4LGPB

Ricin a chain bound to camelid nanobody (vhh1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLVETGGGLVQPGGSLTLSCAGSGGTLEHYAIGWFRQAPGKEHEWLVCNRGEYGSTVYVDSVKGRFTASRDNAKNTVYLQLNSLKPDDTGIYYCVSGCYSWRGPWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
molecule keywords Ricin
total genus 24
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgpB00
2Y06H 1TIUA 4KKBD 4P0DA 3VXUD 1D9KD 3NGBC 4Y16D 4HJGA 4YK4B 1EUUA 1AY1H 5D96B 1MNUL 2A0LC 3VD7A 4RBPK 2VLKA 1MRDH 2G75B 3QP3A 1T7VA 4XP9H 4PJGF 3GKWH 3IS0X 3KXFB 3QUZA 3DYPA 5C0RL 5F3HB 2FRGP 4ORGB 4JFED 5D5MF 4E42B 4HUMB 3BW9A 1Q94A 5JW5B 5DGQA 1Y6MR 3RWFB 4POYA 1FORH 2W65A 2E6JA 4JR9H 3BVNA 4WFHE 5DA4A 4MJ4A 3CFEA 1XF2B 3FFCD 4DZ8A 1KPRA 2YEZA 1J1XL 2VDPH 1S7XB 4EVNB 2NY4D 5D70L 3S5LA 3OBAA 2WINB 7CGTA 5EO1B 1EEYA 1N6VA 4KFZC 3HI6L 3KLDA 1J10A 2VN7A 4N8PA 5IQ9A 1L0QA 2CRYA 2G5RA 1YQVH 5DJYB 2C3VB 2CUIA 5DF0A 1C8PA 1A6ZB 5EU4B 1QPXA 3C5ZB 1ZGLM 5DJCB 1RZ7H 1G7JB 1X7QA 4UBDC 5J13B 4Z78B 4M61A 1I4FA 4MD0B 3V4UL 3QEHB 4HUXA 3TBWB 5FYJL 3S35X 3NIDF 4QTIH 1NC4A 3IFNH 3QQ9D 2BVOB 4DKFH 5D7JA 1OL0A 3BAEH 4GG8A 3C9NB 2J88L 5EZJA 4A6YA 4J8RB 2DYPB 3MGTA 1QSEE 4N5EC 1PKQB 1QYGH 1OLLA 5D1QB 5DK2A 1MVUB 1C16A 4NSKB 1T1YB 1K4DB 3QUMH 3T8XA 3RNQB 5C2BL 3HLAB 4N0YL 3RWCA 2GJ6D 3QNZA 3OGCB 2M1KA 2XTJD 4MX7B 5DRXA 4L3EA 5HI3D 3C60D 1WFTA 4D0DB 1E6JH 4N5UA 1AD0B 2B0SH 5E2WL 3UTTE 5F7HA 4DN3H 5IJVB 5JDSB 3NFNB 2CH8A 3PGDB 3DROA 2HYMA 2V5MA 4OFKA 1IM3A 1GC1C 1W0YT 2R8SL 3QISA 4QKXB 2V5YA 3NABL 1W8NA 3LEXB 1JNHA 3DPBA 2HMID 2D7TH 4HZLA 3GB7A 5HXMA 2BVUA 3BESR 1OQXA 2WV3A 4LNRA 4XWGH 4MYWB 4O00A 1F3DH 1IAIH 3L5JA 4R8WH 1Q0YH 1P7QD 4Z7QE 1MCNA 2AXJA 4MNQB 5I19L 3B83A 3P4OB 1T1YA 4KY1L 3W5NA 1YNKL 5DI8B 3MLUH 5I71C 2ESVD 4PJAB 2VLLB 5J6GA 2HG5A 3NIFE 4L29B 4CN1A 2MSPA 2P8PB 3UO1H 1RUAL 3FT4B 2BRRH 3PGCB 5E94B 3MYZA 1PSKL 5DJZB 3HE7C 4EI5A 4IRJB 1NFDB 5C0AA 4CADB 3RA7H 3UZQA 4HQQH 3SDDD 2NY2B 3FHAA 1V8HA 2GK0B 5IR1A 1AQKL 2PYEA 3PJSA 3PP3K 4XXDA 2FX8L 1G6RL 1IRAY 4JY6B 3LQAH 1AGDB 1FCGA 2AW2A 1TTGA 4TSBH 3UROR 5L88L 1I1CA 1I1YB 1AQDB 3HB3C 5CP3H 3JWDC 3UYRH 4G9FB 3D18B 5GGTH 2H1PL 2OZ4A 1P5VA 4LASL 4NUGL 5SV3A 2OQJA 2Y25A 3RDTA 1DQML 3VRIA 5DQDL 4OFYD 4ZTOL 1V05A 1U42A 5BVPL 3EO1A 3ETBF 4K3GA 3WE6B 3T08A 4X6CE 4HPOL 2R0WH 1A6VL 3QUKB 5DMKA 5I8EB 5DHXB 3QUZB 1T2QL 1GZPA 4BZ1H 5L6YH 4YUEL 4ZAKB 4G8GB 1FZOA 5D2LB 1EO8L 4XHJD 4YZFE 5GGUB 4O02H 2DQDH 4TUJB 5LG1A 1S7QA 2VAAB 3ZHLA 3FZUC 3HN3A 1NLDL 5F7FA 1KN4H 5LCVL 5DRWB 2VZVA 1EUTA 4CAGA 3DMMB 4G6FD 5KVDL 3CUPB 4JFZL 3W5MA 4V1DB 3IJHB 3Q5OA 4HF5H 3FONB 5DUBB 4HC1A 3RGVB 3D18A 2CIIA 3RZCC 1UKQA 4G9FA 4J4PA 3JTSA 1N0XH 2E27L 3DOSA 4X6CF 5CS7A 5CWSB 4Z7VA 1TDQA 1WIOA 4X6EA 2D7NA 5CBEA 2EDBA 1RULH 3RWEA 5B3JE 5C08D 3P4LA 3WUZA 2RHEA 1XIWB 1IAMA 1YEGH 1RVFH 3FO1B 1FV1A 5FA3A 4GG6F 1IM9B 3EKCA 1LMKA 1YMHA 4M5YH 1S7TB 2AERT 1Z3GH 4GW4B 5SWZD 5IROA 3C5SB 5KSBF 2B8OT 3VMOA 3WIHA 3UAJC 1X6LA 4JM2C 1QEWB 3GSUA 3FFDB 5IM7A 5E6ID 3BIBX 2UV3A 2R1XA 5CIPB 2KDGA 3EO0B 2R4SL 1V3LA 2IALB 4PJAA 3R1GH 3SOBH 4TSCH 3L3OA 2VAAA 1I85C 3WN5A 1LEGB 4MB3A 1N6QH 1YEGL 1LNUB 3UXFA 4HJ0D 5CJOH 2APVA 4HUWA 1T20A 4G42A 1UM6H 1QKZL 3H3PH 4GS7B 4M1GL 5BQ7A 4CVZB 5FV1L 3OPZL 1NBZB 3F58L 1U8OA 4L4VA 5IJVA 4FQHB 4PR5A 3C5JA 1IBGL 1BAFH 4X9HA 4J3VA 4GFTB 2D4FA 4YH6A 3FB7B 2BFVL 4PRPD 4N0CC 4HV8A 4CMHB 1KELL 4HZAA 5BMFL 5J8OA 5EO0B 3IFLH 4OAWA 3PWPE 3EJZC 3VFWA 1VGEL 4QHKI 4IS6A 4NQEB 1HXYA 1BIIB 5D8JL 5FO7A 3ZHDA 5AG9A 5IV2A 3MV9B 4OIAA 4E41A 4U1HB 5DMIL 4J8RA 3VXNB 2IBZY 1F11B 2ADIB 4PFEA 3CSYB 5DFVC 4GRMA 4JFPA 2FD6L 2JF1A 1MVUA 4NSKA 3IDNB 1E4JA 2R69L 5HPMA 2JCCF 1YMMD 2XZZA 5L2KB 5CSBA 4RQQA 1KB9J 4IDJL 5ISZA 1P84J 2OR9H 3BP4B 5FF6B 3QDJD 2XI9A 5IQ9B 3LD8C 3UYRL 3GJFH 4M7JH 2IH1A 2HG5B 3BEWA 1ZHNB 1HWHB 4OJFH 2FWOA 2BOBB 5EIIB 1KPUA 4NUJB 5AWNH 1JJUA 2PETA 4NCC2 5LXGH 3KPMA 2Q86B 1N4XL 3RA7L 1FLRH 1SY6H 2HKHH 1EK3A 4C58B 4F2MB 5IB2A 1UM6L 3CXHJ 3W0WB 1PSKH 2D7OA 3N06B 1OWRM 3GB7B 4F9LC 4YIQA 2R0ZH 2DLFH 3CFBB 4BSJA 5GS0C 4YHOL 4N8CL 4O2CA 4M7JL 1AC6A 1JWSB 3GBML 2IQ9L 1KIUA 4LEOB 3U7AA 3KYMA 1YYLL 4JZJC 5KANG 4OI7A 5BZDB 2ZG2A 3O6KL 4NRYB 2I24N 1T03H 1N6UA 3U48A 4BKLB 4X6FB 3RDTD 4Y4HD 3R06A 4OBSA 3ULSB 5DJZA 2NNAA 3L95A 5J11B 1KJ2B 2YPLD 4I77L 4MJ6B 3ROLB 4OLWL 3T8XB 2PYEB 4KDWA 2F8XC 4XVUD 4K3EL 5TFSL 3D39E 4U0QB 4XWOC 5F9JB 4JQXA 5JOEA 3K2UH 1I7RA 3MYJA 5KVDH 2VE6A 3SE4C 3IXTB 4ZDHB 4OGXH 4X5XA 1K4CA 3V7AE 3VGFA 1BAFL 3BE1L 4UTAH 4K7PH 5K59E 3UTQA 5FO8B 3T0VA 5HHXH 5GS0L 5DJXB 3LSOA 2EEAA 4KRMB 1E4KA 2ESVA 4X7SH 5C70A 5C86A 2K1MA 3DJ9A 5HYJD 1PGRB 2FX7L 5GS3A 5FO8A 4OLWH 3IAGC 4X4YA 5IHZB 4LSSH 3UMTA 4EI6B 1WF5A 2R56H 4Z5RA 2AK4E 4L8SC 4PRDA 4XRCB 4Q6IA 3RBSA 3V4UH 3VI3F 4PJ8B 5DQJB 1SJEB 3PL6C 3KWWA 3O2DA 1YYLH 4FFVC 5MENB 3QRFM 4Y88A 1ORSA 1BFSA 1OHQA 1Q9LB 2ZZUT 3PHSA 4JO4L 4I0CC 2X9YA 3ULVC 2FR4B 5SX4H 1JPGB 1C08A 2GJZA 3HE6D 3JSSA 1QZ1A 1XGTA 3LVEA 2ZOKA 3STZB 3OR7B 1MHEB 5JMOC 3MGOB 4OZFB 1CE1L 2X4QA 5C0DA 4KTDH 3P0YL 4P3WA 2JJWA 4HWZA 2P8MB 2J8HA 1N64L 1T66C 3QDJA 3BKJH 1O5DT 4AQ1B 3LCYA 4UILH 4Y5VB 2HA1A 4QRQA 3FFCE 5EH1A 3KLAA 2R0KH 5DDHA 5M95B 1F6LL 5E70A 4HUKB 4YIQB 3LB6D 3MRNB 1EA9C 1WJ3A 3MLSL 4G5ZH 3QB7C 2EKSA 3WCYA 5FOBB 2YZ1A 3SKMA 2D3VA 4M4PA 5KZCB 2A74A 2GY7B 1FH5H 3DV4B 3ULUF 1P4BL 4JEGB 1AGEB 4M7ZC 3NIGE 4I3RH 4HS8H 4EDWL 2IG2H 1N5YL 2D4DA 3GI9H 1EEQA 1NEUA 1T0MA 5FOBA 3RL2B 5I8KH 1UXSA 1R5IA 2CLVA 4JFQB 5E8OA 3QDGB 2YEZB 5L2KE 2UYLA 5E5MA 5J1SC 4C56D 4S1DD 3BEWB 4JQIL 2A9ML 2RCSL 4GQPH 3VFUA 1YY9C 3G6AB 1UWGH 3S3JA 1RURL 5T1LB 5KVFL 1JNNL 3DRTA 2X1PA 4BK5A 5SWSD 4WI6A 4PRPA 2QSTA 4I0PB 1KENH 3VW3H 4CW1B 2HMIC 1Z5LB 1IBGH 1E28A 1VADB 1EEUA 2OK0H 5E9DA 5GRVK 4PJCE 4P5MB 4RA3A 4Q6YA 4P46B 3S36L 4AIXA 4JHZA 2H41A 5TE6H 4R4BB 4RX4A 3IJYB 4HIIB 1DUYA 1T5XB 3MXWL 5FYLH 4XI5C 3QCVH 4NZTH 2BVPA 2Q7YA 3IB4A 3T65B 1IAOA 5A2KH 4NGHL 1QFHA 5CHNA 5EFIA 3SDXB 5L0QB 5I19H 1E4XL 4X4YB 4YXLH 3QFJE 4L4VD 1G1CA 2AAVA 5INCA 3ZE2F 4QHLB 1IGCL 4WWKA 3HCVA 4HIXL 3CFKB 3A67H 1MH5B 3PGFL 2DKSA 1WBXB 4XMLH 3RY5A 1MWAA 1LEKB 2CLZA 4D94A 5HI5C 4H20H 1QSEA 1ZGLB 1GH7A 2EEBA 1RJLB 2J2ZA 4X6CA 1CFTB 5B22A 5IFHL 3LEYH 2A6KB 2NY5H 3R8QA 1H8SA 4IBLT 1B3JA 3P73A 4LP5A 4NN6B 4ZUTA 2GEEA 2AJ3B 2B0SL 2IBZX 3QIWD 4IRSB 1N3NA 2WBWB 3HC4H 3WXVL 3TO4D 1EHLL 4NP4H 1I1AA 5KS9A 5C0GB 3KPSD 4MXVE 3JWNC 4YGVA 5EFIB 1MFAL 3SDXA 1P4IH 2HN7A 3PL6B 3LN5B 3ZYOA 3HNTH 1CL7L 4JKKA 1ZV5A 4PRPE 1JRHH 4P4KB 3B9VA 5HD8C 3U4EB 3QR2A 1KNOA 4NHCH 4ZUUA 3QNYA 5CMAB 4NQVA 1R3IL 1MLCB 3MREA 4K8RH 3MLYL 4LSUL 3MJ9L 4JPKH 4MXWH 1J5OH 4FABH 5DT1L 4FP8L 1KB9K 5A16B 1G0XA 2Y9RT 5CCKL 1FJ1B 4C57C 3CFBA 3BJLA 3FO2A 4BFBD 2HRPH 3NCJH 3S7GA 1V7MH 3I6GA 3TYFB 4AEIH 2F54A 2VDRL 4KMTL 4H25B 2J6EL 3LKSA 2FR4A 4L8BB 3KPMB 3O8XD 4Z8FL 2IFFH 3IF1A 1EMTL 4LF3B 2WIIA 4D9QD 3V6FB 2CR3A 1IGJB 3AB0B 3ESVF 4KVCH 2DMBA 2X9WA 2IALA 3GZKA 1CLYH 1WV7T 2BRRL 1IQWL 5IMKA 4OKVB 1EAPB 3KPSA 3GHBL 4Y89A 3RAJH 3B6SA 4OM0L 3RY6C 1DN0A 2DN7A 2MOVA 1NL0H 1QRNA 4QOKB 1DUZB 5KN5B 5HYQB 4WWKD 1DQJB 5GS1A 4AEFA 5FA3B 3AAZB 4U1HA 4KVNH 2GK2A 1CIDA 3VXUA 3V6OA 5L8LB 4NDMA 2Y06L 1TPXB 4CMMA 4TQEL 4UIMA 3QIUB 3V2AR 2HJKB 2D7TL 4P2OD 3HRZA 4NQXB 5EO0A 3S97C 4JKLA 1WFOA 4HWZB 3D85B 2N4IA 3DMMA 5DRNA 3T0EB 4ELMB 4QHNA 1HZHH 5A40E 4R4FL 4GBXD 1OAUH 2DQHL 2ERJB 5D1ZC 3D0VB 3HE7D 1LP9F 1G6RA 2GW5A 1XR8A 2AEPL 4G43B 3KYKL 4ODBD 2KQNA 2GJZB 4RDQF 1HYSD 4KQ4H 1LQSR 3BFOA 1ZT1A 3MLPA 1DANU 2IFGA 4L8CA 3C8DA 4HEME 4FNLH 4GW1B 5HVHC 2R1WB 4UB0H 4M5ZL 3HI5H 2YKLH 4HUUB 4F7PB 4XGZB 4NQTA 3S36H 4EEEA 4H26B 1EO7A 4K94C 2Z9TA 4JFHE 4LHUB 2EDOA 1ZVYA 3EGSA 5EO9A 4WI4A 2OK0L 4EUPA 5ENWB 1QLEL 2VAJA 3C2AL 5HHNA 4ODVH 1OAXH 4F57L 3SE3C 4HS6A 4OD2A 2C26A 2WWKO 4FQ2L 2Q86A 3TPUB 2GT9B 2C3XA 2A74B 5TH2A 1OSZA 5FGRA 5JIPA 4GKZB 1F45A 2F5BL 3FTGA 4WTXA 1PG7L 1CLOL 2IQAB 3TV3L 3JV6B 1E4KC 2DRUA 2FJGB 4OF8A 4PREB 1FL3B 1C7TA 4MVBD 4ODSH 1EJ6A 1CGTA 2LAAA 3PQYE 4UTBH 3OZ9H 3TO2A 3HR6A 2BXYA 4YFLF 2GSGA 5CJXC 3LQMA 1A5FL 1TZIA 3VG9B 4ZFOL 2P8PA 4PREA 1JRHL 3OQ3B 5A43C 2X70B 3QI9A 4JHAH 5IESH 3QZWA 2YUZA 3LKNB 4U1JB 2XZAH 5B39B 2YC1B 4DKEH 6FABL 1T4KA 4EOWH 3GNMH 2V2WA 4ZFFB 5E56A 5DQ9B 3SE3A 3QQ9C 4G8GA 5IV2B 1OM3L 3HUJE 2YRZA 4Q7DA 5DJ2B 4CBPA 2QQNL 4PRHD 2VLKD 4EVNA 4FQ1L 5MHSE 1Z9LA 4NZDA 4ZYKB 1YPZB 4NFDA 1OPGL 3VRIB 3DYMA 4NQCD 1B0GB 1KTDB 4Q6IB 1BBDL 4HGWA 3QHZL 2YOCA 5DUML 5KAQF 3RGVC 1CU4H 3R0NA 3AFLA 5DJ6A 4YDLC 5FA4A 4JGUA 4C55A 4P23A 2P8LB 5EC2B 4XVJH 1ES0B 4F33B 5F1NB 4YR6A 3BWAA 2DBLH 2XY1A 4OF0A 4DZBB 3QZWB 2JIXA 4ZG1A 2IANB 1QLFB 1LO4H 1TPXC 1ZT1B 2ZPKH 4H1LB 1U8LA 2EXYC 2W9EH 4P4RB 1ED3B 4E0RA 3UBXB 1ZAGA 2R56L 5EZJB 1JMXA 1A4KB 3C9NA 4OCLC 4WI8A 4F80A 4UDUB 4TTDD 3LKPB 4OFDA 5GGRB 1ED3A 5IHBA 2IADB 4JG1L 4XPBL 5T1KD 1F4AA 1VFAB 4R97C 2P46B 3HNTL 1CICD 4PRIE 2GCYA 4LU5H 2Q76A 4UB0L 3W2DL 4PJ9D 1NAKH 5CEZH 4HXBH 3GMPB 4XVTL 2PKDA 4W6XB 4FQQA 5CEYA 1G9EA 4OCRH 4NQEA 5DXWA 4RGND 3RPIB 4KKCD 3MRMA 4RX4D 4UAOB 3ULVF 4R96A 4MWFB 1OTUD 5EC2A 4K3EH 2NY5L 5H2BA 4L9LA 1NH6A 3FAWA 3AY4C 2QL1A 4RDQG 1FNAA 2BDNL 4U1KA 2YK1H 4JZNA 1ZT4A 3LHPL 3DX7B 4PJFB 4QLRA 1Q0XH 4MQXC 5DHYB 4GMTL 4WUKL 5E2JA 1FH5L 1T20B 1A7NL 1OGAA 4PJ7B 3SCMC 4KQ3L 3D5OF 3LV3A 1IGIH 4JFHD 4O5LH 4QXUL 2YUVA 4WDIB 1H0DA 5DURD 1MCPL 3GHBH 1UXWA 4PP1C 1NLBL 4NN7B 5I1CH 3RTQD 1J86A 5F9WB 2NXYC 1I75A 1B0RA 3UJIL 4KH2A 4F7CB 1JZ2A 3DBXA 2NY7H 5CLTA 1B90A 3T77A 4E41E 1I1AD 1OTUC 43C9B 3LN5A 2HJFA 3VRJB 3RUGA 4XC1L 2F53E 4LLUA 3H9SE 5HYQA 5DFWH 2ICWA 4PD4K 4O9HH 2GTZB 5C0CD 4NKDB 5ALCH 4GH7B 4X6DF 5CINL 4FXLA 3S5LB 1SVCP 1DVFA 4GKZA 2YBRB 4NZUL 2KZ1B 3I6LD 3ARTA 2NW2B 3UP1A 1JNLL 1I3RA 1NCWH 3E6FB 1BZ9A 5ID1B 4KAQL 2DWDB 2NMSA 5JO5A 3BH9B 4JKPL 4Z7NE 5JQ6H 3EGSB 1KIRA 4Y19B 2QR0A 4AL8H 1GZPB 2W91A 4YWGH 2EXWC 1BP3B 2JJVA 3WJJC 1J1PL 1EGJH 3QUXA 5T1DH 1D5BA 1LEGA 2FIKA 4LSQH 3T1FA 2V5RA 3QXWA 4R2GB 4QT5A 3VFVA 2CDFA 4UU9A 4HLJA 2JLLA 1JHLL 1DQQA 1FP5A 1Q9WA 4UDTB 4Y4FA 4Y16B 5IP4A 1A3LH 3U4EA 2WP3O 4YC2B 5K9JL 4XBGA 5I1LA 3HFMH 4UNTA 4D0DA 3VCLB 3JV0A 3ZSTA 2UZIL 2CPCA 1A1MB 1RY7B 4NDMB 1LK2A 4WU5A 3OGCA 5B39G 4Q0XH 1M71B 5F1SA 4D0CB 1KJMA 5C0BE 2HJKA 5DD0L 1T7YA 1EIBA 3CVHH 4I0PA 3S8WA 1DBAH 3TJEL 2ZUSA 1AFVH 2AEQL 3X3FH 2AV7A 1VADA 4UDUA 4WEBL 1U8JA 4KK9D 2YD8A 5B8CB 1XIWC 1ADQH 3VH8B 1A14H 1U8LB 2VXVH 3OR6A 1DBAL 4OLYH 5F8RC 1IGJA 1Z3GL 3SBWA 1CFSA 4PRIA 32C2A 1UVQA 1MCBA 5B4MD 1MI5E 2EIZB 4TNVF 3QUYA 3U9UA 2R2BB 3BGFB 3MRFB 3SO3C 1F6AA 1XFPA 1CD9B 5BZWA 3DMMC 4LBEB 3H8NA 5J6HB 4K8RC 3BHBA 3ZKNC 3DURA 4OZ4B 1F42A 4OIIH 4K9EL 4LRIA 4OLVL 3DX9B 1L9NA 3VW3L 3O9WB 4OGXL 5D9SB 2VZOA 5HDQL 3B8SA 3RZWA 4WFGD 1R24B 5D1QD 3PGDA 4F15C 3SKMB 3U0WL 1ORQA 4OZGE 2EDRA 3WFCH 2FB4H 1A9BB 2EYRB 2P43B 4GAFB 4YHLL 4G6AC 1WVZA 2R69H 1A02N 2MHAB 5A16A 2HT3C 2E7MA 1I7UA 4J3OC 1I7ZA 4JQIH 2BMKA 3AB0C 1RHFA 1FYTD 5CMAA 1MAML 5D2LE 4XZUB 2XQYK 3GMLA 4TRPL 2YPKA 2ZUWA 4Z7WF 4UV7L 5D8JH 1Q72H 3WYRA 1N3NB 3GK8L 1DSFL 4RFNC 1RJYB 1WICA 1JZ4A 2MMXA 3NZHL 4G9DA 3DUHA 3IDIA 2Z31C 4QRRA 5ISZE 4N8CH 4D9RD 1OOAA 4Z6AT 3RKPA 1FL5B 3MJ8B 3JZ7A 2GTWB 1NAMB 3BN9D 4N1EA 1N64H 5IMMB 3S37H 4FFZH 3MRRA 1HSBB 4RAUA 4TVPD 3QEUB 5IF0A 4HS6B 4V2CB 4MDJB 1HSAB 1NFDE 3QFDB 1P69B 4AIZB 3UJIH 3HHRB 3ZTNH 2XG4A 5FDYA 5EUKA 4ONGH 5F70A 1RZGA 3ZKMD 4JFDB 5CHNB 2BNQD 2IGFL 4MDJA 2W92A 2FYYB 4BZYA 2I9LA 2FATH 5BV7H 4FFWC 1XGPB 3VWJB 3SDDB 4Y5XC 2XZQH 2OR9L 3UBXI 3MRGB 3HZYA 3BJ91 4LPXA 1KJMB 4PD4J 1H3PL 1B4JH 2VR9A 1HEZB 4PJDA 4PJ9A 5JPMB 4NN6C 1MFCL 3L1OH 4OZHB 4H0HB 3MRIB 3L3HB 5E4EC 4HG4J 3HS0A 2OL3H 1AKJB 3MNZA 5D5ME 4PJ5E 2EDXA 4MJ6A 1F02I 1PY9A 4G43A 1MAMH 1KJ2A 3S88L 5GZND 2DWEB 3H3BC 5KSBE 4C4KO 3B4NA 1OCWH 5A3ID 1BQHA 4UBDD 5DYOB 1HHJA 3U79A 5E9DB 4C4KT 2ITDB 3TCLA 4OQTL 1WCBA 2W60A 2YXMA 2XN9D 3QHFH 3MJ9A 3OSKA 5EU6B 2I9LB 4XXCC 2FL5B 5I1DB 1G7JA 1X7QB 4U7KA 5H94B 2NY6C 3BUYB 5ADOL 3O2WL 4OQTH 2LVEA 1EO8H 4FXGA 3W0WA 1BZ9B 4MSWA 3QEQE 2ESVB 5MI0C 3QO0A 1N2RB 4JJHA 5GGRY 4FQIH 3TP4A 4AT6B 2VDKH 4WFEE 5DLML 4PYHA 3GSNH 5C07E 5T5NF 3RWDB 2ADFH 4OZIB 3MV8E 3WIIL 3MV9E 1HINL 3FRUA 2A83B 2HRLA 1HILA 2MCG1 1AGEA 5LGJB 3LKOB 4C56A 3F7VB 1WISA 2JCCA 1TVHA 2EC9U 5D1XB 4OFVA 5C08B 4WFFD 4CGTA 1C5BL 2OXGA 1BF8A 5L2KA 3IF1B 2XZQL 5F96L 4CMHC 3MCG1 1LEIB 4PG2A 4JM4L 2WBJA 1IZKA 3AY4A 2EC9T 3MV7E 2R0ZL 1MHEA 3F7YA 3FOLB 1CLCA 2VR5A 4XC1H 2BSTB 3CXHK 2ZNXA 1I9RH 5FUOL 4G6KH 2JJUA 3ARGB 1KEGL 1CCZA 1OPGH 4HWUA 1TETH 1T1ZB 5BW7C 5C0AD 3HFML 1CDCA 1YEFH 5D7LD 2EYRA 2XPGB 3IAQA 3O4LB 4HT1L 4LEXL 2APFA 1D5XB 5IEHB 5C7XH 4PJIB 2E8ZA 5FM5O 1I7UB 3EYVB 2Y7QB 2Q87A 3LPFA 4Y4HC 4CUCA 5JW4Q 2BC4B 3AROA 1OP3K 5IMOB 1QFUH 3K1DA 3BZFA 1M1SA 1S5HA 2VZUA 5D1XA 2VLRA 4DCQA 2CDFB 2DQFA 1MHHA 2OJEA 1XGPA 3QDMB 3VRLE 4ZS6D 4XCNA 3U9UB 5AUMB 1KLFA 4U33A 4C59B 3RPIA 2XZCH 4O58L 4Z77B 5HBBA 1CGYA 5H35A 4DGYL 5ICYA 3BP5B 3OJDA 4JPIA 4YDKH 4AYFA 3RGHA 1OW0A 4PLJD 3O4LE 1V3MA 5F9JA 1CE6B 2ZUXA 1A1NA 1MCKA 4PP1D 4KK8D 3D39B 5EU3A 5F88A 4PJEB 5D7KD 3ECBA 3K2MC 2HJLA 3WL9B 3BH8A 1BM3L 2P5WD 3LKRB 3VRLF 4JANB 3BDXA 3INUL 4MCYB 1N59B 3V0AC 2QJDA 3RJQB 3G6DL 3FQRA 4DEPC 3IS1X 5I8OH 3ULUL 2Y07L 5TDOB 4D0BB 4F7EB 1H5BB 5LBSH 4WO4B 1X5FA 4XX1G 3NAAH 1RZKL 4XBGB 2OCFD 1YZZA 5I1LB 2YPKB 5HGDB 3VFWB 1T5XA 5DFVD 4HIIA 1ZS8A 2OR8A 1UWXH 2B39A 3O8XA 1RZJH 3FO0H 3HS0B 4OLYL 4X6EB 2Y5TB 4LSTH 1S5IH 5C0EB 3EW3B 2X4SA 1GGCL 1DBBL 4M3KB 3O11B 4P3CH 3EOBA 1J18A 1XR9B 2WP3T 4OCWL 3P4MA 1HEZA 1NCNA 5DSCA 2XRAH 3IJSA 1DQLL 4Q2ZA 4ZXBD 5C0FB 3WEXB 4LLYB 3PE9A 4JHWH 4PLKD 4ZAKA 1MFEL 2PUQT 3M1BA 3H7BA 4BZ2L 4Y19A 3HPJA 4PRNB 2H26B 4PIRF 5T1LA 4HX1B 4Z0XB 5IOPA 1INQA 4K94L 5SWQB 1RK1A 3ULVE 4ZO9A 2PR4H 3NFSH 3L5XL 1BECA 1WIPA 1FSKC 4WW2C 4QRPA 4G7VH 3G5XA 1FVDB 5FKPA 1TJGL 2AABH 1CVSC 2F58H 3PL6D 1XF3A 1QSFE 4P57B 3QCUH 4QTHB 4U1MB 4KXZH 1XH3A 4NM8L 3R8BB 4JQVC 1FFNA 4KK5C 1NPUA 1JTPA 1MLCA 4MWFA 4EOWL 4MAYB 1BFOB 4LNVA 3LEVH 3MV9A 1EVUA 4G8FB 3VXMD 1AQDA 4YDVB 5GSVA 5DUPH 2ADIA 4AM0A 3NA4A 2BMKB 2IBGA 2CUHA 1KJ2H 4UV4L 5GGVH 3FN0H 3VD9A 3GI8H 3OG4B 3RWJA 5F7YC 1QSZA 4MA1C 5FEBA 3WFEL 1A64A 3G5XB 3MV7B 3D3VE 4RIRB 3WXWL 5JDJA 4QRPB 3C09B 3V7MA 1AGBA 8CGTA 1WC7A 1MCJA 4JO1L 4YBLC 1NSNH 4DKAA 2O5XH 3M17A 3VD3A 2JE8A 4X5WA 5BV7B 4JKMA 1KCVL 3DURB 4OZ4A 1QR1A 3PWPA 5DJDB 2XTJB 4JVWA 4FQLL 4UT6H 1GVIA 5CBAA 1HK6A 3T0DA 1GGIL 1TENA 1QR1B 1MCSA 2AK4D 1OAQL 1R3HA 3UO1L 2YR3A 3Q6FB 3HE7A 4EI5C 3MFFA 3CSBA 3WS3B 1IZJA 3J7HA 2MCPL 1NC2B 1G9NH 1QOKA 5ESAB 4U6VH 4EJ1C 2YWYA 3GMPA 3HRZB 5DD3L 4KWUA 3KHOA 2HFEB 1SEQL 1UEMA 2F58L 5DC9B 1EX0A 4X4XA 4N0FA 1FRGH 2E5EA 3TZVA 1NDMB 4ZD3H 3RRQA 3ARFA 3N1PC 1U91B 5ABDE 3VFRB 5CAYB 5ITBH 1MREH 3IETB 2MQ0A 2IPKB 3C87A 2Z35B 2Z92A 3DHMA 4U6XB 3FQWA 1YJDC 5T3ZL 4ODSL 3W9EB 4OF3A 5DK2B 1II4E 4ZOBA 4L4JA 3S4SA 2HVKA 3TT1H 5DTFB 5TF0A 3L3IB 3LS4L 4OKVA 3KXFE 5BXFB 2P5EE 3BQUC 4G80A 5ADPL 1YEJH 4P4RA 5DD1L 4FQXB 1KLGA 1P53A 1U6AL 2VDML 3OMZA 3TPKA 1NGZB 5D7IF 3FKUS 1S7SB 2VUYA 1GIGH 2R2EA 2HTLD 3EJJX 2CDEB 4K2UL 3LAFA 4QXTA 4F8QA 4DUVA 1GGIH 2VC2L 4WWID 1K9TA 1YY9D 2NY0C 2V2XB 3SE8L 1X5AA 2WBJD 2EIBA 2XQBH 4JRYA 1QFWM 1J8HB 2OSLA 4FXGB 1WAAE 2UVEA 4Y5VC 3MRNA 4YK4C 3RZCB 4XPFL 3NGBB 3IXAA 2PTTA 3QDGE 3H7BB 1SEBA 4ODWA 4XP1H 2AJSH 1YPZA 4J3WA 2J6EH 4M62L 5GZOD 5IEHA 3GSOB 4KROD 5CILH 3P0VL 1KYOK 4PTUB 5FHAL 3U2SA 4UUJA 4YDKL 5GRXG 2B2XL 2V5SA 2DIJA 3L3KB 4XTRD 1F58L 1ZHLA 4DWHA 3C2SA 3HR5B 4M7LT 1DZBA 5GJTH 1NCDL 4PJIF 5SX4I 4YFEA 3WLWC 1KPVB 4YGVB 1LO0H 2GUOA 3UX9B 5KZCD 3D0VA 5LJYH 1XGQB 2AV1A 2F53D 2BSRB 4HUVA 1NFIB 2QTEA 5J1TC 2V7HB 5E5RB 5MEQB 4TYUA 3PWVB 2VN4A 1D5MB 3UTZB 1FGNH 2I27N 5TDNA 4JDVA 3OJDB 3KR3H 4H5SA 4LMQE 3BIAX 1HXYB 2SEBA 3H9HA 5F7DA 2Q8BL 3HC4L 5C8JB 3NN8B 3ULVD 1XIWD 4OGAD 3DRQA 4QGTA 3ZT7A 3BVNB 2DM2A 1T04A 5SWSB 3CH1B 4RAUB 4TN9A 4P5TD 2PR4L 1P7HL 3UTQB 3KPSB 3DSFL 3JUZA 5ACMA 4GT7A 2H9GA 1ZTXL 2QQQA 3QEQB 1CK0L 5LWYH 2HKFH 5H2BB 2NQCA 1NFDF 1QRKA 3NCJL 3HI1B 3IDMB 4BQ9A 2XWTB 4OB5H 4P46A 2EH8H 2BSED 5I1HL 5BOPA 3EDFA 5GGQH 4F8TA 1HINH 2CKBH 4EQ3A 5TDNB 3JUYA 4ODVL 3BT2H 2E3VA 5JTWA 1BLNA 5EWIL 3ZYZA 1IILE 3C5ZD 3OF6D 3LKNA 4U1JA 4ZFOA 1D9KC 3VI4F 2CGRL 3VDAA 4KHTL 4OF7A 3MRCB 3ULUH 3O9WC 2D9CA 3D87B 5IVOA 1PJ9A 1SMOA 2QQKL 4Y8DC 4NOBA 1HCFX 5DK0B 1MCEA 3QWRA 1KULA 1ORQB 4QXWA 2CLRA 3QYCA 4N1HB 3WKML 4HC1H 4NM8H 5CZXC 4MD0A 1Z0NA 3MV9D 4S0TD 3VXUB 1UENA 3HC3L 4FOMA 4APQC 4DZBA 1A8JH 1A9EA 3TFKC 5I9QC 5MHSD 3K2UL 5F8QC 2VUOA 3IGAA 4FTVA 2GJ6B 2ID5A 3GJEA 3SJVD 5HTSA 3TT1L 3QO0B 1KJ3L 1JBJA 2HFFB 2XZCL 4RCAA 2AI0H 5AYUL 5C0JB 4U7MA 4P59H 4DVRL 1UVQB 1FVDA 5FKPB 1B2WL 5A2IH 1YEIH 4HWBH 3QULB 1ZWIA 2O5ZH 4E5XA 4HIXH 1U8IB 3B2UC 1MFCH 3BEVB 4WJ5A 5J13C 1YPZF 4J23A 4LF3A 3RVUD 3S98A 3V6OC 5F89A 1CGXA 2BHZA 4GW1A 1OGAD 2GITB 2OJZL 1VACB 3DECA 2PO6B 3DXAB 3KXFA 3RNKA 4ZFGH 4YHOH 3OJ2C 3PG2A 4J3XA 2CSPA 3GMMB 2ATPB 1D6VH 3VDBA 4TVPH 1JPTL 4J1UB 1HHGB 3RY4A 3QJHB 1M7XA 1RZKH 4PJBB 2O61B 2LVCA 5IBTL 1MUJB 3G5YA 4UT6L 5C0CB 5JUEH 3Q6GL 1CZ8H 1SYVA 1CR9L 3GGWB 3H9SB 2H32H 2R39A 4NNXB 4KJQD 5EULV 3C6LD 2NLJB 1CXKA 4KKLC 3KWWB 1JGEB 3HC0A 3C60C 4DTGL 4K7FB 4OJFL 3BUTA 5TQ2H 5JHDA 4IRJD 2GAZA 2NY1B 2D31B 3VXME 3UJJH 4D0BA 2IANE 1JNNH 1OWWA 1NCCH 3GBNL 3PGCA 4RRPA 1BWMA 2Q8AL 4LLQB 4R7NA 4MNHB 5HSFA 1MRCH 25C8H 4FZEH 5ESAA 2A6KA 4OF5A 3C60B 3FJTA 4MXWL 4MA8H 3N85H 1I8MB 1HNGA 3GSNL 5JO5B 2DWDA 5EIQA 3MBEC 3WUWG 2VDKL 5E2UH 3PP4L 5ALBH 4M43H 1S9VA 2YD9A 3MMEB 3ARYA 2Z8VC 4HS8L 5TE7L 1KB5L 5IMMA 1YYMH 1CL7H 4KI5C 4U7SA 4N90D 3NCCB 3GJFA 3PWPB 1YEKL 1IGFH 3VXTA 2FB4L 2V7HA 2BJML 4U49A 2JKXA 4YHMH 5B4MC 1G0DA 3U0WH 3DI2B 3CMOH 5GPRA 5HI4C 3HE6C 5HHME 5BVJB 1RIVH 3KAAA 3E2HB 1G7LA 3LN4A 2NY4C 4NKOB 3IKKA 5HVHB 3MODL 4Y5YC 4OLUL 1CD1A 1VB9A 4MX7A 5DRXB 3TNMA 3LPGA 1T3FB 4HEPG 1BJ8A 2M8XA 3JBG7 4KRPD 3UTPE 1QBBA 4L5FH 1UA6L 4H20L 1BIHA 5H8DA 1T2JA 4JO2L 5T3XH 3FB6A 1N8ZA 2GSIA 3CFJA 1MCOH 3FAXA 4CMMB 5DWUH 3FMGH 3MFGB 3WS6A 3MGTB 3O4OC 3V9FA 3FT3B 4G7YH 1H3PH 3A6BH 4H0IA 4MCZA 5ILTL 1MAKA 1U36A 3WIFA 5KN5A 5KJRH 2FHBA 3NIGF 3I02A 1K6QH 4PRAB 3RNKB 1U8IA 4NJ9H 3O0RL 4FTVE 4LSTL 3QULA 1MCOL 4XNXL 4M1DH 3Q48A 12E8H 2BHYA 4HS3B 4PJFA 2X89A 2FSEB 3ARRA 4JO2H 5T3XL 2OTUA 4POZD 3D3VD 4L5FL 1S7RA 2QADD 4LPTA 2W07A 4N8VG 5J6HA 4JN2B 3HMXA 1F6AB 2CQVA 4P23C 4HK3N 1MJUL 4L9LB 2DQIH 5LGKA 1VENA 3MV8D 3IDGA 4KGJA 2IWGA 3WLWD 1XF2A 3FQUA 2LTQB 3FRPG 5JLZA 1XZ0B 3GSNB 2JB5H 5J12C 3HRPA 3CFCH 4LLWB 4NQSB 1H3WM 3LIZL 2ICWB 1TZGL 5T1KB 4XI5D 3BW9B 1LVEA 3MPCA 4LARH 4LCWE 5KVFH 1F4YH 4XZUA 4DOHB 1L4IA 3GK8H 1JNJA 1EGJL 1HKLH 3WNNA 4OUUA 1I7TA 4DK6A 1WFNA 5DR5H 5IIEB 1JF6A 1JWUA 3NCBB 3NFPA 2FD6H 2XN9A 3WNKA 5ACZB 3W82A 4PJDE 2CDGB 5IQ7H 1QR4A 4RFOH 4L29A 3A6CH 4MZ3A 4WTWA 3V52H 3VDCA 3AU1A 5KVEL 2ITCA 2G5BB 4BFIB 5T3XD 4NO2A 4X8JA 3HZKB 3K7UA 4QCIB 3SPVA 4W4OA 5SWZA 1I3UA 4R26H 1AXTH 2CRMA 4X6BA 3MUJA 1FN4B 3RTQC 3RIFF 1LGVA 5CINH 1TZGH 3OHXA 2I5YH 1QRND 1ZLUH 4S1DC 5DHVB 4PRDB 2YN3A 1EO5A 4CVXB 3MSPA 1NDGA 3GM8A 4JY5L 3ZTNL 4LEOA 4RWHA 2YMXH 4EBQH 3KG5A 4Y4KA 4S1QH 3MTRA 1AP2B 1NGWB 1HI6A 1LK3L 2A1WH 4YJZL 3QG6B 5D7JC 4JFDA 4LLQA 4R7NB 3I3EA 3GSRA 2QHLA 2MKLC 1DVFB 1T5WB 1NLBH 1BVKB 4XMPH 5JA9A 2VXVL 1AKJD 5I18L 1U8QB 1KXTB 3QQ3B 3FCTA 4XB8A 3WNLA 4POUB 1CFVH 5D93B 1BBJA 3FO1A 3BN3B 4PUBH 1LK2B 1VFAA 2AEQH 4K3HA 1CF8L 1PKQA 3QG7H 3T77B 3TJEH 2OTWB 1NCAH 1Q0XL 5JPNA 1YEIL 4HWBL 2G9HA 3EOAB 4JFOB 5H37H 3PUCA 1NUDA 5BCAA 4LQFH 3DETC 3RBGA 1M05A 5DR5L 5GSRA 4X5LA 1IQDA 4WGVB 3T1FB 1N0XL 1HYRC 2X4NA 1VACA 5IVXE 5B8CC 3FT2B 5HY9A 1FZJB 1M7DA 2YPLB 4OCYL 4RNRA 2MQCA 4L4TE 4YPGB 3TLRA 5CEZD 3ZDYE 4P46C 3QAZC 3WKMH 5D71H 1X4ZA 4N9OB 2BX5A 1YMMB 2H2SD 3ELAT 4IS6B 5EZLB 5L2KD 3W2DH 3P77A 3RZCA 3SDCA 3EYQD 4L1DA 3VE0A 1K8DB 4MA7L 5E03A 1Z0MA 1X44A 2LE9A 3BKML 3ARBD 4J6RH 4ODWB 3VXSB 2K9UA 1FQ9C 3OKDB 4KKNA 5C0FA 3O9WA 3IGAB 2ZSVA 4HKBB 1FFPA 5IVXF 5HHMD 4OZIA 2CIKB 3L3DA 5D6CA 1TCMA 4R3SA 3SDXE 2PW1A 3ARZA 4LIQE 3TO4C 3MV01 3P4NA 1MRCL 3W0WD 3TH3T 5ISZB 4MB5A 3GMNB 5C92A 3DNKA 2A6DA 2V9TA 2Z91A 4GQ9L 4LAQL 1CGSL 3D48R 3BIKB 3O45B 1ZHNA 3GBMH 5A3IC 1UYWL 1XCQA 1RUML 4AJ0A 2IH1B 1AFVL 4YNYA 2X41A 3H42H 5C0AB 3KHQA 4CADA 4EI5B 1GGYA 1JWMB 2P49B 4B0MM 4M5YL 3G9AB 3UTZA 1J1XH 2VTFA 5MEQA 1WK0A 2FX8H 2DDQH 3KPOB 2VDQL 3TCLB 1JWMA 3SDXF 4EN3D 1F00I 4QOKD 2CMRL 3THMH 4JY5H 4XCYB 5KVGL 4LCWB 2DMKA 4I18A 3QPXH 4QOKE 5K33A 3L3GB 1CG9A 3KR3L 3IU3B 1MRDL 2CK0H 3B9KB 4GAYB 4I4WB 4KJPD 3GSRB 3U2SB 4MNQE 3FB5A 4DKEL 1GPOL 4Y2DC 4F33A 4HGWB 4YHKL 1YYML 2APBA 4WUKH 2OJEB 5F7WC 1JUFA 2VLJE 3CH1A 1RPQA 2VLRD 4O4YL 2CK2A 2VIRB 5DHVH 5L8JB 1LILA 3KPPB 5E9DE 4XHQA 3K3QA 4X5WB 4PJ8C 1A6UH 1MI5B 3ROOB 3VGDA 2B2XH 3EO0A 3RWCB 1VGEH 2ZOLA 1IARB 2F5BH 3WFCL 1XR8B 3MRDA 2AJZA 3VFPA 3EIFA 5IBUG 1DR9A 4KV5E 2A77L 2C3HA 3EOTH 2BNRE 5JNYB 1WBYA 4FQ2H 2PW2B 4QRTB 1XGYL 4JPVH 1B6UA 4L3CA 4GKNB 1Y18B 4FXKA 1QFWL 4NOFA 4JM2F 1JE6A 2E9WA 3DO7A 4Y2DA 5KSAD 1IC7H 3I2CL 1AGFA 5I66A 2CGRH 2X4TA 2UUDK 3EO9L 1I9EA 1CQYA 1FIEA 3VH8G 4ZXBB 3S34H 1L9MA 4P2OC 3WSQL 4NBZB 3GSOA 2CKBL 3IETA 4FNLL 3UJTL 43C9A 3X14B 4HKJA 4X6FA 2MTPA 4I2XA 3AC0A 3TPUA 3VI4E 1I7ZB 4U1NB 5C09E 3BZ4B 4OQTA 4KY1H 4LFHD 1TVBA 2YSSA 3HNVH 3L3DB 3NH7L 5HGHB 1FFPB 4KQ3H 4OV5A 2E6QA 3BD5A 4YBQC 2H2PC 4WUUA 1MF2H 1UGNA 2HTKD 4OLXH 3VMPA 1TCRB 1MY5A 1FZMB 2EO9A 1Y0LB 2VL4A 3MXVH 4MNQA 3D3VA 5IOPB 4KUCF 1S9XA 3O2VH 1U8OB 4L4VB 4R0LC 5F9OL 5EOQH 3DLQR 1VA9A 2DLHA 2EH7L 2VLKB 3MX0A 1K2DB 1T4KB 3VGAB 4GMSH 3QDGD 1DLFL 3B2VL 3G5VB 3VXRE 4GW5A 4LSVL 3BPCB 3ZDZE 3GKWL 5EB9A 4KZDL 4OM0H 2K3TA 1R0AL 4ALAL 2YN5A 3D85A 1MHPL 2DQDL 2HFGL 4HXBL 5TE4L 4HK3J 1TVBB 2YSSB 4TPRH 2CXGA 4LU5L 3OX8A 5JPNB 2ZG3A 2X4SB 5EUOE 1KB5H 5CGMA 4ODHH 5L6YL 3IDNA 2DJUA 4MXQC 2J5LB 5F21B 4PGCA 4KDTC 4PJEF 4HMCA 4MQ7A 3T4YA 4P2RB 3C6SB 4PJ5B 5E99H 5FO9B 3IAPA 4X9IA 4NNPH 1BEYH 3TZVB 4P3DA 4PV8B 4Q9CA 2YRLA 35C8H 4LFHG 1NGYA 1KXQE 4NFBA 2EYTB 3PIQB 4LKXB 5EA0H 1S7VB 3EYUH 1FFNB 3IDYC 1P6AB 5AZ2L 5ITFA 2P4AB 1VGKA 1R3LB 4H1LA 4OD3L 1S9WA 2B7DT 4GW5B 4PGDA 3VG9C 4DJMA 3T2NH 2XKNB 2A0LD 5GGUA 1P2CA 3V6ZB 4F7MB 4ZUSB 1FYHB 2NY1C 4EDXB 2VLME 2WNGA 4URTB 3BMVA 3NPSB 3L7FB 1ZA3B 4HCRL 4R3SB 3MJGX 1RJZA 5CJXA 1MFAH 1FFQA 5E8EA 4DZ8B 3UTPD 2LV4A 3BZFB 3STLB 4V1DE 4PG2C 4ALAH 2IPTH 4OD1L 1JUFB 3GIVA 4IMKA 1NGQL 2QHRL 1TLKA 2DQFB 3MLUL 2DLTA 4XVSL 3NFNA 4NFCA 2YHGA 2HT2C 2OJZH 1K8DA 5I1JL 4YX2H 3FB5B 4OIBA 6FABH 1A21A 3UPRA 1FO0L 3QPQC 2EDWA 4D3CH 3RFZC 2XN9B 4ENED 5ACZA 5EBLB 4WNQA 4U4BA 3IDXL 5EU6D 4PGBA 5IHUH 5IB1A 3NBNA 2ARJQ 3L5XH 4JE4B 4ELKB 2VISA 3AREA 4ZUWA 4WI3A 3O4LA 4HWEH 2HTLC 4GG8B 1C5CL 3HPLA 3L5WB 4OLXL 2DQCL 1DN0B 3BDBA 5EBWB 1JYNA 1MFEH 1AR1D 3MA9L 4JY4A 3JTSB 4L8SB 2CIIB 4JFEB 5DVLA 1I1FB 1DCLA 5FB8B 1SEQH 1D5ZB 3MCKB 2DLEA 1N59A 3HNVL 1ZLSL 2VDNL 2CO7B 3WFDL 4U6VL 1I1AB 5ANMA 1H0DB 4XMKH 5E0QA 4NZTL 1XF3B 5EU4A 2B4CH 5ESQA 4ZS6C 4M7KL 4XCEB 3U4BH 3LKOA 4NN7C 5E00A 3JTTB 3OAZH 4KHTH 3B5TA 5IWLA 4L1HA 3DV4A 2PW1B 2EDDA 2R9HC 2Y23A 1ZT4B 5FUCC 5FYJE 1U8JB 4FQJH 3VXSE 7FABL 3OKDA 1LO3H 1FJ1A 5MEOB 4NKMB 1VESA 5J12B 2X4OA 1IAKA 5DD1H 2LTQC 2RFXA 5DEGB 5IVZB 4MNGE 4NQVB 4EQ2A 2OR7A 3WJLA 2R1WA 3EYFA 4GSDL 1GGUA 5F9DC 1QQDA 4R4FH 5E99L 3MA7A 4BQCA 2EE6A 4X7EC 4Y0GA 4JZJB 4XNMA 2CKBB 3OGOE 2X4NB 3O8XC 1MLBB 3GMMA 5E2VH 3WHE0 1N7MH 1YECH 4TQEH 5C0GA 5LQBH 4K8RD 1T1ZA 4NO2B 3KYOA 1JHTB 4JB9H 3QIUD 1PEZA 1BVZA 1IJ9A 1D5BB 3PP3H 1EXUB 5DEFB 4JCLA 4JJ5A 3GJFK 4RGMC 1CGVA 3FB8B 4OLZL 5B3NA 3UBXA 4BQBA 1ND0A 1JWUB 1QBAA 3O6ML 1JHKH 2X2YA 1A1OB 4CN4A 4RAVB 5MEOA 1H5BC 3G6JE 3KS0H 3ARFC 1DLHB 4NNYA 4IRZL 3AAZA 4U31A 4PTTB 4LEXH 5IVZA 3QDGA 4YR6B 5F1NA 5DD5H 3O4OB 2N7BA 4XNYL 3LEYL 4ACPA 1KEMH 3F7VA 2ENYA 1MHCA 4W4OC 2GFBB 1P7QB 3DX6A 3FN3A 4DEPB 1UXSB 1QO3A 4UINH 2XKSA 4Z8FH 4J3TA 4PS4L 4XAKE 4AT6A 4BZ2H 1MIEL 1IKNC 3E2HC 1CVRA 3L7EB 5DDHB 3MNVA 1T1WB 1JF1A 1MCWM 4MJIB 5IB5A 3V6BR 2XRAL 3V6FA 3EFFA 1D5ZA 1I8LC 4XBPB 4ZSOA 1C5DB 35C8L 4ONHB 5EORH 1E27B 5I1EL 5ANMB 5JOFA 3ARPA 2AJUH 1MJ7L 5EU6A 5IW6A 1J87A 1OP5K 1CIUA 1G7QA 5CEXA 1OAXL 1WZ1H 3WN5C 5HI5D 4X6DB 4PJXA 4XWOD 5TE6L 4NQCA 3SGDH 1EGJA 2P48B 3WD5L 5LBSL 2YRPA 1U8NB 3GEWB 5KW9H 1IC1A 1R5WB 3CK0H 3HNSL 3UBXG 4G9FD 4J4PD 3WHXB 5BZDA 1WTLA 4P2QD 4TPRL 3NVQA 1EZVY 1KNOB 1WZMA 4A6YL 1BM3H 3CDCA 1JWSA 1MEXH 3HAEB 5IB1B 3RWHB 1IKNA 4RFEA 4NP4L 1U6AH 3MRIA 4K23L 4KQ4L 1A6TB 1A9BA 15C8L 3FTGB 4NBYB 3H9ZA 2AEPH 4Z5RB 4JLRA 1TVHB 4TUKH 4XP4H 5HVGB 3OJMB 3GJEB 2DLGA 1A3RL 3P9MB 2LU7A 1UM5H 4X7FC 4YBHA 2DICA 2AJ3A 3CFEB 3WN5B 3D0LA 1MREL 4X7DC 3GO1H 3DXAD 3MOQA 5D93C 3REWB 2VSCA 1KLGB 3BP4A 4YHKH 3L1OL 5FF6A 1QLRB 1I7RB 1HHIA 3X3GH 3B5GA 3DX8A 3F12B 4HKZA 5I1DA 4CVXA 3CDGA 4GBXC 1NFIA 5IFAL 1JHTA 2APXA 3IDIB 2R2HB 2G75A 3CC5A 3PDDA 4OCSL 4JJ5B 5H37G 4DK3A 4YXKL 2D0FA 1YNLL 3E1F1 1QBLH 1YUHA 1QNZL 2D31A 1AR1C 1OGTA 4FFZL 1N0LA 2JIXD 1Q9LA 5ETUB 1AO7A 3OJVC 3ARQA 1W72L 4FFYL 3BMWA 4X98B 3OXSB 3QQ4A 3M8OH 2VLJA 2P1YA 4HLZH 2XTJC 1RHHB 3VWJA 5FA4B 1INDL 4JM4H 4JRXE 2OLDA 4DW2L 1SMAA 3KPRD 4R0LB 4JO4H 1XF5A 4MMXC 4KMTH 5CD3B 5E8EB 4PJ9B 5F7UA 3MRBA 3QUXB 2P5EB 2J3SA 1ZOXA 2FBJH 5I17B 4IHOA 3FO9B 5JR1H 3IFOB 3HMXH 4RFOL 1LNUA 4YHIA 4XCEA 4FN0A 3B3IB 4PGDB 5I74C 3S35L 1JN6A 5GRJL 4XAWL 4ODHL 5C9KA 3VXMA 1UEYA 1KOAA 1P6FA 1A4JB 4EN3C 1OB1A 2V7NB 1NAMA 1ACYL 3SDCD 3TM6A 1Y0LA 3BPOC 1SJHB 1NUGA 3RL2A 5I16B 4X80H 4JY4B 1YNTA 1DL7L 4HSQA 1UKTA 1OSPH 1YMHB 5JW3L 3UC0H 1I85A 4H88L 1JTTA 5C09B 3BDYH 5E08H 3AREB 4JM2D 4ZUWB 5TFSH 4XXDB 3OPZH 1OAKL 1SJVA 3VFRA 4U1NA 4Z7UE 4JFDE 3LRHA 5GGTA 2VDQH 1BFOA 3O41B 5J89A 1BOGA 3QHTC 4DGVL 3I75B 4WGWB 2I07B 1I3VA 4MXQD 4GKNA 2HH0H 1CF8H 1A14L 2AXFB 4AIOA 1UYWH 2PXYA 1PLGL 4L8DA 4P5TB 4OZHE 5AG8A 2J8UB 4Y16A 1OB1B 2QADB 2QEJA 2V7NA 3T09A 4LLVA 4XVUC 2O5YL 9CGTA 1AIFA 5E6ZA 5IHLB 1W8OA 4K9EC 4XMPL 4PGZA 5F89B 4AK1A 2BK8A 1JYXA 5GS2D 4HDIA 5GJSH 2E9JA 5DZLA 1FPTH 5FDWB 4OV6F 1T83C 2A1WL 3OKOA 3GJFB 4KDVA 3B8YA 1OAYL 4ORZC 4NBXB 5ITFB 4OFPA 3ZE1F 4N8VA 5LGHL 4OV5B 4OZHF 1UJ3B 3NACH 1AD0A 2XKNA 3EOBB 4HJJH 5IHZA 4DVBA 1J0YA 3VD5A 1TJHH 2CLZB 4U2YA 4MAUL 1DDHB 1LEKA 1LO2H 5FECA 1WBXA 4FA8A 4ELMA 5HYJE 5JORB 4LVHB 2AGJH 3FRPA 2EYSA 3FQWB 3CSYA 5F1IB 2P24B 4J2XA 2ADGA 4I13B 1AO7D 1Q72L 3MLVL 3O6LL 1C7SA 5FO7B 4ZNCD 2H32A 2VJXA 4JAMA 2UUDH 4XP5L 4UOJA 2F5AL 1EBPA 5KVEH 3MLZH 3T0EE 2H8PA 5DK0A 3TNNB 4HULB 4Q9BA 5DMIH 1IKFH 1X4XA 3BPNC 2ADJB 4RISH 2HAZA 1RUQL 3QEHA 1M4KA 2HLAB 1X5YA 4I3RL 4O2FA 5TPWL 5GGRA 1EFXD 4KK6D 3MRJA 3RI5F 1MCLA 4F7CA 2ZCLL 4LASH 5L2JA 5TDPB 1UJ3A 2ZJSH 5FYKD 3QEQD 3QH3B 4QT5B 2FATL 4YDIH 5HYJB 4YHZH 4OZIF 3S5LG 4G42B 5FFLA 5EO1A 4UUJB 1A7RH 4AEEA 3X13B 5KVGH 3WE6A 4FFYH 3BSZH 4JG0L 2X40A 3MV8A 4KMLB 2ATKA 2W65B 1TETL 5DJ6B 4LVOC 1SM3L 2BNRA 4GRWE 4NQDB 1ZANH 2GYSA 4FZ8L 4JDZA 3W81A 5IG7A 3DX7A 3BKYL 2H9GB 1EVTC 1XGUB 4Y2OA 5E8OB 1QBMH 5EOCH 5C08E 4F9PC 3E6FA 1OTTC 1MFBL 3QFJA 5FCSH 5E00B 4JKWA 5HHOB 2Z4QB 4UT9L 1PAMA 3RVWC 1DSFH 1UCBL 1BD2A 2E7LC 1CICC 4ZTPH 4GKOA 3VGAC 4X9GA 5B38A 5DZOA 3MOBL 5B3JF 2NY1D 3HA0A 1IKFL 2QKIA 1D5MA 4DGVH 3I9GL 4KPHL 3MCKA 1N5AB 4LSSL 4WEMB 1G7QB 5JW4N 2P7TB 3TBVB 5SX5K 1LE5B 1S3KL 4YBLB 2P8MA 4FMKA 2HJLB 2UZIH 1XCQB 2WWMD 3Q0HA 4FMFA 1TJIH 2P7TA 4GRWB 5C0CE 1AGCB 3TBVA 5AAWA 5I75C 5JNYA 4DGIL 3BE1H 4UTAL 2ZKHH 3U6RA 2ZSWA 4YHNA 3RX7A 1U58A 1UXWB 3VXSD 3FCTB 1JGUL 1FNEA 1GGBH 1F3RB 5SX5H 1ZT7B 4X4XB 3CMOL 2ZCHH 3QHFL 2ED8A 1MIMH 1QD0A 4JHBA 5HHVL 1NAKL 5CEZL 2NXYB 4DGIH 3NACL 1J1PH 4LCUA 5TQ0L 5C0BA 3DUSA 1RFDH 5EU5A 1A7BA 3JV5A 5F1OB 1PVHA 5TE7H 2APWA 3QXAA 1X5JA 5C07A 1T5WA 1DTUA 1R3KB 4WI2A 2ESVE 2YD5A 3CLFH 4ZMAT 3HMXL 5CD3A 4QTIL 3A6OA 2W9EL 4S2SA 3SEPA 5A2LH 25C8L 5C3TA 4XBEH 3LSOB 2XXMB 4TNWF 5FDWA 3Q5YA 2V9QA 2CDEA 5L2JB 3PJSB 4HBCL 4IM8A 5E8PB 4L8CB 5IR1B 5GSRB 1JFQL 3IYLW 3K74B 5HVWA 3O3EA 5KOVC 1CK0H 2DI9A 2R4RH 4H5SB 3ARGA 4JGMA 2DQUL 1EEZB 1RIUH 2YWZA 4LCWD 1IVLA 1UA6H 5CIPH 4MVBC 5I1IL 4OZFG 5C0ND 1RULL 1NC2D 5JUEL 5EUOB 1LP9E 4OT1H 5IBLC 3T3MF 3F6IA 1M6OB 1CXEA 3L3JA 3QA3A 3CSPA 4NO0D 5E5UB 3UYOD 4UOW0 5IW1A 4TVPL 4RMTA 2Q20A 5GS1B 4P23B 3SGJA 3ME0A 4R97B 5IFAH 1X5IA 3MROA 3L3KA 5DK3A 4MNGA 5C0BD 1JZ8A 1OP3H 2HFEA 5AUMA 1ZEAL 5M7QA 1FYTA 4Q9QL 4UMGA 3L9RA 1MI5D 5IMLA 3HTLX 4OSUL 3VGGA 3Q3GA 4KUCD 4MHHI 4P57A 1S7QB 3WHE1 3IVKA 4TUJA 3IDGB 1U0QA 4JKPH 4LGRB 1EERB 1A7PL 4XPTH 2Y6SD 4KJQC 4P4KC 3ZDZF 4NJAL 1URLA 1F4WH 4QRRB 4PLNC 5DJ2A 2Y7QA 3KXFD 5I71B 4YDLB 4YGAB 3ZYJA 2I9TB 3DVGA 4P2QE 1ROWA 1KPUB 3O6FC 4Z7WE 4BFEA 1G6VK 3HPJB 4GUPA 2YD1A 3HC3H 1F4XL 3PDGA 1WEJH 5D6DA 3TIEA 5IVXB 3MLWL 1INDH 5MEPA 4LSRL 5BRZA 3EDKA 1TJHL 1ZA6A 2KL6A 1DEEB 3MGOA 4LLVB 4OKDA 5ICZA 2V2TA 5C2BH 2CDGA 4PP2B 2OI9B 1KT2B 4CVWA 3K81A 3CK0L 2J8UF 5EU7E 3NPZB 3BZ4A 1ZLVH 1J05B 4B50A 3TNMB 3SDAD 3SE8H 2I07A 5K93A 2XA8L 5EBLA 4F37K 4Q58C 1N6QL 1CQKA 4LHUG 4KKCC 5EWIH 1BQSA 1HN1A 3CU1A 2V9RA 1T1WA 5INDB 4NC0B 2FECI 2C7UA 4QHMB 5FGCB 4NM4H 4U1IB 4RGOL 5F9AC 5FGBC 4BA8A 3F8UB 3KNBA 2KZWA 1G7MA 1WLHA 1BD2B 4G7YL 1EH9A 2DQJL 3NCYP 1PDKA 3TBYB 4QRSA 3O6FA 2W0KA 3X3FL 1G7LB 3TVMD 4XX1E 4NZRH 1DUZA 2VLLA 5J6GB 1KIPB 2R2BA 3D39A 5EU3B 5DI8A 3EAKA 5F88B 4IRSA 5JA8B 4HWEL 1NJ9B 3TZVC 4JR9L 4NQDA 5AZEH 2FIRT 4KMQA 2E6PA 5B38G 2W0PA 1AHWA 1U93B 3TBTB 4WWKB 2F8OA 2H3NA 4F3FA 3C5ZC 1FO0H 4KJYB 3OKNB 4YHIB 2NTFB 3C8KB 1IC4L 5LCVH 1IM3B 4JREB 5HHPA 1KYOJ 2IPTL 4OD1H 3VXQA 1FIGH 4L4TB 4JFFA 1FGNL 2W9LA 4LP4A 4X98A 1YEKH 5CJ8A 4PJ7F 4MB4A 4F7TB 4JB9L 4UIMB 2DM4A 2BC4A 4R7DA 4LCYA 5CD5C 5J0BA 2W1NA 2YD4A 1KV3A 3IDJA 1LE9A 1YDPB 5F93C 5D7IB 3X12B 3LOWA 2H8PB 1JPFA 1PQZA 5IIEA 4PJCB 5GIRA 5EBMB 5AZ2H 5EORL 2PCPA 3CAFA 1NGPL 3SDCC 1V7ML 4G8GE 1Z5LA 2GHWB 5DC0A 3G6AA 4C83A 5CEXB 1NBQA 4OGAC 2R2HA 3RJDA 4D9LH 4HUXB 5E8DH 2XT1B 4QRPE 3UEZA 3ARDB 3KYNB 4HFUL 3DO3A 5I1KL 1BZ7B 3ZDXF 4XNZB 2Z8SA 4MA3A 2YZ8A 3X17A 1W72H 3VJ6B 3GSXA 1UB6B 3P73B 4QRPD 4Z95H 3RWGB 5EPMB 4WW1B 1TQCB 4TNWK 4PRBA 1L7TL 1K8IB 1EEYB 4OGYH 3HI5L 4M93B 1P4IL 1DBML 3U30C 2FLRT 4UQ3B 2X7LB 4N9GA 3K80A 1RU9L 5DJ8B 5JOPE 1Q9KB 1K5NA 3T4AB 4YLQT 3QIBB 3QWQB 4LSVH 3TYFA 1IGIL 4O5LL 3IJSB 1D5IH 2NY3D 4PY8I 5CKGA 4LSPH 3GSQB 3QI9D 2DLIA 1U3HD 1W0WB 2OZ4L 3PWJA 2AXFA 1HZHL 3WFHA 4ODTL 4PGBB 4L9LC 5EU6E 4QRRE 3QFJD 4L4VE 5DMGD 3QUMB 4XXCA 5F9OH 5E2VL 3SDYL 3GSQA 4YAQB 3B9KD 2RQ8A 4ODXA 4I18C 2YK1L 2OL3A 4JGJA 1OP5H 1VEOA 3UTSB 5ITBL 4Z7VE 4K7PY 3AMLA 4G9FE 5CSZB 1MWAL 1BMGA 2VL5B 4XNUL 3SDAC 2D9QB 3T0AA 4GXVH 1UWEL 2ZOKB 3STZA 4YXLL 3DVGB 1OW0C 2EDLA 3MUGB 3NH7H 2CKBA 3AUVA 5IW6B 4KK6C 4XT1C 1CICA 3HZMB 5TF1H 2OM5A 1KACB 4H0GA 2Z31B 2QHRH 3L3HA 1RMFH 1LWRA 3GSWA 2IH3B 2R1YA 1UM4H 2OYPA 4Z7NF 4EDXA 1TQBB 3FOMB 3TC9A 1BOYA 3CPLA 4M9OA 1WBZB 3B9KC 8FABA 3TIDA 1IM9D 4GKSB 2E8YA 1T6VN 1ZHBB 3HNSH 3UDWC 2CRZA 4P2RE 43CAB 1U3HC 2HLFD 4WCYH 2Y4SA 3HCVB 5DJAB 4K3DL 2VC2H 1KCVH 4M1CD 3G6DH 4QRSB 1QSEB 3BPOB 3VXUE 4ESKA 1XEDA 3T2NL 1J8HE 1D9KA 5DJAA 1UM4L 1NSNL 4EN3B 1KIPA 3U46A 3U9PL 1PZ5A 4BUGA 2UZXB 3QDHA 3ZE1E 1M7IB 4DCQB 1XCTB 4NT6A 4ENEC 4DUXA 1X5LA 4WV1A 4XNQA 4ZUVA 3TH2T 4R90L 5I1GL 5CBEB 4HKXB 4L3ED 4Y4HA 2RCSH 2IF7A 1CXIA 1IEAB 3WS6C 4NJAH 3PWPD 1CICB 1RIHH 1UWXK 3VFGH 4K8RL 3SE9H 1A7PH 2VDPL 3IJYA 4LGPB 4WHYG 5FYKU 2FNBA 5I8KL 4L8SA 4RAHA 2IG2L 1K3IA 4PRPB 3VFOA 2FJFA 3TA3A 3ARBA 1FRGL 1O0VA 3DXAE 3I6KA 1E28B 4ODUB 2V17L 4M8QB 1DEDA 1H15B 4LGSB 4XCCH 4OI9A 2CK0L 4AENB 2FEEI 3T0BA 1TVDA 1OM3H 3BP7A 3LD8B 1SEBB 4C56E 1X5ZA 1Q1JL 1IC4H 5JPMA 5D6CB 5JXED 3ARGC 2A38A 5ICXB 3B2VH 2R29H 3UTTD 2GQHA 1E4WH 1I9IH 3VFUB 2QQLH 5D7IE 5BS0E 5JZ7C 1FE8H 3BRDA 2NW2A 3V7AG 3MRKA 3GM0A 1RZIB 1ZLUK 1T1XA 3M45A 5DEZA 4B5EA 3SE9L 1OGAE 4UTBL 5KSAB 2GIYA 5FYLE 1QSVA 4EIGB 2A2QT 4DQOL 5JXAH 3H42L 2D03L 1T89A 2DQEH 3ARBC 1MF2L 4ZS7L 2PO6C 4HBCH 5I2IA 3RKDC 4ERSH 3I50H 2DQJH 2YD3A 4J3SA 4JRWA 4JFEA 4Z0BH 3TN0C 1DBBH 4NNPL 3EDEA 1S5IL 4CN6A 5DT1H 2J1KA 1HH9A 5HGBA 3TZVD 3U7YL 3EYSL 3HPLB 4AENA 4JPKL 4KROB 3CLFL 5C1MB 3NA9H 1YA5A 3BP6A 2FJHA 3TO2B 4JFYA 5ICZB 4JFFE 2V2TB 5JOPD 3MCLH 3RU8H 2CRIA 1PG7W 4FHBD 4ZQKB 2EDYA 1KBGH 3BKMH 4ISVA 4Z7UB 1CDJA 3I2CH 2UZYB 3W9EA 3X12A 4BSWB 5I0DA 4Y1AD 4K7PL 1FFOA 4GXUN 4PJGA 2VISB 5CJQH 3V6OE 2HFGH 3WLBA 1Z6JT 2P8LA 1AKJA 3MNZB 3MLWH 2HTKC 1OAZH 5FUCE 3IRPX 2VDNH 3QRGH 2VKXA 2EKJA 4ZODA 4WV1B 4AH2A 3ILQC 1NBZA 3RVWD 3WO3B 3P9LA 3MNVB 4S2SB 1KCSH 3AS0A 3U46B 3NFSL 4QXTB 3SN6N 3O2VL 4HUWB 1GAFL 2HVJB 3RWIB 4F3FB 1NGZA 4I48B 4IMKC 4AG4L 3A67L 3PGFH 1NCAL 4Y4KC 3SDDC 2ICEA 3TEUA 4ZDHA 2YXFA 2CJUH 3VFTA 1FC1A 4KVNL 1FN4A 1I3GH 4GKSA 2CR6A 2R2CA 3MUHL 5D7SH 2Q6WA 4P2RD 1OT2A 2YC1A 3M17B 1NAMH 5F7DB 5MP6L 3RI5K 5EUOA 2DD8H 3ISWA 4KRLB 3UJTH 3KPOA 1RU9H 3LKPA 1G7IA 3T4YB 4R4ND 4PJCF 1IQWH 3KJ6H 2PNDA 4HHAA 3BKYH 1P7KA 3D9AH 2XYCA 5DMGC 3OKMB 3WNMA 1SM3H 4NQEE 2WLZA 4O51A 4X4MA 2BZDA 2Y07H 1VHPA 4YHPA 5INDA 4JG0H 4GRMB 4JFPB 2JELL 4UAOC 1KTLB 1IL1A 4PJHE 1IEBB 1NMCC 1QQDB 2DI8A 1D6EA 5CP3A 2JTDA 3DBXB 5CSGA 3WFEH 3WXWH 1RURH 3C6LB 3CCHB 4M6ML 3FFCA 1QSFB 2Z93A 2C4FT 1PBYA 3AGVA 5HHOA 3O2DL 5HYSB 2KQMA 5DRWA 2XTLA 1AE6L 3DXAA 4UV7H 3RIAF 5C0NC 4HJ0C 2ADFL 3G5VA 3R0MA 3WBDA 4LSUH 4LDOB 1U8MA 3STLA 5DC4B 1SVZA 5I8CA 2PTUA 4OBRA 4U6TA 5J11C 5CFHA 4F2MA 4FQIL 5IB2B 4LOUC 4LCCC 4JFXB 3SKJH 5D5MA 5HHXL 1A6PA 4FQXA 2F15A 2OXHA 4FFVD 4M8VA 3FT2A 3CZFB 3PHOA 4LVNB 3ARED 2JK5A 1MCRA 5C6TH 1S7SA 5HDLA 3SQOH 2KUTA 4X4ME 3Q3GB 1HQRB 1KTRL 2GSIB 4HKJB 1IEBA 5HHMB 1S7VA 1FYTB 2ENSA 3N1GC 2WBKA 3BQUA 4K9EH 3FFDA 4HIHA 2EDKA 4RGNE 4XP6L 3U83A 3U0TA 2B4CC 2HVKB 3S4SB 1JZ3A 2AVGA 1NUFA 2YPVL 5ISZD 1UJTA 4K3JH 1JYVA 2BSSB 4QNPE 2P24A 2XTJE 3AS3A 3WL9A 2KBGA 4BUHA 1CL7I 4JO3H 3H9YA 3VXPB 5I30H 1WBYB 1ADQL 3H9SD 2UWEF 4GXUM 1T7ZA 1CFQA 4FQHA 4PR5B 5E1AA 1X6NA 1HI6B 1EEZA 2H2SC 3H2WA 4RGOH 4GLRH 4Q74A 3VFMB 2ICEB 4YNYB 3FB7A 4P46D 4M48L 3D25A 3DIFB 1JN6B 3WKNA 4CNIB 4MJID 3MXWH 5FYLL 4AZ8A 3MNWB 4HDIB 3RL1B 1PY4A 1TITA 4Q0XL 5IW3A 1R5VA 4Y16C 2WUBH 4HPYL 5LXGL 4HZLB 1U92B 3DETD 3I3BA 4F7MA 1P9MA 5DSCB 4U1KB 3GSUB 3FQTB 3QXDA 4Y1AA 2ZCHL 3VGBA 5F6IC 1XGRA 3AU1B 1J8KA 5F6IB 2VLRB 2DKMA 2BNQA 5HDBE 1T04B 3K8MA 1J1OH 3QXTA 3H0TA 2C3WA 1IGFL 2Q1EA 2Y72A 2VABB 4JRXB 4TOYH 3F6LA 3C8HA 4PB9L 4YAQA 4JVUA 3O41A 3PHQA 2A9MH 1RUKH 1NBVL 1F4WL 1AHWC 3A6CL 3V5KA 1JPSH 2V2WB 3MV11 2XPGA 3FOLA 4LLUB 1JTOA 5D7JB 4LLDB 3CUPA 5SWZE 3K0WA 3PV7A 4LLWA 4NQSA 1G9MC 3CDGB 3OKYA 1CE6A 5C3LD 2WUCL 3ZZ1A 4TOYL 4DVBB 5J9PB 4LRNL 1A4KA 3MLSH 4G5ZL 1RZFH 2HFTA 3GBNH 1FVCB 4H1LG 1B4JL 1QFOA 4OTXH 3KPNA 5C07D 2G9HB 3EOAA 3LIZH 4WW1A 5LGJA 3ABZA 2BFVH 5HDQH 4JFXA 5I16A 4O9HL 2JB5L 3OKOB 1FZKA 4DTGH 4F9LA 4J3UA 1QBML 1QO3B 1RJLA 4MA3B 3GMQB 2W0FB 3UTTA 4UILL 3LQAL 3PNWB 1BBJB 4XPGH 2CMRH 4KU1A 1LK3H 4NQDE 3KJ4C 4GAJL 2HKHL 2GY5A 3ARVA 5ID0A 3V0VA 4LLMB 1VKXA 5E6YA 4EBQL 2OQJB 3UZEA 3ZO0A 1FPTL 1QSFA 1XGUA 1RZIA 4YDJA 2HT2D 2DQUH 3MRKB 1TTUA 3EO1B 2ED9A 1L0YA 4M1DL 5IUSA 4HW6A 2R4SH 1NAML 3VXOB 4BSVB 2EDFA 4QXUH 4KDTA 1CGSH 4E42A 1ETZA 4PY8J 5HGHA 1NKOA 4Z7UF 1RZFL 5IFJA 1JL8A 4R26L 4NYLA 1L0XA 2VDOL 1OARL 1WZKA 1PLGH 3ZE0F 5E4EB 1F13A 3MJ7A 1BQHB 5DYOA 1YQ2A 1OGTB 2HH0L 4WO4A 2FDBP 3CVHL 3L3GA 4AQOA 1P7KB 5KTEH 3O4LD 1UACL 4WI9A 3P11H 1UH2A 1J0JA 3VWJC 2EXYD 4YHPB 3T0XA 5JOFB 3DGGB 4J6RL 3L6FA 4IRJA 1UB5A 3MLXH 5T5NG 4NQXA 2AQ2A 2FX9H 1FG9C 4G3YL 5JW4M 5HHVH 4ONFH 3ZL4H 2QBWA 4FG6D 1OAZL 3W11C 3OKKA 4XRCA 3V5DB 3NZ8B 2AKRB 4U1LA 1CXLA 3MR9A 3O3AB 4OCYH 2BVTA 4NKQB 4WVRA 5IEKA 3CH8A 1HKFA 3GMNA 5EG6C 2CXKA 1MH5A 3SKOB 2J8OA 1C1EL 1PZ5B 3QDMA 3OAYH 43CAA 4RMWA 4AL8L 1OTSD 5BW7A 4KZEL 1HH6A 2B1HH 2X09A 1A6VH 2NPLX 4P9HH 2RBLA 5IMKB 1TMCB 1YN7B 3NA9L 1CFNA 2G60H 5F7MC 2FL5A 3EYSH 2FH6A 5K9KA 4TSCL 2IH3A 2R1YB 4PJBE 1RZ8B 4BH8B 5HGAA 2EH8L 2Q7YB 3O2DH 2P5WB 4IOIA 1NCCL 3P77B 1DVFD 4UT9H 1UB5B 1YQVL 4KKBC 4BJLA 2DMCA 1R5WA 1H3XA 3WHXA 4KI5E 1MUJA 3G5YB 5C0CA 1MIEH 4EIZC 2DWEA 1GXEA 4FG6C 5GRWA 4WI7A 1D5XA 2WZPD 4X6BB 2BSTA 4RWYH 1RVFL 4M8QA 2ATPA 3MOAL 1GZQA 4M6NH 3WIHH 1AGCA 1UADC 4M6AA 3Q6GH 3DV6B 2MHAA 2NY7L 4X6DA 4PTUA 3FB6B 5AWNL 5HHOE 3HZYB 4WV1C 4JCMA 1JHLH 5DJYA 4YHZL 1Q1JH 1MCPH 1BJ1H 2I5YL 1RIVL 5TJWK 3WO4C 3JV6A 5FHBL 5I6XC 1F6FB 4LSQL 1CD1B 5DJ0A 3CLEH 1QA9A 3ULUD 1G9ML 5MERB 4O02L 4XNQB 3PDOB 4YEEA 1U3JA 2B5IB 3BXNB 4CKVX 4GRWF 4NZJA 3CXDL 2XV6B 4JHAL 5IESL 1KJVA 3MRRB 4CDGC 5J7CC 1KN2L 4W4NA 1EAPA 4I9WD 4M02A 4ZUSA 1SJHA 3TN0B 5AYUH 1KGCE 1W2KT 1H3VA 4MA8L 1K4CB 4EUPH 1YEHL 4F58L 4S10A 5BVPH 2MWCA 2F5AH 3N1MC 1FVEA 4YHLH 5FHAH 5LKNA 4WHCA 1I1FA 3EDDA 1KTKE 2H1PH 3BUYA 5CILL 4KGLA 1L7IH 5HYIA 4M62H 2FGWL 4DW2H 3L6FB 1O7SA 1DP0A 4XP1L 1V5JA 1LO2L 4LVOB 2XKUA 2P5EA 4YE4H 4HJJL 2A6JA 3QUML 2ZUYA 4KC3B 3O11A 3ULSA 2UWEB 5EN2A 4WCYL 4XPBH 4HQQL 2XQBL 4M7ZB 3B2UD 4O2FB 1T89C 4U0RC 5MI0B 5DMYA 3QIWA 1RUPL 4M7KH 4NRYA 1U8KA 5IVNA 4PGEB 1LD9A 2B4CL 2PYFA 3O81A 4W81A 4M48H 5ETUA 2DD8L 5FM4A 5D7LE 2CKNA 1GRWA 1NCUA 4JQVA 3FQTA 4NQDD 2FIKB 4OUUB 3ARXA 3C5JB 4J12A 3A6BL 4GAGL 4QRUA 5FAAA 1T22A 5I9QB 2ZWLT 2I60H 3BHBB 3VFVB 2HWZH 3BH8B 3VD4A 1IAIL 3WO4B 1MWAH 2FHFA 3TWCL 5DJXA 2EIZA 3TVMA 1EPFA 5IKCA 1UZ6F 3OKNA 4K3JL 3OTTA 3D25B 3DIFA 3V0WL 3U1SL 3V5DA 5JHDE 1FORL 3ZKND 3OB0H 2XFXA 3FQXA 2I26N 1OAKH 3BOVA 1R3JA 3AS2A 4WHYH 1ZGLA 4HK0B 2YA2A 1KCLA 2AV7B 1U8PA 5J1AB 4H88H 1T0MB 4JN1H 4XVSH 3WDJA 4JRYD 2MCPH 3Q1SH 2NXZD 3RUGF 4BYHA 3O6FB 4YHML 2EKSB 3HC0B 5CJ5A 2XZAL 4FRWA 1MCQA 1CLYL 4QHMA 2E9IA 2G5BA 2DIAA 4WUUD 3MCLL 3S35H 2J88H 2NY6D 3SKNB 3IDJB 1ZLWH 3BT2L 1S8DB 2FO4A 2NX5A 4LRIC 3IFNL 4G8EA 1P4LB 1A22B 4XH2B 4ZTOH 4U1SB 4OFYA 5DURB 1DQMH 4YDJB 1HHGA 3AXLB 3KLSA 3MRDB 4LAJH 1MFDH 1WFUA 1IFHL 1F8TH 1FNFA 2I9TA 4L4TA 4KK5D 5C2UB 2YD6A 4GUPB 4FABL 2DF3A 1YNTB 4P2QB 3K4AA 2F54D 4F57H 3F5WB 4JZNB 5EZIH 3VJ6A 4XCFH 3X13A 1U8MB 5KS9F 2JELH 3QHZH 5DUMH 2HT4C 3RY6A 4TULH 1CZ8L 5EPMA 3RWGA 1HILB 1YPZE 5A1AA 3RDTB 4IEFB 2EDJA 2OP4H 3CZJA 4YXKH 2VZ1A 4HIEB 4RQQB 3ALPA 2R29L 2EYTA 3UPAA 1S9KC 2OMNA 5FYKH 3MRJB 1JK8B 4I9WE 4L9DA 1VGKB 3VH8A 1CTOA 2NR6D 5F72S 4FTVB 5HYEA 2GKIA 3ZKMC 1KGCD 4C83B 4MCZB 1B6DA 4MNHA 4QYOA 4JY6A 2RIKA 4M1CC 2ZUVA 4GMSL 3UTSD 4ELKA 2GCYB 4G7VL 4PV9A 3W9DA 4HXAH 5EBMA 3KPRA 1H5BA 2SEBB 3H9HB 4UNUA 4GMTH 4WFGE 5EOQL 2C1PB 2F53B 3KJ4B 4U05A 4QWWC 3BGFC 3UTSE 5FM5M 3IFPB 4HD9A 5BO1L 5E6IA 4LMQI 5IB3A 4JANA 1KIQA 3WNOA 1RIHL 1Y18A 4FXKB 1HHJB 1HHHA 5L0QC 3ARDC 1F58H 4NZRL 4HXAL 2WBJC 1J05A 3OKEA 1BVLA 4DN3L 4Y5XA 1HDMB 4OCMC 4NIKB 3P0VH 1RJZB 5DD3H 1G9NL 3R06B 2XACC 5DFTA 2JIXB 3WV0A 1RZJL 3FO0L 4OZHA 2ZUTA 2ED7A 2BVQA 2VLJD 3CJJA 3LEXA 5MEND 2B20A 2CIKA 1QLEH 2OP4L 3QSKB 3CD4A 1HOCA 2IAMD 2NYYC 3P9LB 2XOTA 1EJOL 5K9KB 4Z95L 1CFQB 2NY3C 2XICA 4YC2C 3BAEL 2N56A 2IFFL 3B9KA 1HH6B 1KENL 3KPRE 4L3EB 3VXPA 1BZQK 5DD6A 3P9MA 5D2NC 4D9LL 1U3HA 1CXFA 1ZK9A 2EZ0D 5CZVH 4PBWD 3DARA 4P49A 1NANH 3MZTA 5D7LA 1ZT7A 4HUVB 4UI2A 5IBLD 2YA0A 4KXZI 2AV1B 3IXTA 2GK0A 5CCKH 4X6DE 4S1RH 5AYQA 1YEHH 1Q9OB 1Z9SA 3NIFF 1QPPA 3HAEA 5T3ZH 3PWVA 1B0RB 4MAYA 5DUBA 2NLJA 4QRQB 1Q9OA 1DQDL 1RK0B 4Y7MA 3QXUA 2WQ8A 4U1MA 4WY7H 3IDXH 4EXPX 5C09D 1E4WL 2IC2A 2GSGB 2HT4D 1YMME 5BV7C 4BK4A 1KG0A 2DS4A 1QUNA 4C56B 4WI5A 2LABA 2IQAA 4U1GB 1NDMA 4OLZH 5F44A 1MNUH 1ADQA 3GNML 3ZKSD 4Z0XA 3UPRB 2V17H 1ORSB 5T1LD 4U3CA 3EFFB 4PY7B 1J8HA 1TCRA 4K71B 2EH7H 3K4ZA 3WDIA 4KTDL 3OXRA 1PKOA 1KEGH 4TULL 1JZ6A 1GHFH 3DROB 5D7KE 3DX9A 3MRBB 2OI9C 2ZUQB 3F62A 1RIUL 1HHKB 4KRPC 1FNSH 3L7FA 5GJTL 5DHVA 4YO0A 5HD8D 1EFXA 1CLOH 3TV3H 1KC5H 1RUMH 5DJDA 4CVUA 2O93L 3D2UA 1H15A 5HY9B 4WFED 1CT8B 2X42A 4HAGA 3KYAA 2A6IA 5BXFA 3G5ZB 2EXWD 3MROB 1M6OA 4M03A 3UDWA 1A7QL 1SHMA 1AGFB 3IKCA 5GGVL 1J5OL 2WQRA 5ERWB 4XPFH 2Z35A 1UJ3C 4Y5XB 2FJHB 2Q76B 3EJYD 3QCTH 1G7HA 3EO9H 2XA8H 2VR4A 3QIUA 3FL7A 3MO1B 2FX7H 4KI5D 5F6HJ 5DTFA 4TVSa 2O26U 3EHBC 4PJ5A 5TQ0H 3O2WH 5GRVL 1F11A 1U95A 2IPKA 2NNAB 4GG6E 2NZIA 3QZWG 5LVEA 4DKDC 1EHAA 3T2QA 4NN5C 4N0FB 4XPHL 3B6SB 5C0AE 5DS8B 5B38B 1D9KB 3BIKA 3KYKH 3ZL4L 4ZXBC 5ADPH 5F1IA 2X4RB 1TQBC 2ARJB 1ZLVK 1DQQB 2R9HD 4LPYA 1TJIL 3TBSB 1OAUL 3QO1A 3DUUA 2C5DC 3ET9F 1A6UL 4XGZA 4IRJC 5JW5A 3ZE2E 4NO5B 3PV6A 3QIBD 1OD9A 3MRLA 5IB4B 3EOYG 2BVEA 5BO1H 2OTUB 4G8IB 4KKLD 5B21A 1K2DA 3D2UD 1DQTA 3BYYA 1W72B 2DM3A 1CDGA 2PN5A 3VWKD 1OARH 3BZDA 4N1CA 5I8EA 5DMKB 4I18B 4D3CL 2YPLA 2ICWJ 1E4XH 2AP2A 5I8CB 1IGTA 4P2QA 2VH5H 4GO6B 4Z7UA 2M26A 5BV7L 4WFHD 4AEHL 4LLYA 4YEFA 3I6LE 1FG2B 4KRPB 1HYSC 4H8WC 2BVOA 1DBMH 4M7LH 2MFNA 4HFWA 3SDAA 1OY3B 1XGQA 4L3EE 3Q5TA 3ARDD 4GAJH 4ZPVB 1JRHI 3D1MC 1FV1B 1IC7L 1OF2A 3EJZD 2VZTA 4KJPC 2L7JA 1MVFA 4QEGA 5FK9B 3RWEB 4N0CD 3V5KB 5I75B 2MPAL 3L7EA 4YQXH 5CZXD 1U91A 5EOTA 3EYOA