3M7OA

Crystal structure of mouse md-1 in complex with phosphatidylcholine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
GWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Lymphocyte antigen 86
publication title Crystal structure of mouse MD-1 with endogenous phospholipid bound in its cavity
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m7oA00
2HKAA 3B2DC 3VQ2C 1AHKA 3T6QC 2Z64C 3FXIC 3M7OA 1WRFA 2E56A 4G8AC 3RG1C 3WEBA 3VQ1C 2E59A 3MTXA 5IJBC 3MU3A 5IJDC 5KWYC 1KTJA 2Z65C 1XWVA 1A9VA 1NEPA 2F08A 1AHMA 5IJCC 3WEAA 3ULAB
chains in the Genus database with same CATH superfamily
1YNTF 1E40A 4NQVB 4IMLB 3S4SG 1NL0H 1WZAA 1SN2A 1X44A 4X7FC 3S34L 3MZGB 4HGWA 3BKYL 1LK3L 4G3YH 4V33A 1CL7I 3JV6B 1IMHC 1A8JH 3PWNA 1OSZA 1P2CA 1F4AA 3FQRB 4O00A 4C47A 4OD3H 4NP4H 4OTXH 5DMIH 3SO3C 4JDZB 3LD8B 3GRWA 4KWUA 3O8XC 5HHQB 1XCWA 2AEWA 1KTKE 3B5TA 4I1PA 4MJID 2VAAB 3B83A 2UUDK 3LYRA 4L8BA 1ACXA 4PV8B 3SKJL 5J6HB 1YECH 4HFUL 4N2IA 1HQRB 2IDUA 2QVIA 1BOGB 2WQXA 1NC2B 5F9WB 1FRGL 5IMOA 4B0MM 4FHJA 2X44D 3LH8A 4Y4HD 5E9DD 1JI1A 1S7QB 1CL7H 1MI5E 3MRRB 3NN8A 4GKZB 3NACL 4D8PB 1KYFA 3T3PE 3HKZA 4F2MB 5KJ7E 4H8UA 3W0WB 5KBMA 3V0HA 1G0DA 4LASH 3L7FA 4KJPC 4F9PC 5K1JA 4GJTB 5K93A 1AGBB 1GSKA 1YYLL 4GAYA 4W9EC 2XTLA 4HIHA 3WFEH 4LSUH 1BWWA 1G6VK 4NDMB 4MQ7A 4PB0H 4XTRC 1NGXA 2YRLA 4ALAC 2ZKXA 4BFNA 5F7KC 5D1XE 4F8QA 3ZYZA 5A3IC 3KM1A 4HH9A 3GMQB 4AGPA 2HRLA 2HH0H 4P4RB 3VFTB 4JKMA 4FA7B 2YGVA 2YKLL 4XAWH 1A6AA 1A6VH 1TVHB 5KBKA 1ZXKA 5IJBC 2H32B 1MW0A 2BLFA 1CLOH 2PW1B 4OVVA 2C34A 4WI5A 1BW8A 1ACYH 2YWZA 4MCMA 1NIFA 4NN6B 2ENSA 3A22A 2X40A 4N9OB 3V6FB 5DMYA 3NZSA 4M7ZB 1GOGA 3QO1A 3UL4A 5CP3H 3MOAL 4FQJL 3BVXA 1JPGB 1CFNA 1XIWB 2VDOH 5JO5A 3D52A 1ML0A 4F1SA 2VIRB 4I18A 3BWZA 3SDDA 4Q56A 2R8SL 3TWCL 1TTAA 2BIHA 3IKCA 4Q7DA 1XAKA 2FWLB 5KSAA 4XPAL 1GVIA 4QYOB 2C7FA 5I0YA 4CMHB 1BD2D 3VDBA 2CA3A 3STZA 3BQUA 5E6ID 2ZOLB 3DVGB 1THCA 3GEFA 4PJCE 4RVBA 3GTVA 3SO3B 1FV1B 1U95A 2ERJC 4RA3A 2X4QB 4QAMB 3O8XB 1U3YA 1FVDB 4ACPA 4ETYA 5ESQB 4CSSA 1AGDA 1AZBA 2Y7SA 2WWNA 4IOSA 4LEBA 3NQKA 1I3VA 5KBPA 1AOZA 1D5IH 1PJWA 2AJXL 2BIIA 2UY6A 5JIMA 3POCA 2Q1EA 5EULV 1F1AA 3RX8A 4JFVA 1YQ2A 4YZWA 4R84A 1BG1A 1MUJB 2DWXA 3UAJD 4F7TA 1ND0B 4I48A 2NW2B 4PJ5A 1TT6A 3D34A 4S11A 4BV1A 2Y4SA 4OCLC 2DKSA 1JV2A 4QXUL 3H42H 4XGZA 4CMMA 2F15A 4HG4J 4LHJB 2FE0A 3D33A 1Y18B 2MEJB 3SQBA 4PS7A 5LAXB 2Z93A 1OB1A 1NAKH 5KTEL 4G42B 4JG0L 4PTUB 2VXTH 4XBPB 4DP0X 5E2TH 3KPPB 4Q9QH 5TF0A 4W9LC 4LEEA 4NI6A 1UJ3C 3FSVA 2XPYA 1U4EA 4PRBA 3QFDB 5AVVB 1UD5A 1NGQH 3K74B 4QLWA 3AADB 5JR1H 2E7LA 4NAQA 3Q05A 2GK2A 4YIQA 1ZVYA 5F1IB 1MG2C 1NC2D 1PU0A 2JKJA 4JY4B 1JDCA 3R18A 1WFMA 4D9RE 5CN1A 4X5RA 5GIRB 2A9AA 1EXUB 2MPAL 3BUYA 1UFGA 1WWWX 3IRZA 4KFZC 4R0LC 2X1PA 3L9YA 3TZVA 2BVOB 4X5QA 3FT9A 4QRPA 4UDUB 3LPGA 1FFTB 2JKXA 3ISYA 3WNLA 1QR4A 4LT7A 3NGBC 3CH1A 2IOIA 2DWDA 2XWTA 2Z31C 2HLFD 4K94H 5E1HB 2E3VA 3T4AC 3NTCH 1LHZA 4F7PA 3BYTA 2AW2A 3UYRL 3EH3B 3THML 4FKHA 2V7HB 4BSWB 4HC1A 4MVBD 4ZS7L 4OGZA 5JXEC 1J8KA 4AK2A 2JTDA 2YUZA 5C0RL 2DAVA 4NO2B 2I27N 4A2HA 3ARRA 3ULUH 4HK0A 2A6JA 3AQZA 4KX8A 3JWNH 1R3IL 2OR8A 3DVFA 5G4NA 5T3XD 2HX9A 5IW1A 5B7FA 1ZANH 4RCAA 3V79C 2BFVL 3D3VE 3E1F1 3NJFA 1I8IB 3RPKA 1T7XA 1AY1L 4PJDE 1VF5C 3BW9A 3ZE2B 3QSKB 2GY5A 1FSKC 1XIWD 2AK4E 4LDOB 4P57B 2JCCE 1LEIB 1E9OA 2JJTA 2XBTA 3K1DA 4NKOA 4ZUWA 2TSBA 1W8OA 4M03A 5IF0B 2NNRA 2K4WA 4KY1L 1BA9A 2K9FB 4ZOAA 5MEPB 4EPSA 4DO6A 4QOKB 1BHGA 1PLBA 4O9HH 4J5VA 1QFUL 1U8QA 3VFPB 2BJMH 5HSFA 1FI8C 1I8MB 1FZKB 4EIZC 12E8L 3VXUE 4UUJB 3GK8H 4NJ9H 4FJZA 5C0EA 4WFFE 3ZL1A 5AW6B 3MRJB 5DRXA 5JW3H 2O72A 2YC1B 4GW4A 2NY4D 3KGRA 1HEZB 2VQTA 3ILPA 2XG5A 5EBLB 4HCFA 4IBWA 4KTEH 4CGUB 2A9BA 3DGGA 5ESAA 3GGWA 4OZ4B 4HHGA 5EOCJ 2OSWA 5LCVH 4CDHA 3LS5L 5EUOE 3RUGF 1FIGL 2CRIA 3RJOA 8FABA 1TZGH 4JQXA 3ZDYE 2QTEA 1GIGL 2HT4C 1B6DA 1ULVA 2MCMA 4ZD3H 2M8XA 5IK3B 1SLVA 4D7BA 5T3ZE 4KJPD 5CJ8A 5DO8A 3ASOB 2X6CA 4CNIA 4DP4X 2WQVA 1CBVL 2G5BA 5D2LF 1J12A 5CNHA 4WCYH 5CKGA 2HJLA 4WKZA 2CM5A 3NGBB 3GSNB 4TRPL 5JA9A 4XTRD 1LO5A 2BFGA 7PCYA 4KRNA 1XO8A 5I1IH 4JKPH 3DWTA 5KG9A 5A3ID 5A2BA 5HYQB 2P5WE 4DJMA 1NMBL 3GMNA 4XR8C 1KEMH 2DQHH 5ANMA 3RTLA 2P46B 4M7LT 2GFBA 2GJ6E 4TUJA 2E74C 2D3VA 2B0SH 3QDGE 4XOEA 1P9MA 2Y1AA 1ADWA 3QC6X 4I18C 3H9ZA 3SDDC 1DSFH 4HGWB 3VH8A 5ETUA 5KSAC 2GJPA 1OPOA 1Q8MA 1G6RH 2Q8BL 2R29L 2WSPA 3PWNB 3X2QB 3TM6A 4JR9H 4FLRA 1OSZB 3OPZL 1P2CB 3PY9A 5F0PB 5HHXH 2KPNA 1FSKB 1A6UH 3LXBA 1RUPH 3CC5A 3VVVA 2PF6A 3DC0A 3EO0A 4KKAC 2KI6A 3AWFA 3GZPA 3PWVA 3QQ9D 1KXQE 4ODVL 2F5AL 3T9WA 3UBHA 4AVKA 1VFAA 2RCSL 4TNWK 3WDIA 3DV4A 4L8BB 4FG2A 2XZZA 4Z7UE 4U1SA 1N67A 4E9WA 4AIXA 2F5BL 5IMOB 1SBSL 2CKBA 4YHOH 2LFGA 2GC7C 2YS4A 4OZFA 2OYPA 1S7VA 3MDJA 1KC5H 2JJWA 3ZVVA 5IVZA 3ZE0B 4JO4L 4C4BA 1W16A 5JORA 3N1MC 4OGYL 2DQMA 3L7FB 3JXAA 3IFPA 4JFFA 3AG2B 1JNNL 1FYTD 1AZNA 3WD5H 4BJLA 4GAYB 1CFSA 2IAMA 2XWCA 1G1YA 4PJGF 4HIHB 2FB4H 1S9YA 2X0WA 3HC2A 4J7RA 5TFSL 3N44B 3WTVA 3MJ9L 1F11A 3JWDH 1NGXB 2HFFA 4CUCA 3KPOB 2YUWA 4YXKL 1IAKA 2B2XL 4HH9B 2LU7A 5C0CE 1GYWA 1BVLA 4RAUA 4W1TA 1T1XA 4QOKD 2EDNA 3IJEA 3PPSA 3ZQXA 2DWEA 4BFRA 5CF3A 1Q9WA 4P23C 1C12B 2XTJB 2F19L 1FZMA 5EU3A 2X3BA 4B5EA 4NQDA 4XN1A 4OUOA 2EICA 2IAND 1NM4A 5TQ0L 3MCKA 2GG1A 3CZEA 1XGTA 2VDQH 1BF5A 4MBOA 4FMKA 4AJWA 1CFNB 3NCJL 1KCSL 2ITFA 3O4OC 1TMQA 1Z1WA 1O5PA 5HI4C 4I18B 3MRMA 3SDDB 3MCYA 4OCWL 3IKCB 4UQAA 4A7TA 1OGSA 1YPZB 4NZTH 3U7WL 5KSAB 4XN4A 3Q13A 4IJTA 3STZB 3BQUB 5HPMA 5DCCA 4HPOH 4YX2H 4ABVA 3APNA 1UZ6F 1HH6A 1U95B 3M46A 2J7LA 1W72A 1I8LA 3WFZA 1AZCA 3VGAC 1ETA1 4BIKA 2WW8A 1IAOA 4RFOL 5J7CC 4JO2H 5JXED 1G9NC 2UY6B 3D4CA 4OM1L 3CXFA 5EDXA 2KBGA 3E0GA 2FLRT 3Q9PA 3T6XA 2A0LC 4DP7X 3QXUA 5I1LA 3M17A 5ACMA 3UBXG 2FYVA 3AAZA 1OW0A 3M1BA 3SPGA 1H3TA 1OAUH 2A99A 4JLRA 1AXSB 4CU6A 4F7TB 3WEXA 5I9QC 1CXIA 2LTQB 4I48B 4PJ5B 3CSTA 4NUMA 4HISA 1KBVA 3S6CA 2A6KA 4X0NA 3G5WA 1A5FH 1JV2B 2B4CH 1JDDA 1ORQA 4O5LL 4XGZB 1RJZA 4CMMB 3QWRA 3UTTA 3ETSA 2H45A 5ERWA 1RZGA 2DRUA 5F1SA 2CXGA 3SQBB 2Z93B 1OB1B 3HNSH 2BNRD 3HG0A 3ATFA 3BVNA 3TCLB 1WLHA 3QHTC 1BVZA 4N5UA 4GEIA 1OZUA 3O3DA 4R26H 1CIUA 2H6OA 3MXWL 4MTMA 3QPXH 4PRBB 1BEXA 3U7YH 3L2NA 1UXMA 3TL5A 1IC0A 2C4FU 4GAAA 1XSOA 5SX5H 5J9PA 4YIQB 4APQD 1N5YL 3G9AB 4FFYA 4GXFA 3VG0H 1KTCA 2H4EA 4Y2LA 2XQ0A 3QJQB 1NEZA 2IWFA 3BUYB 3IU4L 4KMLB 4MD0A 5JQIB 1OGPA 4L3CA 1UGKA 4PWGA 3RWDA 1BM3L 4BZ1H 3TZVB 3Q6GL 2OI9C 2VQ4A 2A73B 5HYJE 3TBWA 1RULH 2V6HA 5KYUA 4QRPB 3QHZH 4I9WE 3FN0H 2RQEA 4P2RE 4QXTA 3O4OB 5E4AA 3CH1B 1FAIL 1QW9A 3N1PC 2DWDB 3PJNA 2XWTB 1OSEA 2V5YA 3VXRE 4FG6D 4EUPH 1T7ZA 4NM8L 2A74C 1DR9A 4DEPC 4F7PB 2ZXDA 1DQLL 4QLRA 1V5JA 4LHUA 5E95B 3FCBA 1I3UA 4YLBA 1OARL 4IOFC 3P11L 4LFHG 2FBJL 2JK5A 4LGRB 4X6CF 1H3PL 3L3DA 1KZYA 4ZUUA 4QRSA 4YWGH 4K15A 5CCJA 1MQKH 2WBJD 4GW5A 1P9MC 2XVGA 4HK0B 2A6JB 4Y16A 1EK3A 4XXWA 2NQ3A 2O6CA 4H1LG 2E27H 4XI5C 2XTJD 4FFZL 2VN6A 3B7RL 4U4BA 3FHAA 3IWVA 1P0SE 4RQQA 5IW1B 2X6BA 2FEJA 2EH7H 5JW4R 1PLCA 4I3SL 1NQBA 1VFUA 1ADQH 1JNHA 4LSVL 1NCDL 1QYGL 3G04B 3BW9B 3QK0A 1BIIA 4LEXH 1KBWA 3RI5F 1U8IA 3TJHD 3BIKA 5IVOA 1E9OB 2EC9U 3ZDXE 5D7KD 3E9TA 2VB5A 1INDH 2P47B 4NKOB 4PP1C 1E9PA 4ZUWB 1OCWL 5I9QB 3SDDD 3PV6A 1XB6A 1JI2A 3B8SA 4KZEL 4QTIL 3GO1L 2X5PA 5KSAD 1U8QB 3BWAA 5FGSA 1DBML 4LAQH 4S0SD 3BQUD 4M5ZH 4N2MA 3SYQA 4KJWC 1R5VA 3L3HB 5C0EB 5GGSY 5DJ6A 5DRXB 2H3XC 1BREA 4GW4B 4P8QA 4QHMA 3J07A 3LZNA 4NC0B 3ZE1F 3VX0A 3ILPB 2VW6A 1TZ8A 1OTUD 1ZIBA 3FZUC 2DBJA 3CHPA 3L1OH 3ZXAC 5K9QG 3F65A 2JQZA 4UAHA 4PSPA 3DGGB 5ESAB 1BGXL 4DN3H 1IGMH 2KLTA 3GGWB 4FQCL 5IHZA 2YPLB 1JZJA 2AS5M 4F3FA 2YXFA 8FABB 4JN1H 1A2YA 3NSJA 4BCZA 5IIEA 2C26A 4PJ5D 4IKIA 4KI5E 2VH5H 2OI9B 4KUCF 2FR4A 4BXVA 4JPKL 2D3LA 2X4PA 2G5BB 3RZCD 1MY5A 2HJLB 4WKZB 4DO4A 4XBEH 5LXVA 1INEH 4OQTA 4MAZA 3VFGL 3B34A 5KBLA 1LO5B 1NUNB 5LBSL 2N01B 5KSBF 2EE9A 3TT3H 4U2ZA 4M1DH 5KG9B 2Z1PA 5CKAA 4JM2F 2WVSA 4KX9A 5FYJD 5JIDA 1OL0A 2Z91A 2P8PA 4GUCA 5FUZH 1KOAA 3GMNB 4GQQA 4ZT1A 5ANMB 4Y4KA 2V0AA 1OHQA 2GFBB 4JHVA 4YS4A 3SQOL 5CEXA 5JHBA 2D7NA 5DC4B 2K7PA 1ETZA 5EO0A 2LV4A 2QPEB 1RZKH 2FHCA 3EADA 3VH8B 5ETUB 1G9EA 1FNEA 4EAEA 1H3XA 1JRHI 1UB6A 2YQ3A 3LH2L 3PREA 1NA8A 4PS4H 3APCA 3TZVD 4K3DL 1TOXA 1S7SA 4QRPD 4ZTOH 1VB9A 3CC5B 2FUQA 4XODA 3EO0B 3TV3L 5HI4D 3PWVB 3HG3A 3Q1SH 1I8LC 1YRKA 1VFAB 3PWPD 4GXUN 3DV4B 3GM8A 1B0RA 3NSXA 1E4WH 3Q8EA 4U1SB 3UC2A 4PWKA 1C7SA 3SDXE 4F58H 4KKBD 2VO5A 1O7VA 3X1GA 5LNDA 2JI2A 5D5MF 3TJEH 4ZBJA 4OZFB 1S7VB 3WY3A 1JRHH 5I0WA 4U3HA 3NIDB 4Y1SA 4DVRH 4H25A 4PQXA 5IVZB 5JORB 2QTVA 4OJDH 1TZOA 3QRGH 4HUKB 4UB0L 3IFPB 2ZPKH 3QNZA 2YARA 4JFFB 4R6UA 3Q5TA 1CFSB 2IAMB 1KCWA 3LNHA 3EUUA 4QYAA 2LU5A 1S9YB 2A0LD 4L29A 1P53A 4M6OH 2HFFB 3P2TA 5CAYB 1JPTL 1ANUA 1IAKB 1TQTA 1YEWA 1MCNA 1M2VA 4FZ8H 2CBPA 1I9EA 2WNXA 3A6OA 4HCIA 3SDCC 5EU6E 1BVLB 4RAUB 4RDBA 1T1XB 4LP4A 1UACL 5ANHA 2IDFA 3J27A 3NJHA 5F1OB 3A5VA 1U8CA 4ZX5A 1CFBA 3ZHLA 1KWKA 4DN4L 1KTRL 2DWEB 4L8CA 1Q9WB 1J8HA 3FQUA 1FQ9C 3CVIH 3UTSE 1E2ZA 2WLMA 1RUMH 4UV4L 4OCSH 1FZMB 4JG9A 5EU3B 1WS8A 4AEHH 3U0WH 1OP3H 4NQDB 3A24A 1MCIA 1NDGA 3GLZA 2MFNA 3MCKB 4N2NA 1MFNA 2R4SH 3W38A 2ETWA 4V2BA 1AQHA 1OAKL 2OR9L 3MV9E 2UWEF 3AJ7A 4ZSOA 2GUYA 3Q5YA 2YPLD 1LO2L 1V3MA 3FUDA 1JD9A 1R1CA 2ICWA 4X8CA 1ZHBA 3NJLA 5JHDB 2MQCA 4Q6IA 3ZTNH 4BH8A 3GSQA 5HPMB 2YA1A 3QXWA 5L4JA 4OW6A 2DMKA 2AZUA 2VC2L 3AROA 1HH6B 1P6FA 2EC8A 4U1LB 3DIFA 2XV2A 1W72B 4PJFF 3U2SA 3W11C 1FLRL 4Y16C 3BDXA 4OT1L 1F58L 2WQUA 3G9VA 3MRGA 1IAOB 3H2WA 4IGBA 2YFOA 5DSCB 5G55A 1SJEA 5HVGB 3UYPA 3OGCA 4K07A 4B0MB 2PABA 5IFAL 4UI2A 2YMXH 4RWYL 1KV7A 4Z3GA 5I1LB 2HKFH 2LGNA 3M17B 3EH2A 3M1BB 4UIMA 1NOAA 3ZU8A 4JLRB 1V3JA 1ZEAH 1ZDSA 4FQIH 4PN6A 1DBBL 5E4IA 4HUCA 3WEXB 1MFDL 2A6KB 1CR9H 3CX5J 1ORQB 5HBBA 1RJZB 2HVBA 4KH9A 4J3UA 4YJZL 5ERWB 1RZGB 5FV1L 2R56H 3W57A 2EDLA 3BVNB 3C60C 1E4XH 4FZEL 4PJBF 1KCLA 3EJRA 3P30L 3QZPA 3R4DA 3RVTD 2NYYC 4PP1D 3O3DB 1YN7A 4QHLA 1FDLL 4YL9A 5T3XH 3FMGL 5T1DL 1EUUA 1O6SB 4U1KA 3VFMA 1FL3B 2ZUYA 5CZRA 4ZMLA 5F96L 3F58L 4P46A 3TO2A 5T3ZL 3FFCE 5CD5D 3BSZA 3MNZA 5J9PB 3UGEA 5FYLD 3G7TA 3CFKA 1H5BA 3QJRB 2PW2B 3LEVL 2HWZH 4JO3H 3V95A 1NEZB 2XIDA 2VDPL 4MD0B 5LVEA 3VW3H 4L3CB 3EJSA 1PG7W 3BUTA 5DMJB 2HX7A 5DJAA 4J3WA 2A9DA 3RWDB 3KBHE 2PTUA 2Y06H 3TBWB 4AYMC 2KMWA 2XCMC 2IGFL 4JFFD 1EVTC 2IAMD 4QXTB 4DKDC 5FUCC 5I1AA 2XN0A 3O2WH 2KQMA 1CLYL 3I50L 3X3FL 1HYRC 2CSPA 1XL4A 1JGVH 2D7OA 5F7MC 4GW1A 2DH2A 2DW5A 3QIWA 1AHWA 4LHUB 5EB9A 1V27A 1HL4A 2JSFA 1RUKL 5CJ5A 2Y0SA 2JK5B 3L3DB 1DVFA 4EJ1C 4ZUUB 3IFLL 4QRSB 2W95A 5IVNA 2VZTA 4WI2A 4GW5B 3QZNA 4Y16B 4ZNEA 2WZ5A 4HJUA 5EZIH 3RNQB 3I85A 1UWEH 2XN9E 3D39E 4WQOA 4RQQB 1YZZA 2NY5L 3B9KA 4NQDD 1PY4A 1T21A 2WAHA 3EXLA 2VWEE 5AW5B 1JNHB 4GXVL 3KHOA 4HSQA 1BIIB 2UZIH 3ILQC 4TSAL 1JG9A 1U8IB 3IGKA 5IV2A 5A7BA 3KGUA 5C0BE 4LKCA 2R29A 4R3SA 4UQ3B 1E9PB 2HT2C 3RY4A 1Z5YD 1TR7A 3AT8A 3PV6B 3EOTL 1FYHB 4JFHE 4K71B 2H47C 3E1ZA 5JHDD 4AE0A 3BWAB 3REVA 5EOQL 3DX7A 2CJSA 2DQIL 1K3ZA 5DC0A 2I9LA 1J1PL 2VLJD 5DJ6B 4ONHA 4TVSa 1S5HB 3GJEA 4QHMB 2J55A 4WWOA 4Z7OF 1JNJA 3BGFC 3IDXL 4JFEA 5IB5A 3IJYB 1KDJA 3QUHA 1WIOA 3BE1H 4QRTA 1V3KA 1WAAA 1ZS8A 3HE7A 4N0FA 2W94A 1EDYA 3TTYA 5IHZB 5D7SH 1WS7A 3P0YH 5EV7A 4F3FB 3VGHA 4XNAA 4TNEA 4OM0L 2B14A 5IIEB 2X41A 1TTBA 2ZUQC 1UXWA 1SFDA 4V11A 2ZG1A 3ARFC 4PWFA 2FR4B 3MJ9A 1BBJA 1JZ5A 4RMWA 4YBQC 3QWRD 4LSPL 3P9WB 4OBRA 1Z9MA 2C4XA 5AVSB 1RZFL 2QVMA 5J89A 3H3PH 2OMNA 4FQHA 2EDFA 5DHVA 4R7NA 1GHFH 5BCAA 5I1GL 1L7IL 3TP4A 2SODB 5IEKA 1JXFA 2AQQA 4JQVC 4LIQH 3U4EA 2Z91B 5C97A 2P8PB 4PGZA 3FH7A 4U4IA 3IXTA 3NP3A 4Y4KB 5EBWA 3KR3H 4LU5L 2YAQA 1JJUA 1OGAA 1B0WA 5CEXB 4HGKC 2GQHA 1ETZB 1HXYA 5EO0B 5HDBE 4NUJA 4OD2A 3EGDA 4G6KL 1DQML 3QUZA 1FNEB 4NC2B 1UB6B 2VN5A 4Q6IC 3VM5A 3CVBA 3VJ6A 3M8OL 1B9KA 1KXHA 4GG8A 1YEFL 2F8IA 1S7SB 4FNLH 3W2DL 1KLFA 1QLRA 3FB7A 2XICA 3M7OA 3M6DA 3GF8A 3QP3A 5ABDE 5C9JA 4AYDC 2MOGA 1OTSC 3VWKD 5EF2A 2Z9TA 1ZK5A 1B0RB 4HETA 1MIEH 2VDMB 1GYUA 1B90A 4IGBC 2IDQA 4LHUD 4HDIA 2JTYA 3ZTJH 5EZPA 3HLKA 3BAJA 3EYOA 4B9ZA 1MEXH 3U9PL 4DAGL 2ZXBA 1JFQL 4CBZA 5B39G 4R4FH 1F5WA 3FK3A 1NKRA 1BMZA 3W11D 3ABMB 4H25B 1H6TA 3BZEA 1MFEH 3N04A 4XVUC 3N43F 3V0IA 3QNZB 4W6YB 4AEIH 4Z76A 1I1YA 4CILA 3GSXA 1O9VA 2K7QA 3NJIA 4OKVA 2F58H 4L29B 3CXHK 3VXNA 4EMZA 3VQ1C 1IQWH 5JDJA 1VEMA 5E99H 1J8SA 3TC9A 3PHOA 2GJZA 2Z65C 2ZUQB 1M2VB 4K3HA 2XU9A 2Z0UA 1D6EA 1UEMA 5CUSH 1D9KA 2VN3A 4GAGL 4YSPA 1OTTD 1E9QA 1U8CB 2CJTA 3HG1E 1NCGA 3MYZA 3ZDZF 4AMWA 3FH8A 4L8CB 4DK6A 1F3JA 1J8HB 2ZAGA 5CLYA 3QWNA 1GKEA 3VI3A 1UASA 3WXVL 1V55B 2IJ0C 3CN1A 1H5BC 4WWNA 1ZV9A 2XQBL 4NUGL 3DO3A 4KRPB 3QJTB 2NYYD 4U7KA 5F8RC 1X7QA 5GQBA 3UJIH 5HPOA 1PQZA 3KWTA 5I1KH 1NDGB 4RIRA 2ATPA 5IVXE 3NJMA 2ZCKH 2QGBA 3SBWA 5DFAA 3VRLF 3ILEA 4XP6L 5IEHA 2FTAA 5LXGH 4ZSOB 3L9EA 4F9LC 1A7QL 4X99A 4JZJA 3OAUL 1Q0XH 1BFSA 4PJXF 2ICWB 1ZHBB 3MLSH 3QIWC 3ECBA 1HAUA 1AHWC 1ED3A 2BOCA 4Q6IB 4XE5B 1CZ8L 5TGBA 2O61A 2DQUL 4WJ5A 4BH8B 3FHEA 3GSQB 4HJJH 3OSKA 2E9BA 5B1JA 2O5NA 4B9KC 4KV5F 1DVFC 3R1GL 4UNUA 2IH8A 2IWGA 2QPFA 2WO2B 4QGTA 2PTVA 3DIFB 4JN2A 1AXTH 5IQ7H 3U2SB 4PV1C 5E51A 5CJQH 4GAJH 4YBHA 5BV7L 2W59A 3MRGB 1G7HA 3C75A 4NFBA 4MZ2A 4IGBB 4S1DD 1SJEB 3MA9H 2HRHA 3UYPB 1FL6A 3OGCB 1V8HA 1ETB1 4YVUA 1UKSA 1KEGL 3VA2C 5L9DH 4OGXH 2E7HA 1U3ZA 1WFOA 4OIFA 4Y4KD 3T2OA 5AAMA 2JLPA 4UIMB 3DK2A 3U36A 1U8JA 1VFMA 1KXVA 3F7PC 3I6SA 1G9ML 1M1SA 2X10A 1MRFL 1IGJB 5ACLA 4QTFA 3T8VA 2WAQA 1MFAL 5LJYH 5FFLA 5GGVY 3K6NA 2WPGA 3DOIA 2FH6A 4HEPG 1FIEA 3INOA 4XO3A 4QHUA 1SMOA 2Y7LA 4ODSL 1F18A 1YEIH 3O2DA 3U4BL 2QV4A 3GS4A 2P8LA 1GY2A 5D1QE 3D8MA 1DSYA 4PWJA 2BO0A 5DZOA 1F8TL 3CVHL 1QUPA 3ZPDA 5GRXG 2XKUA 4HWZA 1V7ML 1YN7B 2CE6A 3ILDA 4QHLB 3QYMA 3BRGC 4RFNC 3CGTA 4U1KB 3V9CA 3VFMB 5F9JA 1KTBA 5E2UL 5IW3A 3ZMRA 1CFTB 4P46B 3TO2B 1HIMH 1P5UA 2AXHA 4OIAA 3S2AA 1WJ3A 3MNZB 1HNFA 3ZYOA 3B8YA 3I6LD 3CFKB 4F37F 1H5BB 2YQ2A 3MLYH 2CMRH 2COVD 2DQEL 3MLTA 5I18L 4RSYA 4WK0B 4KO9A 5IQOA 4QI3A 4JW3A 4QRUA 5DJAB 1LP9E 5F88A 4O51A 1IT9H 1KYOK 1KB5H 1W0YT 4H88L 5BZWA 4LP5A 1TKWA 4OCYH 5E1GA 5I1AB 4XBGA 4NQEA 2OM5A 2JKNA 4ODWA 4JO1H 2WXHA 1AKJD 4NBZB 1KYDA 3QIWB 2FX8H 1SJHA 1AHWB 4PD4K 4R5TA 3LHPH 5GS1A 1SEQL 1QBLH 3GXNA 4WVRA 1DVFB 5B3JE 2JXMA 3WIAA 4JREC 1ZHKA 1EO8H 5IQLA 1FE8H 2R15A 5E56A 2J56A 4GYBA 4Y1AA 1J8HD 3RWCA 1HZHH 1IKNA 1EHLH 3GI9H 4D7PA 3TIDA 4TPRL 5AZEH 2CXKA 3ZL4L 4KRPD 3Q2WA 3B9KB 1ASQA 1MF2H 5DUPL 3IMUA 1Q9LA 1GYAA 1CU4L 3MUUA 2W0FA 1F4YL 5IV2B 1MAKA 2HTLC 4ODTH 4XWOD 5JIQA 4LCWA 4LKCB 4Y89A 4R3SB 4NRXA 3WKQA 2VXUH 3O6KH 2VZSA 3VMNA 4G5ZH 2QSQA 3HOGA 5FYJH 5J13C 3VI3E 1RIHL 2B39A 3REVB 3DX7B 4H26A 3QULA 4RSVA 2H6PA 4RZCA 1HINL 1U92A 1FUNA 2I9LB 4OB5H 4G7SB 5ES4B 2DQFA 1GJWA 5DT1L 4ONHB 2F2HA 3RL2A 1CT8A 4LL1A 3RWIA 3GJEB 4H2CA 1CTMA 2ZTBA 5JA8B 1OTSD 4JFEB 5IB5B 3HI5L 4MA1C 2FX7L 4AMKL 4LP8A 2VQUA 3QIUB 2YD2A 4IGBD 4QRTB 1TDQA 1ZS8B 3HE7B 4N0FB 4PJ7A 1NLDL 1E3ZA 2J71A 3UAFA 2WNWA 1I1FA 2ZCHL 4LPVA 4QHKJ 4NAJA 5I0XA 1IC7L 2JLLA 3MUY1 1CFMA 3PXLA 3I9IA 4NZUL 2KL6A 3MOQA 1UXWB 3SODB 5I28A 5DVOA 4TUKL 3SE8L 1OAQL 3EKCA 4BGDA 1BBJB 5GGRB 3RVXD 1D9KC 3V0JA 1LQSR 2NMSA 5JOPD 5K5YA 2L8AA 1S7RA 5INDA 1D5XA 5DC9B 4BFKA 2V4LA 2AJZA 5E8PB 5F70A 2G0KA 5AB9A 3C5ZA 4FQHB 3RGVA 3VGBA 3FOLA 5DHVB 1LO3H 2F7OA 3HLAB 4R7NB 5D70H 1E42A 4KRMB 3F7VA 4BFIA 5FECA 4OUUA 2QPSA 4XP5L 5IEKB 1L6ZA 3WEAA 4WW2A 2F9BT 4PWHA 3U4EB 4HK3J 3WKML 5KVGH 4R96A 1GKOA 2N0KA 2P48B 3IXTB 3SBWC 4XN8A 5EBWB 3S98A 5I8KH 1XX9C 4AQZA 4P46D 1OGAB 2F54E 1F4XL 2OPCA 4FMVA 2WUCH 1ZE3H 4BRJA 5ILTH 1B0IA 1P4BL 3MODL 4MAYD 5AW9B 1HXYB 3D2TA 4LBAA 4Z7WF 1BMWA 1K8DA 2CLVA 2HJKB 4JZJC 3EGDB 2ZX6A 4NUJB 4OD2B 2Q3ZA 4FC3E 5AVXB 3QR2A 3S7GA 4ABQA 4DSYA 3QUZB 1C1EL 1CGXA 3DTXA 3KYMA 5E08H 3BH4A 4O4YH 4JDTL 4GG8B 4PGCA 1V7NH 5B1JC 5C70A 3QXDA 4KVNL 1KLFB 1QBBA 1QLRB 3FB7B 1P7BA 2DWTA 4GXUM 5CEYA 5C9JB 3G6JF 1OM9A 5IBLC 4ELDA 4UQIM 1PX8A 4OSUH 1TG8A 4FNTA 5D96C 2EEDA 5J13B 4HDIB 1HAWA 3NG5A 4L1SA 2AV1A 1DVFD 2BOLA 3K71A 4FOMA 5AAMC 3GXMA 2C9XA 2B15A 4XP4L 2JFCA 4MHHG 4F7KA 4FTVA 4QY8A 3VU2A 4WI0B 3BZEB 4MD5A 4NHCL 5FHAH 2QHLA 2A1WL 5MEQA 1J5OL 4NQEE 4Z77A 5GISH 5B4MC 3B9KD 4YQXH 4Z76B 1I1YB 4U1JB 3GSXB 2BZ7A 3O4LA 4XNUH 3WY4A 4OKVB 4RNRA 4WFGE 1SOKA 3WE6A 3HBZA 5E5UB 3VXNB 2F0CA 4HOMA 3PHOB 3EBIA 1QSZA 2GJZB 1E67A 3G6AA 1D6EB 2IPUG 3A47A 1E5UI 2ZCLL 1U3HA 3FRUA 1E9QB 2ZP0T 1AS8A 5GS0L 5H37A 1P5UC 2WBWB 1Z3RA 4AQEA 3FTZA 4G7YH 4AZUA 2LQRA 1F3JB 2QZ5A 4MCNA 4YDIH 3FBQA 3RKPA 4U6XA 4X5LA 1W0WA 3I9GH 2X70A 5ICZA 5MHSE 1CJYA 1X7QB 1PQZB 1BEYL 4GKOA 3CC1A 4RIRB 2ATPB 3L4TA 4FXLA 5IHWA 1DLHA 1IUZA 3F62A 4XMZA 4XMKH 3QIUD 4WI4A 4ZMQA 1JZGA 4OQ1A 3RBSA 5IEHB 1S3KL 4GSRA 5DD3H 4RGNB 3HE7D 4LSSH 1DBAH 3LXCA 7FABH 2ZKWA 5CU5A 3QDJE 4X99B 2MH4A 5DQDH 4JZJB 5BQDA 1YEGL 3DX1A 3JV4A 3SDAA 4XB3A 3ECBB 3ESMA 2BOCB 5TGBB 2O61B 4LSTL 3N40P 2Y7MA 4WJ5B 3MN8A 3AQDA 5GS1C 2WJ7A 1BECA 3Q8AA 4Q89A 2NOYA 4PRHA 5EUKA 2B1HL 3SJVA 4G7RB 4JN2B 4PJHF 4OZFH 4XPGL 3T2NL 5ISZA 5H94A 1IKNC 4BWTA 2YPVL 3QUYA 5JW4N 5D96B 1G7HB 2DEYX 1ECYA 5AW3B 3QUMA 1IBHA 2IOMA 1A7PH 2JIXD 2RB8A 2NTSP 2WLHA 3FT3A 5A2AA 4KTDL 2H0JA 2JKLA 5KEZA 5KUKA 4J3BA 2QVKA 3HNVL 1B2YA 1NCTA 1MCCA 1OGAD 1U8JB 3U36B 4D3CH 4Z8FH 3D0AA 1EIBA 2IADA 4I9XA 4PGBA 5MI0C 3OZKA 4PY7A 1KTLA 2CJUL 3B9AA 3AW5A 1XF5A 3QQNA 3ZUCA 1UWXK 3MCLH 2OTUA 3QUZD 4QHUB 1JMXA 2VZ3A 2L0DA 4TSCH 2FJSA 2FEEI 1YQVL 3AC0A 4I3RL 1D6VH 2ADFH 2CHNA 2AERT 4FF9A 5EC1A 2KH2B 4UV7L 3SZKC 3DJ9A 2Z7UA 3FTWA 3L4ZA 2HTLD 3KCWA 3LNDA 3E9UA 4WHTB 3LEXA 5F9OL 2PXYA 4HWZB 5I1HL 4I13B 1MJ7H 4JHWL 4MDJA 1VSCA 5L6YH 1G0XA 2VDLL 3EOAA 5F9JB 4XCNA 3VD0A 1RI8A 1OALA 2LHAA 3RWHA 3T0VA 1P5UB 1HSAA 2DI9A 3SPJA 1UA3A 1XDTT 1N5AA 1SMAA 1NCOA 1R75A 4WTQA 4CC4A 3O9WA 2DDQH 4B41A 3PHQA 4B97A 3FSOA 3MV8A 1YAIA 3MLTB 1ZPLA 2NY2B 3WE1A 3CTTA 2RH0A 4OGQC 5D93B 1UQSA 2NNAA 3VXMA 5F88B 4O51B 2W38A 2ITDA 1HZLA 4L4VE 2FSEA 5BZWB 1O9ZA 1NFDA 1SXSA 1TKWB 2G5RA 4N68A 3FU0A 1KCKA 4CBPA 1N7ML 3WNMA 4ODWB 4XMPH 3C5ZC 3S3SA 3TN0C 3N91A 1W72H 3GBLA 5JOEA 1TCRA 2XXMB 4WW2C 4P5MA 5GS1B 3KYNA 4FTVE 2H2SD 1MFMA 1KCBA 2JXMB 1E5ZA 1ZHKB 1YDPA 1FNGB 2ZOUA 1DJGA 2UV3A 3CFQA 3FQWA 1BSIA 4Y1AB 5IJCC 3TIDB 3DVNA 5I5RA 3TNNA 3DTDA 2JCWA 2V5SA 4X50A 1EERB 2ORBH 1Q9LB 1IC5H 4IYKA 4P2OA 3QNXA 3DX8A 2PPAA 1YN6A 3DJTA 2W0FB 3S5YA 5JPNA 2VXSH 4RGND 4LCWB 3QAQA 1E2WA 1XF4A 4NRXB 2F18A 3WELA 3TYGH 4ZNCD 3O2VH 2Y6SC 2XY2A 3D07A 1WUNT 2DYPD 3ARDC 2AITA 4H26B 3QULB 1QLEB 3DIVA 2EUXA 2H6PB 2BSCA 4RZCB 1U92B 3RUGE 3UZVA 3S5LA 1SDAB 2VDRL 1OAXH 2DQFB 1QFWL 4WY7L 2QSTA 3CU7A 3RL2B 3RWIB 3GHEH 5IBTL 2B08A 3IPFA 4XVSL 2D4DA 1ZLVH 4K7FA 4NQUA 3NK3A 5D2LE 1J9TA 3K8LA 4ODXB 1SXBA 5KS9B 3M86A 1MJJA 1IB5A 4ELMA 2QL1A 4PJ7B 5T5NF 1UH4A 1FHNA 1M6OA 4K7PH 2OBGA 4KK8C 1ZSDA 1I1FB 1BJ1J 2XXCB 2ZG2A 1G43A 4PBXA 1JGUL 1YO4A 1HE8A 5SWQA 1R3HA 5TE7L 2BC4A 3NJKA 3D50A 2ZWSA 1Z2KA 1TITA 4K4KA 5J12B 5FK9A 1U3HC 2R69L 2NY6B 5INDB 1D5XB 1L9PA 4JY6A 3P3RA 4WHDA 3RY5A 2AJZB 4YSAA 3C5ZB 4U05A 3RGVB 3ZN6A 3FOLB 4MA7L 1KN4H 2X6AA 2AXFA 3VNZA 3WEMA 3F7VB 4BFIB 5FECB 1A3RL 3N41F 4OUUB 3IWUA 4WW2B 4QRRE 2WCSA 4R96B 5HY9A 2Y1VA 4BGLA 4LVNB 1F3RB 1FNLA 4X80L 3SB3A 4BQBA 5BS0A 4MD4A 2ARJQ 1ZY9A 3S34H 3E6HA 5CN3A 3BKYH 1LK3H 1GC1C 4KK6C 1K8DB 2CLVB 5F89A 4EN3C 3LZOA 1MCWW 3DTXB 1Q1PA 3KYMB 3SDAC 2NY2D 4K7PX 4IRSA 4N8PA 5A2JH 5BOPA 4PGCB 3D06A 3U79A 3C8KA 4G8IA 2EXSA 3QXDB 4YDNA 3WNKA 2J5LB 3V7AG 5CEYB 3SYAA 3T08A 4EN2A 1IO4C 3SKJH 3V6BR 3SE4C 1UM5L 4QJ5B 3LVEA 3WFEL 4HFUH 4OJFL 3QUYC 2QT6A 4PJGE 4WFHD 1EZSA 2AV1B 3NACH 1CO1A 3K71B 3AB0C 1PCXA 5EN3A 2AV7A 3D4YA 4PRIA 2AKRB 4PP2A 1BF8A 2AXJA 5L2KE 4QY8B 1AVAA 4Y1AD 4EI5A 4MD5B 1V54B 1YYLH 4Y19E 5MEQB 3DO4A 2EP6A 3WIIH 4Z77B 3KEDA 3QXAA 2HKAA 4NC1C 5F93C 4LMQI 1NCWL 2IH3A 3O4LB 4PJIF 4K2UL 4RNRB 3OL2A 3WE6B 3WNNA 5I6XC 2W9LA 4L9LA 2PPDA 3S0PA 3KJ4B 3NRFA 4OF6A 1XTLA 2YEVB 2YKLH 3PCYA 3BN3B 4LCWD 5IT2L 5J1SC 2AFNA 2PXYC 1CN4A 3CK0L 3LKPA 3G6AB 1Q1JL 1S5IL 1VZGA 4QHNA 3CVHA 1U3HB 1P7HL 3FRUB 1JZDC 5A2FA 3Q8BA 2ZUUA 4JDEA 3SGJA 1SOSA 4DWHA 3Q48A 4AQEB 4BSJA 4NNYA 4A66A 1QA9A 2JI3A 4IRZA 4U6XB 4CC4C 3O9WC 2CH8A 1W0WB 5ICZB 3CQPA 5KW9L 3VFSB 2DBLL 2CO3A 2YN5A 4FQJH 3CX2A 2BOBA 4DETA 4PB9L 4ZXBA 4UM9A 1DBKH 3HBPA 5L7XL 3MZTA 3TBYA 5A2KH 1UZ6E 1DLHB 4RETB 1XSIA 3K2UL 3L48A 1ZLSL 1G1KA 3QHFL 1AO7E 2VDPB 4OLXL 4V1DA 3Q0HA 3AXHA 4M8QA 2WXFA 5E2WL 4DW2H 4XPAH 3PHAA 1KIQB 4AKQA 3HC3L 3JV4B 3SDAB 2LLGA 1IQDA 3BXNA 3ZGIA 2P1YA 4F8NA 3T3MB 2YQBA 5AOIA 2X1QA 4J4PC 1YG9A 4PRHB 5EUKB 2NY6D 1DBJH 3SJVB 4D9RD 1WD9A 3ASNB 5F21B 3N50A 4GKNA 3RGVD 5ISZB 2AJXH 2C9AA 1A25A 2Y2WA 2F7QA 2OW6A 3QUYB 5JHAA 3L5IA 3G5XA 4N86A 1T5WB 2XC8A 2O6DA 5BNXD 2EDOA 2CO4A 3OX8A 3QUMB 2J6WA 4M7LL 3FT3B 4NRZB 3IU3A 2C5DC 3AB0B 1TXKA 3HPLA 5JPNC 3WTWA 1WG3A 1FJ1B 5CSZA 1U8PA 3SE9L 4LQ1A 4QXUH 2IADB 4PGBB 5FGRA 5EEZA 35C8L 5DK3A 3WV0A 5GRYA 2CO7A 2A4CA 4PY7B 1KTLB 1XF5B 1RUAL 4FEMA 2J57A 3ESNA 3NSYA 2OTUB 4FRWA 3WG7B 1AS7A 3K5RA 4JG0H 5KTEH 2V37A 5GJSH 2ICWI 1ZHNA 3IXAA 1U8MA 3IEAA 3NP4A 5EC1B 1Q4NX 1NFKA 5J57B 3FQNA 4A2GA 3CFUA 3LEXB 1H3WM 3FRPG 1BYNA 4UT9A 4N2DA 4S0TD 4MDJB 4Z7QB 1ILSA 1BF2A 2Y6SD 3EOAB 2B9BA 3A4EA 4ZZFA 3CHQA 5I0ZA 2EVJA 3RWHB 1JYNA 1YMME 4D8OA 1HSAB 2YRPA 2VSDA 2AK4D 1N5AB 2FQGA 2MPAH 1KGUA 2AEQL 2FNBA 3CN0A 2DWYA 1LXMA 4Q0XL 3IMBA 2NUPA 2HVKA 3DYOA 3O9WB 1RPUA 3M1OA 4BZ2L 3C6EA 3B7SA 1N6UA 3PHQB 2WNKA 3TFKD 3MV8B 4N0RA 4N8UA 2YXWA 3OR6A 2P3YA 3QDMA 4X6CE 4WI6A 1UQSB 2NNAB 1TJIL 2HXAA 4MZRA 3VXMB 1MSPA 5FM4A 4L18A 3FUIA 2E76C 3VXUD 4KQ4L 2FSEB 1NFDB 4NPJA 3UYRH 3VXSA 3O4LD 4PG2A 3THMH 4NQSA 5T5FL 4WWPA 4ZS7H 1S7UA 5F7AA 1HZKA 5C0RH 2ZP8A 3BCDA 5D7JC 5ECJE 1TCRB 1M4KA 5FYKE 1RERA 5CBEA 4P5MB 1WA1X 1WICA 2LVEA 3KYNB 3N2JA 3DSNA 4N5ED 2YGQA 1TPXC 1U3HD 4BCYA 5IMMA 1R3IH 2ENQA 1YDPB 2NTFA 4Q97A 1FPTL 2YA0A 4LOUD 5GRJL 1BPVA 3FQWB 4ZAKA 1TVBA 3WFDL 2GITA 3V4PA 1OV8A 2J44A 2BFVH 3TNNB 1AY1H 5CLZA 5EA0H 2I9TA 4HJGA 2QQLL 3FUNA 1FCCA 2VUOA 1R3KA 3KVPA 1F4WL 4JFUA 4LE8A 3WU1A 4P2OB 2DV6A 3QNXB 3DX8B 1I1AA 1YN6B 4RGOL 5JPNB 1KPRA 3PWJA 4FLQA 4KY1H 4UF7C 1LD9A 3QR0A 2C9PA 4Z3IA 1PZ2A 1T03L 1T89A 3ZE1E 1PZDA 1XF4B 2XV3A 5I73B 1VHPA 3IGAA 3EYUL 12E8H 4M5YL 4P2QE 5LCVL 3SDAD 2WP3O 1A7BA 3S36L 4ERSL 4EXKA 2Z92A 4XX5A 2DI8A 4OAWA 4YLQT 3UZVB 3S5LB 4PRHD 5DI8A 1AI1L 3SJVD 3PAVA 4GQ9H 1LQBC 2R0KL 3K81A 1MCRA 4EI5C 5ISZD 4K7FB 1EO5A 1BXVA 1BLNA 2X38A 1MJJB 1OK0A 4JKPL 4ELMB 1WUZA 1DSWA 3LS5H 1FIGH 1L5GA 2ZCZA 1M6OB 1VFBA 3CSYA 1ZSDB 5KSBE 1N0LA 1OIOA 3LPFA 2IMMA 2WNGA 3OKKA 5CFAA 4L9LC 4KMTL 3TEWA 4AE1A 5TDPA 1JZEA 5SWQB 1R3HB 2B0SL 2BC4B 3V55A 1CBVH 5DC2A 2QFRA 1NDMA 4Y5XA 4MMXA 5FK9B 5BJTA 2Y1YA 3B3BA 5AG9A 4XC1L 5B1BB 2ZKMX 3APDA 5EIVA 4TRPH 3MLZL 3SGJC 4JY6B 5FKPA 3ELAT 3HHRB 5ECGA 1G6RL 4XB7A 4EQ3A 2IWKA 1NH6A 4LSRL 2FO1A 1NMBH 2AXFB 3IAGC 5HYJB 3F05A 1RUPL 4NLHA 3LRMA 1ZGLM 5LBGA 3P4NA 4XP1L 5HY9B 4WUUA 3NSFA 1XWVA 2APFA 5BS0B 3KPSA 1S7WA 4MD4B 2XWXA 3ARGA 2Q7NA 1CDGA 3E6HB 2EDRA 3WKYA 4BH7A 2Y23A 5F89B 2Q8BH 2R29H 4LLYA 2OMVA 4BSVA 1J0KA 3QG6A 3MV8D 4YHOL 3MLVL 4YSEA 3OPZH 4IBZA 5KBNC 2FNWA 3RKDC 4GG6A 2IIJA 4IRSB 1SLWA 2B59A 4X9HA 3WTUA 3UTOA 4JM2C 2HX8A 5D5ME 1TQUA 4U0RB 3VXMD 3C8KB 4BXSV 3OHMB 4G8IB 1UENA 4BRVA 5ICXA 1PG7L 4ODVH 2F5AH 4JZOA 2RCSH 3VSQA 2ZYHA 1FFOA 4KRLB 3WD5L 4JB9H 3ARBD 1W6LA 4JAMA 5FGCB 1AQMA 5D7IA 4FQ1L 3PDDA 4ZG1A 3F3HA 2F5BH 3LV3A 2EYSA 4X7TB 5AVTB 1SBSH 1S78D 3REWA 3V5DA 3FUEA 3N1QC 5GRVK 5TE4L 3ASWA 3N9GH 4PREA 3JVFC 2YPVA 3W1ZA 3GM0A 3CHSA 3OD3A 2APWA 4JO4H 2AV7B 4OGYH 4PRIB 2W8CA 2EDBA 3O0LA 2R2EA 2YAFA 3QQDA 2JKRM 2VRQA 4HJTA 4HYTB 5JDSA 3L4VA 1J11A 1JHKH 1JNNH 4LPWA 2WWMC 3CXHJ 1N6QL 3HAEA 3R7QA 5TFSH 2O30A 3QXAB 3C5SA 3MJ9H 5KOVC 2IH3B 3KLHC 1UT2A 1JERA 4KXAA 4YXKH 4P2OD 3IK2A 3FC8A 2X3CA 1GZPA 9PCYA 3QCVL 4HAFA 2VDQL 4BINA 4ZK8A 2J73A 4OLWL 5EU7E 3MROA 3LKPB 5CP7A 1A14L 2APXA 4LCUA 3US0A 4PJ8C 4QHNB 1D7FA 3CVHB 2UWEE 3SGEI 1OD9A 4JDEB 3ZE2F 4PW9A 3HI1A 2F19H 2XTSA 2X2UA 2VTFA 2EDKA 3GMMA 4IHOA 2FRGP 4NNYB 1DQQA 1QA9B 3QRLA 3MTRA 1G7JA 4TQHA 3CLFL 5EIIA 5TQ0H 5FX3A 2BZCA 3WY1A 2CHWA 2X6MA 2BOBB 3OAYH 1WZKA 4ZXBB 2X9YA 3TU6A 4UM9B 2BXYA 3NCJH 1JNLH 4UQCA 4WHYH 3TBYB 2Y1ZA 3U6RA 3U9WA 3WENA 2ED6A 5CBAA 1EEQA 2EEBA 4OCWH 4L0PB 1P4UA 4HK3N 3BAXA 3DHPA 1SYVA 2KERA 4PJFE 4V1DB 4B96A 4PG2C 4HCRA 1JCKA 4M8QB 4PJAE 1T0MA 4RLDA 3T71A 1JWUA 3U7WH 1MREL 2ZNXA 3CZJA 4PJEA 2ZJSL 5F0LB 3SGEH 1OVZA 4FNPA 4DQOL 4WI9A 1IQDB 1N4XL 3B5GA 3BXNB 4PWEA 4S0HA 4A39A 2UVEA 2OMYA 3OB0H 1NEPA 1MN4A 2GJRA 1U41A 1JZ2A 5I19L 3A4FA 3G3LA 5F2FA 4DPAX 4U6HA 3GMLA 4D9LL 5JW4M 4RBPK 2P24B 4DFHA 4RFOH 4ZAKC 4GKNB 4C56A 3CN3A 3PQYE 4OM1H 4K5NA 1NFIA 4F27A 3G5XB 1KG0A 4PLKC 2WM0A 2E4FA 2BRRH 2OA9A 3EJQA 5HYJD 1GS7A 3OM3B 3CFBB 3OX8B 4I9WD 4ISVA 3HVDA 4YC2C 1YEJL 1XR8A 2NSQA 4Q6KA 4XPHL 4P2RD 4PJBE 6CGTA 4NIYE 5ID1A 3IU3B 3QORC 5BS0D 1I1AC 3HPLB 2BS71 2I69A 5TQ2L 2IPKA 5EBMA 5CSZB 1U8PB 4UOQA 5H8DA 4PLNC 1T89C 1MW2A 4O5LH 3PWUA 2GB2A 2VOTA 2CO7B 1ZXQA 2XLLA 3NJXA 3KPTA 4HIJA 4NWTL 2GBVA 3GUFA 4Y2OA 4IRSD 4XHJC 2EYRA 2JH2A 4A7GA 1ZHNB 3IXAB 2XVBA 1U8MB 4NUPA 5AAWA 5I2IA 3FQNB 3PAYA 4L1HA 5FFOA 3MXWH 1S7TA 4WWKD 5B38A 2KPWA 4KZ0A 4Y8AA 3IMVA 3SYCA 3KJ6L 3FB6A 1E4JA 3ZQWA 1N5YH 5HP5A 5DMGC 1A4JB 2Y5EA 1NGWA 3VQ2C 2MCG1 3IU4H 5CM1A 5I6KA 2E4TA 2NUPB 2HVKB 5DDHA 3OBAA 1BM3H 3WTSA 4PRID 3Q6GH 3BEWA 1JZ7A 4AEEA 4MMYA 3QDMB 2VISA 3RVVD 2MKLC 2B8OT 1FAIH 2EADA 4MMXC 4K9EC 3RG1C 2QJDA 3BVVA 3CFDA 4WGVB 1A3ZA 2I7SA 3FPXA 4NM8H 4ZW3A 1E4KA 2NSMA 2WO3B 1DQLH 2Z35A 4PD4J 5GS2D 3VXSB 4NQSB 3ZBMA 1S7UB 1T1ZA 1RQ5A 3ZE0F 4Y9GA 1OARH 2A9NL 3P11H 2FBJH 1NWPA 3BFOA 1H3PH 3FQ2A 3EBGA 3US1A 1U3NA 3DSNB 2GHWB 3DX9A 2GBAA 3GIVA 5DJDA 2PYFB 5IMMB 3N44F 3NIGB 4FFZH 4V2CB 2NTFB 2PP7A 4R4ND 3ARGC 3FYIB 2JQMA 4Z95L 3U4AA 2AJ3A 3JZYA 1IBDA 4ZAKB 4N6RA 1IKFL 1TVBB 4M5ZL 2GITB 1Y6MR 4I3SH 3V4PB 4N8VA 1QVOA 4XNQA 4AVIA 3FU7A 2YMOA 3Q9QA 4G6JL 2Y25A 1NCDH 1QYGH 3GBNL 2J20A 4LSVH 4HJGB 4N22A 4ZXBD 3T2PA 2I9TB 1OCZB 1R3KB 1HOCA 3RPBA 3T1FA 4P06A 3LRHA 3RE0A 1T66D 2F53A 1I1AB 2B7DT 1FGVH 2PMZA 1OCWH 3ULAB 5CEZL 1KPRB 1PSKL 2J88H 2J6EH 3PWJB 1SHXA 4NSKA 1LD9B 1QRNE 4V1DD 1JK8A 3PDGA 4Z7AA 4QTIH 3GO1H 4Z7OE 1PZAA 5AG8A 4UOW1 1FNFA 2CPCA 1DBMH 3IGAB 1HHGA 2OXHA 4MAUL 1E5YA 3D4GA 4UWQB 3S88L 4MMZC 3RKDD 5CLXA 4JN1L 5L88L 1E0OB 4L1LA 2Z92B 6TAAA 2JWYA 4OAWB 3EZ8A 4M3HA 1GW6A 5DI8B 3NEEA 1WBZA 3NA4A 3FL7A 2YSTA 2HFEA 5FCUL 4OF7A 2QEJA 3UPCA 4E9XA 3V6OA 5ELIA 4DKEL 1BGXH 1BLNB 1UA6L 3WIFA 4FQCH 4PJEE 3MJ6A 4KPHL 1X5LA 1L5GB 3VCLA 3U0TA 1VFBB 3AG1B 3CSYB 3K1KC 1N0LB 1SBBA 2C9QA 1L9QA 3KLDA 3OKKB 3V4LA 5TDPB 3L13A 4F2EA 3BFWA 2UZYA 3BMVA 3A6CL 3JT2A 4JPKH 3AACA 3P73A 4Z7VA 3QEQA 2GK0A 4EDWL 1NDMB 4Y5XB 4MMXB 5CP3A 1SN0A 5BJTB 3VFGH 5E9AA 3K7UA 4Z7NB 3P4LA 5CWSA 4HKZA 4N0CC 4PJ9A 5LBSH 5FKPB 3TH2T 3HTLX 3DDGA 3LVTA 3OVUB 4RFEA 4PLJD 1J9RA 4FEIA 2IBZX 4JPVL 4GSUA 4YSTA 2OCJA 4ZZKA 4HD5A 3V2AR 4AC4A 5J11B 4F57L 1NEUA 3P4NB 2CUHA 4WUUB 3SQOH 3Q1SL 5D6DA 2C9VA 3NBNA 3KPRE 3KPSB 1S7WB 1K3IA 1BFOA 1EJOL 3VSTA 3ARGB 3NEOA 5FUOL 2E5EA 2Y69B 4BH7B 5SWSE 3VGAB 1CDHA 3B7TA 1KIPA 5DUBA 3LH2H 5HHNA 1IILE 2OMVB 4G72B 4HJ0C 3QG6B 4BSVB 4K3DH 4GG6B 3QDMD 2V7NA 4FXKA 3QVAA 1DQTA 5C07E 4DP8X 3LIZL 3ATDA 2XX1A 3MJ8A 3TV3H 5J8OA 5ICXB 2CNZA 3N6YA 4JZOB 1QR1A 4GFTB 1CE1L 1WFNA 1FFOB 2PCPB 3SCMC 3VXSD 4AGNA 4Y1TA 3FB8A 3V4VL 3T0EA 1ZLWK 2BHZA 3MOBH 4JAMB 5D7IB 3NIFB 4EF3A 3QAZC 3LV3B 5HGGS 2EYSB 3OHXA 1IKOP 2EIEA 4DK5A 3REWB 3V5DB 2FQDA 1JSYA 2BHUA 4NZRL 3T2QA 2BSDA 3MV9D 4PREB 1N8ZA 4D0CA 2VLMD 1G7MA 5HVFB 3U30C 3BD5A 3BRDA 3QQDB 2R2EB 4UB0H 4ZAKD 1Q0YH 4P9HC 2CDEA 3A3YB 3CVIL 3HAEB 4QIRA 3ZDZE 2VRAA 5AVWB 3BLKA 3C5SB 2I5YL 3M7FB 4MDRA 3U0WL 1WZMA 1BQRA 1JPTH 3AABA 4KKQA 5MENE 4MRBA 3VTMA 1I1AD 1WEJL 2HFGL 1GZPB 5AAWC 5JPMA 2VR8A 2YEZA 2LU3A 4YH6A 1UACH 4N25A 4NFCA 3MROB 3ULVC 2C3HA 5CP7B 4MSWB 3HUJA 1QSEE 3VRLE 4DN4H 4JFTA 3SD2A 3OWRA 2WWOA 1H0DA 2LFEA 2FGZA 3H9SE 1DEEA 2VRKA 3HI1B 4UV4H 3K0WA 1IZJA 2EVGA 4P5TA 4IHOB 1DQQB 2NDGA 4PJXE 5HVHB 1MNUL 1G7JB 4KKLD 1UFUA 5EIIB 3TA4D 1ZGLA 5E7FA 2WB7A 3D48R 2BZDA 3EOBA 1OAKH 2OR9H 4KV5E 5KJ4A 5IB4A 5ACZA 4KXZI 5FYKL 4BZ2A 5CBAB 1H8NA 1FLTX 2G4EA 4HF5L 1TTUA 1Q9KA 2W91A 5LBVA 1LO2H 1SYVB 3QXVA 1E4KC 3FHQA 4GBXA 2AMGA 3WHXB 4G9FE 1T0MB 1VGKA 1JWUB 1WRFA 4Z9KB 2EVHA 1KPVA 1I8KA 1G94A 1ZEAL 3I75A 5I5IA 4X4MA 3ZO9A 2VC2H 4QDGA 3MRDA 3ATAA 3FFCD 2OMYB 4IKLA 1H6EA 1VA9A 1PZ3A 1FLRH 4TQEL 5CCKL 1UVQA 1NEZG 4U6HB 3GMLB 1LLAA 3LZQA 5FIEA 4B7LA 2BH0A 3BAIA 4C56B 4KXZH 1NFIB 5IFAH 3QAZB 5IY5B 1E4XL 1LILA 1KG0B 1GMEA 4RWYH 4ZMTA 1JXGA 3DVIA 4ISVB 1XR8B 3GSOB 1DBBH 3A21A 1QSFE 2E86A 2L7UA 1GA2A 3DETD 3V5KA 1I53A 5ID1B 1MFDH 3KPSD 4NLAA 3U30B 2IPKB 5EBMB 3WNPA 4NBYB 2CA4A 3LNGA 3MRKA 1CPUA 4LHUG 1RU9L 4HWUA 1VEPA 4UTCA 4HIJB 4ADIA 2P5EE 4M7KL 2FUTA 4JFQA 1EMTL 3S35L 3MBEC 4FQLL 4M43L 4MRCA 3IM1A 2IBZY 2W1NA 5HXMA 4FZEH 4X4YA 2EYRB 4OLEA 3P30H 1BLIA 3QGVA 1IV8A 4B6ZA 5I2IB 1FDLH 3FMGH 5LCVA 1S7TB 5T1DH 5B38B 1YNKL 4XRCA 5SWZE 4AXWA 4BDVB 5F96H 3FB6B 4EI0A 1IC4L 1PL3A 2VT0A 3F58H 4Q6YA 3V6OC 4BM7A 5T3ZH 4DVBA 2VDRB 3BEVA 3PL6A 4J3VA 4GI6A 4NO3A 4Y5YC 3X14B 2AQ3A 1JGVL 4BUQA 1P1ZA 5BRZE 2JMRA 5BZZA 1NGWB 3LEVH 1PGRB 2Z4QA 4F8TA 5J1TC 5AD0A 1YSOA 2R0WL 2VDPH 3HE6A 3WJJA 5LHDA 5DDHB 2RD0A 3MXVL 4DZ8B 5AAPA 3BEWB 3BZ5A 3VYOA 4Y2DA 4JFHD 1BQHA 1V05A 1H19A 2IGFH 2OQJA 2ZUWA 4MMYB 5J06A 3MJ7A 2VISB 4ZUTA 4FDWA 5EZIL 4IK7A 4POZC 2DTML 1CLYH 3I50H 2OCCB 3CFDB 3X3FH 1MWOA 2Z35B 1IBGL 3DBSA 1EAQA 6FABL 3NIDF 3LRGA 2N7AA 4EZJA 4DOHB 4DTGL 1RUKH 2UZIL 4UT7L 2OMUA 2O4EA 3H85A 3IFLH 2LE9A 1G6RA 3M07A 5AKRA 5EEUA 4M4RA 5KVEL 5DJDB 3GIVB 5D6DC 5TDOA 4P2YA 3B2VL 5BOZG 1QTSA 3IDJA 2Q2EB 1X6NA 2AJ3B 1X5AA 3B2PA 2Y3NA 2NY5H 3Q06A 1CYXA 2WVVA 3BGAA 4N6RB 3CZGA 4YHNA 5K59F 4OI7A 1IJNA 2J72A 4HA1A 1BFVL 1QVOB 4XNQB 4NFDA 1KY7A 3FU7B 4GXVH 1F1GA 2I7OA 1FFPA 4I88A 4TSAH 2XWBB 4ZMYA 5LG6A 2FJGB 2WZAA 1HOCB 4FXKC 1BQUA 2F53B 3NPSC 1JXDA 2VCOA 3A67L 5E70A 3U4KA 4ZO8A 2XUWA 4NSKB 1JK8B 3EOTH 3GJFK 5LO7A 3T0EC 3TEYA 4UNTA 3SPIA 4DIXA 5EOQH 1HHGB 2DQIH 2OXHB 4HJ0D 3KGTA 4UU9A 3QIBC 1RD6A 4K73A 1X3DA 4HMDA 1ZIAA 1NCAL 5DVMA 4PI0A 3BPLC 2VLKE 3SOTA 2OULB 1IC1A 2L04A 5DJZA 1QMUA 5G2NA 1J88A 4NX0A 2NNXA 1WBZB 3IDXH 1TYRA 2A7BA 2HFEB 4B7IA 3QZLA 3KYOA 2AZAA 2X1XR 5CXPA 2BNQA 1WFIA 3H3PL 1ODAA 4L4TA 4N90D 1BAGA 3WIFB 5FDYA 1AHKA 4IRJC 4S1QL 1EGJL 3LNEA 3VCLB 3U0TB 4KJQD 1PVHA 4PVBA 4OM0H 4ZUSA 4P07A 1ZGLP 3WAKA 2CDFA 4X4ME 5JPMC 5IROD 2WXGA 3ATEA 4H8VA 2UZYB 3GBML 3P4OA 4JGMA 1EX0A 3OLGA 3P73B 4LSPH 4Z7VB 3QEQB 2GK0B 4HKXA 1RZFH 5C7ZA 2YAEA 3U82B 3O6ML 3SPVA 2KHAA 5CWSB 4PJ9B 2DLFH 4Z7WE 4RFEB 5I1GH 2VDOB 1TTFA 3H56A 2EXYD 1L7IH 1L9NA 4R7VA 4K94C 4YSDA 2X9XA 1L6XA 2VJ0A 3APMA 1G87A 3SHSA 3ULVD 2IGTA 2G9HA 1LDSA 1A64A 4LU5H 3EYSL 3K2MC 3P2DA 5D6CA 1MFUA 3S4SA 5I0VA 5EOTA 1BFOB 2E59A 3G6JE 2AQ2A 3K4ZA 4G6KH 1RP8A 3CFCL 4GBXC 3ULUC 3L4YA 1FF5A 2QV2A 2KDYA 1MEXL 1KIPB 2VL4A 5DUBB 3JWNC 5HHNB 1RXLA 2JF1A 3ALPA 1UD8A 3KGSA 3M8OH 1CDBA 1YEFH 5FW6A 5C08A 3MLXH 2V7NB 4FXKB 4YGVA 4JRXA 4H0HB 3AY4A 3NPSB 1U30A 3D2UD 4G70B 1QR1B 1CGSL 4JVWA 1PPIA 3FTSA 3T0EB 3FB8B 5C7XL 4B9YA 2AAAA 2ESVE 2Z6FA 2F58L 2WOYA 2XN1A 3U9PH 3BN9C 4HIIA 4DAGH 1JFQH 3OHXB 4WDIA 4OFYA 2MSPA 2WANA 3LRSA 4D0CB 1N8ZB 1XT5A 4N1HB 3B37A 4H0IA 1G7MB 5CUSL 5IZ7A 1AZRA 1I9RL 1NPJA 4J8QA 4RMBA 4ACTA 1JHLL 1BVOA 2BS8A 4JHZA 2CDEB 2P4AB 3HBGA 4PIRF 2LR4A 1U9KA 1RIVL 4MNQA 2CR6A 3AQXA 3V0WL 4ELKA 2WP3T 3WY2A 5IB1A 5EZOL 2F53D 5JPMB 4YHMH 5DYOA 5F8QC 2X2YA 4QWWD 2QLYA 4GAGH 5LXGL 3HUJB 4BZ1A 2NYKA 3PL6C 1H0DB 2CD0A 2FD6L 2FYYA 4GUQA 2FX9L 3AM8A 3WXVH 1DEEB 2H5UA 4IK6A 2XQBH 1EDQA 4NUGH 4M61A 4P5TB 4U1MA 5E6ZA 3E8UH 5DRZA 3HE6C 1HE7A 4FI7A 5C9KA 1FZOA 1FH5L 1RPQA 4HT1L 1FZJA 4EUPA 1MAML 5CINH 1ZGLB 4Y2DC 3EOBB 4XP6H 1CBJA 3GMOA 3IN2A 1VRSA 2HTKC 3NJVA 1E5BA 2HZHA 2XG4A 3QS2A 4U7SA 5ACZB 1QPPA 2N1TE 1Q9KB 1A7QH 3PP3H 4PJHE 3OAUH 2XZCL 1MHCA 2VMCA 4D9QD 4GBXB 3ECUA 3CPUA 1VGKB 2KZWA 4KVCL 1K5NA 2XBZA 1BYPA 1CZ8H 2DQUH 4PVLA 2GCYA 3BWUC 4E41A 2YLKA 4K55A 4A1RA 4M48L 1KPVB 1I8KB 3R1GH 3I75B 5TH2A 3QEQD 1Q38A 1CVSC 1G1OA 3FT0A 3MRDB 4OJYA 4E68A 5DZAA 1BMGA 1ADQA 4U2YA 1RZPA 1UVQB 5HHOE 1UOWA 5ITBL 4PJ9D 1UXLA 5BV7H 3O3EA 4PRPE 4TVPE 4B9GA 3IJ7A 2LU4A 2ZAIA 4ZQTA 4W9JC 3FO9A 3O3UN 1RK1A 1TCMA 2Y6TE 1KEGH 2C9RA 4HKJA 3HR5A 4PS3A 4FA8A 3IDMA 2NY1B 3R0NA 1TLKA 2Q87A 2EO1A 5FLVA 1G9MH 1KFGA 3V5KB 1ZVSA 1MRFH 1OT2A 3RILA 1IFGA 5GS2H 2CRYA 2YOAA 1MFAH 2F6AA 3MJGX 5BXFA 4MLIA 3MRKB 4MKTA 1QEXA 4ODSH 4URTB 4NN5B 3U4BH 5CN2A 3UC0L 3BVTA 1ASOA 4JFQB 1FO0L 3BT2L 3QZWA 5ALCL 5SX4H 3MLYL 4YGAB 4MQSB 4NNPL 1AANA 4X4YB 1F8TH 1MQ8A 3CVHH 2BX5A 4NBXB 1N26A 5DGRA 1V7MH 5BZXA 3L3JA 1AE6L 2GY7B 1NIAA 1IT9L 3JWDC 4XRCB 1XGPA 4AXWB 2HUHA 4DP1X 3T0ED 5E2UH 2VMFA 4OCYL 2BCMA 2W81C 5I17B 4DVBB 2JKSA 3BEVB 3PL6B 4NO3B 5DHDA 1P1ZB 5DMKA 2ZWNA 1JUFA 3N55A 2Z4QB 1A0QL 2DQEH 4M6NL 3CLWA 5AD0B 5IFHL 1KJ2L 3HE6B 4C4UA 5I18H 5CZXC 1T0NA 3L5XL 3D18A 5BRQA 3UXFA 3JTBA 1QFHA 5F72S 4Y2DB 1BQHB 1AKPA 1O0VA 3C6SA 4H88H 2OQJB 5EG6C 3O45A 3MJ7B 4YSRA 3BI9X 4ZUTB 1DZBA 4XN7A 3BKCL 1LMIA 3SZ6A 4JPWL 2HUEA 1WV7T 4LOEA 2Z7WA 3MSPA 5DZPA 2IFGA 5B1CA 4PCTA 3UIZA 1SQMA 5GSVA 1UB5A 4W6WB 3B1UA 1MNNA 4KZDL 3OAWA 1HSBA 3HC0A 3P3SA 2OMUB 3F8UB 3PAZA 1AC6A 1G6RB 2Q7AA 1VKXA 4M4RB 1SRDA 2VXUL 3O6KL 1NIEA 1T5KA 5TDOB 1QO3A 3CBRA 1JMZA 2UXVA 2ICEA 4MXVF 1JZIA 2WSKA 3IDJB 4XO9A 4TPRH 3VFOA 3F7RA 3ZL4H 4P5TD 1GJIA 3HJ0A 3SBRA 2WVVB 1HESA 5DUPH 4A7VA 4YHNB 2DMGA 3TF7C 1FHGA 4NUQA 1DUYA 5AKVA 2EQDA 1A4CA 3CVCA 1CU4H 2YJQA 3SY0A 1DL7L 4Z3FA 1EZVY 1FFPB 1PAZA 2ZAHA 4AYBA 4K3JH 1F4YH 3LKRA 1TQBC 3AY4C 5E03A 3FNKA 4OLZL 1UHVA 1TTCA 3MV7E 3FQTA 1QBML 3O6FA 1KGIA 4GBXD 3OLDA 5D2NA 2A9MH 1RIHH 4AUUA 4DEUA 3OKNA 1I7ZA 3CFIC 4TQ8A 3ALXA 3VXPA 2B4CC 4UU9B 1HINH 1O6TA 3V4VA 4JPIA 2RACA 5DT1H 1IAMA 2Q9OA 4M1GL 1V3LA 3B9VA 2ED7A 3HC4L 3IJSA 3VE0B 5DJZB 3JWOL 1R5WA 3HI5H 2FX7H 1M1XA 2Y24A 2YOCA 3IPEA 4AYSA 3G5ZA 2BNQB 1KXTA 1NLDH 4L4TB 1GY1A 4JKWA 2ZCHH 2M2DA 4L8SA 2NY1D 5I66A 1IC7H 3FU3A 4NZUH 5CJXA 4ZUSB 3RHWK 5KVGL 2CDFB 1W8EA 4KNQA 4TUKH 3IMWA 3SE8H 1IGCL 1OCOB 2V9QA 4N0UE 3P4OB 2H1PH 2EABA 4HKXB 3V0FA 4OZGA 1NCNA 2BY0A 4OI9A 4OV6F 2VDQB 4XMTA 3BP7A 2HLEB 3WS6A 4XP5H 5EFIA 3S3JA 3TBSA 2EZ0C 1V7NL 5F6HI 3WKMH 3WKNA 2WLKA 3EJTA 2W0LA 4AIOA 4ADJA 4XNDA 4I2XA 1CF8L 2G9HB 1ZTXE 5HDBF 3BUPA 1PAMA 2R0LL 2GSIA 3PL6D 4LF3A 4MNHA 5D6CB 1JPST 3HS8A 3S4SB 1P4BH 3MODH 2ENPA 5EOTB 2BM3A 4LPUA 3OWEA 3FF7A 5F9DC 4UBDC 1TTRA 4NKIL 1C1EH 3HE6D 3TCTA 5I71B 5HDQL 4GINA 2DQGL 3V8OA 4JDTH 1XHHA 2HCZX 2G4GA 4Y2DD 2AI0L 4KVNH 5C08B 5H35A 2AXGA 2DQTH 3M1CA 4YGVB 4JRXB 7CGTA 5AW2B 3S97C 1F86A 1AGBA 1FWXA 2YWYA 4MJIE 4U31A 4XCFL 4PPTA 3RDTB 4NZJA 3CD4A 2IH1A 5JMRA 1EEYA 2L3BA 1HN1A 4YFLI 5GGQL 2P28B 2C3GA 3POHA 3E3QC 3A6BL 2WZ6A 4TL4A 4HIIB 5C8JA 3WFCL 5E9DE 1XGRB 4PJIE 4WDIB 3L7EA 5D72L 3LRSB 4GT0A 3ZZSA 4XP4H 4F91B 3I9PA 4WIQA 1QPXA 3CZNA 4NHCH 1NLBL 2BY2A 1J5OH 1ZTMA 3LMJL 2YBRA 5F6IC 2C9UA 3NYKA 5F0MB 5J1AA 4H8PA 3CZUB 3H0TA 4PIBA 4I5BA 4MNQB 4ELKB 1X5HA 1S9XA 4Z3HA 4M8UA 2JI1A 3WJMA 5IB1B 4QNPE 3NUKA 3ZRCC 1F45A 1X5FA 4TNGA 4LNVA 1PKQE 5DYOB 1UCTA 2VDNL 1KB9K 2NY3C 5BVPL 2ZCLH 1E5CA 4FFWD 3BJ91 4K8RL 4LSSL 5GS0H 4XO4A 2I85A 2CR0A 3LCYA 3TA3D 1GAFL 2OK0L 2FYYB 3ZMEA 2YAHA 2ZOLA 3DVGA 3OMAB 3CAFA 2XJLA 4M61B 4NQCA 1G7LA 3LKQA 4U1MB 5DRZB 5K39A 2CQVA 3B2MA 1BEYH 1FZOB 3QH3A 4EUPB 1FZJB 5DEZA 5I30L 4AYEC 1KJMA 1R34A 5E9NA 4CN1A 1MCJA 4F8LA 2XG4B 3EGSA 1BOYA 4L4TD 3RWGB 3TOPA 4HWEH 3HS0A 4A2DA 3D85A 4HU2A 2BW5A 1MHCB 1YEGH 1O7DC 1BD2E 2Q76A 4E5XA 1K5NB 3ROOA 2JJVA 4LSTH 1Y6KR 4E41B 2GCYB 3JSSA 2FHFA 1RZKC 3FQYA 5LGYA 2UVFA 1OF2A 2QR0A 3AS3A 5TH2B 1NZRA 3CHXA 1JDAA 4CKVX 2H41A 3OC5A 1WAAF 2B1HH 4G43A 1Y18A 2W60A 2RHEA 3PGFL 4XPGH 5F44A 3T2NH 1KLGA 2ICEC 2JELL 4UTBL 3HS9A 4HLZH 1A4KA 2YPVH 4U3SA 3RX7A 4MCYA 4XBPA 3UABA 5HTSA 1RFDL 3PABA 2XVKA 3RU8L 1JS4A 3FO9B 1RK1B 4HKJB 4J3SA 2DL2A 4KTDH 2WIMA 1YA5A 3HAEH 3IDMB 4YNYA 3HNVH 3NFPA 5CSGA 5HI5C 1XL6A 4BKSC 1ZVSB 2HJFA 3LKSA 5BXFB 1ZPUA 2CJUH 1DDTA 4HEMA 2G60L 2ZXQA 2I60H 5F1IA 2YD9A 5DK2B 3WN6A 2K45A 3O6LL 1ZA3A 1C9SA 2PPEA 5F6IB 4WI7A 2M1KA 3WUWA 1BBDL 1YQVH 4LK4A 3IRPX 3MRPA 2DD8L 3QZWB 4I3RH 5AOMA 3SGKA 5F7HA 4E36A 2HMID 2B1AL 2BIQA 3FONB 4G6ML 4UV7H 5C08D 1QNZL 1T2QL 4JRXD 5K9OA 2IC2A 3RWEA 5F9OH 5I1HH 3L3JB 3RDTD 3V4UH 4QUOA 2VDLH 1XGPB 3UGUA 2NY3B 4M00A 2KLSA 1N3NA 3QJFA 2BP5M 3DJZA 2WXQA 5HGAA 3KLSA 1M05A 4HUUA 4JX0A 1XEUA 3MBXL 3LZLA 3UJTL 4CC0A 3HA0A 5DMKB 1TU2A 4L8SC 4OFYD 2OJ1A 4BQ6A 1GS6X 3KH3A 3N5AA 4F2ME 1CVRA 4MX7A 3W0WE 3INUH 3PP4L 4L3EA 2FLMA 1T0NB 3C12A 3D18B 3MU3A 2EACA 2PWFA 15C8L 5C0JA 3S37X 1EBPA 3MLUL 1VAHA 3C6SB 3CFNA 4C57C 4ENZA 5IFJA 3O45B 1G1CA 1G7IA 1FYTA 1QI5A 3VRJA 4MNQD 3VFVA 4A2FA 1IM3A 4YK4C 1JGEA 4GOSA 3ECQA 3S3DB 1PMYA 4N2AA 1NBQA 4AQ8A 4U6YA 1OWWA 3LD8C 2H0EA 4HUNB 4HZ1A 1N64L 2CK2A 2NQCA 5GSVB 5AALA 2EH8L 3HC0B 4OJAA 1QASA 5TPWL 4UMSA 3SDYL 2R1WA 1KNOA 5DS8A 1AAJA 1QO3B 3O2VL 1J0IA 2WN2A 4H1LA 1QLFA 5SV4A 1IEBA 2ICEB 1S46A 2PR9A 4RRPM 3V7AE 3MUGA 5T3XE 3ETBJ 4I3GA 1QFWI 2FT6A 2ZXWB 3MRJA 2IBGA 3N42F 2QSCL 1DUYB 3FF8A 3GJFH 3H6JA 3SY0B 2IANA 4N9GA 1CGTA 2GI7A 2G2RA 4ANKA 1MCOL 3T0AA 3LKRB 2PCYA 3AU1A 5E1QA 1VPOL 4QGYA 1MCSA 3WEBA 3FQTB 3VI3F 3L5WA 1JTOA 4JPQA 4WLCA 3O6FB 5D2NB 3IRCA 4LESA 3DURA 2GSMB 1LK2A 2CK0L 3KVDD 2E6QA 3OKNB 1I7ZB 3VXPB 4E41D 3NZUA 4MVBC 3BO8A 2XA3A 2MNJB 2ZE0A 4FP8L 2PWGA 2VDRH 4OF0A 3V4VB 5BRPA 4JPIB 1QFWH 1GYVA 1U8LA 4NKDA 5HHMB 4WY7H 3LS4L 1OSYA 5IBTH 3IJSB 5DD5L 1ROCA 1R5WB 2C3VB 2CHDA 1M1XB 2PCXA 1FC1A 1WPCA 2VUYA 2WTRA 3G5ZB 3OZ9H 5LDUA 4NN6C 1NOLA 3P4MA 3WI9A 1DFBL 1KXTB 1XCXA 2O5ZL 2P8MA 3RIFK 5GXBB 5E8EA 2ZNWA 3MUHL 4R5XA 4DKFL 4L8SB 4YPGA 5I66B 1JGUH 1DE4A 3FU8A 4HD9A 4DNLA 3MRLA 5TE7H 2LAAA 1ZJAA 3G6DL 3B7UX 3RFZB 2RFXA 4WZ9A 3ZRFC 2V3FA 1RZJL 4DPBX 2R69H 2OMWA 1QWUA 4OZGB 5CEZD 3GKWL 5DA4A 3GHBL 4CMHC 1EQWA 3BP7B 4PU2A 1R47A 2ZOOA 2BP8A 4MA7H 4YK4B 2BNRA 3VFUA 5I15H 1JZFA 1TO5A 1L0QA 4WI8A 4ZW7A 1CDCA 1A3RH 3TESA 1CB4A 1MRCL 5EFIB 3IDYB 3TBSB 5AKTA 5DVLA 4UINL 2NY4C 3RVUD 2NY3D 5GRZA 4X80H 5EO9A 5FC9A 2W65A 1F00I 4I2XB 3UG3A 4HLEA 1JYVA 1MWAL 5AKSA 2BCKA 3GWJA 3FFDA 4MNHB 2GSIB 4LF3B 3C2SA 3D0VA 3S8GB 3P0GB 2OJZL 3HS0C 1JYXA 1AFVL 4APQA 1D5BA 1UWGL 2ZKHL 3QB7C 4M6AA 1P7KA 5C0AA 4TVPL 3LZPA 3ZO0A 5E94A 5H37G 3JYBA 3Q8CA 2C3WA 4J3OH 5H35B 2AXGB 2WV3A 4CJ0A 1TJHL 5DEGA 5EZLA 1UM5H 2CIIA 2NZ1A 4PBDA 1DVXA 5F6HJ 3G08A 3WIIL 3AT9A 2IH1B 2HVJA 3B5HA 4OJFH 1EEYB 2X0VA 2AQRA 3KPOA 1MVUA 5I6MA 4X8XA 3II3A 1CFVH 1U0QA 5C8JB 2WY3B 2E8YA 5DS2A 1IRAY 3L7EB 1AO7D 3EYVA 1XQ4A 2BIPA 3CZSA 4L4JA 3DHUA 3HFMH 3U7AA 2WBJA 2YKKA 2VR6A 1C12A 1M9WA 2NXYB 4QRAA 2YBRB 4X0KA 5J1AB 3QJSB 1NCWH 3H0TB 3NPZB 4K2UH 3ZE2E 4I5BB 1NWOA 2KZKA 2DM4A 3EYQD 1S9XB 2EXTA 1WFJA 1B4JL 4XWGH 2EVFA 3RHWF 4AKPA 3WJMB 5HI5D 5IT2H 1QI3A 1DBKL 1OWRM 3CK0H 4F24A 1FO0A 4QOKE 1Q1JH 1S5IH 3L16A 3QQ9C 2AP2A 3O6FD 1EDHA 5H2BA 3EFFA 4IW4C 1YPZA 2FATL 4DW2L 2JKWA 1EHKB 2VN7A 4DT2A 4TQPA 1KB5A 3LQAL 3NZ8A 2WXKA 1EHAA 1UOKA 2F8VA 3N40F 1T7YA 5HHMD 5KW9H 4NQCB 2DBLH 1G7LB 3LKQB 1WP6A 4FN0A 4OFPA 5K39B 3UEZA 3QH3B 4PB9H 4UTAL 2J12B 5L7XH 2NY4B 1KJMB 2HG5A 3DDFA 1R3JB 1DBJL 3K2UH 4PCKA 4MDIA 1ZLSH 3QHFH 1KJ2A 2DIAA 3GXTA 4OLXH 3EGSB 2XFGB 3V10A 1UKQA 2G9KA 3HS0B 1GRWA 1OSPL 5E2WH 3V9EA 1NCJA 2N7SA 2VR7A 3D85B 4N2EA 4HJSA 4A2EA 4PW4A 1QSVA 1S9WA 3I6KA 3HC3H 3IETB 2Q76B 4E5XB 3BKJL 4K9JA 3ROOB 3WTYA 1KMGA 1AXSA 1DFXA 3RI5K 3PAUA 1OF2B 2QR0B 1YEKL 4G43B 3ZMNA 4PJ7F 1FG2B 3MQIA 1Q94B 2W60B 3RZCA 4JRYA 5TJWK 4ENED 5CHNA 1KLGB 3HN5A 1OCCB 1OCRB 4U3SB 1A4KB 3TCLA 2CCVA 4FCHA 5KANI 4LDLB 4MCYB 2UXFA 2BW4A 3PABB 5GJSL 5ADPL 3DO7A 1BQKA 1XGQA 5DVNA 3DSFL 5A6LA 4M7LH 3FN9A 1ETJA 1FNHA 3CHRA 3NFPB 1AIZA 1Z9OA 3MKGA 4YNYB 3C6LA 3SE9H 3L3GA 1Z9SA 3QQ4A 5G4MA 1E5AA 35C8H 1EHNA 2HJFB 1BCIA 3LKSB 4HUMB 4P3CL 3ARZA 4Y4FD 3T0DA 3I3EA 1RUAH 1KN2L 1ZA3B 2WBXA 4A7QA 4G59C 1RURH 4U6VL 4WW2F 3WGVB 3LDBC 3WUWB 3MRPB 1MXDA 3QUKA 2B20A 2A73A 1BQSA 1OLLA 1U6AL 3H6AA 2EXWC 3RWEB 5K9OB 1WYJA 3BZDA 3VE0A 4ESKA 2DH3A 1AJ7L 3FTVA 3D87B 1CI3M 4XAKD 1A6TA 3VXQA 3I3BA 3PJLA 3PWPA 1MHPL 1A21A 1N3NB 1QUNA 3QJFB 3EJJX 4JRFA 5HGAB 1M05B 2NYZA 4H8WH 4HUUB 4Q0XH 2AEQH 3F83A 4IBQA 1TU2B 4N2BA 3MA7A 4BZ2H 3IGLA 4MX7B 3ZE0E 1WBYA 1OPGL 2R0ZL 3EHBD 4L3EB 2MJWA 4IDLA 4GKLA 3T0BA 2QKIA 1TJIH 1NBCA 5C0JB 4P2QD 2NXYD 5IFJB 4KQ4H 5I0DA 3I2CL 1G7IB 4PVNA 1FYTB 1HHIA 3S5LG 2MQ0A 2ZX7A 3VRJB 3VFVB 5EN2A