3M7OA

Crystal structure of mouse md-1 in complex with phosphatidylcholine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
GWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphocyte antigen 86
publication title Crystal structure of mouse MD-1 with endogenous phospholipid bound in its cavity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m7oA00
3FXIC 3WEBA 1KTJA 3T6QC 3VQ2C 4G8AC 2Z64C 3M7OA 5KWYC 5IJBC 2Z65C 2HKAA 1A9VA 3B2DC 3MTXA 1WRFA 2F08A 1AHMA 3VQ1C 1NEPA 1XWVA 2E59A 3MU3A 1AHKA 5IJCC 3ULAB 3WEAA 3RG1C 5IJDC 2E56A
chains in the Genus database with same CATH superfamily
1M05A 2PW2A 3LZPA 3RJDA 1L3WA 1LDPL 1BWWA 2E9GA 2J1WA 4FD0A 3IMRA 1R24A 3IGAA 1HNYA 2IWGA 3BKJL 3BSGA 1JYXA 3H9SD 2ROXA 5IJBC 4PJDB 3ARBD 1VKXA 4RDQG 4MAZA 5INCA 3V0EA 3T6VA 3W9DB 2BSRB 1FDLH 3L13A 4FP8H 4I13B 2J1ZA 3HE6C 3I3EA 1V05A 4GQQA 2CIIB 3ILPA 1A3ZA 5KZCB 2EC9U 1OAUH 1WT5A 4LDEB 1FDLL 1R5WB 4IEFB 4FFZH 4FP8L 4TS6A 4W6WB 2OL3H 3LNEA 2NQDA 3FH7A 3GSVA 2QADD 1CCZA 3HBGA 3LRSA 1OAUL 3MXWH 2CM6A 2VLME 2ZPKL 3IETB 5F1OB 3TO2A 4FFZL 1PZ5B 1AACA 4ORGB 2BOBB 2OL3L 2Z91A 2DLEA 3NK3A 3AQZA 1RLWA 1P5UA 2DWYA 3MQIA 4YIQB 1D5RA 2DEXX 1UWEH 2VCOA 3A24A 4BE6A 2A83B 3EYQD 3K1KC 4QDGA 4S0TD 3D34A 2P46B 3P40A 4Q6IB 3QJOA 5G2NA 3ZU8A 1KT2A 5HYQB 1UWEL 3IN2A 1JRHH 2CJ3A 3UTTA 5HYJE 3RL1A 2HCZX 3FTUA 3DUSA 3HTLX 4MASA 4WJG3 1E5ZA 1N0LA 5B21A 4BZYA 5KTEL 3VFGL 3T0EE 2CBOA 2MIZA 2OX5A 5D1ZB 1XSJA 4KZDH 2XFXA 1JRHL 1IVLA 3P9LB 4U7KA 2WLHA 2OTUB 4FCAA 4LE8A 2PWEA 3AQXA 4KZDL 3V5KA 2BDNL 3CH8A 2XZAH 2XOTA 3SKMA 5KSBB 3VRIA 3FT2A 2NCMA 1EMTH 5CZVH 1MAJA 1KFAH 4JLRB 4Z3GA 5DJ0B 2XZAL 1U3HD 4GW4A 4JY4A 4RNRB 1BQKA 2P5WE 5DF0A 3CX5J 4BFBD 3I02B 3JZ7A 4KK6C 2IH3B 5FEBA 2QHRL 3T5WA 3PHQB 1EMTL 5DJZB 1KFAL 3FQTA 3IFLH 5E00B 2VE6A 5IHZA 4R7VA 1FN4B 2WXNA 5T5NG 3HG1D 3SD2A 2X05A 4R4FH 2WCPA 1QLEB 1DQTA 1GGCL 1ZIBA 4KY1H 1KWKA 5GGTA 4FQLH 5HY9B 2VLLA 1K6QL 2YUVA 2X3BA 5K1VA 3OMAB 1FHGA 3CWGA 3VQ1C 1MFNA 2VSCA 4R4FL 1KCVL 2QQNH 5GSVA 4RBPH 5HHXL 4RX4D 5C0AE 5CGYC 3F58H 2JTDA 3HN5A 4FQLL 4XZUB 3B7RL 3OXSB 1JZ4A 3L3HA 1CDYA 1U21A 6PAZA 4IK6A 4XI5D 3RWIB 2QQNL 4U1HA 3PU7A 2LHAA 4EI5D 4Z8FL 3CDGA 4EKXA 1W0VA 4YX2L 4NXKA 4QT5B 1EGJH 2Z1PA 1ZANH 3D4YA 2FO1A 2R8SL 1XL6A 3T3PF 1RUML 2KH2B 5DWPA 3VH8B 1LEGB 2ADIA 4PYGA 3QIWB 2VXQA 3SPGA 3VWJD 3IPFA 4W4NA 3W81A 1EGJL 3BI9X 3AB0C 4YDJA 5B1JC 4NAMA 2AAAA 5D7JB 2DWSA 3KGRA 3H2QA 1S7WB 1AQKH 3CSYA 5IB3A 1X5IA 1F3JB 3CZEA 4NQEB 4P46A 4P2CG 2RA1A 3ILEA 2YPLA 1WCBA 3QG7H 3ULSB 2GT9B 3H8NA 3IGFA 1MJUL 1AQKL 3D51A 3PUCA 3SYCA 4A7QA 1T04B 1G7MA 2WXRA 3LDBC 3PWPB 4LDCA 1XB6A 4APQD 3QG7L 1SDDB 4PD4K 4XP9H 4YFEA 5J7CC 2XTJB 3REWA 3FO2A 3CLEL 5KSAD 4MRBA 1R1CA 1SF5A 1T20A 2VQ4A 1CLZH 4EN3B 1ZLVK 3KWVA 4XP9L 5BMFL 4HIHA 4LU5H 1NC4A 4HAKA 1ZGLB 4JJOA 3JTSB 4JVPA 4WWNA 1KGCE 4QNPE 5IV2A 3C60B 3IK2A 2H3NB 4JO3L 4K3GA 2FEEI 4H20H 1UVQB 1C7SA 2MFNA 1I1AC 4LU5L 5I24A 4HJ1A 4NM8L 1LO5B 3BKYH 3EYUL 1ZD6A 4DSYA 3HJEA 3OG4B 3O8XC 3GKZA 2IXQB 3PGDA 5EIIG 4ZSOE 1JGIA 1FYTE 1UACL 3JV4B 4W9FC 5FFLA 4NERA 1JZ7A 4MJIA 3FTSA 3BKYL 2VO5A 3VJ6A 1XD0A 3PQYE 1HCVA 1TXKA 2E76C 2XC8A 2AXGB 2NZIA 1FRGH 3FUEA 3QFJE 2G75B 2EXWD 4UQ9A 2RCSH 2CR3A 3CVDA 3KW7A 3TX4A 3QA3B 3VD3A 3JV5A 1A65A 1P5VB 4NDMB 5EDSA 4TNGA 5BZDB 1FRGL 3FQXB 3T4AB 4DN4H 1AP2A 3CVIH 2IPUG 1NCJA 2RCSL 2WUCH 3TBCA 1ZXQA 5IR1B 2M8XA 3HG4A 4KNSA 1IGTA 2XWTA 5GGRB 5EOQH 1I9RH 4EIUA 1U3JA 2CBTA 4YGVA 4DN4L 2CDFA 2APXA 4XO9A 1N6QL 2WUCL 43CAB 4CU7A 2EXTA 1DN0A 1M2OA 3EOAB 2ZUVA 1TPXB 4WJ5B 5D7LA 1WBXA 1I9RL 3A23A 3CV5A 4F1ZA 2JXMB 3H55A 5DRXA 3EIFA 1I3UA 3ABZA 5BS0A 4FQHA 1QLFA 4M9PA 1GVIA 3MI6A 3IMWA 4O5LH 3V0FA 4LSTH 1FFRA 3Q0HA 4EAEA 3QO1A 1II4E 1PLGH 4O02H 4YXLH 3ETBF 4MXWL 2JJUA 4LCWD 1HXMB 3V0VA 1TZ8A 4M03A 3EFFB 5D1QD 5DK0A 4FYQA 1G87A 2EXSA 3LV3A 2HLFD 3S3CB 1XBRA 1NC2D 3IDIA 4GNKB 4LHUA 1FUNA 1KB5H 3SDAA 5BZZA 2WQUA 2HX8A 3ML9A 4P2QA 3FFDB 4X4ME 1F90H 4D7PA 1I31A 5FC9A 1BZ7B 1KB5L 5IJCC 1WIOA 1UA3A 3OPUA 1G7QB 4Y5VB 3UZQB 3AXIA 3KBEA 4PJ9C 1F90L 3V0JA 3NJMA 4PSRA 4MX7B 3PL6D 3V0IA 4WNSA 2V9QA 2PXYD 5FCUL 4Z5RB 1C08A 4NZRH 3PABA 3HFFA 4OI8A 4OI9A 4I3RL 5F9WC 4IRJC 2MTPA 1E28B 3UTZA 1XR9A 4ODSH 4YLBA 3RZCB 3OLGA 4TSBH 2MOVA 4N28A 4NZRL 1CDHA 5C0JB 3D85A 4ELKA 3BVNA 3ARPA 1DVTA 4J1UB 4Y2DC 4ODSL 2R23A 4QHLA 5H4YA 2QKIC 2NY4D 3RPKA 1X5YA 1MG2C 3O0RL 1D5MB 3GM0A 5DU7A 5EZPA 2ZXGA 5EEUA 3ARYA 2X6CA 3SDDA 1YAZA 2O5NA 4CMHC 4C8XA 1FL5B 4HJJH 5FV2A 2Z64C 2VH5L 3UJJH 4Q2ZB 2FWOB 2ZIDA 4Z76B 3TN0D 1R3JA 5A2KH 2R29A 3NUKA 5JPNA 1M42A 2WTRA 4BH8B 1INDH 4BDVA 2LTQC 3HE7D 1TZAA 4PJIA 4FLSA 5H37G 5F3HA 3UJJL 3QDJD 1NH6A 3SKOA 1WGOA 2HTKC 5H94A 3ECUA 4FMVA 2Z4QB 1INDL 2OR7A 4GW5A 4PRNA 3DSNB 3P02A 4ODTH 3FK3A 1RULH 1A9BB 1X5AA 2J72A 4N24A 5JIDA 2FCBA 1AS7A 4P5KB 1U3YA 5DYOA 1IAIL 2R1YA 2FBRA 3SOBH 3APFA 5EG6C 3T3PB 4ODTL 3ENEA 1RULL 4YHYC 1MW2A 1LNUB 3INOA 5EU4B 2F19H 1OW0C 2XV3A 4FRWA 1E9PB 3L5HA 4BFEA 3MBED 2G5BA 2XWJA 1NAMB 4JFFD 2F19L 3T04D 4IRSB 4ODHH 3WOVA 1URLA 3QXDA 4U05A 5F3BB 4NC1C 2ZWZA 5LCVH 1TTAA 4P23B 2FB4H 4N5ED 4IBQA 1NGQL 2CPCA 4U49A 1X5KA 4ODHL 3UG4A 4U3HA 2H2SC 4UOW0 3NCBB 4O00A 1G4MA 4D0DA 1UD8A 4U7SA 2ADGA 2FB4L 1U92B 4MJ5A 4R96A 5HDOA 4AH2A 4LCUA 3VXRA 5J1TC 3C2AH 4DUVA 5FO7B 3DJZA 3L4XA 4LLYB 3TF7C 4FLRA 1CC3A 3FCSB 3CMGA 1MFBH 5AKRA 2VZUA 5JW4M 4XTRD 5ESVA 4Z7OE 4LF3B 1HL8A 2Y5TB 4W9ZA 3QEQE 4ZUVA 3RKDD 1D7DA 1KBWA 1UQSB 4I18A 4KUZL 4UV4H 3QRFM 5E5MA 3P4NA 2FHCA 12E8L 3IKCB 1Q90A 4HEPG 4NO3B 4BFGA 4DQOH 2CJUH 1KTKE 1LMKA 4UV4L 4AQAB 2B20A 2G5RA 4MQSB 3RVTC 3MV8D 3G6JE 3WNNA 5IK3A 4CBZA 4G80A 4ZODA 4YBQD 4LQ1A 3EGDB 4C54A 4DQOL 4HOWA 4GW1B 3TJEH 5LDUA 4FCHA 4KRPD 4HUXB 4MDIA 5MERA 4RMTA 4RMBA 4BJLA 1X5ZA 1CL7H 5DRNA 5E9DD 3A5VA 2EDJA 3G5YB 1N70A 4IOFC 2XN1A 5AVYB 1CL7L 5HYIA 4ZG1A 1NBYB 5HDWA 4R5XA 4L1LA 4Z6AT 1YAIA 4N1HB 1Q9WA 2IH8A 3W3BA 3ZL4H 3RJOA 4QRPE 3KD4A 5D1ZD 3NJJA 3KYMA 4MD0A 1XF5B 3HZVA 3V0AC 2WHVA 4L8BB 3O4LB 3T08A 5DMKB 3ZL4L 4I77H 5J06A 1N5AA 1CDCA 4XHJD 1VJSA 3EDFA 1JAEA 2XPYA 4AIZB 1S5IH 1SNRA 2XN9A 1I53A 2ZE0A 4UMGA 2XA8H 4NXSA 4Y9FA 5AD0B 2IFFH 3NRFA 3O41B 4I77L 4G59C 1EA9C 3IWVA 3V6OC 4F33B 2CO7A 1E8YA 1SF3A 4C4KT 1S5IL 1Z3GH 3MRFA 1TQSA 2DWXA 3L95A 2WNKA 2E74C 5F8QC 1QFUH 4OGZA 1N4XH 3EBGA 4ZQKA 1IJNA 3LZRA 5AL8A 1P7KA 4RMQA 3UJIL 1DQLH 1Z3GL 3MACL 3LRHA 4ZO9A 5DMGC 5IG7B 4JNXA 1L0XA 1QFUL 5ACLA 3FU6A 3C5SB 1N4XL 3KL5A 4UT7H 3G9AB 4PRAB 5I6LA 2PCFB 1SFHA 1UM4L 1DQLL 4PRIE 5L8KB 5ID1A 1NDGA 2EKSB 4DERA 3H9SA 3HN8A 3ARBA 3NCXA 4EXKA 2WVUA 3LKQA 4MMYB 1HCZA 1O5PA 4PRBA 1TTGA 4OCXH 1RUQH 4G6KH 3WNIA 3IDJA 3FUMA 4B9JA 4QRRB 3OKOB 3QK0A 1PEWA 3U0PB 2AABL 4TTGA 2FH8A 5KYUB 4Y4KB 1RUQL 1O9ZA 4TVPE 5IROD 2ZKWA 5E4AA 4YVUA 1KJ2A 5GZOC 2OMYB 5J0BA 5GSRA 1R19A 3QIWD 2NMSA 3QZBA 1T4KB 2VJ0A 3L9RA 5BXFB 2UXGA 3M8OH 2YAEA 3MVSA 1JERA 5DJ6B 1S9KC 1OTSD 3QJQB 4JPKH 4EJ1C 2V2TA 1CYXA 3ILQC 4NQED 3UBFA 4LOEA 4RAUB 2QT6A 4TRPL 5F6HI 1SXBA 2AJXL 4ILDA 2ZJSH 3KPPA 1LMIA 5I6KA 2H47C 1C7TA 1DN2A 2X9ZA 2O6DA 4F24A 4YSEA 4JPKL 4ANWA 5AB9A 2YKKA 3TBVB 4P4KB 5B39B 4PJXF 3GJFB 5F7UA 1FVCB 2GY7B 3BVUA 3VXSE 2Z4TA 1DVQA 3MV9B 2VM9A 1E5BA 5DS1A 2JF1A 2QQKL 4PGEB 3TYFB 1NDMA 4XOCA 4P5SA 4XNBA 1AJ7H 3L1GA 3U48A 5DJYB 4HD5A 1PD1A 5EUOE 4O2EB 5HHME 3EJPA 2BVUA 1BLIA 1MCDA 4PRHD 4TPRH 1WFOA 4QRQB 1RJLB 3C60D 4TNWK 2Z8RA 4J7RA 5KUMA 5EBWB 4L4TD 1ZEAH 2NUTB 3X1BA 1IE4A 1CLOL 2JI3A 3BEVB 4GIOA 3IXAA 4PTUB 4TPRL 4N2OA 1U3HA 5FWQA 3S36X 1ZEAL 4NN6C 4YBLB 3HC0A 3S96A 4JY5H 1TDQA 1KBPA 2J21A 4QGTA 7FABH 4JFDB 2OMVB 4AE0A 1IKFL 1MZZA 2VR9A 3SE3C 5IQ9B 3VUAA 2FECL 3CFDB 5HDRA 4OD1L 3HG1A 1G7JA 4QNPF 3U36A 2OULB 4QXVA 5D70H 3RKPA 4DP2X 5ISZD 3WYRA 3GB7A 2V17L 5TQ0H 2UWEA 1HN1A 1DE4B 4PGDA 1NIBA 4UIKL 2JWYA 3ATEA 1S78D 5D70L 2AS5M 1BSIA 5DD5H 3JQOB 2V5RA 2NZ9C 4RX4A 2WO3B 2ICES 1EAOA 2AQQA 2QMJA 2K78A 2WVSA 1BVKB 4KPHH 4FNQA 2HVJA 3VFRB 2FWSA 2XZCH 1L6PA 3BZFA 2YKLH 5IIEA 2UXTA 4NIYE 5KN5A 1HE8A 4XMKH 3H0TB 5IBLC 4EI5A 4TL5A 2ATKA 3EH5B 4M61B 3C8KB 2XZCL 5CILH 1HJCA 2GJRA 2YKLL 3N55A 4JGUA 2IPTH 4N86A 2PW1B 3VWJA 2A3TA 1TKWA 4PR5B 3NPZB 1KYUA 4PB0H 3I6KA 4PMEA 4YSPA 4EDXA 1BMGA 2V37A 2VR3A 3GS4A 4WWKD 2QPDB 4PB0L 3OD3A 3O81A 1BFOB 1EHNA 3RG1C 2J8UF 5IHUH 2B59A 1KDIA 3VGBA 3AXLB 4NRZB 4APQA 2VZ3A 2EZ0D 1HAUA 3DX7B 3U4EB 1KPRA 2BIMA 5IHUL 5KSAA 2XG4A 3DROA 1OARH 3WFEL 4H26B 4GUCA 1JNLH 1P84J 3HG5A 3CSBA 4HV8A 3EO0A 1PKQE 2O61B 5J9PB 3LKNA 5EO1A 2WBKA 5J57B 4K3DL 4ADIA 1OARL 3UERA 1WFUA 1JNLL 1OGSA 4OZGA 4CC4C 4DP6X 1WSST 5AENA 2WSKA 1FO0A 1ED3A 1B3JA 1SRDA 2DIAA 5HYJB 1YVLA 4BD4A 3HB3B 4A63A 2BMKB 1B9KA 3SCMC 3T0EB 1XH3A 3PWNB 5HXMA 4F3FA 3KXFE 1MELA 4PWHA 3DX0A 2OSLA 4XNZC 5GS1A 1K85A 2ZCZA 3GUFA 1BEYH 2KKQA 5E1GA 2ZXAA 3TJPA 1NGZA 3AAZB 5EC2B 8PAZA 1ZE3H 5D6DC 4QWWC 1JTPA 2A7BA 5E7FA 3UGUA 2NY2B 4U1IB 3HPLA 5AOIA 1DSFH 4O51B 1L9SA 3RPBA 3CHRA 4JPSA 2R1XB 5TPWH 3B5GA 4S0HA 1H3GA 5BUAA 3VD0A 3CNKA 4XPGL 1DSFL 3GEFA 4NGHH 5DJ2A 3D2UB 1RP8A 3G5XB 1A1OB 5TDNB 2ESVE 5TPWL 3ULVH 3O6LH 3C2SA 1FC1A 5A1AA 4J39A 4LL4A 5B8CC 4LVOB 3L3IA 1BFVH 2AXHA 2DBJA 1ILSA 3K2UL 3M1OA 4NGHL 2I7OA 4X9HA 1GSMA 3VGFA 3BSZA 1OCCB 2A0LC 3L17A 4F9PC 3ULVL 5FCSH 2WSPA 1Z9MA 2V2WA 1EDQA 1BFVL 1MJ7H 5GGTH 1FVEB 3F00A 1H6EA 2I32A 1OP3K 4JR9H 4KKPA 4J8RB 1JFHA 4TVUA 4LCWA 5C0AB 4JPIB 2R4SH 4OKDA 3RBGA 5D1QA 1G1CA 1BQUA 1G6VK 4Q9BA 2DQJH 3UBXA 5GGTL 4JR9L 1NC2A 3V52H 2CO1A 2DLGA 4M29A 2OTWB 1FORL 2R4SL 5E7BA 1F58H 1UJTA 3EXJA 2OZ4A 2DQJL 4PLKC 4LVNC 3QO0B 4U31A 4PJXB 3EYOA 4MJ6B 4P23D 3VD5A 1OCOB 2DQUH 4YXHH 1F58L 4AJVA 4H25A 1H3XA 1L9TA 4QO1A 1JWUA 3PL6A 2VXQH 4FI8A 4TL4A 5EV7A 2DQUL 2F1BA 3K6NA 1GC1H 4DGUA 2NT0A 1G9HA 5DHVB 5IFJA 3JWDL 2KPWA 3U2SB 5AVVB 2LU7A 3VXQA 3AU1B 4C57C 2VXQL 4WTXA 1MRDL 3E6HA 2HMID 3B6SA 4D9QD 1AD9B 1LO4H 2WO4A 2C5DC 4UM8A 5GS2H 1WWCA 1UZ8B 3N1QC 3ARQA 4TQEH 3ZGHA 1GH7A 5CJXA 3BP6A 4ADGA 4XE5B 2CZNA 3WUZA 4YL4A 2IIJA 2YAOA 1BG1A 1U9KA 1UH2A 1E67A 4CDGC 3W5MA 4EF3A 4DZBB 3OJDA 1JZGA 3DGCR 1C1EL 1F41A 2FBJL 2BZCA 3TN0A 3AG2B 3ATFA 4BWWA 4Z7OF 3IT8D 2NYYD 3AG1B 1ZHKB 4MYPA 3ROOA 2E7LC 3HE7A 4F7TA 1A9VA 5KVGE 4DVBB 3B2UC 3QDJA 3BYTA 1FYTB 4I85A 1J8KA 3H4FA 1O6TA 2B15A 4NJAH 3PQYB 4L48A 2BRRH 2VDRL 3A4DA 4X42A 1UKTA 4P5MB 4NX0A 2VXTH 5D7IA 1YNLL 3PDGA 2GJZA 1KTJA 3WKMH 2AQ2A 4K23L 2BRRL 1AR1C 2B39A 3FPXA 1UT2A 1OTTD 2R51A 4LCYB 1DBBH 4PY8J 2XV0A 2XSKA 5D4IA 4W9KC 3MBEA 5A6IA 5I1LA 1WICA 3J27A 5CWSA 4CVZB 2GK2A 4JFFA 4AGPA 3RVXD 1DBBL 4PJBE 4AGLA 3EJZC 4FADA 2CUHA 4LLWB 4YHMH 2J8UB 5DYFA 3ZQWA 5JHLA 1NBCA 2XWBA 3MSPA 4AEIH 4YHML 1KJ3H 2GCYB 3AQDA 1ZPUA 1CTOA 5MEQA 4JM2F 1FGNL 2ZD0A 3IJYA 5GXBB 2F5BH 1INQB 4WUKH 4G42B 1LL1A 4NO2B 3QRGH 4N20A 5D7SH 1OIOA 2DQIH 2GY5A 2F5BL 2DTMH 1AGFA 4HWZB 4XP1H 4WUKL 5IOPB 2DI9A 3QRGL 3P3TA 5D7SL 1E5UI 4A6YH 4OGAD 4FNSA 3U1SL 4PJDA 1HE7A 2ZXCA 1EJFA 1T1YB 5DHEA 1T89C 1ZMYA 2BSRA 4RZCB 3QQ9C 4PVLA 3BLBA 1FHNA 5FWRA 4PJ5B 4HKZB 2CIIA 4P3WA 2KDYA 1PAZA 1R5WA 4IU3B 3FO1B 3MV8A 3NSFA 1CFSB 4PB9H 1L7IH 4Y4KD 3UTQB 4YMPA 1CO1A 5E2WH 1AGEB 1LO2L 2QL1A 2YD1A 4K7PX 4YFDB 4AGNA 1E7UA 1TVBB 3HBQA 1I3RB 3GBNL 5DD3H 4ORGA 3FT9A 4PB9L 5I0DA 1L7IL 2VMEA 3D50A 4YIQA 5E2WL 1NIDA 1SLXA 4DK6A 2ZXBA 1F4XH 1UKSA 3HG0A 4UB0H 4XN8A 3U9WA 3D3VD 3WGVB 5HYQA 4LGRB 1E3FA 4QR7A 4JJ5B 4K5NA 1P6AB 1F4XL 4P4KD 2F54E 2R1WB 4UB0L 5L2KB 4DEWA 5I8KH 5GRJH 3MTXA 4LPXA 3FB8A 3PRZA 3MV9D 5D1ZA 3G6AB 2DM7A 4HJGB 5I8KL 3GXNA 1MCWW 2R29H 5GRJL 3G04B 1KTRL 4RBPK 3M45A 4MLIA 3X1NA 2X0WA 5GS0D 5JW4N 4FQXC 4HG4J 4MJHA 1WD9A 1Q1JH 5D93B 4TUOB 2R29L 5KSBA 1E43A 2Y72A 2GJJA 3WUWG 2NY3B 2VDLH 2GTWB 3RFZB 4PP1D 5DJ0A 1JNNH 4RNRA 1RD6A 1Q1JL 1BBJB 3VB9A 3I02A 1JI2A 2ZYHA 1OKEA 3G08B 4F5CA 2VDLL 5DJZA 2R2EA 1U30A 1X7SA 5E8DH 5CSBA 2J57A 4JFDD 3D7PA 3NACH 5EUOF 4Y7OC 4YSDA 1U8CB 3LZLA 2J8HA 3ZYZA 1GOHA 1Q8MA 5AKVA 1MFDL 1J7VR 1NIFA 1XCXA 4H0HB 4CSZA 1Q0YH 1ZTXE 3GMLA 3NACL 5HY9A 4I0PC 5SWQB 5HJ3B 5E6SB 1EVUA 2AQNA 3Q2CA 1Q0YL 3CFEA 1UFGA 5T1KB 2CK2A 4NZDA 3QNXB 1JDAA 4AVKA 4BHUI 4L5FH 2NNAA 1L5GB 5CEYA 3IBEA 3KVDD 2BH0A 3OM3B 5IJKA 3RVUD 3B2XA 4QT5A 5EU7C 4ATTA 5IROA 3CQQA 4L5FL 2O6PA 1L9MA 2F8OA 1LEGA 2P24B 4IBTA 3VH8A 4QRTA 1HEHC 3QIWA 4TOYH 2F9BT 2ZZUT 3C87A 4F7PB 2A4ZA 1NCCH 1DZBA 1BX2A 3N1GC 4Z7OB 3PJSA 5I0YA 3O3EA 1S7WA 3QEQB 1MFVA 1CQYA 4NQEA 4PG2C 1ET5A 4I48A 3GMNB 2BSTB 1MW1A 1NCCL 2F53E 2GT9A 4HD9A 2NW2B 1TCRA 3BFQG 1T04A 3S5LG 1SDDA 2D73A 3EH4B 4KKAC 2ZUSA 3FAXA 1XMWA 3BT2H 3VDBA 1H6FA 1FGVL 2CUMA 3IDUA 5T5FH 1CDIA 2Q7AA 2A6JB 1AE6H 1I8IB 4OF0A 1BQHB 3MRCB 3DJTA 3P2DA 3BT2L 3ZKND 1ZGLA 5D1XD 4YHNA 4PRHA 2IH9A 3JTSA 5I6XC 5GGQH 3C60A 3UH8A 4D7BA 1MLCB 1UVQA 4L4TA 3FN0L 2WNXA 1LO5A 4OCSH 3HHRB 3FO0H 4UTAA 1H19A 1AMYA 2F5AH 2IXQA 5F89B 4GRLB 1WT5C 2Y69B 3JV4A 3DVIA 3B2MA 5ICXA 3HB3D 5LQBH 3QXUA 5T3XH 4QRPB 3Q6FB 2FL5A 3FO0L 4KKNA 4X7TB 4Y5XB 4DJMA 5HD8C 3FDWA 4JM2B 3VU2A 1LK2B 2EH7L 2XWDA 1ECZA 4KROB 1T0NB 5LQBL 2NY0C 2BIOA 5ISZA 2PWDA 2GJ6E 3I6LD 1P5UC 5FGCE 1JD7A 1YEEH 1JV2B 4AKQA 2XQYK 5C09E 4NDMA 2FR4B 3UG5A 5E6IB 2AW2A 5BZDA 4CU8A 2J12B 3FQXA 2HFEB 1HNGA 4IGBD 1TQTA 5AVSB 3Q8FA 1NCWH 5AKSA 4P06A 1U36A 1YEEL 5DFVD 3KBHE 5IR1A 3QDMD 1GPOH 1HC1A 1N6VA 3A67L 3VG0H 4U3CA 3HNSH 1SDYA 1SXCA 1ZK9A 43CAA 3BVDB 3I74A 3VXTB 1WFJA 1GPOL 3AW5A 1BMZA 4WJ5A 5I6NA 2BNRB 2MKWA 3VG0L 2KHAA 1UENA 2H1PH 2JXMA 3QHFH 3HNSL 4DT2A 1Y6KR 1PPIA 4JS7A 1CQKA 5SWZE 1ZE3C 2XKUA 1K5NA 4KK8D 1A4AA 2W9LA 1QUNA 1NUDA 4YSOA 4PRIB 4WWKA 1KLUA 2H1PL 3HAEG 3NBNA 1QBLH 1HXMA 2WMPB 3GM8A 1JNHB 2FYVA 4F8OA 3NQIA 1OTUD 3DTUB 1GJWA 4HH9B 2F1EA 1XH1A 2R4RH 3CDFA 3IS0X 1OO2A 2CLZB 2Q9OA 4OJYA 3ULVC 4LCCB 2I26N 3FFDA 3SDCD 3O9WB 4BK5A 2R4RL 2X44D 1BZ7A 5B7FA 2Z0UA 4IKNA 4N0UA 1OOAA 1G7QA 4Y5VA 5CEZD 3NP4A 3HG2A 2PETA 4MX7A 1WTLA 4XPTH 5EN3A 2C7UB 4ZPTB 3P3RA 3L54A 1KJ2L 5AG9A 4UBDD 5I30H 4Q9RH 2IDCA 1WBYB 4Y2LA 3RVWD 1E28A 2X1XR 1UXWA 1YY9D 1QBAA 4H1LG 4XPTL 3RZCA 2GK0A 3K81A 3ZZ1A 1XF3B 5AW4B 5C0JA 1BXAA 4KRMB 4EZLA 3RNKB 3LNFA 1ACYL 2VDPB 35C8H 1XT5A 2WIIA 4J1UA 3BAJA 5D2NB 3OG6B 2FO8A 3KR3H 1D5MA 1OGAE 2DWEA 35C8L 4D0CB 4JGNA 1E40A 3QDGB 1GC1C 3PGCB 5DLLA 1TSRA 3MFFB 1FL5A 3MRJB 2FX8H 3KR3L 1FCGA 3DYPA 2YPVA 3RHWK 4Q2ZA 2FWOA 2XHNA 4P46C 4Z76A 3K72B 5EORH 3IU3B 2EO9A 3MV7E 3MUZ1 3SQBB 3B34A 4PGCB 4KNQA 2FX8L 4JFSA 3FHEA 1DVYA 2DM3A 4KXCA 5SV3A 2Z4QA 5KSUA 1W2KT 2ZYIA 3BOVA 4F93B 1ES0B 3VM7A 1A9BA 3GBDA 5B3JE 2QDVA 1E9OA 2O6FA 3HA0A 1EJ8A 5ERWA 4TQPA 5C3TA 1UM5L 3L1EA 2GEQA 2VXSH 4MNGE 2WN2A 5CZRA 1LNUA 3TEYA 5EU4A 4ZUWB 4PIRF 3MCKB 6CGTA 5B22A 5DT1H 4XMTA 1U3NA 5KG9B 4KVCH 2VXSL 3QH3B 5CSGA 2WXFA 5DI8B 2JJVA 3D06A 4AI7A 4K5LA 1NAMA 1DVUA 5T3ZE 4I9WE 2L3BA 4IRSA 1IC5H 3Q9QA 1QEXA 4XMVA 1FLTX 4YVNA 4JPWH 1O7DE 5F3BA 4JQIA 1RJZB 3APDA 4ANKA 4P23A 1A3LH 1MFCH 2AMGA 5DUBB 2ICWA 5FYJD 3SGJC 5D96B 2WXHA 4M4RB 1A3LL 5I1AB 4ZMQA 3IFNH 3MC0A 3QZNA 5KS9E 3TCLB 4RGOH 5JDJA 2JKIS 2C3HA 5FO7A 1J8SA 4LLYA 4UDTA 4BFNA 1AZVA 3FCSA 1JI1A 3ZO9A 5TK4A 1KEGH 5HBBA 1RL1A 3ZSTA 4LF3A 3ZTJG 3BP7B 3V5HB 4EIGB 2P28B 4V11A 4YPGB 3LVTA 2PTVA 4PJ5D 3IKCA 5K93A 2ZOKA 2OS7A 2WBJC 3GJEB 3NA9H 4YWGH 3QUXB 2NYZA 4KDTA 4AQAA 3ULUD 2JCCA 2V5SA 1G1KA 1MUJB 4FNUA 5IVZA 1XIWB 2YK1H 4FN0A 3L9YA 3QP3A 3ZHDA 3EGDA 5HPOA 3NA9L 4KDWA 4CVWA 1MY7A 2XWXA 4GW1A 4GXFA 4DVRH 2Y07L 4HUXA 1QWNA 1U8PB 2YK1L 4GMSH 5EUKB 2YLHA 1FO0H 3SDAC 5JOPE 1YEIH 3U9PH 4FFWC 4ZMYA 2A9CA 2PNDA 1BF2A 2K3TA 1D9KC 4F8LA 3HZMB 1ODAA 4MD5B 3DJSA 3G5YA 4HJSA 1A64A 1GR7A 4GMSL 4GSUA 4LESA 3ZZLA 1FO0L 1NBYA 4AL8C 1IO4C 4G83A 5L2KD 1QZ1A 4NN7B 4XBPA 4MMXB 3U6XA 1UADC 5AW7B 4GKOA 2PF6A 1XF5A 5JQ6L 1CT8A 4L8BA 5DMKA 5F9JA 4G9FE 4YPJA 3MRMB 1THAA 2XBZA 3LIZA 1HVXA 5BRZB 2V7NB 3MRNB 4A04A 1PLBA 5CP3A 2OYKA 3L8QA 3TIEB 3LIUA 1V5JA 4NCC1 5FA3A 2ESVB 5AD0A 3O41A 2NY3D 3CSGA 1J12A 5F1NB 1LGVA 2X0UA 4OGQC 3N1MC 4F33A 2JFCA 3CX5K 4N90D 1BFTA 1J9CT 1GW6A 4L4VE 4N68A 1XCWA 3SDDC 3FTZA 3BSZH 1XO8A 1BVNP 1R47A 1NAKL 5ICUA 2OXHB 1EZVY 3QUMB 5JPNC 4PJ7F 4X2UA 2MHAB 1RZ7H 1JGUL 2VL5B 1AC0A 3BSZL 3QIUB 4FEMA 3OKMB 4GSDL 4Z78B 3AITA 1E27B 3C5SA 1KYFA 2N01B 1IAMA 4OCWH 4PRAA 2PCFA 2IADB 2Y1VA 5DHYB 3BDYH 3DK2A 2EKSA 1RZ7L 1KN4H 3VDAA 2EIEA 1G43A 2LGNA 4K7PH 4HLJA 4OCWL 5LKNA 4MMYA 1VB9A 5D2LA 1T1WB 5C0NC 2Y6TE 3BDYL 5JHAA 4ZMOA 4HK0B 5HP5A 1KN4L 2JJTC 1T5XA 2G2RA 3QQ4B 4X6DF 5KSVA 2OZ4L 2HT3D 3OKOA 3U0PA 5EEYA 4TYUA 2EDXA 1KLFB 5KYUA 1L0YA 1PZDA 1VACA 2OR9H 4MS6A 3A3YB 3RX8A 1L6ZA 2Y7MA 1KIQB 4Y4KA 4P2OB 1F02I 2UZYA 2OMYA 1WRFA 4RFNC 4E9LA 2R0LH 4WTZA 5EOTB 1IE5A 5DD0H 2FYYB 4L0ZA 1P4BL 3V4UH 5KEZA 1T4KA 5BXFA 3IGKA 2OR9L 3NN8A 4F2FA 3UPRA 1HWGB 2J2ZB 1YEDB 4KQ3H 4N2KA 3QNZB 5DJ6A 5GPRA 4K9JA 2F7OA 2R0LL 3LMJH 4PJHE 3V4UL 1ANUA 4OLYL 3SD5A 5T8IA 4HYTB 3SIKA 1GY1A 4KQ3L 3D3VA 3KLLA 5IQLA 2KZWA 4KK9C 3TURA 3LMJL 3TBVA 4B5EA 4P4KA 4ZD3H 5B39A 4N2HA 3GJFA 4UQEA 5T1LB 4R4BA 3CMOL 1FVCA 4TSAL 4JZOB 4Z7UE 5F70A 4JCMA 4OT1L 4XXWA 3MV9A 4G43B 3S4SB 3CQPA 3IDXH 4Z3HA 1MW0A 5K1NA 3TYFA 3ZYJA 4ZD3L 4ERSL 1DO5A 1DSYA 5DEGA 4XN4A 3VFUA 5DJYA 1XF4B 3B5HA 4O2EA 1H8SA 3VI3E 4OD2B 4I18C 2WGXA 5EBWA 4ODVH 3CX2A 2R0WH 5HYSB 3FFCE 2BIPA 4HCIA 4OBRA 4PTUA 4YXKL 1DCEA 4GRLD 3DRQB 2R0WL 3MLWH 3ZTCC 4F2ME 4FG2A 4KI5C 5CAYB 4JFDA 2OMVA 4E9XA 5GGSY 4RSYA 1N3NB 2JQAA 4Y0GA 2IH1B 3TBYA 1SXZA 3EOBA 3GSUB 4WQOA 3WNMA 4V1DE 3FOLA 1R9FA 4DP7X 2OW6A 4XBEH 4AYBA 4FTDA 2E3VA 1BVKA 2ZG2A 4P2RD 3QCTL 5DMYA 3QUZD 4X6CE 5JHLL 2HN7B 4XBEL 4M3JA 4M61A 3HOGA 3C8KA 5BV7B 4TXVB 3QDAA 2BNRD 1XZ0A 2AZAA 1UD4A 4R0LB 5FK9A 3GSRA 2DICA 5BO0D 4GXVH 2PW1A 2YAFA 2COQA 1EAQA 4PS8A 3RU8H 3TIDB 4GB9A 4PR5A 4FMFA 1JYWA 4BUHA 4HCFA 3VGDA 3QHTC 4B7LA 1BZ8A 5LWYH 4LDOB 3UJTL 2AK1H 3BFOA 1A7QH 3M07A 4BXVA 3RU8L 1OE3A 2DYPB 4M4PA 1FV1B 1BFOA 1BLNB 4AOFA 5LWYL 1OSPL 2WAQA 3KS0J 4B3VA 1SJHB 2AK1L 2PMZA 3HI6H 4ZO7A 3B9VA 4NRZA 2NXZC 1KB9J 1N7ML 4U1KB 3O9WD 1BVLB 1X5JA 3DX7A 1PCSA 3E2HC 4QTIH 3ETBJ 4ZX4A 1KTCA 3C09B 3HI6L 1FH2A 4H26A 1GJIA 4XMXA 2L4OA 3ORJA 3TU6A 1HDMB 4AIEA 2ZX8A 5D1XA 2WZ5A 4QTIL 3ARGB 3MRLB 2KYIA 3VO0A 5FO8B 5EB9A 2WQAA 4P59H 2O61A 3BZEB 4YNYA 2R56H 3KLQA 2HG5A 4P8QA 2O26U 2VLKE 2WLIB 2Y7SA 2V9TA 3GTTA 2B5IB 2FQFA 1UZ6E 2EIMB 1AXIB 4JL2A 1LM8V 4NPYB 4P59L 1YEGL 4OLEA 5DFTA 3TA3B 2R56L 3EG9B 4GP5B 2F54B 1QFWI 2CU9A 1UJ3B 1NMCC 4B9YA 3IWUA 3B2VH 4OLUH 2BMKA 5D6CB 1Q0XH 1XGPA 2QADC 1JN6B 3LEVL 5HI4C 3ARDB 3F7YB 1ZLWH 1H5BC 4ZW6A 5IESL 4OLUL 1G7IB 3HZ3A 3QDGD 1Q0XL 3NPSB 3E1F1 1P2CA 4PJ7B 3II2A 5EC2A 3VXME 3Q05A 2EEDA 2ADJA 4U1IA 3DYMA 4O51A 1OSEA 3OAWA 4ZNEA 3LPOA 4IGBA 2R1XA 4JFXB 5CP7B 2CBPA 2V33A 4FNTA 2EDDA 2IANE 2OSXA 3QDMA 4UT6H 1ZVNA 3TASA 3VWKB 3WXWH 5DJXB 3DHPA 4OAWB 3RI5K 2KQMA 3OB0H 3G5XA 4MBRA 5TDNA 1A1OA 1Q9KB 3ZSSA 4QJ4B 3TNMB 4JDZB 4WFEE 2EE9A 3GXDA 1IGIH 3BWUF 1AYRA 2VIRA 4X6DB 5EN2B 3WXWL 4WEEA 2NX5E 1YEJH 3WIHA 4QUOA 4G1EA 4ZFZB 3PWUB 1KG0A 1UOKA 1IGIL 3NFSH 1QLEH 3OR6B 2HKHH 3DUHA 4AQ8C 3INUH 1FVEA 1YEJL 1JZHA 1PFCA 3QS3A 4J8RA 1JUFB 5C0AA 4JPIA 1QLEL 3VFPA 1AOZA 4K3HA 5C0CE 2HKHL 1U3HC 4OH2A 4Z7IA 3INUL 2DLTA 3BN9C 3MROB 1NJ9B 1OAXH 2E9BA 4C4UA 2SEBB 1JGVH 2OTWA 4N26A 4N9GB 4XX1G 5B3JF 1YC8A 3SDCA 3QO0A 3TV8A 3ZDYE 4PJXA 4MJ6A 3Q3GB 2DMHA 1JGVL 3WLWD 1GMIA 1E3XA 1HESA 1GZHC 4G6AD 3ZTNH 1LK3L 5I9QC 2WXJA 4MB4A 4NI3A 1G0XA 1RY7B 5DHVA 3UG3A 2P5EE 4OFYD 1IBHA 2WZAA 3T0AA 3U2SA 3ZTNL 4J3OF 2D9CA 1UCTA 1AIZA 2VAAA 2G5UA 4EI0A 4OCYH 4CC1A 1ZS8B 1VZGA 5FYKH 3UYRH 4F37K 1FG9C 3MGTA 1NCBH 4XI5C 3ZKQD 1AD9A 4JDTH 2A4CA 4OCYL 1LVEA 4L8SB 3D8MA 2YD7A 4Z0XB 1E4XH 1QI4A 3F84A 1NCBL 1QNIA 1RXLA 4JDTL 4KFMA 2A6KB 1K4DB 1I7UB 4I4WB 3ECVA 5KS9F 1CG9B 3VWJC 2WO2B 1PSKH 4DZBA 5B1KA 1KEML 1GHFH 4WWPA 3QUXD 5C0DB 5JQIB 3R7QA 1NGXB 3P9WB 1XIWD 3SKUD 1JPSH 2FJGA 1UT1A 3WNJA 4PBWD 2XBTA 1PSKL 3HCVB 1GHFL 2X1PA 3B8SA 3RGVB 1ZHKA 3FB5B 3UPCA 2NY5L 3D39E 2YFNA 3QG6B 1ONQB 2XIDA 3WMPA 4UTAH 4APQC 4EQ2A 1AGBB 1D2PA 4ZXBC 1PTZA 2GJPA 4MDRA 4ZS7H 1OZUA 3PQYA 4QXTB 2DKMA 5L0QB 3QYNA 1BJ8A 1KELH 4UTAL 1HZKA 4HS6B 2P9RA 2DIJA 1ZLSL 5KYYA 3EFOB 2RR3A 3L3DA 4RVBA 4ZS7L 2GJ6B 3K6SB 1ID2A 5J89A 1IT9H 1KELL 4LHUG 3KE0A 5C09B 4LCYA 5HHNA 1IEBB 3AS0A 4MBOA 5A6LA 4FJZA 3DX9B 3LY6A 5JW4R 4ZDHA 2AEIT 1IT9L 4AYFB 4RCAA 5BRZD 4AM0A 3CPUA 2G4EA 3WJJA 4LLWA 4WNQB 4ETQA 2ESVD 2HKFH 1YC7A 2J8UA 3RTQD 1YECH 4NO5B 4FA8A 4HZAA 5D71L 4CGTA 1Q94A 1ASQA 2F08A 5CJ8A 1IVTA 1BIIB 1OT2A 3HVNA 4WI0B 2HKFL 4JG5A 2GCYA 5SWZB 3CFNA 5CWSB 3P54A 4Z77B 1AGDB 2AJVL 1INQA 3NZ8B 3AVEA 4G42A 4ONGH 4NO2A 1F1GA 2A9NH 3X11B 3TVMB 4FZEL 2FDBP 4JGJA 2AVFA 2RFXB 2V5YA 3DV4B 3OGCB 1J18A 1DJWA 2AEQL 4HWZA 1YSOA 2ZCKH 5IOPA 5F7AA 1JRHI 1DVFB 5ALBL 4JHBA 2A9NL 4PWJA 4HWNA 5I17B 4X4MA 5A7EA 1AMXA 3VB8A 4RZCA 4LAQH 4QI3A 4QHKJ 4ZTPH 2BNUB 3CJJA 4PJ5A 4HKZA 1HOCB 1D6EB 4TNVF 4MA8H 2KBGA 2CO2A 3QWOB 3EDJA 3Q7JA 4IU3A 2OK0H 2YWYA 4ZTPL 1JZ5A 3FO1A 1MRFL 1CFSA 4FQ1H 5C86A 3UTQA 1W72B 4KGLA 4P2OD 4OIFA 4JHZA 5FYJU 1TVBA 1LILA 4HZ1A 5T1DL 4JRXE 1I3RA 4BV1A 4G8FB 4OJDH 5FF6B 2OK0L 5I8EB 4FQ1L 3NJXA 1IGJA 3I50H 3D33A 3UYPB 3GXIA 2FUTA 3AACA 1AZRA 4OCRH 2FLRT 3OKYA 5I1EH 3PIQA 3WGUB 2JVUA 3BPOC 4J3SA 2ZONA 1BXXA 3F05A 3I50L 4JJ5A 4FA6A 1OGAB 3QRBA 4OCRL 2R1WA 3OF6D 2VUYA 5L2KA 2OW7A 1WHOA 3WN5B 5I1EL 1KTLB 3G6AA 1X4ZA 4MAYC 2YPVH 4IDJH 4JMXA 4IJ3C 5HHPA 4WI3A 1TF4A 3G04A 4W81A 2NNCA 4PJHF 2J25A 4RMWA 1FIGH 4L1DA 3LZOA 5DWUH 4M7ZC 2YPVL 3H53A 4F7KA 4IDJL 2AJYH 3NCYP 3V5DB 4TUOA 2NW3B 1U8LB 5AYTA 3MZTA 4NFDA 4DKEH 3CHSA 5CJXC 5J6GB 4JFHE 4UTCA 3RFZA 2CBMA 1KTDB 5IGXH 4Z7UF 3IDGA 2AJYL 5KJ7E 2QZ5A 1BBJA 5FDWB 2XNAA 4DKEL 3RWCB 4MNGB 1A6TB 3VXNB 3TN0C 1ZRUA 1U8CA 1LLAA 1MNUH 3VI3F 1DDHB 2QQLH 1F45A 2N59A 3F64A 3QI9B 1IKNA 2C9SA 3QJTB 3HE7C 4XCCH 5DR5L 5FDYA 3ASNB 4N8VB 4F2EA 5AQ0A 4LL9A 4RA3A 1NAMH 3UC2A 5HJ3A 4TULH 5LBGA 4ATWA 5KYNA 3VW3H 2O5YH 3DLQR 4NBXB 2XG5A 4KJYB 5CGYD 1T7WA 2L7QA 4W9IC 2JQMA 3ISRA 1KCLA 3NCJH 1NAML 4TULL 4LSQH 1NM9A 3QNXA 1U8MA 1FG2B 2WZPD 4M8UA 5ES4B 4NZJA 1CFVH 5I2IB 3DOSA 1WF5A 4S1SL 2KS0A 2WWNA 4JQIL 5KS9B 4HKXA 2OI9C 3O6KH 3JTBA 3MBEC 1CFVL 2P24A 4B27A 4BSWB 2DYSB 4W9EC 3ES6B 1ZGLP 4F7PA 4DEUA 3BUIA 2BHFA 2DM4A 3O6KL 4B9PA 3PY9A 2E6PA 7TAAA 1EIBA 2FTAA 1FE8H 3BIBX 3TO4B 3GMNA 2BSTA 2FATL 5DLMH 1F6LL 2C1PA 4NQTA 2NW2A 1JFQH 3T8XB 4GKSB 4ZUSB 1VZHA 3FQUB 5DLML 4Z3JA 1E9QB 4Y7MA 4V2BA 1JFQL 2WQ8A 1MHPH 4J3TA 3IGLA 3B56A 1P84K 5C08E 4ENZA 1I8IA 4NO0D 4IRZH 3D5OF 3N85H 4FNLL 4PV9A 1T6BX 2JK5B 3WKQA 2AEPH 3UDWA 3ARGD 4NS0A 1MHPL 1MLCA 3ZVVA 2D31B 3MLVH 4GMTL 4OF7A 1I1AD 4KY2A 2AK4D 1OLLA 5DJ8B 4Q4EA 3N85L 3D69B 4DHLA 4OFVA 5C8JB 3WL9B 2ZKHH 2AEPL 5T33H 1TZHB 3TH2T 3O8XD 5ENWB 1AZNA 5I82A 3TA3D 2Z7WA 5F89A 4GRLA 4TLUA 3OV6A 4N3UA 2QGBA 1S7RB 2ZKHL 1SJEB 4H0GA 4O4YH 4TV3A 5CCGE 3IS1X 5AEAA 3Q6FA 3VAEA 2YUWA 3TWCH 3MLYH 1IZKA 2C9XA 4X7TA 4Y5XA 3KS0H 1VDGA 2VKXA 4YBQC 3VGAB 3GT6A 4I1NB 4BEIA 4XAWH 4OCLC 4XNAA 1T0NA 1U8NB 4O4YL 1OSYA 4B9FA 1BCIA 4U6XB 3RZWA 3MLYL 2VMJA 1XGTA 3EW3B 3LIZH 4KVPA 5CGMA 4BQCA 3THML 4M8VA 2ZF8A 2FR4A 4XAWL 5CP3H 5E6IA 4X5RA 5GGSB 3UAEA 4Q6IC 4HUNB 4L8DB 3STBA 2BSBA 3EH2A 4ZT1A 5AZ2H 3SODB 5C0BB 4KMTL 3LIZL 4XMPH 1Z0NA 1I8UA 4L4VB 2ZOUA 3VWKD 1UC6A 2HPOA 1FJ1A 1X5LA 4A2HA 1KPVB 2HZHA 4P2RA 5LAXB 3EGXB 4X80H 2FHBA 3MRDB 5KVDH 3GEWB 3QUZA 5D1ZC 4Z3EA 2G9HB 4XMPL 2CCLA 2C9QA 5JXEC 1WA2X 4ZMXA 2D7QA 4Y1AE 2BNRA 2E47A 3HRPA 3MLXH 4X80L 2MCG1 4AG4H 3QXTA 1BYOA 2BRQA 4HJTA 2W0PA 3DETD 3ZW3A 4HWUA 4L37B 3MLXL 1RK0B 1CB4A 1S5HB 2WMPA 3U4BH 4AG4L 1JNHA 5EF1A 3GXPA 4HH9A 1L4IA 1FC2D 1G9NL 3MRRA 3QXWA 2O5ZH 3EOTH 2CLZA 4LCCA 1W0WA 4X9IA 5F7EH 2IC2A 2VSMB 3O9WA 3LPPA 3FUIA 6PCYA 3GZKA 1BZ9A 2PP7A 1F3DJ 5L7XH 5F7EL 3MUHL 5ITBH 1MIMH 1CXKA 1BZDA 2Q7NA 4QMEA 3OMIB 5HGAB 2CLVB 2C7UA 4PCTA 3W0WD 4ZPTA 3HC4H 1RHHB 4PJHB 3GI9L 1WBYA 3UGEA 4NWTH 3LKPA 1TJGH 3I9AA 3HC4L 1XF3A 4WUUE 4XO3A 3VSUA 5EC1B 3ZDYF 4OJAA 1S8DB 3MRKB 1Z32X 4PHXA 5IJKC 4Z7UB 4RDQF 1XEUA 1TJGL 2AKRB 5D2NA 2D03H 3RIAK 5EBGA 1KXTB 4Q7DA 4XGZB 2O4EA 4BFIA 3QIWC 1YG9A 4D0CA 5K9KB 2OYPA 2ZP0T 3QDGA 3QYMA 3PGCA 2D03L 1OTSC 2FEJA 3MFFA 4WDIB 5D7JC 4LLDB 3VI3B 3MRJA 5GS0H 5DK2A 3BSHA 3N1FC 3K72A 2BVOB 1FL3B 3VA2C 2CIKB 3IU3A 3FFCB 4JANB 4DTGH 3GSWB 3SQBA 4PGCA 4FHBD 4BFOA 3G7TA 2P3YA 2OYLA 5GS0L 3W5NA 4G6ML 5ACZA 4OI7A 4E2OA 4DTGL 1X5FA 5DVPA 2XTJC 3REVB 5KBMA 3SE9L 4LRNL 2JJSA 1HSAB 1ES0A 3VA6A 4EN3C 5HTSA 5E6ZA 4KKZA 3KYAA 5DHXB 1P53A 2MQGA 2EUWA 1XFPA 5FYLE 2GJ6D 3AS3A 3QEGH 2F7RA 3C60C 1MVUA 2GEEA 3BKMH 1IIKA 5C09D 1ZHBB 4LFHD 1I85C 2VOTA 2XXCB 4ZUWA 4A2FA 4V1DB 3MCKA 4HW6A 4JFUA 1F6AB 5KG9A 5F7KC 5LGHH 3QEGL 1LO0H 3Q2VA 4I1RA 4XB8A 1YUKB 2GUOA 4GFXA 4X99B 4TMPA 1X7QB 4GAJH 4OB5L 3HC3H 1U4FA 3BN3B 5LGHL 1OOWA 1YMHB 2XCMC 1B0GB 2VRQA 1RJZA 4WFGD 4GAJL 4ZFOA 5E2VH 3LN9A 5DUBA 1U42A 1QSEB 4XNMB 3UAJC 4CMMB 4AC4A 2DQHL 1JCVA 1U6AH 3HR5B 1FFQA 4M4RA 5DURD 5I1AA 5E2VL 1AGCB 1S78C 1CL7I 1T2JA 1JF5A 4OFYA 5T5NF 1NCUA 3PHSA 4LCIH 3T4AC 4BXSV 4JK0D 3TVMD 4R26L 1LWRA 1U6AL 4S1DD 3BDXA 5J12B 1MWAB 5LXGL 4NQCE 1DVFD 3BP7A 3NZHH 4LCIL 4U1LB 3VSQA 3IAQA 3F5WB 4I3GA 2FJHB 4FYTA 1TPXC 1NM4A 5GRVK 3PHAA 3L7EB 3NZHL 3ZY7A 2VW6A 1KV7A 4LASH 4HOMA 4XCNB 1BM7A 3GJEA 5K59E 3VGHA 2WTPA 3RVTD 3QUXA 3A6BH 5FGRA 5BW7A 5EU5B 1MUJA 5GISL 1EFXB 1XIWA 2LLNA 1A1MB 4G3YH 1MXDA 1CPUA 2Z8VC 5E2UH 4FX5A 3LHAA 5FW8A 3GLAA 1H3WM 5EUKA 4G3YL 4H4NA 1GTNA 3WIIL 5E2UL 2WV3A 3S3PA 4BK5C 2EZ0C 3HZMA 5DC0A 1ETZA 1IILE 4XCEB 5CUSH 2LVEA 1O0VA 1UA7A 4Q9CA 1YPZE 1BVZA 2CJSA 3QJXA 4AY0A 2DH3A 2L0DA 2W9EH 4Y5VC 4WU7A 3HHSB 1UA6L 3LXAA 4HDIB 4HS3B 1GGIL 3UBXG 2F1AA 1UUNA 4QXGH 3GXFA 5CUSL 4ALAH 1AR1B 5JHDE 1J5OL 2P26A 2QVTA 1H9VA 4MMXA 4UNIA 2W9EL 5LO7A 3SOTA 3GIVA 4MA7H 3ZBMA 4QY8A 4QXGL 5EMYA 4ALAL 2MKLC 3RZCC 3AWFA 3K71B 3MRMA 2J1YA 5INDB 2IANB 2HWZH 4QOKD 1NFKA 4ZX6A 5BRZA 4HG4K 3TPKA 2V7NA 1EWHA 3MRNA 2CCWA 3JWOL 4LO9A 4ZAKB 1I3GH 2X3CA 4ACPA 3KL0A 5FW7A 4FQ2H 3M7FB 2ESVA 3NA4A 2GB2A 2BFVH 2F8IA 3RNQB 3RTQA 1DBAH 5F1NA 2FUQA 5CN2A 2HWZL 5I1HH 4RESB 5DJAB 4DQAA 1SHMA 4W93A 2RHEA 3ME0B 1I3GL 1MCWM 4JO1H 3WTUA 1UB6A 4FQ2L 4GP8B 3WIHH 2BFVL 4ISVB 5DQDH 5HPMA 5I1HL 1Q4NX 5C07E 2D7TH 4E9TA 1I9EA 2VLRE 4WGKA 2OXHA 3QUMA 1FA4A 3I3BA 5DMGD 3CFIC 4W70A 5A2AA 3GHBL 2MHAA 3R1GH 3WIHL 2PTTB 1PGRB 5DQDL 5F9OH 3QI9D 4UZSA 4Z78A 4G9DA 4FNRA 3QAQA 4P3CH 4HEMA 2IADA 3H9ZA 5DHYA 4BBWA 2EE0A 3R1GL 3KPSE 2ADYA 4E9YA 4TQIA 3IU4H 4WW1B 2HJFB 4LPWA 3ZDYB 4H2AA 5LJYH 4P3CL 4XN2A 3OKDA 1T1WA 3E7JA 1CIDA 4HK0A 4B96A 3QORB 1P1ZB 1J0HA 4YZFE 4AK1A 3QQ4A 2I07B 3IU4L 4ZPVB 3MUGB 5CEZH 4NHCH 5C6TH 1KLFA 3TTYA 3FSWA 4QF1B 5LG6A 4P2OA 4LLMA 5DHVH 4QYOB 2CO4A 5CEZL 4NHCL 3UIZA 1E3ZA 1VCAA 1TUPA 1VERA 2J2ZA 1YEDA 5H4ZA 1PZBA 4IRSC 1QSFD 4CBPA 2YOCA 3W82A 2CKBB 2AMUA 1MHHB 3L4CA 4P23C 1KJVB 1KXQA 4PW4A 5AZEL 3OKNA 3TWYA 2VAJA 3MBWB 4K73A 3BX7C 3DVGB 3OF6A 3QWRD 5EPMA 4NRYA 1UHVA 4HIEB 4JZOA 2TRYA 3HI1B 3JWNH 4G43A 3K80A 1HHGB 1K8DB 2VR7A 3HEIB 4JPVL 4L1TA 2Q1EA 1B4TA 2HMIC 1T5KA 1XF4A 4MCYB 5DD1H 2DN7A 4F92B 1CLCA 3PWVB 3KG5A 4Y2OB 4OD2A 4Q4IA 5TH2B 5HYSA 2KDGA 2VN3A 3JUYA 5DD1L 4UYPA 4PREB 3J7HA 4HWBA 5K9QG 2COVD 3DRQA 2KI6A 2B14A 2APTA 3L4YA 2XU9A 4Y4FB 3T6WA 4E0RB 2WXQA 3DHUA 5DRZB 2H6OA 1N3NA 3FNKA 2EKJA 2J4WH 4OUUB 1A3QA 3QISA 3ZDZE 2PCYA 2W1NA 2IH1A 3E8UH 3V95A 1IV8A 4RMSA 5HJGA 3GSUA 4JDEB 5EFIB 2FLBT 3LPWA 2N56A 1N5YH 1A7OL 4YSSA 3E8UL 4YHLH 5C0BD 4ZBJA 1RURH 4FKKA 4YFLI 4GAYB 1GGBH 2X38A 5I0VA 3BGAA 2WZPA 2X9XA 3G5WA 4YHLL 1E5YA 2Z92B 4OZHB 1A6VH 4PPTA 2HN7A 1DLFH 1CE6B 4OZIB 1GGBL 4M02A 1JNJA 1KCBA 2Z8WC 2LV4A 4R0LA 5DS2A 5FYJL 5FXCH 1NWPA 1A6VL 2ARWA 4QRUB 3SO3B 3TIDA 3ZMEA 5B1JA 3BH8A 4XVOA 4RWYH 1AC6A 3ALPA 3HN3A 3BVTA 5F7MC 2DYPA 2JMRA 1U93A 3CCHB 1FV1A 5KJ4A 2N0MA 1ZLWK 4RDBA 1SJHA 5CD3A 4M7KH 1RZJH 5I8CB 3UACA 4U1KA 3V7AG 4LGSB 1U2CA 4FJYA 1UWGL 3VGGA 4LLQB 5M95B 3VACA 3RWGB 3MRPA 2A6IB 1CF8H 2BP0A 1RZJL 4JRXB 4NO0A 4X5LA 1HDMA 4RRPM 1CGVA 4DP8X 2VSKB 3ULUL 5FO8A 5JIPA 3ARGA 3MRLA 4X4XB 1WAEA 1CF1A 3BZ4B 4OGAC 3ZMNA 2XWZA 3KYNA 5DS8B 3BZEA 1CF8L 1OF2B 3E1ZA 3NRQA 2AK4A 3OB0K 4O2CA 4HIXH 4UT9A 3OQRA 2JKNA 3T6XA 1MI5D 1X5GA 1GOGA 2X6UA 4NPYA 4H8PA 3O8XA 1U2HA 3TA3A 1BVOA 2IDQA 1CVRA 3LXCA 1UJ3A 3RB5A 4CA4A 3SCMD 4BA0A 4LEBA 4Y4KC 4DW2H 3HRZB 2BWQA 3IJSB 3F7YA 3ESPA 1G9MH 5J4MA 3GKWH 3CDZB 4BWTA 1G7IA 4UOW1 2CNZA 4MNQE 4PV8B 4XB3A 4Y19E 4DW2L 4G72B 2X4UB 5ID0B 4PJ7A 2MH4A 2O72A 5JW3H 1JPTH 4QWWD 5D4HA 4WCYH 1G9ML 3GKWL 2EADA 1T1XA 2KERA 1D5ZB 3EGSB 2E6QA 3E80A 1XGZA 5JW3L 2ETWA 1QAWA 4K9EH 1JPTL 5CP7A 4WCYL 3FMGH 3KAAA 5GGVY 4P4KC 3VH8G 3VWKA 3DX6B 5DJXA 2ID5A 4IBSA 1PLCA 5F7DB 3UL4A 4OAWA 3BRFA 1L0PA 3DX1A 3FYIB 4XXWC 2V3DA 2CK0H 2GQHA 4FG0A 4JDZA 3E9TA 3RWJB 2QVFB 5JO5B 4WTWA 4X6DA 2AQPA 1OPOA 5EN2A 2YMXH 4KKCC 4ZFZA 5EEVA 2A0LD 4G82A 2CK0L 4AMWA 1RVFH 3F7RA 2W9DH 1G6RB 3H9YA 5F96H 4DF9A 5GS0C 4AKOA 4M5ZH 3S35X 4FTVD 2YMXL 4N2BA 1WHPA 4BZ1A 4XVUD 1QRND 4R5TA 1MSPA 3AG3B 1RVFL 3WIAA 2W9DL 5EDXA 1YNKH 2ZUWA 4Z7WE 5C6WH 4M5ZL 4OZFA 2W0KA 2ALWA 3MROA 3ALWA 3ZKXB 3RPIB 4YBLC 1NJ9A 2SEBA 1B3IA 3SE8H 3IXTA 4PP2B 4JFYB 4N9GA 1YNKL 4MXQD 5F7YC 3TESA 2EDNA 4HX1B 3Q3GA 4GQRA 1EQWA 5DJCA 1ADQA 2FT8A 2V3FA 1RZPA 4PTTA 4JO4H 2GVYA 1MCNA 1QSED 1XX9C 1SN5A 2ZCHL 4N87A 2R69A 2ZKYA 5FGBA 3W0WA 5JOFB 2RIKA 3GBEA 4PHZA 4UUJB 3B7SA 1TG8A 3W9EA 3DX4A 1AYOA 3BZ5A 1WVZA 1ZSDB 1ZS8A 1QBMH 3ESOA 3KDPB 3K5RA 3VCLA 4WSJA 3NIDE 4HETA 4NRXB 4AENB 2IBZY 2FHFA 2QKIA 4UWQB 3RVUC 3TS8A 3CN1A 4Z0XA 1QBML 4AJYV 3G3LA 1WZKA 3V4VB 3O2DA 4L9LB 1G7LB 1I7UA 1K4DA 5DEZA 3EKCA 4C56D 4ZOEA 4PN6A 3VQLA 1MJJB 3BVVA 1GGUA 2PO6B 3D4CA 5C0DA 1F11B 1NGXA 4N2MA 3N50A 3FQWB 5BRPA 4G8EB 1OAQL 3S88H 2HXAA 3SBWA 3UOAB 5IEHA 3EFDH 3RGVA 4WGWB 3BPNB 3JXAA 5IKCB 3FB5A 1T80A 4P99A 5HI3D 2BNQE 1A6ZA 3LPGA 3B2UD 3QG6A 4LSVH 1I82A 3BE1H 4WEUD 2FWUA 2ENYA 2E8YA 3NQKA 1MY5A 1AGBA 2H45A 2JLLA 4Z95H 1WFMA 3EFDL 5MEPB 4CAGA 2B4CH 4PRPE 1ETB1 4FOMA 5DFAA 4HIIB 2WZ0A 4QXTA 5K59F 4NOFA 4LSVL 3TPUB 4UAOB 1CVSC 3BE1L 3MA9H 4HHAA 4L0YA 2YRBA 5HHOD 1C8QA 4HS6A 5AFAA 4LEOB 4Z95L 1IFHH 3QCVL 2B4CL 1DQVA 2Y4SA 3EFOA 1V8HA 4HH8A 5DVNA 1RZKL 4EPSA 1AR1D 2GJ6A 2Z93B 2IWEA 3K6SA 4GQ9H 4XBMA 1XEDA 3GSOB 1FFTB 2PR4H 3N40F 5C09A 5I74B 3E9UA 4Z0BH 3ZXAC 1IFHL 2YD3A 4E41D 1AO7E 3WFCH 3DX9A 4H8UA 1C5CH 2IMMA 2K1MA 1WJ3A 4GQ9L 5IW3A 3HS0B 4OIIL 2DQFA 2PR4L 2VNCA 4DP0X 1CGYA 4Z0BL 4WFFE 2EYSA 4AYFA 4CRPA 4FG6D 3WFCL 1HH9B 4WFHE 4Y8DC 1YPZF 1SHXA 3P4OB 4ZAKD 1C5CL 3T0EC 3FHQA 4JKWA 1E4WH 2Y1ZA 3KPNB 2XICA 1J9TA 2HFGL 2VUKA 3F6LA 5H2BA 1E4HA 5T1MB 2RQEA 3X3FH 4PCKA 4ALAC 1BPLB 2JB6B 4MSWA 4U1GB 4XP4H 5SWZA 4Z77A 1E4WL 3T2NL 3B3IB 2NY2C 5A2JH 3X3FL 1HT6A 4LXFA 2ED9A 4XP4L 3TVMA 1Z3RA 5C7XH 5DFVC 2RFXA 2CAKA 1SYSB 4RFEB 5ICZB 3Q5OA 1DVFA 3E0GA 3CK0L 4LSDA 1RIVH 2W0FB 4AQ1B 4OZ4B 3HNVH 4KITB 5C7XL 3EHBB 4QJ5B 4LVOC 5JORB 3QQ9D 2ZUXA 3RBSA 2BNUA 3HLAA 4TVPH 3CN2A 4BKTC 2VDQL 1HOCA 3HNVL 1G5GA 1GZPB 2GIYA 5AUMB 2Y7LA 3BO8B 1QHQA 2J55A 4NQXB 4JAMA 3P4MB 3N6YA 3MJ8B 3RL2B 1LP9A 3ZRSA 3GQFA 1A9EB 1J9SA 1W72A 1Y6MR 1E6OH 5D7KD 1WGVA 1H3VA 3UBGA 4R6UA 5FF6A 4A6YB 5I8EA 4U3SB 4D8PB 1R5IB 1E6OL 2AHIA 3UYPA 2V7HA 3PXLA 1HX0A 4KO5A 1TQCB 2VDPH 4PMFA 5AB2A 3K4ZA 4NC0B 1FBIH 4MB3A 4YZFF 4B9CA 4L0PB 1EHXA 4OIBA 5ABDE 1OGAA 1UWYA 2A5UA 2C9VA 1V3JA 4Y9CA 2P4AB 5A2BA 2VDPL 4L3EE 3WE6A 3WN5A 1FBIL 1CFBA 4IQHA 3CFBB 3K6DA 3KCPB 1M53A 3ZR6A 4C4KO 4R8WL 4UBDC 1TLKA 1FPTL 5C92A 2BWIA 3RVWC 3TBTB 3W38A 5CCJA 5BRQA 3MGOB 2E9IA 4FQXD 4EE2A 4QOKA 2QSQA 5DMJB 3L4WA 5FO2A 2OCCB 4L18A 2VRKA 3V5DA 5C3IA 2NW3A 1U8LA 1JDDA 3H2WA 2QKSA 5J6GA 4AMKL 3EJTA 3MNWA 1CXFA 3V6OA 5GHWL 3RIFF 1C5DA 3W11D 3PPEA 3G9VA 1JVLA 5FDWA 5MI0B 4OV5B 1IL1B 3ARZA 3QARA 3VD2A 1HWHB 1BF5A 1JK8B 3JWNC 4LKCB 5ILTH 4IBWA 4K8RH 4FLHA 3EYSL 1AI1H 2UXVA 4HK3J 4R3SB 5K9JH 3V0WH 2B1HL 3VXUD 2WXPA 1DDHA 1ND0A 4LOUD 3QI9A 5JA8B 5K9JL 1IBZA 2TRHA 4N8VA 2VUOA 4I0PD 3V0WL 4YO0B 5D4JA 5E6UB 5FHAL 3Q8EA 1VAHA 3HZKB 4XCYB 1N59A 5F1SA 3FN3A 3KYOB 4QHUA 5AOJA 4OFQA 2D3JA 3C08H 1XGRB 1Z5LB 2DMGA 3UO1H 3UXFA 1FG2A 3BAKA 3FU7B 1ULVA 4TNEA 2RQ8A 3PHOB 2XYBA 5I6PA 2NY7H 5C0RH 3C08L 1H15B 1NPJA 2WAHA 4PCYA 3ZDZF 2KT6A 4ZFOL 4DIXA 3BPCB 2IJ0C 1NCAL 3TONA 1YDPA 2NY7L 3X3GH 5C0RL 2A38A 1RFDH 4NQCB 4B60A 3KPRE 3WJJC 1QSFA 1FLRH 1KXHA 5I71C 1WEJH 3SGEH 1MREH 3X3GL 5AW0B 2Y7NA 4Y16B 1XF2A 3AG4B 4C55A 1S9VB 2D3LA 2YEQA 3BGFB 4NLAA 1MREL 5DVKA 5KOVC 3CFKA 5J5EA 2HP4A 2ZUYA 3QWRA 1MHEB 1KB9K 3BAIA 4PI2A 4ZUSA 1OALA 1H9DA 5B1BB 3UEQA 1T22A 2AC0A 1E9QA 4WHYH 4HBCH 2BOCA 4PRDB 4UOZA 2E7HA 2JKWA 2L7JA 4NKMA 4YQXH 2R9HC 2YLKA 3GSQB 3Q1SH 3RDJA 2JK5A 4BH7B 1MFUA 3WIFB 4HBCL 4HF5H 8FABB 4A55A 2N0KA 2QELA 4HGWA 1NINA 2D31A 1A1NB 1N6UA 2RACA 4JFPA 3U9UB 5C8JA 1CICB 4BYHA 3WL9A 1MCRA 4HF5L 4KNTA 1WWWX 1YPZB 5L9DH 5ANME 1YA5A 4AM0Q 3P0VH 1RZJC 1BVNT 5AW9B 4PFEA 2XPGA 2DL2A 3MRGB 2XWCA 2NSXA 5JHDB 1P0SE 4NZ8A 1SLWA 4A7VA 4B53A 1NTDA 3BAXA 2E7BA 2K8QA 3P0VL 2JLPA 4FL4B 5HD8D 2EXYC 5IB5B 1FZJB 3GF8A 3QC6X 2NY0D 1U8NA 1RCYA 1V3MA 1F4WH 1J8HE 3CG8A 3U30B 1DJIA 1FFPB 1N8ZB 1M7IB 3GSXA 1ZAGA 5JW4Q 2GTZB 4XX5A 1ROWA 1IBYA 5GGSA 5HVFB 4L8DA 2QGDA 1F4WL 1PG7X 2Y7QB 3HJ0A 3IDNB 4M8QB 5C0BA 5LUMA 5AAMC 4CKVX 3SB3A 5ADPH 4WTZG 1YN7B 3C6LB 3IJHA 1KPVA 2VERA 2V3EA 3SZKC 3EGXA 3MRDA 2JQZA 2G9HA 3ATDA 1G9MC 5CCKH 1NKOA 3QUMH 1U95B 2ZAGA 4XNQB 1QTSA 1CLYL 1U8OB 1UH4A 3B9KC 3IJ9A 1P4UA 3D25B 3MJGX 4LOVA 5HGHB 5CCKL 5IEKB 2J20A 5B39G 3L3GB 3QUML 5FKPB 3U46B 1YMMB 5D93C 4L37A 2CHXA 3N91A 1RK0A 3PUUA 1S5HA 2NY3C 4K9EC 3RFZC 3FAWA 5BOPA 2Q3XA 3WDJA 3ABMB 1C12B 2OXGA 3GD1C 1R3IH 3ULVD 4Y9EA 2CHNA 4POZD 4NUJB 5F72S 4AV5A 4G8GD 5DVLA 3A6OA 5CBAB 2R7EB 1EZVX 1F8TH 1IKNC 1IC1A 3US9A 4TUKH 3ZZQA 2PPFA 4O02A 1BD2D 1C5BL 5HGAA 1ESOA 1TTRA 4KX8A 3CZFB 3F6IA 3GMRB 4Z7WF 1ZLEA 1RHHA 1F8TL 3JTTB 1TMCB 1FNHA 1REIA 3NZUA 4PJHA 5IJVA 4TUKL 1JOIA 2XQYA 3VU1A 1S9YB 1MI5A 3CLWA 4YSQA 4X4YB 3M1BB 4HLZH 2L7UA 1OB0A 4B9GA 3MRKA 1OM3L 1NEUA 1IAIM 2B3RA 4S1RH 3M7OA 4Z7UA 3SCMA 3VRJB 1TQWA 2AKRA 3OPZL 2EE3A 4HUWB 2W5PA 1A14H 1KXTA 5DVMA 2A77L 4Y8AA 4S1RL 3C5XA 3MR9B 2WQVA 2XV2A 5K9KA 4XVJH 3CC1A 2GSGB 2YC1A 3G5ZB 3O2WL 4WDIA 4YDZA 1A14L 4LLDA 3FB7B 3WHE1 1JZDC 3BD4A 5EU6E 4KHXH 4YSAA 1OGPA 2BVOA 1FL3A 1AH1A 4XVJL 1QFPA 3R06B 2JELH 4JANA 3NIDF 2VZVA 4JRYE 2MPVA 2ICEB 4KHXL 4YHKH 1AANA 2DMKA 3S35H 3VE0B 4HWBH 1KFGA 5E6RB 5IW1B 2IGTA 4HALA 4Z7QE 1KBBA 2FBOJ 2ZICA 1HSAA 1V10A 4ODUB 3S35L 3IF1A 3DVNB 3LXBA 3QCUL 4HWBL 4N6RA 2BM3A 3VX0A 4X0KB 1CDGA 3KH3A 3ZDZB 5MENE 1TZGH 2XKNB 3UDWC 5C1MB 1UTDA 2EDWA 4GI9A 3OQ3B 3W39B 1ZHBA 5F6HJ 1UCBL 1IBBA 1QRNA 3F7LA 4V1DA 5IFHH 4C59B 1TZGL 4H0IA 4UINH 3U7YL 2DQGH 5AG8A 4J5VA 1XCQB 1CUOA 3QR0A 1U58B 3SQOH 1X7QA 3GBLA 4GRLC 3T65B 2B4CC 5IFHL 2EDQA 2D7OA 4QHNA 3LKRA 4MDJB 2WLNA 1B0GA 3NABH 4Y5XC 5E8PB 3SQOL 3TLRA 1CXEA 1XR8A 3HPJB 3Q8BA 4F1SA 4JM2C 2W91A 2VLJE 4K2UH 4BSVB 5BV7H 3A22A 4KROC 3S37X 5IUSA 1QSEA 1G4RA 4XNMA 3T0BA 4A2GA 3NABL 3HR5A 2XA3A 2F58H 4K2UL 1BZOA 5IQ7H 5ECGA 2YZ8A 5E6IC 5JIMA 4G1MB 4ODXA 3ROLA 4BQBA 4ELMF 1KIUA 4GI8A 1SM3L 2QTEA 3C9NB 1LD9A 3FSOA 4FLOA 2F58L 1MWAA 4A1RA 3MZGB 4DP5X 5IQ7L 5M94B 4OCMC 3P0GB 3LS4H 4U1LA 3F5WA 3PS6A 5LCVA 1YY8B 1NEPA 3GMOB 3DX2A 1FAIH 1TTUA 2KQNA 3L7EA 4Q0XL 5FECB 5GIRB 1BF8A 3LS4L 4U6TA 5E5RB 5F2FA 1QR4A 2G60H 4OQTA 2WBJD 3N9GL 4XCNA 4XAKD 5AVQB 4C56A 5B7MA 5KYXB 5EU7E 1FAIL 4EO5A 4IIQB 1F42A 5EU5A 1MCKA 1O7SA 3SJVE 2C8NA 1A1MA 4Q6YA 2G60L 4HGKC 3GRWA 1RU9L 2YBRB 4UT9H 1A4CA 2X6AA 1CMOA 5F7FA 2Z34A 3DGGB 1CZ8H 1IM9D 1JD9A 4RGMB 4LCCC 2AXJA 1D9KD 3LEYH 3TBWB 3O9WC 4UT9L 1YNTF 4N2IA 4M6NL 4OW6A 2KZBA 4GSRA 4PLJC 4KU1A 3O11B 2WJ7A 3NDZE 3HHSA 4HS3A 4BUQA 2FRGP 4Y19B 4PJAF 5LVEA 3UBXI 2YJLA 4GEJA 4KOBA 3PV6B 4XVSH 1PCXA 3Q2WA 4XXCC 2BERA 2D2CC 1HCYA 3QJFB 4E41A 2QMKA 3MKKA 4JZJB 4ZTOH 1RUPH 3ATBA 1OCWH 4N0CD 3K71A 3BISA 5INDA 5I1KH 1Q38A 3MMEB 4R83A 4ZAKA 4ZTOL 4GXUN 1RUPL 4NIKB 5I6MA 5D2NC 3RNQA 1SEBB 2AJZB 5I1KL 4IBLT 1T0MB 3ME0A 2X0VA 3QRLA 4H0LC 4QXWA 2BHYA 4ISVA 1N12A 2FJUB 4OVVA 3X1EA 3NSDA 3DRTB 3VXPB 4U6VH 4MLSA 3APMA 4BZ1H 1S3RA 3RX7A 3S8WA 1I9IH 5A2IH 2PTTA 2P8MB 2GSIB 2WCSA 5A16B 4Z7WB 1BW8A 3HMWH 2D7NA 4KO9A 4BZ1L 2R83A 4JFTA 4N25A 5TE4H 1GYCA 3EO9L 3JWNG 5EBLB 4WW1A 2JJSC 3UTTE 1A2YB 4TNFA 3D52A 2UZIH 2NUPB 3HMWL 3MFGB 1DDTA 2BIQA 4N8PA 1HQ4B 5I18H 5H8DA 4K8RC 1ADQH 5F7LB 1MIEL 4W9GC 5J1SC 5IMOB 4YS4A 5JZ7C 1ZHLB 2UZIL 1FYHB 2VN7A 2X2YA 4FI6A 3DURA 4KQ0A 2P44B 1JPFB 5I18L 2R69H 4QF1A 1SBSL 1ADQL 1CYWA 4QYOA 4MHHG 3QJSB 3LS5H 2D0FA 3O3BB 2WNWA 4Y2NA 2R69L 4NQCD 3VFVB 4HKJB 2NY6B 4OGYH 4ODWB 2YD5A 3QEHB 2CKBA 2XY2A 2GITB 1WAAF 1CR9L 1PNDA 1MHHA 1P4LB 1KJVA 3DI3B 4OGYL 3JV6B 4KK9D 1E6JH 5CU9A 3WLWC 3O2DH 3MBWA 4G6AC 1CURA 3D9AH 2BVYA 2LAGB 3DVGA 3H9HB 1FNEB 5D96C 4AC2A 3RUGA 3FU5A 4H8QA 4HIEA 4DCQA 1CFNA 1KCRH 2YUZA 5B3SB 3VXRD 3HI1A 4PS7A 1E6JL 5I16B 3O2DL 4PJGE 4R97B 2DMBA 2B9AA 3D9AL 3PLYA 2W60A 4G8IB 5E8EB 1JGLH 4WI6A 2W95A 3G5VB 3WS6A 2XZQL 4MCYA 2BNQB 3M17B 2DKUA 2LT9A 5F0PB 4ANXA 4FABL 1MH5B 1QWUA 3PWVA 1ET7A 2AGJH 4M62H 4Y2OA 5CR8A 4I5BB 4PRPB 1CICD 1CD1A 1U8KA 1WG3A 1TZIB 1FVDB 4WKZB 3K91A 4PREA 1Q9LA 3MYZA 2YD0A 3WO3B 3WUWB 3BEWB 5CLXA 3DUUB 5K9QI 3QUXC 4KI5D 4AJWA 5GGUA 5HHVL 2AFNA 4E0RA 1XIWC 4FE9A 3AXHA 1N2RB 2P47B 5TF0A 4HWEH 3PYCA 5JOEA 4AXWB 2Q20A 4ELMB 4I0PA 4DP9X 1QA9A 2K70A 2YPLE 3P77B 1WD8A 3NJLA 4JDEA 1WYJA 2P45B 4HWEL 3NFNA 2WUBH 4X6BA 1M6OB 1NFDB 4YDKL 5B3NA 4PJFF 2WLMA 2N3JA 4BSJA 3AABA 4GAYA 5JIQA 1MCHA 3C6LD 5T3XD 4F8NA 4H5SB 4NN7C 1Y7VA 4MMXC 2DLFH 2QLVB 2AI0H 2Z92A 3WLBA 2D3NA 4OZHA 5TE6L 1GKEA 2B1OA 2X1QA 1D6VL 4OZIA 4P5TB 3F8UB 1UD3A 3R7RA 2BZ7A 5TK2A 4BRJA 4XX1E 4TF4A 2DLFL 3ECQA 2AI0L 2H2PD 4QRUA 5GRUL 2EIZB 4Z7VA 3DTXB 3R8QA 5EF0A 1YMMD 5LG1A 4X0NA 4PG2A 2XTSA 5KWYC 1W9XA 2D0HA 1VGKA 4I3SH 1NCDH 4X6FB 1ICTA 4IMKA 2X10A 5D1ZI 3CCHA 2EEXA 4MJIE 1YNTB 1WZLA 3SGKA 1RIUL 3DA0A 4XC3H 1W6WA 4GT7A 4QYAA 2DQCH 3DC0A 5I8CA 4I3SL 1PZAA 1P69B 1EAPB 3AWGA 4HZLB 3TL5A 4LLUB 1HEJC 2NLJA 4PJAB 1BIHA 3RWGA 4XC3L 2Z31B 3BH4A 1W72H 4OGXL 5ACMA 2A6IA 2QSCL 5JYMA 1Q9OA 3QIUC 2VXVH 2Z7UA 3RP1A 2QSVA 2FEDC 4DPRA 4X4XA 3PAYA 2J71A 1W72L 3CZGA 4F15B 1OF2A 1SHSA 1MPAH 2VXVL 3NIGE 3D0AA 2MRYA 4OLWH 5D5MF 1AOHA 1BP3B 3X17A 5E4OA 1HU8A 1QUPA 1R3HB 4GRWB 4KXAA 1MXGA 1AXTH 3PFUA 1WBZA 1MPAL 5FM4A 1NLDH 1FQ9C 2H0PA 3MYJB 5D7LE 2F6AA 3S5YA 1O5DT 2Y06H 3HRZA 4P2OC 1PG7H 2MQ3A 5HI4D 3IJSA 4KXDA 2YWZA 1AR2A 1AXTL 3T4YB 1NLDL 3ZDXE 3CBRA 3CDZA 4R2GB 2Y06L 4PV8A 4S11A 3QIBB 5ID0A 2OMZB 4D94A 3MXWL 3GZOA 3QJZA 5H35A 3QWQB 1PG7W 1I1FB 1D5ZA 3EGSA 4M5YH 3SKNB 5K33A 1HILB 4CNIB 3MPCA 4XMZA 4V2CB 4RMRA 3KLSA 1EH9A 1WC7B 4PGZA 1XXFC 1P6FA 3MCLH 1K4CB 5F7DA 5E9AA 2EYTA 4M5YL 4NNXA 4NKOB 3T3MF 2KLRA 3VD1A 2YS4A 1I1YB 3RWJA 5JO5A 4MZ2A 4I9XA 4A2DA 3MCLL 1X9LA 2VR8A 1A4KB 4PJEB 1JPST 4MJ4A 5BJTB 4QRSA 5C70A 1E7VA 1GMEA 4Y4HB 2CDGB 1MRCH 3H3BC 3AWEA 3I75A 1S6NA 4J3OH 5T3ZH 1MCJA 1PY4A 4XMWA 4FKHA 3NEEA 5MHSE 1U8QB 1WUZA 1HQRB 1MRCL 5HHQB 1XTMA 3BJLA 3BN9D 3HAEB 5I1JH 2XWRA 4M93B 4X9FA 1AG0A 4Z7QF 3RPIA 5ABZA 4B9KC 4D9RD 1AKJB 2EH8H 4P9MH 5CZVL 5C97A 3T77A 2DZEA 5I1CH 1WITA 4JFYA 5FOBB 4NNYB 3QQXA 3L7FB 4G8GA 4HX1A 5DA0B 1VSCA 3FB6A 3D12B 2RAMA 2EH8L 1J88A 5I1CL 2NY1B 2Z65C 3IFLL 5F93C 2XT1B 1ASOA 2VM4A 3ZHKA 2ARJA 2K6ZA 1BD2A 5DGRA 3N04A 3KPRB 5JOFA 2NTFB 3ZPDA 1QYGH 2A99A 5DHMC 2CRIA 4KY1L 4UUJA 2EVJA 4PJIE 3SQRA 3OKKB 5IB4B 1XGUA 4HJUA 2ZOTA 1IAKB 4WEBH 5CBEB 1ZSDA 4ONFH 1IQWH 2CBQA 3FFOA 3F58L 2VB5A 4NRXA 2EQDA 5I6OA 4AENA 2QHLA 4GT0A 4WEBL 4ONFL 5AVTB 5BV7C 1IQWL 5AZUA 4ZZFA 3KYKH 3V4VA 4M1DH 1UYWH 3EJSA 3V55A 4L05A 3CBJB 4L9LA 4R0LC 5JHMA 3N42F 4RLDA 3AREB 4JQVC 1EXGA 1MJJA 1ZANL 3FQNB 4GIAA 4C4BA 1F11A 1UYWL 3CVBA 4M1DL 5EOCJ 4RGNB 1MCPH 4G8EA 5FR3A 4D9LH 1S7VA 5E51A 2OMUB 4PVBA 1J5CA 1XDTT 5FS5A 2X4RB 3PWLA 2HVBA 1OGTB 1MCPL 3MNZA 4GG6B 4QRFA 4D9LL 3V4PB 4PJFB 1B0RB 3PDOB 43C9B 2J5WA 1TTBA 4ZXBD 1QOKA 4L5FE 1T21B 1SZNA 3P3YA 4FZ8H 1RLBA 4HIIA 1Z7JA 3FT4B 3C09C 4LEOA 3EO1B 4YHIB 4ZW3A 4AV0A 1NQBA 2OPCA 4K5PA 4FZ8L 4X7CC 4I88A 3ARGC 2Z93A 4AQEB 1CLZL 3GSOA 3CIQA 4U6YA 4IIZA 1M2VB 2QVMA 2B5IC 3WHXB 5C9JB 3HS0A 2JJWA 4H20L 3TA3C 3SDXF 4DPAX 1UJ3C 3S34H 1HH9A 1BOGB 1N0XH 3GC3A 4RWHA 1BA9A 15C8H 3ARDC 3DTDA 3KPNA 4U1MB 3S34L 4KH2A 3H3KA 4AGQA 1N0XL 3V0GA 3SGJA 3NPSC 3T1WA 4F57H 3BGMA 4PI0A 4EMZA 3WD5H 3B3IA 1MDTA 1TCMA 4L3CB 1CGUA 3BHBB 2IALB 4A37A 4F57L 4IHBA 5EEXA 2NSMA 4YSTA 3V10A 2BS8A 4BCXA 3WD5L 1SYSA 2C3GA 4NLHA 3VWKC 2GBVA 5ICZA 5TGBB 2VDMB 3CVIL 1J05B 3DXAB 5D5MB 4QTHA 2VO8A 2W0FA 4MD4B 4AQ1A 4OZ4A 3SGDH 2NRDA 2YQBA 1JHTB 2J6EH 4YDMA 2FE0A 5EOQL 3H6AA 3B9AA 3N0AA 3OMNB 5FA4B 5AB1A 1T6WA 4OJFH 4NBZB 2XQ0A 3MA7A 2WBJA 1GZPA 2W92A 4JJHA