4LGPB

Ricin a chain bound to camelid nanobody (vhh1)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
QVQLVETGGGLVQPGGSLTLSCAGSGGTLEHYAIGWFRQAPGKEHEWLVCNRGEYGSTVYVDSVKGRFTASRDNAKNTVYLQLNSLKPDDTGIYYCVSGCYSWRGPWGQGTQVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
total genus 24
structure length 116
sequence length 116
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgpB00
1F90L 1KUMA 3GKWL 3MRIB 4GMTL 4LARL 5TFSH 1KIQA 3OQ3B 1T1XB 4HMDA 4JO4H 4OZFA 2PYFA 2GTWB 1FVCB 4LAQH 1KF9B 1NLDH 4HSQA 3DYPA 4HGWA 1D5BA 3DVNB 3VXRE 5E6IC 5JZ7C 4K23H 2PW2B 4ZSOB 1IGIL 2PYEE 4OFDA 5DEFA 4TNVF 5BVJB 5DJXA 4HZAA 3E6FA 3U9UA 5EU6A 3I75A 1LP9B 4F33A 4OCSH 2VC2L 4RCAA 2C3XA 4KKAD 1OT2A 5IB1A 4FQXC 5D71L 2FYYB 4LCUA 3PGFL 3O8XA 1D6VH 2F53A 4LLMB 1A3RL 1Q9OA 5E99L 4EN3B 1A0QH 2YBRB 4N9GA 3TESA 1G6RB 1ZS8B 3I02A 5ISZA 5L8KB 2NLJB 2YK1H 1RZKH 4LSUL 4X4YB 1JHKL 3L3DA 3TZVC 2R1WA 5BQ7A 3QIWC 4XB7A 5CP7B 3UTQB 4Y5YB 3U9PL 3NN8A 4JHBA 1ZTXH 3OAYK 1I1AB 3QDJB 3BXNB 1YY8B 2L7JA 3EZJB 3MLSL 4WDIB 3HC4L 2X41A 4HIHB 1ZGLP 3WUZA 2XXMB 5JXAH 4KRMB 3ARFD 3G5VB 5EA0L 1NCAH 2VLLB 3O9WD 4ERSH 4TQEL 4G42A 3BH9A 4F57L 3MV8B 2R9HC 3CXDL 2ZWLT 3ARGA 4GBXC 1CLYH 1XF2A 2XTJE 3DECA 1WTLA 3UPRA 3NCCB 1F90H 4P0DA 4GMTH 4ZO9A 5J1AB 3IYLW 4NOBA 4XH2B 1WAAA 3DETD 3KPRA 3D9AL 4GW4A 1O7VA 4QHMB 3P4NA 5CHNA 1IGIH 4RGOL 3QNXB 4Z76A 1U3HD 2X4TB 2DBJA 1JNJA 3NVQA 3DNKA 4KKBC 3TGXA 2VC2H 2DLFL 3D3VE 3ARPA 4YBHA 5D71H 1URLA 2CLVA 1RZJL 3PGFH 4HUVB 3FQTA 1XAUA 2A9NL 5IP4A 3QSKB 1YNTA 1A3RH 3PHOB 4G8GB 2FECI 5E99H 4ZNEA 5HY9A 3UYOD 2P24B 3MRLB 1RIVL 3S37X 5F7KC 1FL5B 4N5UA 2FECL 3IJHB 2FHBA 3UPAA 4YHOL 3FO2A 1A21A 1JPFB 3NIDE 4YFLI 2YPVH 1QVOA 4LSUH 5EZJA 2CLRB 1JHKH 1PYWA 3IFPA 4ZUSB 2HTLD 1HH9A 4YDKL 1HNGA 1FO0A 2ZJSH 4RISH 5GRXG 1AXTL 3IRZA 2ARWA 3WNLA 4U1GB 4RQQB 5C0AB 3RKPA 3WE6A 2QLVB 5CZXC 5A3IC 1UH4A 4Y8AA 3WDHA 2BCKB 1A9EA 5I1LB 3MLSH 4LLWB 3HC4H 3RPKA 2OI9B 1U8HA 5JW5B 2GT9A 3K1DA 2IH1A 3IKCB 3DVGA 3GJFA 5EA0H 3EDJA 4K7PL 4YGVA 1NDGB 4TQEH 2VLRA 1AY1L 3LEXA 2CK0L 3CXDH 2E9JA 5LVEA 5CLTA 3NGBC 4YIQB 3V2AR 2EIEA 3AS3A 1AIFA 3L5JA 4LF3B 1CFBA 3PABA 5DA0B 2GK0A 2UZYB 6CGTA 1YQ2A 2XA3A 4U1NA 3D9AH 5CP3H 4HT1L 4HIXL 3RWGB 4U1MA 1S5HB 4MQ7A 4RGOH 1JTOA 3DUUB 4XMPL 5I15L 4UUJA 3C5ZD 1BJ1H 1CG9B 4OZFH 1U93A 5FYJE 3PL6B 2DLFH 1NGYB 4Q74A 2CQVA 3E2HB 3MOBL 5GGSB 1BFSA 2ENSA 1IL1B 1RZJH 2X4OB 4E41E 4ENED 2A9NH 1X3DA 5E9DE 3PWPB 1QBLL 3FL7A 3DJ9A 2EE2A 1RIVH 1UXWB 3HAEG 4Z0BL 3LQAC 4YHOH 3VXPA 1QRKA 3QUXD 1BECA 1WJ3A 2IPTL 3HUJF 4NZRL 2NXZB 3AM8A 3HG1A 15C8L 4Q6IC 4YDKH 4EDXB 2WBJB 2E3VA 3RNQA 1AXTH 1EHLL 3TN0B 5FV1L 3Q3GB 1NMCB 4HQQL 4AZ8A 4NO0B 4P5MB 2AEQL 2ADIA 1ZT7A 4R6UA 1IQWL 4Y5XA 1JFQL 3SDAD 1FE8L 1NGXA 3VRJA 4C59B 1FO0L 1OTUC 4JG1L 3ARYA 4KRPC 5I6XB 4NBXB 3DV4B 2QSTA 5MEQB 4PJXE 4TSCL 1YY9C 4F9PC 5B22A 4F7PB 2BXZA 5ICYB 1AY1H 1MRDL 3FOMB 3KPNA 5D96B 2CK0H 2DQFA 2BDNL 4JHAL 2NX5B 3RVWC 4JZNA 4M61B 3S35L 4R4FL 3WDIA 5JO5A 4LVNB 1UWGL 3QDMA 1SMAA 5DYOB 4KJWD 3KHQA 4HKXB 5CCKH 4PRHD 4U1LA 4OLVL 5F9JB 1T22B 3MMEB 5EU4A 2OLDA 5HI4D 5HGAA 4S1RH 2W38A 4HT1H 4HIXH 2OXHA 32C2B 2RFXA 3QHZL 3MGOB 1ZGLM 2HFGH 5C0RL 4XMPH 5IMKA 3FB8B 1JI1A 2DTML 4Y1AB 5HHME 3QR2A 3AAZA 1QFUL 3MOBH 3RP1A 3VJ6B 4MA8H 4LPUA 1D5IL 3KYOA 1AGBB 5EUOE 3TBYB 2EIDA 1QBLH 3DX9B 3R4DA 3OKLB 2IANE 3VXME 1XGTA 1G7LB 3KLAB 4DZ8A 4NC2B 4Z0BH 2M1KA 1EHAA 1U91A 1KPUB 5IMLB 4YK4B 3H9ZA 1Q9WA 4UIMB 3BI9X 4UINL 3KS0H 2EDTA 4BM7A 2IPTH 2WQ8A 1R24A 2BNUA 3TO4B 4GXVH 5DFTA 1RV6X 4AIOA 4WNQA 1MH5B 3RBGA 4YDVA 1EHLH 1R3JA 5GHWL 2C3HA 4PJGF 2AEQH 4D8PB 2APBA 4H26A 4PJHB 1N2RB 1IQWH 2VLKB 3H7BB 4NBYB 1NFKA 1DEEA 1FE8H 3BEVB 3T2QA 5ANMB 1FO0H 4JG1H 1T3FA 3L5IA 5J6HA 1EUUA 1KIUA 3TFKD 4X0KA 5INDA 3P0YL 5IK3A 4Z7UE 5JHDB 3FHAA 3MRIA 4U6XA 4WUUB 3BDYH 4PLKD 2BDNH 4JHAH 3HPJB 4G8IB 1G9EA 1FVCA 5C0BB 2NY6D 1RJCA 4R4FH 3S35H 4WI6A 5JPNB 2VKXA 3VXUE 1FFNB 4KH2A 4XPGL 1P6FA 3GJFH 2JJUA 4U6VL 1JF5A 2AJZB 2DWDB 1KT2B 4IMLB 2Y07H 1S7UA 1Y6MR 4AIZB 5CJ8A 3GNML 1XCQB 4R4BB 4N0CD 1MFNA 2FYYA 4LCWD 5ELIA 2UYLB 1DE4A 9CGTA 4JR9L 2HG5A 4EN3A 3DMMD 4AL8L 1QFUH 3VH8G 3GSVB 2YBRA 1D5IH 1ZT1A 3MJ6A 1ZS8A 3ULUL 5D1ZB 3WS6C 4MNGA 4MJIE 3V0AC 2WV3A 2X05A 2FH6A 4JHWL 3GMMB 3DGGA 4PRDA 3CX5K 5CS7A 5E6YA 2ICES 3UTQA 3HNVH 3LEVL 1H3VA 4J2XA 4ZUUB 2FSEB 4CN1A 4PP2B 4ZXBA 5KAQF 4IRJB 3OKKB 5TE6L 4UINH 5KSBE 5I74C 1H3GA 1BWWA 1I1AA 3QDJA 1J0ZA 1VEOA 1ONQA 3UTTE 1CL7I 3BXNA 4NKMB 1QSEE 2DM3A 4WDIA 2FR4B 4P2RA 4PV9B 1D5XB 5TF1L 2VZVA 4KVCH 4XWGL 3M1BA 1W72B 2Y5TA 1S7WB 3DHMA 1CL7L 4U49A 4YFEA 5GHWH 3RGVD 3HI5L 2VLLA 4M8VA 5CBEB 2QL1A 4PRNB 3MV7A 3MV8A 4FFVD 3QIBB 1P4IL 3NABL 1A6UL 2DQJL 1X9QA 4PREA 3P0YH 3PXJA 1MWAB 4R9HA 3CC5A 3QBTB 4W81A 1P4LB 1YEEH 5J1AA 3T77A 3CVHB 1B4RA 2OJEA 5GS3A 2EYSA 4HS8L 3PXHA 4OZGF 5EU5A 4XPGH 4HW6A 4QHMA 4U6VH 4UIKL 5IM7B 1MFCL 5HHOD 3T1FB 4YQXH 1CFSB 4FQ2L 4FQQB 1Z3GL 3QZWG 1RJZB 3EYVA 2J88H 4P2QB 3DX6B 3GNMH 4HXBL 1ZHLA 12E8H 4HUVA 2CMRL 4G8GA 2F54E 4W70A 4XP5L 1S78D 4AL8H 2R0KH 3GM8A 1FL5A 3ULUH 3F12B 3IJHA 5HDBF 4O02L 1KG0A 4NJAL 2CLRA 4JHWH 2V7HB 5C0CD 3LEVH 2XIDA 5IROC 1J0KA 3SO3B 1UENA 5TE6H 5HYJB 2VR5A 5FUOL 3DUHA 5GZOC 3P0GB 4OF7A 3GSUB 1K4DA 1WCQA 3CDYA 4P9HL 5AZEL 1R5VA 2BCKA 5I9QC 5TF1H 3FMGL 4XWGH 5JW5A 1IVLA 2DLHA 1EJ6A 1CL7H 3EO9L 4NNYB 4V2BA 2Y36L 3IKCA 4XVUC 3ARXA 3GMQB 5LBSL 1KB5B 5E56A 1Y6KR 3TCXA 2ATPB 1FQ9C 4JO1L 1FJ1B 1P4IH 3NABH 4HWEH 4ZPTB 4ZD3L 1A6UH 2DQJH 5E5UB 4GRLA 4ODSH 1RY7B 5C08E 3E1F1 1EFXD 2B5IB 5T5NG 3S4SB 3OF6D 2ZPKL 3P73B 4OFYD 4LF3A 1HHJB 4HBQA 3WFZA 3VXQB 2B2XH 5KANI 3MBED 3T0EB 5FOBB 2L0DA 1DUYB 4JFFB 4PJCE 4H1LA 4GG8B 3GSNB 4UIKH 1MFCH 1U8MB 4JFYB 2LAGB 3DUUA 3TH4T 3VGBA 4A2MA 1YMME 1FYTE 4IBLT 1B0WA 4FQ2H 1CG9A 4OLZL 4RA3A 5AEAA 1TZHB 1NGYA 3VFSA 4ZFGL 1F97A 4HXBH 4NZUL 5GGSA 3NFSH 4LSRH 1P5VA 3LKOA 5DRXA 2CMRH 4S11A 2X89A 3T2OA 2JTDA 1R3LA 3G6JB 1KN2H 2MKLC 1OQXA 4OF6A 5E4EB 4NRZA 3PWPA 2O26U 3K7UA 4ZOEA 1JZ6A 5IV2B 4KV5E 4XP5H 4L29B 5DEGB 3ZTNL 5B39G 2WM0A 4G43B 5HVWA 4B7LA 2ATKB 2A74B 4O02H 3BQUB 3HMWL 1DLHA 1NAML 4NJAH 4JFDD 4ODUB 5J56B 1TPXB 5EN2A 2EE6A 4KXZI 5EIIB 4EDXA 2QSCL 3C8KB 4XNYH 4M43L 1X7QA 4A2LA 5FUOH 1WICA 1NMBL 4P5MA 4LSPL 4YDJB 3SE9H 1A02N 1IE5A 3DXAB 1VKXB 4P9HH 1I7TB 5AZEH 3SCMD 1UEYA 3VXSB 3W0WB 3D0LB 4J6RL 3EO9H 2MQCA 2Y36H 1ZGLB 4RWHA 5T3XD 2XY1A 1C12A 2HRPL 5LBSH 2XZAL 2BP3A 1MCWM 1WBYB 1QFWM 1VADB 4ELKB 5ICYA 3PDOB 3O4OC 4JO1H 4ZQKB 4DK6A 4ZD3H 1C08B 1KCVH 2MTPA 4WI7A 1PX3A 4CGTA 3WN5C 2ILLA 1KIPB 3NH7H 4M61A 4MXQC 5DYOA 5GJTL 2YD9A 5F89B 4HKXA 4BSJA 3VFRB 2ZPKH 2J8UA 1F2QA 1CXHA 2V5SA 1T22A 5LGKA 4S2SA 3MMEA 1IGJA 4JM2D 1VB9A 3GFUA 1FFRA 2GTZB 32C2A 3JV6B 3SDDD 3D39B 1FFOB 5DDHA 1H3XA 4HV8B 3RPIB 2XKNB 2XZQL 2AW2A 2D3VA 4OLZH 2ZSVB 4PRPE 4QHUB 4ZFGH 4NZUH 3VJ6A 5F96L 4L3EB 4JRXE 1AGBA 1JIBA 2FDBP 2FBOJ 3TBYA 4PY8J 4XI5C 5F21B 3FZUD 3BP4B 3ZKND 3KPSE 4MNHB 4L8SC 2HA1A 4PV8B 3KLAA 4H20H 3IFLL 4IRZH 3ZTNH 4KHXL 4D9RD 2X4UB 2GJ6E 5IJKC 3TYFA 1KPUA 5IMLA 4XXDB 4OD2B 4R0LB 3O8XD 2F53D 1NAMH 4WHTB 1OD7A 4GG6B 3TO4A 5GJSL 1HQRA 1IKNA 1T7VA 4WFFE 3TNMB 5I1HL 4C54A 3R8QA 2QSCH 5LKNA 4M43H 3RL2B 5F9WC 1MH5A 4JQXC 3BPOB 4WV1B 1J12A 1NMBH 4ZPVA 4KXZH 4KROC 7FABL 2ESVD 1HCVA 3HNTL 4PJHA 1N2RA 4OCRL 1ITBB 4PJIE 3VFGL 1N59B 2VLKA 4PYHA 1UZ6E 3VFUB 1JGEA 4U3HA 3PQYB 3ZTJH 3TA3C 1QNZL 3QQ4A 2HRPH 2XZAH 1BEYL 5I71C 2VTFA 3RKDD 1IC1A 4I77L 3DV6B 3O6KL 1Z9OA 3V0WL 5JHDA 4WUUA 1MIEL 3NPSC 3HPJA 4X99B 3OBAA 3U6RA 4LPYA 5C0BA 3RVVD 5ENWB 4PJAE 3L3KA 5JPNA 5GJTH 3QJHA 3L9RA 1C5CL 1MVUA 1Z2KA 4BZ1L 4WFGE 4LPCA 1XR8B 3ARDC 5H94B 5EO9A 1FV1A 3I6LD 4P4KA 4IOFD 3KJ4B 4UT6L 2VZSA 4AIZA 2VXTH 2B4CC 1OTSC 1NBVL 3KG5A 2X4QA 3TIEB 4K3GA 2GCYB 2XZQH 5B8CA 2D0FA 1DVFB 2BVEA 2NY4D 1RVFL 3HE7D 4GW5B 3NFNB 3HI6L 5FKAA 3GSVA 5JIPA 4OFKA 4PRIB 2LFGA 3ALWA 4H1LH 5D1ZA 4HLZG 5DRWB 3ZE0F 4P59L 1DBBL 1A1OB 1ES0A 1EO5A 2X9XA 3H9SB 5I2IA 2Z8WC 2PXYC 3GMMA 2MQ0A 2ZOLB 3IFLH 4FTVA 1K2DB 4GXUM 1XIWD 4KHXH 1QR1B 5EORL 1IGYA 3HPLB 1NGWA 1RJYB 4Y4FB 2FSEA 5EO1A 3CZJA 1HN1A 1R3IL 3RGHA 3ARGC 4WWKB 5GJSH 5T1KD 4JAMA 3VXRD 4NKMA 1F4WL 1NSNL 1U6AL 5I1HH 4PV9A 1JPSL 3TBSB 2DIAA 1F00I 1PX4A 3MOQA 1U8NA 5HI3D 4X7EC 7FABH 3OGCB 4G7VL 2C1OB 3HNTH 2KZ1B 1M7DA 1Z9LA 2N7AA 4OCRH 3RWFB 1OTTD 1X5HA 3VFGH 1A3QA 1BOGA 4PRNA 5KS9F 4I3GA 3QIBA 1LILA 4MA3B 2ITDA 4NZTL 5TQ0L 1KJ3H 1ZHBB 3PV6B 1OPGL 4LCYB 1QNZH 1BEYH 2X1OA 2OL3B 3AB0B 4GKOA 2D7PA 4PJFF 3G6DL 3U36A 3O6KH 3V0WH 3DVFA 4LEXL 1MIEH 1WZMA 4PGDB 4X80L 1MIML 2DN7A 5C70A 4OUUB 5ACLA 2PW1B 4S1QH 3TNNA 1G7HB 4XBGB 2BVUA 4GQ9L 4OIBA 4WGVB 1C5CH 3TBVB 4BZ1H 4QWWC 3CUPA 4RGND 2NXYD 2W0PA 3PWVB 4Y8DC 1CFSA 4OCLC 4UT6H 1CDJA 3HI1B 1YEFL 4HBCL 4OZHF 4LHUG 1F4HA 1NBVH 2DLEA 2WIIA 5DHVB 1CFQB 4I9WE 4LFHG 4XAKE 1P53A 1S7RB 3QIUC 1OAYL 5LGJA 1RVFH 2QADD 4Q2ZB 5EBMA 3VWKD 5C07B 3U1SL 4MJ6A 2FL5B 4OF8A 5DI8B 5J12B 1H3PL 3F12A 4P59H 1DBBH 3K8KA 3N1MC 2XTJD 1NCDL 3PGDB 4HUUA 1CE6B 3TWCH 4WO4B 5EORH 5BW7A 1I8MA 4I0PC 3CSBA 1R3IH 3BHBA 4C56A 5HYJA 3IF1B 4ZS7L 1TNMA 2FCBA 3GSUA 3W11D 2AV7B 3G6AB 3MXWL 1F4WH 1NSNH 1U6AH 3KHOA 2P8PA 4RDQF 5CINL 1JPSH 1DBJL 3N85L 3F5WB 4NNYA 2CIIA 4G7VH 1KB5A 5T1MA 3NIFE 2XFXA 5F6HJ 3OKNB 5FYKL 3GIVA 5DVMA 1A9BB 3ILPB 2P45B 4XT1C 1FJ1A 1BAFH 3T2NL 4NZTH 3LVEA 5TQ0H 1OPGH 4RFNC 2P8MA 1PBYA 2N1KA 1W0YT 3LRSB 1JL8A 5DHYB 4JVUA 4P5KB 5DO2C 1C1EL 1KTRL 3G6DH 5DMYA 4LEXH 3S4SA 4X80H 1MIMH 3QG7L 4RFEB 2UY6A 1HHJA 4RAVB 1VFAB 1MCNA 1A4KB 4JO2L 5FOBA 4GQ9H 5ALCH 1OAZL 4GG8A 2BSED 3S5LG 2X7LB 3GSNA 3VXTA 1OOAA 1U8MA 4JFYA 2RAMA 4IJ3C 4GAYB 4HK0B 3TEUA 2MHAA 2AEWA 2G9HB 5D7IF 4S1DD 1AGCA 3REWA 4I4WA 4CW1A 1Q72H 5INCB 1YEFH 4HBCH 1RUPL 5HYSB 3DPBA 1BVKB 1WFTA 4P2YA 1I7ZB 4NWUH 2JK5B 2GAZB 3G6JA 3VGFA 1V5JA 1OAYH 1AXSA 3QEGL 2F15A 4JGJA 4XHJC 4Y5XC 5C9JA 5DEGA 5MENB 4MQXD 1H3PH 2D2OA 1F11B 2YPKA 5FHBL 3LY6A 4G43A 2ATKA 3BQUA 1EBAA 2ZUTA 2NY3C 4LHUD 1NCDH 2C1PB 4R90L 4MLSA 1JGLH 3MGAA 3V5HB 1BF2A 4MS8C 4LFHD 4HS3B 5EIIA 1J5OL 4OLWL 5HDOA 4NT6A 5D7LE 5D5MB 4ZS7H 3FFCB 5HHPB 2Z35A 1H8SA 1MNUL 4K9EL 4QRPE 4YDJA 3MXWH 3DXAA 2EYTA 4Y4HA 1DP0A 1VKXA 2NCMA 4WCYL 5DUPL 1I7TA 2ARJB 5IF0B 5CINH 1DBJH 3U30B 4F7MB 3CFCL 3D0LA 3N85H 3KNBB 3IXAB 1BZ7B 3ETBF 1DUZB 3VRLE 3WEXA 5FYKH 1VADA 3UYPA 4E41D 1MCDA 4GUPB 2QKIB 4ZQKA 3T2NH 5E9DD 4OM0L 5KANG 4Z7QE 2APTA 4JFHE 4AH2B 3NA4A 1CIUA 4I48A 2X4RA 1KIPA 1IM9A 1C1EH 3CXHK 3GSOA 4LLUB 4U1HB 2AKRB 2ZCLH 4MGXA 4PY7A 2VN4A 3DI2B 3L7FA 3MRHB 1QFHA 1Z9MA 4HUNB 3KYAA 5F89A 5TH2A 4ELME 5ERWA 4QXUL 4YPGA 3QG7H 1JMZA 5I8KL 4Y88A 3GBNL 4L3AA 4Q97A 3ARRA 3JV6A 1BX2A 3D39A 5E0QA 4N0UB 2W9DL 1FFOA 2C4FU 1FORL 1G1CA 1SY6A 3RPIA 4GKSB 5DSCB 1OLZA 3DWTA 8FABB 1ACZA 1MCIA 1DCLA 1WAAE 4MNQB 3J8F7 2HFEA 3KPRE 2DIBA 1RUPH 5D2LA 4NQDB 2YUZA 3H3KA 4K3HA 3ULVC 2K9UA 4EQ2A 1FG2B 3BP4A 3F7YB 4PV8A 4U6TA 1X5YA 1ZSDB 4GLRI 1ACYL 5GGUB 5FHBH 4F15C 2X4UA 1RMFL 4G6AC 1SBBA 1UEMA 4FN0A 5GIRB 4GW1B 2D0GA 2DQUH 4OD2A 4R0LA 3KLHC 4GG6A 1F8TL 4R90H 4ZNEE 2NY0B 3UTSB 3TZVD 2Z9TA 3ZTJG 3V5KB 1Q94B 1CDHA 2YN5A 3QIWD 5EOTA 2DMKA 1P4BL 3G9VA 5DWUL 3RL2A 1J5OH 4OLWH 3ZYJA 3CJJA 3ECBB 1N5AB 3H2WA 1NEUA 1MHHB 1MNUH 4K9EH 3QA3A 3R0MA 1MFBL 1QA9A 4WCYH 5DUPH 4KDWA 3U48A 1N59A 3VFUA 3P4MB 4ISVA 3MJ7A 2A9ML 3TIDB 1C7TA 3CFCH 3MYJA 1DBML 4X4ME 4ZXBD 3X3FH 4X9FA 3LB6C 3AY4A 5C6WH 1RUML 3HS0A 4G6JL 4ZMAT 5E08L 43CAB 4MX7B 4FQPA 1DL7L 1QEWA 2BSTB 2IC2A 4MCYB 3DV6A 3MLZL 4KPHL 1MLBB 4OM0H 2EH8L 1Y18A 5BRZD 3GZKA 5DFVD 4EN3C 4F2MB 2IAND 3VXMD 2ZSWB 1INQA 1GGYA 2XZCL 3BPLB 4LQ1A 4OFIA 3RY6A 4GBXD 2UUDH 3LAFA 4GT7A 2V5MA 1B4JH 4KKLC 4KJQD 4BQ6A 5BXFB 3MV7D 2VITB 4QXUH 5H94A 1A1NB 5E2UL 1IM3B 5I8KH 1S7SB 2NW3B 3GBNH 4NSKB 3C87A 4NQUA 2QQKL 4Y5YC 1T03L 1P7QB 2K7PA 3NCEB 2W9DH 4QRRB 1JPST 1FORH 1I1AC 2GCYA 1M1SA 4GW5A 2R0LL 3NFNA 4KKBD 1A7NL 2NTFB 4RBPH 4NO5A 1V3LA 3TCLA 4PRIA 4U3CA 5BV7L 2CD0A 3GSNH 1A1OA 5GS1B 2FO4B 3H9SA 5LAXB 1SY6L 5FUCE 4OQTA 2ZOLA 1QG3A 1ACYH 2F19L 1QR1A 3SKMB 3UBXG 2IAMA 3HPLA 4MMXC 1RJYA 1J0IA 1G7JB 4EUPB 4GLRH 4LVHC 1F8TH 3VXUD 4WWKA 5DZNA 3EDKA 5E94B 4NRXA 3QEQA 4JFEA 1AKJA 4MQSB 1MFAL 3KXFE 4RMRA 1P4BH 5DWUH 3DRTA 1T21A 4N8PA 3OKDB 3VDAA 3TBSA 2AJUL 2ZCKL 5A3ID 4M6OL 3MOAL 1A8JH 3L6FA 3OGCA 2C1OA 5I1JL 1MFBH 4I13B 5F7YC 4PJDA 2A9MH 3ARBD 1DBMH 4MA3A 4OGXH 4PD4J 2EO1A 4LCYA 1RUMH 4NPYB 4XP9L 4IOSD 3BAEL 4G6JH 3H3PL 1UQSA 4OCWL 4P5TA 5E08H 1A6WH 2OL3A 4M1CC 1DL7H 3MLZH 4KPHH 4MJID 1T7WA 2EH8H 4PGDA 4UTBL 2XZCH 4OUUA 2PW1A 2P5WA 4PTUA 5J06A 4M8QB 3BGFB 4UU9B 2Q6WB 3ZL4L 5HSFA 5HHXL 3Q6FA 3THMH 3UTTD 1CICD 3PWVA 1QSED 4GRLD 2X5PA 2EXWC 5DD6A 1UM6L 3K4ZA 5ICZB 3HI1A 1Z6JT 2FH8A 4UAOB 1HYSD 1H8OA 2QQKH 1T03H 1EVTC 4U1GC 3A67L 5DHVA 1CFQA 4QO1A 1T4KB 2VSDA 3QULA 5LGHH 2DRUA 4Z7WF 5E4IA 2Q8AL 2R0LH 4OF5A 1A7NH 2EDBA 1T1ZB 2BVQB 2YD2A 2OI9C 5KVMC 2HRLA 3QEHB 4P46B 1I8LC 3VXOB 3AROA 5ITBL 2UWEF 5BV7H 5JOPD 4X6CF 4LQFL 1SY6H 3QQNA 1NC2A 3B5HA 4GAFB 4DWHA 3PGDA 4HPYL 1CE6A 1ZE3C 4CN4A 2F19H 5E2VL 1N0XL 1FAKT 1NCNA 1PDKA 2E9IA 3K80A 5CBAA 3FB5B 3W9DB 5DMKB 1F4AA 3IF1A 1UG9A 3UAJC 4K07A 1S7VB 5E8DH 4EVNB 1I3UA 3OB0K 3OR6A 1MFAH 3SQOL 3UX9B 2OTUB 3LQZB 4KGLA 1B0GB 3SKNB 5B38G 3F5WA 2AJUH 2ZCKH 4TYUA 4M6OH 3MOAH 5I1JH 1DZBA 4EBQL 1IAIM 3OKNA 3ILPA 4XCNB 4N1HB 3PG2A 3O0RL 2NY1B 3PL6C 4XP9H 1G9NL 3E2HC 3H3PH 4OCWH 3ULVE 2EKSB 3U0WH 4GS7B 3PIQB 2KUTA 1AP2B 1RIHL 2Z4QB 1EUTA 4UTBH 2YD8A 2W1NA 2DQDL 3L5WA 4NM4L 1U8PB 2FJFB 4U3XA 5IJVB 2NW2B 2BOBB 4Z7VE 3B2VL 4JCMA 4NP4L 3ZL4H 3X3GL 5HHXH 1FG9C 2NXZC 5CAYB 1FCGA 3MNVB 2JKXA 1MPAL 2WBJC 4HH9A 1BVKA 4NKDA 2P5EA 1XF1A 3A67H 3TN0C 5FFLA 4ZSOE 1NMCC 3KYMB 3U7YL 1PZ5B 2PO6B 2Q8AH 5EFIB 3M07A 1LP9E 2E8YA 5MENA 3MA9L 2BMKB 5C71A 5I6XC 5C08D 3ZHLA 5DJ0B 4DGIL 3PWNA 4HPYH 1OSPL 4X8XA 4HS3A 3V4VL 5D96C 4NKQB 5FKPB 5K9KB 1IFHL 5JW4R 4HKJB 2NY7L 3D85B 2EE3A 2I27N 3FFCA 4LVNC 2LV4A 5EU7C 3H42H 5CJOL 4O4YL 2OZ4A 2ARJA 4ONOA 2YZ8A 5H2BA 3SQOH 4TUOA 5IF0A 1YMMD 5L2KA 4A6YA 5CSZA 1FYTD 4JPKL 4XWOC 2DQHL 2WSKA 1MF2L 4U1JA 1MCBA 4XP4H 4G3YL 5HHNB 1BZ7A 4TVPE 1CD0A 1CXKA 1UB6A 5KSAB 5FOJA 5FHAH 2F5BH 1MAML 4ZO7A 2W60B 1D3CA 3SDXF 1XGRA 3T4YB 4AH2A 1G9NH 3ORJA 4P2CG 4UILL 1UFUA 4LLVB 1HWGB 2VOTA 2VL4A 1RIHH 1RUAL 3DLQR 4Y19D 2AXFA 3O6LL 5I8OH 5IBLC 3QI9B 5LG1A 1GZQA 3PGCB 3SE4A 3MV11 3QUZB 3C6LD 4X5WB 4FQCL 4OSUL 2YN3A 5CJQL 3B2VH 4YK4C 4NP4H 1VFMA 3X3GH 3TO4C 4MVBC 4GKSA 5DSCA 8FABA 4GRWE 4LGRB 1CD8A 4P23B 5HVHB 3C5SB 1MPAH 1GOHA 1I3RB 3WSQL 5GGTA 4IEFB 1BQHA 3SBWA 1FG2A 1BQSA 2XWJA 3F7YA 2XWTB 2Y1VA 2YZ1A 3P11L 5KJRL 1NBZB 5GGUA 1E4KC 4QRSB 2G2RB 3MA9H 4HULB 4JPIB 4H25A 3MRKA 4L9DA 1UADC 4Y16D 3RVTC 4RZCB 1KCSL 5DHVH 4DGIH 4Z7OF 3DUSB 2X4PB 4KK5C 2DWEB 3V4UL 1OSPH 1QUNA 1V05A 5MHSE 3V5KA 2HKFL 3V4VH 4GRMB 2ZUWA 3L3HA 1IFHH 4QHKI 2NY7H 5C0GA 3BMVA 4LLQA 4CMMA 1EEYB 3FQXB 5IWLA 5I19L 5KZCB 4WU5A 3ZE2F 5CJOH 3QXDA 5J9PA 3JUZA 3MRRA 3NCJL 4FTVD 3GEWB 5IVOA 3P4MA 1Q9LB 3TIDA 3EUUA 1Q38A 4JPKH 3AFLA 2DQHH 1MF2H 5D7JA 3M8OL 5C0AE 5D1XB 4G3YH 5DMIH 4NO2B 5FYKD 4MX7A 4JRXD 3IU4L 3FRPG 2BSTA 4MCYA 1PSKL 1E0OB 2OZ4L 1MAMH 3UP1A 3KPSD 4WHYH 1MQ8A 4A6YL 2ZSWA 4OKVB 4QHLB 4UILH 1B9ZA 2GJ6D 3DYOA 5D1ZC 3SEPA 1ULVA 2WWKT 4FG6C 5T5NF 5BXFA 2VITA 5BOPA 2PTVA 3O6LH 4LHQB 2VLJA 1BD2A 3K46A 4YC2B 1FBIL 1A1NA 3SDCD 1P84K 4WFFD 5FGRA 4NSKA 3EOBB 4FQCH 4OSUH 5CJQH 5E8OA 4NFDA 1P7QA 3HA0A 4IRJC 4QRQB 4ZTPL 4QRRA 3S7GA 3EFDL 2BNQA 3GSRA 3O3DB 1DANT 1WITA 1FZMB 3C8DA 4FFZL 3STZA 3WSQH 3DX7B 4QNPE 3G5ZB 5GS1A 2FO4A 2I07A 1FFPB 3VFMB 1SM3L 1YPZB 5EIVA 4EI6A 3P11H 5KJRH 4N0FB 1T1WA 3QIBC 3O3AB 2R15A 4X9GA 5GGTL 2FGWL 2MCPL 4EUPA 2VLME 1KCSH 1WFNA 4KDTC 1YEIL 3V4UH 1FH5L 1CZ8L 1E4WL 2HKFH 3C6SB 4H5SA 1BFOB 4TUJA 4J8RB 1WLHA 4JZOA 3GGWB 2WUCL 3OKDA 3B9KC 4Q9RL 1L9NA 5GZOD 1L0YA 4L1HA 4JQVA 4HFWB 3NCJH 5F7FA 3RUGF 4PJGA 3T3ME 1VCAA 2FWOB 3M8OH 1HINL 4P99A 4NPYA 2Y25A 1NEZA 4XVUD 1YEGL 5E8EB 2VXUL 3IU4H 4OZGE 1RZGA 1PSKH 4XNQA 2OZ4H 5L88L 1J86A 3EOAB 4IDJL 4A6YH 2I5YL 3ZE1E 4LOUD 5FM4A 4JFZL 3TVMB 4UU9A 2Q6WA 5HGBA 4KJYA 4K8RL 1LO5B 4S0TD 3WFEL 1FBIH 4XCCL 1CU4H 2NX5E 4PRBA 4K55A 4Z5RB 4NOFA 5BW7C 3T0WA 4PJ9B 1B6DA 2OSLA 4I18B 1ZEAL 5EU7E 3BO8B 3SO3C 4RNRB 3BMWA 5HDBE 5ADPL 1U41A 3EFDH 4UV7H 3TJEL 5DURD 1AO7B 3DO7B 1T1ZA 3MRJB 2EDEA 3QEHA 2VQ1B 2J5LC 3U2SA 4EIGB 4ONGL 2YA0A 3TV3L 3IDJB 5H35A 4Y1AE 4PTTB 1SM3H 5DVLA 3EOYG 4DJMA 2CR6A 5EZIL 5DF0A 4CJ1A 3W9DA 3S36X 5GGTH 2MMXA 2FGWH 2MCPH 5DMKA 4CRPA 3I6KB 1K8IB 1YEIH 5L6YL 1J0YA 4X8JA 2B5IC 1FH5H 5C0DB 4G9FD 3BD5A 5ACZB 2LVCA 3PHSA 4J3OC 4JFPB 2WUCH 3LQZA 4TTDD 1E27B 5FYKU 3SKNA 4Q9RH 3T0EC 4OCMC 1HHHA 2QSQA 4I9WD 2IPKA 2Q20A 2OX5A 5JUEL 1HINH 5FIEA 4KY1L 5AAMA 1YEGH 4ZS6D 3GSXB 1FP5A 4Y4HD 1S9VA 2VL5A 2ZUVA 1LO2H 3PIQA 2Z91A 1NBQA 1MHCB 2OMBA 3T8XB 1NC4A 2HFTA 2Z4QA 5L88H 5ANME 5E4EC 2N56A 4ZOAA 4IDJH 5HYQA 2I5YH 4U1KB 1U42A 2ADFL 2AVGA 4MXQD 4OZIB 2NW2A 5DC0A 1NLBH 2BOBA 3O3BA 2A83A 3BQUC 3P4OB 4H0HB 5JHDE 4LKXB 3WFEH 1IGTB 4EZMA 4XCCH 1OP5K 5F7UA 1CDUA 2YC1A 3V6BR 3X12B 1TPXC 3U0PB 3MNVA 2OYPA 1IM9D 2FIKB 4FHBD 4HXAH 1LK3H 1ZEAH 4UQ2B 1LD9A 3LV3B 5ADPH 4HF5H 1PZ5A 4KTDL 2PO6A 3TJEH 3BD4A 5EFIA 5ESAB 2NR6C 5HHVL 2OR9L 1E6OL 5EULV 1NFDB 1IAMA 2BMKA 3VFOB 4ONGH 4BZ2L 3TV3H 3G5XB 4XI5D 4MB5A 2F58L 2V2TB 4ONHB 1HHGB 4H8WC 2E7MA 1MJJB 5FA4A 4R7NB 4PJEE 3UMTA 1FZJB 4L1DA 4ODTL 5EZIH 1S9KC 3DURA 5K9KA 4HKJA 5KVEL 2V2XB 4X5XB 5A2LH 3HKFA 4ZUTA 4X6DB 3HLAB 3OJDA 5L6YH 1Q0XL 3EJYC 1R3KB 3W5NA 2HH0L 5GSVB 3E6HA 4UMGA 5E8NB 3ARFB 3FT3B 3P9MB 4J4PA 4NN7B 3WIHL 3GSWB 4GAGL 1JE6A 3IDXL 4OIIL 4XGZA 1F3DH 3NIDF 3CH1B 5HHNA 4PG2C 5DR5L 4M6ML 3V6FB 5IVXB 4LLYB 4E9LA 4MSWA 5KSAA 5F88A 3CVIL 5SWQB 2R1XB 5JUEH 1MUJB 4XVSL 3ISWA 3T4YA 3FAXA 4U0QB 5A16B 2EC9T 2OM5A 5D6DA 3G08B 4BSWA 3ARUA 2NZIA 1PGRB 1U8JB 5HGHB 1GZPB 2FHFA 1U3HB 2YD5A 3PGCA 4HG4J 2ADFH 2X9YA 5JMRA 3QUZA 2W9EL 5D7LD 3IGAA 4HIJA 3OL2A 4R0LC 3VCLB 3MRMB 1F4XL 1WVZA 4WW2B 4MLIA 1AI1L 2GITA 3ARDD 4QRPD 5C0EB 3VXNB 2WP3T 4ZFFA 1KNOA 3EDEA 3HZYB 4IMKA 4P23A 2DM2A 4JANA 5IEHA 3BPOC 4WV1C 1JYNA 2Y6SC 1N0LA 2DS4A 1BLNB 4G9DB 4QRTA 1CGSL 4CUCA 1EJOL 4KTDH 3DIFB 5HGGS 3MJ9A 1JYVA 2XKSA 1DN2A 2DM4A 2J3SA 2XWTA 1I75A 2OR9H 4HC1L 2XN9E 1E6OH 4P2QE 4QRSA 2G2RA 1HXYB 1JV5B 4JPIA 4JFHD 3AY4C 4BZ2H 4MD4B 2F58H 1R0AH 2XRAH 5F44A 3EO1B 2PXYD 2DWEA 1RK1A 4ETQB 3Q5OA 4AG4L 1IC4L 3WIIL 2A6DB 4ODTH 4K7PY 4OGZA 1XZ0A 4NIKB 3RY6C 3IAQA 2QQQA 4GKZB 5D6CA 1Q0XH 1WC7A 1QKZH 3FQXA 4KK6D 2HH0H 3D0VA 1WCBB 2AEPH 2HLFC 4CU7A 2VNCA 1QLRB 1LEGA 3IDXH 4OIIH 1I1RA 3KJ4C 3KWWA 5GGQL 1ZLWH 5DR5H 4ZUWB 3S35X 4L8DB 3UZVB 3OKEB 4YAQB 4NO2A 3BWAA 2DQCH 2R2HA 1OY3B 2E5EA 1AKJD 3CVIH 4JFED 2Q7YB 4YBQC 4CJ0A 2YXFA 3EO0B 4K3JL 5IR1B 1ZVSA 5AD0B 3CX5J 3LKPB 1DVFC 2YPLA 4I5BB 5EU3A 4XVSH 4WHCA 4OKVA 4QHLA 5SWSA 3MRFB 1MFDL 3H9YA 5C09B 5EC2B 5IESH 5F7WC 2HVKA 2BHUA 3EIFA 1U8LB 1JCKA 5E24E 3RZWA 3C5ZB 2F8XC 4P5TD 3S97C 2W9EH 5BZWB 3BIKA 4PJXF 4Y4FC 1FVDB 1F4XH 4CADB 1OHQA 4QWWD 5IB2B 1AI1H 4L4VE 4WWKC 1WUNT 1YUHA 1FYHB 1G7QB 1AGDB 3NCFB 3T0EE 1V3MA 1HQ4A 4JFFE 1NMAH 2JCCE 4PIRF 3DX7A 3DBXA 1KB9K 2AK4E 4NHCL 3QIUD 1HDMB 1FFPA 1T66D 4P9ML 1EXUB 1JMXA 3EYFB 4AQ1B 1CE1L 3OXSB 5DUBB 4XZUB 5EDXA 4BFIB 5ALBH 1GGCL 5SV4A 3L3JB 2XICA 3AB0C 2R4RL 5KG9A 3UZQA 4AG4H 1IC4H 3MJ9L 3IKKA 1OW0C 1DANU 1ORQA 3GGWA 1F02I 4WU7B 3SDAB 4I0PD 3TT1L 3V6OC 2FB4L 3GMPA 2JIXD 1HILB 4LVOB 4XMLL 1D7FA 4PYGA 2BNRE 3JWDH 3B8YA 5D7KE 3GMLB 5DMGC 2E7LA 5GGQH 3SJVB 4WTXA 5E8EA 2CDEB 4IOIB 2ITCA 1RI8A 4NNPL 4K3JH 3VXSE 3W0WE 3QO1B 4JB9L 1T2JA 5M7QA 2IJ0C 4PRHB 1Y0LB 5K93A 5DO2D 1MFDH 5J12C 1IILE 3B5GA 3VU2A 1QQDB 1Q1JL 5KOMC 5JMOC 3CLEL 5GRZA 1LO5A 4JKPL 3B3IB 4WO4C 5HVFB 2VISA 5IW1B 4PJ9A 4Z7UF 5I1AA 3BO8A 3B9VA 2VIRB 3ZDZE 4NYLB 3RQ3A 3C8HA 1QRNE 1TZGL 3B2UC 3FTGA 3X11A 3DO7A 1OWWA 1AO7A 1D9KB 2BY2A 1DFBL 2RJMA 5E2JA 3RDTC 5DVKA 1NGQL 1ZMYA 1ZXQA 3MRJA 3RWJB 2VQ1A 5I16A 1MCJA 4HWZB 1W8OA 3IDJA 1JHTB 4P9MH 4TNVK 4XPAH 4BSVA 2CJUH 4R96B 2GY5A 3GMOB 1RHHB 1CE1H 1MCWW 5D70L 4L3EE 3DSFL 1GGCH 4E42A 1K8IA 4LGSB 4PGBB 5F72S 5IB5B 2R4RH 4O2FA 4Z0XB 3HAEB 5EB9A 1F3JA 4MD5B 5C0DA 3MJ9H 5KSVA 3QWQB 5DRNB 3RVXD 1LHZA 1UYWL 1YEDB 4JFPA 3WIFA 3NBNA 4KRNA 3TT1H 1CT8B 4GG6E 2FB4H 3MNWA 1SYSB 3MXVL 4RFOL 4XMLH 3QPXL 2YD7A 1QYGL 2A6KA 3VFVB 4J12A 4PJ5D 4UOJA 3T4AB 3BUYB 1TDQA 5DZLA 2IPUG 5KS9A 5KSBF 5IMOA 3GSXA 2NY6B 3LRHA 2FZ3B 1ZLSL 5IEKA 4NNPH 4GFTB 2CUMA 4PJ7B 4N68A 3PQYE 3VG9B 5DA4A 5DJ8B 3WS3A 1YNKL 1YMHB 1J8HB 1YJDL 1RD6A 1WBZA 3S8WA 3NCBB 4YHNB 1PKQA 1WBXB 3CLEH 3MR9B 4BH8B 2BVTA 3BZFB 4LCWB 4JKPH 2DJUA 2PUQT 4KUCF 5C7XH 2FIKA 3BP7A 2DYPB 1SHMA 4HWBA 3DMMB 1KELH 5FEBA 3HR5B 1TETL 1JGDA 3T0DA 2YEZB 2G5BB 3LV3A 1K9TA 1AD0B 2DICA 1TZGH 4X4XA 3VFPB 1SYVA 3OHXB 3VFTB 4G7YL 1DFBH 5ESAA 1V8HA 1NGQH 2ERJB 3EDFA 4CNIB 5IOPA 4R26L 3U30C 5FK9A 3L3GA 3IXTA 4QRUA 1U3YA 1KXVC 3UZEA 5EZOL 2GJZA 4CVWA 1KLFA 3ULVD 2V2TA 2AJ3A 2CUIA 4ONHA 5F1IA 1TJGL 1MJJA 4Y2DC 4R7NA 3WJLC 4JLRB 3WFDL 2Q76B 3QEUB 1S5IL 1UWEL 2DQTL 4X6CB 3RTQB 3QUMA 3DSFH 3QUYA 4JFOB 4X5XA 1EFQA 3LPWA 3KLHD 3H9SE 3C08H 4BQCA 5L0QB 2V7NB 1R3KA 5GSVA 3N9GH 4JPWL 1JHLH 1UYWH 2Z8RA 3HE6B 5E8NA 5I8CB 3O9WA 1X5KA 3SGJA 3K3QA 3GSWA 5TE7L 3ZHDA 1UXSB 1VERA 3SE4C 3SKOB 1CLCA 3MXVH 1F6LL 4RFOH 2HFFA 3QPXH 4LLYA 1QYGH 3Q6GL 4XCYA 1JUFA 5JA8B 1RU9L 5I1EL 1GXEA 1CLZL 4QXGL 1IEBA 2ZUXA 4CVXB 3LB6D 1OSZB 5A16A 3F7VA 3T3PE 2DLGA 1JYXA 4OBSA 3QXWA 3U83A 5F7DA 4YHLL 3SBWC 1HHIB 1TVHB 4MAYB 1U8JA 3IDNB 1GZPA 1PY4A 5C86A 2VDRH 5HHOB 2A2QT 2YRZA 1TJIL 1YJDH 1LEIB 3WHXB 4KKLD 4CMHB 4K8RD 4D3CL 3MRMA 4L9LA 5E1AA 5ETUA 3VD9A 5EWIH 1EAJA 1FNLA 2V5YA 3V6OE 5JORB 3MLVL 2IBZY 5JQHC 1TETH 3HB3D 4G9DA 5D7IA 1BLNA 1A2YB 3IDGB 4PJ8B 5E03A 2VLJD 1BD2D 3OKMB 5DJZB 5HXMA 1R3HA 5A2KH 4G7YH 5C8JB 1IEAA 5DJAB 3U46B 3DHJA 4WFHE 2EDRA 5HYIA 4R26H 1JV5A 4PJCF 3S9DB 4HWBL 1Z0NA 4MD4A 4ZFZB 1MJ8L 4CU8A 2W07A 1X6NA 1PEZA 3AU1A 4ZO8A 1TJGH 5K59E 2BNQD 3EO1A 3VH8B 1W0VB 5E5MB 3I50L 1G6VK 3CZFB 5C07E 3WFDH 2A6DA 1S5IH 1UWEH 2DQTH 5K9JL 4M7JL 1BJ1J 4X7TB 4UBDC 3BPLC 5KAQG 4GKZA 4DN3L 4OD1L 2DL2A 4JPWH 4O51A 4KV5F 1A1MB 1QLRA 5TE7H 4BFGA 2B39A 3QUML 1X4ZA 3GO1L 3QFJD 3V95A 4FP8H 4ZUWA 3OKEA 4QHNB 4LL9A 3K81A 5SWZB 2Q7YA 3NZ8A 4LAJH 1T20B 3Q6GH 1EFXB 2HMIC 1XFPA 3EO0A 3PWUA 5IVNA 1RU9H 5I1EH 1IRAY 1CLZH 5AD0A 1CFNA 4I5BA 4QXGH 2YSSA 2VDQL 4POZC 3MRFA 1AFVL 4HIEB 3MBEB 4FMKA 4XTRD 1JYWA 4YHLH 5EC2A 5IB3B 5GS1C 5I1GL 3O6FD 1U8LA 1KLUA 2R2BB 3W2DL 1NCUA 3BZ4B 3GJEB 1BFTA 4UI2A 1TJIH 4KUZL 3C5ZA 1BPVA 1BFVH 3IJYB 4S10A 1FVDA 4D3CH 4DZBA 3RZCD 2Q87A 4IIQA 1U8KB 3BISA 1WGOA 3VMOA 3LN4B 4MZ2A 3BPCB 3IU3B 1S9YB 4W68A 3MLVH 4YXKL 1N6UA 1I3GL 5C0AD 3ZDYF 4JQVC 1HDMA 3MYZA 2VDOL 3DGCR 3QZWB 4LBEB 1EXUA 3QUXA 3EYFA 4JFDB 1MCOL 1ZV5A 2PCPB 3OXSA 5DUBA 5SV3A 4XZUA 2UZXB 3SGEI 3UTPE 2H2SD 1ZHKA 4HWBH 4BFIA 4DAGL 4U05A 5LXGL 2WWKO 3BZDA 4M9OA 5C0IB 1AXIB 3N1GC 1I8IB 4G6FB 4NQEB 3I50H 2L4OA 2IALA 4PB9L 1XEDA 3BE1L 2YMXL 5MENE 3MRDB 3FQNB 3UDWC 2OJZH 5IG7B 4WU7A 4MHHG 4MXWL 4KZEL 4L8CB 5EG6C 2HVJB 1KCRL 4DN3H 4QYOB 1JZ5A 2H26B 3BGFC 1JK8B 1HILA 5AG9A 4ZFOL 5I0ZA 2Y9RT 1OGAB 3GMLA 3QUMH 5D5ME 3GO1H 3M45A 1ZWIB 3HZKB 4UAOC 3RL1A 1QO3B 4B41A 1T89A 4J3TA 2VSCA 1UJTA 5TPWL 3QO1A 1T83C 2VDQH 3MJ8A 1QLEL 1Y0LA 3C60B 4DGYH 1AFVH 4P46C 5TDPB 5I76B 4KDVA 4JM2B 4MWFB 4GQPH 5I1GH 2ED7A 4PJIF 5LWYL 1IBGH 3ILQD 1SQ2N 4UT9L 4OLXL 1UZ6F 3QDGE 4QTHA 3NA9L 3W2DH 4Z7WE 2AS5M 4JREB 3B3IA 4KUZH 3JWOC 4YH6A 4OZFB 4RRPG 3S37L 1D5BB 2EICA 1NC4D 3QXAB 4NYLA 1A4JB 4UQ3A 3NTCH 4WEBL 5DEFB 5DK3A 1F2XK 3T09A 3E6FB 3U9UB 3CMGA 5EU6B 5HI5C 4PJAF 4XNMA 4YXKH 1I3GH 4HWZA 4N0UE 3TN0D 2BZDA 4AMKL 1WK0A 2D4FA 2WIMA 3RY5A 2VDOH 5KVGL 4MNQE 3O8XB 2F53B 1ZVHA 1MCOH 5I1KL 1A7PL 1Q9OB 4NQDE 4QF1B 4OF3A 2NY1C 4PY8I 4DAGH 4N9GB 4WFEE 5LXGH 1ND0B 4CBPA 3I02B 1ZT4A 5IB5A 3SGEH 5JTWA 4GS7C 3HAEA 5I8EB 3MUY1 4PB9H 2ESVB 4DOHB 5D4QA 4DVRL 3BE1H 2YMXH 5DRNA 3LDBC 4DKAA 3ELAT 3RNKA 2R1WB 5BQ7B 4MXWH 2B7DT 4XB8A 1CT8A 1I1CA 3C5JA 1NCBH 4UT7L 3ZKSD 3UTSE 4KK8C 3T2PA 4PLJC 4J7RA 4LMQE 4C55A 1X5AA 4L5FL 4F37K 3VFVA 4IRSC 4YDLB 3T4AA 1S8DA 3NCMA 5A43C 5C0JA 4MD0B 1CGUA 4FXGA 5TPWH 4Y5VC 4G42B 2PO6C 4Y1AD 4ZAKD 3LPGA 1QLEH 5DJ8A 5F70A 1YMHA 4O2EA 3KGRA 5CD5C 4OAWA 3W39A 4EDWL 2NY5L 4MB4A 1I8KB 4H0IA 4M48H 1XF2B 1T7XA 4PBVC 4YHNA 5M95B 4UT9H 3UPRB 4OLXH 3MBXL 2CKNA 4BH8A 5IBLD 3JWDC 1OAXL 2NY4B 2OTPA 1T7ZA 1A7BA 2AQ2A 1J8KA 2G5BA 2LAAA 1L9MA 2DF3A 4AENB 2YA2A 5CHNB 4MVBD 2Q3AA 1AD0A 2HTKC 3VFPA 4Q9BA 3OHXA 4KK9C 3L5HA 3BGMA 4J4PC 1GC1L 2OP4L 3MC0A 3CXHJ 2JJTC 4XNZC 1FIEA 4QRRE 1IAOA 4AMKH 4HEME 2FX7L 5KVGH 3FQTB 5KSAC 1YNTB 4OI9A 4EXPX 4AY0A 1A7PH 3LN9A 5I1KH 5T1KB 2UWEA 5EBLA 4X6CA 4F9LA 3UEZA 1JPGA 1HNFA 2FD6L 1CGWA 2YD4A 4JFOA 3RVTD 5D6DC 4JG0L 4QOKE 3RAJL 3DX8A 1KSRA 5IHLB 1HZHH 2V7NA 1QVOB 5EZJB 4DVRH 3RGVA 2EH7L 1PYWB 4HD9A 1J18A 5I8CA 2EEAA 3OAZK 5LCVL 1DEDA 2ADJA 4KQ4L 3QI9C 1FO0B 5JQ6L 2CO7B 4UT7H 3QUZC 3SE3A 5TJWK 4OD3L 5CEZE 4V1DE 4NQCA 4NWTL 4P23C 4PGCA 4R2GB 5HVHC 1U8HB 1KPRA 1OSZA 2GT9B 2IH1B 1X4YA 5DTFA 4X9HA 3G04B 2QEJA 3GJFB 3TM6A 3WUWG 2P47B 1I85C 5BMFL 3IDNA 1MHPL 1G9MC 2VLRB 3F6LA 3LEXB 1QFWI 5HHOA 5KVFL 4RGNB 2NXYB 4EDWH 2NY5H 1D6EB 3WHXA 3NIFF 1QFWL 1AGEB 3RWCB 1HYRC 2YPLD 3PABB 4K94H 3WO3B 5F3BA 5SWSD 4KQ3L 3I6GA 4U1NB 4XNUL 4IRJD 4APQA 5JXED 1A2YA 3IDGA 4U1MB 3ARSA 4MQ7B 3SOBL 3OKMA 4N5EC 2XTJB 5C8JA 4UUJB 4Z7NE 3A6CL 3U46A 1GC1H 1I9RL 2LTQB 5C0CA 2EO9A 5D1XC 3U79A 5TDOA 4RMQA 2BSSA 2FX7H 3VA2C 3VH8A 3CZFA 1CLOL 5EOQL 4L8BA 5ADOL 4BH7A 3TBTB 4X7TA 2FD6H 3F65A 4AEIL 1T0PB 4JG0H 3RAJH 1NUGA 2WP3O 3MZGB 1HWHB 1FAIL 1XR9B 2EH7H 3F62A 3BD3A 4OQ1A 5LCVH 1A1MA 4YC2C 4KQ4H 3WXWL 2VKWA 1M7IA 4UOW0 3B9KD 5JQ6H 4UOW1 3RNQB 1SMOA 1A5FL 4C4KT 1F3RB 1EFXA 3LHPL 4OD3H 2ADIB 1ZT7B 3IB4A 4J3UA 5CKGA 4NWTH 2X10A 3K2MC 3OF6A 5F3HA 1CI5A 3BJLA 4UB0L 1LK2A 1NGXB 2XN9D 3EYOB 5F6HI 4P2QD 4HIEA 1QLFB 3FRUA 4OI8A 2Z31D 5IB3A 3SDXA 2VQUA 3BGAA 4P4RA 1MHPH 1PEWA 2WW8A 1FZOB 2R2BA 5KVFH 1DQML 2DQFB 4JZNB 3N1QC 1P2CB 3QDMB 3VRLF 1KC5L 4MXVE 4BQBA 4LMQI 3ARZA 1U8KA 1ZHNB 4Z7QF 5DD1L 2X40A 4KQ3H 3ZKMC 3LN4A 1YYML 5EU4B 4XNUH 3A6OA 1QPPA 3IETB 2RFXB 4G6ML 4LDLB 3SOBH 1WT5C 4ELMF 2VDLL 3SGKA 3QZWA 2P7TB 3A6CH 4JFDA 2PCPA 1I9RH 1N26A 3Q5YA 3AAZB 3WNMA 4JRYD 3OX8A 1GYAA 2D7QA 1RFDL 3KYOB 2BERA 2D9QB 1T04B 3B9EA 4IM8A 1CLOH 1WAAF 2DIJA 5EOQH 1AJ7L 1YEJL 5ADOH 1XGTB 3UO1L 4DZ8B 5IG7A 4X9IA 2VH5L 3SCMA 1C7SA 1BIIA 4AEIH 1HSAB 2ADGA 3S3SA 1U91B 4L8CA 2HVJA 3TVMC 5C0FB 4KZDL 1FAIH 3QISA 1K8DB 5DEZA 1R24B 1OAKL 1JWMB 3AS2A 4PLOB 4L4VD 4X6EA 1P1ZA 1NAKL 3GHEL 3WXWH 1ODAA 5JA9A 4WNQB 3T0ED 4JFFD 4PJ9C 1R3JB 4I18C 1A5FH 3RX8A 1UKTA 3LHPH 2AK4D 1EMTL 5IBUB 4XBPA 4UB0H 3WDJA 3T0BA 3VWJD 4X7SL 1N3NA 1T3FB 5J6HB 5TDPA 4GJTB 4JM2A 4F7TB 1V7ML 5IK3B 3WO4B 3NOIA 2Q3ZA 3SDDA 4D0DB 1AQKH 4U6XB 1DQMH 3BN9C 4LNRB 4HIIB 3JVGA 1OGTB 1TXKA 1KC5H 4BJLA 3QXAA 1HXMB 1A4JA 1GHFL 4LP5A 5DD1H 2YA1A 1QOKA 1NGPH 2BNRD 1UCBL 3W82A 1S7UB 4WW1A 3S5LB 1YYMH 5D7KD 1H5BA 4G6MH 1XF4A 3MRBA 2OMNA 4U2ZA 4WI5A 1UC6A 1RUKL 1FFQA 1DE4B 2AERT 3ARED 3VXSD 2HG5B 4HS6A 5JW4M 4QF1A 3MV9E 3MODL 1RFDH 4WY7H 1ZT1B 3W81A 1ND0A 4FQHB 2VZ1A 4MNGB 5GRUH 1VPOL 4ODXB 5I8EA 5B39A 2ESVA 1YEJH 3DGGB 4PRDB 4NCDA 3UO1H 1QSVA 2VH5H 1YN7A 1L4IA 3IT8D 4ZXBB 1RIUL 3L3OA 4KZDH 1A7OH 3OV6A 1A7QL 1OAKH 1CVSC 4XRCB 1ONQB 1JF1A 4LKCA 5EUOB 4NHUB 1NAKH 3GHEH 1QRND 1O7SA 3W5MA 3MLXL 2NY2D 4P2RB 3QUYD 4XXCC 4MD0A 3M1BB 2Y5TB 5BRZB 1VACA 3RUGA 2AI0L 4GBXB 2VZUA 5AWNL 5T3XL 1HH6B 4K3DH 4G8EA 1EMTH 3QJFA 1K4CB 3MV7B 4NQVA 3RI5K 2DMCA 1J11A 4X7SH 5C0NC 3BYTA 1EHXA 5E6ZA 4PREB 1I8KA 1V7MH 5AUMB 5FV2A 5EC1A 1TMCB 3CC5B 3QCVL 4PS4L 1DQTA 3GKWH 2O5XL 4LARH 4YEFA 3T77B 1NH6A 3BKYL 5ICXA 3HE7A 5F7LB 1EPFA 3JWOL 2CR3A 2OJEB 4WI8A 1DQJB 2EYSB 5EU5B 4M7KL 3K74B 4MCZB 4AENA 4P3CL 1GHFH 2ZNWA 5EBGA 1H0DB 4PLNC 4Z7UB 2WQRA 3ARFC 2AXGA 3SGJC 4NN7C 3EYVB 4OCNC 1XIWA 3QNZB 1ZHLB 5FDWB 1NAMB 1II4E 3VXUB 4OV5B 5T1KA 2IF7A 5SX5K 3VXRA 1IKFL 4IHOA 3STLB 4FXLA 3MODH 1MCEA 3DETC 4XX1E 3NMEA 2Q86B 1VPOH 1YPZE 4YR6A 1KG0B 2E6PA 4HH8A 3GUTB 3PNWA 4LSDA 1U3HC 1EEZB 3ARBB 2IQAA 3U9PH 4PJBB 5D1QC 3D2UD 1NCTA 1E28B 3JV5A 3UTZB 2HLFD 1K4DB 4WW2C 4ZTOL 4KAQL 1R5VB 2AXJA 3MLXH 3QXVA 2E8ZA 3U82B 3PJSB 2AI0H 5AWNH 5GS0C 4LU5L 2Z0BA 3G04A 5T3XH 4YBQD 4OTXL 3VRIA 2CKBL 4F57H 1DVFD 1A6ZB 2IQ9L 1DBKL 4FXKB 1CICB 2HTLC 3LH2L 4U0RB 4GRLB 1D6EA 1G7PB 2UVEA 4TULL 2H41A 1FZKA 1AGEA 2GJJA 3QCVH 3RWCA 4PS4H 2F8OA 4JQIL 2XZZA 2O5XH 4HJJL 4YZFE 3P40A 4DUXA 3BKYH 4X7CC 3VWKA 1NQBA 3S88L 3ULVF 5HPMA 1PG7W 4Y4FD 4CDHA 4M7KH 4CDGC 4H1LB 2EDDA 3IDYB 4HFUL 4PFEA 3L7EB 1M71B 1WZLA 1OD9A 2CIKB 3PHQB 1U95B 4G6KL 3VFSB 3HFML 4Z7VF 1NCCL 4YHPB 3LKOB 3MCKA 5DRXB 4OLUL 2A0LC 1R3LB 1KULA 4NRZB 1P84J 1IKFH 1JZ2A 3TBTA 4FFYL 4W6XB 4WIQA 1DLHB 3EGSB 4MYWB 1XR9A 1LP9F 5HYSG 5EN2B 5EH1A 3ZT6A 3ZT5A 3TBWB 1MLCB 1X7QB 3C5ZC 2XKUA 4Q6YA 3MPCA 2A77L 1DJSA 1VEPA 1AH1A 1X5LA 4W6YB 2Y23A 5I75B 1ZVYA 4ZTOH 4KAQH 4ENEC 1J88A 3MUHL 2P8LA 5DMGD 1IGFL 2IG2L 4WFHD 3EYOA 4Y7MA 1QLFA 1C12B 4LU5H 2CH8A 4OTXH 4K7PH 5FM5M 2CKBH 4O5LL 2R23B 5C07D 1AHWB 1FZOA 1DBKH 2YR3A 5BS0E 3LH2H 4EXKA 5J1TC 4F58L 3FO9B 4TULH 5D2NB 1P2CA 5CJXA 3BPNB 1ZK9A 4JQIH 4HJJH 2J8UB 2JB5L 1Z5LA 3M17A 1ZHNA 4KC3B 4WO4D 3IRPX 4S2SB 4OZIE 1MOEA 3S88H 1IGJB 1BQUA 3OGOE 3SDAC 4C57C 3IETA 4HFUH 1VGKA 1QTYT 5DDHB 5J89A 5FB8A 3B2UD 3CU1A 5C08B 4LVOC 2P7TA 4Y4KA 4PR5A 5I15H 3RDTD 4LHUA 2WLYA 3GMNA 5ABDE 1MSPA 1MCRA 4G6KH 3MSPA 2WUBL 1FPTL 1NCCH 1CIDA 4OLUH 1T04A 5ESVA 5FGSA 2F74B 4RX4D 4GRWF 4Q7DA 5GRVK 4KJWC 4ORGA 2CGRL 3T1WA 3G5YA 4K94C 1NFDE 4FFYH 1HSAA 3TYFB 1XT5A 1FYTB 5F93C 4Y2OA 5EO0A 5C0FA 1QACA 1K8DA 4OZ4A 1INEL 1JWMA 2J1KA 4NZRH 1HQRB 4M6AA 15C8H 4E41A 4HPOL 4KGJA 5E9DA 1TZIA 2BXYA 4AT6B 2A77H 2VXVL 4X6DE 4ZPVB 4HQQH 4JY4A 5FXCH 2PTTB 4Y19B 1JFQH 1D9KC 2W59A 1JGEB 1IGFH 4DVBA 3HZVB 2IG2H 3LIZL 4X83A 3UTPD 1WZ1L 1CDBA 1CXFA 5IVXE 3QQ4B 3C6LB 4F7TA 4TSCH 1T2XA 5I1DA 5ID1B 1AQDB 2B8OT 4O5LH 5E6IA 4D0DA 1MRDH 5ID0B 3RFZC 2HP4A 5GQBA 3BVNA 2GFBB 4LNRA 1AGFA 4F58H 3U6RB 4B7IA 4HIIA 4XVJL 3R1GL 1OGTA 5IT2L 3L3KB 1UWGH 5T3ZE 3QJHB 3L9RB 1HXMA 4FQXA 4X7FC 5FA3A 1MVUB 2JB5H 3HR6A 4YX2L 4OLVH 5EO9B 3MUZ1 1FV1B 3S5LA 4P4KB 1OB1A 4G80A 5CJBA 5K9QG 2WK2A 5GS2D 1T2QL 3QHZH 4KFZC 2X4QB 1EH9A 3I84A 4OFPA 4Y16B 3WMSA 5C0RH 5B8CB 2DTMH 3TZVA 1LO0L 1XF5B 3QIWA 5FKAB 2WUBH 3ALPA 4PLKC 1UT9A 1CDGA 4FQHA 2NY6C 1CDYA 1ES0B 3AXLB 3KAAA 4ODXA 1IJ9A 4Y2DD 5I2IB 1P6AB 2YUXA 2CGRH 1B88A 3QDGD 3VG9C 4B50A 4FTVB 2GUOB 1IGYB 5C3TA 1NGWB 5FYLE 2Q8BL 5JOFA 4QNPF 5EO1B 2R2CA 1WEJL 4BZYA 5DT1L 4M1GL 1INEH 2XA8L 4JAMB 4XRCA 3VI3E 4N0CC 2ARJQ 4NHUA 5EUOA 4HPOH 4HLZH 1O0VA 2R2EA 2ID5A 5BRZA 2VXVH 3BDBA 2IANA 3VXMA 3KPPB 3DMMC 1U8NB 5FYJL 4GBXA 1HH6A 1B0RA 4X6FA 1M7DB 1BOGB 1K4CA 4KMTL 2JB6A 4OI7A 3HCVB 3RHWK 2ERJC 2ITDB 3LIZH 3SDCB 1WZ1H 2R4SL 2ZOKA 1CXLA 5DD5L 5AUMA 1IAIL 4WFED 5DK0A 3ZDXE 3U36B 5E1HB 2X4NA 3MACL 4NQCD 2XQYK 4X98B 3T3MF 3MLPA 4F9LC 4PJIB 3RTQC 4XVJH 5C09E 3EHBC 3R1GH 1MI5D 5IT2H 1DQJA 3TNNB 1SVCP 3JTTB 2KDGA 4MCZA 5T5FL 2GK2A 3OKOA 3EOTL 3UTSD 5L0QC 4YX2H 3CUPB 1H3UA 1H0DA 1BZ9B 2HJLA 1JN6B 4Z7UA 3HE6C 4LPTA 4KJPC 3ZE1F 4U1SB 1KCLA 4BUGA 1T2QH 3B8SA 1NJ9A 3QNZA 4KVNL 4P3DB 3VDCA 2JE8A 5FDWA 1NAMA 2WIIB 5FDYA 3VXUA 4JR9H 5LGJB 4OV5A 1ZANL 5EBMB 2HN7B 5L2JB 4MJ6B 5FUZL 4Q58C 3WNPA 3STLA 4APQD 4M02A 1EX0A 5KVDL 1CYGA 1GGBL 3IDIB 1XF3A 2Q86A 3C09B 1I1YA 1RUQL 3N50A 5DGRA 3E0GA 2EDNA 3FQRB 4HUUB 4MAYC 1K3IA 5FO9A 1OAUL 3GUTA 4UBDD 4RIRA 5JLZB 1EEZA 1I8MB 3ARBA 2VR4A 2Q8BH 2CLZB 1R5IA 4PJBA 4C56B 3BHBB 1HKFA 1WEJH 4NFCA 4M1GH 1E28A 4CMHC 2RQ8A 3UTZA 3REVA 4ODWB 2XA8H 1INDL 5IHBA 2VDML 1CDIA 1QSFD 4MJIA 2M8XA 2P8PB 5CMAB 1CDCA 1U92B 4OCYL 2DQEL 3OKYA 3PJSA 5J6GA 3LKSB 2CIIB 5FYJH 2HT2C 1KLGB 1AR1D 3HI5H 4OB5L 4TPRL 2HMID 5T1MB 2FGZA 2XFXB 4PJ8C 5AG8A 1AE6L 3GIVB 4DFHA 3L3IB 4KMTH 1RZKC 5KSBA 1A6ZA 1FL3A 3LKNA 3SJVE 3UTTA 4FXKA 1CICA 4P49A 2R4SH 3O41B 1QSEA 2P8MB 2H2PC 1G7PA 5DD5H 4UDTB 4QOKD 4ZUVB 2ICWB 3MACH 2XG4A 4YEEA 3T0AA 2HJFA 1EVUA 4PRHE 1GVIA 3C9NA 3QB7C 1F42A 2V2WA 4JDZA 5DURB 4AM0B 1QD0A 4H88L 1LO3L 1RK0B 3BX7C 4HS8H 2MFNA 4PJHF 5GGVY 2UY7A 1F6AB 5T5FH 3FN9A 3OAYH 3VXTB 4YHML 3L7EA 4LRNL 1M71A 4HDIB 2MHAB 3D18A 3EBAA 2LE9A 3REWB 1AGCB 4I2XB 1UGNA 4I4WB 4CW1B 1GOGA 2CIKA 3I3BA 4V1DD 3PHQA 1Z3GH 1X5IA 1U95A 4LCCB 2DI9A 3NFPB 4R97B 4L4JA 4KVNH 4YHPA 1D5MA 5FGCB 5IBTL 1AXSB 1ZANH 5C9JB 4G9FB 5FUZH 1YEHL 4UDUB 2YPKB 5KVDH 1GGBH 1H3TA 3QWRD 5KN5A 4WTWA 3MBEC 2P4AB 1RUQH 3DVIA 2FBJL 3EGSA 3NCYS 3UBXA 1OAUH 5T3ZL 3UCRA 2OQJB 3AMLA 3TBWA 1MLCA 4NT6B 1CK0L 4NZDA 2Z35B 1WWWX 1OP9A 4AQOA 4PJEF 2EYTB 4Y4HB 4LIQE 2LQRA 1INDH 4F9PA 5MEOA 3QG6B 4XAWL 4M4RA 2VDMH 2OTWA 3FMGH 1NCWL 2DQEH 3KPLB 4OCYH 4U1IB 4F7EB 4OBRA 1GRWA 4OB5H 5HGDA 2C4FT 4TPRH 4XP6L 1AE6H 3WEXB 3SGKC 2R23A 2WAHA 5EBWB 1AHWA 1LE9B 1U36A 3DYMA 3NCYP 3LN5B 4I48B 2X4RB 2FX9L 3FO9A 5DK2A 1IM9B 3GSOB 5D2NA 1T80A 1TQBB 1S7TA 1CGTA 1U8QB 4PY7B 1U8OB 3L7FB 3ZDYE 1DQLL 4PJ7E 5TH2B 5ERWB 4M5YL 4WHDA 4RAHA 3D1MC 4YPGB 3QQ3A 5F1NA 1J8HE 3SE8L 2NYYD 5CGMA 4H88H 4KMQA 5FO8A 1LO3H 4C4KO 5BV7B 1XGQA 1BX2B 4YHMH 5DQ9A 5DD0L 5B4MC 4LCWE 4LRNH 5C08A 2DB8A 4LCIL 2HFEB 5D2LB 3HMXL 5AYUL 2CUHA 5IBTH 4O2CA 1P9MC 2F74A 3GRWL 3STBA 1YEHH 3AGVA 3P30L 4YJZL 3C60C 4YHYB 1YMMA 1FYTA 3HMWH 3LQAL 4JM2C 5EPMB 5ACMA 1UKSA 2FBJH 2W0KA 4AEEA 4LASL 5T3ZH 1FLRL 5EOTB 4JREC 1CK0H 3UBXI 4AT6A 2X70B 3EKCA 3JVGC 4KK8D 1CQYA 4PLJD 3QA3B 4LSPH 3MLTA 1RZJC 4HUWA 1FVEA 1QA9B 4JRWA 1PG7L 4N8VG 5B38A 2PTTA 4IRSD 4XAWH 3BP6B 4Y19A 1JZ8A 3FB6A 4ISVB 3MJ7B 3FO1A 3ZKNC 3MYJB 3HZVA 4J6RH 3T04D 3HS0B 4K2UL 4GOSA 3C6LA 4XP6H 1XMWA 4MDJA 5ID1A 3LMJL 4L4TD 1QEWB 1AQDA 3O8XC 3QXTA 5FF6A 5ID0A 3ARDB 1Y18B 1KJ2L 2GFBA 1INQB 2CDFB 2F5AL 3GB7A 4NJ9L 3O2VL 3C2SA 3O4LD 2WBKA 4M5YH 3V7MA 2A1WL 3SE8H 1G7IA 4YO0B 3D85D 3BRGC 1UACL 3LRGA 4D9QD 3F8UB 5E7FA 5DD0H 2OBGA 2VDKL 4Y16A 1TCMA 3G9AB 2YD3A 3BW9B 4YE4L 2X09A 4LCIH 2R8SL 3K0WA 4YDLC 4NO5B 1K5NB 1XF5A 1X44A 5AYUH 3QDAA 5F96H 2AJXL 3DSNA 3TCLB 4HJGB 1CS6A 4PBWD 3AXLA 1RAMA 3H8NA 2VR9A 3GRWH 4Z77B 3P30H 2JCCF 2GUOA 2IAMB 3FAWA 3LQAH 4IOFC 4PRPA 3MUGB 4JRXA 1RQ5A 4LASH 4NRXB 1J0HA 3QEQB 4JFEB 1AKJB 1FLRH 4M1DL 2PYED 3D48R 3QI9D 3WLWD 3DRTB 5DXWA 2DQIL 1T21B 25C8L 2NY4C 3KPSA 4XX1G 3KPPA 4P2OD 1WIPA 1MCLA 3L6FB 2GJ6A 4UNUA 1RZ7L 3X17A 1PG7H 4KKNA 3KYNB 3HCVA 4PJDB 3MNZA 3F7RA 4UV4L 2AJYL 3SDCA 4K2UH 3MV9D 1MRCL 5SWZE 1DN0A 1UQSB 4PP1D 4P5TB 2W9LA 3LMJH 4I77H 4QHKJ 5E95B 1HEZA 4X98A 1KJ2H 1KCUL 1T0NB 4PJIA 5A1AA 2F5AH 3JUYA 3MRGA 1K85A 1QBBA 2P5WB 4PTUB 3JTTA 3O2VH 3JV0A 3KR3L 43C9B 3V52L 1BZ9A 1JN6A 1LNUA 3Q6FB 1OTTC 5DD6B 2GY7B 4U1SA 2R0WL 3H0TA 3VD3A 1BVLA 5EUKA 4P3DA 1T5WA 4ODBD 2VDKH 1M6OA 1W0WA 5ITFA 3QULB 4PJAA 4XCEA 4YE4H 2HN7A 5L2JA 1A6PA 3HI6H 4R2GC 4EI5D 2FEDD 2AJXH 4OGAC 4OV6F 1N8ZB 2IMMA 5IROA 4I0PB 3IDIA 5A2JH 3ZDZF 4JFDE 3FQRA 1NC2B 2EDKA 5IMMA 1F45A 5JHLL 5JLZA 3CK0L 5GSRB 5CBAB 4RGNC 3AS0A 2NXYC 2CLZA 1BGXL 4NQEE 5GZNC 4ODWA 1A14L 3OR6B 1YN6A 4M1DH 2A38A 5F7MC 5CMAA 3MJGX 2DQIH 1U92A 2GIYA 2K7QA 1HHKB 3LKSA 3D3VD 5KSUA 1KLGA 3RA7L 1RZ7H 4UZGA 4GKNA 3QUKA 1OGAE 3D6GA 4GH7B 3L3IA 1FLTX 4CVZB 3FRPA 2AJYH 3O41A 4GG6F 3H9HB 1MRCH 4UDTA 4OJFL 4ZUVA 2ICWA 3B5TA 2PTUA 3FT4A 3GJFK 4IJ3B 4KKCC 1JNHB 4FRWA 1KCUH 3DARA 3UPCA 1DR9A 3RWIA 3TH2T 3VA6A 4AM0A 3L5WB 3VD4A 1RK0A 4H0GA 3KR3H 1F6AA 4QGYA 4OM1L 3BDXA 1CVRA 2KL6A 3V52H 1C16A 1UM4L 4HDIA 3GSQA 3ZT7A 3ZKMD 3AM8C 4I2XA 5T1LA 3O3EA 4R3SB 3QWOB 4LCCA 4HH9B 3NFPA 3O2WL 4NKDB 2P5EB 3MGTA 3GI9L 5EU6E 3U1SH 4G9FA 3JTSB 4UDUA 1AD9A 4N9OB 4D9RE 2H32A 3MLYL 1N4XL 3CFBB 2F53E 4LAQL 1WIUA 4Y4KD 1ED3B 2I60L 3PWNB 4N1CA 2OQJA 3CDGA 5JHLH 1EA9C 2JF1A 4PJ5B 1DLFL 1BGXH 1NKOA 4N8CL 3QNYA 3TVMD 5ISZE 4DOHE 1I4FB 4WGWB 2ESVE 1QP1A 2D7OA 4ACPA 3QG6A 5H2BB 4HUXA 4TUOB 5L2KB 4A6YB 1I7RA 5CSZB 3KPLA 4U1IA 4XMKL 1XH3A 4U1JB 5FYJD 4F7EA 5J4MA 3ULUC 3RA7H 3IJSA 1OAQL 1UB6B 3QFDB 4NGHL 2BRQA 5EBWA 1LE9A 2I9TB 5IFJA 2LU3A 4G8FA 1XGRB 3LN5A 1RJLB 1WWCA 4F3FB 1F3DJ 4OJFH 1U8QA 1U8OA 2AXFB 3WFBL 1ZTXL 1T7YA 2Z93B 4RSVA 2J12B 1KENL 5DS8A 1GZQB 3I6LE 1ZKAA 3T3PF 2ICWI 4JO2H 2BSRB 1NGZB 4ZDHA 4OM1H 1OAZH 3WL9B 1IMHC 4JM4L 1SJVA 5E6ID 5JZ7D 4GXUN 1UM4H 4XPFL 4DKDC 3V0VA 4YFDB 4L8SA 1NCAL 4F7CB 3DROA 5IJKA 3O2WH 1BQHB 4FQXD 3MRQB 2K3TA 1G84A 1CLYL 3GI9H 3QEGH 3K8LA 3P3YA 2XWJB 2XI9A 1FN4A 3RIAK 3TO2B 4XPHL 5DVOA 3P4LA 3MLYH 4JQXA 4F80A 5BS0D 1JF6A 1N4XH 1X4XA 1ZAGA 3BWUC 3MRKB 4H25B 5D9SB 5EPMA 2Y7QB 1RPQA 4AK1A 5CZVL 1UH3A 3WO4C 1JNLL 2I60H 5DJCB 4TOYL 1BBDL 1U58B 3FO0L 2X42A 3L3HB 1DLFH 4N8CH 2X70A 3HUJB 5C0GB 1FGNL 1KGCE 1OM3L 4LLQB 3TA3A 5K59F 4CMMB 2RCSL 1EBPA 4P57A 4WU5B 3PP3H 3QXDB 5J9PB 3VFNA 3BP6A 3MRRB 1R6VA 5DRZA 2FJHA 4XMKH 5HHMD 4FA8A 5D7JB 4MB3A 3OG6B 2EEBA 4CVUA 5CEXA 2X1XR 4HUKB 1OAQH 3EAKA 4NGHH 5D7LA 1FGVL 3DTXA 4D0CA 2R9HD 2YPVL 4M9PA 4QRPA 4R8WL 3ARDA 5C0ND 4B0MM 4R7DA 1VA9A 2CDFA 2VN7A 2ZJSL 4RISL 2Q1EA 2VLRE 3WFBH 5DUML 4DCQB 2VLJB 4P9HC 1BD2B 1KENH 4RGNE 1TENA 3FB7B 1TIUA 4DGVL 1HI6B 4YO0A 4Z18A 3S36L 5E8OB 5IIEB 2ZUYA 1YDPB 4JM4H 3RU8L 4ZXBC 4XPFH 4JHZA 1JGUL 1TTGA 3BW9A 4IS6A 3TPKA 2BNQB 2PXYA 3GSRB 1KTDB 2C4XA 2C26A 4ELMA 1K5NA 3STZB 4YUEL 3VGAB 4FOMA 3MRCB 5DFVC 4HJGA 2W0FA 2AJVL 4LDOB 4NUJB 2HT4C 4LVHB 1TVBA 2I07B 5ECJE 1G1YA 3X14A 4EI6B 5IW6A 4KJQC 4Z77A 3FONB 3BP5B 4XPHH 1T1WB 1RMFH 1U2HA 4GRWB 5CZVH 3QH3B 2A6IA 4O58L 3QFJB 4N0YL 1OT1A 1JNLH 4HLJA 5T3ZD 1KN4L 4TOYH 3MUGA 4ZO6A 1BBDH 4JY6A 4DTGL 3FO0H 2H9GA 4H5SB 4TUJB 2VERN 5FYJU 3S6CA 4JZOB 5AZ2L 2H32H 2K1MA 1FGNH 5D1QD 1OM3H 1KCKA 1OQOA 5CZXD 2VABA 2RCSH 1KTLA 3HG1E 3KYNA 3BUTA 3O6FB 1MAKA 4PJGB 1IAKB 2IADB 1JTPA 2UV3A 5F7EL 5TDNB 1NEZB 5GS0D 1CN4A 4NQXA 3SY0A 1FGVH 1RZGB 2VZOA 3L95B 1WWBX 4XNQB 5ESQA 3RZCB 4R8WH 4JDVB 2NPLX 5D5MF 1TVDA 1T0NA 2J6EA 2PETA 3U7WL 3UXFA 2AK1L 4QXTB 5FYLD 4X4MA 3V6ZA 43C9A 5IHZA 1EIBA 5HGBB 1S7QB 5DUMH 4EKXA 4KJYB 5A2FA 4I0KA 3QIUA 3HTLX 5E2UH 4GAJL 5IQ9B 4PRBB 2GHWB 4DGVH 4YHZL 3S36H 3QDME 3ARBC 3WFHB 4MJ5B 2OSLB 5DJ6A 2EDFA 3RU8H 4TNWK 2B4CL 1JGUH 2IBGA 1EHNA 4JDTL 3O81A 3ULUE 4YUEH 1N8ZA 2D7NA 4KUCD 3ROLB 3U2SB 4I0PA 4ZOBA 2A0LD 1KEGL 2AJVH 5CIPB 1NDMB 1EGJA 2VE6A 5H35B 1H15B 5JPMB 2JIXA 2M2DA 3BYYA 5CCKL 1IC7L 3KLDA 2IH3A 4YDIL 5GSRA 1HSBA 2DLTA 1CICC 1CD1B 4U0RC 4GRLC 3JXAA 5C09D 1PQZB 4O58H 4HZLA 4N0YH 1HYSC 2XWBA 1WISA 5CEYB 1EEUA 4S1RL 1KN4H 2BVPB 4X8JB 3IDUA 4DTGH 2BY0A 5C6PB 1JPTL 2HFGL 2DLIA 5AZ2H 4LSSL 4WTZG 1HHKA 2VYRE 3ROOB 1HHHB 4MA8L 3IDYC 2PKDA 2IPKB 2DI8A 3D69A 2F54D 4CVZA 5C2BL 3DRQB 3ABZA 1OTUD 4KRPD 5F7EH 3KXFA 3BAEH 3H9HA 4AEFA 4P48A 1ZLVH 1JBJA 2LABA 1S9VB 2VL5B 1YY9D 2Z91B 4F8QA 3QQ9C 5D8JL 5J3HC 5FAAA 1NC4B 3MFFA 1JNHA 2X1QA 4GXVL 5HYQB 3RVWD 5EOCJ 5IQ7L 3V79C 3U7WH 4RAUB 2AK1H 3VD5A 3O3BB 4NO3A 2MCG1 2A83B 2CPCA 2R1YA 3LKQA 3FQWA 2YC1B 4OZGB 1S3KL 4GAJH 3LSOB 3CFKA 1UM6H 4YHZH 2J6EL 3QWOA 4R3SA 3ULSA 2XQYG 1LD9B 5C3LD 2B4CH 4QT5B 4QXWA 2IWGA 3JZ7A 1M4KA 2VAJA 5I75C 4U33A 2EIBA 3RWDB 3QDHA 3B43A 3JTSA 4JDTH 4JGUA 4Y0GA 4NQTA 2XTLA 3BDYL 5F97E 3SJVD 1M05A 3L1OL 4X4ZA 1L6XA 5ITBH 1KEGH 3CFBA 1X5FA 1KYOK 2Y06L 4LQFH 5DJYA 1WIOA 1ED3A 3VMPA 3JV4A 5FA4B 3BIAX 3P2TA 1IC7H 4YDIH 5E2VH 1AHWC 1N0XH 3DURB 3NZHL 3ALXA 2Y07L 3OXRB 4PJ5A 1CTOA 2A73B 4MNGE 1YEKL 5D2NC 1I4FA 4ZUTB 3OJDB 3BPNC 1TJHL 4WWID 1EGJL 4CL7A 3CSPA 3E6HB 1U8IA 2J2ZA 3IVKA 1JPTH 2KH2B 1KBGL 4MJ2A 4LSSH 3B9DA 4ZAKB 4AYFA 4R4NC 4WEMB 3CMOL 1U3ZA 4XGZB 4EBQH 3QDJE 4MSWB 3QFDA 5F88B 1CGVA 5IKCA 1D9KD 4P2RE 2Z92A 2O93L 3O0RH 5C2BH 2I9TA 5BRZE 2E7HA 2YD6A 1RJLA 4XCFL 4RGMB 4F3FA 3HNVL 4BSWB 1ORSB 4MA7L 5HDLA 3SQBA 3MV7E 5D8JH 3MV8E 2N7BA 2QV2A 2Z93A 1IARB 3OJ2C 2DQDH 5IQ7H 1DDHA 3VE0A 2NMSA 4J3XA 4NM4H 5HTSA 1VENA 2BSRA 4KVCL 3MX0A 1NGZA 4HG4K 3WL9A 3IGAB 4HIJB 1YQVL 3Q0HA 1PKOA 2GITB 4KRLB 4ZFFB 1KNOB 1S3KH 5CWSA 4I3RL 3ZO0A 1IKNC 5CD3A 2J6EH 1MCFA 4F7CA 4JANB 5IEHB 3MRQA 1NFIB 4QRTB 3U7YH 3RX5A 1LMKA 4DN4L 4Q9QL 4KU1A 4Z7VA 5DFWH 1ETZA 2W92A 4LGPB 1YEEL 2PF6A 3TO2A 1QBML 3L1OH 1T1XA 4OIAA 2GTWA 5D9SA 2Y06H 3S98A 2Y7QA 1VESA 3C6LC 5HVGB 4G8GE 2YUVA 3R8BB 5DJCA 1RZ8B 4Z7NF 1RK1B 4FS0A 3DVNA 1U58A 2BVOB 2PW2A 4ZSOA 3BKCL 2GI7A 3NZHH 3BKML 5BVJA 3NACL 1J8HD 1XZ0B 3L5XL 7CGTA 3HUJA 4YQXL 1LP9A 1YEKH 5D6CB 2VDNL 2J88L 1TJHH 1WC7B 4FQ1L 1IC5L 1EGJH 3D0VB 3FOLB 12E8L 4O4YH 2BY1A 1EO8L 2CSPA 1PY9A 1KBGH 2MQ3A 4LLMA 3RIFK 4I8DA 2J8HA 1LEGB 4PJBE 4P4KC 2DYPD 4PJEB 3VG0L 3KWWB 2EDXA 3CMOH 2Q7NA 4PRPD 4YBLB 2OCFD 2R0KL 4MAUL 2W65B 1G6RA 3BWAB 2R2HB 4Y16C 5B8CC 5MERB 2NLJA 1ZVSB 4X4YA 4PPTA 2YPLB 5EU3B 3S96B 1DBAL 4JZJB 1LEKB 5L8LB 4XCFH 5SWSB 5CP7A 4F37F