4LGPB

Ricin a chain bound to camelid nanobody (vhh1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLVETGGGLVQPGGSLTLSCAGSGGTLEHYAIGWFRQAPGKEHEWLVCNRGEYGSTVYVDSVKGRFTASRDNAKNTVYLQLNSLKPDDTGIYYCVSGCYSWRGPWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 24
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgpB00
4G6MH 3IRZA 2QBWA 4PJEE 1FFOA 4ZO7A 1UXWB 5EZLA 3BHBA 5J4MA 3IDIA 4L9LB 4FFVD 3KYMB 1HOCB 4P2QE 3C8KA 4X5LA 2H2PC 5KSAA 4EI5D 4PJCF 2J8UA 2ADGA 5FYKH 4AMKH 2ORBH 2Y7QA 1I8MB 2VLJB 3GUTB 3GMOB 5C2UB 1MJJA 3VWKB 5I6XB 3TWCH 1ZMYA 3WL9B 2BRQA 3VU2A 4XBEL 4D0DA 4ZG1A 5T33L 5A2JH 3PIQA 1LWRA 4X98B 3RWDA 3SY0B 4M1CC 1VSCA 1QFUL 1INEH 3OXSA 3OKDB 1EEYB 4Y5YA 3NN8B 3CLFL 3NFNB 4JY4B 3K8MA 4Z78B 2V17H 3QDGA 1JJUA 1SM3L 3S8WA 3Q1SH 2FX9L 1HSAB 4WHCA 3LHPH 15C8H 5CEZD 1G9ML 1KJVB 5HYJD 1J12A 2DBLH 3T8XB 5EU6B 4Q6IA 4UU9B 5IF0A 1HXMA 3VFMA 2VJXA 2AV1B 1NC4B 2EDNA 1O7SA 5DJ6A 2VN7A 1F42A 4QRSA 3N06B 5IHLB 4ELKB 4FFYH 1WFTA 1RVFL 3B8SA 1MCRA 4QEGA 3QO1B 5T3ZH 3CFCH 4PV8A 2OK0L 1TFHA 2AP2A 3L9RA 3L5WB 2E3VA 3OJDB 5C0GA 4DAGL 4Y1AD 5DRZA 1T0NB 1JGDA 3LQAC 3WS3B 1T1WA 2QHRL 1RZGA 3JTTB 1MJ8H 3D69B 5T1KD 4D9RE 5IWLC 3M17B 1R3KB 3ARQA 4XNXH 1FPTH 1MVUB 1EO8H 3BYTA 3I6LE 3V0VA 2GHWB 3DHMA 3JWOH 3Q48A 1OL0A 3EO1B 3CC5A 1X44A 3WFZA 2WBJC 3NCJH 4PRDB 2XFXB 2H1PL 1XAUA 3QFJD 3DIFB 3NIDF 3VRLF 1N8ZB 2ZUSA 3W2DH 3FTGA 5IQ7H 2CKBL 1KJ2H 5BRZA 1RUQH 4O4YH 1DN0A 1TVHA 3BP4A 4XVTH 4QRQA 2MTPA 4R97C 4HBQA 3P30L 2JCCE 4JPWL 1NDMA 2X10A 4HGMA 2C4FT 4X5XA 1MCCA 1I75A 2GT9B 1MY5A 1LQSR 1NEUA 4QHLB 1AO7D 2WBJB 5HI4D 5DMYA 5L8KB 3TO4D 4M9PA 1T4KB 3TBYA 3VGGA 3KS0H 5BCAA 1P84K 5E08H 3THMH 2E6PA 2BVOB 3RKPA 5JPNA 5FM5M 4UMGA 2PNDA 3MRLB 3PWPD 3BSZL 2R15A 1XFPA 1LD9B 3HNVL 3ZTNH 3ZYJA 2OBGA 4R97B 5ESVA 1T03H 4XP5L 3MRNB 3O3DA 3QWRA 5IT2L 3RWCB 3W0WB 3T2QA 4RQQA 4WHYH 2OMNA 1L7IH 2EIEA 1AFVL 3VXRE 1CFQA 3KXFD 3GSUA 4C54A 5GS0L 5GISL 4PJDA 4HWNA 5EFIA 3ARSA 5DJXA 3JWDL 3DX7A 2O5ZL 4Y16C 3LH2L 3BXNB 4G6FB 1SYSB 5DD3H 3UTTB 3BEVA 3D39A 1UVQA 1U93A 3EO9L 2JIXA 1OSZA 3ARYA 3RWHB 4MQ7B 3VFSB 4WU5A 4HXBL 4UNTA 5HI5C 3W9DB 4NWUH 1AD0A 1SVCP 5CZXD 4JFXA 3VD5A 1EHLH 1HHIA 1IGCH 2BNUA 1RURL 5C71A 3CFBA 5EO0A 5FECB 2WQRA 4HFUL 3L3GA 1MNUH 4HX1B 4Y4FD 2WBKA 4HG4K 3LQZA 1UJ3C 4M6MH 1MFDH 4O5LH 1GZQB 2N7AA 1QRNA 3QR2A 4Y16B 3LEVL 2C5DC 4R0LA 2ICCA 4G7YH 4NQSB 4FOMA 4O2EA 3IAGC 4KI5C 5B8CA 4FFZH 2EKJA 3GI9L 2QSVA 5FKPA 1GIGH 4GW5B 4TRPL 1H5BA 2IWGA 1MI5D 5JXED 3O4LD 2CIKA 1RJYA 1EFXD 4PJHF 4XWOD 3D9AL 3TEUA 3GJFB 3VG9B 1DDHA 4OF5A 1RMFL 1JRHI 2CDEA 1BD2B 1A6UL 5ACLA 4F9PA 4CVZB 4QT5A 5IQ9B 3AAZA 2X4UA 1QKZL 1RU9H 1MFBL 4V1DB 1TTUA 5EBWB 3ARDC 3QPQD 3NAAH 1NFKA 1BEYH 3HE7D 1A3RH 3PGFH 5BS0D 1X4ZA 3EZ8A 2VDPL 1CVRA 3DURA 3QPXL 5ACZB 5I30L 3TFKD 2OR9H 5DQDH 5GRXG 5I1IL 2CIIA 4M7JH 5F7LB 1IC7L 4L1DA 4EOWL 3DXAE 3FRUA 4OGAD 4LLWA 4O51B 4GQ9H 1XCQA 2QADC 1QSFE 1B2WL 4EXKA 4G6KH 3HPJB 5JHLH 2CMRL 3ZDXF 3NIFE 3O41B 3SGEH 5CJQH 3L3KA 5ERWA 4S1DC 2XRAH 2QKIB 5EORL 3L7FA 3S96B 1I8LA 4YHLL 1VADB 3BMWA 3SCMC 3I50H 4N8CH 4Y4HD 1MCKA 4GSDH 1JZ7A 1AI1H 2FATH 4JFFB 3PP4L 2NYYC 1IAOA 2DLFL 1L0QA 3MRKA 5H8DA 1FNSL 3AXLA 5C07D 3VWJD 1HHJB 2QADB 2YPLD 4ELME 2CO7B 4Z76B 2JJWA 1YN7A 3EKCA 4HIXL 4EI5A 2G5BB 2X2YA 5FEBA 5DQ9B 1AXSB 1H0DB 3FB6B 5E5RB 1UM6L 4ODXB 4OV5B 4DFIA 2W9LA 1I3UA 2WZPD 4RA3A 5HVWA 4R2GD 1PZ5A 5SX4I 5CBEB 2J88L 1SVZA 5KTEL 4KKBC 1FNLA 5L2JB 4GAJL 2IBBA 4PRHD 3RWFA 3EYSL 5HD8D 1SEBA 5DT1L 2HH0L 1KCSH 4L8BB 4NZRL 1S7UB 4RAUB 4AEIL 5M95B 5FYJE 3WXWH 5LKNA 1D5MB 3BKCH 4BH8A 3W82A 5IB4B 2OSLA 1NKOA 3EDJA 4XXDA 5TFSL 3PHOB 5ENWA 2XA8L 3VDCA 1NJ9B 3QCTL 4KHTH 3BAEH 4ONFL 4U31A 3FMGH 4QRUB 3MYJB 5HYJA 1R3LB 2VXUH 3SOBH 2IG2H 3VGHA 5EZOL 3DHJA 2DOCA 5K59E 1IGTA 3GHEL 4MCZA 1PKQB 1V7ML 3DVNB 2DWDB 4B53A 4JM2D 4BFIB 4WY7H 3MBEA 4TNWF 2I9TA 1QYGL 3LKQA 4QRRB 4NT6A 4JRYB 2VABA 4KZDH 2BX5A 2E5EA 4WNQB 3U7WH 2FECL 2YD5A 3HI6H 1ITCA 1LDPH 4LRNL 2VITA 5GHWH 2PCPB 5C8JA 1M7XA 1A3LL 1X7QA 3ARXA 4ZPVB 1YN6A 3CH8A 5AZEL 4OCSH 4C55A 1QFWM 1NMCC 3BN9C 1Y6MR 5T1KA 3VI4F 1NCNA 4P9HC 2P49B 2VNCA 3RKDD 4PJIA 2RFXA 3PGDA 5C7XL 1FZOB 1YYMH 4YBLC 5IR1B 1BREA 2FL5A 3QEQB 1FCCA 5H37G 1P7KA 5C0DA 1N0XL 2UY6A 4XX1G 1DCLA 3P9LB 4X99B 3VXOA 3NZHL 3QAZB 5GJTL 4NQEB 3NIGF 4KJQC 3C6LB 2J6EH 8FABB 1INDL 3TPUB 4IRJC 2Q86B 4ZFGH 2V2TA 4GG6F 2AJZA 4OUOA 1KPVA 2GJ6D 1CGXA 1JYVA 2M8XA 4KK9C 1V3LA 2CO6B 4YBLB 4A6YL 3OKKB 4OIIL 1MCOL 1LO5B 4OM0H 1RPQA 2NY6C 5D2NE 5F7NC 2W9EH 3LRGA 4KK8D 3TO4A 1MREH 1XF5A 1NGZA 2H2SD 3LKSB 3FB5A 4GMSH 4UZGA 4WEBH 1MWAA 5CMAB 4YBQD 1R0AL 3GKWL 1I8KB 2ZJSH 4X9FA 4ZOAA 2VXTL 3PWPA 4OLEA 2GJZB 3ULVL 3ZT6A 1ZLSL 1ZTXH 3EBAA 4M7KH 4G3YL 5FM8A 1WFUA 5TQ2L 5SWSE 3VJ6B 1SBSL 5EBMB 1N64H 5ICXA 3F65A 4YHZH 2NY6B 3HKFA 3HG1E 3KXFA 5CIPA 2BDNH 1UZ8A 5JQ6L 3WIIL 3GMMB 5KVMC 4YDVA 1CL7L 4F33B 2YUZA 3REWA 2DICA 1MCPL 2DLIA 4ZUUA 1QACA 4NDMB 3NCYS 4HGKC 4JFYA 5AD0B 3OZ9L 1A2YB 4PJCB 3DUHA 3RAJH 3U83A 3ARBC 2WUBL 5BVJB 1KGCE 4G9FB 4DVBA 4R4FL 5TF1H 2VDNH 2BVUA 3FRPA 3M1BA 5HHQA 1JVKA 3P77B 3HAEB 1J7VR 3T0EC 3JV4A 1NCDH 1PFCA 4JANA 4QXGH 3QUXC 3K4AA 4AIXA 3R4DA 1TJIH 5A3ID 2Z93A 2X40A 4Y4FA 5GRJL 1LILA 4L8CB 4C83A 4NWTL 1X5KA 5IV2A 3O2WH 1YEJL 5I1KH 3BWAB 4B41A 5EO1A 2BCKB 4OCWL 4ODVH 2ZOKA 4FXKB 3ARBB 1CFSA 3ET9F 2K9UA 2B1AH 4FG6C 3K2MC 1C5BL 4I5BB 5DFVC 5JXEA 3O4LA 4UUJA 4APQC 2AV7A 1BIHA 2ZUYA 1KLGA 3QUXB 3IDYC 1YEHL 2DQCH 3TBSA 5J9PA 4MGXA 4MWFB 4YUEL 2YMXL 1T20A 3G6JE 3HB3D 1WF5A 4WWKC 4G8GB 1JWSB 5HGDB 1NCWL 3IXTB 5C0NC 3HE7A 3QWOA 3PF2A 5HGBB 1R5WB 2DLEA 4O2FB 5BS0A 4X6CA 4D0BA 5I1DA 2E27L 3JWNC 5F89B 4APQB 4JG0L 3EOTL 2EDQA 2MPAH 5BVPH 2BSRB 3B83A 4XVJL 4KKAD 3IDYB 4KKCC 5JLZB 3KPRB 5MEOB 2XN9E 3BDYL 4YDKH 4KQ3L 3NTCH 1J0KA 1R5VB 5BJTA 5EC2B 2VYRE 4WWKB 4LPYA 3SPVA 2GI7A 2HT4C 2Q6WA 3IXAA 4JREB 3GSNB 3S3PA 2FJFA 1KYOK 3MXVH 4LEXL 4U1NA 4P5KA 1NBVH 2Y5TB 4X6BB 4UB0H 4Y4HA 2JJUA 5GZND 1BWWA 5E9DB 3UXFA 4ZO6A 2VXSH 2GIYA 3HPLA 4U0RC 1BQHB 4MXVF 1KTRL 5C07A 3VWJA 4JZJB 1ACYL 4KI5E 2YPLA 4FZ8H 4KMTH 3U36B 4TULH 5DVLA 5J6GB 4X7EC 3TN0D 1W8NA 3G5YB 3H3PH 4WI6A 2G75B 5IOPB 2ZSWA 4ZFOB 4N1EA 1MLBA 2W0PA 5DMIL 3QG6B 4JFQB 4LCYA 2GY7B 3H42H 2Z8RA 4KRPD 1EZVY 1J0YA 2P8LB 2QHLA 4X6DF 4NQXA 4KDVA 4MAYC 4U0RB 3DMMD 2YWYA 2YPVL 1ACZA 4OZFA 5TJWK 3MA9H 1TVBB 2BOBA 5MENB 5HPMB 1BAFL 4I2XE 4BSVA 4HZAA 4PREB 3P4NB 4KV5E 1NUFA 4M5ZL 4MNGA 3JXAA 1CFBA 5J89A 3C2SA 1AGFA 2APTA 4MAYB 4QRPE 3O9WD 1A6WL 5IUSA 1VGEH 3MV8E 1BJMA 3MUY1 3ESVF 4FN0A 5GRUL 3B9DA 4L8DB 4ZD3L 4KMLB 4OLVL 1E28A 3W39B 4JEGB 3UJJL 5GGQH 2FWOB 2BC4A 1S7WB 4KK6C 4KGJA 4IHOB 1R3JB 4LARL 2UWEF 1BQSA 4UOJA 1FFPA 3IDMA 4CUCA 1OCWL 2VQTA 1CBVL 5D7LE 1Y6NR 4AEEA 3K8KA 1YJDL 2FHBA 1PD6A 4HJGA 3VFRB 5A40E 3QUZD 4PJHB 3VXUD 2R2CA 2P45B 5DWUL 4ESKA 4H25B 4L4VB 5IHUH 2AXFA 1WTGT 2ED8A 5HYQA 1PX4A 1FG9C 5C9JB 4YR6A 5ALBL 5INDA 1XGYH 2DM2A 4OAWB 2C1PB 1A7BA 4PRNA 5CBAB 1ZT4A 2DD8H 5IESL 2YS4A 3MOBL 3SKOB 2GJ6A 1Z3GL 4LIQL 5BXFB 3TA3C 3L6FB 4KZEH 4J3TA 4DVRL 2HFEA 4WU7A 4P4KB 4X7TB 3QH3A 4UINH 3T08A 1UG9A 4F7PB 1Y6KR 2IFFH 5DJ0B 4XNMB 4LASL 1GVIA 1VDGA 4XPAH 3GBML 3RZCC 1ZT7B 4HWBL 5AWNL 3GNMH 4U1JB 2CLZB 4WW1A 3MUZ1 3MUHL 4TTGA 3T3ME 4MXQD 3FQWB 3OXRB 1ODAA 1FN4B 2Z31D 5F7DB 4FP8L 1CK0H 1IAIL 3NFSL 4KVCH 5CFHA 5IW6A 3ARED 1JN6B 3L7EA 2R2HA 4QYOA 3EZJB 3ZYIA 3RFZC 5IJKA 1JZ6A 2AK4D 2BOCB 3RZCB 4QXUH 3QG7L 2EXYC 4X6FB 2AABL 3U1SL 4AG4L 4P3CL 4PJAF 1KIPA 4F2MB 4P57A 5IB2B 4WI8A 1NSNL 1KIQA 4HF5H 3MV7D 3EAKA 1GGCH 5DDHB 3KPSE 4PB9L 4GRMA 3EIFA 1OLLA 1V3KA 4PGEA 4NN7C 4MXWH 1VGKB 5DJYB 5D7KE 5IG7A 3QQ4B 3G6AA 3BIKB 1OOAA 1UQSA 5B39B 1FNAA 5LAXA 5SV3A 1EXUA 2AEPH 2VDRL 3FRPG 2ZCHL 2B1HL 1BFTA 4CRPA 1A4JB 1S5HA 4J3WA 5JOPD 1CD1A 4HDIA 3CUPA 4XCEB 2HJFA 3EJYD 2IPTH 3UYRH 3FO1B 1UADC 1DSFL 2VERN 2ZG1A 4KJWC 3VXPA 1KB9J 4FQIL 1QHOA 5KSBB 4RDQF 1U8QA 4MQXD 5C08D 5B38A 1MRDH 2DM3A 3HZVB 5IBUB 5TQ0H 5DVKA 1CIUA 4PG9B 5E6ZA 5GRZA 3HC4L 3ILPA 1UH3A 2HMID 2CDFA 2HA1A 3I3BA 3GMNA 3RDTC 5SV4A 3X3FL 1IEBA 5GGUB 3IYLW 5E8OA 2HTKC 3PABA 1EERB 1OTSC 2FO4B 3IDJA 1XGTA 4CDHA 1XGPB 2XZCL 4LVEA 5B21A 4ZNEE 3GB7A 4OI9A 3BQUC 2ADJA 3TZVC 2D0HA 2VQ1A 4KKLC 4O02L 2GSGA 4OLWH 4BYHA 5E24E 1SJVA 2P46B 1XCTA 4CU8A 4E41E 2O5YL 1KJ3H 5HJ3B 3QCVL 1FV1A 1Q0XH 4Y19A 5K9JL 4RMSA 4ZAKC 1P84J 4MA3B 3WNKA 4TUKL 5F7YC 3E1F1 4YIQA 3L1OH 3T0EE 2OX5A 3ESUF 1UXSB 5ESQA 2NX5D 1FVDA 2FRGP 5DUMH 1EEZB 3BQUB 3TZVB 3QULB 5I0ZA 4X5WA 1W0VB 3G5VA 4DN3H 3G08B 2A0LC 4PYGA 5EOCH 4GG6B 3MLXL 4NNXA 5IBTL 3WN5A 5IJVA 2W92A 4P2RB 2FEEI 4PJ5E 1FG2A 1J5OH 3KG5A 4UDTA 3P4MA 4XBPA 4ZAKB 3TN0A 2IQAA 4N5EC 2H41A 1LEIB 3WFHB 3H3BC 4HCRA 3GJEA 3QDMB 4GW1B 3GIZL 2MCPL 5C0AD 12E8L 3DUUB 5HDQL 5EDXA 3GRWA 4U1SB 1FHGA 1OY3B 3L3IB 3A0OA 4OD1H 3KAAA 3DMMA 5FO8B 3V5DB 4JB9H 1I7RA 1QSED 5KOMC 1NLBL 3GM8A 3LZFH 4GS7C 1AXIB 3RBSA 1UCBH 3GSVA 4MDJB 4FA8A 4OLYH 5FOBB 5F3HA 5BQ7B 4LSSH 2NY0C 1I7TB 4F7MB 1QO3B 4HG4J 4G8IA 1MFCL 3NIDE 4IRZL 3VRLE 1BBJA 3E0GA 3HR5A 1T83C 1WCBB 2DB8A 2YRPA 4UDUB 2LAGB 1I7UA 3FO0L 1FQ9C 3UC0L 3O9WA 2WQ8A 4KUCF 3SO5A 5IB1A 2V2WB 3O81A 4LU5H 5HGAA 4GS7B 4NUJB 4Z7WA 2CH8A 4JJ5B 4KROD 1IM3B 2ZPKH 3T09A 1A7PH 2X7LA 2KDGA 4GRWH 1RZ8A 5CHNB 5GGRY 3ZKND 3R0NA 2QSQA 2ITCB 3IFPB 1NLDL 4HV8B 1I1YA 2XACC 4GKSB 4K8RH 1VKXA 3TYFB 2J2ZA 3BT2L 1XR9B 3P3YA 2HYMA 1NBYA 5IFAH 2D9QB 4HT1H 1FYTD 2UV3A 3WBDA 5FYJH 2J7LA 3BPNC 3DSNA 3QUZA 3EGSA 1JPSL 3UTSE 3N85L 1A1OA 2EDOA 4I3GA 5D93C 5E56A 3G5ZA 2JE8A 4N0CD 5ANME 3QFDA 3IDGB 4NJAL 2EDFA 4M7LL 4J6RH 1HDMA 1KIRA 4JO3H 4M93C 1Y18B 3PL6B 4X4ZA 3VFVB 3MJ7B 3U4EB 3MLRL 3ARFC 4R26L 5F9JA 4I18A 3MNWA 1B0GB 2QSCH 3I6GA 5A16B 1CI5A 4JDTH 1S7XA 1HQ4A 2VDQL 4XH2A 5D93B 1HILB 2DQUL 4P2QD 1XGQB 1K8IB 3FONB 2PXYC 4LLDA 2IH1B 5DJDB 3IVKA 3PV6B 1EDQA 1LK2B 3KYKL 4YWGL 4M93B 1T1YB 4PJBE 3QIWB 3P9MA 4F8TA 3KPOB 2B4CH 2OTPA 3ARFB 5FKAB 5T1LB 5JW3L 4L4VE 1A02N 4MS8C 3GSNL 1M6OB 5I1CL 5EZJA 1NCBL 1MH5A 1WUNT 4DGYL 5EN2A 3O0RL 3VFTA 1F58H 5T3XL 4CJ1A 2V9QA 5DHVB 3QQNA 2PXYB 1DEDA 2ICWA 3E6HA 2BVQB 3TNNB 3QDJD 4I77L 4E0RB 3CU7A 4POYA 1D5IH 3CVHL 2X4TA 4AL8H 3V4VL 3GSOA 3MV7A 3CFEA 5I8EB 3MGOB 4GT7A 3X11B 2NTFB 3NZ8A 4XCCH 4JZNA 1DP0A 4OFIA 3NA9H 1ZGLM 4ZFOL 3U2SA 2VL4A 5D7IA 4FQHB 1S3KH 3M45A 1JPST 4H26A 5FK9A 3C5ZD 4V2CB 2COQA 4X6DB 5FIEA 1KXVC 1F4XL 5IROC 5T1MA 2RIKA 4M7LT 4XTRC 4F9LA 1AE6H 1TPXC 1N6VA 3C9NA 3FFDA 5EG6C 5MERA 3ZDXE 4NCDA 4DUXA 3BPCA 4JO4H 5DZNA 2ZCKH 5DD5H 4D3CL 1FRGL 1IT9H 1W0WB 4HFWA 3T77A 2DQEH 3S5LA 2RCSH 5EU4A 4EDWL 1K4CB 1U8HB 3R8BB 1NFDE 4XMPL 3VFPA 4D9RD 1XF1A 3TIDB 2D31A 5E8EA 5C08A 4R7NB 4LHUA 4EUPA 4U1LA 3MJ8A 1NC2D 3OAUL 3MREB 2B20A 3O3BB 5E2UL 1UFUA 3FT3B 5B38G 1EAPB 2YZ8A 5C0CE 3V4UH 3SJVE 4XI5D 1KTDA 4X9BA 5IEKA 1I9IL 3FN0H 3N0PB 4M6OH 1F00I 5D1QC 3R0MA 1O5DT 5BV7L 1VACB 3DWTA 5FAAA 1HQRA 3J8F7 3LEYL 4L4TB 4LCIH 1OAZL 2UWEB 5JNYA 4PJGE 3WIFB 2X9XA 4EI6A 4E42A 2FYYB 1SJHA 1KB5L 3MNVA 1KN2L 2WWKT 5D2LA 4U33A 4HIIA 2OQJB 4MNQE 1DFBH 1U8OA 2IFGA 4W4OA 4Y2DC 4PJ9B 3D3VB 5D1QB 4RIRB 2WP3O 3EJJX 5I73B 4WFHE 1K5NA 3B2UC 1O0VA 2NX5A 2FGZA 2ITDB 1BZ7A 3X12A 1WEJL 1DEEB 4JN1H 1JPFB 3MLSH 1X4XA 4GAGH 5FFLA 1OAQH 5DTFB 1REIA 2Y36L 5DJ2A 4P4RB 3ULUL 4G8EB 3KR3H 4QOKE 4Y2DB 1T3FB 5IW1B 3BP7B 1YEGH 4JGUA 2EIDA 4WGVB 4TOYH 1YEDA 3U9UA 1MHHB 4TTDD 5KSVB 4H1LB 2HFGH 5C0AA 2AI0L 4D8PA 4OF3A 3VI4E 2BHYA 3O3EB 4G6AC 4UQ3B 5JIHA 1JGLH 1T2QH 4PJFA 1YECH 4S1SL 3QXVA 1QSEA 1HCFX 1BJ1J 4XPTL 1R24B 5JOEA 4LLAA 1HHHB 3MLYL 3REVB 4AIZB 1YQVL 5CCKL 1UKTA 4OIBA 5EZLB 4NNPL 5IGXH 3RIFF 1FAIH 3SDAD 4PJAB 1QD0A 5DVOA 1ONQA 5ITBH 3QZWB 5KSAB 2DM7A 2J8UB 2ADGB 4KAQL 4MJ6A 1NBQA 4N0UE 2Y7QB 4HKBA 1TVDA 3IFNL 1MJJB 1MOEA 4YFEA 2JLLA 3TJEL 1ZA6A 5E99H 4JM4L 4D0DB 4XNUH 4I0PD 3PIQB 3RWDB 4R90L 1N26A 4UT9H 3BD5A 4NRZA 4HWUA 5CJXA 3CXDH 1BLNA 1F97A 3RX8A 3CAFA 5IVOA 3QDGB 4K94H 1JRHL 2OP4L 2WIIA 2P5WD 3GI8L 1FYTA 4NOFA 3RVTD 1MAMH 4KFZC 2D7NA 4M48H 1S9YA 4XMLL 4NFBA 3WHE1 4ODTL 1IL1B 1CLYL 3LKPA 3BMVA 5IF0B 5I1JL 3WD5L 3DXAD 4G8FB 1MAKA 3FQTA 3TCLB 3O8XD 1YPZF 3S36X 1MQKH 2OI9C 4NNYA 1QSFD 1RIUH 3V4PL 5DJ6B 4F7CA 4M8QA 4GMTL 2Q1EA 4PGBA 1KEML 4N8PA 2K7PA 2QR0A 1YMMB 1K2DA 4QNPF 5LCVL 4PV8B 5C0GB 1U8MA 4L3EB 2VR4A 1X3DA 4U1IA 2HTLD 2RR3A 5DRZB 1T0PB 3INUH 1T1WB 2Y1VA 4Z7NF 5L88H 2OI9B 2DMKA 4PLKD 4P2QA 5E2TH 5C9KA 3UDWC 1AQDA 3O6LH 4DCQA 3WHE0 3V0VB 1S5IH 2OLDA 4GQPH 1V3MA 2XQBL 1YEFH 4ALAL 3AMLA 1HYSC 5DQJA 1E4XL 5MP6L 3ARTA 4FQJH 3GEWB 4NHCH 5I76A 3AGVA 3ZE0E 1T66C 1OARH 4BA8A 1LP9A 5DA0B 1NAKL 4OZIA 5BRZB 1DN0B 1TVHB 2E9JA 3BP4B 4QRQB 2DTSA 3QUYD 3PHQB 1KG0B 2DJ4A 1NGWA 1NDMB 3QDJA 4I9WE 4YX2L 2D7MA 3ARWA 4RBPH 3V9FA 4X5XB 5EC1A 1IC5L 1FL3A 4F57L 2BNRE 5I18L 5HY9A 1ZE3C 4O2CB 1IEAA 4D94A 7FABH 2DKSA 3TBYB 1J8KA 5GRVL 5EBLA 3HZMA 5JPNB 3MNZA 3SE4A 3PXHA 4NIKB 2AAVA 2EC9T 4HJJH 3LKOA 4FQLH 5ESVB 5I16B 3TLRA 3O3DB 4U1GC 4YHNB 3S88H 1S7QB 2VLJD 3VWKD 4RQQB 3IDNB 1L7TH 4FQCH 3QSKB 4M6NH 1CFQB 3LQMA 3DYMA 5IB5A 1INQA 5JMOC 5J3HC 4PJDB 1EV2E 5EFIB 5DJXB 5KS9E 3KLSA 4YDJA 1K8DA 1BBDL 2JELH 1MJUH 3IU3B 4CL7A 1NCTA 2H2PD 4RISL 1JUFA 5TE6H 2EEAA 3D39B 4U1GB 1UVQB 1UJTA 2IMNA 5DD6A 1NC2A 4XPHH 4U1MB 3E6FA 2P24A 3FN9A 4M9OA 4O9HH 1JFQH 2HKFL 1H5BC 3IJSA 4LCUA 1FNHA 4RMQA 4EUPG 1AD0B 2D03H 4OCYH 1HHIB 4I3RL 2BNUB 4M1CD 3CFBB 1UA6L 3JBG7 3UPCA 3F58H 1TJGL 1NBZA 3MXWH 3WFDL 4MA8H 4R0LB 4NCC1 2JCCA 4O2EB 3HMXL 4NKIH 5B8CB 2YN3A 5FYLD 1JTPA 4MA7L 1J9CT 5FKPB 1OAKL 1HI6B 1H5BB 2HT3C 5J11B 1PY4A 1WIOA 4LDOB 3FOMB 5J1SC 2R1XA 1DDHB 2H45A 3HFMH 3U9PH 2CDEB 1LO3L 1AXTL 1NGXA 5IVXF 1IGYA 5IMOA 4OGZA 4QT5B 2UZIL 1A6ZA 3AAZB 2X4UB 4BZ1H 2F54B 5KW9L 3ES6A 1Z0NA 3ISWA 5J6HB 3DSFH 4MX7A 3SDXE 4PBVC 4DKEL 1TXKA 4P46A 1GL4B 2GAZB 1CD9B 5FDWB 3HG1D 5JA8B 4UI2A 4JHAL 5JOFA 1U8JA 1B9ZA 3LB6C 1ZLVK 4XVUD 1P1ZA 2CIIB 1QLEL 4ZSOE 3AU1B 1YY9C 5FCUL 4LLWB 2EC8A 3CFDA 5F93C 1XCQB 3EDDA 1ZS8A 1A14L 2JJTA 5CGYC 4WW2A 4IBLT 4PTTA 1DBJL 1FBIH 1J0ZA 4HMEA 5ECJE 1W72L 2GCYB 3GBNL 2WBJD 1S9WA 3L3KB 4L8SA 5ERWB 3U0WL 4PRPE 5T5FH 2YXMA 4YK4B 3FJTA 4RZCA 1CF8L 2X70A 3LPGA 5A2IH 4IMLB 1FNEB 4JFDE 1I9RL 1IAOB 2LFGA 2HAZA 3KLHC 3MRKB 3SDAA 4GOSA 3AXLB 5F9AC 3SGDH 3W0WD 4YHKH 1YN7B 4PY8I 3I2CL 5JXAH 5JW4N 2KUTA 4FMKA 4JQXA 3HZKB 3FQUA 3EYQC 2DLTA 4WI3A 2R2BB 4Z0XA 5ALCH 1A5FH 1H8NA 1MFEL 4ZS6C 4F58L 2W60A 3L3HB 2I60H 1PZ5B 2DN7A 4CADA 4I0PA 2YUWA 2F5BL 5DJCA 2PO6A 4OZGA 5DLML 5E8DH 3RPKA 3RWFB 3PGCB 4G6FD 4FQQB 4M8VA 3P11L 5DHXB 3UTTD 4J8RA 3LIZH 2X1PA 4ZDHA 5JDSA 4PR5B 2A6DB 1WC7A 3MBEC 4XP9L 4BH8B 5TDPA 1MCWW 4WV1A 2P5WA 4JFEB 1GGIL 2H26A 3MROA 2A1WH 5DMKA 3WO3B 2A74A 4HWEL 1J88A 2M2DA 1YYLH 5HYJB 2OL3A 5L6YH 1U95B 4D9LH 3MRJA 1QSVA 4Y16D 3DXAA 3O8XA 1ND0A 4MCZB 4HPOH 1QSFA 5IMKA 1L9NA 1CE1L 3MBEB 2I9TB 5HI5D 3LKQB 2CKNA 4FFWC 2VABB 2XNAB 1CXHA 2ESVB 3AM8A 2VITB 1H8OA 4HGWA 1BD2D 5C8JB 3MO1B 1LNUA 5DD1L 1CT8A 3N1FC 1YN6B 5DEZA 4JAMA 3KPQA 3QI9A 3VI3F 3VFOA 3KYAA 1CIDA 4JPVH 5E7BA 1NMAH 4HIJB 1MHPH 3HI5L 4KI5D 5E2WL 4ELMA 4PJIB 3PGDB 5L9DH 4LLVA 2FL5B 2OTUB 4OB5H 4ZOBA 1P7KB 3WKMH 4I0KA 2ICEA 3VXOB 1FO0H 1SY6L 2X09A 1SBBA 1A1NA 1UEMA 1H3XA 5CEYB 1QFPA 2HN7A 2A9ML 4B0MM 3FKUS 3TT3H 2AJVH 5CJOH 4P2OC 3OKOA 1ZSDA 2WW8A 2VDMH 3ARDD 3TH4T 2ATPB 3CX5J 2AJZB 4U2ZA 1KPVB 3V6OE 4EXPX 1QBLL 2R4SL 3QUYA 4DOHE 2BRRH 4PLNC 3NMEA 3QDHA 1MLCA 5GSRA 3WDHA 5F88A 4GAFB 3CZFB 1HKLL 2EYSA 3NH7H 5ISZE 3BP5A 1IC4L 2YK1L 4HS8H 3ZKXC 2VLRE 3QNYB 2I26N 3QT2A 1XF5B 1NGZB 3FB5B 4JN2B 4EKXA 1Z0MA 2IQ9L 4S2SA 5LXGL 5LBSL 4QRPD 4JZOB 2QADD 4ZXBA 3SE3A 1OT2A 3MV8D 1M1SA 4LDEB 3V6ZB 1I8MA 1EZVX 4S1DD 3VWKA 5BO1L 2VLME 4WJ5A 3MJ9A 3SCMD 2UY7A 5CIPB 4YXHL 1G7IA 1UZ8B 2YEZA 2NYYD 4X98A 3SY0A 4YDVB 5EZIL 1U8IB 2X6MA 4OLUL 5DFWH 3OPZH 2YR3A 4XBEH 5T33H 3KPTA 5EUOE 4WUUE 1U6AL 4JRXE 1T7WA 3CFKB 3TV3L 3NN8A 3BKYL 3NFNA 1QFUH 4JY4A 4B7IA 1JNLL 4RSVA 5KVDL 1SMOA 4Z78A 3S3SA 1URLA 3CLFH 5IBLC 4DVBB 2ICWI 4WRLA 3M1BB 5HHQB 3RZWA 1NCUA 1KJVA 1SM3H 2FX9H 4RGNC 3JV4B 4KKBD 3T8XA 4L3CA 1QVOB 3LDBC 1G9MH 4MB5A 2Z93B 3NCFB 5BZWB 1A6AA 2AV1A 4C83B 3RNQA 1CTNA 3L95A 3OF6D 5EO1B 3ROOB 4QRRD 3KPLA 4JRYD 2ZOKB 3QO1A 1CFSB 4JO1L 2P7TB 2C7UB 4WHTA 3FT4A 1B0RA 3L5WA 3O4LB 4UUJB 5D2NA 3UTOA 1PEWA 4XAKE 1KLGB 2OK0H 1RUPL 3LDBB 4DAGH 4EN3C 4YH6A 5J9PB 3M17A 1YPZB 4OZ4B 5F1KC 2UVEA 2QHRH 4OGAC 3BZDA 4BFBD 1T20B 4NRYA 1PY9A 2PR4L 1AGEA 3QEQD 4J3UA 2XZAL 3EO1A 5JW4M 4RGOL 1J0JA 2Z92A 5HDOA 2FLRT 1DLFL 1F3DH 1OB1B 4PRDA 3HG1A 2EEBA 4NQED 1PEZA 1JYXA 3SGKC 4R6UA 3BN9D 2H1PH 5IWLA 4UT7L 2E6JA 4BJLA 1C7SA 4MB4A 5BJTB 4MB3A 2HJLA 5D7JC 2CKBH 4PS4L 3K8LA 4G6JL 5C2BL 3P30H 1I3GL 4JPWH 2DYPB 4RAHA 3JZ7A 4LHJB 4ORZC 1TNNA 4YGAB 2Z9TA 2FJFB 4KJQD 5D7KD 4BSWB 4U1NB 4P5KB 2DQDL 1WBXA 2Q8BL 5F7HA 3I85A 5ESAB 3QJHA 1G0XA 3TESA 4IRJD 4WI4A 4PGJA 3BWUC 2LV4A 1LD9A 4KQ4L 4KK9D 5D7JB 5C07B 3VWJB 4R4BB 3BSZH 5HI3C 3RWCA 2EE2A 2YPLB 3HNTL 5F7EL 3W0WA 2NY6D 3RIAK 3FOLB 2ENYA 4TVPD 5IT2H 2ZSWB 2AEQL 3KWWA 3T2PA 1MLBB 4PY8J 4RMRA 1AFVH 4LCYB 1L4IA 3QXDA 5GS0H 5GISH 1KF9B 4KVNL 2XTJC 4LCWE 4NQXB 3JWDH 1S9KC 5FHBL 3BXNA 1PG7L 3DECA 3UTTA 4OZFB 3RWHA 4QHUB 4MQ7A 3LH2H 3VFSA 2E9BA 3EDFA 5KJRL 3EO9H 3W9DA 1I9EA 4BSVB 3DBXA 4HXBH 4WFED 1MIEL 5IEHB 1CFTB 3CSPA 4HX1A 4MNGB 5JIIA 5ICZA 1AGFB 3SKJL 2XTJB 4JKLA 3LN5A 4HFUH 3NCCB 4Y16A 4LSDA 1LGVA 1RQ5A 5FUOL 3ARBD 1WWCA 3LEVH 3DV6A 5EU5A 5KANG 4GW5A 4ODHL 3T0DA 5M94B 3RGVC 5L2KB 2NY4C 4X8JA 3T0ED 2GQHA 2LTQC 3BKJL 4NUGL 4TRPH 2ZG2A 3QUXD 4X83A 1BD2A 3PQYE 2GTZB 1J1PL 2Z8SA 3D9AH 4NFCA 1UJ3A 5A43C 2VN4A 4POZC 4CVZA 2X41A 3HNSL 1RMFH 1RK1A 1A6UH 5EBWA 3IDMB 1BQLL 4I8DA 3WFEH 1BPVA 1QKZH 4NM4L 1MFBH 4LAQL 4FG6D 1VCAA 5DFVD 1PW3A 2CGRL 4HJGB 3RGVB 3G6DL 4APQD 5HPOA 2NY4B 3K81A 4I4WB 4LL9A 2AXFB 2ZCLH 2VDPH 4GKNB 3KYNB 5F6HJ 3KPRD 1VB9A 4YR6B 3QPXH 1YEIL 2FEEL 5I30H 5INDB 1Z2KA 2OJZL 5IVXB 4O51A 1X6NA 4WWKD 5EU3A 2Q7NA 1ZT4B 3ARDA 4NQCE 4EOWH 1IC7H 5C0ND 1A4KA 1I1AC 4LLMA 2NY5L 3D6GA 1B2WH 4HPYL 5FV1L 3RA7L 4I2XA 2PUQT 2RQ8A 4WU7B 4ZUTA 2CMRH 5F7KC 2CQVA 4KKCD 4QXTA 1CDCA 5EORH 3SO3C 3HUJE 4YHLH 2KPNA 3JWOC 3UJTL 4BQBA 4QRPA 5J8OA 3PP4H 2DLFH 4ENEC 3MV8A 4F8QA 2W65B 4H0IA 2N4IA 3F7VB 1QEWA 4HC1A 5DQ9A 2HT4D 5E94B 1H0DA 4HH9A 4LVNC 3CSGA 3Q5TA 4HIXH 1KULA 1U58A 2ADIB 2WAHA 3L7EB 2R2HB 4G80A 2ERJC 2PYFA 1UM6H 3SCMA 2E8YA 3SO3B 2V5SA 4Q7DA 2BSSB 1I3VA 1YDPB 2XT1B 1A1MA 5I17A 4HUVA 1KIPB 2J88H 4NN6B 5KTEH 2XG4A 4P57B 1C12B 5D7LA 1KIQB 4GAJH 1HIML 5MEND 1QRKA 1NKRA 3EYSH 1D5MA 5BOPA 5DT1H 2BVPA 2HH0H 4KI1A 4P49A 4ZOCA 5IB4A 4MJ5A 4GRMB 3L5IA 4U7KA 4NC1C 4PGEB 1CU4L 1GZPA 1KJ2B 1NJ9A 2ERJB 3VFWA 5IG7B 1R3LA 5TFSH 3G6AB 2XA8H 3A6BL 2J8OA 2ICWJ 3QCTH 4ONFH 4MAYD 5FCSH 2NZIA 5LAXB 1II4E 1PKQA 5GS2D 5J12C 4NC2B 5EZOH 1CZ8L 3OF6A 4BFIA 5I71C 3GHEH 3CUPB 4QRRA 1V7MH 3DUSB 3HC3L 4JRYA 4ETYA 3OAYH 2HJFB 4X8XA 4IOIB 4WNQA 1LO2L 3CVIL 3VXPB 5I1HL 1QYGH 2PCPA 3QEHA 5CEZL 4LRNH 1U8QB 5B38B 3LV3B 1A3LH 4MQSB 2N1KA 5AZEH 5J12B 1YC8A 2DMCA 3EW3B 3ILPB 5LGHH 3GMNB 5EA0L 1H3TA 5I71B 3CCHA 1R3IL 1IEBB 3MCKB 4M3JA 3D25A 5E8OB 3PABB 5C7XH 4L4VD 3IDJB 5JHDE 4XVSL 1T5WA 1XGTB 3RWJA 3Q5YA 4KK6D 4NQEA 1N0XH 4PJEF 3OGOE 3O3AA 1QNZL 2APVA 3NZHH 4PIRF 5GJTH 2CUHA 2HVJA 3TPUA 2Q86A 3BISA 4ORGB 2Y5EA 3S4SA 1FL5A 3WN5C 1Z9LA 1INDH 1WFOA 4LPTA 3LS4H 1FV1B 4Y19B 1OAUL 3LY6A 1KTKE 4A6YH 4OIIH 1MCOH 2FD6H 3B9EA 1M7IA 2R4RL 4YIQB 4RGNE 3MRBA 3D18B 3LKSA 1DANT 3PDDA 1FVCA 5ESQB 5CMAA 1FVDB 1XR8A 5F3BA 2NY3C 3IU4H 4YO0B 1IQWL 4IRJA 3G5VB 2GJZA 3SE9L 4JR9L 3UAJC 4NNXB 1R0AH 4UBDC 3WN5B 2XKSA 1D9KC 3GKWH 5IJVB 3P0VL 2VXTH 3S34L 5CSGA 5EBMA 4NHUA 3TA3D 3ULVH 3BP6B 1ZLSH 4OQTA 1NGYA 3TC9A 4G3YH 4ZQKA 4UDTB 5TQ2H 3P4MB 4NZUL 4QNPE 1SBSH 3TN0B 5ADOL 3RVXC 1IM9B 3GMMA 4HBCH 3GJEB 5D70L 1MWAL 4JY6A 4F33A 4I13B 2NY3B 5JQ6H 3WIIH 2BFVH 1BF8A 1CL7H 1OP5K 4WI5A 4PJCA 1D9KB 1ZV5A 3B9VA 5JO5A 5LQBL 1A22B 1MCPH 4JLRA 5FUCC 3OZ9H 4HQQL 2LU7A 2I9LB 3Q3GA 1ED3A 5F3HB 4QCIA 1OF2A 2WUBH 2OR8A 1BP3B 2MFNA 4R4FH 3GK8L 2BP3A 4G8IB 2EXYD 1BBJB 3Q2CA 5CLWA 3HR5B 4XMKL 3IAQA 1TCMA 4Z7OE 3H9HA 3TVMC 2ZUQB 1NANH 3O9WB 5GRJH 4MNQD 1V3JA 5IB1B 2BCKA 5HGAB 4E41A 4FXKA 4NWTH 4OLXL 3ARBA 3RX5A 1YEJH 1KLFA 2BSTA 4J4PC 2LVCA 4HKXA 1F4WH 4OCWH 3I75A 3C8DA 1UZ6E 3T0EA 3QUXA 1C5BH 4G7VL 1I1YB 4MWFA 5GS3A 5MHSD 1JWMA 4QO1A 2FX7H 1VFOA 1YEHH 3GBLA 2A77L 5C0BE 4YUEH 2YMXH 4O2FA 1P7QD 1T1XA 1NCWH 4KJWD 4NN5C 5F89A 1SYVA 2BVEA 4APQA 2X4OB 2H32H 2KZ1B 1K6QL 4GJTB 3CSYB 3EGSB 3A6CL 5TE7L 2E27H 3RWEA 2BSRA 3VXSE 3P0YL 4JG0H 3EOTH 1A1OB 3KPRA 4URTB 2AJUL 5KZCD 3G5ZB 2EE6A 2FECI 4WDIB 3M07A 1RK0A 4ODSL 4OLZH 1R5VA 4XVJH 5EC2A 3WFCL 4WWKA 3RDTD 4KHXL 5HHME 3BDYH 1AGCA 4KQ3H 2G2RB 2W0LA 4LGPB 5KANI 3MACH 1RZJL 4OD3L 2HTKD 4PB0L 1EMTL 1IKNC 1OTSD 2IADA 4KTEL 4NN5B 5I15L 4I18B 1QQDA 3I6GB 2LABA 3LKRB 3ECBA 1S7XB 1GPOL 1JF1A 4K3DL 3BQUD 3PE9A 5GJSL 3TZVD 4RBPK 3OKMB 4KKLD 3QXAA 4LEXH 4U1KA 1G6RA 3SQOL 1H3PL 2DJSA 4P2RD 3IVKB 4WW2F 2ZUTA 1VHPA 5J6GA 4B7LA 4ZAKD 5CAYB 3G5YA 1ACYH 1HE7A 3BIAX 5IOPA 3P0GB 4KXZH 4XB8A 3D0VB 3P73B 5EZJB 1Q72L 1ZEAL 3MV01 1VA9A 3QDMD 5EN2B 5DMIH 1ERNA 2A0LD 3S37L 3E6HB 2QTEA 1Z9SA 2ID5A 2IEPA 5DJAA 3UZVB 2X4TB 3CFEB 3VG0L 3QEUA 2YPVH 4D0CA 3NZ8B 5KAQG 3MLWL 1AHWA 3ALPA 4N5ED 1BAFH 3WIHA 5I19L 5DA4A 3DRTA 2QL1A 1T2JA 3BUYA 5FK9B 4HAGA 4N1HB 5ANMA 1OP3H 1H15A 3OV6A 4M5ZH 5T3ZE 1ITBB 1KEGL 1FORH 1OP9A 5T1MB 4HSQA 1F3JA 4PUBL 2HMIC 3FFDB 3BZ4B 3C9NB 5MERB 4L8DA 1A6WH 3H9SE 3T4YA 1IQDA 3BPCB 1LO0L 3BJ91 3W39A 3WUWA 2G60H 2NY0D 5GRUH 3IFOA 4CVUA 1FGVL 4HFWB 4ZD3H 4OLVH 3T77B 3S5LB 2AXJA 4IHOA 3UJJH 4C56E 2APWA 3VFPB 4CNIA 1UM5L 5E8EB 4Q58C 3WEXA 2HP4A 4LHUB 25C8L 4U1LB 4LARH 2GEEA 3MJ8B 3QUKA 2VLKE 2DM4A 4M02A 3RUGF 2VISB 5CD5C 4Y4KC 1FH5L 1OCWH 3SN6N 1CBVH 1A8JH 2UYLA 5TDOA 5IEKB 4W4OC 4HK0B 3VFRA 4PJHA 3T0AA 3I84A 1YJDH 4TYUA 4L4VA 1FNGA 2PTUA 1HQRB 5C9JA 2B0SL 5FYKL 3D2UA 3GJFH 4DW2L 2C1PA 1G9EA 3GZKA 3N1QC 1SJHB 3U6RA 3MNVB 5ALBH 5D2LB 4HIIB 1TTGA 1GGBL 5E5UB 5D72L 4GRWF 2BNRD 5J57B 5FB8B 5IESH 2HJKB 3L6FA 4HIHA 4NC1E 4AEHL 3GHBL 1Z3GH 5A2LH 4LIQH 2AXHA 1INEL 5E4EC 1ADQA 1KCRL 4DVRH 5C86A 4XNZC 4PD4K 1X5GA 1K5NB 1CFVH 4RRPG 4TNVF 3T4AA 2V17L 4LASH 1BZ7B 4J3SA 5AAMA 3X12B 3GBMH 4HWBH 4LSPH 5AWNH 5F1OB 3MLZL 3OXRA 1FN4A 2H3NB 5DJ2B 4U3CA 3ARFD 3TA3A 4WWID 4DKFL 1L6XA 4M62L 3MLVL 5T1LD 1T7YA 1JN6A 1GOHA 4JHWL 1IAIH 3NFSH 5E4EB 1FE8L 4UV7H 3V52L 8CGTA 1YEEL 1QA9B 4M4RA 4XNZB 1YEDB 3U9UB 2PXYD 2F53E 3FT2B 1BIIB 5C0AB 4Q0XH 4D8PB 5J06A 4F2MA 4KU1A 3PP3K 1ZLUH 4N8VB 3QG7H 3U1SH 4AG4H 4P3CH 4PJFB 4CVXB 2R29L 1QSEB 5FYKU 3DNKA 5TPWL 2W0FB 1OGAE 2A9NL 4MS8D 4WI2A 4PB9H 4PLJC 3ZDYF 5DJYA 2N7BA 3QQ4A 3BIKA 1IE5A 5ID0A 4LBEA 3BH9A 4IDJL 3MV9E 1OPGL 1ONQB 1KUMA 3RVVC 2DQGH 4MJIE 3D0LB 5GGSA 4MJ6B 2VDRH 4GLRH 4MNQA 2B1HH 3OB0H 1X4YA 4HKBB 4XCEA 5I8CA 3FO1A 1NGPL 1HHKB 1ZA6B 3BEWA 5IQ7L 3UBXA 1F4AA 1DSFH 3HZVA 4NRZB 1XF2B 4FQIH 4XTRD 4UTAL 1QOKA 1I85A 1HNFA 3K46A 1IVLA 2IANE 3VE0B 3HC4H 1RV6X 5J7CC 2WIIB 1P7QA 5I8KL 2FO4A 4N90D 1S9YB 4L4TD 5F7UA 3SDCA 2KKQA 3KPMA 2GYSA 4X7SL 3FQTB 2DLHA 4L3AA 1WIPA 2XZCH 1V7NL 2AKRB 4F7CB 4M8QB 1WBZA 1UM4L 2YZ1A 3RDTA 4O02H 3TPKA 1G7LB 4MA1B 4PGBB 2H8PA 2QR0B 1K2DB 5D1QD 1K9TA 3P4LA 4MA3A 4NOBA 3O6ML 3RNKA 3QCVH 3UJIL 3B5GA 4AQ1B 1UXSA 4PJEB 5K9JH 2IBGA 4Q9QL 4TUKH 1EEZA 1BGXL 1DL7L 4CU6A 3QULA 1W0YT 1W0VA 5FXCH 2IALA 4P2QB 5HHOE 4M3KB 2VZ1A 4GG6A 1KN4L 5DYOA 4DCQB 3BGMB 3L5JA 4P2RA 2W0KA 4N0UA 4Y2DD 3MLXH 5IBTH 1CQYA 2XA3A 5DQJB 4ZAKA 1BQHG 2V7NB 5I76B 3X14A 3B2UD 3WFHA 2IPUK 1GAFL 3QDMA 4GW1A 4UQ2B 3SE4C 2XWBA 4AJ0A 3DUUA 4NYLB 1GIGL 4YXLL 3L3IA 3NPSC 1IAKA 3GIZH 2MCPH 4NBXB 5FO8A 1NGWB 12E8H 5HDQH 3V5DA 3B8YA 5F7WC 1ZA3A 5EC1B 4OTXL 4JVWA 4U1HB 1FL3B 3MLTA 2P47B 2R0ZL 4X4XA 1WIUA 2VZOA 1IEAB 1NLBH 5BQ7A 3MC0A 2QQNL 4F7MA 3BZEB 5EBLB 4ZODA 3HZMB 3AB0B 3MNZB 4HCRL 3AY4A 1A3RL 1MFCH 3FB7B 2OS7A 4G6AD 3G6JF 3GRWL 3LKOB 3NPSB 3JUZA 2WWMC 4NO0D 2R0KL 5IHZA 3WHXA 2V2WA 3N50A 3U30C 4KTDL 3B5HA 3BRGC 2R39A 3FO0H 4XCNB 2D4DA 3UC0H 1U8PA 1J1XL 1EBPA 3QRGL 1INQB 3CDGA 1HH9A 2EDTA 5BZDA 4YDJB 1K8DB 1T83A 2FNBA 2ITCA 3IFPA 4GKSA 3HAEH 5CD3A 4JG1L 1JZ8A 5CJQL 1LEGA 5L0QC 1NLDH 1XR9A 2BY2A 3QDGD 5HSFA 4Z8FL 4YGVB 3U30B 3E6FB 2P24B 1JGEB 1H9VA 3PXJA 1CICC 3BT2H 3IJSB 1F2QA 3A6OA 3FAWA 4TQEL 4GAYA 2VZSA 3MOQA 4OCLC 4QHKI 3B6SA 1CCZA 3IS1X 4G42B 5ITFA 1NBZB 3IDGA 3CZJA 4PP2A 3N85H 5L0QB 2JCCB 1HZHL 1S78C 3QXTA 2V9TA 4NJAH 1YMMD 4P46C 4M7LH 4FQXC 1CICB 4S0SD 2ZNWA 5ETUA 2BNRA 4L3ED 2YRLA 4XPGL 5I2IB 2CR6A 1N59B 2R1XB 1JNJA 3HRZB 3MLRH 2VAAB 4R26H 1NGXB 1IGYB 5IMOB 5C0RL 3IT8D 1A6ZB 3SDYL 3FONA 1TETL 2VDQH 1MIML 1MEXL 1JZ3A 2DQUH 4WW2C 5MEPA 4BFGA 2VIRB 4P46B 4KHTL 1EVUA 4FQXB 3VXRB 1FGNL 1AGDB 3KYKH 4OZHE 4YWGH 3GSXB 3I9GL 3SOBL 2FIRT 5T1LA 4KV5F 3EOYG 5JOFB 1M6OA 1U8JB 5KS9A 4KGLA 4K7PY 3M8OL 2DKUA 5JW3H 1P1ZB 1JI2A 3BJLA 3UROR 4JFZL 3GSNH 2F5AH 5I1CH 1X5LA 2AJYL 5DHVA 4DGYH 3CFDB 2BHZA 3O0RH 1ZS8B 4E0RA 5T3XH 4WW2B 4PTTB 4TNWK 1LDPL 4YNYB 3BPLC 1HYSD 4I77H 1S9WB 3T2NH 4L8SB 3CVHH 4K9EH 3X11A 3V4VH 4PYHA 4RZCB 1GC1L 2BJML 1CDHA 3P4OA 5SWZE 1T66D 4PJ8C 1ZWIA 3OKLA 3EOAA 2PO6C 1MFAL 4X6DA 3SDAB 2D7OA 1FL6A 5F70A 1YMHB 3BPLB 3FQUB 1F4XH 2DIBA 3NFPA 4JFHD 1QP1A 4Z0XB 1F5WA 2LU3A 3NCMA 4PJXF 2EECA 3G04B 2IAMC 1XT5A 4PJ8B 3ZKQD 4D3CH 1FRGH 4DZBB 4CADB 5AG9A 5DJCB 3ZKSD 2PO6B 4OKDA 3O45A 1LK3L 4EDWH 4J8RB 4XMPH 4OF6A 3QO0A 5IROA 3V0WL 4KUCD 4ZDHB 5JDSB 4ZUSA 3MREA 4P23C 3O3BA 1WC7B 3FT3A 2W9EL 3KVQA 5HVGB 1EAPA 3O2DA 2GJJA 4O00A 5F72S 3OAUH 5TDPB 4WV1B 5CP3A 5J3HD 2H26B 4ONGL 5E2UH 2IPKA 3AM8C 5DMKB 2IAMB 1EBAA 3PWUA 1VACA 5DS8A 1KFAL 1I9IH 1MPAL 4YDLC 1ZTXL 4L4TA 4YHML 4NO2B 5BV7H 3MRJB 1JPTL 2UWEA 1SEQH 4JDVA 4XC3H 4XZUA 4ZSOA 3QI9C 4LLYA 3WIFA 2HT2C 1E6JH 3LEYH 1ND0B 4L9DA 4CAGA 4TPRL 1OAZH 1QSFB 1HK6A 4P23B 2WANA 1KB5H 1X5HA 1KN2H 1W8OA 3CX2A 4W4NA 1GH7A 1TIUA 3W11C 5D1QA 4K8RC 4RIRA 3GMRA 1LNUB 4IJ3B 3DVIA 3MRPB 2DQHL 5D7SL 2F54D 4JAMB 4GKOA 3QI9B 4LSVL 3SKUD 3VFOB 1DEEA 2UVFA 1JPFA 1IBGL 3UMTA 2VDNL 2L7JA 3LEXA 1HEZB 4CN1A 2HT3D 4LLVB 1G7JA 1WEJH 5DTFA 5HYIA 3OGCA 4Y2DA 2ICEB 3C08L 5IW1A 2F19H 2Y36H 3ULUH 3WNLA 4YLQT 1FFNB 4HS6B 4K3EL 5HYFA 1NPUA 4ZFZA 4LCWD 3OKOB 3C87A 5KSVA 2ZSVB 2JB5H 3TBWB 4ZXBC 4ZUVB 3SE3C 3WFBL 4OV6F 3QUYB 4IIQC 3CLEL 3QXUA 2AI0H 4K3HA 1EK3A 5D1ZC 2XZQL 1FFRA 5IK3B 1NMBL 1R24A 1MLCB 5GSRB 5F88B 1RULH 4IEFB 4S1SH 2A83A 3V2AR 2VL5B 1Q9LB 2WNGA 2EYSB 4RMVA 3BP5B 4XPTH 3BIBX 3LB6D 1P4BL 3MLYH 4BZ2H 1RZ7L 4ETQB 1YY9D 3L5HA 4S2SB 4ERSL 1GJIA 1YQVH 5CCKH 3BD3A 4PJAA 3QB7C 4ZXBB 2B4CC 5CGYD 1J1OL 4NNPH 3QZWA 1CN4A 3AUVA 4IIQB 2Z35B 3BGFC 4NO0A 1JMXA 4U6TA 3SKNA 4WJ5B 1MCNA 1G9NC 4L29A 2FIKA 2K3TA 4AYFA 4LQFL 3ELAT 3IFNH 4Y0GA 1G7IB 2YEZB 3TJEH 3NCBB 3KLHD 5DUBA 3ZE2F 4JM4H 1J18A 2VC2H 5EU7E 1QRNE 2I07A 4R90H 1NL0L 5KN5A 4Z7VF 5D8JL 3EYQD 1T6WA 4LLQA 4JFED 4ZS6D 2P4AB 3MZGB 5D2NC 1JRHH 2OP4H 2L4OA 1GHFL 3GI8H 1IL1A 3IKCA 4L3CB 1DTUA 4G8FA 4KJYB 2X1QA 3TCLA 1A6AB 4XMLH 1YNTA 4YE4L 2J8HA 4QHKJ 4ODTH 1CLYH 4NC0B 5I1JH 3RNQB 3WD5H 3LVEA 3L95B 3V6OA 3MBED 1MCHA 4RMTA 2CLVB 4S1RL 3KPLB 5IMLA 4CJ0A 3V4PH 1YMMA 2ESVD 4GMTH 4WHTB 1EHXA 3DROA 3OL2A 4OD2B 3FT4B 1B0RB 5D2NB 4L3EA 1KEMH 5HDBE 3ZTJG 1RSFA 3T0XA 5ISZA 4JFOB 4H8WL 5HHNB 3OX8A 3ZL4L 3EO0A 3JTSA 3S37X 3ZHDA 5LCVH 2FDBP 3CH1A 4BK5A 4XVUC 4NRYB 1AGEB 3FO2B 2PF6A 5SWSB 3U46B 3CXHK 5E6YA 4FFWD 3RWGA 2Z92B 3KLAA 3T1FA 5HHVL 3HG1B 2XQBH 4ALAH 4PP1C 4KDWA 1E4XH 3QA3A 3DI3B 3LMJL 5E8PB 1NAMA 1G1CA 1UWGL 1CDGA 3CFJA 4QTHA 4JRXA 3UDWA 3PHQA 3ULSB 1KG0A 2HJLB 5C70A 2HFFA 3RY5A 5IVZB 1KV3A 4OT1H 3SDDC 2X4QA 1WV7T 4PRIE 4YX2H 5LWYL 4O2CA 4NQUA 1CGVA 1IC5H 5SX4H 5I18H 1WBXB 4P2OD 2DQJL 3QJHB 5KVEL 1E27A 5I16A 7CGTA 3MX0A 5JMRA 4JQIL 4MD0A 3RQ3A 4YHNA 1S7QA 5E95B 4GW4A 3IDNA 3SDDB 4DJMA 2Y06L 1EFQA 3QNZA 2ARJB 3KWWB 5CEZE 3QXDB 2XTLA 1C08A 2KL6A 4U7SA 4YHPB 3IU3A 2PTVA 1BBDH 2E7BA 3MRMA 3G6JB 3HS0A 3PWJA 4HJ0C 5HHXH 4RISH 3F7PC 4U1MA 1F6AB 3V6FA 1MCWM 4XP4H 4K7PL 3DBXB 1OM3L 4Y1AE 4Z95L 4JRWA 5F6IC 1HSBB 1CD8A 5ICZB 3GGWB 5DHYB 2XN9B 4UOW1 4I3RH 1TLKA 1UA6H 3LN5B 4ZNCD 2MMXA 1TJGH 5IBLD 2FH8A 4PG2C 5F96L 4PJBF 3DV6B 5EU5B 1HI6A 1NFIA 4Y7MA 3HMXH 4QXUL 1P9MC 1OAKH 3FOMA 3KJ6L 4OUUA 4RGND 4X8JB 3DX9A 3QFJE 4TUJB 2Q3AA 3VXNA 5F6IB 1DVFC 1UJ3B 1PLGL 2BNQE 4K94C 2F54A 1RK1B 2CPCA 1LO3H 1AXTH 5J6HA 4UILL 3JSSA 2UZIH 3RX7A 5KW9H 2ZNXA 1JPGA 2GAZA 4DKEH 5FDWA 4UOW0 1AO7E 3TT1L 4PTUB 2DI7A 1FZJB 1DUZB 3CPLA 5DJ8B 4EN3D 2QEJA 1RZIA 2YC1A 4JHAH 1G84A 3AU1A 3PWPE 5KG9A 4LCWA 1KT2A 5JW4Q 3VFGL 2MKLC 1NGQH 3DTXB 5EU3B 3ARDB 3SKMA 1QLEH 5FGRA 4CGTA 1S9XA 1QFWI 1A4KB 4C59B 5FCUH 4LLMB 3RUGE 3JUYA 2GCYA 2DYPD 1D5ZA 1A14H 1D6VL 4H1LG 1DBJH 2EYTA 4I2XB 3KXFE 4ZUTB 1W72H 3GBNH 1MHEA 4QRTA 3CDYA 4W6XB 4IMLA 3U0WH 1FNEA 4QXTB 4UTBL 1NFDF 2BERA 1CF8H 1E4XI 2DQIL 2YA2A 3C8HA 4OCMC 4QRPB 5D7JD 2VTFA 4Z7UF 1I9RH 4EVNB 4HKZA 1H3UA 1AQKL 3MV8B 4X80H 2OZ4H 4GRWE 1QEWB 3C5JA 3HZKA 4U3XA 4HH9B 5HYEA 1ZGLA 2D3VA 2R2BA 2RBLA 1OP3K 3OJVC 3I2CH 1U58B 3IB4A 2DJUA 4G80B 3QZWG 3L3HA 2PYFB 3SCMB 4Y89A 1MFEH 4F58H 4LSQH 1T21B 3S3JA 4PJGF 3PGCA 1A1MB 4FQQA 5I17B 4HUVB 2F5BH 5HI3D 5DGRA 5DLMH 5D7LB 5C0BD 1EEUA 3ILQC 2A6DA 4PR5A 1RJZA 3P11H 4YHYC 2BVPB 2GITB 4MJ5B 1U8LB 2ATKA 1MI5E 3F7YB 4JFEA 1ZKAA 1GZPB 5D5MF 4JKPL 1BECA 4XP9H 4QXWA 4HLZG 3VFWB 3FB8B 5JPMA 3FAXA 3RHWF 3FQRA 1GGIH 1U95A 4XBGB 1JNNL 2XTJD 5I9QC 4HWZB 4HWEH 2ZUUA 43C9B 4NRXB 1D6EA 5T1DL 3WNMA 4NQCA 1F90L 3MRRA 4M7ZC 3UZEA 1NH6A 4LOUC 4YHYB 4RDQG 3GDBA 4X6CE 5BS0E 3BUTA 4GBXA 5L2KD 2XNAA 3F6IA 2UUDH 1CE1H 2ESVA 4LK4A 1N5AB 1I1RA 1FLRL 3MO1A 5FYKD 3ZDYE 3PWLB 2FB4L 2KH2B 2HVKB 3QEHB 5IIEB 2OL3L 4OD1L 1AGBA 1C1EL 3PWNB 2FEDC 4Z7QF 4JB9L 3T1WA 1KELL 5AUMA 5DD1H 1U2HA 4HIJA 1MELA 1JWUA 3CCHB 5CSBA 3RGVD 2OTUA 5T5NF 1J05A 5IP4A 3HI5H 5E2WH 4NGHL 3D25B 2HWZL 2NY4D 5FGBC 4OF7A 2C4XA 1T5WB 3RWJB 1IKFL 5CEYA 3O3AB 4POZD 2MCG1 1EGJA 2QQKL 1RZKL 2GY5A 5EIVA 2HLFC 3TYGL 2HVJB 1NMCB 1OD9A 1MRFH 2A9MH 2ATPA 2VSDA 3S4SB 1FL5B 1QBAA 2O5XL 5EWIH 4NP4L 4JPKL 2ZPKL 1IRAY 3KPSB 4IOSD 2EZ0C 1QBLH 2R4SH 3CZFA 3VGDA 2Y23A 1M7IB 2B5IC 2LAAA 4K8RL 1A0QL 3MRBB 3QNYA 4JN2A 1FVCB 1XR8B 1OAXL 1HKLH 5F3BB 2GUOA 4P2OA 1IC4H 2YK1H 3QISA 4JZOA 5T3ZD 4PRHE 4PRAA 3BH8A 4IRJB 2V6HA 4HK3N 2IQ9H 1I1AD 5DUPL 5LXGH 1F13A 2OR7A 1OAYL 1DLHB 4NHUB 3V6ZA 1NGYB 2VO5A 4ZQKB 5CILL 4F3FB 4W68A 5CP7B 4CDGC 4PV9A 2P8PA 5TE4H 1NCAH 5D71L 5BO1H 3JV6A 5TDNB 1BVLB 4M5YL 4C56D 1G1YA 1U8IA 4IRSA 2W9DL 3OB0K 4JY6B 4YXHH 4DK3A 4H88L 4JO3L 2JJSA 3CFKA 4ENED 2J12B 4OLUH 3OMZA 3MTRA 5JO5B 4HUKB 1U6AH 3TV3H 3BKYH 1MCEA 4JLRB 2O93L 4UIKL 2QSCL 4M00A 2EO9A 3BE1L 1JNLH 3Q3GB 1ED3B 3EFFB 4U3HA 2FJGA 3MJ9L 4QCIB 1OF2B 1FSKC 4HD9A 4PGCA 1T22A 1RAMA 1QVOA 5BZWA 3O6KH 4WHDA 4HIEA 1CDIA 2B4CL 3H9HB 3KYOB 3ROOA 2XQYK 4OCXH 4E41B 3BO8A 4I3SH 2P7TA 1MRCL 2BSTB 2C7UA 4ODWA 4HKXB 1G9NL 3I75B 1U91B 1F58L 4JO1H 3T0EB 2X89D 2A6KA 3ZE0F 1PQZA 5FYJU 1UB5A 1SJXA 4CW1A 4ZTOL 1ZVSA 1DUYB 1P6AB 1YPZA 4OZ4A 2QQLL 1JWMB 1ZLWH 2Z8VC 1T80A 4K7FA 4F7TB 4AENA 2GJ6E 1PG7W 3VXTA 4PJ5B 3C09C 2PR4H 1T1XB 1QSZA 5FYLL 1SYVB 3UTZA 1OB1A 4P9MH 1WTLA 3G5XB 4U6HA 1VFAA 1DLFH 1UKSA 3RWEB 1XMWA 4JO2L 2DKMA 4EN3A 1Z6JT 3L5XL 2F53D 3QIBC 3DX6A 3WV0A 5INCA 1RK0B 1LEKA 1XZ0A 3DPBA 5F1NB 2G9HB 4KJPC 2ZCKL 5H37H 4UT7H 3TIEA 1AGCB 4NCC2 1XGRA 3KHQA 3C09B 4Y19D 1VENA 4OM1H 1OGAD 2IADB 2DYPA 4PS4H 1AY1L 4G6JH 4BSWA 1QQDB 5KS9F 1NEZB 3ECBB 3FHQA 1LO4L 3SGKA 1JF1B 3IDXL 3LQAL 2XQYG 5ESAA 3QIBB 3QXAB 1JV5B 4U1KB 3OAZH 1G6RB 2DQDH 1RY7B 2Q8BH 4MJID 5HGHB 4AQOA 5D7JA 4R4BA 3TBTA 1RFDL 4KQ4H 3FOLA 1EJOL 3HNTH 5F7EH 3ARZA 2AS5M 1IM9D 1AHWC 5E2VL 5FA4B 4XPFL 1OHQA 2QLVB 4OCNC 1U41A 2AEQH 2NY3D 3PDGA 1YY8B 4DQOH 3UAJD 1E4JA 4UBDD 1D9KD 2ZG3A 4MD4B 4KVNH 5DJAB 2V5TA 5C0BA 5FHBH 1FO0B 2O26U 4QHUA 1PG7H 3QEUB 2AXGA 1PYWA 1DQJB 4LRIC 1PX3A 1U36A 4LMQE 4D0CB 4GXUN 3RVXD 3WLBA 1AHWB 5IEHA 5KJRH 1CFTA 3UTPD 3UTSB 1BHGA 3DRTB 3BUYB 2ILLA 3S98A 1MIEH 5ANMB 3ULVF 1H15B 3IETB 3SDXF 2X1XR 3HZYB 3SKJH 4NJ9L 1F3JB 3OKYA 3MYZA 5FUOH 5F7MC 3T4YB 1IQDB 4RWHA 3WUWB 1ETZA 4TOYL 5L2KA 3IFOB 3PUCA 3SQBA 4ODHH 2IGFL 2XG5A 4KRMB 1DBAL 2GTZA 1B88A 4IOFC 4CNIB 2SEBA 4NUGH 4EEEA 1ZHNB 3WEXB 5HHOD 1VESA 3TVMD 4ODBD 1G7MB 1WAAF 1J1PH 2R9HC 4YXKL 2NW3A 3HNSH 4QWWC 3QUKB 4JY5L 2EDRA 1P6FA 4BQ8A 3BX7C 4PJBB 1BQLH 4OF8A 2UYLB 4J4PD 3RGVA 1KPUB 1U8KB 5TDOB 1BVKA 4LSRL 4NM4H 1G9MC 3BI9X 4LAQH 4I4WA 4PJXE 3WXVH 2CGRH 1MCJA 3G6DH 1FNGB 3MZTA 4GKNA 3KYNA 3MOAL 3RIFK 4BQ9A 2YD6A 5IVXA 3D2UB 2E6QA 3MUJA 2GTWB 5CUSH 3U6RB 1YEIH 3F7QA 2W91A 1B6DA 2OJZH 1QLFA 1MY7A 4HIHB 3J7HA 5DEGB 1UYWL 2NY5H 4LPCA 5FO9A 4HPYH 5C6WH 3NCEB 1CR9H 3RA7H 4KRNA 2YUXA 1ES0A 3NPZB 4UAOC 1BJ1H 5D1XC 3T4AB 1Y0LA 2VZUA 4ZO8A 3IJYB 4JE4B 1I7ZA 4WO4C 1I1AA 2W65A 3F7VA 2VOTA 3U4BL 2DI9A 1WZKA 2XKNB 5E94A 5I8OL 3H9SA 3TA3B 4J1UA 1I4FA 5E6IA 1CE6A 1JYWA 3RL1A 2ADIA 3S6CA 2K7QA 4KY1L 1C16A 4X4MA 4LKCB 1WCQA 4V2BA 2PYEE 2OCFD 4C56A 2EDKA 1NFDB 2BSSA 4CVWA 5D1XB 1HINL 1YDPA 1J87A 1ORSB 1ULVA 2R2EA 3QHTC 1C12A 1AR2A 1HWHB 4LP5A 3SE8L 2VLKA 2ZKHL 5E8NB 4Z7WE 1N2RA 1F4YL 4HC1L 5C09E 5C0CB 3SJVB 1HIMH 1JHLL 5GGRA 1EH9A 1KJ2A 5L88L 2ZUVA 5DFTA 1CU4H 2CKBB 5DC4B 3O6LL 5ID0B 4LBEB 3BH9B 4PJGB 2VR9A 2WSKA 3U7YL 1FFQA 3A6BH 1UACL 1I85C 5GGSB 4G5ZL 4MNQB 3DUSA 4NHCL 3BESR 3ZT5A 5I8CB 3LS5L 4IOIA 1CZ8H 4NN7B 3BEWB 1WZ1L 3VXUE 3KLDA 3HC3H 2BXZA 4HULB 1M05A 2VKXA 5C3TA 5CKAA 5IHBA 3SDCC 3UBXB 1LO2H 3CVIH 5I1HH 3MRQB 2X89A 2YN5A 5F9OL 3QIUC 4LHUD 3LV3A 5H35B 2EDEA 3MR9A 5CEZH 5D96C 4MVBC 3CXHJ 5MI0C 2GK2A 4K3JH 2FSEB 3MCKA 4U7MA 1A7RL 2X4RA 3ETBF 3WJLA 4QOKB 1P7QB 3CSBA 1R3IH 4NQVA 3L3OA 3RY4A 2EH8L 3SDCB 1FZKA 5IB3A 4EDXA 3TO2A 3KPMB 2R8SL 4XVSH 3ZE2E 1WSST 5GRWA 4CBPA 5KZCB 2F53A 4LDLB 4ORGA 5D96B 3MA7A 2BHUA 1GXEA 5B4MC 1QNZH 3HMWL 4OI7A 4Z7VE 3V8OA 1WBZB 3MQIA 3RTQC 5CD5D 3RDTB 4Y4KD 5MI0B 5DK2B 3TH3T 2H8PB 1CLZL 1OGAA 5IKCA 1I8IA 4GXUM 3RNKB 5SWZD 4CN4A 2NXZC 1WT5C 1OAUH 3D18A 4DN4H 2Z91A 4HK3J 4OGXH 3IRPX 2YD8A 2AK4E 4XCFL 2R4RH 4YO0A 5EUOF 1RHHA 32C2A 2IALB 5I1GH 4O9HL 3MV9A 3HMXA 4P9HL 1A9EB 5DYOB 2R0LL 4MJIA 3UX9B 4K7PX 1B4JH 1KBGL 3HHRB 3MV7E 4N0UB 4JR9H 3SE9H 3BP6A 3UTQB 4XAWL 5C0JB 3S34H 5GGSY 5DJZA 2PTTA 2R23A 3PNWA 1DQML 4RMUA 5D7IE 1IM9A 3X14B 4NZUH 3WS6C 4P5TC 5ADOH 2DLGA 2XWBB 1TTFA 3AY4C 1JK8A 5F1IB 4Z0BH 5D70H 1MWAH 1IAKB 3UP1A 1D9KA 5H2BA 5F9DC 4MJ4A 4R8WL 1ZA3B 4GRLA 3MLTB 2I9LA 4OQTL 4X4XB 2C3VA 1DQQA 5LQBH 4TVPL 1A3QA 1U3HC 2V5YA 4HQQH 4OZFG 2D0FA 4CMMA 1Q9KB 4P5TB 3DSFL 1J8HE 4XXCA 5F71A 5IM7B 3GK8H 5CIPH 3ZDZF 2AJ3A 5CINH 5IHZB 2CRYA 3WHXB 3ZYZA 3GMLA 1AIFA 1IAIM 1U8PB 4UV4H 1Z9MA 4PLJD 4OLXH 2NY0B 5GZOC 3S9DB 2NY2C 3MRFA 3CDGB 1HH9B 1OSPH 4WUKL 5BZDB 4YQXL 2V9RA 2OZ4A 3MJGX 1UB6B 3RVVD 3ROLA 5CD3B 5HHOA 3P9WB 1LEGB 2R0WL 3TVMA 5HHPA 3GMQA 4G7VH 9CGTA 4MZ3A 1MF2L 3VFUA 5CGMA 1A47A 2CXKA 4J4PA 1KLUA 3MGTB 4GAYB 1OT1A 2X4OA 2NY2B 1UENA 1V5JA 3B6SB 3CSYA 2EKSA 5ITFB 2NX5E 2NY1C 4P3WA 4S1QH 5EULV 1K6QH 2VLLA 4WDIA 1KC5L 2PETA 3A6CH 5TE7H 6FABH 1MSPA 4MD5A 4YC2C 3P0YH 3D1MC 4PP2B 2A6IA 2Y6SC 2AJUH 4ZTPL 2YHGA 2G2RA 1A5FL 4ODSH 1FC2D 3WFCH 4KHXH 5ETUB 4E5XB 4GG8B 1NQBA 2BNRB 2WBWB 5TF0A 1RZJH 2EDHA 3BPNB 3NVQA 4OD3H 5E8DL 3LKRA 4PB0H 1EMTH 4QTIL 5FV2A 3EYOB 5I15H 3LIZL 2NY1B 3OKMA 4JCLA 5SWQB 3HE6C 4XP1L 1GPOH 5GJSH 4K3DH 4TUOB 4JGMA 5K93A 3ZE1F 1IGML 1H3WM 1EHAA 2XPGB 5MEPB 1WWWX 2AGJH 3SQOH 4KPHL 1H3PH 2HKHL 3VXME 1XGUA 1IKNA 3RVWC 2NNAB 1VFBA 4NKMA 2C3GA 4JDZA 3D0VA 1OW0A 3P73A 5KS9B 3VFNB 5D9SA 3HE6B 1Q72H 4WFGE 3BKML 1G6RL 4X9IA 1A7NL 3AS3A 3S37H 2FH6A 3K1KC 3KPNB 3E2HC 5DI8B 5CJ8A 2J6EA 4D2NA 4OFYD 3VG0H 3P4OB 3CK0L 1T1ZB 1ZWIB 3OKLB 3IFLL 2FJHB 3EOAB 3MFGB 2WIMA 3F5WB 3MLWH 2P8MA 5I19H 3ULVC 2P5EE 5I74C 1EX0A 1FL6B 3G9VA 3V6BR 4A6YB 4DUWA 1JF6A 3BZ4A 2ARJQ 3E2HB 2DMBA 1KEGH 3NFPB 3VCLA 4IS6A 2GK0B 4PUBH 4M6AA 3EUUA 2NMSA 3TT3L 2K1MA 4OBRA 1LO0H 4OJFL 3U0PB 1YEKL 3WIHL 1KCVL 1FGVH 2HRPL 4L9LC 4WI9A 3O45B 4MLSA 4YDIL 1T5XB 5I74B 2WWMD 3I6LD 1CGSL 4Z7UE 3QO0B 1C5CL 1UM5H 3SDXB 4ZUSB 2CD0A 1TPXB 3TBVA 25C8H 2VISA 4BK4A 3KNBB 1WISA 3NH7L 3L3JA 4GFTB 1AJ7L 2FBJL 4WHYG 4HK0A 4LSUH 5ICYA 1GGYA 3MRIB 2FX8L 2IPKB 1FH5H 1RUML 5DS8B 3PWUB 3N1GC 1TCRA 3BW9A 3FQNB 3HUJF 1A6VL 4JDVB 4XZUB 4ZSOB 4LLYB 4N0FA 3VW3L 4WTWA 2VDOL 4YFLF 1VEOA 2B0SH 2YOCA 2R69L 3AMKA 3MSPA 4DW2H 1CICD 4Y4KA 2XKUA 4PRID 5FB8A 3C2AL 2HJKA 2I27N 1GGBH 1IEHA 5D72H 4PRPB 3OPZL 5D5ME 1CLCA 2XOTA 4ISVA 3GMRB 5SWZA 4AEHH 4M61B 1LP9E 3GHBH 5F9WC 4OZIE 4JFDB 2B7DT 1KCRH 3WJJA 1UCTA 1S78D 3QDJE 5EIQA 4P46D 3LEXB 3MRDB 2OTWB 2H3NA 4FQXD 3QRFM 1G7JB 2CJUL 3VXRD 1BX2A 3OGCB 5SX5H 3MLZH 4M4PA 3DOSA 4M1DL 1FIEA 3WSQL 1CDYA 2JTDA 2NLJB 5E1AB 1QR1B 3HI1B 3OKNA 4DKFH 1EUUA 3GSWB 1QA9A 3MLVH 1ADQL 1L0XA 1ZHLA 4M62H 5B22A 4JHWH 5F9WB 3NABL 4ZFZB 5MEQB 1FE8H 3V52H 4EIZC 3FT2A 1BIIA 4Z7QE 1YEEH 3QYCA 4N8VA 4HXAL 3V7AG 4HUWB 4J2XA 1WWAX 2H32B 4CVXA 1IAMA 1FIGL 2BSED 5DO2C 1QUNA 2W0FA 2UZYB 2A83B 3TM6A 3QBTB 2R29H 4LVHC 5D6CA 1KCKA 4HUMB 5TPWH 1KB9K 1PVHA 3V8CA 2A9NH 4WEMB 4HW6A 4KC3B 5GGVY 1VFMA 1B0WA 2JKXA 3VGBA 4PJ7E 2NY7L 3D0LA 4EBQL 4WEUD 4X6EA 4LFHD 4IDJH 4NO0B 1OPGH 3SKNB 5KVFL 1WBYA 1HHKA 4L29B 2FIKB 2C4FU 4NQDE 4PJ8D 4LVHB 5EUKA 2BZDA 2VE6B 4NBYB 2DI8A 2PO6D 1NGPH 1R5IB 2BNQD 5DUBB 1XF2A 1U9KA 2Z4QB 5DRWA 4BH7A 2I07B 2UUDK 1E6OL 2XYCA 4G43B 5KN5B 5DXWA 1PBYA 3V6OC 1X5JA 4ZYKA 1MCBA 3EYFA 3VE0A 1CLOL 1ZANL 4LLQB 4UTAH 5I1EL 3DRQA 2IAMD 3LAFA 5ID1A 3WNOA 1FLTX 3STBA 2WINA 3IKCB 3MCLL 1A21A 5I8KH 2H6PB 1G7PB 1X5YA 3FN3A 1YNTB 1TENA 1JZ4A 2VDKL 1ZT1A 2AKRA 4FTVE 4P23D 3VGAC 4X7SH 5BMFL 1OWWA 4LNVA 4DOHB 3QUMH 1G7LA 5IMLB 1V7NH 1UM4H 3DROB 5JZ7C 1KYOJ 5C0FB 5ISZB 3OX8B 3EO0B 3JTSB 4PJEA 2VLRB 4OSUL 1QFWL 3O6MH 3QI9D 3CH1B 2HT2D 3K2UL 3UJIH 4K23L 2EDLA 4Q9QH 4NM8L 2EXWC 3B9KA 1MHCB 3VGAB 1BGXH 1DL7H 3VRJB 3BGMA 3OKEB 1YJDC 1DQLL 3RWGB 1U8NA 1S9VB 1KN4H 4HEPG 2JK5A 1XH3B 3O11B 3W11D 4K8RD 3KLAB 3T1FB 1A6TB 3PG2A 3VG9C 1BWMA 2V7NA 3QA3B 5K9KA 4LNRA 2UZXB 4UQ2A 1NAMB 4ONOA 3MRHB 3CFJB 4WUUB 4QTHB 4JRXB 5EUOB 4NYLA 1D7FA 1CYGA 1GAFH 1PGRB 4Z7OF 5FYJD 3VD4A 2R1WA 4TSBL 1QTYT 5AYUL 2HFFB 2I24N 4YXLH 2X4QB 4U1HA 1MJ7L 4R4NC 2BMKB 4OGYL 5LVEA 4OTXH 3WE6A 3UO1L 1UZ6F 2R0ZH 4OFYA 6CGTA 3BZEA 2DF3A 4OZGE 3CDCA 1AD9B 3WFEL 2QQNH 1E27B 1N7ML 2I25N 4ZXBD 4FHBD 3FB7A 3QP3A 3HN3A 2AQ1A 3U4AA 1AC0A 3FFCE 2YSSA 5FGCE 4RFOH 4HCRH 5GGTL 4MD0B 2EEDA 4FABH 5D1ZD 3ULUF 3QHZL 4GW4B 4KH2A 3GRWH 4XCNA 2ZCLL 1TZGL 2AJXL 2B39A 2P5WE 2R0KH 3QNZB 4YHOL 3RJDA 4KTDH 4K2UH 4X7CC 1J1XH 3QRGH 5I66A 1C08B 4Q2ZA 2Q8AL 3F12A 3HCVA 1KTLA 2E7CA 4JPIB 3MRMB 3HS0B 3S5LG 4P59L 3PWJB 2WUCH 4YGVA 4JG1H 3LN4A 1TZHA 1JGEA 3KJ4C 3V6FB 4S10A 5DR5L 4LHUG 4Z8FH 1ZLWK 5JW4R 1L6ZA 3RPIB 3MMEA 4JQVC 5DK0A 2HLAB 4TQEH 4G42A 3WDJA 3ME0A 5C3LD 4DGIL 4KK5C 3DJ9A 4AH2B 4YPGB 1YC7A 2AEIT 4N9GA 2E9WA 1U2CA 3RY6A 3KJ4B 1NFIB 2ADFL 2VQUA 4GUPB 1CICA 1P4LB 2V2XB 1JGVL 4PRIA 1HZHH 3TNMA 4JHBA 5I2IA 4OUUB 1N59A 3DX9B 3HRZA 2VAAA 3VXNB 4XPGH 1ZGLP 1GSMA 5AG8A 4Y8AA 3CD4A 2MKWA 3JVGA 1CQKA 5J1AB 3ULVE 1YUHA 5E2JA 1E4WL 4O58L 5SWSD 5C0RH 3SDYH 1ZK9A 2VIRA 1TETH 1ZHBA 1MIMH 1X5IA 4NPYA 1JPGB 1MEXH 2WV3A 4FQXA 5F44A 3VXRA 3B2VL 1AGDA 4XCYB 3GSXA 3OAZK 2EDBA 3H7BA 3CFIC 1DZBA 5KSBF 1FGNH 3CPLB 3N1PC 3LOWA 1RZIB 2YC1B 3I9GH 4WIQA 2OJEA 2ICES 5KG9B 4LCWB 1KT2B 4HLJA 1N6QL 1WAAE 5DD0L 3M8OH 3DO7B 3Q6GL 3SKMB 5E0QA 3QQ3A 1S9XB 2YBRA 4JFZH 4RMWA 4C58B 2AJYH 2VLJE 4YNYA 5AAWA 3E8UL 1KGCD 1D5ZB 1NUDA 2H9GB 5JUEL 2EYTB 5GQBA 4DTGL 4PP1D 4N8VG 1MHEB 3QAZC 4QRTB 4Y1AA 1W2KT 2DDQL 3C6LC 1DBBH 3QHFL 1GC1H 5LGHL 2BJMH 4IDLA 1HYRC 3QEGH 4YAQA 2N56A 35C8L 1XIWD 2EDXA 4GO6B 2R56L 3DV4A 4HKZB 2ZUWA 2CK2A 3SDDD 1MFAH 1RIHL 1BOGA 3GSRA 1YMHA 3K0WA 3C5JB 1WFNA 3E3QC 5DRXB 1ZGLB 3BOVA 2NCMA 3H7LA 5FM4A 3G04A 4PJ8A 4GXVL 3KGRA 5EU6E 3QFJA 4RAVA 4DZBA 3PQYB 1KJMB 2Y07L 4OQ1A 4GKZB 2BNQA 1RHFA 3LS4L 1JHTA 4U0QB 1DBKL 1RJZB 4FQPA 1LK3H 2FD6L 3O2VL 5FYLE 2Q20A 4XWGL 3V0WH 4GBXC 4F7EB 4IM8A 1BFVL 2ATKB 1AO7A 4JKMA 4IMKA 2IAMA 3MCG1 3IU4L 3FHAA 5JPMB 5JIKA 3FQRB 4ONGH 4NO2A 2XN9D 4WCYL 5CEXB 1KFAH 1MPAH 1D6EB 4FQ1L 4X4YB 5B3JE 4YHMH 4HJ0D 1JPTH 4NQCB 1IGJA 3MRRB 4P23A 3RUGA 5BW7C 2VWEC 4EUPH 4TPRH 4GBXB 3SGEI 3MRGA 1FJ1B 3O2DL 1V8HA 4HBCL 5CZKA 2LU4A 1QR4A 5GGVL 3IJHB 3R8QA 2BFVL 1E4KC 3SGJC 2FR4A 1FZMB 3MRPA 4DZ8A 3H8NA 1AGBB 3HUJB 5AUMB 2ED9A 2DQHH 1JWUB 5D7SH 4LPVA 5HGGS 4LSVH 1C5DA 1HEZA 3OSKA 1J05B 1IBGH 1T7VA 5F6HI 1YQ2A 3HC0B 4XRCA 4RNRA 1CXLA 4DGVL 1DVFD 1FFNA 4HS6A 3C08H 1CXKA 4Q9RL 2YUVA 1T7ZA 4P5MB 3QJFB 4ZFFA 2ZSVA 4K3EH 1QBML 5CWSB 3TBWA 4ZUVA 1P69B 4F37F 2LVEA 3W0WE 4JKWA 1F4WL