 1N19A 3HI1A 2HFGL 1NBQA 1NGZB 3FKUS 4HUUB 3UTSB 2VXVH 2H4EA 2VDLB 3BC9A 3R8QA 4BZ2A 4YS4A 3T0EE 4PSRA 3QEGH 2IGFL 3IGFA 4LPCA 2ZCZA 4JPKL 2WWNA 4MWFA 4NGHL 1T0PB 2YXWA 3AQYA 3POCA 4R5XA 2EVFA 2BSCA 4R8WH 1FNSL 3VH8G 4NQDD 4OF7A 4AZUA 3S35X 3HS9A 1S7VA 4QJ3B 5TK2A 1KIRA 1VPOL 3T8MA 5E94A 3BUPA 3T4AC 5HBBA 3GYRA 3LKOB 1PLCA 4ERSH 4EXKA 1NCBH 3IF1B 2ZXWB 4CW1B 1XFPA 3BKJH 4L4TE 3RNQA 4E0RB 4MXWH 1TVDA 4HXAH 3NZ8A 2CR0A 5EWIH 3CHSA 3K6SA 1V7MH 3FF7A 5I26A 5J6GA 1RFDL 4W68A 3TV8A 3OG4B 1UADC 1JRHH 4GRLA 2ALWA 1NBVH 4OM1H 4GIAA 2C3XA 4GP4B 4K0OA 2EDDA 4HEMA 2ADFL 1U8JB 1OEZW 3HS8A 3T4YA 4ODUB 4NQUA 1FH5L 4UV4H 3GHEH 3N41B 4G11A 1LP9E 3K4DA 1BFOA 4C56A 3T0EB 4I87A 3UP1A 4MFHA 4ODXB 1BV8A 3DPBB 1P69B 1G0YR 4IRJB 3SOBL 3SEPA 1YPZB 5GGSA 1HT6A 1QRNB 2BPBA 3FTGA 3F6JA 4UTAH 1KEGH 2BWDA 1Y1DA 3G08A 4PRIB 4ZMPA 1OY3B 1KXVC 2XV6B 4Z0XA 4N8UA 1MN4A 5CBEB 2BSSB 2IBGA 4KC3B 5B39G 5IEKB 2CDGA 1CL7L 1R3KB 2GK0B 4X4KA 4IBSA 3LD8C 3O6FB 2KDGA 2FQFA 1L3WA 5F7HA 15C8H 2E27H 3BN9D 5C0AE 4OGXH 1I31A 5J3HC 1MEXL 3O6LL 2IDFA 3PQYE 5TDOA 1NCWL 3D39A 4CC4C 3OKOB 4TTGA 3HAEA 2PLTA 1Z66A 2RB8A 1NUNB 2H6OA 3ATBA 1KYUA 1AZRA 1JPFA 3K3QA 2BW5A 3FQTB 1LDSA 1O0VA 5SWSE 1JTOA 5DHMC 5EU6D 2FECL 4YO0B 1PIFA 4N9GB 2AKRB 4XMKH 5GHWL 3S5LG 2AXFA 4G6KL 1XB6A 4ONHA 5B38A 3TIDB 4QY8B 1FL5B 1TTFA 3SKOA 3IFPB 5I19H 3MLWH 2YA0A 2JCCB 1RJZB 4K3EL 1SLXA 1YMHA 4U05A 4HPOL 2X6MA 2XZZA 4LU5L 4D9RE 5F44A 4Q2ZA 1SHMA 3WNJA 4QHUA 3TCTA 5L7XH 3PXLA 2DQCH 3GK8L 4C47A 2K6ZA 3CZKA 1RMFH 1B9KA 3KH3A 1DL7H 4XN8A 3PRZA 5DSCB 1GZHC 1FDLL 5B22A 4AIEA 3DX6A 2NOYA 5HGHA 2J6EL 1JZ5A 2ZAGA 1T6WA 1H3WM 1ZVYA 4HHGA 4JFZH 4KK9D 5D93C 5E8NB 4IEFA 2LU7A 2XETA 3RHWF 4AQ8A 2ZG2A 1IVLA 3VGFA 2R4SH 4G3YL 4YL9A 4G42A 2AQSA 1R0AH 1QAWA 43CAB 4F3FA 5KSAC 4JPIB 1OPOA 4CVZB 1BSIA 3ZDYF 2CRYA 5DFWH 4CAGA 1DCLA 1K9TA 2ERJB 4TSBL 1YVLA 3SPJA 2BHYA 4YSOA 3BWAB 1S7WA 4LEOA 3OR6B 4YFLI 2E6PA 5HHMB 2NNCA 1QFHA 2DWDB 3MCKB 5TQ0H 3A3YB 4YXLH 2MHAB 1RZFL 5HI5D 3SPGA 2IADA 2VUKA 3FCUB 4XO5A 6PCYA 3JWNH 2H0JA 3QZWG 1TF4A 2MRYA 3RURA 1ZA3B 4GAFB 4WEBL 4WTZA 4K55A 3OL2A 4H8WH 4IKIA 4W9ZA 5I15L 2DYSB 3CBRA 5KTEL 1GPOL 2VDQH 4IM8A 1CLZL 1B0RA 3D33A 4Z1PA 1HESA 1GRWA 4JRXD 5G4MA 4I4WB 3SY6A 1EXUA 1F11B 3CFIC 1TQCC 4ZX5A 3OKDA 1NFAA 4D0BA 5FO7B 1GCFA 3RPKA 3WIIL 4FTVA 1M71B 3WOVA 3LMJH 5CJQH 2VR7A 4G1EB 4JO3H 1RURL 3V8OA 3ARGD 2P8PA 3HR5A 2DWYA 4KK5C 2VUYA 3SE9L 4EN3B 4GUCA 4AK1A 3ABGA 4JY4B 3MLYL 5LKNA 1QWNA 1C12B 2AZUA 4HEME 3CSPA 3SPIA 2CJ3A 2D3JA 5I75C 3KPLA 1TYJA 5FO2A 3IDGA 2HAZA 5T3ZD 1OF0A 2QQLH 3QH3A 3TYGH 1HZHL 2GIXA 4M1DH 4AEFA 4C56E 4KHTL 2NQ3A 4GUQA 1VA9A 2FJSA 3WS6A 1AJ7H 4NFBA 3BHBA 1KTKE 4P9ML 2HFGH 1S3RA 1MG3C 3CLWA 4UQ2B 4QEGA 2IJ0C 2FB4L 2ICCA 1WZKA 4I18A 4V1DB 2ZF9A 3NRFA 3RX7A 4WHYG 3TPUB 2JFCA 3FW6A 4LCIL 4LFHD 2BRQA 2IGFH 4N8PA 1SF3A 2NY1D 3S3BB 1EFXB 4JPKH 4NGHH 2XIDA 2E8ZA 3FFDB 2XWBA 3GT6A 2WVVB 5E2WL 2GHZA 2F9BT 1FNSH 3MNWA 1NZRA 4OB5L 3MYJA 1F8TL 4NRZB 3Q43A 2C3VB 3JV0A 4FG0A 3MMEB 4AKOA 1R4XA 4OZFG 4IJ3B 1MWAB 5JXAL 2ZXQA 5TQ2L 1RFDH 1OF2A 1E3ZA 1I1YA 3T6XA 1HH6B 2OYMA 3BIKA 5A6IA 2ADFH 3CNKA 3QXTA 3L95B 1FNEB 5IBUB 2C7UA 3V0VA 4NERA 4Y16C 1P5VB 5JW5B 5MEND 3FFCD 2MQCA 1IBDA 5KG9A 4LLUB 1U3HD 2E56A 4WW2B 3L3HB 2ICWI 1T4KA 3CXFA 5EZJA 5H37H 2W8CA 4FNUA 3RGVB 4CL7A 3B2VL 3PHQA 4ZZKA 2H2SC 1PLGL 1WV7T 2GVYA 3NN8A 3S97C 1YEWA 3SOBH 4ATWA 4XP5L 3HZMA 4KH2A 4CSTA 4QTIH 1KNOB 5D2NA 3CZUB 4HUWB 3FH8A 3NSFA 1W6LA 2AITA 1G6RB 1KY6A 3PWVB 2RR3A 1YJDH 1UVQB 4QI3A 4GKLA 2FD6H 5C0JB 1AD9B 1S7SB 1SVCP 1ACZA 2V4LA 1AIFB 2EECA 1MEXH 3O6LH 3VDBA 1NCWH 2WLIA 4PI0A 1CXKA 1S7QB 4NM4H 2AXGB 1P9MC 4DP2X 3MTRA 4OGAC 3ZMNA 4Z3JA 3B7TA 3HN3A 5BO1L 4BKLB 5JXEC 3LQAL 1TFPA 3BAWA 1IQDB 2GT9B 3QNYA 3UZEA 3SGDH 2AERT 3FTVA 5FA3B 3HR6A 2Y2TA 4BDVA 3RB5A 2QR0B 4PJDF 1QUNB 3V4VB 3V5DB 5T5FA 3D3VB 1DE4B 5EULV 4D0CA 2FQDA 3CDYA 2J7LA 5DD1H 2V7NA 5GHWH 1EJFA 1YMHB 4G6KH 5DVMA 3S37X 4JZJA 4TVPL 1E4KA 5D2LA 5FEBA 5FYKD 1F00I 2Q3AA 1F4YL 4M7ZB 3UTTE 3DROA 4JO2L 1LEKB 1YEHL 4K3EH 1M7XA 2OTPA 4HPOH 3W0WA 1SQMA 4HIEB 4AIZA 1PZUB 1NGXA 1PY9A 3FU0A 2X4OA 4LARL 3RU8L 5CP3A 5C92A 1PKOA 1W0WA 1A3RL 4H88L 4PG9B 4JFFA 1LEIB 4I77L 1PLAA 1TYRA 2GABA 4RWYH 4IDJH 3LN4B 4BQBA 3GK8H 3V7AE 4MQXC 4WFFE 1HXKA 5AYTA 2J8HA 4QRRD 4K4KA 3F3HA 2OXHA 2EO7A 3BQUD 1A7OL 4ZW6A 4KX9A 1FDLH 4FTVE 2VDMH 2J6EH 1ZE3C 2MCG1 3ZVVA 3GMLA 1XTMA 3CVBA 2AEWA 2X3AA 2XOTA 4WHYH 3NTCL 1NLBH 5LG6A 4JE4B 1A1NB 4RFEA 2QMKA 4EKXA 3DV6A 4JFYA 2NY6D 4G3YH 2KZ1B 3QUXA 4XX1E 4RMWA 5I1EH 5D1ZD 3FH7A 3UTTB 3BCDA 3ARZA 3RX8A 3JTBA 4F33A 4H25B 3L2LA 4TSBH 2W94A 4D9QE 2CXGA 2H0FA 3UERA 1MFVA 2IO5A 4OZFH 5CCKL 4RH4A 3VFVA 4KMTL 2EIKB 4OZGF 4DESA 3U79A 4MA1C 1EX0A 1RZFH 5E6ID 3VD7A 4L4TD 5IHZB 3S2AA 5MI0C 4R83A 2WOBA 1AGEB 4UQ3A 2ETWA 1DVZA 4A2MA 5BPPA 3NCXA 4WEBH 4XWGH 2EE3A 1Q0YL 2ZICA 4BSJA 4F7TA 5I15H 5KSBF 9CGTA 2FBOJ 1GPOH 3L5WB 1K8DA 1CLZH 1UUSA 2NYYC 2JQAA 3VE0B 3DX8A 4JRYB 4ODVL 2JIXA 3HR5B 4XWOD 1EMTH 4XN4A 2ICES 3WIIH 4L0YA 2Q87A 3RTQB 2WB7A 1QWUA 4OJAA 4OCWL 1RURH 1YMMA 4BFEA 5GRUH 2ZOLA 1K5WA 4N5ED 4U1NA 3SE9H 3P4MA 1C1EL 1KZQA 2FUTA 4JHUA 4M43L 3BGMA 3BAIA 3MLYH 4F9PC 3QS3A 4NQXB 5DZOA 5JW4R 1CICA 1CLOL 2K6WA 4Z8FL 5B3JF 5I17A 4N26A 2WM0A 5DEGB 5K9QG 1ULVA 2AGJL 3GSUA 1W8EA 2CCWA 1FFPA 1WISA 1IC5H 2E59A 1HZHH 1DVYA 3KDMA 4Z7UF 3S8FB 4OD3H 2XACC 4QNPF 3QVAA 1WWBX 2WZ5A 3FAXA 2VMJA 3LH8A 3NIGF 3NJLA 4WF7A 5C0AD 1PNDA 7PAZA 3SDAD 2Y9RT 4P9MH 3PQYD 3I74A 2R0KL 5BRPA 4HJGA 1JDDA 3VWJD 1BMWA 2VTFA 4OT1L 4ZO9A 3OR7A 3DMMB 4LCIH 4YMPA 3Q8CA 4X6CE 1BZOA 2EDLA 5DRNA 5D2NE 3UJJL 3DTUB 4PTTB 1TXKA 4HT1H 5E2WH 5FKPA 5SWSD 3GUTA 3H0TB 1F8TH 3RG1C 1XIWB 5DJAA 4JVPA 4YNYA 1IVTA 5C0CA 4ELMB 5F7KC 3EJZC 5CLZA 3ZOAA 4WW1B 1C5DB 5I1HL 5TPWH 3HBZA 1IQWL 3B9KA 4ELKA 4Z7WA 1FP5A 3WHXA 5JXAH 1E4XI 5IJKC 1WIUA 2RIKA 2DI7A 3SE4C 3ULUF 1V27A 3QJVB 1Z1WA 3I02B 3P0YL 5IQMA 1TJMA 2HSIA 3MUY1 1YNKL 3HC2A 1T5XB 1MCIA 5EZJB 4D9RD 3O3DB 5LN4A 2F7RA 1CIDA 4PRHA 1MVFA 4YC2C 1INQB 1CE6A 1J18A 1IAIL 1UENA 4DUVA 3GPSA 5HHPA 2RQEA 4MCYA 4MQ7A 2WWOA 5D2LE 3MRJA 4FXTA 3KPOA 2X2IA 4POZD 4X6CB 1CYWA 1GR7A 2BLFA 2P80D 1MCJA 4DVRL 5I71B 3B2VH 3PAVA 1AQDA 1WWAX 1ADQA 1PLGH 3NEEA 3PNWB 1X5AA 2YKKA 4LDLB 4IBVA 1G9HA 1LILA 2QPSA 4XP5H 4AYSA 2F74B 2AJUL 2VRAA 3EYUL 1O6SB 3W0WE 4ANWA 4BQCA 1JXDA 3VD4A 2EVIA 3GKWL 3ZKNC 1M56B 3FONB 2YMOA 2PW2A 4JFFE 5E8EA 2BSDA 2BFGA 5AYQA 2XWEA 2IH9A 3GLDA 2K7QA 3FU7B 3IGLA 5DZJA 4M6NL 2QSVA 2VZTA 4HQQL 4N0YH 1JHTA 4P2OB 1T3FB 1E7UA 1ZHKA 1EJ8A 2ZXEB 3FQ2A 5FGCE 3KYMA 4CNIB 1G1CA 5EBGA 2Q1EA 3H2WA 3O6KH 4O4YL 3TF7C 4XBGB 4PEEA 3ROLA 5IHLB 3GO1L 4NB7A 3SKJL 3FQXB 3OWEA 3BAYA 3PGCB 4Z7NF 2VXQL 3TBCA 3DTXB 4E9TA 3LQAH 3M17A 3PREA 4ACPA 4E36A 3IGAA 5D2LB 4U33A 1A4KA 4PI2A 2YA2A 1S6NA 4M7KL 3VM5A 4Q9CA 3DROB 1LNUB 3DBSA 5FW8A 4Y4HB 4TVPH 2LAGB 2WNXA 1F4YH