4HALA

Multicopper oxidase cueo mutant e506i
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHIDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Multicopper Oxidase CueO mutant E506I
rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4halA03
3FT0A 1PNCA 1IUZA 1TU2A 4P5SA 4HCFA 2CUAA 2YAOA 5AKRA 4RH4A 3IN2A 9PCYA 3AG3B 3CZUB 3FU7A 2HRGA 1J5DA 2R7EA 1QNIA 3HEIB 3NSYA 4BDVB 4YL4A 3N2JA 1E5YA 4FAAB 4E9RA 3WKPA 2DWTA 2EILB 2JXMA 3NP4A 2H3XC 2IDSA 1XB8A 1JVOA 2B08A 1JXGA 4G72B 2GC4C 3HB3B 4AX3A 3PPSA 2UXVA 3FS9A 3QJVB 4GY4A 3X2QB 3ABGA 6PAZA 2YXWA 1ILSA 2TSBA 3X1BA 1JZGA 2DWSA 1ZDQA 5I26A 2BZCA 1A4CA 3WI9A 4DP9X 2XV2A 2YXVA 3EH5B 1EZLA 1OCCB 3PAVA 4UANA 1WA1X 1QHQA 3CVBA 2FWLB 1BXUA 3DKHA 1OE1A 1NIDA 2PPCA 2XX0A 1AZBA 1HAUA 1PAZA 3OMNB 1BQ5A 4HALA 5EHFA 1T5KA 3X1FA 1NICA 5B7EA 1PY0A 2VW7A 1JVLA 1PZCA 2XLLA 5I6OA 4PAZA 2BP8A 4G71B 4KOCA 3TASA 1IBZA 3NJKA 4HIPA 3TBBA 2Q5BA 1PLBA 2HX8A 3FU9A 1FA4A 4DP6X 2HX7A 3OQRA 2Y69B 2TSAA 3GXUB 1TEGA 1CURA 4P5RA 3CG8A 4E9XA 5D4IA 5IY5B 1J9RA 2BWDA 4BDVA 4A66A 2PPAA 1N68A 1XB6A 1RKRA 2B3IA 2GBAA 2IDUA 4WTQA 1JXDA 1RZQA 1PMYA 4WKXA 1AZNA 2VM4A 1NZRA 1PLCA 2FT6A 4GXFA 5B3SB 3DIVA 2HZHA 3PAZA 2EIMB 1SHWA 1JERA 4E9WA 1AOZA 1OCZB 1CYWA 1OV8A 1L9RA 2VSMB 4DP8X 1SFHA 2FTAA 2BW5A 3PAUA 4BXSV 4G7QB 1VLXA 3NJNA 2I7OA 4KO9A 2UX7A 3QJSB 2BWIA 1AG6A 4YVNA 3S3CB 1L9TA 1NWOA 2J5WA 3WG7B 3FPYA 1A8ZA 4YSUA 2VW6A 1N70A 2PPEA 3AG4B 4A2FA 3L45A 3ZX1A 1X9RA 2CCWA 1AQ8A 1XB3A 3MBWB 3NP3A 4Q89A 1PCSA 1FFTB 1ZDSA 1TKWA 3CVCA 1KCBA 1NPJA 1PLAA 3QQXA 4GP4B 1ET5A 1XMEB 3CDZB 1IBYA 4DPAX 5PAZA 4A67A 1OCOB 3OMIB 3V9EA 3WNIA 4YSEA 2X87A 1AZCA 3FSVA 1CUOA 3NT0A 7PCYA 2AZUA 2XXFA 1E5ZA 2XX1A 3TU6A 1EHKB 4MFHA 1JXFA 3H4HA 3TA4D 4Q8BA 1PNDA 3FQYA 2AFNA 1ZIAA 2UXFA 2BZ7A 5AZUA 2AANA 2UX6A 1SF5A 5ANHA 2CJ3A 3UABA 4X4KA 1BYPA 3D12B 4E9SA 3IE9A 4KO5A 4YSQA 4YSTA 1OOWA 1W6LA 3FSAA 1KYAA 3V9CA 3S8GB 3T6XA 2YARA 4BXVA 2IH9A 3IBOA 1L9OA 1GY2A 1NIAA 5I5JA 1ID2A 3AZUA 4AKPA 5FC9A 4BWTA 3N55A 2PLTA 5I28A 3KW7A 1OCRB 2WSDA 3CDZA 1R1CA 3WNJA 2YAHA 2W8CA 3X1NA 1NIEA 3FYEB 5A7EA 2FNWA 1V10A 2XV0A 4GYBA 1AAJA 3FSWA 5F7BA 1J9QA 2QT6A 1FWXA 3ASOB 3PLYA 4KO6A 4DPBX 3JTBA 5I6LA 3OM3B 5I6MA 1IC0A 2VMJA 2J55A 2BP0B 1ZIBA 2HLEB 4YSOA 1MDAA 4W1TA 2W88A 2BW4A 2IDTA 3QJRB 3GYRA 3T71A 1NINA 4YSAA 4M4RB 4NAJA 1KV7A 4JHUA 5I6KA 1ASQA 3UAEA 1AANA 2XUWA 1GYCA 2MTAA 3QPKA 3IN0A 5I6PA 3ZIYA 5F7AA 3NJIA 2YAPA 1NWPA 3ZBMA 1SFDA 2E86A 2YAQA 3QJTB 4KO7A 2PPFA 3FU8A 5B1BB 5LDUA 2YAFA 4E9TA 2CBPA 2OV0A 1WAEA 2PCFA 3T6VA 1IKOP 3JT2A 2IWEA 1WS8A 4F2FA 1KDJA 3H56A 3QJQB 4YSPA 3BVDB 5I6NA 1L9QA 2BP0A 1JZFA 5B1JA 3ZDWA 5AFAA 2XU9A 3NSFA 1MZYA 2QDVA 2FT8A 4HCGA 1E67A 1ILUA 2EIJB 1B3IA 1E65A 2XVBA 4FA7B 1PZAA 1MG3C 2YAEA 1W8EA 3EH3B 2EINB 1MZZA 3X1GA 7PAZA 1DZ0A 1YLBB 1JZHA 4HZ1A 1SDDB 1KBVA 5B1JC 1SF3A 1JOIA 1QLEB 4ENZA 2I7SA 4G7RB 4G7SB 3NJGA 4KNTA 1A65A 4YVUA 3SQRA 3GDCA 5B7FA 1SHXA 2PP7A 2CALA 1OE3A 4JHVA 4TXVB 2YQBA 2CAKA 1V54B 2LLNA 3WKQA 4K9JA 4N4YB 2GC7C 1BQKA 2OCCB 3FQ1A 1PZBA 2ZONA 3S8FB 5TK2A 3DTUB 3ABKB 2FT7A 2J57A 2HX9A 4GP8B 2DYSB 4W9ZA 5E9NA 4A2GA 4QLWA 1F56A 2GHZA 4A2DA 1OF0A 1ZV2A 2DYRB 3FYIB 4HHWA 5D4HA 2AZAA 1AG0A 2QDWA 3UACA 1CYXA 2NRDA 2MRYA 1BXVA 4HAKA 4DP0X 1NIFA 3ABMB 1J9SA 2XWZA 4PCYA 3OD3A 4A2EA 1AACA 1A4BA 2RACA 1RCYA 3NJMA 8PAZA 1AZRA 1JZIA 4G70B 1CC3A 3ERXA 3TBCA 2H5UA 3NJLA 3NYKA 1BYOA 2Y1AA 3WIAA 1WA0X 1E30A 2VW4A 3NJHA 1GR7A 1ETJA 2ZWNA 3SBRA 1SDDA 2PP8A 4ZK8A 1NDTA 2IWFA 1J5CA 1AZUA 4UF7C 2GIMA 5PCYA 1AS6A 4HHGA 4KNUA 3OMAB 4JKNA 3UGEA 1WS7A 3G5WA 4AI7A 1M57B 3NSCA 3S3DB 4DP2X 2FQGA 1I53A 3SBPA 2FQEA 3AG2B 1KDIA 2HXAA 4BWWA 1RZPA 2PP9A 2PPDA 1M56B 2YAMA 4NERA 3S3BB 2X88A 2FQDA 1X9UA 1TEFA 1ET8A 2VN3A 1KGYE 3ASNB 3FSZA 4AZUA 2IDQA 1URIA 2EIKB 5B1AB 1AIZA 3RYMA 2P80D 2UXGA 3UAAA 1V55B 1ET7A 1NPNA 4DP7X 1AS8A 5I5IA 1SJMA 3T6ZA 3T9WA 1AS7A 2H47C 4E9QA 5TK4A 3NJJA 1M9WA 1W6WA 4YSSA 4YSDA 3EHBB 2J56A 4KNSA 2GSMB 1HAWA 2IWKA 1BQRA 2QPDB 3EH4B 4EF3A 3FQ2A 3MX0B 1AR1B 3FPXA 4BK5C 3T6WA 2JFCA 1BXAA 4AKQA 4NB7A 4E9VA 2GI0A 1JZJA 2FQFA 1ASPA 2IAAC 1DYZA 4A2HA 4DP1X 5B7MA 2BHFA 1BEXA 4HCIA 1A4AA 4GP5B 1KBWA 4E9YA 3AY2A 1BAWA 3U25A 3KW8A 1ZPUA 2PCYA 1HFUA 2A3TA 4QKTA 3SBQA 1GS6X 3PXLA 2JKWA 4KOBA 2XXGA 1NTDA 1GW0A 1L9SA 1A3ZA 2DV6A 2P80A 2WO3B 2UXTA 2XYBA 3FU7B 1OE2A 2R7EB 2XV3A 3CVDA 1J9TA 3NJFA 4N8UA 2IH8A 6PCYA 3IEAA 3NSDA 4M3HA 1GY1A 1ADWA 1L9PA 2ZOOA 2AVFA 4YSCA 5B1KA 1PF3A 5D4JA 3AW5A 4BWUA 3X1EA 2WO2B 1SNRA 3ABLB 1KCWA 1ASOA 2BO0A 1GS8A 2FJSA 4DP5X 3EF4A 2OJ1A 4AKOA 1NIBA 2ZXWB 1WA2X 3H4FA 2IDFA 4L0PB 1MG2C 2VM3A 2VSKB 4UAHA 2GB2A 4DPCX 2HRHA 2N0MA 2I85A 2DY2A 1JZEA 2QPEB 1GSKA 1GS7A 2BP8B 3AG1B 3UADA 4CSZA 4YSRA 2Q9OA 3PCYA 4CSPA 4DP4X 3BQVA 4A68A 4F2EA 1UATA 3QJUB 4F7KA 3C75A 5I5MA
chains in the Genus database with same CATH superfamily
2HA1A 5DJZB 1MVUB 3OMZA 3ISYA 3FH7A 1PX8A 4PJXB 1B88A 4PJGB 2C7FA 1E40A 4GOSA 3RDJA 4RH4A 3QUML 2EEXA 4LAQH 2VLRD 4CC1A 3DUHA 3QDJE 1E5YA 5DHDA 2SODB 4JGMA 4JRYE 4UOZA 1LL1A 3EH1A 2B08A 1TVDA 4OJYA 1A7NH 2BH0A 3AADB 2P7TB 2C7UB 4FQXB 4O5LL 2BSSB 4JDZB 2TSBA 4OFPA 1EXUB 1IGYA 2OMVA 1DN0B 1G7MA 4Q56A 4WU7A 1TEYA 3EO9H 3VRIA 4NFDA 4JO3H 5I1KL 3OMNB 1O6TA 5F88A 2YGNA 4K23L 2EE3A 3OB0K 1UACL 3D39D 4I0KA 1BAGA 3MRNA 1T0MB 3PWPE 3UPRB 2YBRB 4BEIA 3KH4A 4R2GB 2GK0B 2GAZB 2TRHA 3GBNL 3P0VL 3DHMA 1Y1UA 2JTDA 3DSFL 4PRDB 4RMTA 5CCHE 4G43B 3EW3B 1IIIA 2R69L 3K81A 4Q58C 4BUHA 1AQHA 4F33A 4X5WB 4H26B 4LPTA 5D72L 2D7MA 2IH1B 2WKGA 3BKYH 4PTTB 4CC4C 3K72A 1CURA 4LKCA 2WMPB 3RE0A 4FQ1L 1Y0LA 2WQVA 1KN2H 3EDKA 4FZ8L 2YD3A 1BFVH 2PW1B 1G7QB 1J9RA 1ZT4A 2PTUA 1IV8A 2BOLA 1K6QH 3I85A 3UTPD 2D8KA 3B9EA 1NANI 1N68A 2Q86B 1SVBA 1H3PL 3FOMB 4FA6A 5IW1A 3G5VB 3QW9A 4KJQC 4HJGA 1E5UI 1NBVH 4RETB 3TZVB 5EG6C 1VFAB 4QO1A 4ZXBB 3SKOB 1RPUA 1UGKA 1MRFH 2GUOA 3H55A 3FQRA 1D5BA 3D7PA 1QX1A 3W37A 4HXAH 1E28A 1TJIH 2MQGA 1I8LA 3VXQB 3OAYH 1ECZA 5IK3A 5EC2B 2CUIA 4NRXA 4FLOA 4EI0A 4X80H 2E27H 2E9WA 4GKNB 4G6KH 1GHFL 4EN3D 1WBZA 3AXHA 2X3CA 5EU4A 4PWEA 1RK1B 5T1KD 3TEUA 1K4CA 2Z91B 1AQDA 5ID1B 4HF5H 4MAYD 4ODVH 4K94L 1JPFA 1XSJA 3UAJC 5AOMA 4I3RH 1VESA 3A6OA 3GMPB 1ITCA 4HW6A 2ZXAA 2NLJB 5BS0A 2DQTH 3UMNA 3O9WD 3P9MA 1MAJA 1MFEH 3VWKB 4G2AA 2CJTA 2OK0H 3SDCA 1JZ4A 2MCG1 2AJZB 3P4NA 5JW4N 5JDSA 3FAXA 1OANA 5BMFL 1ZT7B 4KVCH 1PCSA 5DJ2A 3T6QC 5A2BA 4FOMA 3RX7A 3FQUA 4WLCA 5EUKA 4D3CL 1S7RA 5B8CA 4J28A 2RIKA 1BOGA 1DQQB 3LCYA 4WWID 4PRHA 4D9LL 4F2MA 2ED8A 5FYKD 5JIQA 4PJFF 1L6XA 3EADA 2VN6A 5PAZA 3AABA 4L1LA 3U4EA 5F1SA 2FSEA 2Y06L 5TH2A 1QBMH 1VENA 3U30B 3FUFA 3VXRE 5ID0B 3LKOA 1PFCA 1TZGH 1I9EA 1F6FB 2A0LC 4CMHB 4X8XA 2IF7A 3PWNB 4OZIB 2ZAGA 3A24A 1NEZG 1FF5A 4Z7OF 2ZKHL 3PQYD 2NNAA 5A40E 3LQZA 4IRZH 1WWAX 4P59H 2X4TA 5AW6B 5E8OB 1FZJA 3HR5B 1P4IL 3QEQE 1KCKA 2Y24A 1ZHBB 5HTSA 4E9SA 3BP6B 4N87A 1FL6A 1GYVA 3W0WA 4JFDD 1X5JA 3ZQWA 2R8SL 3QR1A 3FSAA 3SCMD 4W6WB 2OTUA 1PU0A 4HT1L 4NUPA 4Q7DA 5K59F 3BGFC 4MYWB 1QLRB 5AW9B 4B9FA 3WNKA 4XNZC 5T1MA 3E2HB 5FC9A 1Q0XH 3KW7A 5IEHB 1XGYH 5GS0L 4X4YA 4EKJA 2V2XA 3BUQA 1KJ2A 3IDGB 4RZCA 5BJTA 2IANB 1GZPA 1NCUA 4MD5A 2APWA 3FTVA 5JXED 3SJVA 5D7IF 4GRWB 4NN5C 3GK8L 3GSOB 3CC5A 3NCYP 4H20L 4PWJA 4KHXL 1VGKB 5I6MA 4G9FB 3ARGB 2Z9TA 4K55A 2ZXCA 4NZTH 5IIEB 3RWIA 1EDQA 4BZ2L 3O8XD 1ETB1 5BZWB 4UV7H 2HUHA 4ZFZA 2WCPA 1QI5A 4YDLC 5A43C 4LFHD 3N40P 5C0FB 1CVRA 4CMMA 1MUJA 2EE2A 3RX9A 3P4MA 1NBYB 2BPBA 4LDEB 3D30A 4CAGA 4DGWC 4ODBD 5DT1H 1YG9A 3OBAA 2ETWA 3W9EB 3O3AB 4M1GL 1QI3A 1H6EA 4KDTC 4ZOBA 3W1ZA 1S7SA 4JUSA 3P3YA 1KJMA 1J0YA 3NJIA 5F93C 3HPJA 4M6ML 4XPBH 1A7OL 2AGJH 4MMYA 3TBWB 4W68A 3ECUA 5LDUA 1ORSA 4IDJL 3ZHLA 3FCGA 5IBUB 2APFA 1I31A 3LSOA 5C0BE 5FDWB 3QPXH 5AB1A 4PY7A 2ED7A 4TULH 3D39A 3OG4B 4XNYH 3UO8B 5M7QA 5H35B 1KDJA 2F74A 3L4WA 4NPYB 4DZBB 2O30A 2N3JA 3DX6A 1OAZL 4ZX6A 4FCAA 4OD3L 1P6FA 4YSPA 2G9HB 3GFUA 3MJ6A 2H6PA 2JCCE 1WC7A 4P46C 5SX5K 4TVPD 3HBQA 1PZ5A 4V1DA 2KZ1B 1X5FA 3C12A 3DJSA 1IAII 3GLZA 5AG9A 4WTXA 4OI7A 4O2CA 5CJOH 5LO7A 1FAKT 5DXWA 4HUCA 1UWXH 4NQCD 5DQ9B 5FYLL 3ZXAC 3IFPB 1IC5L 1WE5A 2NNXA 3GXFA 4F8TA 1A66A 4HCGA 1TTBA 3IK2A 4WHCA 4EZJA 3HUJE 2OCJA 5D7LD 1QSVA 3L9RA 3MCKB 4KQ3L 1FSKC 5ABDE 1TTAA 3IGFA 5M95B 4PMEA 2E6PA 2F9BT 1J8HE 2A4EA 3BFOA 4HIXH 1ZT1A 3ZE1F 1U91B 3VXMA 4KY1H 1H0DB 2G3XA 4M3KB 1M6UA 1WCQA 1XXDC 2KZKA 2ZF9A 5GGSY 2BNUB 2CBOA 4KI5C 3SQRA 5M94B 5KVEE 2EE0A 3FOLA 3TNNA 3QQDA 3L1OL 4EN3A 4QCIB 3MOAH 4K9JA 5J06A 1NBQA 5T1KA 4OZFH 12E8L 3JWNC 3VYPA 4MAYA 2CLRA 3MLSL 4CADA 3M86A 1RIHL 1DO6A 5DLML 1A7QH 3RTQC 4QRPB 3RILA 5JYLA 2ZE0A 4JFOA 3ULVD 1JN6A 1MJUL 3C2SA 1F4WH 3LIZA 4KJQD 1MJJA 5F96L 1I9RH 3LKPB 5JIIA 3O9WA 3MRIA 4IKKA 2XZCL 4DP0X 1E4KC 1S7VB 1G9HA 4Z3GA 3SDAB 3W2DL 1L9MA 3KPNB 2EZ0C 2CJUH 1KFAL 2R1YA 1WCBB 1RCYA 3UJJH 1CIDA 1E4XH 5MEPA 3DECA 3MYZA 3IGAA 3FRPG 1KYDA 4ICWA 4FZEH 2KC0A 2EUZA 4MA8L 2NYYC 1MFVA 2WM0A 1BYOA 4KMTH 4JPQA 1WICA 1WA0X 5BOJA 2L7UA 1ZHKA 1LO3L 2ZKMX 4JZOA 3H9SD 4YEEA 1QOKA 1Z5HA 2ITEA 2ZWNA 2YKLL 5C86A 2CA3A 4QRSB 5DJXA 3F2LA 1DBMH 3GHEH 4GUPA 1HVXA 3UAJD 4LGPB 1MWOA 4XVJH 1ZV5A 4N68A 2YUWA 4Y16C 5HHPB 1HKLL 4D8PA 4NJ9H 4Y1TA 5K9KB 3QQNA 1KDIA 2HXAA 1NOFA 3PQYA 4N0UB 3VGBA 3CFKB 3CQQA 2G2RA 2B20A 3N50A 3OAZK 4L05A 3FTGB 3O11A 4JN2B 4NNXB 4NN7C 3UTSD 4LLMB 1MFMA 5E51A 5IOPB 3MRKB 3UZVA 1P4LB 1QRNE 3CD4A 2EYRA 2HKFH 3GMLB 4JFDA 1VEPA 4R7XA 4AM0Q 3SCMA 1LO4H 3VJ6B 5C0ND 2XTJC 3KYKL 1KLFB 4E9QA 1NM4A 3KGSA 3R7RA 1R24A 5E70A 2V17H 2A0LD 2DLHA 5G4OA 3D6GA 4CVWA 5LGHL 2XG4B 1N6QH 2IWKA 5IQ9B 3IDXL 1ZE3H 4NO5B 1BQRA 4LQFH 2BY2A 2VN5A 2C1PA 4XC1L 2P4AB 3OLEA 1MCOH 4UUJB 1I1AB 3WS6C 2NTFA 3D0VB 5I71C 2EEFA 3PWJB 5JXEA 3H7BB 2CR6A 3PUUA 1LE9A 2CK2A 5B7MA 1RK0B 1IBGL 5E8DH 1J05B 2EXTA 4RFNB 1XIWA 1OPGL 3SO3B 1FO0B 2ZOKB 3AY2A 4J8QA 4KKPA 4U1NB 1EBAA 4DGVL 4LSQH 1HCZA 3SZKC 5JNYA 4AM0A 4Z7WB 3ULUH 3WTVA 3MRGA 4JRYB 5LBSL 3O8XA 4XNUH 4WO4C 4X50A 3SBQA 5KG9B 4FEMA 4XPGL 3LPOA 5LCVL 4OCXH 4Y9CA 4KGJA 4Y88A 2WZPD 2BRRH 3TJEH 1MAKA 1QW9A 4HIHB 4PS4L 2XYBA 1VFOA 2BVQB 3FT2A 4OGXH 4AV4A 2XV3A 3TYFB 3APFA 1DL7H 1FBIL 1DSFH 4G6ML 2JXMB 4DEPB 4ZMLA 3NSDA 2PR4L 4B95C 4EPSA 1OZTG 4MD4A 3Q3GB 2K6ZA 5GGSB 2WXJA 5GRUH 4YXHL 1CDUA 3AW5A 4LLYB 4BKTC 1S7QA 5C9KA 3AAZB 3PWPB 2NR6C 4CJ1A 5TE4H 4MJID 1JXKA 5INCA 2VDLH 2OJ1A 5F7KC 4PJCB 2OMXB 2ZXWB 1D7BA 1YMMB 3N5AA 3UC2A 1GGBL 2IDFA 4PRPB 4R7DA 1Z9SA 3RX8A 4A2MA 4BQCA 1QFWM 2F7PA 3H1ZA 2C9XA 2EH7L 4GAGH 4GFTB 4UQ3A 1VDGA 5E6RB 5IGXL 2HT2C 5I5RA 3D48R 1AXSA 3MODH 3V9FA 2RR3A 3RP1A 1ONQB 2VN7A 2C9SA 5LG6A 3GMRB 4M7ZB 4PPTA 5ICXA 5LWYL 5CSGA 4I5BB 2APTA 4PB9H 2C4FU 3CZJA 4L5FL 5BCAA 2V37A 2XN1A 4R97C 3QDAA 3SYQA 1PNCA 2CO3A 4P5SA 2L7EA 5JIKA 1NAMH 4FYSA 4AYDC 4XCEB 4Y5XC 3NSXA 3PY9A 5AG8A 3RX5A 3BJ91 1HL5A 4MTMA 2HRGA 4R4FL 4OD2A 2Y3NA 5JQ6L 5D7LA 4BDVB 2AP2A 4WF7A 4UINH 3VCLB 3S35X 4NQDE 3RFZB 2QL1A 3MVSA 4FTVA 3WCYA 4W9DC 3KDPB 3P30H 3D25A 5I26A 4G82A 4CN4A 3FQTB 5FUZL 4J3BA 3NCBB 2MOGA 3GBLA 1MHCB 2A6KB 3QO1B 4FKHA 3DRQB 4P46D 3X11B 3KPLA 1KY7A 5TDNB 3N0AA 4UANA 3H54A 5KBDA 1NGXA 1FYTE 2NXZB 3CVBA 3W3BA 5BZDB 4A7GA 3CCHB 3CNKA 4N2FA 3HG0A 3QFJD 5CLWA 4X7DC 5GRJL 1GKOA 4KRNA 4W93A 4HWUA 3G6AA 3MLWL 4OIIL 3V5DB 3ZKMC 3MLXH 2H1PL 4P2QD 2YA1A 3DPBA 4H4NA 4PLNC 3HC0A 4OV5B 3LNEA 1QYGH 2V9UA 3IDIB 4HUUA 4J3OF 4P9ML 5GGQH 5IW3A 3F5WA 2HX8A 4WWKD 3BT2H 1EJOH 1G7HA 3WDIA 5DFVC 4NQEA 2Y69B 3MLUH 4PJDA 5K33A 1MRDL 1TEGA 2NCEA 3V6ZB 2XWRA 4Y7MA 2H0PA 4E41B 2FHBA 4FMFA 3EAKA 4NDMB 1FL5B 3CH1B 2EVGA 1G6RH 5I24A 5FA4B 3V5KB 4P49A 2ADIB 1FZMB 2B1HH 3VXRB 4KZDH 4L0YA 1UOLA 4ODHL 4PW9A 1CS6A 3LDBC 4TQIA 2ZUQB 5EUOA 1T2QH 3UAJA 4OFKA 3ZDXB 2D7PA 3RTQD 4NP4L 4LSPH 4ZFOL 4LOUC 2X0WA 1N26A 4LNRB 3WL9B 1RL1A 4HHAB 4P9HC 1N0LA 1CDHA 1O9WA 2EZ0D 1RZKL 3WFDH 3EOYG 4JQVC 3WTSA 1NLBL 2GYSA 3UTSA 3BUPA 1U3ZA 2OR8A 2XTLA 3L5JA 4MDRA 3ZIMA 3FONA 4UQBA 2J1WA 1KBKA 4AYFB 4Y4FB 3BAEL 2B5IC 4Y2DC 3BSHA 4ZO7A 5TPWL 1OLZA 4S2SB 5DO2C 5BZZA 1U6AL 1MNUL 3FN3A 5T3ZE 4UDTA 1UT1A 3DOSA 2X5PA 4JN1H 2KH2B 4GEIA 1WBYA 1GGUA 2OW6A 3AQXA 3DXAB 4YSUA 1AH1A 1RY7B 4K3JH 4F7EA 4KDWA 2X4QB 3MJGX 4XH2A 3ZRFC 4Y16D 1GH7A 4LPWA 4C47A 3HBPA 1MFCL 2CLVB 1BSIA 2N01B 1YJDC 1KC5L 2XSKA 1OGTA 4U6TA 4UM8B 5JPNB 3LAFA 3D2UD 4PRIE 1WZAA 1L5GB 4RX4D 3ULUC 1G9NC 4YSEA 2NCMA 4M5YH 3BIBX 3RWCB 3UTZB 2VMCA 4N2HA 2XXFA 3OKOA 2PWGA 1YEGL 2XTJD 1KPVB 1DFBL 2R2EA 1UASA 3MC0A 5BVJB 4N0RA 4ZX3A 3RL2A 5C6TL 1SOXA 4HJ0D 2C9AA 2R0LH 1PNDA 3ISRA 1CZ8H 4ODSL 1ZIAA 5EEUA 2WZPA 2UX6A 2Z92B 3A6BL 3ILPA 3NZUA 4QY8A 3QYNA 4MQXC 5E08H 1PW3A 1X4XA 2VJ0A 3GDBA 4JKMA 4OSUH 1UHVA 3P0YL 1JZ6A 1BVZA 4HIIB 3PWVB 4PS7A 2MNWA 5C0BB 3OAYK 1FE8L 4KX7A 5EU6D 2OL3A 3RGHA 4PJAE 3VFRA 3MBWA 3RVWC 2XBZA 5DJYA 1SRDA 4OCYL 1QBLH 4PBDA 3M88A 2VL5A 5IW6B 2BY0A 1MELA 2G0KA 2XACC 4G6JH 5FW6A 2JCCB 2QEJA 2CXKA 1VADB 4WO4D 5HDWA 1F6AA 4IYKA 2NXYB 4UQ2A 1Q9LA 1N8ZB 5GIRA 3M1BB 1DQMH 2A99A 4WFHE 4XXDA 1YEFL 2XWTB 4XX1G 4G83A 2UZYA 5F7BA 3WAJA 3ASOB 4JFEA 3JTBA 5I30H 4KDTA 2QTEA 5KJ4A 2PYEE 5SV3A 5D8JH 4B96A 4RFOH 3VGFA 4D0CA 2LE9A 1IRAY 3HG1D 1J8HB 1LEKA 3DX8A 1SJXA 2WZ6A 5ESAB 4Z3FA 2NR6D 3REVA 1E4WL 1WZLA 3W5NA 4M29A 1U8OB 5J12B 3VSTA 1TYEB 3RZCA 4I77L 3I9GL 2YC1A 1A6UL 5E4OA 1UGNA 3JUYA 1WLHA 5I16B 4PSPA 4FYQA 4LLDB 4HGWA 4PJ5B 4MD0A 1JDCA 3VD2A 4KXBA 1DANT 1HINH 1IB5A 5DMKA 1MY5A 4P46A 3Q6FA 5MENE 1RULH 2E86A 1E8WA 4I7ZC 1UD8A 4FL4C 3VI3E 1T0NB 1YQVH 3FU8A 4Z78B 3CX5K 4AGMA 3WUWB 3E0GA 3Q43A 3SD2A 3EBHA 1WAEA 1GOHA 5ETUA 4IBLT 3QFJA 5T1DL 2MFNA 1WQVT 3ETSA 1N12A 5HPMA 4OT1H 3BKJL 3B2DC 1JDDA 1RIVH 1XHHA 2IDCA 3SE6A 4ZMVA 4L18A 4P2QA 2EEBA 2J3SA 4ODWA 3ZK0A 2B0SH 5GRWA 3RB5A 2DD8H 4PWHA 4M43L 5AKVA 4GQRA 3ZDYF 1WRFA 4OFYD 3FF7A 3MNVA 1T20B 3MV11 3U83A 5DQJA 4FG6C 4GKOA 1KTBA 2BIIA 5HVGB 4ODTH 3K8MA 4U1LA 3Q5TA 5KAQF 1E67A 2C9QA 4FQQB 1MF2L 4H40A 4K7PX 2EIJB 3RAJH 3ZT7A 2ORBL 3OKYA 3KYNB 4ODUB 5H37H 2NX5D 4IMLB 3EH3B 3KPOA 4U7KA 1H3XA 1XEUA 1Q94A 1SXZA 2ZWZA 3OG6B 3PNWB 3MCG1 4J3OG 5DFAA 1M6OB 3K71A 3RTQA 5KS9F 4KXZH 3N06B 4UTBH 1VERA 4I1RA 2YPLE 4D0DB 4LSUH 4HJTA 3K4AA 4GKZB 3R7QA 4Z7QF 1E4KA 1MQ8A 35C8H 3OSVA 1NC2B 3V7AG 4FQ2L 1NCHA 5DFVD 3TA3C 1QRNB 3LRLA 5C0DA 3NIGF 1NMAL 3VUAA 1CDIA 4MGXA 3V52L 5CHNA 1TETH 2GJ6D 1G94A 2W80C 1IE5A 4LCWB 1ZVYA 4LASH 3NQIA 4N26A 1CF8H 1JNNH 1H3TA 2YN5A 3QDMA 1PYWA 4H7VA 1QSED 4LBEA 4YIQB 3UYRL 3VGAC 1UD6A 4I4WA 5DFWH 3G5XA 3DPDA 3RUGF 2V5MA 1F3DH 2YPKA 3BZFA 4F37F 3VD1A 1AACA 4NNPL 2VE6A 1G6VK 2K7QA 3ETBJ 2H3NA 1B6UA 1JGUL 1JGEB 2QQLH 5JHLL 1JMXA 3DIDA 4F9LC 3MRPB 1CDCA 2CK0L 3CFCH 4HJJL 4LARH 3VXUD 5BVPL 3UG5A 2Y1AA 5GGTA 1T5XB 1E30A 2UWEB 5E2WL 5E6YA 5AOLA 3D2UA 3WMQA 3EOTH 4GKSB 1D5XA 4KVNL 4XOEA 5FM5M 5JQIB 3M1CA 3QEUB 2VABA 4JG5A 3WY4A 1U8PB 5EO1B 1XT5A 1NCBL 1G43A 4HS3B 5T5NF 4JS7A 2X7LB 5PCYA 1I8MA 1KG0A 3EF7A 4Y2DD 3U82B 4HPYH 1WS7A 2GJPA 2QGBA 3HG5A 1G7LB 5DO2D 4AQ1C 5T5FA 5TQ0H 3AC0A 3TC9A 1UWXK 1A1NA 1EAQA 2FQEA 4BWWA 2X3AA 3GSNB 3QT2A 5AYUH 2HPTA 2C3WA 2A2QT 4KMLB 4PJEB 2J12B 4MAUL 3Q8AA 2IBBA 1YEJH 4FNTA 3LB6C 4PLKC 3ASNB 3H0TB 4YFLF 4GS7B 3JT0A 1AIZA 1UZ6E 5CJQH 2EXYC 3BZEA 5CIPH 1JHLL 3UAAA 4WFED 4O02A 3WS6A 4HUKB 1A6PA 2CNZA 1RZJC 4XVSL 5EU6A 2Z4QA 1GPOH 1TPXB 5KSUA 5TK4A 4AG4L 1MCSA 3GXMA 3EHBB 1R3KB 1ZHNB 4A38A 3A0OA 3TF7C 1NGZB 5IBTL 1UEYA 4U6YA 5ILTH 1DBKH 1QLFA 3NK4A 3EYQC 3K6IA 5DURB 4WO4A 3MNDA 3RNKB 3INOA 1KCLA 3ZRCC 1CFBA 3O3UN 2J71A 4C4KT 4W9EC 3FPXA 4XPFL 1P7KB 1KPUA 4YDIH 4X6CB 1DUZB 4R7NA 4TVUA 4B9ZA 1F13A 1Z2KA 3AS1A 5SWSB 1DCLA 3VG0L 1T04B 1JV5B 3VXSE 2AJXH 4ZMNA 5ITFA 4TUUA 2HLFC 3CLFL 4OQTH 4Z7UE 2HRPL 3N41F 2CUMA 2WW8A 4NWTL 1LDPH 1XSIA 1A3LL 4FRWA 4Q0XH 3QZNA 1E6OL 5BV7H 3O3DA 1TF4A 3RWHA 3KLKA 4NQDB 3RVWD 2NR6A 1NGPH 1AQKL 4AEIL 2JKWA 2CDFA 5I6XC 3L3KA 2YRLA 1MFUA 5HYQA 4F8NA 4ES9A 2VKXA 1E7UA 1O6SB 4R4BA 1DDHB 1AGDA 5C9JB 3R18A 5C0CE 4DH2A 4OV6F 1MLBA 4D9QE 2NDFA 1FNEB 1XDTT 1I85C 3MA9L 4YC2C 4UILH 4BWUA 3X1EA 2RAMA 1P7HL 2CO6A 3ZHNA 5GGUB 4TL4A 3WFEH 4K2UL 1FHGA 2OCFD 3PHOB 1BVOA 1CMOA 4KTEL 2MOVA 3MV7E 4Y5XA 3WHE0 5F1IB 1KXTB 1RUKL 3HI5H 1U8QB 5F3HB 3KWTA 1X4YA 1SN0A 2NTSP 3UC0L 3L3OB 3WV0A 4GI6A 1KIRB 5D2NB 3RY6C 4JPVL 3DURB 1BG1A 4OFYA 2C9UA 3O2DA 4NHUA 4HUVB 4GG8B 4YHOL 2DQUL 4DP4X 4QRRD 3KVDD 3HS0B 3ZE0F 3AWGA 3MUGB 5ECGA 5GRYA 4YHNB 3C5JA 5JMRA 1KXQA 4L3EB 2IJ0C 4PJIF 4KAQH 1IC7H 1NFDE 3UTTD 1JYWA 1YYLH 4N8CH 3FCSA 4XCFL 2NX5A 4F8OA 4PTUB 4OZGB 1R33A 5IFAH 4K8RH 4YL4A 4LVOC 3TPKA 1WUNT 1SXCA 2IDSA 1T21A 4IGBC 3HB3D 2F53D 1IEBB 1A25A 1G5GA 4K3DH 3BDXA 3QAZC 3ZKQD 3E1F1 4M6NH 2DM3A 1JPSL 2BZCA 4S1SL 3UO1L 4FD0A 4C4UA 1K8IB 4L4TD 1C1EL 1NAKH 4HS8H 2P28B 4TSBL 2D9CA 5E2UH 1YNKL 1YUKB 2BP3A 2RCSH 2W59A 3LN4B 1KELH 1AZBA 4FG6D 5LAXB 1Y18A 2GJ6A 3TEYA 4P05A 4ZFFA 5B7EA 3ZW3A 1N64H 3TWCL 3OC5A 6TAAA 3CMOH 3UBXI 1QSEA 3TASA 2VXTH 3NJKA 3BVXA 5FGRA 5BUAA 5KN5A 3VRLE 5HDRA 3V0DA 1FA4A 4PVMA 3OQRA 4C59B 1PZDA 4PUBL 2LABA 3S3SA 2NW3A 1KCRL 3O6ML 1W72A 5IY5B 3O4OB 3VXUA 2IC2A 1THCA 2Z93B 1CGVA 3J07A 4UYQA 3ROOA 3TA3D 2HMIC 2XA8L 1NCDH 3E7JA 3R06A 4JQVA 3DO7B 3BLKA 2P8MA 5HYSG 5F0LB 3EUDA 4B0MB 3E6FA 5IQLA 5I19L 3GTNA 3KLLA 4UOW1 3NPSC 3VXPA 3LHPL 4C56D 4MA7L 1BD2D 1S7WB 2PF6A 4Y2DA 3NDYE 1QR4A 4G5ZH 3CX5J 4TUJA 3HCVA 3FQXB 4TVPL 4YE4L 1AOZA 1QR1A 1OCZB 2VO8A 4UDUB 3TJHC 3QZPA 2EDOA 4ZPVB 1PKQB 3JV6A 2HWZL 3MRCA 3OXSA 3NGBC 2VQ1A 4UB0H 5ALBL 3F7RA 2ZX9A 3KWWA 4RCAA 2DWEA 1HYRC 3ABZA 3K4ZA 3CHPA 4KGLA 1IAIM 3N91A 4RGOH 5F9JA 3B37A 4GBXB 3HI1B 3C5SA 1VFMA 3HG4A 5DJCB 4PY8I 1Q1JH 2X42A 2Y36L 5IVZB 5I0DA 2EVIA 4NQSB 3RBGA 5LG1A 3L7EA 4AIEA 3ARFB 1F8TH 2B7DT 3QORC 5KYUB 2O5XH 4OLYL 3WIHA 1RZIA 5HDBE 2XQYG 2PPEA 3W11C 2OJEA 3T0EC 2IH3A 3BH8A 3MRHB 5SWZE 1CICB 3SQBA 1TTCA 5DCCA 4X6EA 4AL8C 2F54D 2AEQL 4X7SL 1BMZA 4WNQA 3RU8L 2CR0A 5BS0E 5C92A 5D96C 1D2PA 1N3NB 1VHPA 2PYEB 4XXWC 2J21A 4I18B 1XH1A 1URZA 5FHAL 5L2JB 1NCOA 3LB6D 1RU9L 4ZS7L 3OMIB 4Z77A 1A6ZA 3IJSA 1TTRA 5FYJL 3TVMD 3WNIA 3VSUA 2EXYD 3UYOD 1KY6A 3BPCA 3UXFA 3C09C 4LLWB 3GBEA 1T1WA 3EO0A 3A4AA 4C4KO 5CINL 4PRHE 1PBYA 2H7WA 3P77B 2CO2A 2C9VA 2DH3A 2ATPA 5ICYB 1ZWIB 4HS6B 2EYSB 5I66B 2WIIB 5IKCA 3SIKA 2XKUA 2AFNA 2Z7YA 5CLZA 5EOQL 3EOBA 1OD7A 1JWSA 4ZUSA 3QFDA 1XGUB 1UUSA 3BSZL 1JGLH 1LD9B 2FZ3A 2CCLA 3UOAB 3IFNL 5HHVL 4OM0L 1W0VA 4M7LT 3V9CA 4I13B 4OVUA 1QHPA 3SKJH 2VXUL 2VH5L 4M62H 1GGIH 1IGCH 1R46A 3WEMA 1XL4A 2Z8WC 4D0BA 1SBBA 1FORH 3M7OA 3WD5H 4JG0H 2X2YA 3WY1A 3GZQA 3KWVA 4L8CB 2X9ZA 3HE6C 2J43A 2X09A 5IVXA 2PCFB 5D1ZC 5I82A 1TYRA 1X3DA 3SKMB 4NCC2 2JJUA 1ODAA 2JB5H 3BZ4A 3H85A 3KLHC 4X7FC 1LE5A 3VD9A 4U1JA 4J3UA 3B6SB 3LIUA 4BCXA 2ZOWA 3OKNB 3QXDB 5E2VL 4FA8A 1A5FL 3MR9A 2ZXQA 2R2HA 3BKCH 1CPUA 3JVGC 2WO4A 3T2OA 3UTTA 1QFUL 4JDEA 3UBHA 2BIHA 2YA2A 4Z5RA 1SEBA 1XGRB 1P1ZB 4HC1H 4AGPA 1V3JA 3GI9H 3LEXA 5E2TH 2X4NA 4XMWA 4EUPB 5DUJA 3QJRB 1SXSA 2YPLB 1OZUA 1EO7A 2ITCB 4M7JH 2GKIA 2IMNA 2J6WA 5K39B 3DJ9A 5CEZE 3VXTB 3CX2A 3BVTA 3JTSB 3GTTA 4N2MA 4HH9A 4NO2A 3UAEA 5DMIL 3B7SA 3MXVL 4WEMB 4HLZG 1H5BC 1FIEA 3C60B 2WBXA 2Y1YA 2OYLA 3UIZA 5J6HB 5CUSH 1DBAH 2VLRE 3AREB 3CPLB 1AGCB 2ZOTA 4L4TA 3T65A 4OLWL 2ZP0T 1H9VA 1I7TA 4L29B 5DD0H 4HAFA 4N2IA 3D34A 3L3DB 4POZC 3A4FA 1T2XA 3O4LA 2GABA 5EIIB 4KUCD 4NQVA 4HPOH 3WIFB 2WQAA 3LQAC 3HFML 3DO4A 3GIZH 3J2PA 3DO3A 3IJHA 5H2BA 1OAYL 4Z7NB 1IAMA 1UKSA 3KYOA 2YJLA 4MWFA 4P5TC 1AJ7L 4ZI8A 2F7RA 3GO1L 5I6NA 5ALCL 2RBLA 4IGBD 1CFNA 3T4YA 5KANI 2AKRB 4Z0XA 2AV1A 2W0PA 3D39E 3EYVA 2XU9A 3GHBH 4UMGA 3NSFA 2YWZA 4I3GA 5J5EA 2V9TA 5KYXB 3LRGA 3I6GA 3I6LD 5I17B 4XBMA 3TA3A 1E65A 1HIMH 1MEXH 3FCTA 5EA0H 4MA1B 1OWWA 4LAQL 1PY4A 3QUHA 1BYNA 3V6BR 5AYQA 3PGCA 1A7NL 4PCSA 2VITB 4XOBA 3EFOA 1J88A 1FNGB 1BJ8A 3UTPE 1M7DA 3DX7B 4CN6A 3FU5A 1LEGB 5B7FA 3FFCA 1DQTA 4IJTA 1LK2B 1ETZB 5FPIA 2X10A 1RHHA 2I24N 1JZDC 3EO9L 4JGNA 1FRGH 4JO3L 2ADFH 2NY3B 4JJOA 5CZRA 3INUL 2XWJB 4LL1A 1HCFX 4NEHB 2HX9A 7FABH 3NFPA 4DGIL 4WSKA 2GTWB 2HMID 1QVOA 4JRXA 1FZOA 2D2CC 1IKNA 1SGKA 3GZOA 5DZ9A 2EDTA 2AZAA 3HW7A 2Q3XA 4Y1AD 1VGEH 5ANMA 4LQ1A 5IHHA 1J9SA 2OQJB 3WDJA 1C5DB 4WGVB 2VLJA 3GS4A 3HLAB 1G7IB 1M42A 1IQDB 2BDNH 2JLLA 2VXSH 2YD0A 3BKYL 3VFPA 2F54A 4WI0A 4AQ1A 5BQ7B 1XGQA 4XT1C 5JIDA 1KN2L 3BH4A 1W0YT 1BFVL 1P7BA 1LM8V 2FE0A 1B0WA 3GTVA 1U8MA 4ZOAA 1K6QL 3Q8CA 3T77B 4AJVA 1RZGB 1UXSB 2IQ9H 2QVFB 5ESQA 4Z7UB 4UT9A 5A2AA 4N1CA 4GIOA 2J4WH 1NBVL 2W5PA 1BWMA 4WHYG 3CSTA 4DSYA 4DUWA 4EDXA 1MRFL 3DGGB 3L1GA 1J5CA 5TDPB 4KQ0A 1AS6A 1TJIL 4HXAL 4JKNA 4ZUUB 3MV9A 4P5KB 3QORD 4LOVA 2OMZA 4WK2B 2FQGA 1C16B 1JTOA 3SBPA 2P8LB 4KFMA 1DVFB 5FYKE 2OMWB 2E27L 3HNSH 3LMJH 2FL5B 1Q9OA 2PPDA 4JRFA 2AJYH 4M8QB 2W65B 4G6KL 5E99H 3W11D 3T0ED 2K9FB 1NCAH 3CFQA 3MUUA 1X9UA 3DNKA 5DVOA 5ACMA 2X6AA 4HUNB 1JHTB 3B43A 4HF5L 4ODVL 3DUUB 1H8OA 2VDNH 4G1MB 4XCNB 4I3RL 3PQYE 1ET7A 2O6EA 3N3EA 3WIIH 1AS8A 5EIQA 4YMPA 2DQTL 2X4OB 3FU3A 4HVBA 3MV7B 2FUQA 1T66C 1TJGH 4K73A 4FKEA 3NJJA 4U1KA 2OK0L 3CVIH 2B39A 4OZHE 4WSJA 5LGJB 3PV7A 3EXLA 5TJWK 2D2OA 2J1YA 4MDIA 3RVXC 1RJZB 4FQIH 3SYOA 1PLGH 1JYVA 4JY4B 7CGTA 4KVCL 5CJ5A 3KL0A 5FGCE 4LVEA 4JFDE 1SDYA 2E5EA 1B2YA 1ORQB 3SDXF 3ZHFA 3FNKA 5LHDA 4FFZA 5EZLA 5AVQB 1UZGA 3SN6N 1KTDA 4GRWH 3FT4A 5D6DC 2MCMA 4ZMQA 1DE4A 1NFDB 2F6AA 1EGJH 4LCCC 1SPDA 2TRYA 1XH2A 4RMBA 3V0IA 1QBML 4ZFOB 3VXOB 3W9DB 3LKNA 4RLDA 2KDYA 4FXGC 5F0PB 1TZGL 1IKFH 5E95B 1CD9B 2UYLA 3BPLC 1I85A 4LCIH 4P5MB 4P3CH 2BNQD 2JI3A 2F2HA 1KT2A 2X4UA 1EH9A 4IRZL 5F9WC 4P59L 4TNVF 4HJEA 5B39G 5GGTL 1M3IA 4IBUA 3HE6D 1GKEA 3CVDA 4UNUA 5D1ZD 1NA8A 2IH8A 3EDDA 6PCYA 2XIDA 1WHOA 3VG9C 4JAMA 4NRYA 5AZEL 2QQKH 2CO4A 5DJ0A 3KLHD 2EC9T 1H3GA 1NGYB 3MCYA 2X9WA 3MBED 1IGYB 2B3RA 4LSTH 1GS8A 2OMVB 2ARJA 4QI3A 1H6UA 2ZNWA 5AUMA 3FF8A 5FIEA 1EFXD 3GSVB 4JPKH 1NIBA 4WU7B 1Q0XL 4UYPA 1I3RA 4QMEA 3FTUA 4F91B 5FM8A 3VRIB 3W57A 4Z6AT 3HI6H 1XGYL 2Q76A 2UY7B 3DJZA 4JVUA 5F88B 3OHXC 4IOSD 1V3MA 3MRJA 1E50A 1GSKA 3MRNB 4YNYA 4UTBA 2APSA 5DTFA 4IGBA 4N0CC 4Y5YC 1GC1C 4MXWH 4TUKH 4GAYA 4CSPA 1UATA 4EQ2A 1CLOH 4PWKA 5EZJA 2ZTBA 4NZTL 2O26U 1FC2D 3Q2CA 2WXNA 4PJ8C 1WWWX 1A7BA 2BHZA 3K72B 4I9WD 4LKCB 2FATH 4UV7L 4BFJA 1Y0LB 2NW2A 3LZNA 3BP7B 4TVPE 9PCYA 4YHMH 1ZT4B 4FG4A 2HG5A 3E1ZA 4PLJD 5ICZB 1KB5H 5DT1L 5IW1B 4NQCE 2E9BA 3PPSA 5MEOA 4QO1B 3X1BA 4B97A 2GUOB 4XPBL 1D5BB 2AGJL 3T4AC 1E28B 2ZUWA 5D7LE 4LHUB 1NEZA 3T3PE 5IK3B 3MRBA 1EZLA 1JNHA 3GINA 4NRXB 2QSCH 1A22B 1BQHA 1QHQA 5A2LH 1U8HB 2XDHA 5DMYA 4TULL 5FWQA 4X6DA 5HDBB 1D5ZA 1WBZB 2TAAA 3KL5A 3MOQA 4XNYL 5EU4B 5CEYA 5MHSD 1CT8A 1TTFA 1JVLA 2FUTA 4PAZA 1OT1A 3VD5A 4Y1AA 1JPFB 3EJYC 2EDWA 1Z7JA 1J0KA 2X38A 3LX9A 3VE0A 5F1KC 3U36A 3Q8FA 5BS0B 15C8H 1MHHA 1QSZA 3P9MB 1MFAH 3SDCB 3ZDZF 4ANWA 3ULVE 2ENQA 2QGDA 3T8XA 4A66A 3MLTB 5JR1H 3PABA 2AXJA 1RD6A 1RKRA 5LUMA 1FNSH 2IDUA 3IJ8A 4PGDA 1HE8A 5GSVB 1G4MA 4ECNA 3FQUB 3N9GH 5EUKB 1S7RB 4Z7VA 5B8CB 4ZT1A 1IBHA 1BOGB 4HIXL 4PRHB 4F2MB 2FT6A 3U9UA 4BGDA 4KY1L 2DEXX 1A4KA 1SHWA 3U4EB 3V2AR 1QTYT 3QORA 4X6FA 4JFPA 3TO4C 2FSEB 2A9MH 1SDAB 1L0QA 5TH2B 3AXLA 8FABB 1YUHB 3H9SE 3L16A 1L9RA 1PZUB 2G3ZA 3Q05A 2F8IA 3T0EA 4N86A 3TH3T 1D6VH 1ACYH 1N59A 1HQRB 3MOAL 1WT5C 1YNTA 5EUOE 4PJXF 1E43A 2XN9A 4MB3A 4PJGF 2NNAB 3FBQA 3HAEG 3U4BH 5I1LA 4HSCX 3AU1B 3VMNA 1A6TA 3LQZB 1R19A 3LY6A 2X4TB 1A7QL 4XXWA 5D5MA 1IAIH 1FZJB 1NWOA 1F4WL 4RSVA 5AB0A 2X4PA 1DJHA 1I9RL 1RV6X 3LN5A 4IS6B 4RGNB 1BM3L 3W0WB 2GTZA 5L4FA 2EDLA 3UTSE 1B4JH 2CJUL 2PWDA 2OTUB 1N67A 3AUVA 3UJJL 5F3BA 4Q9BA 1E4XL 3KEHA 1XSOA 4ONOA 1I75A 4FZEL 3JV5A 3BC9A 4H88H 1PG7X 1PZSA 1F4AA 4KMTL 5HVHB 1VAHA 2CZNA 1K5WA 4RMVA 2QGEA 2VT0A 1AFVL 4PIBA 2D7TH 3Q9PA 2CGZA 1XO8A 2PXYC 2V2XB 4RZCB 4A67A 5BJTB 1GZPB 1DBML 1JI2A 2CRZA 2F19H 3GHEL 1FO0H 4PLOB 4MD5B 1J5HA 1LP9A 4PP1C 4XVJL 3SJVB 2I27N 4P2RD 2Y6TE 2IADA 3SYCA 4AENA 3CC5B 1EHKB 4NJ9L 3WSQH 5IVNA 4DQOH 1UJ3C 2BNQA 3TM6A 1T66D 3CHXA 4TL5A 2IOOA 1E9PA 2VWEC 4ENEC 3CTTA 5DDHA 2BZ7A 1FVCA 1W72L 1MREH 2O1AA 4TN9A 3L7FA 2EEDA 3QFGA 3ARRA 3HE6A 4ZG1A 5D1ZA 4KX8A 1MUJB 4CMMB 5HYJD 2A6JA 4X4KA 3CAFA 3DX3A 3VFVA 3VYOA 4DT2A 3PFUA 1R4XA 3HMWH 4MLSA 1CXHA 4DJMA 1LO4L 1WITA 4HUXA 1W6LA 2FLBT 4X5XA 3MLYH 5HI3C 5LAPA 2OMNA 2UVEA 1WIOA 3HPJB 4KUZH 5J6GA 2IQAB 1EFXA 2V17L 3JVGA 5HI4C 1ORSB 1ZXQA 4N6RA 3N85L 3PDOA 3D33A 3QNXA 1N6QL 3C6EA 3LSOB 4LQFL 4YK4B 4FLSA 4J3OC 1RK7A 2ICWI 4PY7B 4IOSA 1MCOL 3D39B 1MW1A 3P9LB 2H6OA 4KXAA 1EPFA 4MJIE 5KVGE 1JZ8A 4NXKA 1MCPL 1HILA 1AAJA 3FSWA 3DX6B 4G8IA 3I3DA 5E8DL 4OCSH 2H6PB 4Y5VC 1H5BA 1WC7B 3CLEH 4E9LA 5J4MA 3V0EA 1PZ5B 4V1DB 4LSQL 3QWOA 4GI8A 3ULUL 2W60A 1OSEA 1XF3A 1KGWA 4O2CB 4XNUL 1R0AL 3KWUA 5FECA 5AVTB 1U8JA 3FRPA 2FJHA 1GCYA 4GO9A 1CD1A 4OCXL 2X2UA 1OAUH 2BRRL 3FKUS 4Q97A 4OGXL 1NLDH 1E42A 2GQHA 2Q7NA 4J7RA 3L9RB 1DL7L 2WBJC 2VUOA 3QPKA 4P5TA 4E2OA 3DA0A 5CD3A 1ZT1B 5GRUL 4XOAA 3VXMB 3DRTA 4H0LC 2YAQA 1KEGH 2FSDA 3BKMH 3QJTB 1WD8A 2ZICA 5BUPA 4OZIF 3PNRB 1JVKA 5TE4L 1CE6A 2A1WL 2DL9A 2R56H 3MRQA 3QG7L 3TNNB 3QQDB 2VDLL 5DJ6A 1JWUB 3MJ9H 5L4MA 4EN3B 3S2AA 2VDRH 4R0LC 4PJ8D 1KB3A 1F2XK 5KUMA 4GAGL 3QJQB 3D4YA 1F3DJ 2WNWA 2CLRB 1FC1A 5D93C 3WE1A 4CADB 1KF9B 1LNUB 3MODL 4DETA 4BCYA 4QRAA 1NFKA 4JFOB 4JGUA 1JN6B 4XBEH 1IE4A 3QFJE 1BQLH 2GEQA 3RZWA 3O9WB 3MRIB 4KITB 4PB9L 1Z5LA 1JUFA 2DYPB 5C0IA 1Z5YD 1P53A 4RAUB 5J8OA 4B0MM 4MA3A 4P2QE 4UQ9A 5A6LA 4MCYA 5FYJU 3EOAA 5MEPB 1EHAA 3QCUH 5F44A 1PZAA 3IGAB 1ZVSA 5FR3A 5FGBA 1QFOA 3WO4C 5DYOA 1I8KA 5FO9B 4UINL 3US9A 3AMKA 1ZHKB 4JZOB 2E4FA 1E3ZA 3IMUA 4NZFA 1SF3A 3CZKA 2VR7A 3P30L 4GRWF 4L1HA 2VAAA 2PYFA 3GXNA 4GUPB 1MWAA 2C8NA 3C6LC 2M2DA 2CBMA 1MXGA 3EBAA 1QWHA 3JWDC 5AVXB 3QVAA 3WTXA 3JWNE 3QQ9C 1HX0A 1F4HA 4D8PB 1H8NA 2NY0B 3L3HA 4HSAC 2OR9H 3P2BA 4L8BA 2LT9A 1A0QH 2G2RB 1Z3RA 2I26N 3L3IB 3AT9A 4C4BA 3O11B 1MPAH 3VFWB 5D7IA 4MHHG 1HWWA 3FTZA 3QDGD 3MLXL 2P5WD 2L04A 1QYGL 1CD0A 1CYXA 5GGQL 5E1QA 5HGAA 3UDWC 3UZVB 4WJG3 2EYRB 2FBRA 2KPNA 5FGCB 4K5PA 3BT2L 2BOBA 3FO1A 3SCMB 1EJOL 2GPZA 4IW4C 4LEXH 3PF2A 3DSNB 4UQAA 1YDPA 1AZRA 2DF3A 4LDLB 3TO4D 5IT2H 1CGUA 3HZYA 3MN8A 5FXCH 5BOZG 3PJSB 3P73B 5C0GA 1UXMA 1G6RL 4TTDC 1U36A 2EJ1A 4J23A 3BWAA 2XQBH 3CSBA 3CSGA 1UADC 3ZR6A 5DJDA 3DTXA 3GSRA 4EJ1C 2C1PB 1I3GH 1S9KC 1XZWA 1X6NA 4NKMA 1INQA 1OD9A 2NTFB 5E6IC 1ZK9A 4P2RA 3IMWA 2P24A 4Z95H 1NC4D 1YCSA 4KNUA 3QNYA 4LSPL 5KW9H 1UWGH 1M57B 5KJRL 5CILL 1XIWB 4GMTH 4ZNEA 3APMA 1KEMH 3RBSA 5E4EB 5DWUL 4HU8A 2QKIB 5IBLC 1PD1A 1UENA 3RG1C 2VXQA 4X0KA 3U2JA 3MRGB 3WDHA 4AM0B 3WFDL 1E27A 2IFFH 4TQEH 3ZR5A 4JW3A 2J8UB 1DEDA 5HYIA 5HYJA 4AEFA 4AGLA 1S46A 4AY0A 2XTJE 3QRLA 1EMTH 2NY4B 2YK1L 3L54A 3PWUA 3QQ4B 4K3GA 2JKJA 5D6DA 5JTWA 2PXYD 3MLVH 1D9KD 4LCCA 3BVUA 4HETA 4MD4B 4WTZG 5E8NA 3ZZSA 2W81C 2PNDA 3WO3B 4DIXA 1PJ9A 4I2XA 1OKEA 2HJKA 4JQIH 5CCKH 4K3JL 4PP1D 4FXGA 4YDKH 1S7QB 3FUDA 5BXFA 5KUKA 1HXYA 2C3VA 2EDHA 5INCB 2YRZA 3TOPA 2WZAA 4QTHA 1WO2A 3K6NA 5EU6E 5CD5C 4BK5C 1WD9A 2K45A 2I07A 4Z76B 4R7DB 1Z9SB 2AI0H 3MGAA 4KQ4H 4KV5F 5C3TA 4CDHA 4LPXA 3UJIH 3GPEA 2WWKT 1WFOA 3UYPA 1AXSB 2CCVA 4ZMPA 4HLZH 1KBWA 4M5YL 1TXKA 3QJZA 4HMDA 3DUSA 5AW7B 3OSKA 5F7NC 1XTLA 4TPRH 3FO9A 5ICXB 2E75C 5HI3D 5HJGA 2IOIA 1AC0A 4QKTA 2QHRH 2ZUXA 1Z0MA 4APQC 2R0LL 1CZ8L 1U8LA 3V4PH 4ELME 5KVEH 5HI4D 4HKZA 4MNGA 1EEZA 2WP3O 3FT9A 3MLRH 4NT6B 3VSVA 4OD2B 5E08L 1BVNP 4RMQA 1NBZA 4CC0A 2A7BA 1M71A 4J3OD 3GZKA 3OHXA 4OSUL 4M3HA 3HG1E 3D3VD 5IG7A 4X5LA 4PGJA 1A1MA 4RA0C 4FTVB 4QYAA 4Y5YA 4WHDA 3BSGA 3D25B 2KL6A 2AQQA 1QBLL 2ZG3A 1TSHA 3C8DA 1XCXA 2G5UA 1E2ZA 3EF4A 5FM5O 4G6JL 3F7QA 4PJ8A 1NGXB 4QKXB 4JFQA 4J3SA 2CHXA 3FXIC 4BKLA 2V5YA 3ATFA 1JZEA 1DQML 3KYAA 3SY6A 3G6AB 2E7CA 3GWJA 1YVLA 2AMGA 3HNVH 4EE2A 3DPBB 4NM8H 2A6IA 3HC0B 5I30L 5JOFA 3BQVA 5E2JA 3BVNA 2WBJD 4HUUB 2W9DL 1FDLH 4JE0A 4RDQG 5FFOA 5DQDH 4W9GC 3TCLA 2FLRT 5D8JL 2G3NA 4RFOL 1G7HB 4NQEB 4PJDB 3QO0A 1F02I 4DK6A 3BPNC 3B5GA 3L4XA 3IN2A 4M1DH 3FU7A 3EG9A 4WDIA 1MCWM 1X5IA 4WK0B 1GMIA 4JKKA 3NH7L 2QFPA 4I9XA 4QJ5B 2H3XC 2R9HC 1XB8A 1BGXH 1JVOA 3LRMA 4HKXA 5FK9A 3TTYA 3WEXA 1KXQE 1UWYA 3L5IA 4M5TA 4OTXH 1AGFA 1ILSA 2ZUSA 5EUOB 1JZGA 2NX5E 3N1GC 1RULL 2NY5C 3CXHK 2H8PA 1YQVL 3GSWA 4Z7WF 1VEMA 2VRKA 3BAJA 1XEDA 3DKHA 3BRDA 1N0LB 4O58H 5C08D 2O6FA 2FX9H 3RL1A 1SJVA 2CD0A 5I2IA 3KYMA 3O0RL 1I7ZA 1RIVL 3B2UC 3QDGA 4CRPA 2A73A 4M93C 3VFSA 3C8KA 1O7DC 3FONB 1K72A 2B0SL 2JF1A 2FWUA 4NOBA 4KKZA 5CEXB 1G4RA 1KGJA 4UDTB 3DOSB 3PHAA 2GJ6E 4N1EA 4WEEA 3IAPA 1WBYB 3TO4A 5E7BA 1XZ0B 1MVFA 3G5ZB 1ZSHA 3C6LD 3CG8A 4F7EB 1QSEE 4PJCF 3Q48A 1WT5A 1U33A 4IBSA 2WLMA 2R23A 1ZCRA 1JWMB 4WKXA 2XWXA 4L48A 5F2FA 4ETQA 2WTOA 4I87A 5IMKA 1NC4A 1S9XA 4CVXA 4K7FA 4UTBL 2LVEA 5A3IC 3VXUE 4DGYH 1NUGA 3GSNH 1CYWA 3TCTA 4JNXA 1DJXA 3OKOB 1HSAA 4Z3EA 5I1KH 2R2EB 3BGFB 2XXMB 3RL2B 1UACH 4XBGA 1TT6A 1TETL 4N9GB 4XNZB 3MRFA 3NDZE 3QJSB 3X14A 4LASL 1EGJA 2IBZX 4FFYA 2G75A 3S3CB 3ILPB 1JNNL 4QY8B 4AEEA 5EDSA 1HZHH 4UAOC 1V7ML 4KROC 3VU2A 2PXYA 1F1DA 1RUQH 4IJ3B 1LEIA 3OR6A 2Z6FA 3BD3A 1QA9A 4LLQB 4FQ1H 4MQ7A 3VFRB 3G3LA 3MBWB 4M03A 4XP6L 2QQLL 4Z8FH 3N6YA 1U93A 4WFEE 1IEHA 3FDWA 4NQUA 1OM3H 2QJDA 3ZQ9A 3MRDA 4P23C 5IBLD 3IE4A 4F8LA 4GP4B 4XMUA 1IEAA 1XMEB 3BXNA 3EOTL 3KJ4C 2IALA 2D0FA 1F6AB 3V0FA 4GO6B 3HC4H 1R5VA 4YHKH 1PDKB 4XXDB 4GG6B 2PMZA 2UZYB 3FSVA 2AZUA 4JFEB 2XX1A 2Y7OA 3U7YH 2B77A 4DAGH 3VW3H 4MSWA 3TL5A 4CA4A 5AYUL 2Y0SA 1BV8A 4ZRGA 4E36A 4D0CB 4ZTOH 2AJ3A 5IM7A 1YEJL 3DX8B 5AVYB 43CAA 2VQTA 4K94H 4AYMC 4NSKA 3REVB 2OLDA 4UBDC 5FW8A 5GGVL 3NZSA 4JLRA 5CJQL 1WAAA 3RZCB 2MHAA 1MKFA 5A2JH 3IE9A 5CD5D 1AP2A 2X2IA 2YO3A 4YSTA 3ZDXF 1Q9KA 4HGWB 4MD0B 1GPOL 3HE7C 1R5WA 5DMKB 4Y5VA 5EB9A 5I1GH 3Q6FB 5BMFH 1H6TA 1ID2A 1OIOA 3MGOA 4BQ6A 1S3RA 3H2PA 5ILTL 1BZ8A 1DBKL 3N55A 4G80A 4ALAH 1AVAA 1IZKA 3HPLA 3UGUA 4IMKC 1MFBH 5ETUB 5I1AB 2NUTA 1MCJA 4AL8L 1KB5A 2OP4H 4W81A 1T5WA 4APQD 4YDIL 5HPMB 3UP1A 2XV0A 5FLVA 4MXVF 3GLEA 4P2QB 4ODWB 1FCCA 2AJXL 2WBJA 1FSKB 1GJUA 4OQTL 2ADGA 3KLQA 2Z8SA 3VTTA 4DKEH 1H8SA 3CBJB 4NYLA 2GSIA 5IVXE 4FFWC 4M6OH 4Q0XL 3MNVB 3IGKA 5DQJB 5BV7L 1I1FA 3B7RL 3LZFH 2ADYA 1NGPL 3RGVC 2VLMD 5F70A 4U1LB 3FH5A 3L2NA 4JFXA 5T8IA 2H45A 1AYRA 2WXQA 4KKBC 1PTZA 4QRRE 3MO1A 3T71A 3UIYA 5BUGA 4EDWH 1E9OA 4R0LA 1I1YA 2ZG2A 3KPOB 1Q94B 3ARQA 5EN2A 4QAWA 1M7XA 43C9A 3UTTE 2V3FA 1VIWA 1U3HC 2ZP9A 5F7AA 1IU1A 4PJBA 3L6FB 3RTQB 2C3XA 3NACH 3CIAA 4XP1H 1FQ9C 4KO7A 3F84A 1IARB 3WYRA 3WENA 2Y3AA 1V7NL 1YMHA 4OLXH 5JA9A 2F53E 4OBRA 5FUCC 5T3ZH 3WFEL 4G8EA 2RMNA 3QG6A 4QHMA 1AKPA 3RVTC 1CI5A 1XF4A 3GJFH 3VDCA 1TQCC 2XHNA 4LB8A 4F1ZA 3UTOA 5C0DB 2VMDA 5E23A 3HI5L 5CHNB 5GXBB 3U0PB 4L4TE 4N2EA 1EK3A 1LJMA 4H20H 2XWEA 2ZSVB 1QMUA 2EDXA 5CGTA 1TO4A 3QDMB 3VA6A 1PYWB 4F5CA 1E7VA 5GJSH 1XBRA 2PCPA 3TV8A 4I4WB 5AENA 3G5XB 2F7QA 4MVBC 1NCWH 4XGZA 1MZYA 1VCAA 1W15A 3C6LA 4Y19D 4TLUA 1IC7L 4PRNA 2VE6B 4CVZA 3VB8A 1YYLL 2H3NB 2VO5A 4LOFA 4RMRA 4X98B 2XVBA 1J9CT 1ZGLP 2OXGB 1W8EA 2WN2A 5IFAL 4K8RL 3HAEH 1GJWA 3MA7A 3VNYA 2IVFC 2ZXDA 3D2UB 4NN7B 5GRXG 5C09B 4F9PC 3B2UD 4M6MH 5DR5H 3A21A 1M2VA 4M6NL 4EIBA 2AJVL 1MCEA 2VABB 4Y2OB 2BIMA 3UDWA 3BO8A 1I8MB 3ESPA 4JHVA 2WWOA 4ZTEA 1NAKL 2XTJB 1A1NB 4HS8L 2DI8A 4R96A 4FNUA 4C56E 1BD2E 5E2UL 2RCSL 1KELL 2WXKA 1PX3A 4GAAA 1F45A 2V6HA 4QLWA 2HT3C 1DQDH 1N64L 4Z3JA 1KPRA 5LJYH 4KXCA 3AUWB 3FYIB 2VXTL 1P69B 3KCPB 2BNRD 1IBFA 3BZEB 1TNNA 1NOAA 3QDJA 3QQ3A 2OX5B 3ABMB 5E6IA 1VF5C 1DFXA 2BIPA 4WI9A 1AD0A 5EU6B 2Z4QB 2KZBA 5E03A 1IC5H 4B53A 1TMCB 1TO5A 4YGAB 5KSUB 1VFBA 3GMOA 4YAQA 1ZOXA 2PTVA 4Y9FA 3TBCA 1E4XI 4YUEL 2ED9A 4U6YB 1K8DA 1QLFB 3KPTA 4N3TA 1NCDL 4KQ3H 5JMOC 2NY6C 2Z8RA 5K9QI 2R1WA 3QS2A 3SQOH 2F54E 1JG9A 4LKXA 3CXHJ 4R7NB 3WFCH 4UF7C 4HHGA 1BA9A 4G5ZL 3S5ZA 3DGCR 4KJPC 1C08A 5ITFB 1EHLH 4AYGA 5IQMA 1FNHA 4IRSA 1OO2A 1RSFA 4UB0L 5I74C 5DD3H 2WKOF 2Y5TA 3CDGA 2DEYX 1BF8A 3O3DB 2XBTA 3NRFA 3CFDA 2Q3AA 2W0LA 2WINA 2Z64C 4RGOL 2CDFB 2DPKA 3BQUC 3L3KB 1YEDA 1Q1JL 4FQLH 1DR9A 5HYQB 4NUGH 2EDJA 5HY9A 2EDRA 4P23D 4G42A 5D9SA 5DVKA 4JG9A 4R4BB 1F8TL 4UM9D 1AGDB 2XZCH 32C2A 2Y23A 3S4SG 3W2DH 2O5XL 2I9TA 3WJLC 2XQYK 1MLBB 4ALAC 1NDMA 2QZQA 4IRJD 4AITA 4QGYA 2EVJA 3D06A 1EVTC 3U1SH 3BE1H 1HAWA 4PREB 3CJJA 2CO6B 3F58H 4OCRH 4PWIA 3AQZA 5K9OA 4NI6A 3T2NH 4APQA 5IJCC 3B83A 4O51A 4Y5XB 3MZGB 2V7HA 3QCTH 4GT7A 3ZL1A 3ZKXB 4YBLB 3JWOC 5AKSA 1BZ7A 1VEOA 3CZSA 2BRQA 4HISA 1UD4A 1Y6KR 4B3VA 3ARDC 5F0JB 1HKLH 1R3IH 3EIFA 4C83A 2HVKB 4NHUB 3CHSA 2ATKA 4YX2L 3VD0A 2WGXA 1SM3H 3HE7D 3V8OA 4EUPH 3FB5A 3U1QA 1ZLSH 1ZTXE 3KLDA 2CBTA 3A5VA 3FCSB 5HYSA 3UZQA 2UXTA 2UWEF 1OE2A 1F00I 1T4WA 5FFGA 3D09A 5DS8A 1J9TA 1JGLL 4N8UA 4BHUA 4FEIA 4FQCH 4OB5H 4IHOA 1X9LA 1G9MC 1L9PA 2DLEA 4XTRC 5F7HA 2B9AA 1T83C 1WZMA 4N28A 3SKJL 5K1NA 4M62L 1NGQL 2VLKB 1GGIL 5FOJA 1IGCL 4BBWA 4BSJA 2AVGA 4NPJA 2QMJA 1WBXA 3RWJA 3U0TA 1FORL 4P4KC 3WD5L 4JG0L 2WOYA 3CFEA 5C7ZA 4AKOA 4EN2A 1AZVA 1R75A 3MX0A 2WWNA 2CKBA 4PJEF 5JW5A 2WQRA 4RESB 3HNTL 2XVLA 4M00A 1Y18B 1ZLVH 1I9IH 3RGVD 3LNGA 1F3JA 2JB5L 4B5ZA 4ZFFB 3OX8A 4FI8A 1KTLA 4KKBD 4R84A 3BOVA 5DRZA 2EYTA 5IEKA 3UADA 3I2CH 1OPGH 2DMKA 4RRPG 1KIQB 1UCTA 2XQYA 3QEQA 3LDBB 3EFFA 4BFIA 3BPOC 1H6FA 3F04A 1HCYA 1MCDA 3BKCL 5E0QA 1IAKB 5C3IA 4Y19A 2HFTA 3R8QA 3WTWA 3B4NA 4HCFA 4Q6IC 1KENH 4UTAH 2DQFA 2QV2A 4GW5A 2NW3B 4FS0A 4KK5D 4HC1L 4P3DB 3GI9L 5SWQA 1CFSB 1W72B 3HEIB 3VXUB 4YDJA 4EBQH 3EDJA 2PO6D 3KPMA 1GYAA 4YFLI 4M7JL 2DWTA 2P47B 3NP4A 1JZ5A 1FBIH 2P8MB 4OGAC 5T3XD 4X6CF 3HZMA 3FQNA 3E6FB 4HD5A 4HWZA 3X2QB 3I6LE 3RKDC 2YXWA 3VXPB 4HWNA 1O9VA 2YS4A 3RDTC 2B5IB 2N56A 4Y2DB 1DBAL 4DP9X 2ZYSA 1QR1B 3HCVB 3ZSSA 2NY1B 2HFGH 3ARBD 4ZZFA 3MJ7A 5DD0L 3JV6B 3MRCB 3OXSB 3FHEA 4MVBD 4BK8A 4HPOL 1PAZA 3KWWB 4R90H 2VQ4A 1NICA 3EZ8A 3GIZL 2DWEB 2VDKH 2VW7A 3BEWB 4U3CA 3C5SB 5I15L 3E9TA 4BYHA 1MI5D 1TQBC 1IBZA 2BNRA 3ZMNA 5IJVA 3EGDA 1DVXA 3L7EB 2GCYA 2YPVA 2GEEA 1CBJA 3ZUNC 3UMTA 2TSAA 5I18H 1RZIB 1O0VA 3PL6C 3PPEA 3GRWH 3GHBL 4Z0BH 2Q10A 2OJEB 3BGMA 2IH3B 3BH8B 4YJZL 5D4IA 3IWUA 1QQDA 4Y1AE 4F7TA 5JQ6H 1MEXL 5EA0L 2XOTA 2WUCH 3L08A 2VLLA 4WNQB 1WHPA 3DC0A 1DLFH 3LVTA 5C1MB 1WFJA 1OTTC 1BZQK 4KPHH 4OF5A 4XE0A 2YMXH 4Z77B 1A6ZB 3IJSB 4JQIA 3N43B 3OWEA 4NKOA 1HDMA 3RRQA 4HLJA 3S37H 1S5HA 4NN6C 5D2LE 2VSMB 1T1WB 2CHDA 3EO0B 2N7AA 4YE0A 4Z7VE 4QWWC 3O3EB 4O9HH 2VDLB 1FRGL 2ADFL 2ATPB 4OZGF 3KVPA 1AO7D 4KK6C 5G5DB 5D6CB 3V6FA 3KXFD 2A38A 1JWSB 3QFDB 2NY6D 1AYOA 1L9TA 3DYPA 1R3HA 1Y7VA 3MROA 4RIRB 3T0EE 2FZ3B 1A6VH 1VGEL 4Q9QL 3GI8H 3W39A 2ZXBA 4BQBA 4BZYA 2FYYA 2LQRA 4DEWA 5HHMD 3GC3A 2OZ4H 2VXSL 5LVEA 4NX0A 4ZMWA 5ELIA 4GUQA 5D5ME 4HK3J 4GMSL 3V4PA 4D0BB 1FFTB 1F4XH 4WI8A 4LP4A 5B1CA 4JG1L 3UEQA 4N24A 1IBYA 2ENSA 1G1CA 2V5RA 3BQUD 5F0MB 5BZXA 2MCAA 1LE5B 2X87A 3H6JA 3FB7A 4XP9L 3L4VA 3F01A 5DZVA 3NT0A 4U1JB 3NIDF 2P8PB 4BJLA 2DQDH 1QP1A 2Z7ZA 2GT9A 3HE7A 3MR9B 1EZVX 2R2HB 3L5WB 3LMJL 4AH2B 1MLCA 2AJYL 1Q90A 4N90D 4JDEB 1NCAL 4R3SA 4FL4B 4Z5RB 1SEBB 1BZ9A 2AANA 1CGTA 4OKVA 3LEXB 2X4NB 4K0OA 4IMKA 4AMWA 1E5AA 3MFFA 4YGVA 2VDNL 1BYPA 2BNQE 3WIIL 2VUKA 4NO2B 1DO5A 2PR9A 4WENB 2ZSWB 1D7FA 4KZ0A 1TJGL 3CVIL 3IBOA 3ARDD 3BLPX 1D2OA 5I5JA 4U3SA 2WXIA 5FO7A 4FQIL 1PLGL 3QR0A 1LTXA 1M9SA 4L4TB 3T65B 4BWTA 1I7TB 1KC5H 4MBRA 5CD3B 5AD0B 1G6RB 1HHHB 3O4LB 5LXGH 2WQSA 2W38A 1R1CA 4NQVB 3RGVA 3FZUC 5G55A 2ZAIA 3K2IA 3NA9H 1V10A 2GJZA 4BQ9A 5DZAA 4MWFB 4GYBA 5ERWA 1EGJL 4BINA 2BK8A 3K4DA 3TTSA 2DIAA 1U3HA 2NT0A 5EFIA 1YEGH 2QSVA 2VDPB 1CFNB 1DFBH 1IKFL 1FIGH 3T4YB 1JI1A 2VMJA 4XTRD 4XHJC 3GSUA 4DKAA 4LCIL 4Z0XB 2AV1B 4GXUN 3UEZA 1AHMA 1Q38A 2HLEB 3EYVB 3CIQA 2YMTA 4P3CL 5IQOA 1CFQA 2HB0A 1U8KA 2IDTA 4WW2C 3I6GB 3TA3B 5C0JA 1QPPA 3FCTB 4WJ5A 3ROLA 1BQSA 4QHLA 4O00A 2VXVH 3D85D 3O2VH 5IROC 5IVOA 3IDNB 4OF7A 5BRQA 5CCJA 3PGCB 2QQKL 4I9WE 2F0CA 1OLLA 4AC2A 3EFOB 1CLZH 1O9ZA 2Z3FA 3IJ9A 5IB3A 4U7SA 2ZUYA 5HGDA 1M7DB 4LT7A 3VGAB 4LSTL 4ZDHA 1XQ4A 3FFCB 1FZKA 4QF1A 3U6XA 4NQTA 1RFDL 4JPKL 1RHHB 3B7UX 4S1QH 1PEWA 4FQXC 2XKNA 3HI6L 4NUJB 5J1SC 3K0WA 1PZ2A 3NFPB 3PDDA 4GSQA 4UV4H 3C87A 1QVOB 4JRXB 2Z31A 4MXWL 4TUKL 3WJJC 4URKA 1HCVA 2CGYA 1UXWA 5KYYA 3OKEA 4J3TA 4U31A 5ANMB 5E1HB 3LPWA 4WK4B 3ZDWA 2HCZX 5MHSE 3KPRB 3VFGH 2OZNA 1CLOL 3UCQA 1E6JH 1R3LB 1R3JA 3ZVVA 5DRNA 2VLJB 3RDTD 4X9IA 3QJXA 4NCC1 3VFPB 1XBDA 2NT1A 1AGEB 2F54B 4AQ1B 2FATL 3ARVA 1L7IH 3ILQD 4YHML 3OB0H 5KBLA 1U8MB 3N44B 1WIUA 2IV9A 5ESQB 1KB5L 3EDEA 5IMLA 1INEH 5LB1A 5HI5C 1GVIA 4B7IA 1RP9A 4DN4L 4EDXB 1DHKA 3T1WA 4KXZI 2V2TB 2OSLA 3MV9B 4PJHA 2CDGA 4KZEH 2NQDA 2QSCL 1OXYA 1T7ZA 4XXCC 3TZVC 3PL6D 2CA4A 1S4IA 2DJSA 3FQ1A 1Q9OB 3IMVA 4F7PB 3IRZA 1U41A 4KBPA 4RMWA 3BKJH 3BESR 1AO7A 3BN9C 1JF1A 4FJ6A 5CBAA 5B39A 2FCBA 2R39A 1F56A 2GHZA 5C6WH 4ATTA 1J0ZA 2AQSA 2BSED 3OJMB 1OF0A 4K71C 1Q4NX 1CGXA 4LLVA 3CBRA 5EEVA 1PFOA 2D31A 1FGVL 3QDHA 2GVYA 1OTTD 3VI4B 15C8L 3ZTDC 1CGSH 1RIUH 1NEUA 3NMEA 4DKTA 3BP4A 4I3SH 2XVKA 4U1KB 5D7IE 2GUYA 3GJFK 4MDIB 1I8AA 2JIXD 4FI7A 5JR1L 3BAYA 1AR2A 4ABWA 1FNSL 1Q8MA 3BI9X 4QWWD 3ZN6A 1GR7A 5KZCD 3STZA 1FYTA 4Z7NF 1KJ2H 5F7YC 3N9GL 4WNJA 4UIKH 3BQUA 3TPUA 3KBHE 5TF1H 3VWKC 3LZRA 2AERT 5EZLB 2HVBA 1KTDB 3FT4B 2GIMA 4YQXH 2D9QB 4LCVA 3TO2A 3VQMA 4F7MA 3OJDA 2A9ML 1CXIA 5CEZH 1I53A 1U2YA 3WJLA 1BFSA 2I60L 4FQ2H 3LKNB 1DJGA 3VD4A 4H5SA 4GKLA 1ACYL 1NMAH 1UH2A 2KMWA 2R29A 3V52H 2Q87A 4OY9A 5IJDC 3U4BL 2F61A 3LV3B 4P2RE 5D7JA 1KT2B 3ZL2A 5J9PA 4M6AA 3KNBB 2X4UB 2EIKB 2CBQA 4AIZB 3QHFL 2P80D 5K5YA 2N0KA 3QXTA 1L3NA 5AVVB 4ZNEE 2WLIA 4CMHC 5L8KB 1CDBA 2FO4A 3CHOA 4Z7AA 3CFNA 3T6ZA 1XGPA 2WV3A 3FC8A 1L0PA 3IPFA 4JAMB 4NRYB 5DJ0B 2X2JA 3ARDA 1T1ZA 5GPRA 1B4JL 2BOCA 3RPKA 1HK6A 2J56A 3O45A 4OIBA 5HYJE 4X6BA 3LH8A 4DQAA 1OVZA 4JM0A 1YYMH 2ARJB 3X13A 2WXRA 4H88L 1DVZA 3EH4B 5AUMB 1B4RA 4OKDA 5DA4A 3WE6A 3BVWA 1S2EA 1I3RB 4BFGA 3BUTA 4NB7A 5D55A 2GI0A 4I2XE 2D7TL 2WNGA 4OAWA 4HQQH 3MRJB 2F19L 2P5PA 1FO0L 1A4AA 2XPGB 4LVOB 4YNYB 3CDCA 4HIQA 5DTFB 5AVWB 1XAUA 4XO5A 4IGBB 3TEZA 2EDYA 1Z1WA 4GAYB 4JFFD 3BWUF 1T83A 3TS8A 3ZE1E 1DQVA 3WSQL 2L7JA 4KY2A 2YFOA 3IF1A 4RNRA 3GJFA 1ES0A 3LVEA 5I0ZA 3S7GA 4ZMOA 4KOBA 3C5ZD 4P4KA 2EC8A 3QYCA 5E8PA 2OMTB 1A3ZA 5AAMC 4Z7UF 2NW2B 3MXWH 2OI9C 4YHIA 4JL2A 1TVHA 1UZ8A 3VX1A 2Q8AL 4AQZA 2ZZUT 2EKSA 3D85A 3ARGC 2KUTA 4X9GA 3FZUD 1N2RA 2XICA 3HMWL 2ZOOA 5MI0C 2WZ0A 5B1KA 5KVMC 2R4RH 1PF3A 5D4JA 2Q7AA 4XN8A 5MEOB 4PRIA 3LD8C 4XC3H 3MLYL 25C8H 5TF0A 1BBDH 4FX5A 4ANXA 4MNGE 2EXSA 2J44A 4KUZL 2CNYA 2IGTA 1MSPA 1NEZB 3WELA 3MRBB 4XHJD 1JNHB 1KN4H 4DO4A 1GAFH 3HAEA 5AWNL 4XPFH 3WNOA 1G7PA 1FLRH 3U6XS 4BFRA 4DPCX 4DEUA 4FXKC 2XNAB 2HP4A 3KBEA 1D5ZB 4X6DB 5CEYB 3GS0A 2HFFA 1IVTA 2VZSA 1CT8B 3RKPA 4YFDB 4HKBA 1HXMA 4P06A 3LIZH 3BIKA 1UB5A 1IILE 4MS6A 4PU2A 5IR1A 4AK2A 5IROD 2ZJSH 3K0YA 3CLEL 2J8OA 1EAJA 2Y07H 4HJSA 3NPSB 1E6OH 3VE0B 3U36B 5L8JB 3RDTA 2AF2A 1IUZA 4DZ8A 1AQKH 1S9YA 1MHHB 3E8VA 5AKRA 3IDMA 4OFIA 3I9AA 5A2FA 3UBXG 3NGBB 3T8XB 4KTGA 3APDA 1CYGA 5EO9A 1OAUL 5FYKH 1AGBA 3P9WB 3RIAK 4PGDB 3QIBA 4G72B 4FQXD 1BJ1J 1JPGA 3FTYA 4GY4A 1JV2A 1NFDF 3B56A 4LLAA 4X99A 3MA9H 3PS6A 1KB9J 3DTDA 4OJCA 3U9UB 2WAQA 3BAXA 3VDBA 1T7VA 1F58H 3ECWA 1A4KB 4G1EA 1KEGL 3BKML 4X6FB 3H3BC 4JFPB 4N9OB 2MQ3A 3PL6A 2MMXA 2R56L 3AXLB 3OQ3B 4KTEH 5H94A 5L6YH 1RUPH 2ILLA 2OMYA 3FTSA 4JZJC 3SDXA 4NUMA 4X8JA 4N2GA 4N8VG 5JUEH 2OAAA 2VDRL 3DARA 5EMYA 1IL1A 2XN9B 1U3NA 1PZCA 2ZKYA 2BSEA 1A6TB 2J5LB 4TM9A 4PCTA 1EDHA 1NL0H 4XBEL 5HI5D 2HX7A 2X4PB 1BJMA 1E2WA 1BQLL 3LN5B 3ZL4H 1P4UA 2AEWA 4B5EA 4HXBL 4LPYA 4U1MB 2IEPA 3PP3H 2GTZB 3D87B 4QRFA 3QDGE 5BV7B 4RAVB 2AEOA 1A8JH 2JIXA 2P5WE 3DI2B 3KGTA 5MENA 2PPAA 1JCKA 4MLIA 1A1OA 4OUOA 3VI3A 1YY9C 3IAQA 3QCUL 3VRLF 2XT1B 1RPQA 3MUHL 3TZVD 1ZLVK 4WTQA 1UWEH 3FT1A 1RZQA 3L4CA 4HWEL 4XAKD 4QXWA 3BN9D 1T6WA 3RIFK 4ZSOA 3SSGA 4OGQC 2P43B 3IU3A 5T1LD 1UQSA 1XR9A 2PUQT 1NOLA 2VZ1A 1RUMH 1LP9B 1OV8A 3QRFM 4TSBH 4X7CC 4F7CB 2IADB 4AENB 3TESA 1D5MA 4DP8X 2IWGA 2PN5A 1TJMA 3NFNA 4R5TA 5EEZA 2BW5A 2GY5A 3FB8B 2BNQB 2OR9L 2DQ6A 1WWBX 1P0SE 3OKMA 1E9PB 4G7QB 1ML0A 4N5UA 1K3ZA 1G1KA 4KO9A 2VDMH 5DDHB 4DERA 1FVCB 1MPAL 4Y4KC 3T3ME 3L7FB 2I69A 3HE6B 4HZLA 1JFQH 1RP8A 3LEVH 3BIAX 5D1ZB 2A6JB 4YBHA 3VFVB 2CIIA 2VR3A 5AAPA 5J13B 3VWKD 4NLAA 5CWSA 3BAKA 4HUXB 3L45A 1FN4A 1SHSA 4LEXL 3ESOA 2CCWA 3VVWA 2OR7A 4K9EH 5CSZA 5IB1A 3PJLA 3CFTA 5J6GB 3QHTC 3L8QA 3L81A 2ISDA 2NY7H 1HOCA 2W9LA 1PLAA 3C6SA 4N6RB 2XQBL 3PDOB 5HDBF 3AS0A 3P0GB 4XX5A 3WBDA 3NAAH 4HK3N 1J5OH 3LHPH 1N5AB 1I3GL 5CXPA 5IFHH 3G08A 3V9EA 3WNNA 4TVPH 4M61A 4B9CA 2F18A 2B1AH 4Z95L 4TOYH 3DI3B 4G8IB 4JPIA 3ZUCA 5KW9L 3U0WH 1UWGL 3EJQA 1Q0EA 3MKKA 5C0AB