3M7OA

Crystal structure of mouse md-1 in complex with phosphatidylcholine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
GWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mouse MD-1 with endogenous phospholipid bound in its cavity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Lymphocyte antigen 86
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m7oA00
3T6QC 3WEAA 1NEPA 5IJCC 1WRFA 3VQ2C 3M7OA 3B2DC 2E59A 1AHKA 3WEBA 3FXIC 5IJDC 2HKAA 5IJBC 3MTXA 2Z65C 2E56A 2F08A 4G8AC 1A9VA 2Z64C 3RG1C 3VQ1C 3MU3A 1KTJA 5KWYC 1AHMA 1XWVA 3ULAB
chains in the Genus database with same CATH superfamily
5F3HB 4CADA 1MHCB 2GKIA 1G94A 4V2BA 2YBRB 2DQHL 3RJQB 1C08A 1E5BA 5JHDE 1FE8H 5FYKE 4PJXA 1YMMB 3K6FA 3BGMA 2WLLB 4LF3A 3G5XB 3F58H 4GW5B 5EO9A 3QI9D 4FFYH 2HKAA 4LEOB 5KSVB 2X41A 4M1CD 2AEQL 3KXFE 3K72B 4HUWB 4MNQD 5DMKB 4OFYD 4Z77A 4V1DE 2F2HA 1FVEA 2OM5A 4O2CB 3EXLA 1S3KH 5E99L 1D7BA 3MO1B 1PEZA 1WBZA 1XGQA 3GJEA 4MRBA 4P4KC 5I0VA 1BXVA 5GPRA 5HYQA 1KEGH 3PDGA 2JJTA 4IGBB 5AYQA 1KN4H 5ICZA 1KN2H 3EFDH 4X6FA 4ZMWA 1K6QH 3UC0L 4Y5YB 2AEPL 2F74B 1V7MH 3R4RA 4XWOD 4IBYA 3IETA 5D7KE 4RFEB 3IGKA 3QPXH 3U0PB 4RSYA 2IF7A 3MLWH 3MLTB 2M26A 3D1MC 4KOCA 4LOEA 4FG4A 3WN5B 1KXVC 4IW4C 1KACB 4KKQA 4P3CH 2LOEA 1E4XI 3HCVB 4NGHL 4XC1L 3MZGB 3UROR 1SVCP 3L3GB 2N0KA 1WP6A 3W0WA 3HA0A 2FL5B 3NSDA 4Z7IA 3FCBA 4N85A 1BX2A 3UBHA 4U3CA 1A3LL 1G9NH 5LO7A 3VD5A 2FQFA 1S3KL 2NUPA 5CD3B 3QG6B 3GLAA 2ZOUA 5T1MB 2A6JB 1FFQA 1SMOA 2FT8A 4YVNA 4B9KC 3BO8A 4J39A 3DUHA 3EJZD 1RURH 3PJLA 3WJJA 3WEBA 3ARQA 4JG0L 4K7PX 1TU2B 2XTJB 3TA3A 1K6QL 1BSIA 5I1CL 4HUUB 5C08A 2AGJL 3JYBA 5FUOL 2VXVL 2E8ZA 3N41B 5DRNA 4R7VA 5AW5B 3EJQA 3L3KB 1G7QB 2CXGA 2ZF9A 1OSPH 4JM2A 4OZIE 2Z8SA 1RUMH 5DGQA 5TE6L 4ETQB 1IGTA 4KGLA 4KDTC 1WDAA 4U1LA 1E65A 4UANA 2BOLA 4KXBA 3BYTA 1QLEB 4P48A 2W81C 3BKJL 2XZQL 4Y2NA 2W92A 3DXAA 1IKNA 1BVZA 2G2PA 4LNRA 4MQXC 1KBWA 5AVUB 4TQ8A 3VG0L 1QBBA 4AUYA 3UFIA 1OW0C 4OBRA 2WUCL 2QSCH 2OMXB 3LYRA 3RUGE 3NA9H 4X4YB 1PLAA 3HG2A 4HC1H 2PXYD 4N1CA 1JN6A 2VKXA 5FWQA 3T2PA 1OTUD 4JFHE 3MNZB 4I85A 4IDJH 3B3IB 2H2PC 3RPIA 1RJYA 2YGNA 3F12A 3OKKA 3QR1A 4B3VA 4HG4J 2CRMA 2GBUA 4PGDB 2ENSA 4EDXB 2DBJA 4HIPA 2ATPA 1TEGA 1WCQA 2FQEA 3R06B 4P2OA 1SN0A 1B88A 3MRHA 3CXDL 5FK9A 4A39A 1I3RB 2NY3B 5C0IB 5KJRH 3UZVA 4BH7B 3FRUA 2DLFH 3GIZL 3F64A 3EDFA 1CZ8L 2FHCA 2YUWA 4R4ND 5BW7A 2V2WA 1D5RA 1WJ3A 2AXGA 3FKUS 4AL8H 4JRYA 4JUSA 1C5DA 4X6DA 1TQWA 3FQ2A 4N6RB 4R5VA 1D9KB 4UAOC 1KPUA 5CJXC 3DJ9A 3HNVH 4ZTEA 3U4EB 2DBLH 1JTPA 2BOBA 1OEZW 2Q87A 3F7YB 1WWCA 2WHVA 3MRMA 3T77B 5D4IA 1MWOA 2CQVA 4GQZA 4OZIF 1KB9J 2IAMD 1TZ8A 1AC0A 1BOYA 3TO4A 1CFNA 5HHMD 4PBVC 1ZA3B 2F61A 5FYLL 2WXLA 1HE7A 3MRCA 5EO0A 4HQQH 3GMPA 4N3TA 3TBSA 1F6AA 4LLMB 1Q90A 4KUCD 5GGRA 3BIAX 3LAFA 2F18A 4OGYH 1JHKH 3ARBC 5F9DC 4D0CB 2QHRH 1S9XB 1X7SA 2CR6A 2X6VA 1AKJA 1DVXA 3FU0A 2WOYA 5F89B 4JBSA 2B39A 1G9ML 1ROCA 3DK0A 5BS0D 1CD0A 4UNTA 1MAML 3IFOA 4DVBA 5E5RB 3QBTB 4MX7B 1FL5B 1NCTA 2EO9A 2WVVB 3GXIA 3UAJD 4U1IA 5GZNA 4I1NB 4FYSA 3FO2A 4IOFD 1JOIA 1YEIH 4G7SB 1MQKH 2PTTB 1AHWB 1OPGL 2R8SL 3FQUB 4ZOAA 4A2EA 1DBBL 2J12B 3TJEH 5KVMC 2WXFA 1X5JA 2MCG1 2R4RL 5JOFA 5J12C 1IRAY 2O5YH 4XP6L 1F4YH 2APXA 1ZK5A 1DE4B 3LVEA 3NCMA 5L0QC 1XDTT 4Y88A 1S7XA 4LOUD 4LEEA 1R0AH 2B1OA 3ARFC 1P7QD 4YXLH 4YDLB 4Y5XC 1R46A 2X2HA 1SM3L 3C9NB 2H47C 1VESA 3JWOL 2W65A 5L2JB 4LLQA 3BAWA 1OF2A 4LSPH 4M1DL 4WWNA 3IAGC 4ES8A 1K3ZA 4HJSA 1KOAA 4BKLA 4CRPA 4HLZH 5CMAB 4W6YB 1MI5D 1A7OL 3WFCH 5KAQF 2NUPB 4Z78B 2JXMB 2NUTB 3GC3A 3T2OA 2BHFA 2XICA 3CQQA 1H6TA 1D9KC 4UAOB 2HJLA 3T6QC 4DEPC 2CLVA 4P06A 4E9WA 1T66C 3X14A 3QHFH 4Q0XL 3SJVD 1E8XA 1NC2A 3DOIA 4UWQB 1AR1B 3S5YA 2HKHH 1HVXA 1JNHB 4M6OL 3VRLE 4QF1A 1HOEA 2YAEA 4YXLL 5KSBA 2VLKA 1YYMH 4KRMB 1ZLVH 1IGYA 5HYSA 2NDFA 2VDKL 4TQHA 1PJ9A 2I32A 4N8CH 4ETQA 3LS5L 2XV0A 3T8MA 3MXVH 5EBLB 5D2LB 3LZLA 4MCYB 1FPTL 4BUQA 3QUZD 2Q1EA 2I24N 5SV3A 3QCUL 3QHZH 1WA1X 5LJYH 3RWEA 3KMDA 1EUTA 1UVQB 2KDGA 2VW4A 3NJGA 3D69B 3Q2LA 4R90L 2JK5B 4Z3JA 2W5PA 2QTVA 1BVOA 2XN2A 3WHXA 2R0WL 4LSDA 5K9JH 4GBXD 4PHXA 5D96C 3VFSB 3Q2WA 5DZLA 4XOCA 4JRLA 3AVEA 3ARUA 3SD5A 1OLLA 4NKOA 3QZLA 1DVYA 3D0VB 4DOHE 1IBFA 3P30H 1JNLH 2MCPH 3DURA 4AQ8A 1PAZA 3TCXA 4XN1A 1BQKA 4W9KC 4OZFB 5C0RL 1THCA 4LLUB 2WXPA 4Y1TA 1BFOB 4LAQH 5IJKC 3GXPA 3SKJL 2A6KB 5KVGH 1MFDL 3OXSB 1J1XL 3QIBB 3SGEI 4FQHA 2VDLL 3JT0A 3T4AB 1YPZE 2YXFA 1KPUB 4UIMA 2VXUL 1OAKH 1V54B 3CMGA 1D2OA 4XBPA 4F2ME 3TEYA 3ZGHA 1MNNA 5F7UA 4KO9A 4LRNH 1J05B 1H8LA 4E9VA 1BZEA 4ZTOH 3D18A 2OK0L 4WUUD 1U30A 2OJEB 2TRHA 2BIPA 4M5YH 3II2A 2X2YA 4WGWB 4Z95L 5CGYC 4LSQH 1JZDC 2FJFB 5ABDE 1UKQA 3VWJB 5AWNH 1AD9B 3WIHA 5EEWA 4L4VD 4FTVA 5DA4A 3LZNA 2WKOF 4HH9A 3V5KB 4GP5B 1IB5A 2BINA 1GS6X 4OIIH 3QYNA 2RQEA 4FXKB 4BZ2L 1OGAB 3VFNA 4BCXA 3EZ8A 4PMFA 3IFOB 5E8EB 1NFKA 3MFFB 1DUYB 5BV7H 3PWLB 3MRRB 5EO1B 1GJUA 1WZAA 3H85A 3U9UB 3ZE2E 1EDYA 3DGCR 1YECL 3UZEC 4NQUA 3KDPB 2EO7A 4EKJA 4PGEA 2Y6SC 3B1TA 4KTEH 1XF2A 5A7BA 4BWWA 1FL6A 3X3FH 4FFTA 2MQCA 2Y5EA 4L1TA 4XXDA 5I1GL 4ZMLA 1GGIH 3M1CA 4HKZB 3A22A 4PRIA 3JBG7 3KG5A 4ABVA 2X28A 4RVBA 4UTBH 2FBRA 1DSWA 3ZE2F 3V0WL 4E68A 2G0LA 2GIYA 2IG2H 1FI8C 3FFCB 3FHQA 3NFPA 3D51A 5I1KL 1XGPA 2OS7A 4XPAL 1ZY9A 2QDWA 3ARZA 4P05A 3EDDA 5FFGA 1UT2A 1HKLL 3QIUD 5DGRA 1AO7D 1T83A 2OMUB 3R8QA 5GIRB 5E1AB 1REIA 5AD0A 4L5FE 3B9VA 1FBIL 7FABH 2Y0SA 2BSRA 1Z9SB 1I8LA 4N6QA 4JMNA 3WKNA 2C7UB 2ZWYA 4HW6A 4N90D 4ODVL 4PV8B 2FECI 3HRZA 3VMPA 3S3BB 4PIRF 3EJUA 4H1LH 4U6VL 5GS0L 1JDDA 4XMKH 4YSTA 3V95A 4NQCA 4RESB 5T3XH 1SOKA 1K2DB 3D39B 2P5WE 3KXFB 3KGTA 4KI5C 4LLYB 5DD6B 3V0JA 1XFPA 5IHUL 2ZXBA 3HS0C 1SYVB 5F3BB 3OGOE 4QCIB 3WD5H 3LNDA 1DQVA 2NYZA 3DSFL 2SEBA 1OTSD 3CTTA 4J3OD 3UPRA 2J1KA 4I2XB 4U2ZA 2VM9A 1KN2L 3EFDL 2AABH 1PQZA 4PV1C 4OTXH 2PPCA 1KEGL 1ZHLA 1KTCA 1PZ5A 4L37B 1J8HE 4H2AA 1OANA 4TSBH 5EZJA 2G4GA 4GMTL 2GW5A 2E7CA 2YD6A 4DVRH 3GTVA 4E9SA 1UUSA 2J1YA 4N0FA 3VXPA 1ZSDA 2FB4H 5B22A 1GC1H 3DVFA 3M17A 2XN0A 4N5UA 4HAKA 5IEHB 1JZ5A 5A2IH 1T04B 4W70A 2ADYA 3TBBA 1ZLUK 1J7VR 5F7LB 3D9AL 2ZYSA 2JIXB 1UXMA 2WSKA 4KJPC 4N2HA 1HXYB 2V3DA 2ZWKA 1F0LA 3HAEG 5CEYB 4ZAKD 1B3JA 1A6ZA 3PNRB 4JFPB 3WGVB 3L5XL 5KVDH 4PRHB 4ZAKA 1VFBB 1IE4A 1Z5HA 4GINA 2Z92A 3D4GA 4K8RC 4U33A 2FBOJ 3OKEB 1MWAA 3ZE0E 2VJ8A 2LU5A 1UWXK 3OKDB 2CJUL 4Z7UF 3X3GL 1RL1A 1ZS8B 2CXKA 4NC2B 4UQ3B 1XGYH 4YFDB 5LGKA 2APFA 4D9RE 2XVKA 4YSQA 4JAMA 3EOTL 1P5VA 3QUYB 4U1MB 2ZJSH 1QYGH 4F7EA 4MA3A 1MRCH 1PW3A 4LCCC 3IJYA 2EYTB 5ILTH 3EH4B 3HIZA 5TDPB 3BKJH 2Q9OA 1T89C 3KL3A 5E7FA 1BWMA 1I7ZB 2MTPA 2YQBA 5SWSA 4WNJA 1CLOL 1RI8A 1N26A 1TVDA 5C6PB 43CAB 3PWVA 5EU6B 3HS0B 4QRRB 2KL6A 5EUKB 1KGXA 1PG7L 1B9KA 4M9OA 4F57L 2A7BA 2R9HC 1JD9A 1KGCD 4GMSH 3HG4A 2E7LC 1AXTL 2LVEA 2G9KA 1RK1B 4FQXB 5AW6B 4YGVB 3PAYA 1MJUL 2AJYL 3C8KB 3PV6A 3H9ZA 5ETUA 1KV3A 4WSJA 5MI0C 2K78A 4ZAKC 3VXQB 1OTSC 4J3OC 3LRKA 4FZEH 1TZOA 3FQRB 3QDGE 1KYAA 1MCOL 3LZFL 3EAKA 2DM2A 4Y19A 3MV9B 1UB5A 3I02B 1NDMA 4FNSA 2ZKMX 4FG2A 3L4TA 2ZAGA 5D8JL 4ZJ9A 2EP6A 3BKYL 2GJZB 5B8CA 3WS3B 3MRGB 3BJLA 1ZXKA 3HB3B 3BYYA 1AD0B 5B3NA 4S1QL 2NXZB 5IWLA 1HILA 1N8ZA 3UTSD 4K3DL 1S7RA 2EE9A 1OWRM 1HAUA 4TUJA 5KVDE 4QKXB 2UXVA 4KV5F 1ETA1 1ES0A 4BEIA 5E6ID 2VR5A 3FUFA 4H4NA 3BP7B 1FNEB 3TEXA 1X44A 3C12A 4NB7A 5C0CD 3MRLA 1E9PB 4UZSA 3E2HB 4CGUB 2ESVB 4P3CL 3L7FA 1DLFL 4GS7C 3RTQB 3IFLH 5F6HI 2IANE 2AI0L 1V5JA 2CUAA 1JCVA 1SJXA 4K0OA 1FFPA 2Z93B 3IDMA 3FYEB 2F58H 3QGVA 4NO3B 3Q6FB 2P80A 4XNQA 1JNNH 5I74C 3SDXE 5C0EA 4IRSC 4RRPM 5L4MA 4MHHI 4EZLA 4YHOL 3LS4H 4FHJA 2WAHA 2D7TL 4O58L 4DESA 3VE0B 1AIFA 3WLWD 2FRGP 5CP3H 4OB5L 2PYEE 3DARA 1UUNA 1HT6A 1DQQB 2UY7B 4R7DB 1KG0B 4UB0L 4PJGA 1DZ0A 2FCBA 3QEQD 2VN3A 3VW3H 3KYKH 4NT6B 4FTVE 4B5EA 4GRLB 1CGYA 2FGWH 5A6MA 3SDDD 4QRQA 1UA6L 3S3DB 4JCLA 1NBZB 4AVIA 1NLDH 3FMGH 2B4CC 3AS2A 4X4KA 4G1EB 4OGXH 2I9TB 4X6EA 2P8MB 2RB8A 3FUKA 3AWFA 4HGMA 4IDLA 1QR1B 2EXTA 4K55A 5IEHA 2VDRB 3KLQA 5ADPL 5FKPB 2P24A 3GINA 1OTTD 4LIQE 4NQEA 4PY8I 4QHUB 2ICWA 4TSCL 5EA0L 5IVXF 2ZICA 1LE9B 2NYYD 2CKNA 4H8QA 4HGWA 1FZOA 2V2TB 2CNZA 5ALCL 4M43L 3T8XA 4EI5C 1A1NA 2UUDK 1CYWA 2XWBA 3DJRA 1DHKA 2CHXA 3Q8BA 1GIGL 3TFKC 1G7PB 3UTSA 3FCSB 1B4JH 2YJLA 2IJ0C 5DD3L 3VXMB 1Z9NA 4WO4D 1CIUA 2F08A 1G7IA 5L8KB 3QQ3B 2DF3A 5E6IA 5C0JB 1NCUA 3IXAA 1U3NA 2Y4SA 3U36A 5I1AB 2AEOA 4TTGA 1RKRA 3O4LB 3UJTH 4IRSD 4U6YA 4HIHB 3QIWD 5GRXG 2VLLA 3E2HC 3Q6GH 2Y1ZA 4A2DA 1YEJL 4ERSL 4Y2DB 3E6FA 3MDJA 5EUOE 2ZNXA 4JANA 3VFPB 3D2UD 4G71B 3BEVB 4DERA 4JHWH 4DN4L 4ZX6A 3CLFH 4OFKA 5KSAC 4FP8H 2ZP9A 2BC4A 2BXZA 12E8H 2FDBP 1X9QA 3C2AL 4XCYB 5D96B 4DFIA 2XWTB 4TUOB 3JWDL 3B8SA 4YUEL 2GB2A 5LXGH 1WBXB 1GJWA 1N5AA 3U0WL 3CX5K 2D3LA 2F1AA 1HQ4A 2BNQA 43CAA 5FC9A 3RVTC 5IOPB 1UG9A 2TSAA 3L5JA 2QSCL 4EDWH 1I3GH 1GMIA 2XN9A 4FNPA 5T3ZH 1KBPA 1XIWB 4XAKE 3FT4A 5GQBA 2NY0D 1N18A 4BFKA 2BNRD 3B7SA 1YEJH 4ERSH 1DANT 3LMJH 5C09A 4W9EC 2WN3A 4DK6A 1ZVSB 3PY9A 2IALB 4PJ5A 3ILPA 5ECJE 4GEIA 2BP3A 5DA0B 2HUEA 2NY4D 4FHKA 2P5ED 4GT7A 5BZWB 4LBAA 5A3ID 2WZ0A 1OGTB 1II4E 4NQED 4D9LL 1DVTA 2EXWD 5E2JA 3ULUD 4DZ8B 3AU1A 3ZZLA 1TZAA 1A66A 1T66D 1D7DA 1SJHB 5IB1A 3ZHLA 3WEXA 3KLDA 3LJ3A 1IILE 4WI9A 5GGUB 4X7SH 3OQ3B 4NKMB 5IWLC 4M5SA 5HY9B 3PXHA 1RFDH 1RQ5A 1FG9C 3X3GH 3AXLB 1R5IB 3UBXA 1QUNA 2YAFA 4FQJH 2CR3A 2R4SL 3KNBB 1F4AA 4KKNA 4I5BA 4LBEB 2B8OT 4PLKD 2B2XL 3P0VH 4BK5C 1QSEB 2CGRL 4ZX3A 3M46A 3MRJA 4HCRL 5DJZB 4EIUA 5CP7A 3ZIYA 2X1QA 4XE0A 3V0VA 4X2UA 5E4AA 4AEHH 3MO1A 4N26A 2RD0A 4KMQA 1HDMB 3TT3L 3KAAA 4NJ9L 4JCWA 5I75C 2ADFH 1J1OL 1G4RA 2BRQA 4AQZA 4AZUA 4DUXA 2RFXA 4WI2A 2B59B 4CVZB 3HLAA 3GMRB 5E9DD 2XG5B 5D70H 1A1MA 1EX0A 2CE6A 4XNZB 3WUWB 1RAMA 2NNAA 4FZ8H 4NENB 1PEWA 1UKTA 3GZPA 4PJHF 3BRGC 5I26A 1F8TL 1MF2H 5AOZA 5BO0D 3WFEL 3BVUA 3V6ZA 1CFQB 2ZSVB 1E5CA 3KL5A 4K9JA 4FHBD 1YZZA 2I07B 1ORQB 3QG6A 4C8XA 1J0JA 3ZUCA 4CVUA 1U3HD 3U4KA 4Z76B 5FKAB 1KNOB 3FU6A 3TT3H 1NEUA 4FN0A 3S88H 4O02H 4LCWD 2LFEA 2NY6B 3KLAA 2E47A 3K3QA 3QFDB 2EDYA 4KTGA 1BYPA 4ZUSB 5F9OL 2A6IA 3W37A 1IEAA 3PWNB 3PJSB 3QFJA 2H0EA 3ECQA 5I66B 3O6LH 5I1JH 1FYTE 2WJ5A 4AWJC 2G9HB 2B20A 4OV6F 1GPOL 1ADQA 3PE9A 2VOTA 2CA3A 3ULVL 5C0GA 3MV11 5IHUH 2G5BA 1SXNA 4P4KB 1U8IB 5KYWB 2DLHA 3AZUA 2Q7YA 3NPSB 3IXTA 1NCGA 2JKSA 3A4FA 1EO7A 2H26A 5E94B 3VNZA 5EFIA 4ONGH 1M4KA 3VI4A 5HHME 4OV5B 3BDYH 2PO6D 3DRQB 3DRTA 3H4FA 2O5XL 1BDYA 4WW2F 4CUCA 1HIMH 1WFJA 4JFDB 2B3RA 1NIEA 4L4VE 1FSKC 1MCJA 1QFHA 4L8DA 6PAZA 3RWJB 1S9YB 4NX0A 6FABH 4K5PA 4OM1L 1TG8A 2F0CA 4JPWH 4F37F 3F84A 3IGLA 5DQJB 3CE1A 4YDIH 2NNRA 2VCOA 6PCYA 3MJWA 1KCSH 3HHSA 4JFEB 4N8VB 5BVPH 1XCQB 1T4KA 2ITCB 3WNNA 1A9VA 3RYMA 1DBAL 4P3WA 2GIXA 3VWKD 5DJYB 5FA3A 2AXGB 5I2IA 3ETTA 2LFGA 3NH7L 4JRXE 1DBMH 3H53A 4I3SH 4OZIA 2X38A 1GTFA 1OD7A 3DHUA 1J48A 3FN0L 3K6IA 4YSUA 3OKMB 3IFNH 3GMQB 4BKTC 1CYGA 1E4XL 2NCEA 3DNKA 4A2GA 2IWGA 1TQVA 3RU8L 3WTSA 4E41B 3MV8D 4PW4A 1BVNT 5J8OA 1TLKA 1EZVX 3GKWL 4JO3L 5FA4A 4DWHA 3WYRA 1JZJA 3L3OA 4Q2ZA 1XD1A 4TRPH 3EZJB 2VC2B 1I9RL 4QTFA 4JRFA 3BH4A 3DHJA 5CJQL 5GGQH 2ENYA 1P84J 2YKKA 4PRDA 5I23A 1PD6A 3CC1A 4R5TA 4LDLB 4XNUL 5EEXA 1I1CA 1MELA 2ZWNA 4MB3A 1F13A 1MIEL 2D7PA 3RIFF 1IJ9A 1D5ZB 4NHUB 2WUBH 4XP5H 1PYWA 4XPTH 1IU1A 4XZ4A 5I0WA 3QIWC 3O2DL 2YKLH 1HKLH 3IT8D 3QO1A 3NIDB 2COQA 4NRXA 1L4IA 4JHBA 3LN9A 1TPXC 5D6CB 5CP7B 2XIDA 5E6YA 1WFTA 1NTDA 1Q1PA 1IBGH 5EIIA 4ODSL 4KK6D 3OMZA 5I0ZA 1GYAA 2H1LM 4OI9A 1HS6A 7PCYA 3CZEA 2YMOA 2O72A 4J4PD 3GSRB 3DX6A 4OT1H 5DJ8A 1NLBH 4RETB 2CM6A 1HOCA 2BW4A 2W0PA 3TCLB 5FECB 2NY1C 5EU3B 3DV4B 1F1AA 5E8NB 5T3XE 5AB1A 4HOZA 3OXRB 1JWUB 5A2AA 4YK4C 2Z35B 4KFMA 3MODH 1TYJA 2DQUL 2JKIS 5EPMB 4F24A 3GIVB 4CJ1A 1AGCA 3JVGC 1MHHA 3W39A 5L8JB 4BELD 3TWCL 1E42A 2I7OA 5KVGE 4ABUA 2BVUA 2WBJA 3CFEA 5T5NF 2ZP8A 5KVFH 4DPCX 3L5WA 2QQLL 4G9FE 3OR7A 2YPLD 4OLWL 2HFEA 4B53A 5IMKB 1E5ZA 3UC0H 2YZ8A 4P9ML 4AKQA 4BFGA 2YPLA 1CYXA 2WCPA 1VEMA 2WNGA 4NCDA 5BMFH 5CEXB 5D7IE 1N7ML 1UZ8B 3SGKA 3B7UX 5JDSB 4ZUSA 4PLNC 5GRVK 3VYPA 1HZHL 4Y4HD 2A83A 1KV7A 2VLKB 2X4NA 4Q9RH 3WFDL 4Y4KD 4RMUA 1U92B 4YC2B 3BVXA 3D25A 1KIPA 4HK0B 5CXPA 4WJKB 2BVOA 4F9PA 2AVFA 4DKDC 3N0PB 1FNAA 2CMRL 3CXFA 1RUPL 2QT6A 2PPAA 4OB5H 2DQTL 3DVGA 4QGYA 4OSUH 4WNQA 5AW9B 4KZEL 3SJVE 3AS3A 5DHVB 5DK3A 4EOWL 5TDNB 3RPBA 4HCGA 4MMZA 1JPFA 1F4YL 4W6XB 4HOWA 1RMFH 2EDBA 1WUNT 3GMMA 2EXWC 4W93A 1KB3A 1ETZB 2WYZA 2X0VA 1S9YA 2DIAA 4KK8C 1MUJA 5GSVA 3QA3A 4KTDH 2AKRA 4YSPA 1OO2A 1Y18B 2OYPA 3HHSB 1KXTA 4FG6D 1IKFL 3PQYD 3HE7D 1T5XB 3R0MA 4KITB 2AXJA 4YHMH 3P0GB 1JCKA 4XAWL 5HYEA 4HWUA 4AUUA 2KDYA 3E80A 1XR8A 2EYSA 2M1KA 3C08L 1HNGA 3LIUA 4CADB 3C2SA 4FQHB 3VU2A 1L9OA 4AQEB 2J1XA 5ESVB 3ALWA 1IC7H 1HCZA 1XCXA 3L4UA 4KOBA 1F42A 1MFEH 5DUPL 4OZHA 2WLLA 3I2CH 1RZGB 3GMOB 3O45B 3WCYA 4Z7OE 1SUHA 1XZ0B 2QMKA 4BSVB 1XGUA 1UXWB 5D1XD 1MH5A 5K9JL 4BFRA 4QRUB 4KTDL 3TJHD 3D4CA 1CDUA 3H3KA 5FDYA 2R69L 1VKXB 3Q5TA 4OFIA 3V5DA 5C7ZA 5GISL 3ARRA 2XPGA 3L16A 3SCMB 1EAQA 1INQB 5BRZB 4L8SB 5FGCB 2HAZA 3MUHL 3U46A 2F5AH 1CGVA 2RACA 3SGDI 3MN8A 1QUPA 4XAWH 3ERXA 3IRCA 4L8BA 1LWHA 4FXKA 1OGPA 5H94B 4XPGL 1JF6A 1NUNB 2MRYA 3VVWA 1ZT1A 1QYGL 4RGMB 2XWRA 4IGBD 4F91B 4PJIF 2Z91A 3ASNB 5AW4B 1SEBB 3NCCB 4N2FA 1N6UA 1JMXA 3R8BB 1CLZL 3TCTA 2ZX7A 4YZFF 3WENA 1CLOH 1TDQA 3NCFB 2WMPB 2AHIA 2A73B 1XO8A 4UT9L 2FATL 1HFUA 4S1DC 1MZZA 5FX3A 3KWWA 5I5MA 2X40A 1F1DA 1WS7A 5F72S 3S5ZA 4AV5A 2CPUA 2APSA 3OB8A 1P4IL 3H3PH 1OCWL 3D39D 43C9A 4CC0A 4OZGB 4GAJL 4NDMB 3GSRA 3HZYA 2JLLA 1TQBB 4R7NA 4UT7H 3IDGB 2F7OA 2FHBA 3FU7A 2QDVA 4FNQA 1TU2A 3TA3B 1VADB 4P5MA 1SJEB 4NBXB 1X3DA 2IDSA 4H25B 3UBGA 1JWUA 1M1XB 5I24A 4MLIA 3F7QA 1OKEA 4MTMA 4ZW3A 3LKPB 4QAMB 3QUXC 1UURA 5I16A 4CNIB 3QDME 3H7BB 4LLWA 1GOHA 4X0NA 2HKFL 4IU3B 3WFHA 3ZKMC 1I9JL 5AUMB 1BGXL 5ID1A 1O7VA 2AXFA 3DSNA 4KU1A 4TNFA 3MUZ1 2IPKB 3FMGL 3VXRD 4WK0B 1OAQH 5IFJA 3HE6B 3L3DB 3D12B 2HG5B 4LLYA 3T2NH 1YEIL 1WTLA 4OT1L 4H2CA 1H6EA 3AXIA 3VFUA 2R7EB 5D7LA 3KPOB 3DI3B 1NKGA 2M2DA 3PYCA 4D0DA 4EI0A 5E5UB 3BZ4A 3B5HA 3BP5A 4K5LA 4AC2A 1WBZB 1K5NB 2DQUH 4D9RD 4K7FB 3MR9B 4FZ8L 1PZ5B 2IWKA 4L37A 5DO2D 1IC0A 1R24A 5DZ9A 5F7AA 1JPTL 2HLFC 3M1BA 3O6FD 3GUTB 3WUWG 2YOAA 5D1ZC 5FHAL 4JZNA 5KS9A 2ADJB 2ADIB 5GRUH 4OJYA 3W0WB 4XXWC 5D9SB 5BNXD 5CBEA 3MTXA 1N0LB 4L1BA 5FHBH 4BDVB 2EH7L 4HUVB 1BQUA 3VGEA 2VZOA 2JJVA 4MSWA 1TEFA 4B0MB 1D5MA 2GT9B 3F7YA 4JFPA 4ONFL 1G6RH 5CJOL 5AW2B 3FS9A 1U21A 2CA4A 4XOEA 3QEQA 1PKOA 3H9SB 1PU0A 1OAJA 2BLFA 1OM3L 2IH1A 2OSWA 2IXQA 4Z3HA 4KI1A 1A6AA 1I7TB 2XWZA 3AUVA 1RSFA 2ZXQA 3NQKA 4A7SA 5HHMB 2GY7B 4E9TA 4QRPE 5EIVA 3PHAA 4L1SA 1FVDB 4MYPA 4FERA 3ECBA 4F15C 5FYLE 1F41A 2WVTA 4KVNH 5AQ0A 2W91A 4MA1B 5F97E 3KCPB 3S5LA 1HSBB 2QR0B 4F7EB 5B3JE 1QSZA 2W1NA 4ONFH 5DJCA 5T3ZE 3EGXB 2QVTA 5CM1A 3MNVA 3ES6A 4IDJL 2EKJA 2XY2A 4U1IB 2X4UA 1I1FA 2FSDA 2ZUYA 1T83C 3BPOB 4XCFH 3HC2A 4FG0A 3QEHB 4XMUA 2FR4B 1TQSA 1UOLA 4Z9KB 1MREL 3VG0H 2OJZL 3NJFA 4X6CE 2EVIA 4I3SL 2MHAB 1LNUA 3P0YH 5KJ4A 3WTVA 3HB3D 3KPPB 4MCMA 2NXZD 3AWGA 4PGCB 5FOBA 1YAZA 1CD1B 3RPIB 1HEJC 4XVOA 4KKPA 3Q7JA 4TSAH 3DX7A 4EMZA 4PJDA 2VXUH 1E8WA 1CLCA 4AE1A 1HYSC 4G43A 2Q0ZX 3WSQL 3MNMA 5IMLA 1NPJA 3D0AA 1TTFA 2DQJH 3MLUL 5BUPA 4TNWF 2ESVD 1FLRH 4XC1H 3UTTE 4JLRA 4U0RB 1ONQB 1FGNL 1PS3A 5C0IA 2HFGL 2G3ZA 4U4IA 4XMPH 4AK2A 5KTEH 2P5WB 1RPKA 4FXGB 1W72B 4IKLA 2MQ3A 1EVUA 4LDEB 3N5AA 1BZ8A 4XCNA 3A23A 1KB5H 1RU9L 5ESQB 3KWUA 4M6NH 3UABA 1KCBA 1B0GA 2R69A 1ZWIA 5J1AA 1RXLA 1WT5C 4Y4KC 1KENH 1RY7B 4LSVH 3PCYA 3UAJA 4AGNA 4V33A 5IB5B 4FI7A 2BSSA 4QXWA 4CDGC 1DTUA 1LHZA 4H26B 4AI7A 2DLGA 4JO2H 3FQTB 2OMWB 3SGEH 3BUIA 4M56A 4P8QA 1CFMA 5G55A 3VB8A 1I9EA 2UZYB 2ZAHA 3KW7A 3UJIL 4FI6A 4N2BA 2QEJA 2YSSB 4MCYA 2VW7A 4RBPH 4B7IA 3KPLA 5JQIB 3EGSB 1KT2A 3SE9H 1CFBA 1R5WA 4Z5RA 1XH1A 4YR6A 3FB5B 4UTBL 1G0YR 3NEEA 3VXUB 1M7UA 3BAYA 5JZ7C 3S88L 4YPJA 4RFEA 3NT0A 2XTJE 2K0RA 4WHTA 3GHPA 1T0NB 2IH3A 1I7UB 1N68A 2V5RA 1CT8B 1N0XL 1NUFA 3BP6A 3CH1A 3GRBA 1JNJA 5GZND 3L9RA 1P4BL 3UJIH 4ONOA 1BEYH 4GBXB 1SRDA 4MJ6A 5KVFL 3MNWA 4OF3A 5SWQB 1ACYH 3FQYA 4YK4B 4PJFA 3QCVH 5KBKA 3RB7A 3U9PL 1KJMA 4HAGA 4ZMTA 1G9EA 4EBQL 1EHNA 5IVOA 3DUSA 1JGEB 1U8NB 5IROD 5KSBE 1A6TB 3VXOB 4IKJA 1J9CT 2AEQH 4OJAA 2HX9A 2QGBA 4F7PA 4FEIA 4R7LA 4Y1AD 2C26A 3C9NA 3QDAA 1N59B 3H56A 3QUYC 5C08B 4Y1AA 1G9HA 4DO4A 1PLGH 1YN7B 4BH8B 2A9MH 4I18B 5D93B 3GSNA 4Y9GA 3FOMA 3SY0B 4CSZA 3L95B 1I1AA 5AYTA 3K81A 4QO1B 1NGXB 3BW9A 5JA8B 1TZIA 2H5UA 4KK9D 3IWUA 3TBYA 1DP0A 1LEIA 2ZCHH 3TN0C 3P11L 4L3CA 4FQQB 4EXPX 4XMZA 4Q14A 3RWIA 4KKBD 2P5EE 3QS2A 2NY0B 4FTVB 1XF5B 2GK2A 2BNRB 5LG1A 1MW3A 3VWJD 2CO4A 4FQXC 2AQNA 3G5VA 1XSJA 4XVUC 3RX5A 5KBLA 3MCKA 4DCQA 2BWIA 2BIIA 3UJTL 4PLKC 4HHAA 3B5GA 1I8UA 1QVOA 5CN3A 3ZYIA 3CD4A 1JV2B 3L4CA 1KC5L 1P7QA 3MJGX 2AJUL 2Q7AA 4MD4A 3MRHB 1CDHA 1PMYA 4G83A 3TLRA 5IQOA 5IVXB 3AROA 4JR9H 2YC1B 1GIGH 3W81A 4QRSB 4RX4D 4GRWH 5TE4H 2VR3A 3U4BL 3ZTJG 4JL2A 1JYWA 5EOCJ 2FWUA 1KY6A 1FGNH 3OAYK 3GJFB 3VGBA 1BG1A 2XN9B 1MFEL 5DUPH 1MI5A 1RUKH 3EJYD 1JERA 3HG1A 2DWDB 2YBGA 8CGTA 2Z7WA 3QUMB 3LXUX 3TT1H 3AW5A 4UQ9A 2NX5B 4IBZA 3CSYB 3P40A 5FIEA 3SJVA 1QSED 3RIFK 4AL8L 2GHZA 3CBJB 1M57B 5JTWA 2C9VA 3G5YA 4G59C 1INEL 4OGAD 4U6XB 1N4XH 4JHWL 4KNSA 4DN4H 4OVVA 1AO7B 2OKMA 2ICEB 3QR0A 1D6EB 1T1XA 3A67H 4XCFL 5EBMB 1Y6NR 3V6OA 2CGZA 2DQ6A 3EIFA 3D8MA 3FQ1A 3ILQC 5J9PB 3C6SB 3QK0A 4QHKI 1OAYL 3G7TA 3HKZA 4FXLA 2IO5A 4F93B 4XRCB 3KCWA 3BJ91 2DQCL 4LSUH 1QBLH 5GGSY 3UYPA 1M7DA 3MOBL 2ID5A 5DD6A 4EIZC 4JFVA 4RIRA 1Q9OA 4Q6YA 4ZFFB 4L23A 2N59A 5CILH 2OXGA 2QJDA 1NFDF 2VDKH 4PREB 5EZOH 1EGJL 1FZKA 2PTTA 1M7XA 4LCWE 4X5XA 5HHNB 3TO4D 3GLDA 4HWEL 1A7NH 3KL0A 3RWCA 1X7QB 5IGXL 5HYJE 2OMTB 3COOA 1KIRB 2OLDA 1DQDL 1U3HB 1LK3L 1KPRB 1AGDA 3LPOA 3OTTA 4N25A 1UXSB 2DTMH 3ULUE 1OGAA 3BUDA 4PJHB 4GQPH 4Z5RB 1CF8L 5FYLD 2P8LB 2W59A 5DS8B 1TQUA 2ZX6A 4M93C 1ZGLM 4QHLB 3L48A 4X5WA 3UZQB 4GSDH 4MD0B 1WWAX 3EJYC 3QXDA 4YE0A 4PWEA 3QW9A 5A3IC 3O8XB 3R1GH 4XMWA 1LP9A 3ZR5A 3EF4A 3US0A 4GW4B 4RZCB 4CJ0A 1CXKA 4H0HB 4JO8A 4Y5XA 4B7LA 5JW4M 3KHOA 3UTOA 1NL0H 4QJ4B 3ULVE 4XHQA 5DUBB 5D4HA 2I5YH 1JGIA 4XXDB 3BZEB 1MIMH 2VMJA 4KRNA 4QNPE 3HTLX 4IRJD 3FPYA 5D6DA 3HE7C 4Y4FC 2HT2D 5GSRB 1MEXH 1SFDA 3V2AR 3FFCA 4K23H 1F90L 3BGFC 3DMMB 4TVUA 4V11A 4AYBA 4J1UB 2PO6B 2W80C 5LHDA 1KJ2B 2UYLA 3LNIA 1VEOA 5TJWK 3QDJE 4GUOA 2BSTA 3U30B 4JVWA 5DRWB 1YO4A 5ID0A 1HNYA 2ICWJ 4ODBD 2NXYB 3KS0J 1NPNA 5KSAB 3ET9F 1H3GA 5JHMA 4F58H 3D3VB 5D2LA 5CNHA 1WBYA 3T2QA 1RZ7H 4JFED 3EYUL 3V9CA 1J8KA 4XCEB 2RGSA 5E2WL 4XMKL 2JNZA 15C8H 2NY4C 1NMCC 5DWUL 1IGJA 4C54A 5JHAA 4JG1H 1JPEA 1UZ6F 2QPFA 2W88A 4CVXA 2DL2A 2BIHA 3RFRA 2BSDA 4ALAL 1J1OH 2PP9A 2D0FA 1DQMH 4ADJA 4XZUB 3QZNA 4YSOA 4PRPB 4R6UA 2R0LL 5L9DH 4H1LB 1QZ1A 3BGAA 5E4OA 1AQ8A 3BPCA 4N86A 2WKLA 3D0VA 2IMMA 1BZQK 4NYLA 3GXTA 2ILLA 2X1XR 3KYOA 4OD3L 3RY5A 3D85B 2TSBA 3ZMNA 3MV8B 4PJAA 4J3UA 1C1EH 4UTAL 3IGAB 3WHE0 3SBRA 3GHEH 4A67A 4Z7VE 3BZDA 3TN0D 1RIVL 1MW1A 4HS3A 1J8HA 4XXCC 3I3EA 3T5WA 4UQDA 3K2MC 2WBJD 3ULVH 1AD0A 4LEXL 4U1NB 1A6ZB 1DVZA 2EIDA 3MRPA 4XNBA 1OVZA 2HN7A 4PJXB 3SBWC 3DX9A 4W4OC 1HHIA 4Y2OB 5IBUG 2NSXA 1P5UB 3MJ6A 2RCSL 3MA9H 5L6YL 1UJ3B 3MLSH 1DBML 2VUOA 1YNTA 1HEZB 2OXHB 3UOAB 3ZDZF 1IX2A 3U6RB 2DYPD 3QC5X 1W15A 1RZ8A 1UOWA 2XZAL 5KVDL 4YDNA 2D73A 1QATA 4DFHA 1RZKL 2VC2H 5I8OH 5DI8B 4DGIH 1ZGLA 1QPXA 4JAMB 4DQOH 3L3OB 3PUUA 4Q2ZB 5BXFB 1F6FB 5DJ6B 1XGYL 2ICES 3IPEA 4WWID 5C07A 1N67A 3RRQA 4L4TA 3BDXA 3C6SA 1J9SA 1LD9A 1I8MA 4M9PA 1OD9A 4XT1C 1HCYA 5C0BB 1V05A 2FD6L 2E8YA 3EYQC 3FFCE 3TBCA 3FCTB 1U8CA 2F5BL 1PYWB 4NAMA 2CALA 2Y3AA 2YMXL 3NCYP 4QGTA 4J6RH 4HJIA 2HYMA 1P69B 1B4RA 5AOKA 1TETL 4IEFA 4X6BA 2EXYC 1DFBL 1XF2B 1EAJA 1I1YB 2DOCA 1KDIA 4ORGA 1RZKC 2D9CA 3ML9A 4DEPB 2ZAIA 2VMEA 3C5ZA 5F7FA 4DOHB 1NL0L 1X9LA 5KBNC 4IBUA 1A4AA 1C12B 5AKVA 1GZQB 3NOIA 2VLJA 3KVQA 3TCLA 5FECA 4S1RL 1CQYA 3VXQA 4APXA 1G7JB 3NZHH 1LP9B 4PJBA 4YHPA 1JF1B 4Y4KB 3CU1A 2E7BA 3P0VL 3SPGA 2IH9A 2ICWB 1TJXA 1WZMA 1J0YA 2WNWA 4P2QD 2WV3A 2P49B 2X5PA 2BSRB 5E1IA 4NC0B 5JXEA 1AZZC 1O7DC 3CHOA 3TZVB 4E36A 5LGJA 4XWGL 3W9DA 1IBDA 3CVHB 2V7NB 4NJ9H 5K9KB 1TR7A 2XV6B 2CWRA 3C60A 4I9XA 3EUUA 4R4NC 5C70A 1N8ZB 4HEMA 4IQHA 1SVZA 4HZLB 4AENA 2GTWB 3MLRL 1LO0H 4K9EH 1J5OH 4OZHF 2WLNA 4J1UA 4TL4A 1FNEA 1CXLA 2KBGA 3A4AA 1QEXA 2WO4A 1JZ2A 2OCCB 2JVUA 4QCIA 3FSZA 4GSDL 5ID0B 2ZQKA 4G7VL 4O2CA 5ECGA 4JHUA 5IW1A 2JELH 3GHBH 3V9EA 4UV4L 1U92A 2WXIA 3FQNB 4Y2DD 4L8SC 3MGTA 5EF0A 4U3SA 3WMSA 5E00A 3KGSA 3G6AA 5AEAA 2FWOA 1I85A 4BGLA 3HLKA 1UZGA 3N2JA 1EO8L 1R75A 3L4WA 4ZTOL 3K74B 3LKNA 4I89A 4NRYA 1MFAH 4PCTA 4JJ5B 4P5KA 5DTFB 3D3VE 1GGTA 1LEKA 5IR1A 5D1QD 4GAGL 4HHWA 2XETA 3JUZA 3EJRA 3JVFC 1TFHA 2PW1A 4K94H 1S5HB 3DYMA 4S11A 1XIWA 5IJCC 3GUFA 1DR9A 1HHJA 2A38A 4H1LA 2E9GA 4ZX4A 2WVSA 4WWKA 3LQAC 5E23A 3T3PB 1FG2B 4NNYB 1RZIB 2WY3B 4E9RA 1K4DB 1S8DA 5IJBC 1W0WA 4KI5D 4TOYH 2UVEA 1XEUA 4CVWA 2R29A 5AB0A 4HJGB 3T1FB 4BJLA 1Q9LB 1G9MH 1S7TA 2P5EB 5C0DB 4F2MB 2C8NA 3DTDA 1U8MA 1M53A 2F53E 4YXKH 3P9MB 4YHNA 1NOAA 4NQEB 4RAUB 2QTEA 3VJ6A 4FXKC 4YWGH 4PTUB 1JZ8A 1T4WA 3EDEA 3NAAL 4UQ2A 1IKFH 3S34L 3UTQB 1KCVH 1SMAA 4H8WL 4MA3B 2C9UA 2HN7B 3JT2A 5DMGD 4DVBB 4ODHH 4YHIB 2EYTA 2ZXCA 3VFVB 1SXZA 5T1JA 1RZGA 3GMOA 3O45A 3IMRA 2DMBA 2WWKO 4Z3TA 5IVXE 3ZDXF 1P7HL 5KBMA 5DZJA 3U6RA 4G2AA 1JYVA 4RA0C 2K4WA 1FUNA 5EBGA 1Q0XL 1R3LA 3O4LA 1ZE3C 1HXMA 2GQHA 5EZLA 5TE7H 4ZNCD 2ZXEB 3IMWA 2NYKA 4JRYD 2F8XC 4MNQA 4DNLA 4GW1B 3EG9A 2X09A 2ZP0T 3OKNB 2VDLH 3QDJD 35C8H 3M7OA 4YEEA 4M3JA 5DVKA 3INOA 1EEYB 4YAQA 1S3RA 2OR9H 2XG5A 6FABL 3DGDA 5CLTA 3SKNA 3R7QA 4H8WH 3VMOA 4MXWL 1U8CB 4JFWA 1SEBA 3O3DB 1F58L 5GS1B 3PDOA 4JFEE 5I1LA 2N56A 3DTXA 1RMFL 4UQIM 4Y19B 1UM5L 4HV8B 2KKQA 5LGYA 4FKHA 3RJOA 2Z31D 3I02A 4JJOA 1IV8A 1CFQA 2J6EH 2WMPA 4KUZH 3OVUB 4UU9A 1JUFA 3P4NB 3VXSB 5HTSA 2GITB 1KGCE 1OHZA 3VXRB 1P1ZA 1XF3B 5JHBA 3T0EB 2YO3A 2XC8A 5JDJA 3KW8A 1U8OB 5IK3A 2J43A 4I4WA 3EOAB 3FB6A 4W1TA 2ZXDA 5HI3C 3J27A 4U1HB 1AO7E 1VFMA 4HSAC 5C8JA 4HG4K 5EF3A 4LCWB 4OJFH 5EWIL 4F37K 4DSYA 1ECYA 5EH1A 3LIZA 1W8EA 2FX9L 1HE8A 4K9EL 1J5OL 4F8PA 1WLHA 1YEHL 3HI6H 3LRGA 3GK8L 1L6PA 4KKLC 2F8VA 2W9DH 3L2MA 4FNRA 3ZDYF 3F7RA 1U6AL 5JXEC 1LO5B 4C55A 3SCMC 3O6FB 2J6EA 4X0KA 2WNXA 5T8IA 5TK4A 2VDQB 1ZDSA 3NUKA 2YD1A 1ZGLP 4ZBJA 4OGZA 1TJHH 2YGOA 4LCCA 3W0WD 3MPCA 2CDEA 1FF5A 2R2CA 1XGTB 4MA7L 3TWCH 3HI5L 4NZRL 4UM8B 4DW2H 2ZXWB 3Q5OA 5JW5A 4M93B 2J1ZA 4CSSA 3V55A 3ZMEA 4PPTA 1I1AD 2O1AA 4F7TB 4OLEA 1U8HA 1X5FA 3IS0X 4LVHC 4LSPL 4M1DH 1DBJL 4Z7QB 2VAAB 5FO8B 3BQUD 3TOPA 5AZ2H 4DKFH 5KG9A 2A74B 2QKIA 4I88A 5JQ6L 3HLAB 3DI2B 3UC2A 1UWEL 3WIFA 3V8CA 3ARSA 5GRJL 4ZFGH 1EPFA 1EXHA 2BSBA 4LIQH 3T4YB 4HCIA 1AKJD 4PJXF 1JGDB 4XN2A 2HKFH 3DPBB 1IAIM 2BWQA 3MBWB 2OL3L 1ZTMA 1P84K 4YBLB 2ZWLT 1A4CA 4IOFC 2J5LB 3QG7H 4NJAH 2R83A 1JK8A 4XMLH 3WJMB 3TTYA 1SQMA 2LGNA 3ZQXA 4UT6A 1HJBC 3BVWA 2A9NH 2HPTA 1LEGA 1FRGH 4MNGB 1AIZA 2D9QB 1BQSA 4FI8A 1WC7A 4WU5B 3EYQD 1IEHA 4JRXA 4PJ8A 1WAAA 4JKPH 2BOCB 4XH2A 5B1CA 2GJ6A 4ZPTB 2YARA 4JO4L 3H55A 5HDRA 3ATDA 5I30L 4GG6A 5C0DA 3MLZH 5FA4B 3FO0L 5BV7L 1CG9A 1UD2A 3CUPB 3RG1C 5DQDL 4P23D 3THMH 4AY0A 1IEAB 1MAMH 1XXFC 2WXQA 3HVDA 4PJ7A 5GGVH 3CN2A 5F21B 1TF4A 3KCPA 3POCA 3S5LB 3SE6A 4DTGH 1F3JA 1KLGB 3M86A 5DHDA 3AGVA 2G30A 1CVSC 3PWLA 2P5WD 4M8QB 5T1DL 4Q74A 3K8MA 1G6RB 3GB7B 3BN9C 1U8IA 5HHVH 3DXAD 2VLRB 3D4YA 1XSOA 2X4RB 1LXMA 1SJVA 5T1LA 3TNMB 4LQFH 1WPCA 2ZCHL 3UTTA 1Y07A 2LT9A 4Z3FA 1G84A 3JWDH 3F7VA 1XH2A 3V10A 2KZKA 4GLRI 1N6QL 3B2UD 4MJHA 4WUKL 3THML 5L6YH 4ILDA 5FO7B 1KPVA 4CC4C 1HOCB 1QFUL 4RZKA 5GJTH 4F8TA 3JZYA 3B43A 2XYBA 4FFZH 4IBTA 3S3CB 3UBXI 3PL6B 1LK2A 4PN6A 4WHDA 3S98A 4CU8A 2F1BA 2N1KA 1T4KB 3NJXA 2QGDA 2AJUH 3RTQC 1KC5H 2F1EA 4P2RD 1NEZG 5DURB 2FQGA 4G8EA 2BP8B 1MCPH 1ZHBA 1SUJA 1Z9SA 4MHHG 1P5UC 4YGAB 2MCPL 5JW4Q 4Z0BL 1UASA 4KXZH 4BQ6A 3LEXA 5JW4N 3LQZA 1XXDC 4OFDA 4Z7VA 2GITA 3ULVD 3HZKB 2DLIA 4TQIA 3N43F 1UJTA 2VZTA 1CGUA 3S35X 3HW7A 3ALPA 5LLIC 1ZE3H 2BZDA 4R4BA 5KVGL 1VACA 3ULUH 4OUUA 4XBMA 4DGVH 5IBUB 4GRWF 3GMLB 3KXFA 3OF6A 2VO8A 1GGBH 1UZ8A 4M7LT 1WZLA 5JDSA 5K1JA 3EFOB 4HX1B 3K1KC 1CL7H 1EUUA 3RP1A 5IQ7H 4NXKA 3IKKA 1W72L 4KI5E 1ERNA 4DK3A 4BD4A 5I73C 2N7AA 5FB8B 1MCLA 1B4TA 5DEFA 1NICA 3LEVH 2E75C 3HI5H 3C8HA 4N2CA 4NZRH 4DPAX 5F88B 3G6DL 2WANA 3S4SG 1U4FA 2E6PA 3EGSA 1OSPL 1NJ9B 1G0DA 2HRLA 4HWZB 1ZLSL 5DSCB 1P6WA 5JPMB 3CZFA 2AMGA 4TNVF 4L8CB 4RLDA 4Y9BA 2XU9A 1MJ8L 2NNAB 3CFJA 4FA8A 4NPKA 2VN7A 2X6CA 1SDDA 5ICYA 5E6RB 3FU5A 2XACC 4YOKA 1C7SA 4XPAH 1IZKA 2GAZB 4NUJA 1UGKA 5F7DB 3KGUA 1QRNA 4F7CB 5DYFA 3FOLA 1F8TH 3NZHL 5KG9B 2Z92B 4FQJL 4ODVH 4WUUA 3SIKA 3ABZA 4J12A 1Z3GL 3PHOB 4BCZA 2VSCA 3MLVH 4UNVA 1QBML 3LKQA 2B7DT 2GFBA 2QQLH 2XPYA 1P0SE 1JPSH 3LPWA 2XLLA 5EUOF 4G42A 3GF8A 3JTTA 4GAFB 3MUUA 1HK6A 5FYJH 4IJTA 3IRPX 1TNNA 4U31A 2DM7A 5HGGS 1AGFB 4F5CE 3ZT7A 1RVFL 2ICEC 3L3HA 5DQ9B 3N04A 2JJTC 4TNVK 1JGUH 1BGXH 4HAFA 1I8IA 4UINH 1NMBL 5EWIH 2Z9TA 2G5UA 3TU6A 5J13B 3NJMA 3PV7A 4S10A 3TF7C 5SWSB 3L1OL 5I75B 3MLPA 3Q1SL 3DETD 4GMSL 1BPLB 1IEBA 3II1A 5GZNC 2EINB 1JN6B 2VDNH 3TYGH 3U1PA 5HYIA 5HYJA 3QCTH 4YQXH 4MNHA 2CO6B 1XZWA 1YN6A 4X99B 3M07A 4NM4L 4NERA 5AVWB 5H2BB 2JB5L 3E9TA 3U1SH 2HWZL 2W0LA 3MCKB 3I9GL 1U3HC 1OSYA 2QPUA 3G08A 3K2UH 4M1CC 3STLA 4C83A 5JLZB 1KCRL 2BVOB 2WQSA 2OMVA 2DICA 4YVUA 4ISVA 1BG9A 4GIPD 3FUIA 4U0QB 2X89D 1BIIB 3GSNL 3IU3B 1NCWH 1GZHC 4OJEH 4Y7OC 4QHNA 4JFEA 4PJ9B 2VLRA 4RDBA 4N8VA 3DROA 3CSTA 4LMQI 4L3EE 1UB5B 4PRAB 2FUTA 1TITA 4QHMA 1QNIA 4JFZL 5TDNA 3KPRE 3FRPG 4KO6A 4KZDL 2JIXA 3CHXA 4G82A 5FA3B 4GQ9L 2GJZA 5B8CB 5C6TH 1TTRA 1ZHKB 5IQLA 3GMMB 2YRZA 4Q9QL 3HG1B 1KCRH 5HYJD 2WZPD 1BZOA 2X3CA 3QS3A 1U8KB 3PWPB 4EOWH 1VFBA 3PIQB 4AG4H 4JFOB 2C9AA 2R15A 3FU7B 4FP8L 4PEEA 3MX0A 4R97C 2Z8VC 3ZZSA 4LKXA 1PJWA 2KZBA 4Y4FB 1MREH 1HHKB 1RSYA 2WSPA 3ARXA 3TA4D 5IUCA 1YNKH 2JWYA 4NQEE 5F7BA 1QHOA 3N44F 2OJEA 2V2XA 2PO6C 1MI5E 2G75A 1ZHBB 4G80B 2DAVA 1UQSA 2AV7A 1I1AC 3VGDA 3WFHB 4EDWL 1MLBB 3NPSC 3CDZA 1TFPA 3GJEB 5B3JF 3J8F7 1ZT7B 1IM9A 1JFHA 3I6LD 3BQUC 3HZKA 1BLNB 4FMFA 3O0LA 4Z7UE 2JQZA 4IGBA 5ICZB 4RISL 1KCSL 2FEEL 3RGVD 3A6OA 5F96L 5IBTL 4GXUN 1HH9B 2JQMA 3JWDC 4PY8J 4LVOC 1AOZA 1B4JL 4JHVA 5DD3H 3LNFA 4XNMB 1CGTA 4ZQTA 4GBXC 2C3VA 1JHTA 3OJ2C 1SZNA 1GYVA 1ULVA 4B97A 4H20H 2XX0A 1BZ7B 4WENB 3ZTNH 3WY3A 2AITA 2UWEA 4CBZA 4JFDE 3C5ZD 3OSKA 5EIIB 4Q97A 5J1TC 4P5TA 3TYFA 3KPSB 3G6JE 2Q7NA 1AGDB 5DCCA 5MEND 4L3EB 4G11A 4QMEA 3OV6A 3GI8H 4JHZA 4JCMA 1PG7X 5E5MA 3DX6B 4HC1L 3TVMA 5JPMA 3BCDA 1KCKA 1RIHL 2MNUA 3BIBX 1CTNA 3ZYJA 4AM0A 4N0YL 2XWJB 2VLRE 4L5FH 4BFFA 4JZNB 3MLRH 3PQYA 2YAOA 3D9AH 5E8NA 1DUZB 1M6UA 2W07B 2W65B 5FR3A 1S9WA 4AYFA 2H32H 4PRPE 4BWTA 2XZQH 5E1AA 3AAZB 3KYNA 5IV2B 4J3OH 1UCTA 4AEHL 3AS0A 2WQRA 4P4RA 1IAII 4N0UE 1AG0A 2K9FB 2J8UB 43C9B 5B39B 2BRRL 2Y7MA 5I0DA 3DHMA 4LL1A 3T3ME 1RVFH 1D5BB 1WZ1H 5DHMC 3RNKA 3VFWB 5GSRA 3LV3B 1A47A 2PTVA 4A38A 1A65A 2VSMB 3IEAA 5T3XD 2EZ0C 1JNNL 3CN3A 3GRWA 4Y5VB 4PB9L 5D7LD 4Z7OF 4WI0A 1DQDH 1MJ7H 1QP1A 4WV1A 3K71A 1OPOA 1WAAF 1WV7T 5IESL 1AGFA 1OZTG 5D4QA 5ID1B 1MVUB 2JKJA 3D85D 1DVFB 2IDTA 5EBWB 1I8IB 5FDWB 1YY9D 5HPOA 5C9JA 5IQMA 4P5TC 4PP1D 2VKWA 4XP1H 2EUXA 2UZIH 4OCNC 4AV4A 5CGBA 2NOYA 1DQLH 2AQ2A 5FLVA 1NGPL 4I7ZC 4JY5H 1KYOJ 4L9LC 3ZRSA 4WNQB 5AWNL 1EXGA 3NZSA 4O00A 1T04A 5SWSE 5I1HH 3BZ4B 2VDMH 3MUGB 3ZW3A 3FT4B 5DUJA 5ALBH 3O2WL 1AQKH 3HC0B 4M61A 5FV1L 4G8AC 5ICUA 4BZYA 3FN9A 5IMMB 3BPCB 3KLLA 3F7PC 4G43B 4KAQL 1MCOH 3LZFH 5T1MA 3MRFB 2F68X 5ISZB 1MNUL 2XG4A 2N3JA 3QA3B 2VSKB 4JG9A 4G1EA 4PWKA 4AMKL 4Q9QH 3D85A 3AREA 3WI9A 1ZPLA 3EYFA 1CICD 4K3JL 4AQAB 4UUJA 2DQIH 3KPMA 4Y9FA 4BBWA 5DFTA 1ADWA 2B4CH 3QEQE 4Q6KA 2E4FA 4G8IB 5DRNB 1ID5I 5I5JA 4NQSA 1YYLH 2MKLC 2OCJA 5F89A 1H6UA 3VH8B 5KSUB 1DVSA 4KAQH 4JB9L 3SDYL 1KTLB 3FUDA 3PIQA 4GEJA 5EDSA 1AQKL 1EANA 7TAAA 3ZN6A 2AK1H 4NM4H 4LNRB 2VH5L 2WQ8A 4I5BB 4LBEA 1A3QA 5C0JA 3IU4L 4JREB 1NGQH 4OKDA 1FNSL 4TOYL 4GPVA 2UZYA 4PP1C 2QLYA 1G6VK 2NNXA 1FC2D 3N91A 3RDTC 3WY4A 3IF1A 2WOBA 1UQSB 1UZ6E 2KI6A 3SCMA 2IVFC 4HH9B 3C09B 4OAWB 2WC7A 1K3IA 2A1WL 3LB6D 3NJJA 2QR0A 4L2YA 4MQ7A 4IOSA 4JVPA 1T5WB 3BZFB 5I8EA 1JWSB 4H88H 4C56B 4UTAH 3VXTB 2CO7A 4RAVB 2P80D 2NR6D 1J0ZA 1HH9A 4WFGE 4FFVC 2VXVH 5E1HB 3CLWA 4FAAB 4P2QB 2H3NA 1DN0B 3DJZA 4HIJA 3T0DA 4QXGH 2XTJC 2GHWB 1FL6B 1UA6H 1PCSA 3MNWB 1K8IA 1M7IB 5DZVA 1RIUL 4G6AC 4XO5A 3WS6C 2I07A 2MNWA 1ORSB 2ORBL 4PJDB 3DUSB 5LN4A 2HJLB 2CIKA 3DMMC 1C1EL 3B9AA 2NW3A 4DKEH 1JXDA 4E2OA 1UB6A 1C5CL 2DTSA 4BYHA 4NO2B 5T5NG 4N8CL 4OFYA 2J4WH 5A40E 3GLZA 2WXHA 3JUYA 3C8DA 5DEZA 2IOOA 3OL2A 4R26H 3UTPD 4JNXA 2HT3D 4AJYV 4HK3J 4XAKD 5HVWA 2G9HA 4Y8DC 2E3VA 3NCJH 3QZBA 3JQOB 4PJ7E 4ZI8A 2KLSA 3KPRD 4LP8A 4D7PA 1AG6A 1LO3H 3MBEB 3N9GL 5HHOD 2DM3A 2BSSB 4R4FH 3KPQA 4Q4EA 1I9JH 3KNBA 2AF2A 4FJZA 2H26B 4BZ2A 5AALA 4RGMC 4P0DA 3IMVA 3VCLA 3QJTB 5JPMC 5LVEA 4OJFL 3FQUA 1MY7A 1MIML 1QLFA 4HJ0C 1KIQB 3ZQ9A 4D0DB 3DYOA 4CMMA 1GW6A 4XO4A 5KVEE 3K6SA 2CCLA 1DVFA 3MREA 3M7FB 1BVKB 2CR0A 3D2UA 4X98B 3NSJA 1DBKH 5EIQA 2CGRH 4OCRH 5C97A 4OZFA 3SE9L 1SN2A 1DL7H 5AG8A 3LD8B 4F33A 4KZ0A 3LDBB 4NENA 5AZEH 4FABH 1LO4H 3NSFA 2FJUB 3LB6C 4KFZC 4QRSA 5HJ3B 5GS1C 1U8QB 4JY6A 4AYMC 5D1ZA 2UWEF 4ODWB 4OLUL 4TVPE 5ANHA 3WTWA 3T6XA 2DWDA 4NZ8A 4S1DD 1OE2A 4QXTB 2OX5B 1W91A 4M61B 2BNQE 1KXQA 3VSUA 4A7GA 3OKOA 1FLRL 4XPFH 1O5PA 1FE8L 4ELKB 1A1NB 4QWWD 4MRCA 3SDDA 2UY6B 3ZRCC 3VQ1C 4Q6IA 4N2GA 1R3JA 5F1KC 4F7PB 1PDKA 1VA9A 1A0QL 1A6AB 1I7TA 2WXRA 4UUJB 4BRJA 4YMPA 4G7YH 4YEFA 3LKOA 4I77H 1KIUB 1WUZA 1VPOH 5BV7C 2GC7C 2WWMC 4W4OA 2BH0A 1NINA 4YN3A 1U95B 1FO0L 3L95A 5E03A 2Z0BA 1P53A 1JHLH 2X42A 2C9PA 2X4OA 3DX3A 3I50L 4IRZA 5EZPA 2G60L 4WV1C 3RWGB 5DVNA 2NTFB 4XMLL 1TZIB 1W6LA 2PCFA 2Y6SD 3GKZA 4N2EA 4YQXL 3HKFA 1TZHB 1A4JB 4HSCX 2HH0H 3D34A 4PP2A 3H2WA 1BYOA 5C6TL 4FX5A 2PYFA 2C1PB 5JMOC 3LSOA 5HPMB 3NP3A 5KYYB 4JO4H 3GSOA 1OAZH 1XIWC 3GM8A 2BP0B 4KTYA 2F53D 1L7IH 2WTRB 4MAYC 1EEZB 2VDRL 4PJEE 1NCWL 4LVHB 1OP5H 3BZFA 2J20A 5DJ8B 1CE6B 2GY5A 3FJTA 4XNXH 3ISRA 4X5WB 1GGCH 1PVHA 3DURB 2AANA 4N24A 4GAGH 4OQTL 5F6IB 2O30A 3OXRA 3WIIL 4PJEA 5D1ZD 4LP4A 4ECNA 1EJFA 5LQBL 2DY2A 4S0SD 3QJFA 5DJYA 2R0ZL 3BH9A 5D5MA 4M7LL 5HHQB 4PH8A 3ZDYE 3VW3L 1QFWL 5CZXC 4ODHL 1CL7I 2HRPL 3AG1B 2E9BA 4AV0A 1S7UA 4RX4A 3PNWB 2OULB 4ZSOA 1PY9A 3NIGF 2HRGA 4KZCA 2PLTA 3KVPA 4KVCH 3WKMH 4LP5A 4IRJB 4AT6B 2HJFB 2BSCA 1AQDB 1HQRB 4JPQA 3EJJX 1A7QL 3PQYE 3AY4A 1QUNB 4TF4A 1GY1A 5KSVA 2EUZA 3AT8A 4WEUD 5E2TL 1WVZA 2IPUK 1CGSH 1I75A 3GTNA 2PABA 4GSUA 3ASOB 2FJFA 4I2XA 4W9JC 1I53A 3HMXH 4IU2B 1GC1C 3C6LB 2DQTH 1NUGA 5F9WB 3JV0A 2MTAA 2Z1PA 2C3WA 4TQPA 3PHQA 2R23B 3JWNC 4XN7A 1Z3GH 1ESOA 3QZOA 5F93C 3RVXC 5JPNA 1V55B 1ZSDB 3P54A 3OJVC 5TFSL 2PR4H 5D5ME 4RMRA 5CBAA 1PGRB 3LXAA 3J07A 4EI6B 3DBXB 4ZRGA 1VFAA 4Z7QF 1LQSR 4DP6X 2H2SD 3SYCA 1NMAL 2FVNA 4U0RC 4L1DA 3MODL 4Z7NE 3NJHA 2KT6A 3QFGA 4UIKH 4NPJA 4PJFB 4XWGH 5D7IA 3LHPL 3QIBC 3A4EA 4LL9A 2C5DC 4HWEH 4C58B 2Y72A 4K7PH 3ATAA 1KNOA 2H4EA 3LN5B 2VXTH 1UWFA 2BY2A 3BCFA 3EH2A 3OJMB 3JYCA 1ZHNA 4HOXA 2FSEA 5C9KA 1M2VA 3FO9A 5AFAA 5AW1B 3F7KA 4NP9A 1A5FH 3DK2A 3S4SB 1YLBB 1BIHA 1MHHB 1MHPL 1JG9A 3TN0B 5CIPB 3AABA 3FCUB 2EDQA 3EYSH 4ZXBD 2BHUA 3O3EB 1E7VA 1K72A 3LH2L 4OFQA 3TEUA 1OSEA 1ZLDA 2WBJB 4JPVL 3LMJL 5G4OA 2YR3A 3HC3L 4JY4B 4PWGA 1WAPA 4LFHG 3DXAB 2WZ5A 5FUCE 4MNGA 2I69A 1NGXA 2VN4A 4GAJH 2NR6C 5KTEL 1E5UI 2EDKA 1KBKA 4MGXA 2PTUA 1DVFC 4XP9L 3S6CA 1T22B 5TGBA 2IGFL 4G9FB 1U0QA 1PFOA 2XPGB 1XF4B 3IJ9A 3OLEA 5IW6B 4FQ1H 2ZCKL 2GTQA 3ZK0A 2DM4A 2DKMA 4WI8A 4M6NL 4B50A 2VZ3A 4QRTA 1A2YB 4GFXA 4R0LB 3BAEH 2DMHA 4P07A 5IB4A 2AK4B 1MIEH 2HVKA 2AJ3A 3VI3E 3VFGL 1DSFL 1TZGL 4N87A 1IC5H 2OTWB 1JL8A 4E5XB 4G3YH 3RZCD 4JM4L 4NKIH 1KLUB 1JVLA 1RZQA 2VZSA 5C0BD 5K5YA 1C5BH 1G6RA 3GB7A 4D8PB 1F18A 1LLAA 4DGUA 1A4JA 4PP2B 1UTDA 2I27N 4E41E 4L1HA 1P7BA 4JN2A 5HHOE 2FQDA 4ATWA 3TBWB 1N9PA 1K5WA 3Q2NA 4YX2H 3NDZE 1L0YA 3F7VB 2VM4A 3CNKA 1BBDL 1ITCA 1T0PB 3CHPA 5CWSB 1NBYA 4PTTB 2EIZB 4R2GC 4OSUL 5ITBL 1J0HA 2W0FB 4GQQA 3IDNA 1MCBA 5EU5A 3QXVA 1JGVL 1MUJB 3L9EA 3BWUF 1FNSH 1NEZA 3BDBA 4HF5L 4KK9C 5L2KE 1IC7L 2GVYA 1ZLVK 1N6QH 3QYMA 1FO0A 4PJCF 1OP5K 4P59L 5FW8A 4HETA 4Y4HA 3VUAA 1EBAA 3FZUC 5L2KA 3QWRD 2DDQH 4H8HA 3LS5H 2A4CA 1RJLA 1UWGH 5J89A 3BN3B 1KY7A 3ML8A 5HY9A 5J9PA 1E8ZA 4PSPA 3MMEA 5DD0H 1FC1A 3D2TA 3L2NA 4YX2L 2JKNA 3ZIMA 2BVPA 2GTWA 2D3NA 2PYEB 1FN4B 3UEQA 4GRMB 2SODB 1MH5B 5HSFA 1KJVB 1S2EA 1RZ8B 4AEFA 3Q01A 1O9ZA 5HGBA 3B2VH 4XN4A 3Q2CA 4PRHE 1WA0X 4N1EA 5MEPA 1BQ5A 4I0KA 4PJIB 3EYVB 2A3TA 2KHAA 2D0HA 3VI3A 3ZE2B 3AY2A 1D3CA 5I8CA 4AQ1A 4NSKA 5IHWA 5AAMC 3VGFA 1EJOH 1L9QA 2FUQA 5J06A 5F7WC 1GPOH 3MFGB 1M05B 2ZCZA 3HHRB 4Z3GA 5AVTB 1TVBA 1Z9OA 1QWUA 3FH8A 5A2BA 1QR1A 1CU4L 3BWSA 1N12A 4EI6A 5KS9B 2A77L 4OVUA 3MRQB 4W68A 4BKLB 2I60L 2YPVH 4YHLH 5EORL 4MJIA 1WAAE 3IJEB 3SKOB 3QNYB 2ICCA 5DK0B 3KM2A 1OK0A 5IP4A 4AK1A 5SWSD 2ETWA 3B6SB 5I15H 3GZQA 1E90A 1SFHA 2YMTA 3AREC 4TTDC 5F1SA 4R2GB 1ZSHA 5I9QB 3GJFK 3MRDA 2E9IA 4DIXA 4J4PA 3ZE0F 4OUOA 4QRRE 1IVTA 4DH2A 1PX8A 1UT1A 2BDNH 3QFDA 1A7NL 1AS6A 2CDGB 3N44B 3ZHKA 4PLOB 2WZ6A 5GGRY 3M8OL 4KDWA 4LSTH 4AXWA 5MEQA 3ECBB 2NZIA 1BAFH 1WFMA 2YPVL 1EDHA 1NDTA 1C7TA 3MNZA 4FTDA 1FH5H 5TFSH 4AX3A 2BVTA 3BXNB 3GBML 3JTSB 2J55A 1PD1A 1CF8H 2EXSA 5DQ9A 1OW0A 5CKGA 5LGJB 3RVUD 2Y24A 1I8KA 3BEWA 1WBYB 2AXFB 2EJ1A 1X5MA 2QQKH 1T3FA 2VDNB 1PG7H 3IDIA 2YUZA 3EO0B 3IJ7A 4J3OF 1EAPB 1SPDA 3OWEA 3RJDA 2R2HB 4ZTPL 3CFBA 4FOMA 5AYUH 3G3LA 1JJUA 5HYJB 3DVNA 3LD8C 4P9HH 3HR6A 1FL3B 4R7DA 1C5DB 4X6DB 2R4SH 4PRPA 3MCLL 1K5NA 1GGIL 4YFEA 1OPGH 4YBHA 3V5HB 1MQKL 4C83B 4V1DA 5E00B 2FX8L 1X5ZA 1ETZA 2G5RA 4XNUH 3X3FL 4FFYL 3O11B 1R24B 4NYLB 4JFHD 2Y2WA 2HG0A 3KYOB 3V4UH 4Q8BA 5TH2B 4P5KB 2R0LH 2X9ZA 1DQJA 3CFKB 5AW8B 5EZOL 3W9EA 3CFNA 3NIGB 4Y8AA 5CN2A 4EUPA 1G1CA 5AW0B 1DQLL 1YC8A 1CFTA 4Y19D 4RWYL 1ADQH 2Q8AH 3QJHB 4GO9A 1SGKA 1S9XA 5FEBA 5IEKB 1X9RA 1XCTA 1AZCA 4NQDB 5D1QA 3FFDB 1E2ZA 1G7HA 4X42A 3RGVB 3E6HA 3VGHA 4BSJA 3TFBA 2DYSB 3EOBA 5KANI 3QUML 1BOGB 1JXGA 5BV7B 3C60D 3BKML 3PAUA 4HVBA 1CPUA 2G2RB 4Z1PA 2JI3A 5C8JB 5T1DH 4KUCF 3BAEL 1T1ZB 3D5OF 5I74B 4E41A 2IXQB 4MAZA 4XB8A 5FYKD 1VIWA 1OM9A 2CCVA 3MRJB 1IFRA 5D72L 5IMOA 3T65A 3X1GA 3S8FB 2PWGA 4DEWA 3ETBF 3KPSD 4YHNB 1AD9A 1AMXA 1X5GA 2DWEA 5L2KB 5MENB 1NC4A 1R9FA 5A6IA 4XNXL 1DLHA 4NWUH 4XTRC 1NC4D 1IM9B 4XHJC 3L1FA 2F9BT 1L5GA 4G5AA 4Z0XA 3STZB 5JR1L 4LLVB 1FO0H 3NFNA 3H7LA 4JFZH 4GY4A 5H94A 3AM8C 3KBEA 4G6JL 3SYQA 2AABL 4F80A 5I1CH 3K1DA 3SO5A 3OKLA 3QUMH 2NY3D 5GZOD 4R9HA 4BQBA 2FNBA 3DA0A 1S7WB 2GCYA 2Y7NA 3QUXA 3FAWA 4G7VH 4MB5A 4JM2D 4XNMA 5E6SB 4EI5D 4ENED 4MXVF 1R3LB 3PGDB 3U7AA 3WFDH 1NPUA 4L9LB 3SGJC 4B60A 5EEZA 4GW1A 3ZXAC 4TL5A 2VAAA 3FQXB 2DIJA 1NLDL 3EG9B 4HHGA 4RNRB 2XQBH 3JWNG 1XT5A 4AQ1B 4Q9RL 4K8RD 4Z78A 4FGMA 2VJXA 4L3EA 1MFAL 4GYBA 1YEKL 2CO3A 2C7FA 3NABL 4NDMA 3WIFB 5B8CC 1MRFH 3NFPB 5EU3A 1A3RH 3ZTNL 2QVMA 2WSDA 3TV3H 4NNPH 4IOSD 1ZJAA 3FQWA 4NOFA 3LIZL 4LVNB 5TQ0L 2EDNA 3MRCB 5TPWH 2MMXA 3LKPA 1JK9A 2BIOA 3IRZA 3I75A 1ZA6A 5C0AD 1HN1A 3CMOH 5TF0A 1CDYA 3NIFE 1MG3C 5EBLA 2J6EL 3H9HB 4KUZL 4IU3A 5J13C 2WXNA 2CIIB 4JO1L 4KKAC 5K9KA 1EHXA 1XSIA 1DJXA 4ADIA 1BM3H 3KWTA 2GJ6B 3V4PL 1H9DA 2C3HA 2NLJA 1FCCA 3FULA 4FABL 3HEIB 5B1BB 1E43A 2F54D 4K3HA 1CGSL 4JREC 3IVKA 2J4WL 2QADB 4R96B 3NFSH 1SEQL 2H0FA 1R5VB 2LU7A 3BVNB 3O2VL 4RDQG 2VXQL 5K39A 1GW0A 3S37X 3US9A 1X6NA 3NBNA 3KR3L 4B0MM 5B7MA 1AANA 3BEWB 1AH1A 4HGKC 5E9AA 3UMNA 4QYOB 3QXWA 5C0AA 1Z3RA 3NCJL 3KBHE 2PWFA 3F65A 1S9VA 4OLZH 3WS6A 4GXVH 1SQ2N 2FAUA 5IVXA 4Z7WF 1U93B 4YBQD 4C59B 3GUTA 3TNMA 3MOAL 4P49A 2I7SA 3IGUA 1X6LA 1ET5A 3SGJA 1IBZA 2YQ3A 5GS2D 4R4FL 3VFOB 5CF3A 4FZEL 1QD0A 2JKWA 3GJFA 3K6NA 4G5ZH 4Q58C 2ODIA 3WJJC 4HT1H 3LRLA 1J8RA 5FO9B 2KPWA 2QHRL 3CCHB 3RWDA 3WSQH 2ZSVA 1JYNA 5FO8A 1V3MA 1T03L 1ADQL 2Q8AL 2J88L 2YEZB 3V5HA 1QI3A 4ZS6D 3FT0A 2FD6H 1HXKA 2VAJA 3MLXH 1JHLL 1EXUA 1GKOA 2NZ9D 2Y7OA 3L08A 4HKXB 5C09D 3HOGA 4G7RB 4F8QA 2GI0A 1O6VA 2B1AH 4MMYA 5E6ZA 1INDH 3I9PA 2G2NA 1ZS8A 3NQIA 3BKMH 3TO2B 3IPBA 2XYCA 4WLCA 5FYLH 2IIJA 5CCHE 1TETH 2CZNA 4A37A 4CBPA 4D9LH 3ME0B 1YJDL 1AFVL 3D4ZA 2A6IB 5CU5A 3TH2T 4WDIB 1NIBA 1XCTB 2WYIA 4WCYH 5ESVA 2IANB 1NANI 3V5KA 1ACZA 4ANKA 3FO1A 4NM8H 4PRDB 2YKLL 1UHVA 2DJ4A 2VDQH 5GXBB 2O61B 1EEUA 2PPEA 4QO1A 3VFVA 3MRRA 3RA7H 4TULH 4LSQL 4BK8A 3RL2A 4IMKA 2BOCA 1MCIA 1J5CA 3OX8A 2H9GB 4ZQKB 3WELA 5BQ7B 2FX8H 4K71C 3VSTA 1IM3D 3N1GC 2PUQT 4IK6A 2GK0A 4U6HB 1KIRA 1U3HA 2AK1L 5C0FA 1HINH 4PG9A 4YXHL 3P2BA 4NM8L 5ISZE 4PGCA 5FOBB 3BHBA 3J7HA 1IFHL 3TIDA 4DUWA 3GPEA 5DO2C 1H5BC 3L4XA 3U6XS 1KBVA 4ODTL 4WTZA 2IMNA 4PRBB 1UC6A 3V52H 1UADC 4OGXL 3VXTA 5DQJA 1S7WA 4IJ3C 2EEXA 4LLUA 1MCWM 4QJ3B 3GSVB 1W2KT 4HIJB 2RTTA 2P5WA 5DD1H 3S96A 1ZLWH 2A6KA 3RDJA 3QIBD 4L9LA 2D3VA 1BJ1H 1UENA 3P77B 3EUDA 2X4TA 2P7TA 1U2CA 3SDYH 4PSRA 4AIOA 3V8OA 1OGSA 2I9LB 4U6TA 2Q86A 4NXSA 3UIYA 2LV4A 4MWFB 3LKQB 2FTAA 2YD8A 1EO5A 1U8OA 2R0WH 3B4NA 4F9LA 4OCXL 3BQVA 3SPHA 3G5WA 5F3BA 1E28A 4MAYA 5DMKA 4ZZKA 3BLPX 3LZOA 5CS7A 3CVIL 2ICEA 3CLEH 3NACL 2JE8A 4FD0A 5INDB 1ASOA 5T3XL 1E5AA 4H7VA 3VXNA 2DWTA 5CJBA 2XOTA 4GSRA 1FYTA 2YA1A 4M6MH 1FVCB 4CN6A 3QARA 4NGHH 4KJYA 2EH7H 3NZ8B 4FEMA 1T7VA 4OLYH 1E9OA 4KJQC 1SXCA 3B9EA 3QRFM 4F7KA 4Z0BH 1J9QA 3TGXA 2J5WA 1XGRB 5SWZA 4X7FC 4A6YH 4IS6B 4U1SB 3W5MA 4A04A 3UEZA 4KQ3L 3DX2A 3AUWB 5JW4R 3VI3F 3VCLB 4GKSA 1PX4A 3SBWA 1T7XA 4L4TE 4B9GA 5I15L 1BX2B 1WWWX 2EDJA 2OMTA 3BISA 4GI6A 1URZA 4DGIL 4M00A 2DI7A 5L7XL 4OLXL 3B7TA 1NBZA 4C4UA 4HLEA 3EJSA 1T1WA 4Z8FH 2DWYA 2FEDC 2P8LA 1IBYA 2XJLA 5HI3D 5KS9E 4H44C 2WGNB 1JGEA 4GS7B 2B15A 2HVJB 4ONHA 4XI5D 3W0WE 1T80A 2H6OA 3T0EC 2I85A 4J27A 3D7PA 2XNAA 4PHZA 1FYHB 3P0YL 4M5YL 4LLAA 1WFUA 4A2MA 2CKBA 4HS3B 5ESAB 3QORD 4ELDA 3DUUB 3MJ9A 5IHBA 2AZUA 3FTUA 4I18C 1IT9L 1F3DJ 1YN7A 4P46A 5D93C 4YSCA 1JMZA 3V7AG 2JJWA 4Y5VC 5ACMA 3R1GL 3FBKA 3EO9H 2F8IA 5CCKL 1ZAGA 4BZ2H 1NUDA 2WLMA 1MG2C 3MX0B 3PHOA 3VXMA 4BSVA 3S37L 1NQBA 5TQ0H 2FATH 1LJMA 2XFGB 4NPYA 1FA4A 1SBSL 1F58H 5FWRA 3FBQA 3BKYH 1SF3A 4UILL 5FCUH 1IQWH 3BVDB 5DEJA 3HS0A 2BSTB 2QSTA 2CBPA 5AVZB 1LP9E 3TL5A 5HD8C 1XF5A 3SE3C 3RGBA 3VFPA 2ED9A 2HZHA 4PGDA 2XA8H 4Y1SA 4EDXA 4NUGL 3C6LC 1U95A 1ROWA 2YN3A 3IJHB 4PY7A 5CINL 8FABA 3P9WB 2DJUA 5H37G 3SKUD 2NRDA 4F7MA 1KYUA 2UX7A 4M8QA 4HF5H 4LESA 1GH7A 2FGZA 3DX4A 4BZ1L 1A14H 4C4KT 2VW6A 1OLZA 5C2UB 1G1OA 1S5IL 1WFNA 3GGWA 1LP9F 4PJ5E 5CLWA 4MMZB 4OF5A 1IQWL 4G1MB 3QB7C 2YS4A 4N6RA 4Z7QE 3W5NA 2J21A 1D9KA 5DJDA 1MFVA 2HH0L 4PRHD 5DLMH 2E56A 1EEZA 4IBLT 1NH6A 1K4CB 5F0MB 2OTUB 3KYMA 1HILB 4PRBA 2H0PA 2HWZH 2W0KA 5IB3A 3CXHJ 3GIZH 4D2NA 3CBRA 1CF1A 1ED3B 1H8OA 4JM4H 1AHWC 1ES0B 1LK2B 4N5EC 1I4FB 1W0YT 1F45A 3Q44A 5BRQA 4BK4A 3DIFB 3ZLQC 3HZVA 3UZEA 3KLKA 2COVD 3ARDA 4PG2A 4OCSL 4WHYG 5CSZA 4G8EB 4JX0A 1CE1L 1KYDA 2HKHL 5FHAH 3W11D 2QGEA 3QUYD 3DSFH 3NJLA 5BQDA 5HGAB 2DV6A 4MLSA 3VWKA 3IDMB 1XBDA 2FB4L 1QQDA 4MX7A 3SGKC 1JXJA 2KUTA 2IPKA 4N2OA 1D9KD 1WIUA 2HJFA 2WKOA 4N9GA 5D5MF 1W0VA 4YDLC 4P2CG 2BP5M 3LN4B 2XBTA 3RI5F 4O2FA 4MJ2A 4ZFOB 4OW6A 5MP6H 2P8PA 2XCMC 4XVSL 4WV1B 4BK5A 3K71B 4JHAH 4QRRD 4HPHA 5E1QA 4ZMOA 1BXXA 3FU3A 3T6WA 3DX8B 2VQ1A 4OQTA 1XH3B 1OL0A 4B9IA 2OSLB 2NY7L 3B2UC 3NIDF 3VXNB 4U3SB 1SF5A 2A74C 3CIQA 2C1OB 4FQXD 4IBQA 5AG9A 4HC1A 4B3EA 2JLPA 1MY5A 2A9AA 1W8NA 1IBBA 4L0ZA 4WFEE 4MDRA 5D7JB 3MTRA 4GLRH 5JHLL 4FYQA 4C56E 3E3QC 4JJ5A 2ZKXA 3BE1H 4LHUG 3UYOD 3APNA 3UZQA 4EAEA 4NZJA 3TJEL 2MPAL 3VRJB 4PUBH 3K6OA 5L2JA 1K8DB 3WKML 3MV9A 4S1SL 2FGWL 3V6ZB 2W9EH 1AGBA 1BEXA 4JHAL 4JO1H 3GTTA 2H1PH 3QYCA 1W8OA 4LCUA 5ANME 1I1YA 5LUMA 2X05A 3FU9A 3QH3A 4MQSB 1SNRA 4HLJA 4L1LA 5DK2B 1N5YH 4X80H 3WBDA 1G7PA 3UTSB 1NMAH 2VDMB 2K8QA 4TUUA 5LBSL 1TMQA 1DVUA 3BE1L 5BW7C 1F11B 4OJDH 1JNHA 1R34A 1CICB 1YEDA 5DFWH 1XCWA 3BVVA 3UAJC 1FVDA 3RTQD 3NA4A 5ESAA 4TMPA 4BH8A 2ZOTA 4A6YL 4P46B 3FOMB 4IOIB 4Z95H 5KSAA 4N5ED 5A2KH 2J8UA 1XQ4A 3CVHA 4I3GA 4W9CC 3V4VH 5TF1H 2H3XC 3EXJA 5DC0A 5DJ0A 3RGHA 2KLRA 1JHKL 1X5AA 5B21A 1BREA 2DYRB 2XV2A 3LRSB 2H8PA 1QFWM 2YLKA 3QAZC 5DR5H 1MXGA 3PABB 2G0KA 2QGCA 3O2DH 5SX4H 5DJAB 3SOTA 5IOKA 1S4IA 2GYSA 3A67L 4B5ZA 1CDJA 2VLJD 25C8L 4GRLD 1U33A 4X99A 5H2BA 1QBAA 4M4RA 3RWFB 3L2LA 4H8PA 3A6CL 3OAUL 3V0DA 1I9RH 2CO7B 4RAVA 5CJQH 1MWAH 3W56A 3SY6A 2OPCA 1BCIA 4MD4B 1J1PH 1D6VH 2KC0A 1ONQA 4CL7A 4DAGL 5I6KA 4E42B 1EGJA 1J8HD 5ITFB 2GEEA 3HPJA 4WKZB 3T3PF 3N1QC 2P26A 3OXSA 2PW1B 4X8GA 2ZUXA 5D72H 3ZU8A 4APQA 4YZWA 2K6ZA 4FKEA 2EC9T 3QUMA 1HL5A 5FW7A 3SSGA 5CEZH