3M7OA

Crystal structure of mouse md-1 in complex with phosphatidylcholine
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
137
structure length
137
Chain Sequence
b'GWPKHTACNSGGLEVVYQSCDPLQDFGLSIDQCSKQIQSNLNIRFGIILRQDIRKLFLDITLMAKGSSILNYSYPLCEEDQPKFSFCGRRKGEQIYYAGPVNNPGLDVPQGEYQLLLELYNENRATVACANATVTSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphocyte antigen 86
publication title Crystal structure of mouse MD-1 with endogenous phospholipid bound in its cavity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 27
structure length 137
sequence length 137
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m7oA00
3T6QC 5IJDC 1XWVA 3RG1C 1KTJA 1AHKA 3MU3A 2E56A 5IJBC 2E59A 3B2DC 3MTXA 3VQ1C 2HKAA 1NEPA 1A9VA 1AHMA 2Z64C 2F08A 3WEBA 4G8AC 3WEAA 3VQ2C 5IJCC 3ULAB 3M7OA 5KWYC 3FXIC 1WRFA 2Z65C
chains in the Genus database with same CATH superfamily
2GC4C 5HDQL 4FXGA 1GL4B 5IQOA 3SO3C 4AQ8A 1U8NA 3ZSSA 1A6PA 5GGRB 2CIKB 5BOJA 4PJXE 5SWSB 3PRZA 1FZJB 1Q9KA 3HVNA 5GGTH 4FXTA 5T1LD 1TPXC 1LE9B 5T5NF 4AYEC 4ODUA 4GRWE 5IW1A 3ZDXE 5C0IA 3H9SD 3V8CA 4M3KB 5EBLB 1H5BC 2C1OB 4FLHA 5AAMC 1KCRH 4JFEA 3O4OB 2J73A 2Y07L 1IGML 1J87A 4HWNA 3DJRA 3N43F 4GG6B 4NRXB 3QR0A 4QRRD 3H6AA 4OCWH 3EOBA 2F58L 3HS0C 3OKMB 1OTSD 3BQUB 4HD5A 4NQVA 3ATAA 1G1KA 3I6GA 1ZK5A 4ERSH 5FA3B 1AR1B 1G7LA 3FUEA 1JZ2A 3PP4H 5LO7A 3WTVA 4QOKD 3NZHH 4OV6F 4WO4B 2J2ZB 3L9EA 4JPWH 4IK6A 4CC0A 5JW5A 5LQBH 1RP8A 3F6IA 4LQFH 3NSFA 4K8RL 4JCMA 3EFOB 3FRUB 4MA7L 5TF0A 4CADB 2JKNA 4P2OD 1MNNA 5B4MC 3CC5B 4NPYA 3SDDC 4U3SB 1KOAA 3RWHB 3G08A 3MLUL 1IGJA 4JS7A 2WZPA 3II1A 3PNWB 4TNVF 1NFIB 2Q3AA 4N2AA 3B3BA 4PRIE 1KB3A 5DO8A 2D7TL 4YGVB 4WWKA 3QIUC 3FFCE 3W1ZA 3OHXA 3O3BB 5DEGB 4KZDH 1PG7L 4YZFF 4JFSA 3OLEA 3ARTA 4QR7A 3QI9A 2WQRA 1UWEH 1SDYA 2PR9A 3CPLA 3DO7A 4HKJB 1VB9A 1Y0LB 3GJFK 3L45A 5J8OA 4GQQA 1CLZL 3MJ8B 4HWUA 1KB5B 3OJDB 4MB4A 4F7CB 1KCLA 9CGTA 4YDZA 3LNIA 3IWUA 4G71B 4X8XA 2HKFL 5EC2B 2DQCH 4L2YA 4OIBA 2AI0L 1ZLSH 1ID2A 1ZDSA 5DHXB 2ZYIA 3SY0B 3R1GH 5JHLA 4FKEA 5JR1H 5DMJB 1MCLA 2NNFA 2GITB 4OI9A 2ZCLH 3RZCB 5F7AA 3RFZB 4Z8FH 3MUY1 3V4PH 2CM6A 3CSPA 2CR3A 4QXGL 3LRSB 5I1IL 1UQSB 5CFAA 5CIPH 3EYVB 2DQGL 5ERWA 4DO4A 2AQPA 2FJFB 5TJWK 3GKWL 1K5WA 3GBDA 1FGNH 1DBKL 2BS71 4NQCE 4R4ND 4HPOH 3FB6B 3WIFA 4KKZA 4QXTB 5D7KD 3UAJC 2VIRB 1M05A 3SKMB 2WGXA 3MSPA 5I16B 1G7JB 1U93A 4XMVA 2VDNL 4LCYB 4U1IB 1XEUA 5FUZH 5TQ0H 3SDCB 2DJ4A 4W68A 3N85H 3QJHA 4HIQA 1PZUB 3T9WA 3ZKND 1KTRL 2CNYA 4X6FB 4LCUB 1VEOA 3LH2H 4H7VA 5D1QA 3UBXI 3FU7B 3FU0A 3VX1A 5BUAA 2X7LB 2FQGA 3WY4A 4Y16D 5EIVA 4XODA 1EEQA 1HHIB 3T6XA 5TDNB 4Z3TA 3MLTA 1URZA 3QQ3A 5A7EA 4D0DA 4PGJA 1AO7D 3UC2A 2OI9B 4NQEB 4OCSH 4MAUH 5C08A 3JYBA 2X4RB 4KQ3H 4MLIA 3PIQA 1JWSB 4K73A 4G80A 4XXDA 1SYVB 1JZJA 1XAUA 1Q0YH 3KCPA 4WUUB 4DN3H 3N2JA 1XGYH 5F7DA 4FZ8L 3OMNB 5KSAC 5C8JB 2JJTC 4KTDH 5E8NB 1G1YA 1YEDA 3ZQ9A 2GJZA 3L3OB 3CH1B 1Z3GH 3Q5OA 2WYIA 4C47A 5KSBF 3FYEB 4F37K 5EC1A 3BW9A 1L5GB 1MCQA 4UNTA 2HPTA 2FHCA 1NDMB 4ODXB 4IRSD 4HWEH 5KSVA 2CO1A 3AQYA 2Z91B 4Y1SA 3HHSB 2IBZX 4GW5B 3KPRB 4U6TA 1Z9LA 4X6CA 1UZ8A 1BPVA 2YA0A 4MQSB 1G7HB 4WWOA 1AP2A 1JV2B 1UJ3C 4PJEB 4V33A 1WBXA 2V17L 5D70H 4EN2A 3BMVA 4Y1TA 4LOVA 2H0EA 5DA0B 2HUEA 2ROYA 3HC3H 3SQOL 5D93C 1E9QB 2J1WA 2OCFD 4RBPH 3IGLA 4L3CB 4HU2A 1NKRA 1G5GA 2WXJA 5EORL 3LRHA 3V4VH 1INDL 4U1MB 3KZ8A 4GXUN 4PTUB 1U92A 3R4DA 2BXYA 2VCOA 1JGDA 1VGEL 1Z7JA 3APFA 3PV6A 1CLVA 3LXAA 1DEEA 5ESAB 1G9NL 3D51A 4M9OA 4B60A 4IBQA 3UTQB 1TJGL 2B1AL 1Z3RA 1KXHA 2BVUA 4JRXD 3EYFB 2UWEE 4H1LG 1E90A 1EVTC 1DQIA 1NFDA 3GGWA 1G6RA 1EIBA 1T5WB 2ENSA 4FDWA 3KXFD 3ERXA 3QW9A 1L9RA 2H6PB 3OKDA 1CICC 1YYLL 5IQLA 3R18A 4G42A 1S7TB 4NZDA 3T0EE 2PYEA 3WDHA 4AQOA 2C9PA 5HYFA 4YFLF 1N5AB 2ODIA 2JELH 2Y5QA 1DBAH 2QLVB 5GGVY 3FT4A 4EJ1C 3SCMD 2YPKA 3QUXA 5LCVA 5FB8B 5C09A 2J25A 3C8DA 4GLRI 4PG9B 3ZMEA 4PJAB 3HG4A 3WKPA 3BH9A 3LJ3A 1A6VL 1JPFA 2AEIT 2G9HA 3EH4B 3PJSB 2QQNL 1MLCA 4J23A 1PSKH 3C6LC 2FGWH 1K2DA 3B43A 4JL1A 1UOWA 2XZCL 1MRFH 3PWPD 4P5KB 1Z5YD 3E2HB 4CVWA 2WN2A 4P46B 3ZKSD 1QO3A 2W38A 2IBGA 3B9DA 4IKIA 2WKOA 4RX4D 2CR0A 3IFNH 2BIIA 4AGPA 5JZ7C 3BZEB 4UT7L 5CLXA 5BXFA 5IVXB 4OZIF 1S7QB 1IKNC 3H6JA 1JVOA 3VXRB 2EE0A 2VLMD 1PAZA 1IJNA 3ARGC 1NAMA 5IJVA 1EEUA 4M62L 1ANUA 3L5WA 3QIWB 1F90L 1JSYA 4O4YL 5T1LA 3E6HB 1FFTB 4PJ5E 3RPIA 4PBDA 4PJBA 3VWJB 1U8HA 1GGIL 2HVKA 2FUTA 3AB0B 1Z6JT 1CE1L 3QH3B 4XBPA 1CDCA 1IEBB 3OR7A 4JW3A 3HZMA 2X4OB 5D2NB 3ZDZB 4QRRA 2O6FA 5E2VL 1CWVA 1BZ9B 5CZKA 3JBG7 5C7ZA 2GEEA 4JHVA 4NAJA 5EOCL 4NRZB 4HBQA 4G6JH 2XWRA 4MDJB 3UTSE 3VFVA 4NCDA 2DAVA 5DJCA 1JI1A 1Z9MA 3RJOA 2W9EH 3M7OA 3FCTA 3CN4A 5CCGE 1MWAA 2E7LA 5AD0A 5I19L 3O6KL 4K0OA 2NY3C 3BPNB 2PETA 2AK1H 1BAGA 5BRQA 1OWWA 3FBQA 2RCSL 3GBLA 4KXZI 4MKTA 5HY9B 4HIHA 5IKCA 4OQTH 5IQMA 1ZGLM 4V2BA 5H4YA 1N8ZB 1A7OH 2HPOA 2FJGA 2OPCA 4TLKA 4AI7A 5C86A 5FYJL 1A1MA 1MFEL 1EMTL 5E6ZA 3HPLA 4JQXA 2K45A 3PWUA 2PCPA 1JDAA 4FABL 2VISB 2P47B 4OLVH 5GS1B 4MXWL 4P23C 3D4YA 5ABZA 4ZXBB 2CR6A 4L3FA 4DUVA 4MMXA 5LGJA 3ARXA 3MLRL 1V05A 4PRDA 1G1CA 1P5UB 1QTSA 2XWTB 3RGVD 5TH2A 5L88L 2AKRA 4HHAB 2BSED 1FHGA 2F53E 2RJMA 3HVDA 1E6OH 1A65A 5B7EA 1WISA 4GSDH 3WIIH 4M9PA 3N1FC 1F86A 1ZT4A 2BVQA 4YXHH 5F7LB 4G8GB 1PD1A 1QSED 3ETBF 1JXGA 5IT2H 2DQEL 4I18A 4Z76A 3D07A 4D3CH 3CLEL 4N25A 4I2XA 4CW1B 4JZJC 5E94B 1JPSH 3MX0A 1U3YA 2FO8A 4AQEA 2F9BT 1VA9A 1GHFH 4FXGC 1CTOA 4P57B 2UYLA 4N8PA 5AOKA 4AQ8C 2VDQH 2BC4B 2DQUL 2VLLA 3C5JB 1E5YA 1HWGB 3OAYH 4ONGL 1VACA 3IMSA 1M7XA 3HRPA 1EANA 1P6WA 2A6IA 3DMMA 3QIBD 5IWLA 1KJ2B 2W65A 3ULSA 4WSJA 4E5XA 2R29A 1FORH 2CO7B 2YHGA 4F91B 1SRDA 2AJZA 3MACH 1SEBA 3FTSA 3ILQD 1UATA 4EVNB 1KBBA 2YAOA 3ABGA 1CVRA 3QG6B 2QZ5A 1BIHA 5I5RA 5CD5D 1QBML 3SQBA 3BKYH 2BXZA 2DTSA 3UCRA 1HH9B 5GRUH 3MO1A 4NYLA 5LGKA 2FBOJ 4Y16A 1HEHC 3ATEA 1T04B 4LPYA 4PRBB 3Q5TA 4OLEA 1CFVH 4TKWA 3MJ7A 1AO7A 4XP9H 5ICZB 2D2OA 1FYTB 5FM8A 3CXHJ 3NQIA 1OB0A 4GKNB 3TL5A 3U1SH 1UA7A 1ZE3C 3ECVA 1JN6A 2CGRL 1MH5A 5HPMA 5JOFA 1IAKA 1OAUL 1GAFL 5I8KL 3MROA 5HDQH 3WD5H 4N0FA 3DTXB 4ECNA 5MI0C 1URLA 3AG4B 1JPGA 2I25N 4HS3A 1LD9B 4A6YL 4DFHA 4UNVA 2XYBA 2Y7QA 3OHXC 2CUMA 5A3ID 1SHMA 5SV3A 2ZNXA 4C4UA 4H0HB 4K3JH 3STBA 4ALAH 2P5WD 4M4RB 4IRSA 1MNUH 1UOVA 4GOSA 4G7VH 3JWDC 3P77B 3O0RL 4L4VE 2OAAA 1C12B 2G0LA 2H6OA 2JIXD 4J3OC 2DYPB 4LLYA 3GSRB 3HUJF 1XH0A 3HI5H 1SVZA 1QP1A 2CRMA 2PW1A 4NO2A 3QFDB 4LU5L 1M7IB 4TSCH 1UD2A 3N0PB 5J56B 3TWCL 5IB4A 5LWYH 1AI1L 1IC4H 2MOGA 4ICXA 1NQBA 4BH7A 2J4WL 4K8RH 4CC1A 3K7UA 1QWHA 3MRMA 4MA7H 4WNSA 4LKXA 1ZLUH 1ZA6B 3T0DA 4YLQT 3KJ6L 3MLUH 4GXUM 2R0LL 2OCJA 5F88B 5ACMA 4F15B 4JRXA 2GC7C 1T0NB 3IB4A 4LGRB 1NFKA 1G7PA 4RLDA 3J07A 3IWVA 4U6HA 4YFLI 5CN2A 4D8OA 3KXFA 5AEAA 3HZKB 3QHZL 4Y2OA 1HQRB 2V6HA 2MPAL 2OZ4L 3AUWB 3JTBA 4TXVB 5BJTA 4YSUA 1UT1A 4BZ2H 2O72A 3V6OA 5D1QC 4I4WA 1ML0A 2WLYA 3L3JA 1OAZH 2DH3A 1CLZH 4PY7B 4M48L 5I6LA 1I3VA 4JJ5B 2VDRL 3SCMA 3ZE1F 3DBXA 3STLA 1PKQE 4OTXL 1ZA3A 4PV1C 1GYWA 7FABL 1I31A 4R8WL 1ZTXH 1U8IB 1KXQE 3L4CA 3IU3A 4R84A 5E5MB 2XY1A 5FLUA 5KYUB 1L9PA 1LO4H 1WIOA 4XVOA 4TUJB 1KNOB 4DGVL 4QHNA 1CLYL 3OKLA 1UTDA 5C0BE 2C9VA 3PWPA 3HBPA 3P9WB 1DUZA 2QBWA 3BWUC 2VAJA 2P26A 2BSBA 1XSKA 2Q86A 3L3IB 4MB5A 5JHDE 2N1KA 1DBKH 1FNEB 1YAIA 3D52A 4AX3A 4MX7A 1TJHL 4FA8A 2R1WB 3HG1D 4MA3A 3H3PH 4NZRH 3WJLC 2R2BB 3NSDA 1QHQA 4R26L 2VDPL 2VDNH 3CFQA 2MSPA 3R8BB 3OX8B 1KYAA 4JN2A 2WLIB 1AGBA 2FEEL 3KBPA 4UINH 4O51A 4F8PA 1G94A 5I1AA 3U6XS 2EDLA 3ZK0A 2OA9A 3X3FL 3SDXA 2ZOUA 2A4ZA 2KQNA 3QK0A 3DJZA 5T3ZE 4AYID 3L5IA 4FERA 3VXPB 3VFWA 1KLFB 1ONQB 4PS4L 2VMFA 4V1DE 4I0PC 3DRTB 1Z9SA 5CGYD 2VITA 2DBJA 4MD5B 1YEJH 2RAMA 1GH7A 2NSQA 5IHZB 4A2HA 4NZUH 3M45A 5HHNB 4FQ2L 1MI5E 3AW5A 1SJEB 3MV11 2NTFB 2H32B 2Q7NA 3QCTH 3JWOC 3QRFM 1I8KA 3GT6A 3RL1A 3T0EA 1O7DE 1Q1JH 2VDMB 4JZNA 1QLRA 1A6UH 1YEIL 1SZNA 4FZ8H 2TRYA 3KDMB 3IF1B 1R5VB 3ARDD 4U0QB 4M93B 1MHCB 3UZEA 4KOBA 1A3QA 2XBZA 1JGEA 1YMME 1IU1A 4MXVF 2YPVH 3DUUA 4XRCA 1KEML 1GRWA 3F85A 4KVPA 2K78A 5BQ7B 4TVSa 2XHNA 2F7OA 1PAMA 1UURA 5ITFB 1SXSA 2P8LB 3ASOB 3GBNL 4XVSH 2FX7L 2A9CA 3BYYA 2XN0A 5SWQB 2ADFL 4M7ZC 3SKNA 3UGEA 3QZPA 4WHTA 3PHQB 1UXSA 4JFOB 3D69A 3QUXC 4XBMA 4KRLB 1RUQH 1DJZA 5DWUL 2YSSB 5FUOL 4QTIH 1UT9A 3DI3B 1UKTA 2VAAB 2A0LD 2GJPA 4JFHE 4GI8A 3WUWG 4ELME 3H0TA 1MJ7H 3V95A 2ZX5A 2V17H 1I8MA 2AJ3B 2H3XC 4TQHA 3SQOH 1ZV2A 5HPOA 3B2DC 3ZKMC 3UADA 1BF5A 2BY3A 1TEGA 3RGVA 2XRAH 1GJIA 1IFRA 1GCFA 1HSAA 4NN7C 4ZTOL 4NKMA 5GZOD 1AHMA 1JP5A 4IW4C 1A02N 1HKLL 1VGEH 3N5AA 1LE5B 2WAQA 4HPYH 5GGUB 2AJUH 4A63A 4WTZG 1QSEA 4X7FC 5K9OB 1KF9B 1U8LB 3U7YH 1AIFB 4MMZB 1F4HA 4FQCL 3OKOA 5FK9B 5JORA 4LAQL 1J1OH 4P06A 5IK3B 1JGVH 2DQFB 3F7VB 3QB7C 4NQSA 5LDSA 2V37A 1YYLH 1Q90A 1FG2B 1DN2A 2J43A 3EW3B 4HOWA 4L29A 4APXB 1A4JA 1BVNT 1MDAA 2DJMA 4TUOA 5FYKL 3VD1A 2C3VA 1GPOL 3RQ3A 2AMUA 4M8QA 3AG2B 4KJYA 4PLKD 3ZE2E 2Z7UA 2DEWX 4D8PB 4EI0A 1J8HB 1GGCH 2WXQA 5K9KA 1YMMD 1DR9A 4XGZA 2D7QA 4EUPB 4PJGB 3CX2A 2R4SH 1JK8A 2X10A 4B9GA 1IT9H 2CDGB 4G1EB 1SJHB 2H26B 3B3IB 1OP5K 3AREB 3MZGB 3SE8L 2QQNH 1OTSC 5IVOA 3T77B 2WNXA 1RZ8A 3MHZA 1IBYA 4EZKA 1U8QA 5ISZD 4DP6X 3VGAB 4M7LL 4PP2A 2NCMA 4X5LA 1YEGL 1JNLL 5BMFL 3VI4F 4JAMB 1PJWA 5FKAB 3V4PA 2XXMB 1EJ8A 1MVUB 1CFSA 1ZLVH 1E8YA 1PZ5B 4LSQL 3GI8H 4N0YL 3D33A 5IHUH 3DV4B 3CVCA 4FXLA 1R24B 4OIAA 4LLAA 1EAOA 5I66A 2GVYA 4IHOA 1S7WB 2IDQA 4WO0A 5I6OA 2UY6B 3HBQA 4JQXC 1O6TA 4HQQL 4P99A 1Y6NR 1A6AA 4PJXB 1F90H 2IPKB 5C0AB 3QFJD 4OF8A 4MMXC 4O02A 4U1GB 1R3LB 1OSZA 2MCMA 4PH8A 2M26A 1UXWB 1GGIH 4ZS7H 3V5KA 2P5WA 4Y8DC 4HG4K 3O8XD 4X9IA 4G83A 1CE1H 2WWMC 3LPOA 1AMYA 1JHLH 2C1PA 1CL7I 4K55A 5E2VH 5A6MA 4GQPH 4R4BB 1UM5L 1KN2H 3JWNE 3QUKA 2JIXA 2Y6SD 2NQCA 4P9HH 4LVHB 3TA3D 4H25B 4UTBH 5EOCH 4L1SA 3L9RB 4Y1AD 5DGQA 3WFBH 3N9GL 3OKNB 3VD4A 4PREA 2RFXB 3HRZA 4MRCA 1J0JA 4GJTB 1PFCA 4I18C 3PS6A 2FO4A 4GUQA 5F3BA 4JDVA 1WFOA 2YOAA 2ETWA 1H6TA 3L3KA 2FSDA 5I19H 5DMGD 4Z3EA 2XZQL 3BVUA 1TQCB 3RWFA 5IEHB 3CHPA 3UZVB 3UBXB 1DTUA 3DX9B 3GSXA 3MBED 1TQWA 2RCSH 1A3RL 4YX2L 1UCBL 1DUYA 3DSFL 2A83A 2YA1A 3W5NA 2BOBA 2VL4A 2CZNA 1A2YB 2C9AA 3DMMC 4PJCB 1MIML 4U6XA 1ADQL 1INEL 3UPAA 3DXAD 4ZMTA 3VNZA 1THCA 4R4NC 3M1OA 4TNWK 3TBWA 2FX8H 4YSRA 2AAVA 3B7RL 5HHME 1B4LA 4PRAA 4XC3L 2Q76B 4L9LA 4PRIB 5AW9B 4PI0A 3CCHB 5HDBF 3FFCB 1P7QD 3ABLB 4XE5B 2I07B 3VXOA 3RJDA 3MLRH 4QT5B 3EFFB 3FTWA 2PXYD 4FC3E 3LKOA 4IRJD 5I9QB 7CGTA 4BELD 1A1NB 3FT1A 3JSSA 1TLMA 2HG5B 1IVLA 3TN0D 2IWEA 4Y16C 4PJ9B 1BXXA 1FNFA 4AL8L 3H4FA 4NM8H 4KV5F 4J3OF 4Q2ZB 2HJLB 2IH3A 2WVUA 3S88H 1JL8A 3WU1A 2DKUA 5BVPL 2AQSA 2EICA 4OI7A 3VFNB 1SF3A 1P2CB 5AVTB 5C97A 3KEHA 3UTTD 2I24N 3P3TA 1GSMA 1NC4A 2B9BA 2J88L 5EZLB 4BFJA 4DP1X 4YSQA 1AXSB 4F58L 4KNTA 3KLQA 3VFRB 1PX8A 2I9LB 2H2SD 2ZSVA 3CJJA 2OXHA 5LBSH 2BCKA 3NA4A 4QRBA 3DLQR 3H8NA 4NQCB 5H37H 2NNAB 2F15A 4BQ6A 4O00A 4ANVA 4DK6A 3HG1A 4IRSC 4HWBA 3GI9L 3NJLA 2JCWA 4Z7OF 1ACYH 5IFHL 2CALA 1BQUA 3MTXA 4LSSL 2WINB 3BO8B 3T2PA 3G3LA 5I1LA 2Q8AH 4PGDA 1QBMH 2DQTL 1DJHA 1NLDL 2J44A 4DW2L 1X9LA 1XGPA 2Q20A 2EDEA 2IGLA 3VQLA 3ZDYB 2CAKA 4Z7UE 2BY0A 2IAMD 1W9XA 3ZYOA 1JNNH 1KGWA 4NC0B 4ZI8A 3BJ91 3GDBA 4JKMA 4L3EE 4ODVH 3UTZB 4OM1L 1QSFD 4PR5B 2JCCB 2ZXQA 4CNIA 2X1WL 2KERA 3E8UL 2C9RA 2IDCA 3GS7A 2CGRH 3HE7D 3C60D 1S4IA 4ZNCD 5I8KH 2CKBA 3NBNA 1F4WL 1AAJA 4DIXA 3ARDA 4M1DH 3OLIA 4UQBA 2BOCA 3SYCA 2EXWC 2GTZA 5DUBA 4ZMVA 3BWUF 1FDLH 1S7XB 1KXQA 3A6CL 4GO8A 2Y0SA 8FABA 3P4OB 1DQTA 3V6OC 3LQMA 4OIFA 2GSGA 1XSOA 2ZXGA 5CAYB 1MFCH 3TPUB 1BCIA 2NXZB 3ISRA 1BLIA 4X6CF 5AVWB 5MHSE 1SJXA 3SZ6A 3QJUB 3AROA 3SGDI 5I6XB 3OB0K 2WMPB 2WXOA 3O4LD 3V9FA 3WV0A 4Y4KD 5J1TC 4F8NA 4I1NB 5FM5O 3TWCH 1B4TA 2R23B 1SXZA 1AI1H 4Q9QL 3UJIL 1CT8A 1SM3H 2KDYA 4M6OH 5E6UB 3BN3B 2EUXA 2GT9B 2O6PA 1A9BB 3LIZH 2NY0B 3GWJA 2VXQL 3FU9A 5HGAA 2OMZA 4OKDA 3KJ6H 3Q8FA 1QW8A 3LOWA 4C83A 1XMWA 1T2QL 4OQTA 3I02B 4P2CG 4C56D 4Z7QF 3WNNA 5AB0A 1FC1A 2IANE 3KPNA 4XNMB 4V1DA 1U6AL 3L5XH 5MEQA 1H8SA 2JKLA 3CWGA 5D5ME 2UWEB 1WBYA 3QEUB 3D1MC 4LASL 4AYMC 2PP9A 3BZDA 4UUJA 5EF1A 1NANI 1NFDF 3CQQA 3A67H 3VB8A 5FW6A 1CGSL 3RU8L 2X4SB 4S1QL 1UWXK 3BN9C 2F8VA 5EOTB 4L8BB 1PW3A 1WAAE 1RZFH 2MPAH 1RH8A 5EV7A 3MDJA 3CBRA 2EILB 3W2DH 3FYIB 4YSDA 3GO1H 2WLJA 2NQDA 1S7SB 4UDUB 5JIHA 3VH8A 1RUAL 4P2QB 2NXYD 1HNFA 2GBAA 2XV6B 1A4KA 3O3EA 4HAFA 4KI5E 5DTFB 5HVWA 4WCYL 1IBGL 2ICWJ 1JK9B 1YMMA 1R17A 4OTXH 3CHOA 1RZIA 2N3JA 3O41B 4FFTA 4FNSA 5E8EB 5GZND 1B4JL 4R8WH 5B39G 2Q7YB 5JW4N 4MS8D 3VFSA 4IKJA 3P9MA 4TNEA 2W0LA 3T0EC 3HLKA 1U21A 2XWJB 3Q06A 2BVYA 3KYKL 4DGVH 2CHNA 5LGHL 4RISL 5ISZA 3ZY7A 4PSPA 1XR9A 3UZEC 4PJ8A 2MCPH 2ZYSA 4HKXA 5F0MB 4CSTA 5EH1A 4ONHA 2D0HA 2GIYA 3KPLA 1WSST 4MA8H 5JYLA 2LU7A 3Q1SH 3HJ0A 2VM3A 1U8KA 3V0IA 4CKQA 1UOKA 4YDVB 4FQHB 3DX7B 4R26H 1I4FB 2B3IA 2APTA 4JL2A 1P1ZB 2ADIB 4JY6A 2OMTA 4MAYD 4GS7C 4N2BA 1RU9H 4M03A 1WAPA 3X3FH 5KN5B 5JQ6H 4UQIM 2Z1KA 3QFJA 3D3VE 4PJ5B 2B14A 3SKJH 2OK0L 1MJJB 4NQDB 1N6UA 1SY6H 2HT3D 4PJBF 3VFMA 3U0WH 5EZIL 2W8CA 3LZFH 1CU4L 4LL9A 3RGVC 1R0AH 1WT5A 5GGSY 2HFFB 2YXMA 2VL5B 3VI3A 1HINL 3NGBB 1F3JB 3RGHA 2CXKA 1AGCB 1HYSD 2VQ4A 1HE8A 1RJZA 5CU5A 2BIPA 5BO1H 5CEZE 3TA3A 4Y1AA 4Y9CA 3TBTA 1IGYB 2MNUA 1MFAL 2MNWA 1YEIH 1P4LA 3PP3K 4Q97A 3UTSB 3MRGB 4DSYA 1T6WA 3HAEB 4BFOA 3GBMH 5IQ7L 1HI6B 1UD3A 1YEEH 3VX0A 2YBRA 3FUKA 4X5WB 2HYMA 4XNYH 2CNZA 3TT1L 3MBEA 2RR3A 1A7PL 3V4UL 1DJIA 5JXAL 2B0SH 3T3PF 4EN3B 2R2EB 5DHMC 2AABL 2ATPB 3HC4H 1RZJC 1B0WA 4RSYA 1YUKB 3TTYA 4BKLA 5C2UB 1BOGA 1N3NB 3ILQC 5DWUH 1OSPH 4HUVB 4TMPA 5DJDB 5JW3L 1FIGL 1P7QA 1NCCL 4E9TA 1I9JH 5J11B 3TJPA 4JFXB 2PXYA 4HK3N 4IRJA 1FE8L 3F12B 4ZPVB 3ZL1A 3B9KD 4NC1E 3GSOA 3SB3A 1BD2D 3RWEA 1ZLEA 4OGYH 1CGVA 2F53B 2E0PA 3HNVL 1AOZA 1HKLH 4Y2NA 5DCCA 2Q5BA 4MNGE 4KUZH 4ENZA 4LCWE 1ET5A 4MD4A 5I1JL 1E7VA 1R9FA 1YEHL 4K3GA 4GRWF 5DZNA 5SX5H 3ZDXF 1VEPA 3D34A 1QFWL 3Q3GB 3U82B 3LNHA 4NRYA 4OJCA 2TRHA 1YY8B 4NWUH 4YFDB 5BZZA 3UTTA 4KY1L 4ZUTA 1QTYT 3ULUE 1YECL 4HK0B 3A3YB 1ZSDA 3VG9C 4JM2D 4KRNA 3QUMH 3IGUA 5AG8A 5A3IC 2W88A 3QQDB 4P07A 4ZO7A 1NJ9B 2R15A 4JM4H 4BZ2A 1MUJB 4ENED 4MJJA 3LDBC 4QHLA 2QADB 3ZHKA 3TO4D 1U8CA 1FH5L 5IW3A 4AE1A 2VXTH 2MTAA 4JDEA 3IJHB 2H6UA 4IIZA 1JTPA 3DX8A 4R97B 5DHDA 3SE8H 4UMGA 4JG5A 5DHVA 2CHDA 3HRZC 1KXTB 5D7LD 2DYSB 5EA0H 2QPDB 3GB7A 1U33A 4V2CB 3SJVD 4G5AA 4OVUA 2BRQA 3IDMB 4WV1B 4M1CD 3PL6D 4GKSA 1CXHA 3JV5A 3GEWB 5DYOA 3FK3A 2M2DA 1QSFA 4Z7WA 1KT2B 3T0BA 3X14A 4N0YH 4HYTB 5CN1A 4K4KA 1NBQA 4FCAA 4MRBA 3C60A 5CJQH 3I6LD 2V8LA 1M7DB 1P84K 3H7LA 1B0RB 5GGRY 3RWCB 2VLRE 3M07A 3DURA 3B7SA 2YAMA 2AJYL 1ETB1 1E67A 1L7TH 4GMSL 5CINL 5FHBH 1AZCA 3F2LA 4L9LC 4LCWD 2QKSA 2EZ0D 1AOHA 1KIQA 1E9OA 4W9ZA 1I9RL 5E2TL 3S5LG 2YLHA 1RULL 3G6AB 5F6IC 4JFPB 2EIEA 4Q56A 2Y7MA 3GK8H 5EU4B 4CSPA 1DFBL 2H3NB 3RDTD 3CVDA 1LO5A 2BP3A 2VRAA 3O9WB 3CVHB 2C3HA 2APSA 2A77L 4L4VB 4AQ1B 1D6EB 1UM5H 3ZDWA 4C4BA 4XMTA 4AIEA 1AY1H 1HWHB 4LCCA 4JHAH 1EEZA 35C8H 4ZO6A 5EU7E 4E9VA 4PJDE 1EA9C 3O4LA 3C6SB 4POZC 4Y4KA 5EF3A 4D9QE 1QNZL 3BRFA 3BZ4A 1F4XL 2NQ3A 3BVNB 4HH8A 3UYPB 4IOFD 1P53A 2BY1A 4AEFA 3N41F 4DKTA 2ICEB 1YNTA 5JXAH 2A5UA 1AQ8A 4XMZA 2GUOA 1LLAA 1TJIL 3V0GA 1YN7B 4Q9CA 2FYVA 1JTTA 5T5FL 1YPZE 4YX2H 2H1XA 4M02A 1NCBL 1UCBH 2E9WA 1N2RB 2YPVA 1MCSA 2ZCZA 5F9JB 1UACL 2CLZB 1INEH 3EYOB 4M5TA 5GHWL 4N8VA 4C56A 2W59A 3EYUH 2KZ1B 3K6DA 4U3XA 3HG5A 3W9EA 5CEYA 2P46B 5JIPA 4QRPE 2EEXA 1YG9A 3F04A 1DQQB 1Z0MA 4DK5A 1BLNA 1WQVT 2G4EA 4L3EA 3VXNB 4KJWD 2FQFA 2AQNA 2DV6A 3C75A 2V7HA 1JZDC 1V7NL 3TJHD 4Q14A 1XV8A 5FO7B 2WVVA 3GXMA 1L3NA 3FNKA 2ZXEB 3WFHB 1GJUA 4W70A 5CGYC 1S9XA 4AL8H 1RMFL 1WFTA 5CEXA 3BIKA 1JF1A 1PKQB 4AZ8A 1TZHA 4MZRA 5GZNA 4BDVB 1XZWA 2BNRE 2WBJD 3NABL 4M7JL 1MSPA 3ZYZA 5CSGA 2OP4L 3GMNB 2FJHA 4JN1L 1UM4L 5CR8A 1YUHB 5D4IA 1NMBH 4DH2A 5I23A 1F0LA 2R0WH 3GHBL 1KCKA 4F58H 4WEEA 5C0BB 25C8H 4PCTA 3OV6A 4G6AD 4IKNA 2VDKH 2F7PA 4FQXB 1G84A 1TQSA 5DQJA 4HISA 5JHDB 1FGVH 3B5TA 1Z9PA 3QO1B 3WNMA 3PXHA 2FWSA 1IGCL 1SHWA 2BHYA 2K7PA 1SMDA 2Y5TB 1KIPB 3GI9H 1XVSA 5DJXB 3WFCH 3IE9A 5IFHH 2F7QA 2HFEB 2FE0A 1F11A 2VC2B 3IT8D 4IJ3B 5DJ0A 5SWZD 5EULV 5J6HA 1TZOA 4MAYA 4YMPA 3LEXA 1WFMA 2L7JA 3L3DA 1LMKA 4KRPD 2A0LC 1X9RA 4X5XA 8CGTA 2A2QT 4DZ8B 3SDXF 4BSJA 4DW2H 2IANA 3NZ8B 2QV2A 2WSDA 4W6WB 5D7JD 3FCSB 2OSXA 2W0PA 1TFPA 3CK0L 2W9DH 3MRLA 4JZOB 5D5MA 1E50A 5INCB 3GMMA 4IBSA 4EEEA 3E8UH 1KPRB 3FSZA 2BRRL 3WGVB 2O4EA 4JGJA 4OFYD 1G0YR 2P45B 4QCIB 3ZVVA 3IU4L 5C0NC 4KKLC 1F4WH 1T22B 2H8PA 1RKRA 3K6OA 1ZVHA 4JRYE 4WSGA 4NIKB 1YJDL 3BZFA 4MD0A 1WVZA 1X5LA 3X1BA 2UVEA 5CHNA 2FR4A 4JFUA 3PAUA 4H8WL 4AEIL 1OEZW 4YHPA 4B3VA 2ORBH 4YSOA 3QDJE 4I7ZC 5IEKA 2VR7A 3AITA 1JYNA 2N7AA 3BP6B 3P1VA 3QNZB 4A39A 1Q9WB 1C5CL 2UV3A 4PGEA 3LZOA 5BZDB 1IQDA 3KR3H 3QGVA 3VGGA 1HHKB 5L0QC 3OAUL 5ABDE 5IF0B 3T2NH 5B1CA 2H5UA 1CGUA 2PLTA 5JA9A 1T0OA 4ELMB 3BEWA 4YZWA 1NGXB 3CFIC 5EPMA 4UTBA 3WEOA 5C0FA 1CDJA 4GBXB 2XN2A 3OJ2C 3BKJH 2BLFA 4NO0D 5F1IB 3B9KA 3EOYG 5JW4R 1WAEA 2NPLX 3CZEA 3KPOB 4M5YL 3O6FB 1NL0L 3UJIH 5EWIH 4CU6A 2PCFA 3O45B 4PJ8C 1T7XA 2XCMC 1PQZA 3ZE0B 4PBWD 1QAWA 4MHHI 2VXQH 3D3VA 3ZZSA 1NIBA 4JCLA 4ODSH 4JRWA 5CMAB 2SEBB 2KDGA 4YXKH 2I5YL 3MRBB 4J2QA 2NNCA 1EH9A 1SYSB 3QHTC 3EO0B 4LASH 1OAJA 4ZW7A 5TDOB 2HB0A 5AVRB 1U2HA 4GW1B 2D4FA 4LKCB 3FQ2A 1IE5A 3D85D 2VABB 2VUYA 4M8UA 4UZUA 2R59A 3TBYB 4PJFA 3HMWL 3FH5A 4JM2A 5KTEH 2DQDL 4I5BA 3ZTJH 1TYRA 1HNYA 1W0VA 2CGYA 3DWTA 4NCC1 2V2XB 5G5DB 3D9AL 5I0XA 4UV7L 2OJEA 4IIQB 2NW3B 3EGDA 4MXQD 1WT5C 1RZKL 3S35X 4YAQA 3BSZL 4QAMB 4GAYA 2CM5A 1YEFH 5I1KH 2UUDH 1UASA 3LKPA 4WQOA 3GS0A 3TA3C 4QJ5B 1AZRA 3ZL2A 4JPVH 8PAZA 5EEWA 1HJCA 1EFXD 4JX0A 1AHWC 1XF4B 3DJSA 5D7LA 1U42A 3VFOA 3IXTB 3VJ6A 1F6LL 3SJVA 1QG3A 5CJOL 1CUOA 1C16A 5DRNB 1KBWA 3CFBB 1BAWA 4MB1A 3PL6A 3RVXD 5KYXA 1NGZA 5DMGC 3C5SB 4I9WD 4AYGA 1CD1A 3QZBA 3MBEC 5FM5M 3W82A 3QISA 3Q44A 3ET9F 4GRLD 3CDCA 5LBSA 4L8CA 2J21A 12E8H 1ORSA 1VZIA 3CXDL 3TBSA 2OTUA 4MSWA 3SE3A 3QS3A 5H37A 2WUCL 3NA9L 1HQ4B 5E23A 3TBCA 4ALAC 2D9CA 4WK0B 3WJMB 1J0YA 3R0NA 5G4MA 2FK9A 3NJVA 3FHAA 3D4ZA 5K39A 4LCWA 4PWFA 2ERJC 5MEOA 2OK0H 5JPNA 1DJXA 3IFOA 3SDAB 1UKQA 3DECA 4NKIL 4N2EA 2PXYC 4FQLH 1E8ZA 4IRJC 4X6BB 3RDTA 3P4LA 3FTZA 1V27A 3ARYA 4P5TD 2ITDA 4QRFA 4UDTB 4CAGA 4G1MA 3PAZA 1P0SE 2G2NA 3NACL 4HWZA 4NHUA 5EO9B 5K1JA 3WUZA 5LKNA 4HDIB 4GG8A 3ME0B 2J5LC 5FCSH 5DEFA 1AS8A 3LKNA 2Q8BH 4XNUL 5CWSB 4RRPM 3W38A 3MYZA 3GZQA 3QE5A 4F7TA 5IQ7H 4DK3A 1PFOA 3S3DB 5PAZA 4CVXB 3ZIYA 5FDWA 1CDGA 4R2GD 2IBZY 1C8PA 4GMTL 3WTUA 3L7EB 4UYQA 4U6VH 4BFFA 3HNTL 4G6ML 2HN7B 3RY5A 3DX6B 2H2SC 3IFLL 3GMOB 3NTCH 2AABH 3L16A 1K5NA 4XPFL 4YPJA 1DQLL 3V6FB 3NIDB 5CLYA 4G2AA 3TH4T 4JREB 1WF5A 5JW3H 2X2IA 4EKXA 4UM9D 1M1XA 3OB8A 2OCCB 3ZN6A 2K9UA 1T7ZA 4G8IA 4Z3FA 3OGCB 4Y5XB 1WZ1H 2EEFA 1JHKH 2ATKB 2Z4TA 3VXSD 1ACZA 1LEKA 2J1YA 4IS6B 3OG6B 5C07D 4B97A 1YNLH 4UIKL 5DQDL 3A4FA 3LCYA 4XO8A 5I1JH 4HKBB 4MJHA 1SXCA 4YEEA 3C2SA 2WBJA 2HX9A 3LIZA 4KKCD 2QVIA 5ANMA 3HI6L 4X0KB 3MRJA 4UQDA 3VW3H 2O5NA 2DW5A 1HKFA 3C60C 3QQ9C 4NJ9H 3I75B 4U0RB 2E6QA 1UD6A 4N6RB 3VG0L 2F2HA 3WE6B 2EVJA 1ZMYA 4X9YA 4KY1H 4R7DB 1X6LA 3QUGA 1CG9B 1F5WA 1R3JA 4K7PY 4DP2X 1O6SA 1CZ8L 3SZKC 3AWEA 2LHAA 3WMPA 2V5SA 4I1RA 4GFXA 1OSYA 1IAII 3VD9A 4N9GB 3RAJL 4E0RB 3MFFB 4U33A 3BAXA 4JFTA 1OHZA 4GKZB 4N8CL 3SBWA 2XDHA 5FGBA 3S36X 1D9KD 5AW7B 3HKZA 5L4MA 2PABA 1XF5A 1NCDH 4YHZH 5SWZA 3TEXA 3CDZA 3ESVF 4XXWA 4BEIA 1YPZA 4UT6A 2P5ED 3S96B 4LCCC 4B9IA 2IFFL 1XDTT 4ZW8A 5FYLE 1XIWB 1FFOB 4EIUA 4JPIB 3U7WL 1BV8A 3NK3A 2GYSA 4DOHE 4Y4KC 1JCVA 1YYMH 2YXVA 5AW3B 1BF2A 4X8JB 4Y4FA 3IJSA 4Z7UB 1JAEA 3JXAA 3D39D 4HS8L 2GI0A 1P7KB 3VXMD 1CK0L 4D0BA 5GSVB 1ZXKA 5ICXB 2G30A 4QYAA 4EAEA 2XUWA 4RCAA 2GSIB 2YJLA 4OFYA 4K9JA 3AS0A 3GSNL 5SV4A 5K59E 1GZHA 2XKSA 1QW9A 3REVB 1OCWH 4U7SA 3TNNB 5DS1A 1SXBA 4WFHD 5CINH 5BS0D 1TYEB 2XFXA 3L9YA 3O2DA 3DVFA 3L7FB 2QGCA 2GAZA 2J7LA 1LJMA 4M6AA 4PRPB 2BNRA 1GYUA 1QRND 3SYAA 3T0AA 4PRHE 4PRNB 1I9RH 1QUNA 3DK0A 4OUOA 4WFGE 5E2TH 3BDXA 3EFDL 5T3XL 2XICA 3QJQB 2GIXA 5IFJA 2ZKHL 4LDLB 2QZQA 2X42A 1SY6A 2E9JA 4JO1L 1FPTL 5DEJA 1TQBB 3CZLA 4HV8B 1K8IB 2WWNA 2NXYC 1MIEL 2HLEB 3D6GA 1UCTA 4Q89A 4FP8H 4UU9A 3C8KA 4PY8I 4A04A 2KQMA 4NUGH 3RZCD 2P24A 3MOAH 4R9HA 3EG9B 1CQYA 2GJ6D 3DBSA 3P2DA 5GZNC 3IDJB 3VXUD 1OHQA 1J5CA 1QNZH 1REIA 1D6VL 3KLAB 3NJHA 1PLCA 1F4XH 1ZTMA 5C0IB 4LIQE 2CIIB 1TZIA 4JQIL 4NO0A 3GXDA 1G7IA 1QEXA 5AZ2H 1S7UB 5HGBA 1FNAA 3VD0A 5K33A 5JPMB 1TJIH 1JPTH 3EOAB 4KO6A 2DWTA 4U05A 4RGND 1I1RA 5HXMA 3GINA 1NWPA 1R6VA 5IBUG 4DKFH 3C5ZD 2YKKA 4LNRA 1XH2A 4HKZB 5C0CE 5GHWH 3MGAA 5IBTL 1R3KB 4NQVB 1DJWA 2AW2A 4ZTPH 5HVHB 4O2EA 1UG9A 1PZAA 4AQAB 1GGTA 3H54A 1VKXA 3D85A 4MAYC 2DMBA 1HAUA 4Y5YA 1CPUA 1V7NH 3F5WB 3TV8A 3T0WA 3CN0A 5T1MA 2COVD 1OL0A 1VPOL 3HIZA 1Y1UA 1XCXA 4NPYB 1XSIA 4AC4A 4Q9RL 2HT3C 3KW8A 5I30L 5DZLA 1UH2A 3HFML 4J3WA 1EZVX 4BUHA 4FTDA 2E46A 1I7RB 3FTUA 1GZPB 4WWKB 1S46A 3NABH 4L4JA 4J3BA 3NEEA 1HYSC 4XOEA 5H4ZA 4G8FB 4WW1A 2OP4H 1OD9A 3SDYL 1IC5L 5IUSA 3QI9B 4JN1H 3CPLB 1FL5B 1S6NA 2YPLD 4OJFL 1EFXA 4HT1H 3OF6D 5MENE 1JNHB 2B08A 3GHBH 3GJFH 4QRQB 4KI5C 1SXNA 3HI1A 1HILA 3H9YA 4AGMA 2COQA 4TLUA 3VRIA 3FH7A 5FF6B 5F6HI 3S3JA 2WXKA 4PGZA 3B2VL 3P9LA 4URTB 4GRLA 4HUMB 3QUMA 1SHSA 3MOQA 5FXCH 3RNQB 4IMLA 3AMLA 3CFEA 3S37X 3UZQB 1J86A 5HTSA 4JFDE 2V5MA 4OT1L 1NKGA 4OFPA 1PYWA 4KK5D 2BSRB 4XVUD 1MJ8L 1BVLA 1TTCA 5A2BA 1T1YA 3Q2NA 1WA2X 5D6DA 5GISL 1EAQA 3O3AB 3MRPA 4LSRL 2JI1A 5MEPA 2NRDA 1DE4B 1RJYA 3BAIA 3BEVA 2JLLA 1Y6MR 3UMNA 1XCTA 2MKWA 2AJVH 3MBXL 4U1NB 1ODUA 1W72A 4P2AA 2AQ2A 2DWEA 1RFDH 3L4UA 3SBPA 4FADA 4IGBD 3B9KC 4P5TA 4Y2DA 3RUGB 2FD6L 1E2VA 1M05B 2QTVA 1HCYA 3L2MA 3VI3F 1JWMA 2XSKA 5JO5A 1T5XB 4RZCB 4WU5A 2BRRH 4W9KC 1ZWIA 2WCPA 1WC7A 2D8KA 3DYMA 2DD8L 4CC4A 1XGZA 4ZDHA 3VGEA 3TT3L 1IBBA 4NN6C 3A6BL 1DYZA 1U91B 2ZG2A 5FO2A 3LXBA 3WFEH 3PG2A 1JZ7A 3T8XB 4WLCA 2H1PL 3KPSD 4MJ4A 1HXYA 4H8WH 3J7HA 1HZLA 4NAMA 4UIMB 3QUZA 2GCYA 2GI7A 3MYJB 3PWVA 4JM2C 5J6GB 3FL7A 1AH1A 5I75C 5BUPA 1MRDH 1NC2B 3KS0H 3SPGA 4ZUSA 2VDOB 2C9SA 2Y36L 4PQXA 5MEND 4HJUA 4ZQKB 4JG1L 4KQ4H 3B8SA 3MA9H 4NFBA 4ENEC 5HYSB 3U7AA 4K71B 4L1TA 2CJTA 1BVNP 4URKA 2OL3B 2R2HB 1BQLH 1PZCA 3JV6A 3LMJL 1ERNA 4BZ1H 5KVFL 4UM9A 1BX2B 3BX7C 5EC1B 5EOCJ 1N6QH 4LOUD 4L4TD 5EIIA 4K9EL 4NHCL 4DQOL 4I89A 1FCCA 4LSTH 1Q9LA 2JQMA 1NL0H 3FUJA 4KK8D 4MNQD 4ISVA 3CUPB 5F0JB 1H6UA 3PL6C 2IPTL 1FZKA 5C07A 3N06B 3JUZA 4KMTL 4KFZC 4AEHL 1U3HB 3U36A 1F2XK 2OSLA 2WZ0A 1C5BH 5EUOE 3U0TA 5H94A 1HAWA 4HFUL 4XHQA 1OARH 3UYRH 2OW7A 1YMHB 3IRZA 1CIUA 2AXGA 3SE3C 4N2KA 1M71A 5GSRB 3T4YA 3CBJB 2O6EA 3M7FB 3MGOA 1DQMH 3CSGA 4I87A 1U92B 1KTDB 3MNWA 2DQDH 2E6PA 1A1OB 4Y88A 2EZ0C 5KYNA 5JXED 4LLQA 5JPNC 3BGFB 1DEEB 5I8OH 2GBTA 2OR9H 1FO0B 2V9RA 5HHOD 4UV7H 1CFNB 4ZMYA 3HR5A 4RWYL 3RDTC 5FOBA 2Y25A 3I6KB 3KLHD 1D9KA 2NOYA 1EUTA 3BSZH 4CA4A 5FA4B 3ULUC 4AXWA 4WNJA 3GGWB 4Z95L 4JVPA 2E5EA 2I7OA 2QT6A 3WL9B 3T3MF 4GT0A 3MLPA 1NLBL 4N8UA 4BV1A 3MLSH 2X4TB 3ZGHA 3MZTA 2J57A 4YHOH 3N44B 5CJOH 3FONB 5AYTA 4IOFC 1F1AA 2B59A 2VM9A 5IBLD 1VZHA 4F7MB 1D5BA 3D39A 3G5XA 5AVXB 3VXMA 1KACB 4WDIA 3LQAC 5AW8B 4Z7WF 2O5YL 1R5IB 3HE6D 1WFUA 5B1BB 3CFTA 5KSUB 2D4DA 1U3NA 2DWYA 5I6MA 5KWYC 4OV5B 3DGGA 4GQZA 3V5HB 1HWWA 5F1OB 2D3VA 3HJEA 2EYRB 5J13B 3DYOA 3O6LL 3AWFA 5TPWH 4D9LH 3IDNA 1E5BA 1LDPL 3CGTA 1EHLL 1MREL 1O75A 5I1CL 4KJWC 1RHHB 1QRNA 4ETYA 4NUPA 4NKIH 3ZZ1A 3BHBB 3E7JA 3TJHC 3BRGC 3ILPB 3BXNB 1B9ZA 4PJ7E 1FZOA 4N0CC 1DVZA 1HCFX 1GC1H 5FM4A 2DMGA 1E4XI 3NACH 5CUSH 3U9PH 4J8RA 1AD0A 5IJVB 3RZCA 3HC0B 1BQRA 1T1XA 2GJ6A 2F54D 3EF4A 4HJGA 2WBJC 4QI3A 1CL7L 1N59B 1HL5A 3M88A 4G8EB 3NSXA 3VXUA 3ZLQC 4CDGC 5IHWA 4RMBA 4PJBB 3H9SB 2RHEA 2DI9A 2AVGA 2G5BA 2NYYD 3MCG1 4TUKL 1E6JH 4WFFD 3CFKA 3HNSH 1YNTF 1FAIL 2ZKYA 4RDBA 3NEOA 1BJMA 1TSRA 2B20A 3HZMB 4G6AC 4LSPH 4QRRB 3C5ZA 1BVOA 5EU7C 5GJTH 3PQYE 3KE0A 3R7QA 5J9PB 4XOAA 2MHAA 3KLLA 4DAGL 1NMCB 3QRBA 2ARJB 1T0MA 5FGBC 4QRPB 2YKLL 3GSQB 1XAKA 4TRPH 1W16A 4QOKB 5E7BA 1G9HA 1YY9C 5D4HA 5T1KD 4AW7A 4IBTA 5KYYB 4XXWC 3GS4A 3JTTA 3BKCH 4LBEB 1BHGA 1VESA 3CN1A 4P2OB 3ZT6A 3RBSA 4KXBA 3AAZB 3TH3T 3VXTB 3FT3A 3HTLX 4E9XA 1E5AA 3HMXL 3WY2A 3LN4A 4WJKB 3CHQA 2YXWA 2J3SA 2OMXA 3GFUA 1SQ2N 4HX1A 3HPLB 3FZUD 4Y4FC 4DEPC 3QBTB 1M6OA 2APVA 1CF1A 2WD0A 3PWUB 3TYFA 3RIAK 3PHSA 3S4SB 2BIQA 3QS2A 3QCUH 1A7QL 2BNQD 2R56L 4JFYA 4NDMB 1GZHC 3QJRB 2YPLA 5AOIA 3RIFK 4PRDB 1JRHI 3OF6A 4MQTB 3K81A 2AKRB 5ICUA 1MCJA 4FQQB 1ZRUA 1SJVA 4D9RD 5A2IH 5IROD 4BHUA 4FJ6A 4UTAH 4F2MB 4KXCA 2P8PB 2A9ML 3TIDA 1IL1A 4XCNB 3EGSA 3KHOA 2GUYA 2CO3A 3N1MC 3IETA 2IFFH 4XMUA 4LPWA 4KX8A 2NYKA 2EC9T 4BWWA 2BM3A 3BP7B 2A6IB 2M83A 2WZAA 2QPUA 1TZ8A 4L1HA 3ULSB 1LP9E 2ZUYA 4E5XB 3K6NA 3NIGF 4U1SB 4Z7NE 3QRLA 9PCYA 4X6EA 3ECQA 3ROLA 4IGBA 2WTRA 4NLHA 5D5MF 3TNMA 2J8UE 1JZFA 3F64A 2JI3A 1CK0H 5KZCB 4KNUA 1FVCB 4QRSA 3GM0A 2CLVA 2VOTA 3NCEB 3X13B 1INQB 2DM7A 3V6ZA 5DC9B 3BAKA 4HJTA 3T2OA 4OD2A 4P3DA 4NYLB 3VD3A 1MHHB 3AGVA 2K4WA 3NSCA 3QHFH 4ANUA 4AVIA 4KI5F 5DR5L 5D8JL 3KBEA 3TVMA 4YJZL 3EJZD 3MUUA 3KPSA 3MJ7B 4ZFGH 1AO7B 5B8CB 1DJGA 2XVBA 3QAZB 4CKVX 2FUQA 5T3XH 2Y1AA 1V8HA 4Y5YC 3RL2A 1RZPA 1S7VA 3PV7A 3QDJB 3VD5A 3LKQA 1S9WA 4NXSA 4JKNA 4GH7B 1JN6B 2DY2A 5KBKA 4H1LA 5C6WH 5MENA 2OQJB 1FPTH 3PGDA 5A16B 1SLXA 3ZOAA 4MXQC 1A5FL 2BVPB 5IV2A 3DUHA 4ODTL 4XN8A 4HS3B 2FHFA 3MRHB 4NSKB 3IFPB 4CJ0A 2K8MA 4XTRD 2QVMA 5LBVA 2GY5A 3GZPA 3CDGB 1M2VB 3MA7A 4WGVB 5F7HA 2FL5B 3GKZA 1KTBA 4JMXA 4L4TA 5IR1A 4IK7A 5E6SB 3ML8A 4CL7A 3KEDA 2F0CA 4MNQA 3TF7C 3U9UA 3DVGB 3FUDA 3RVXC 1WPCA 4WJG3 4HXAL 3DRQB 2X4UB 5C3TA 5DRXB 4ELKB 3NSYA 4ACTA 3IBOA 4GRLC 3CFCH 4FQ1H 1MW0A 3OPZL 2YUWA 5AOLA 1KYDA 1I1AD 4JO4L 3AS2A 1Q94A 1KG0B 5AB9A 1M3JA 3COOA 5IJBC 1BJ1J 5CJXA 3TWYA 3EO1A 5L7XL 4HETA 4XNXH 5IMLA 3K6SA 4KU1A 3MRIA 3QUYD 4PJFF 4Y0GA 5AUMA 4JM2F 1AR2A 2F1EA 3MREA 4R96A 1A21A 4Q9RH 3T5WA 5I71C 3N1PC 2YWZA 3QT2A 5HHOA 1PX3A 4ZMPA 6FABL 4Z1PA 5ILTH 4Z18A 5IQ9B 4X4XB 2DS4A 4GSXA 3HFMH 4P5TC 4Y2DC 1CDBA 1E4WH 2EO1A 2JK5A 5E5LA 4AOFA 2JJSA 3BUBA 2X41A 2P52A 4Y5VA 4HZLB 4TOYL 4HJEA 1GW0A 1BYPA 1PDKB 5BJTB 1XCWA 2W81C 3JT0A 1BIIB 3FO1A 4PS7A 1KYOJ 4U1LA 2HJKA 4H5SB 4OLZH 2P28B 4AKQA 4ONFL 3EH3B 2R51A 3SCMB 3ZTDC 3FT2A 5CS7A 2ICWB 1XF3B 2V2WB 1LO0H 1N0XL 3B2VH 4ELDA 2PWFA 4HZ1A 1UB5B 3QUZC 3RB7A 5I76B 2BFVL 5HGDA 3S9DB 4PD4J 3HE6A 1KCSH 1LEGB 4OB5H 3RIKA 4BCZA 2ZF8A 1Z5LB 3AWGA 5TE7L 3QORA 4LT7A 3BC9A 1ND0A 2OMUA 2ZAGA 5E9NA 2APFA 3W81A 2E7BA 4QDGA 2XVKA 3OKLB 1HN1A 1QLEB 3IEAA 2BP8A 1DL7L 1FRGL 4LSRH 4B9JA 2AEQH 2QSQA 3V0WH 3W11D 4AGQA 4OCMC 1X5GA 4G9DB 4N2FA 5EBMA 3MBXH 1MAKA 5EEVA 2EKJA 3B6SB 4X4ME 2EINB 4KHTH 2VJ8A 3CHXA 3MRRA 3SODB 2FD6H 1AG6A 4FNLL 5AKSA 2WP3T 4LQ1A 4JLRB 4PN6A 1KGCD 5DSCB 1BPLB 4WI5A 3IGAA 4I3SL 3MUGA 3G5ZA 1D5ZA 4YWGL 3MMEA 3K0WA 3II3A 3ROOA 2WCGA 2OX5B 4U1JA 3TV3H 4E9LA 2JQAA 4WUKL 4KKCC 5JDJA 4WI4A 2LQRA 4E9SA 4A2DA 1YRKA 1B9KA 1K6QL 3A6BH 3LY6A 2CCLA 2W07A 2H1PH 1ZIBA 3VQ2C 2JQZA 2RQEA 2B1OA 2NY4B 1UM6H 1J5OL 1OALA 2WQWA 5KVDL 1I8KB 3RKDD 2WWKT 3W0WE 1HTYA 4ZSOA 3HPJB 4JZNB 4JG1H 4JY4A 4YDLC 3KL0A 4AEEA 1T03L 3FSAA 3WNOA 2VGLM 1AGEB 1D9KC 2ZX8A 2EYSA 2JH2A 5T1KA 4LVNB 3MR9A 3CXHK 1M4KA 2NW2A 2W92A 5AVUB 4NKOB 4E42A 4XP4L 3DPBB 3MLYL 4K3DL 1Y07A 4ZUUA 4H40A 4NHCH 1CR9H 4EIZC 4OJEH 4K7FA 2VQ1A 4GQ9H 1OPOA 3DETD 4R3SA 3ZUNC 1DLHA 4RGMC 2MRYA 3JWDL 1ICTA 4E9RA 5IB2A 1I1FA 2WO4A 3AY4A 4AEHH 5J12C 4ZFOB 5D96C 1CFTB 4I8DA 4BBWA 5D1ZB 2B8OT 4YSCA 3VQ1C 1EJOH 3QDGD 1BFOB 3WI9A 5CJ8A 2BNQA 1WFJA 4MKMA 4PJ7A 5JHLL 3EDDA 5ALBH 2EUWA 2EYTB 3CAFA 3V4LA 1A4CA 3WXWL 5FCUL 4OZHA 2O61A 3CZSA 5AAWA 1MELA 4LK4A 1KIUA 5IB3A 1LO2H 3OJMB 4X5RA 1KGUA 4I88A 4QXVA 3FQRB 3FB8B 1QSEB 4QRUB 2ICCA 1JV5B 4WI9A 3I85A 2RACA 5FYJE 1R47A 1IGFH 1S2EA 1P4IH 5DRZA 3MLZL 5ESQB 5DJ6A 5E00A 5FDYA 1HZHH 4YDIL 3C6EA 3W9DA 4Z95H 2OJZL 2XTJD 3H9HA 1LNUB 3MV7E 4H8QA 2F74A 3RVWD 2BMKB 2FGZA 3HLAA 1YPZF 3RZCC 2DEYX 4F8QA 5CN3A 3BH8A 3FB7B 3CG8A 3W0WD 3QIBB 2Z31D 4NENB 1KELL 4L29B 4YGAB 4DOHB 4MTMA 2J1XA 3F7PC 5CO1A 1ITCA 3G9VA 2Y2YA 3KM2A 3GJFA 4G9FE 2LGNA 2Z1PA 5IREA 2ZXDA 1A4AA 1U95B 5IMKB 4MNHB 4I13B 4P05A 1YHPA 3C5ZC 3T4AB 4EZLA 1V3JA 4AMKH 4BRJA 1BVZA 4F5CA 2PO6B 2VDOL 4L5FL 1TZGL 4QRAA 2R7EB 1RZ8B 1QQDA 3P73A 3OXRA 1U8MA 4ZODA 3VYPA 4YQXL 2VZSA 1U8QB 3EGXA 1KB5H 1AE6L 1MRCL 2AAAA 1G43A 5BV7B 1JZ3A 4H20L 2V2TA 1LDPH 2WKGA 2GY7B 3W39A 1EHLH 2IXQA 1H8LA 4M1GH 4OAWA 3AG3B 1EBAA 4PFEA 5EO0B 2BHZA 4PRHB 2N59A 1I7ZB 5GGQH 5IIEB 3OLGA 5CIPB 2CA4A 5J7CC 1OB1A 1QZ1A 4YVNA 2QKIA 5KVEL 3MTRA 2PTVA 1UC6A 3VU2A 5H2BA 4PJHA 2ZP0T 1R1CA 1ES0B 4X6DA 1T1ZA 3SKOA 4BSVA 1CL7H 2HLAB 3OJVC 3VXQB 1IEHA 2IH1B 1Q72H 4RIRA 5DS8A 5KS9E 3FMGH 2WXNA 3CTTA 3FRPB 3NEXA 5I1HH 5C0GB 4S1DD 2CHZA 1BZ7B 1ZVSA 3QEHA 4ES8A 3LDBB 3MAWA 3DVNB 4RMUA 4J28A 4DVRH 4KVNH 1JI2A 4UM8A 5DZVA 3G6JB 4N90D 4TTDD 5KG9B 4YPGA 1FC2D 4YIQA 4ZJ9A 5I2IA 2XV2A 3KWXA 2D2CC 4KAQH 1AKJB 3EJQA 4DAGH 3FOLA 2EEDA 5JTWA 1LP9A 3MRCA 4AITA 2PPCA 2XIIA 4E41E 2NZIA 4JVWA 3BD5A 2CO2A 3F6LA 5F3BB 2J8UA 4GP8B 4FAAB 3ARVA 1DN0B 4F20A 3KYOA 1XGUB 4NQUA 4N2MA 4XVUC 1LTXA 3RWFB 3JQOB 1PZDA 2C7FA 3UGUA 1GW6A 4PLJD 3NP4A 2BOBB 4BZ1A 4L23A 3MNVB 1IM3B 1FN4A 2VN6A 3HMXH 2QQQA 5D1XD 5I8EA 4G72B 4IGBC 4PIBA 3I2CL 5L8JB 5EG6C 4PRAB 4H88H 3JZYA 4RDQF 4ZFFB 5LCVL 3IXAB 1JPEA 3M6DA 2P48B 3VGFA 1SN2A 4HGMA 1NUGA 4DVBA 1VFAA 5FFGA 1A7QH 2C7UB 4LOEA 1FNSL 1EAPB 1XX9C 2XBTA 3BYTA 2WXIA 1ROCA 3LKOB 4HCRH 2WJ5A 2Y1YA 2AXFA 2VJ0A 2GW5A 4M7KL 1JYVA 3BWAB 5A40E 4J1UB 3PWJA 5DD6A 4M4PA 1KGJA 4OFIA 3TVMC 3V4VB 3NUKA 3HN8A 4UOZA 2IPUK 5IM7B 4ETQB 3CSYA 3UDWA 2R0ZL 1MW3A 5GJSH 4JFDB 5E4EB 4NKDA 4IJTA 1NAML 1OTUD 1IB5A 3NJMA 2XIDA 2F7RA 2MOVA 4Z3IA 2QMKA 4X80L 3RNKB 1H8OA 1QFUH 3HB3B 4IEFB 1JJUA 3BGAA 2QFPA 3RRQA 4LOUC 1KXVA 5IOPA 5DUPH 1KWGA 1NDGA 3KPPB 4KK8C 3VM5A 1JF6A 3DOHA 4OSUL 3WUWA 1UVQA 1R3IL 1ID5I 3OZKA 1T6VN 2WO2B 1T6BX 4PGCB 4XPGL 3JWNG 4XO5A 1UJTA 5L2KE 4LP4A 5D2LE 5E8PA 5LLIC 2XN1A 2F19H 1VADA 5HYEA 2E76C 5C6TH 2ESVD 4KKNA 4WI0B 1NCOA 5DR5H 2EXTA 1P9MA 5CGBA 3V8OA 1MWAL 4YXLL 1KJMB 3VRJA 3ZTCC 3QXDB 1KIRB 2G2RB 5SWSE 4FFYH 4JB9L 2XG4A 3S3SA 4GPVA 2JTYA 1I3RA 3PF2A 5JNYA 1VGKA 5DT1L 1CN4A 4DESA 1ET8A 1JFQL 2AV7B 4HAKA 2PW2B 3C2AH 4N5ED 1SN0A 3ARDB 5EMYA 5EHFA 4ZW6A 4YO0B 4ODTH 4GG6E 4OQ1A 3DGDA 1OAQH 4Y5VC 1JXFA 2GTZB 2W94A 1OOWA 4NNYA 5HGHB 4MJ5B 2BP0B 2NNXA 1S5HA 3FU6A 3V0VB 4N2IA 3BPLB 1UENA 1NGWB 2Z4QB 4XAWL 2WJ7A 3N55A 4JFFD 5HGGS 4DETA 5HYJD 1N64L 1OP9A 4XN7A 2OYKA 4P5SA 2I9TB 4KROC 1IX2A 1N0LB 1N9PA 2EXSA 3RWDB 2BJML 5DHYA 3ESPA 1USZA 1ACXA 5EUOB 2XWZA 4E68A 3QDGA 1QUPA 4X4MA 3VCLA 3OPZH 1QRKA 4ZMAT 3HE6C 2BWQA 1HSBB 4BA0A 4N0UB 3WGUB 4HUXB 3QORC 5D7IB 4J3SA 1X6NA 3X1FA 2GK2A 5FS5A 3LKRB 5DJ2A 4NGHL 3VFGL 2BPBA 4TLSA 2CJ3A 1RJLA 3UEZA 1TMQA 3GJEA 1TKWA 3K5SA 4YN3A 1JG9A 2R29L 4OI8A 4OZ4A 1NINA 4HH9A 1OANA 1A9VA 4KK9D 1P84J 5FO8A 4QUOA 5CBEB 4MLSA 5E8DH 5KYWB 1CFQB 1MDTA 2ATAA 5BCAA 3INUH 4WK4B 5E4IA 4PLNC 5AFAA 4S2SB 4TQEL 2K9FB 4TOYH 4FRWA 2XWDA 3RWGB 1P4UA 5GRJL 2XTSA 3W0WA 1A6ZB 2Z31A 4HVBA 1XXFC 4XNZB 4O9HH 4OF5A 1OVZA 4FGMA 2NYYC 5JIDA 3O2WH 4QWWC 1PG7X 3KDPB 4QF1A 1PY9A 3F8UB 2Z34A 1UADC 3WELA 5KW9L 3K2MC 1S8DA 2YS4A 5FO9A 5B4MD 1NBZA 3P9MB 2EE3A 1G7MA 1AR1D 3MNDA 2D03H 2ZOWA 3QR2A 4JRFA 4IOSD 4WO4D 2MOQA 4EDWH 1FFRA 1FNGB 3DSNB 4TSAL 1DL7H 5IJDC 4XC1H 1E4JA 1HHJA 1FVEB 2EDJA 1N18A 2HWZH 4B6ZA 1OK0A 4U1KB 2ZWZA 2VDQB 2Z35B 4P5MA 1N7ML 4CJ1A 4ZUVA 4GAAA 4RQQA 1FFQA 1MAJA 2OMWA 4LLWA 2BY2A 4CSSA 5FYKE 3MUHL 3G6DL 4FNLH 4PUBL 4G5ZL 2JB5L 2HVJA 1KGYE 2E27H 4ZMQA 1XSJA 2FEDD 3AY4C 3NG5A 4Q8BA 3WHXA 2XACC 2OMTB 1J12A 1OAYH 1YEKH 3FZUC 3F83A 3WIHH 4B41A 4NQEE 4Z7VA 5KVGL 1KJ2H 4WUKH 1SDDB 4HFWB 4NFCA 4XBGA 2AGJL 4WUUE 5CKAA 4LLMA 3O8XB 5CXPA 3JT2A 5C2BL 2EIBA 1H0DA 4TPRL 1GY2A 1AQKH 1BMZA 5J1SC 3MV7A 1E27A 1V55B 1FLRL 2DLGA 2GIMA 5AAWC 4JEGB 4HJ0D 1ZE3H 1J5OH 3FFOA 1RJZB 1BAFH 2FAUA 3PQYB 5AALA 3WG7B 1JWUA 3TBTB 1U8OA 1T03H 1MCRA 3TZVA 4WW2B 4LMQE 2X70B 2YBRB 3KPRE 3FPYA 4AG4H 3MLYH 2FTAA 3P4NB 4UTCA 1AS6A 5C9JA 4P3CH 1KCVL 5HDOA 1QFWM 1TTUA 1OF2B 3ES6B 3K8MA 3BP5B 3DXAB 3OR6A 3F7RA 4X2UA 4B7LA 3JWDH 4P4KA 3RB5A 2HJFA 1X5XA 4J3OH 3SDCD 4R6UA 1ZT7A 1J1XL 1COBA 2IGFH 1E28B 1RLBA 3BMWA 3HZVA 5C9KA 2DM4A 4S1RL 4F1ZA 4X7CC 4TSBH 2DDQL 4XWGL 2YMXH 1WA1X 3WXWH 3E6FB 2IG2L 3QA3B 5FCUH 5KSAD 3OXSA 2EH8L 1H6EA 5EUKB 1ZHKA 5LAXA 3TN0B 4M43H 1WV7T 5BOPA 3FQ1A 4L8DA 4YVUA 5FC9A 2F61A 3LIUA 4JO2H 3W37A 1S3KL 2CBMA 4CBPA 4MCYA 2LW3A 3EJZC 5GGSA 3VO0A 2VH5L 2ZOKA 5EZJA 4GUPB 3K0YA 4GO9A 4LDEB 1WCBB 3PHOB 3TO2A 1J05A 5AG9A 1FL6A 3Q8EA 4MA1C 2A73B 1RIUH 2FATL 2QKIC 3U2JA 2Q1EA 3E0GA 1FNHA 1IAIL 3NN8A 4GP5B 4WHCA 4YDIH 2OJZH 4HOMA 1OE2A 3BQVA 2XA3A 4IU3B 3OTTA 5ESVB 3RWIB 3ZRFC 2X3BA 3SQRA 4AMWA 3K71B 1FBIL 4XTRC 2XKNA 3KWUA 1BVKA 5DD0L 4XZUB 1KEGL 4K3EH 3SPVB 2EO7A 3FCBA 3MJ9L 1NCJA 4Z7NB 3C9NB 3ILDA 3LN5B 4KZ0A 3S3CB 3BPCA 1SVCP 1E3ZA 3KPRD 4ORGA 4E9YA 4IU2A 2CDEA 1SJMA 3VD2A 3L4YA 5D4JA 4MWFA 1F6AB 4TV3A 4A68A 3P0VL 4L5FH 1Z1WA 5KANG 1AQDB 1CD9B 2Y24A 4YUEL 3BUQA 5DJZB 5B7FA 3G5VB 4UMSA 5IVXE 4GKOA 3MRNB 1AE6H 1MRCH 2BVOA 2ESVA 3ECBB 3VXRE 1E9PB 2CDFB 2IAMB 4L0ZA 4O2FB 5IG7A 3H9ZA 4B9ZA 2DL9A 3U83A 1NCWL 3T09A 1QSFB 4LLDA 1CICD 5GGTL 3BFWA 1QBAA 3X14B 2CQVA 3QRGH 4X8CA 1Q0EA 2XYCA 3HE7B 4JCWA 5KVEH 3LXCA 4B9FA 1J48A 1KCRL 1NDTA 1OV8A 2CO6B 5BNXD 4C57C 3JV4B 3WSQH 4WKZB 1BFTA 1OKEA 4QMEA 2CRIA 3N50A 1FJ1B 2PWDA 2AJSH 4TN9A 5D2NE 5D6CB 5HYSG 2VDNB 4N4YB 4KGJA 2E4TA 4KKQA 4OCWL 5E8OB 2ZAHA 3L6FA 4S10A 3VQMA 2X6CA 1GA2A 4F80A 4UT9H 3BVXA 4QYOA 2HT2D 3KWWB 2ICES 3MGTA 3NCFB 4F9PA 3S7GA 3WN5B 3PP4L 2YD1A 3PWNA 4JFFA 3FFDB 2VLKE 4IQHA 3TIEA 1R4XA 1TVHA 4PWKA 4JPWL 3JWOH 5T33H 4Z5RB 3FQTB 4ZW5A 2FWOA 5LQBL 4LQFL 2Q2EB 4DGYH 1T7WA 4GFTB 1BZEA 3RTQC 4L8SB 3F6JA 1KCWA 3UDWC 5JMOC 3GSWA 2YGQA 3QQNA 4LSUH 1DBJH 3CFJA 5CP7B 2IPUG 2P43B 1G6RH 3H2PA 3IMVA 3CVIH 2BIOA 4P46D 4EDXA 1J9RA 3ZGIA 2ZUQC 3Q01A 5DD1H 1IAMA 3D2UD 2LAAA 1EXGA 4M6MH 2LLNA 3ARBB 1KFAL 3W11C 5H8DA 5L2KA 1M9WA 4KZDL 4OJYA 1M42A 5F89B 1RZJL 2W0FA 1KXVC 1G7QA 4AJWA 2UZYA 3I2CH 4IRZA 5LCVH 3U46B 1EDQA 5GGRA 2ADJB 3BE1H 2ITCB 1F02I 1FZJA 4FL4C 4RVBA 2Q6WB 1LE9A 1QBLH 2DQCL 3F3HA 5EBLA 1ZLSL 2C1OA 2H41A 4RSVA 3UTPD 1U41A 1OLZA 4MCZB 4JO3H 2KPNA 3DIFB 4CRPA 2WBXA 5JR1L 4TUUA 1P6AB 2IV8A 1XT5A 2ZCLL 1I75A 4GG6A 4WWPA 4Z8FL 4NRXA 4TVPE 4LNVA 3V4PL 4OZGE 4RFNC 4XAKE 3ASNB 5EBWB 1J8RA 4D0CB 3OKMA 2VYRE 3BQUA 1CD0A 3K2KA 4FJYA 1GMEA 1WJ3A 2FIKA 5FA3A 3RKDC 1FGNL 1UZ6F 4EXKA 1OT2A 4AC2A 4HPOL 3RLSA 1BW8A 4F8OA 2D7NA 4W9CC 4Y7OC 4IOSA 4WO4A 2YZ8A 1GC1C 1OXYA 2XJLA 1NAMH 5CM1A 2RBLA 2X89D 1FUNA 1DO6A 1PZ3A 1UFUA 2N7BA 4K2UH 4X80H 2H3KA 3MNZB 3EFOA 3EHBB 3FBKA 3FRUA 1ZLWK 3N85L 1A14H 2CJUH 4CADA 1AANA 2L4OA 3E3QE 4G8AC 4W93A 3CC5A 4PVMA 4O02L 2DTMH 3RWHA 3QUHA 5FKPB 2EADA 3TEYA 4N5UA 1TTAA 4TLTA 2XWCA 3PNWA 5GGVH 2R4RL 5DJ0B 1BXVA 1R3IH 3MRDB 5CSZB 1ZEAH 4XBEH 4YGVA 5BRZE 2AEPH 5K9QG 1FV1A 1KWKA 1FYTE 3T2LA 3FCGA 3O3BA 5DEGA 3V5DB 4MAUL 4S1SL 4F2FA 4KQ3L 1JZ4A 5HHVL 3QZWB 1Y0LA 1E2WA 1Q0YL 1X7TA 2PR4H 4DN3L 2JNZA 3BAEL 3MJ8A 1XGYL 2ZUWA 2D7MA 4UAOB 4YXLH 1KB5A 2GFBB 3OJDA 4F7CA 4KTDL 1CQKA 1J10A 3GMMB 5FGCB 2DM3A 5EC2A 2AS5M 1Z3GL 2WLNA 4G8GD 4R90H 3FO9A 3SY0A 2ED9A 5DT1H 4C55A 3ULVE 4FXKB 2NDFA 5ENWB 4Q4EA 2GITA 2VWEE 4BKSC 3L81A 3RFZA 3GHEH 2EEAA 1HXMB 2JJWA 4UQ2B 2EIZB 4W1TA 4XAKD 1SBSH 3NFPA 2XTJC 4KQ0A 1UQSA 3EH5B 4YBQD 3RVWC 2FR4B 3EYVA 2EH7H 4BXVA 3UL4A 2FJFA 3QQ4B 1SOKA 2FWUA 1M56B 3FB6A 5D70L 3H7BB 4QXTA 4NT6A 3MOBH 3HC3L 2VIRA 4QTHB 1GS7A 5I16A 1G7JA 3R19A 4WI2A 4LCYA 1OCRB 2VW7A 4U1IA 3MQIA 3UBFA 3SDCA 3V4VL 1ZHBB 4HD9A 5F7BA 2LTQB 1FI8C 3EYQC 4GRWH 2ZTBA 4XXCC 4Y19B 4X6FA 5FGSA 2QGDA 5EPMB 3S4SG 3TS8A 5C0FB 3FU7A 2Y7NA 4PJ7F 3SPHA 1MF2L 4BHUI 1HHIA 3N6YA 1BD2B 1RPKA 5TDNA 1CO1A 1DJSA 4NGHH 4NN5C 4OZHF 3UTOA 4FLOA 1EZVY 1ETJA 2PCFB 1CLCA 4NQEA 5I74C 4LOFA 2CD0A 2X4RA 1WD9A 4R7NB 4QHUB 5AW4B 2MCAA 4AVKA 5HYQB 1JWSA 1GVIA 4Z9KB 1PPIA 4YK4C 1SYVA 1EDHA 2VLJE 3A4DA 3TEZA 4WUUA 2ZXAA 4QRTB 3SBQA 2UX7A 4ABWA 1NPNA 2JELL 4HWBL 4F57H 5C8JA 1DBAL 5E8NA 5JW4Q 4GSQA 4HJIA 3U25A 1QI3A 3L3OA 4XNAA 1RUKH 2XWBB 2GG1A 3CH1A 4TQEH 4X99B 4D94A 3FU8A 2JKIS 5DLML 1UJ3A 1NCUA 4HIPA 3I9GH 4YL4A 5GRJH 1H9VA 3C5XA 1L5GA 2E4FA 3ULVD 3QDME 5TQ2L 2Z91A 4HCRA 1PSKL 1A4BA 1MFBH 2JWYA 2NUTB 1W0WB 4S1DC 3HHSA 5IUCA 2FGWL 3H3BC 4Q6IB 1OGAE 2H0JA 2MWCA 3KPRA 4G9FB 4GW5A 4KMLB 5J57B 4ZMZA 1MRFL 3F62A 1RQ5A 3TO4B 1IC0A 1G7HA 4TTDC 2DYPD 3NZSA 1JV2A 3LNFA 4PJEA 4OVVA 2IDSA 4ZO9A 4FS0A 5E2JA 2GTQA 5F44A 3IJ7A 2XG5B 5ALCH 3RFRA 2CKBL 1UKSA 5I17B 4OIIH 3VJ6B 1MW1A 1E9QA 4RBPK 1F3DJ 2NNRA 5IHHA 1X7SA 3TZVC 1OK8A 4PVLA 4TSAH 1EK3A 4U1MA 3Q48A 3ATBA 4LEXH 2QDVA 3CSBA 2ARWA 4PTUA 1GKEA 1N7MH 5ESAA 5BPPA 3MN8A 3AFLA 4A67A 3UTQA 4PLJC 3T0XA 1GXEA 1ORSB 1Y18B 2JKRM 5LNGA 3UC0L 1DEDA 4PUBH 2JB5H 3EYFA 3I9IA 4AKOA 1TETL 2R1XB 4P4KC 1ESOA 2EACA 3FOMB 5KJ4A 4CVZB 3QYMA 3ISWA 4FEMA 4PJHF 1T5WA 2EIJB 3WS3B 4J12A 4X6DF 3F7QA 5DF0A 3OMAB 5CGTA 1GOGA 2WYTA 2AGJH 1E5UI 3PGFH 5KS9B 1N5AA 4EE2A 5C2BH 2B5IB 3IJ8A 3P2BA 4X7TB 2ZSWA 3EJCA 2W9EL 5DK2B 4CMHC 1GYCA 3NPSC 4F8TA 2ZXBA 3K4DA 5BZWB 4FTVE 1CS6A 1HOEA 1KTJA 2MFNA 3M1CA 4UQ9A 4PG9A 4PJAA 4HCGA 2AK1L 3RJQB 4FFYA 1MAMH 4QHKJ 1IKFH 3ARFB 3PJSA 4MVBD 4OQTL 1I8IB 3B2PA 5CU9A 2YD9A 1LP9F 3CMOH 2J55A 4M61B 4E41B 1B0IA 3PGCB 1L7IL 4S0HA 2W5PA 3CMGA 3OHMB 3TCLA 1S3RA 2CBTA 2J8UF 3BPOB 4AIXA 2CXGA 3L9BA 4P46A 1OZTG 2WZ6A 3ELQA 1LWHA 4AUUA 5IFAH 1OTUC 1DVYA 4XH2B 1WBZB 4OLVL 5AYQA 4A6YB 2CUHA 3D2UA 1AZZC 4I0CC 4ZX3A 3T6WA 3BZEA 1MG2C 1Z9NA 4RMRA 1K5NB 4HHGA 3NCXA 4I0PD 2VW4A 4F37F 1M3IA 3P69A 1MY7A 3QXAB 4WI8A 3VXRA 2NY6B 4CN4A 1J1XH 1E6OL 2RA1A 3RWJB 2BW5A 3WIIL 5MP6H 2ZPKL 3E6HA 4FLRA 4FOMA 4YXHL 4KPHL 2NX5B 3TYGH 4AGNA 5C0JB 3TCXA 2DDQH 3H3KA 3VWJA 5IT2L 4EI5C 2IG2H 2WXHA 4D3CL 2R69H 3QH3A 5IJKC 3T1FB 1I7TB 1IEBA 4HSCX 1LEKB 2X4OA 5D2NA 2DF3A 3X12B 1JRHL 2VH5H 1BZ9A 1WYJA 1SFDA 2VDQL 2KH2B 2WXFA 4Y7MA 3KYMB 1DVXA 3L3GB 4NRZA 4XMWA 3MRJB 1QWUA 2FATH 3FQWB 1FORL 2WB7A 5ELIA 2W1NA 1J8HE 3UIZA 3HA0A 3MACL 3QUXD 1O6SB 4N2HA 2X89A 3ZKXB 2WQXA 4X50A 1AC0A 5C09D 1TIUA 4YS4A 2JLPA 1WGVA 1BEXA 1N8ZA 4HAGA 1KEGH 1KYFA 2X2JA 1I1YB 4HA1A 5GRUL 2VR4A 2NUPB 3OWEA 4F9PC 4JNXA 4U2YA 4KTYA 2EDKA 4HSQA 2BH0A 1QOKA 2VISA 5GS1A 1MLBB 4XB8A 4AYFB 3MCYA 4FA6A 4ZXBA 3P0VH 4KRPB 2B15A 4TL5A 1F58L 3U1SL 5D2LB 1P5UA 3B5HA 3OVUB 5DZ9A 2WB1A 4PYHA 4AUJA 3SD5A 1IC1A 4JZJA 5D7JB 4HHAA 4NNPH 3RZWA 3TOPA 4KO9A 3WD5L 1RK0B 2HCZX 4BM7A 1NCWH 1S7RB 2WUBH 3O11B 3E38A 5C0AE 4G8GA 3KL5A 5L6YH 1ASOA 3SGJA 3LZQA 4MJ2A 4K3JL 3HZYB 1NBYB 1JZEA 4CW1A 4ALAL 5E94A 1KN4H 1MNUL 4KK9C 4UILH 4U4BA 3REWB 3I3BA 4G7VL 4P57A 1H15A 2VDPB 2BC4A 4FI6A 3C5JA 1PG7W 3WIHA 3WDJA 1KJ2A 3TBVB 2VSMB 1V54B 1XF2B 2CO7A 3HI5L 2XX1A 3GRWA 5B38B 3O4OC 1A7RL 3F58H 4XWOC 3R06B 4TSCL 2W0KA 5H35B 4EVNA 1RSYA 3VFUB 5I6KA 1DVFB 1G9MC 4UU9B 3ESMA 5DZJA 5I6PA 2X44D 3NIFF 4P3WA 5ID0B 1IC4L 2BNUB 5B21A 3U2SB 1GYVA 3QG6A 4LEOB 1HS6A 2C4XA 3MKKA 3BQUC 2G4GA 2K4AA 4PJCE 5F2FA 1AR1C 2DLFL 1TTFA 1I3UA 2QPSA 4NO0B 4FKHA 1L6ZA 2PPDA 4PRBA 3VFTB 4WO4C 5A2LH 5EU6E 3HHRB 5DI8A 5ICZA 1FYTA 1FQ9C 1QR1A 4GKNA 5TFSH 1KFAH 5F7YC 1RZJH 4N87A 5I15L 4APQB 4BZ2L 2WWMD 2YAPA 3S98A 2VN7A 2XPYA 1OAZL 3RX8A 2A74B 4O2EB 2GJRA 1JUFB 2XXCB 2NLJB 3WFZA 4MASA 1LD9A 2FEDC 1HJBC 1ZV5A 3WMSA 2VR5A 4F3FA 5CCKL 3ETBJ 3GPEA 3BCDA 2F8OA 1ZTXL 3STZB 3BAJA 4M4RA 3IKCA 2XV0A 1A6TB 4ODBD 5E9DE 1LO4L 1OCZB 4KKAD 1TDQA 2C3GA 1CDYA 1MCFA 2WXGA 4BH8A 4CMMB 1C12A 4BUGA 1QEWB 2DYPA 4HJ0C 2RQ8A 3GSRA 3AUVA 3DMMD 5DFVD 3FH8A 4DCQB 2L04A 4FNQA 3U9WA 2VMCA 1PEWA 5MERB 3TPKA 3QEGH 5TE4L 1M7IA 3QNXA 4RESB 4M56A 3ZYIA 3UABA 2YK1H 5B1AB 4NZRL 3H3PL 3RFZC 3HCVB 2B4CC 3B2MA 3PWLA 4DP5X 4UINL 4X0NA 1D2OA 2ZJSL 4O02H 1ZA6A 2XN9E 3P9LB 4YBHA 3UBHA 1RZQA 2Y2TA 5M94B 5F88A 2IQAB 4UNIA 1B3JA 1CGYA 1T0NA 4NB7A 4UV4L 4PVNA 3U4AA 3IKKA 2R4RH 3ZDYE 1YEJL 4PRID 4NZUL 1TCRB 1BVLB 1WRFA 3FFCD 3SDCC 3HZKA 1MCEA 1AGDA 4S1SH 1ZHLB 2JCCE 2IF7A 4Z7VF 1HQRA 2DI7A 3OSVA 3QCTL 1I3GL 3U4EB 4PJIB 4G7YH 5HHVH 3OM3B 3HS9A 1Q1JL 1XCTB 4M5ZH 3ZT5A 2LVCA 1DQKA 1BGXL 3BAEH 3B7UX 4QNPE 1A6UL 4PY7A 4KDWA 4PB9H 4RAUA 3CFDB 4JJ5A 5EO1B 4PJ9D 3FRPG 5HJ3B 3AXLB 1DVUA 4LVOB 2X9YA 5F9WB 1NGYB 3SE6A 2OI9C 1PF3A 2YPVL 4QLWA 4WU5B 1RJCA 1SBBA 1U8IA 5E5MA 5KBLA 2LABA 2IQ9H 5KYUA 4TUJA 1KNOA 3NH7L 4ZAKD 3WJLA 4XVSL 2AF2A 3TFKD 3DHJA 3M17B 3QJZA 5B3SB 1V7ML 3LB6D 1ZK9A 2OMVB 3PYCA 4R2GB 4AMXA 4BZYA 3L3OC 1RUQL 1RXLA 1FHNA 4QTIL 4Z0XB 2VQUA 1MJ7L 2OSYA 4OD1H 1JGLH 1ASPA 4NQCD 3VE0B 3NJXA 4ZUSB 2JXMB 3CU7A 1NIFA 1RVFL 4UT9A 4I0PA 2AEOA 2R2BA 1JDDA 2XRAL 3ZTEA 5EEUA 4YDMA 3OX8A 2WLIA 4EIBA 1OAKH 3O2VH 4HPYL 4MFHA 2AJUL 4N68A 2BK8A 1IBDA 1NSNL 1MF2H 3ZPDA 5DK3A 1KLFA 1ONQA 1QFPA 3CVHH 4PYGA 1ACCA 3DRTA 4UCFA 3U7YL 4MD5A 3WOVA