1GSMA

A reassessment of the madcam-1 structure and its role in integrin recognition.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Reassessment of the Madcam-1 Structure and its Role in Integrin Recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
molecule keywords MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA01
3RQ3A 2H2SD 2W60B 2EDBA 3VXPB 4L4VD 4F57L 3MV7E 3SE8H 3BRDA 3EYSL 4MCYA 4I77L 1KIUA 1XR9B 4ODVH 3MLWH 3GMPB 1S7XA 5GGSA 4GAGL 3A67H 3RZWA 1FIEA 1FFRA 1SBBA 3HPLB 4GMSL 5K9OA 3WV0A 1RZKL 5B39A 4KKBC 2VITA 5JR1H 5IK3A 3DHMA 4NQVB 3CH8A 2O5XH 4GRMA 2OQJB 4L29A 4XBEL 1TITA 1WVZA 1MH5A 1QA9A 2FGZA 5EUOB 1C7TA 3QJHA 3NCJL 4HG4K 5AD0B 3QEQE 4EDXA 1GPOH 2JJTC 4JG1L 3RX5A 4ZYKA 3VWKD 3HUJF 4XP6L 1T1XB 3O6KL 4ODHL 1U92A 3BO8B 2VL4A 1N7MH 5L8KB 3HFML 1IEBB 4N5ED 4KKAC 1E4JA 3WXVH 5KAQG 1Q9KB 1PEZA 1F4YL 1BJ1J 1G9NL 5HI5D 5DDHA 1XGPB 4PJAB 4GMSH 3HLAB 1TNNA 1P6AB 4U6XB 3LEYL 3FKUS 4O5LH 1A6AA 1FZKB 1N5AA 3FQWB 3I50L 4O2EA 3L1OH 2VDPL 3MJ9H 1W0YT 2F54B 4DGIH 4H5SB 3IU3B 5IFAL 5ICZB 1DBKL 3NIGF 1MJUH 2PR4L 2B4CC 1NGXB 2CRMA 2OR7A 3WDIA 2W0KA 4DZ8B 1KPRB 3EOTL 1N0XH 1S5IH 3SGJA 2ZUYA 4L4JA 5IW6B 1A14L 5E8PA 2OJZL 2Z91B 1CDUA 1DQJB 2EDJA 4L3EE 4UINH 3SHSA 4M7KL 3VFUA 5EO1A 1T20B 2WWMC 4HKBA 3DX6A 2HLAB 4P2RE 2FIKA 2L7UA 4MVBC 3MROB 1XIWD 4BH7A 4ELKA 3EJYD 5ICZA 2D0HA 2R4RL 5D71L 2X1OA 4G3YH 3TBWB 5C0CE 1NEUA 3DROB 4XCFH 4UIKH 4U6YB 3GSWA 3MACH 4NQUA 1RZ7H 2HRPH 3T09A 3OAYK 4FQCL 2IH3A 2XZCL 5JW4R 5C0CA 3BN9C 1MCEA 4Y5YC 4OZFB 3TT1H 5CD5D 1UA6H 1FZJB 1QFUH 3DYMA 3MBED 5GRUL 4JG1H 3ABZA 4BH7B 1VACB 4J1UB 4L9LB 2P8LB 3BDXA 3KNBA 4X4MA 5D93B 5TF0A 1S7QA 1NFKA 1ZT1A 1CGWA 1UXSA 2VDRH 1I9EA 4LF3A 5T1LA 5J6HB 4FG6D 5L6YH 2FEDC 3T0XA 2W9EH 4KV5E 3VFTB 3S88L 1INQA 4XVUD 5EC1B 3N1QC 4ODTL 4OT1L 3JZ7A 1RJLA 4M48H 3ROOA 4AT6B 1INEH 4BFEA 2OM5A 5D72L 5GSVB 1HHKB 1AKJB 3TPUB 1IQWL 1WZ1H 3FFDB 4FQCH 3LN4A 4JANA 8CGTA 3HC4L 5BMFL 1I7ZB 1K6QH 2ATPA 1EHXA 3MRJB 4L4VA 4G6ML 1UA6L 3RIAK 4K9EL 3O3BA 4GUPA 1AHWC 5FHBH 4JM2C 5BRZE 5CP7B 4ZMAT 1R6VA 4QRRB 5F8RC 3NCCB 2ORBH 2XWJB 3RJQB 4X6FA 3LEVL 1FORH 1AQDA 4NT6B 1NBZA 2X89A 1CQKA 3I2CL 3M07A 1X44A 1B88A 5F44A 3MNWA 3PQYA 4KKLC 3LN4B 3KPRA 4Y4FA 2VQTA 2R2BB 4EI5B 4YUEH 5I17A 1BD2E 4WV1C 4AY0A 1IQWH 1I4FA 4BM7A 2ED7A 2FB4H 1OTTD 3OZ9H 4URTB 1IVLA 3O45B 4NRXA 5EZLA 1B6DA 2OXHA 1G9MH 2FJFA 1R5WA 2JCCE 4LSQH 3U9PH 5T3XE 2HWZL 3GBLA 5DFVC 2WLZA 5IOPA 5C08D 3RY6A 3UEZA 3RWGA 3SQOH 4MQXD 4NO5A 3SDXB 1IGIH 4Y4FB 3BEVA 4QRTA 5IHUL 4UNVA 1UJ3A 5DJ0B 1ZKAA 4RFNC 4RGMC 1HK6A 3H9HA 1IBGL 4AK1A 1XMWA 4HFUL 4GBXB 4ZAKB 1CIDA 2YS4A 3I6LE 3NPSB 1BIIB 4MXQC 1XGRA 3F58H 5FK9A 3R4DA 1VPOL 3IKKA 4KRPD 4TUOB 3VE0B 3O9WC 5DURD 3KXFD 4XNMB 3MBEC 2BVPB 3TEUA 5IBUG 1KBGH 3ILQD 3LRHA 5F96L 4OKVA 3GBMH 2DWEB 2EYSA 4YDIH 4HD9A 4DK3A 5T3XH 1BLNA 3BPLC 5HHVH 4P3CL 3V4VH 1NCCL 1WCQA 2OSLB 1NGYA 5CZVL 4X6BB 2PETA 1JGEA 4FZEH 4RWYL 5CEZL 3RWCB 3GZKA 4GXUM 2AJYH 4P46B 5DMKA 4AEEA 3LN5B 4G42B 4QY8A 4OFIA 1YEKH 2PF6A 2AEIT 4EN3C 5HHPA 4N0YH 3OKLA 4RMTA 5FA4A 3QIBC 5CGYD 1Z3GH 4Q58C 5F9WB 2HH0L 4YBLC 1BREA 4ZTOL 5IQ9B 2PTUA 1N6UA 4LCUB 5EU3B 3M1BA 5LJYH 5GS0D 3IDGA 2GTZA 3NPZB 3ZE1F 3WS3B 3SKJL 1P7QB 1UWXK 4TSBH 4K55A 3D6GA 3MLXL 5CZVH 3RZCB 1WV7T 4EKXA 1FNEB 4F37F 2QTEA 4HEPG 3D39D 3MGOA 2UY6A 2A83B 1JTPA 1UWXH 1I8LA 1SJEB 1S7SB 5FYLD 5GRXG 1G6RH 5C07A 5T5FH 1VFBB 5JOPE 4OCNC 4CRPA 2DMBA 4G9FE 1TXKA 1RZIA 3VWJB 2ZG1A 1R5IB 3TIDB 3UO1L 3BVNA 5IMKA 3QFJE 2WAHA 5IESL 3CVIH 4Y16D 4P5MB 4J3TA 3KXFB 3TF7C 3MLSH 2V2TB 1R5VB 2XQYK 3EAKA 2GITB 3GSRA 4PJBA 3BSZL 2H26A 2WP3T 3FO0L 4XP1H 4JM2D 4G7YL 3OB0H 3QUZB 4MJIA 1K3IA 5F1IB 2YRPA 3ARFD 1ND0A 3H3BC 4E42A 1VEPA 3MRCA 1F3JA 1S7VB 3VGGA 4XNXL 5C0AD 3GBML 5IVXE 2FX7L 4PJCB 1VFMA 1LK3L 3QFJA 3OKDB 3WNOA 2P7TA 4P3CH 1I1FA 5F7KC 3O8XC 4X7SL 3CFEB 4L1HA 4ZQKB 5JW3H 2R1WA 1BFVH 5MEOB 4Z7UF 3GNMH 1KC5H 4P59H 1LDPL 2A9NH 4Z7VA 3SBWC 2OK0L 3IFPA 3DI3B 3JTTB 4N90D 3B8YA 4Z8FH 3TO4C 4LCCC 4NBXB 2NNAB 1YMME 3FO0H 2P44B 4NWTL 2F8XC 1MHCB 2R15A 3OKOB 5CGTA 4IOIA 4KDWA 3ME0A 4MD5B 5ANME 4OZIF 4ALAL 3HCVB 4WENB 2BJMH 2OP4H 2LTQB 1LVEA 3MCG1 5LWYL 4V2CB 2D7PA 2CD0A 1BX2B 4JRYD 5JA8B 3MYJA 3LS4H 3NFPB 2EIEA 3OKKB 1I1AA 3PWPE 2AJXH 5F6IC 4AH2B 4XPAL 1YNLL 4J3WA 4ORZC 1CDGA 2EE6A 3DX6B 5LQBH 4ZOEA 2JKXA 5HYJB 4JRWA 3BGFB 3J7HA 3GNML 2CRYA 5DEGA 4S2SA 4IOIB 3QZWG 1OB1B 2XZAL 3ZDYE 3GMQA 3FMGH 4HFWA 4JREC 1W0VB 3HMXH 1D6EB 5BQ7A 4PJ7A 5DQDH 3ARDA 4JR9L 3AS3A 3U7YL 2B39A 5CJ8A 4JY4B 1A1NB 5IB2A 2ESVD 1T83A 2ESVE 1BVKA 5I8KH 4U6YA 1NJ9A 4JN1H 5D8JL 5IB1A 5IESH 1WJ3A 5JW5A 2I5YH 4R97B 4QXWA 2GAZA 1OY3B 3CK0L 5SWZD 1P7KB 3CUPB 3MPCA 4I4WB 1DDHB 4LFHD 3VW3L 4HWZA 1WTGT 1FVDA 3RRQA 5EUOF 1P9MA 1SMOA 4XVJH 2EYTB 1F42A 4HV8A 5E6ID 4NNPH 4BSVB 4W70A 3X17A 4R0LA 1RJYA 1UJTA 2BY2A 1AO7A 4JGUA 1IGJA 5CSBA 4FABH 3T0EC 3PWJB 1KSRA 2DM2A 5CEXA 3CFDB 5HI5C 2ICEB 3O2VL 3TPUA 1L0YA 3NACL 3L5XL 3HZMB 4P2OA 4G8GA 1T1XA 2HFGL 5H2BB 1HZHL 3BQUB 4I4WA 5C2BH 4N90E 1YEIL 4Z76A 1INDH 2X89D 2EDFA 1UH2A 1F58L 4Y2OA 3BZFB 4FP8L 4U1SB 4MAYD 5JMRA 1ZGLB 5E2TH 2AV1B 4X6DF 3MRQA 1ULVA 4V1DA 1PLGH 2GSIB 1FAIL 1JPSH 5DDHB 3T1FA 1A1MA 2EXWC 4M8VA 4PJFA 3KDMA 4JLRA 3VD3A 4ZXBD 5DRNA 3P0YL 1AQDB 3C60A 3O3AA 5F7YC 4OZFG 1K8DB 3STZA 2ZCLH 4TRPL 1VHPA 4F2MB 1QFWI 2ICWI 2VQUA 4KQ3H 1KTRL 1T83C 1V3MA 4JM2A 2A1WH 4NQXB 3WLWD 3WS6C 4LSPH 4K94C 4UINL 4AENA 5IK3B 5I2IA 1T89A 4HKJB 3HMXL 2FJFB 3U46A 4Y2DC 5FO8B 4NUGH 4M4PA 2P47B 1PLGL 2XOTA 1BGXH 1X5HA 4JFOB 3WIFB 3K2MC 4PGJA 3KWWA 4LSRL 1T20A 4NO0D 4ZUVB 2AEPL 3SDXA 4GSDL 2J5LC 1D5MA 4KHXH 1Q8MA 1L7TH 2DJUA 4LLMB 3SDAA 4WFED 3WUWG 5I16B 5IHLB 2ZCLL 5KVEL 4LBEA 1Q9KA 4CBPA 4UUJA 5T1LD 4X7TB 3I50H 5I2IB 3FJTA 2NY4D 2C1PB 4MNQA 4LASL 4JFFA 4X6DB 3LB6C 3QUZC 1A6UL 2R8SH 3ARWA 4WEMB 2VR9A 4XNMA 3C5JA 2MKLC 4DGIL 1QFUL 2Y7QA 4QRPE 2X4NA 4RNRA 1ZLSH 5E94A 2HKFH 1N5AB 3I3EA 1CU4L 2XWBB 3O2DL 4KJQD 1DL7L 2YUWA 3RI5F 2BSTB 5DVOA 1ZHBA 4OF7A 2B5IC 5DD1H 2P45B 5E03A 2VL5A 3MJ9L 2X10A 3G5VA 4PJBE 4U1NB 5D5MB 4NN7B 1NCWH 4XPGH 4KKCD 4PP2B 2ILLA 4QO1A 3B9AA 4FTVD 1I75A 4PRNB 3DV4B 3FOMB 1CXKA 3CJJA 5GS0C 1LK2B 2EDWA 4F7EA 4P2RA 4RISH 4O02L 3TN0C 3HE7D 4QRUA 3M8OL 4XB7A 3M17A 1IL1B 3OR7B 1PG7L 4KI1A 4PJEB 2QKIB 5T1KA 1WFUA 3S98A 3WLBB 1JE6A 4RRPA 5I1DB 3WFBH 4JHBA 4P2QD 5D1XC 3BRFA 4HUMB 1WQVT 3IDGB 2UYLA 3UPCA 1EEYA 3SE4A 2DQGL 4FQ2H 5HHXH 4N5EC 4ETYA 2P8PB 4EN3B 2I07B 4FZ8H 5C9JA 1CWVA 3SE3A 2FO4B 1JGLL 3GSXB 3TBTB 3D0LB 4BH8A 3JV4A 3MGOB 3BJLA 4G8FB 4L3ED 1DTUA 2VN4A 1U3ZA 1J8HE 5DJDA 3PQYD 4IHOA 1S8DA 1DUZB 1JNHA 1GAFH 1HNGA 1MFAL 1N64L 2HLFD 1FL6B 5HHOE 3VFOA 1E4WL 1RZIB 3VWJA 3NN8A 1FVEA 4R2GC 5IG7B 4PJDB 4HS3A 5D7IB 4MJIE 1PSKL 5F9DC 1MJUL 4JKLA 3KXFA 4NQTA 5GSRA 3OV6A 2NYYC 3QUXD 3FQRB 1S7UB 2R23A 5ITFB 2R0KH 1J0ZA 4YHMH 1DUYA 1U8NA 1A2YB 4PP1D 3JWNC 2IH1A 1WF5A 4YHZH 4FQXC 2GJZA 2FATH 3CSPA 4GBXC 4ZAKC 4NCDA 1MCOL 5ACZA 1CK0H 1D6VH 5BZDB 4G8IB 5I1CH 2E7MA 1TDQA 2C5DC 2DM7A 2V7NB 3OXSB 3QNXA 3F7YB 3I2CH 4MD4B 4PR5A 2C9AA 4H1LA 1DBMH 4U6TA 4F3FA 4PJFF 3VXRD 4X6FB 4BQBA 2EDQA 1BWWA 5L7XL 2R23B 4AG4L 4DGVL 5DK0A 1FL3B 4NN5B 4I3SH 2IH1B 1MUJA 1PYWA 4F15B 3VA6A 1NFDF 4XP9H 5J9PA 2CKBB 4G8IA 5HD8D 4YHZL 2QSCL 1NGYB 2Z35A 4QHLB 4LIQH 2CJUL 3AU1A 2LU7A 1T1ZA 1V3LA 4H1LB 3QUMB 4YNYB 1XGTA 1IM3A 5M7QA 3BEWB 5IIEB 3IRZA 3ZMRA 1ETZA 4G42A 4QY8B 5DJZB 1MFCH 4RQQB 1LE9B 4PTTB 3VFNA 4KXZH 4OZIB 1QFHA 1MUJB 1C5BL 4W4OA 3MNVB 5IWLA 1C12A 1WZ1L 2M2DA 1I1AD 3B9EA 3B4NA 1IGIL 1R0AL 4KDTA 4M7ZC 3KHQA 1T1YB 4NHUA 3WN5B 5BS0D 5I18L 2DRUA 2ZPKL 2DB8A 4NQDB 4WV1A 1CR9L 5HYEA 4CVXB 4ODXB 4LK4A 12E8H 2VXTL 4RWHA 2ESVA 1EGJL 3QEHB 3LV3A 5FOJA 2EIBA 2BVOB 2GAZB 4X6EB 1JI2A 1FORL 5I0DA 2XQBL 4YDKH 2Z4QB 5MERB 4Z0BL 2HVJB 4ZOCA 1YN6B 2BNQE 5F96H 1AXIB 3BN3B 2BNRB 4KY1L 2IF7A 4TTDC 5SX5H 2XICA 1N59A 4FQXB 2FB4L 2WW8A 2KBGA 1R5VA 1MFDH 3MJ6A 4GXVL 3BWAA 5JNYA 1RK0B 4N8CL 3TN0B 1UFUA 4MDIA 4WFHE 5KVFL 2PYFA 4WWKA 2GTWA 2E9BA 1ORQB 3BQUA 3PV6A 4XC1L 3WXWH 4CDHA 3MZGB 4U1SA 1ZGLA 4HQQL 3OKDA 1JV5A 1RK1A 1MCCA 1YEGL 3FQNB 5DVMA 4NQVA 4KJQC 1JRHI 5F3HB 1I7UB 4JLRB 4OCXH 3RZCA 4P4RA 2P5WB 2PXYD 5DI8A 5C0DA 1W72H 4F7CB 2AI0H 1AGEA 3PWVB 3PGDA 2EZ0C 3G5ZB 4WHYH 4WI3A 3SGEI 1MFDL 1NDMB 3IFNH 5L0QC 2EDTA 3OJDA 4N8CH 1IEBA 3AGVA 3CVHL 4I9WD 5D1XB 4H0HB 5GRVK 3OJ2C 5C70A 5D7IE 1EVTC 4BQCA 1MY7A 1IAII 4QT5B 2A6JB 4NNXB 5BS0B 2P5EE 4X4ZA 3MNZB 4JZNB 3SE9L 5D5ME 1BD2D 3NA9L 3OGOE 5I15H 4RWYH 1T22B 5CEZH 1LWRA 4PJBB 4RX4A 2J5LB 1S9YA 5F72S 5MI0B 3WIIH 3FQWA 4O2EB 3CNKA 5E08L 3LQAC 3JWDL 3LKNA 3TWCL 2Q6WB 4OCWL 4QXUL 1FFQA 3FMGL 3U82B 1I3UA 3WCYA 2CIIA 4HIEB 3DTXB 2EDNA 1MRDH 1FSKC 4G5ZH 4OQ1A 2NY7H 1JL8A 2IBZX 5BRZD 4K3DL 3MUJA 5JLZB 5T3ZE 5KSVB 1ZLUH 1NGXA 2PO6D 1CGSH 2PO6B 2GUOB 4QHNA 2UZXB 5AG9A 1Y0LB 2ZKHH 1YPZF 5CINH 5HDLA 3RX8A 5JXEC 3N9GL 4HS6B 4PRPB 3ZDZF 2PNDA 3IDJA 5EBWB 2FIKB 5IEKB 1QBLH 1YEHL 1WAAE 3S37L 3A6BH 1HSAB 1FLTX 5JXED 2FEEL 2VL5B 3QDJE 2VB5A 1WWBX 5TQ0L 3EYVA 2R1YA 4PRIB 5GHWH 3FHQA 2NY7L 5JXAL 2W9DH 3PUCA 1YEGH 2D7TH 1FRGL 4Z7NE 2X4SA 2OR9L 4S11A 3CFDA 1A7NH 4POZD 1WBZA 1J05A 4QRUB 3VXQA 3IDJB 3IDXH 2XI9A 5GGQH 3GMRA 3RL2A 1LP9B 4PBWD 1DJSA 4LVHB 1J1PL 1K4CA 4Y5XB 4WFGE 1AE6H 1HH9B 2LQRA 2VITB 3BX7C 4HIHB 4ZO9A 2R1YB 4PRIA 5T1LB 5BOZG 1FO0A 2YXMA 1KF9B 1UQSA 1LEKA 4WI5A 3T0DA 2HT4D 3CFKA 3SE9H 2AP2A 4OCYH 4KMTH 4E41A 4LVOB 5E2VH 3QZWA 4F9PC 1J05B 2A1WL 3O6FC 5F8QC 1AGBB 2D7TL 2DQFA 2JB5L 5BV7H 2W07A 2OR9H 5F7EL 1NC2D 4TVPH 5TF1H 4LHQB 5GIRA 4IRJB 1JUFB 1GGBH 2HJKA 2BHUA 4MLIA 3FT2A 5F97E 3F8UB 1SVCP 1QRKA 4U3HA 3VWKC 3WUWB 2RFXB 1G6RB 3IXTB 3CU7A 2CLZA 1MI5B 4NNPL 1LE5B 1KJ2A 4LPXA 1NAML 1MAML 3IF1A 4LGSB 2DICA 2YWZA 4FABL 1M6OA 4HWBA 5CZXD 1P4LA 5LQBL 1EBPA 2EDXA 1T7WA 5CHNB 3C5ZA 4Q9CA 4ONFH 2R8SL 5F7EH 2L0DA 3MRQB 1UZ8A 2R0ZL 1YEFL 3L3KA 5EWIL 3B6SA 3FQUA 4TVPE 4LCCB 5DQJA 3SDDB 1K8IA 4GRWF 3V52L 4J4PC 3NIDE 4YPJA 3QFDA 4K07A 3QCVL 3WFBL 5JOPD 1KJMA 1PYWB 4G3YL 1ORSA 2P24A 3IDXL 1IJ9A 3C5ZB 3PWPB 3OB0K 5F21B 2PXYA 3S34L 4EIZC 3LSOB 2N56A 1CG9A 4FQQB 3AB0B 4KQ3L 3BP7B 3GKWH 4GBXA 4ZAKA 3WNKA 2ZUVA 1CD1B 3TJHC 4I0PC 5JHDD 1FIGH 4ONFL 3VGFA 3S36H 3GSWB 1RIUL 1K8IB 5C0GB 1E28B 4U05A 5FDWA 2BRQA 5DD3H 1S7TB 2MNUA 3SDYL 5EPMA 1LE9A 2ITCB 3LKQA 2RR3A 3M17B 4Y1AD 4YWGH 3UTQA 2O61A 1CD8A 4HBCL 4ODBD 3SE8L 2FGWL 1U58A 5I75C 1ZVHA 1XCQB 3RFZC 2XG5A 4OGXL 3L5JA 4NFCA 3VWJC 1INDL 4L3CA 3I6GB 3O2DH 3LEXB 4FQHA 4H25B 1ZA6B 2NY1D 3ES6B 3JWOL 5I71C 4QHMB 4CVXA 3RHWK 2NTSP 4PJXA 1EJOL 4JEGB 2PN5A 3REVB 1F90L 3W82A 2Q86B 1QR1A 4HK3N 1DQQB 1HHIB 3LKRB 3SKMB 3WFHA 1OTSC 3VFGL 2I26N 2P46B 4L3EA 5GGSY 4XP6H 4I48B 4UV7H 3SDYH 4LVEA 1OGTB 3FHAA 1GGCL 4IIQC 4N0CC 4RMSA 4P5TA 3KXFE 5AAMA 3SCMC 4FQIL 2M26A 4O02H 4ZXBB 3MV8E 4MJ2A 4AEHH 3I84A 3MA9H 3TZVA 3W0WD 4M5ZH 2XWJA 5JW4M 5FUOH 5CJXA 3IS1X 2V5MA 2IAMC 1NBZB 1OP3K 4MA8H 5B22A 3W39B 1M7IA 2J8HA 1U8NB 4M4RA 3QO1A 1TIUA 3BMVA 4BFIB 4ZUWB 4BKLB 4LRIA 5D6CA 1KJVB 4OM0L 3UTPE 4EI5A 1W8NA 5A2LH 3MRFA 3D39B 4I9WE 3K4DA 4HLZG 4ONOA 1DANU 3MV8A 2DQIL 5HGAB 4Y88A 5FAAA 1IEHA 2DN7A 4K7FA 4LKCA 2GITA 3GSRB 3IAPA 3RGVC 4LASH 4DN4H 1WT5C 3QXWA 3AM8A 3GMMB 4OAWA 3VMOA 4JG0L 2YPLD 4D0DA 5HDQH 4MS8D 3B5GA 1DLHA 1J8KA 1NDMA 4K3GA 4LLDB 1CU4H 2ED9A 2SEBB 3MRLA 1S8DB 1JZ5A 4GRLB 3QFJB 3NN8B 2P7TB 4HS3B 1XGRB 4OGZA 1CICA 1EEUA 2CDFB 5GSRB 3BEWA 2HVKA 4MNGA 5D1XD 1Q9LA 4OJFL 1QG3A 1JIBA 2Z92B 1SYVA 3KPQA 1KCSH 4ZTPH 1T3FB 5L2JA 4S0SD 2B20A 1JHLL 1A2YA 1NEZG 4HWBL 1T03H 4PJGA 4LHUB 5EZIH 1WLHA 3KPMB 5LGHH 2NQCA 4NKMB 1BLNB 2FJGA 3MRHB 3O6ML 3WJLC 2Y36H 2AJYL 1T89C 2I27N 4H26B 5L7XH 4QYOB 1EGJH 1FFNA 1CBVH 4PRPD 1XF1A 4C56E 2VAJA 1A6WH 4RSVA 3TA3B 5HHME 1JNNH 3KPLA 1T21B 2YK1L 2Z92A 1TVDA 4XXDB 3QNZB 5DUPH 4YJZL 4K7PX 1J12A 4DW2L 5JPNB 3MBEB 1A1OA 3S3JA 3FONA 2Z4QA 2L4OA 2BERA 3U0WH 5IROC 2WP3O 3QPQC 1DVFB 2VRAA 3LB6D 3NPSC 4HZLA 1AXTL 3D1MC 1CGUA 2VLJA 3QDHA 1FFNB 5FHAH 1TZIA 3QUMA 3QXVA 2GK0A 5FHBL 1IGFL 1HHJB 2R69H 1G9EA 5DF0A 5F9JB 4NKOB 4XC1H 3HZKB 1FFPA 3RIFK 1RZFH 3MBEA 3OWEA 4P2CG 4WCYH 5E8OB 2DJ4A 2ZOLB 1LP9A 5CEZE 1GYAA 1G7MB 3LQZB 2XA8H 2A6KB 1MVFA 3E3QE 1B0GA 1FBIH 4PP1C 3S97C 4N8PA 3H42L 4OUUB 1JI1A 1RIVH 3UDWC 5DRXA 1JWMB 4N0YL 3LV3B 1NBYB 3KJ4C 2R2CA 4RGNE 3U6RB 1RUMH 1T66C 4YIQA 1NLBL 4OJFH 4TYUA 1IGTB 1LK3H 2PCPA 3PWUB 4H0IA 4E42B 1R3IL 5GZOC 4I3SL 1QRNA 3C08L 3HC4H 1AHWB 1V3JA 2YD5A 1MCLA 1B0GB 2XY1A 5I1AB 3ZZ1A 2UVFA 1WBXB 1C5DB 3VA2C 3BHBB 2GK2A 4Z0BH 3TP4A 2BOCA 3GMNA 5E9DE 5M94B 3VXRB 1I8MA 1AJ7H 2A0LC 2ZUXA 4PLKD 4PJHA 4Y16A 1SY6H 2A9ML 1RIVL 2HRLA 4C56A 2WQ8A 3ARGA 3LH2H 1LE5A 3AVEA 2NPLX 1K8DA 3LKNB 2GT9A 4WI4A 5SWZB 4TUKL 2PCPB 2DQTH 4KI5C 4OM1L 4C55A 3LZFH 1QFWM 1MFCL 2UZIH 3LQMA 2HYMA 3STLB 2VH5L 3CDGA 4OD2A 4PG9A 4UOJA 5DSCA 4E9LA 4G9FD 4UNUA 4P57A 2KL6A 4Q9QL 4JFDB 1JV5B 1RK1B 3MJGX 4L9LC 2ZUTA 2VLKD 3TH2T 3N9GH 3ULUL 4OZHB 3D39E 3FB7B 2X4PB 4HKXA 4CVZA 5GS1B 3UC0H 1W8OA 1ONQB 1X6LA 5MENA 1UACH 3G5ZA 3MREB 5BO1H 1D5XB 1RHHB 1F4XL 4ODUB 5LGKA 4POZC 2QADD 3IU3A 4X7SH 3MV7D 4PRAA 5I15L 3PWPA 5JW3L 3HR6A 4Y5VB 5AUMB 3TA3D 5HDBF 3BESR 4MB3A 2AK4E 4ZFZA 2GJ6E 4G80A 3S5LB 1FBIL 3UPRB 4QXUH 2VDOL 3JTSA 4PGDB 1OM3L 1I9RH 3DGGA 4Y5YA 3P9MB 3HE6A 1DQJA 4YDVA 1E28A 4HPOL 5FDWB 5E94B 1VGKA 4BSWB 1WISA 1B0RB 3ARED 2GSGB 5B8CA 4HX1A 4NC2B 3V0VA 1ZANL 4M62H 4YDIL 5T5FL 5KSVA 2CH8A 5DUMH 2D9CA 1YQVH 3ARDD 4UT7L 3JV5A 4QHMA 4N1HB 1JMZA 2FH8A 2YMXH 4E41B 3T1WA 4HULB 4P2RB 4G6FD 3HE6C 3HZMA 2Y5TB 2GSGA 3E6HB 4M7LL 3LH2L 3W5MA 4ONHB 5T1KB 1JZ7A 2MCPH 4YFLI 4I48A 1HH6B 4J3XA 4JE4B 1JN6B 5CJQL 3E0GA 3U2SB 3IVKB 1JPTH 1QBLL 4PGZA 3OJVC 1U8JA 5GZOD 4NOFA 3SKJH 5ADPH 2EICA 7CGTA 2CLZB 3G6DH 4LSVH 3O3AB 4PD4J 1J1PH 4WTZG 4NO2A 4HSQA 4XRCA 4LSPL 5E70A 5TH2B 5I1GH 4OCWH 4RAHA 3V8OA 5EWIH 3P11H 4G8EA 1F4XH 1S9XA 2C7UA 4PGEB 4QRSB 2BSRB 4HWNA 5GGQL 1XR8A 4PJAE 1MRDL 4JQVA 2X41A 3ZYOA 5GISH 1FVEB 2OLDA 1QVOB 1JHTB 2B8OT 2WBJD 1G0XA 5IV2B 3F5WB 5HGBA 5I8CA 1TVHA 5GXBB 4B0MM 3RVUC 5HHMD 3O6FB 4I18A 2QQKL 3KYOA 3SDDA 3MLSL 3HMXA 4NT6A 3DUSA 3WIFA 3DWTA 4FFZL 3WFEL 5CFHA 5CINL 1JHKH 5ELIA 3O11B 4NSKA 4YDLB 5DHYB 1U8PB 5GIRB 2P24B 4OUOA 5D7LA 4NCC2 3UDWA 3VXOB 3CD4A 4WW2B 2EIDA 1IZJA 1YEHH 2VXVL 2PYEB 3P0YH 4PV9B 5JHDE 1XF5A 5HYQA 1MAMH 3V5DB 4MNQB 2BVYA 5C8JA 4LMQE 1DL7H 4IOSD 3WUWA 4PRHB 4JFZH 4GRLD 4YWGL 1SYVB 1TLKA 4HBCH 4WHTA 3VXMB 2MKWA 2QR0A 4YHLL 3QWOB 3MV7B 3MV9D 4YE4L 4H20L 4CU6A 3QEQA 3UTQB 4L4VE 2FZ3A 2X70B 5GGUB 3G5VB 5DURB 1YNTA 4ELMB 5E5MA 5B3JF 2WIIA 4PBVC 5FK9B 3QCVH 3IJSA 4FFWC 2CUHA 3IB4A 3LEXA 4XPTH 3TZVD 1UM6H 1Q9OB 4Z77A 5KSBA 3TA3A 2LFGA 1WIOA 1MJJA 3B9VA 1I1YB 2R0WL 2VLJD 2BC4B 1YNLH 2NMSA 3NCYP 1KCUL 2V2WB 1AC6A 5DMIH 2PO6C 4UU9B 4Z9KB 5A2IH 3UBXB 1KPVA 4J3VA 1IQDB 3ZDXF 4MX7B 1NMBL 4H88H 2J6EL 5FUOL 4PJGE 1MEXL 2BNUB 4P2RD 4FHBD 1YJDH 4NO0B 1JWSB 2FBJL 1T1YA 4NHUB 5JW4N 4CADA 5EN2B 4QRPD 3JUYA 4KROD 2ICWA 4HC1L 4D9RE 1ZGLP 3GBNL 3ECBB 4FFVC 3HTLX 1E6OH 2HJFB 1NAMH 4NZRL 4I8DA 1MHPH 2DDQL 4PB0L 1A7RH 1CE6B 5I74C 2APBA 1W2KT 1F11A 3KAAA 1V3KA 1XF3B 3MLTA 5E8NB 5DS8B 3RL1A 2HT2D 3TT1L 1FDLH 1ZA6A 4H25A 4WUUD 1LILA 3QUXA 3VGAB 3GGWA 2RAMA 1HE7A 4H88L 2NY3D 2WINB 2D0GA 4D9LH 5C6PB 4IRJD 4LAJH 5F9OH 3ECBA 4AL8L 5EUKB 4MDIB 1DQQA 2A0LD 5CWSA 4CMMA 1ACZA 1TENA 4FQ2L 2DQGH 1AGFA 2QSTA 3KPNA 1Q94A 3IXAA 1U92B 3WHXA 3ZE2E 1WC7A 2EE2A 2AEPH 3L7EA 3MRLB 1A47A 4I77H 1DBML 1GGUA 5TFSL 4W6WB 5BS0E 4RMVA 1EFXB 1BQHB 4NRYA 5F6HJ 4UV7L 4AIOA 3QIWB 4PB0H 3BGMA 3MRMB 4HWBH 1T03L 1NBQA 4EJ1C 1K6QL 1ADQH 1DZBA 2AJ3A 1A14H 1YDPB 1WT5A 1NCAL 4FRWA 3GIVB 3O6MH 5ILTL 3OGCB 4JGMA 1XGYL 3D85A 4M7KH 3CAFA 4GRWH 1P84J 2FR4B 2E7HA 3WHE1 1YA5A 4NKMA 1CFVL 4HK0A 1ZVSA 3MO1B 1YPZE 1BM3L 1G7QA 3RUGB 4H26A 4QYOA 2C4FT 2QBWA 4R26L 4M8QB 4WO4C 4K7FB 1T22A 2IBBA 4KPHH 5DZOA 1A6VL 5EBMA 3QP3A 5KSBF 4UDTB 1FGVH 3FN3A 5GS1A 2QADB 3PF2A 2G5BB 3MREA 1NDGA 3UBXG 1TJIH 1IILE 3ARTA 4JG0H 2MCG1 4OIBA 5IJVB 3UTTE 5HDQL 1MVUA 3PP3H 4N0RA 4MD5A 3IETB 5C08A 2XACC 3FO2B 5EU7C 1KCSL 4ZO7A 4G80B 2HAZA 2A74B 2JJTA 3KR3L 4HS8H 3S4SB 5CP3A 4G9DB 4YDKL 4AEHL 4YBQD 5FKAA 4M5ZL 3DSFH 4E5XA 4JFFE 3VRLF 5F9AC 3V6OE 5GRVL 4OZFA 5B8CB 3GJFA 2VDQL 2YPLE 1QSZA 3KPMA 3O2DA 4IEFB 5E8OA 5IEKA 4AL8H 1MELA 2VUYA 1MFBL 4IRZL 1MCPL 3CFBA 1GZPB 4Y19B 3TVMD 1YN7A 5B4MD 1W72A 2UWEA 2X4TA 2V9QA 4JVPA 2NY0D 3BKML 1MFAH 1N64H 4ETQB 3HR5B 4K9EH 2VOTA 2X05A 2F5AL 5EU7E 2Z8RA 4UT6H 1VKXB 2X7LB 2HJLB 4JFHD 4JDZA 4TTGA 5I66A 2J8OA 1HN1A 1JF6A 1ITBB 4NO3A 1F4WH 1FYHB 2DKUA 3ARBD 4OFDA 4JFDE 3R8QA 4YHML 1FAKT 5HPMA 4JANB 3SPVB 1DDHA 5DJXB 1PJ9A 1ZK9A 4Y19A 1MLCA 1M71A 4PJXF 4ZPTB 3MCLL 4OCXL 3MR9A 4YHNB 1YEKL 3BP6A 2AQ1A 3GMNB 1I8MB 2D03L 1WIPA 5T1MB 3VXNA 1AH1A 2WWMD 2VZTA 3NCMA 4QWWD 2QEJA 4Y16B 1G9ML 4XCCL 5C0IA 1A6PA 5LVEA 3TC9A 4LSSL 4P99A 2VH5H 3VXRE 5I66B 5E9DB 4UT6L 1F97A 4I18C 5F1NA 3SCMD 2DQFB 5HI4D 1MWAB 3QDJD 4HGWA 2DLIA 5DJXA 4IRJA 5HDOA 5DSCB 2JCCF 1G0DA 1DLFH 4PGEA 4XP9L 5J1TC 1BJMA 1JK8A 3BKYH 1RUML 4DKAA 3PWNA 1JWMA 3KLDA 2XA8L 3FO9B 1Q0XH 3DMMC 4EOWL 5SWQA 2V7HA 3QI9C 5EOCH 3ISWA 1J10A 1CBVL 2GCYB 4WW2F 2J4WL 4HZAA 3LEVH 3KR3H 2D03H 2Z9TA 1CDHA 3QULA 4OZGB 2J6EA 3OHXA 4IDLA 4YPGA 5TQ2H 2HN7A 4LSSH 2IQAB 2AGJL 3X11A 1AHWA 4NM8H 5D2NE 3BUTA 3SDDD 4GG6E 3MV9A 3SKNA 1N6QL 1C5DA 4PJDE 5IGXL 1KT2A 2AI0L 3KJ6H 1AXTH 3KHOA 2VWEC 2DQDL 2DQTL 5DQJB 4F9PA 5IFJA 4MA1C 1QFWH 4YAQA 4TNWK 4EUPH 4U4BA 2NY2D 2EIZB 2B2XH 3RWHA 3VDCA 2DJSA 2Z0BA 4K71C 4QOKB 5C08E 1BEYH 5EORH 3QXAB 5FGBA 5EZJA 1HSAA 5FXCH 1ZHLB 4NN7C 1F00I 5DJAB 4BK4A 1MIEH 4OLZL 4HIXL 5FO9B 3ULUF 3N85L 1H3VA 3G08B 4KJYB 2CJUH 2Z31B 3DV6A 2OK0H 4OZHA 5EULV 5FYLL 2FX9L 3VRJB 1JF1B 3RTQB 5CIPH 4OF0A 4PJ9A 1MJJB 2X4NB 5I1KH 1XZ0B 4PJEE 3ZTNL 4LL9A 1S7TA 2K3TA 2VNCA 4BFBD 3LHPH 4YFLF 2QHRH 3AMLA 5KOMC 3MZTA 2F15A 3UPAA 2JF1A 4NQSA 4Z5RA 2X4RB 3MLUL 4OZ4A 3WSQH 1I9RL 3TBSA 3BPNB 5ADPL 2J8UB 4C58B 2FJHA 5LXGH 1U91B 3H6JA 1R24A 3LQAL 2WM0A 3JTSB 4PGDA 5D96B 1BZ7B 4JM4L 5H35A 1PZUB 3QYCA 2ZUQC 4RIRB 4UMGA 3B2VH 4NRZB 2HMIC 2I24N 3OPZH 2ITDA 3IGAA 4UOW0 3H9SB 4IJ3C 5DVLA 1OP5H 1GGBL 1WBYB 4QWWC 4Y2DB 1J0JA 4J23A 3BPOB 5FM4A 2WUCL 4X9BA 1EMTH 1T0PB 4OM1H 3UTTA 3CFJA 4XCYA 2OCFD 1T0NB 2UZIL 3WE6A 3T65A 1U8QA 3WO4B 3PHOB 4FXKB 3P40A 1DQDH 5E8DH 4PRDB 1WWCA 2AAVA 5IGXH 4YHIB 4R4FL 2I9TA 4LLQA 1A7OH 5L2KD 4NP4L 2XTLA 5D2LE 1YQVL 3VG9B 4BH8B 3H9SA 4O58H 1UWGL 3OMZA 5FGCE 1OAYL 1PKQE 1QSED 1A5FH 1M6OB 2MQ3A 3B2VL 4NKQB 3ZYJA 4OCMC 1LDPH 1P4LB 2A9NL 2Y4SA 3FFCA 3B5HA 3OPZL 1LO3L 1YUHB 3VH8B 1S7WB 5DA0B 1I9JH 2CXKA 3WE6B 5D7SH 1JPFB 3QHZL 5E24E 3RVXC 4MSWA 1HWGB 3QHTC 3UXFA 1CN4A 4JZJB 1HILB 2VR4A 1AGCA 1MCJA 3O6LH 1H5BB 5KVDH 2E5EA 3Q1SL 4PJAF 3NIFE 3HI6L 5DJ8B 2VDOH 5K33A 1KCVL 2Z93B 3FT3A 1FG2B 3T0EB 1FZMA 5DD0L 4XPAH 5DD5H 3D85B 2PTTB 4LSVL 3DGCR 3D85D 4Z7UA 3GSVB 4F37K 3KYMA 43CAA 1J1OH 5EIVA 1JYXA 3BOVA 3NCJH 1DSFH 1I8IA 1MREH 3MRPA 5D7JC 1JGVL 1EHLH 1HILA 1Q9OA 3QIUB 4QTHA 1I85C 1EERB 4AMKH 4R97C 4PJ8C 5DO2C 3ARFA 1ZV5A 1FO0H 2IJ0C 1NMBH 2PTTA 3MLPA 1VFOA 4ZNEE 2FLRT 3GSVA 4ZD3H 2EDDA 3HB3C 1HYSD 5I8EB 1MLBB 1EMTL 1QKZL 3CCHB 2JLLA 3AU1B 3CZJA 4PJIF 1SBSH 4LCWD 4GXUN 3NZ8B 4WUUA 2NY5H 1DSFL 4DK6A 4OI7A 3LOWA 3HS0B 3MA7A 4MCZA 1H3PL 3MRGB 2NY0C 4ACPA 4M6AA 2NR6D 5F7LB 4MZ2A 3QAZC 1BAFL 1GGCH 4Y89A 1L7IL 1X5AA 2X70A 4JCMA 4Y4HC 1R3JB 1K2DA 4TQEL 1MQ8A 1V8HA 3KS0H 2F58L 1FDLL 3EYFB 4YE4H 5I1GL 3EDDA 2PW1B 3KPSD 2R0WH 1IC4L 3OAZH 4NC0B 1EO5A 5DS8A 2HFFB 1HSBA 1LO2L 1KTDA 5D7SL 2OS7A 3CXDL 4ZD3L 4JR9H 5C0NC 2QHLA 5BOPA 5I8KL 5DD1L 4LVNB 4K23L 2NY0B 3W39A 2ICEA 4B5EA 1E4KA 5D1ZA 4XPGL 2V2WA 3SGDH 1ZT4A 1DBBH 5HPMB 1TQBC 4WFGD 3PGFH 4IM8A 2GIYA 5K9OB 1C08A 3UAJC 2LV4A 2AV1A 3T77A 1JWSA 4XVTH 2VXVH 1XIWC 3JV6B 4M6OH 2QQLH 3BKCH 1HIML 1EXUB 1UB5B 5GRUH 1JGVH 2DM4A 5EN2A 1YMMB 4F7PA 4PLOB 2BP3A 4JFZL 4JFEA 4ZSOB 3ZYZA 3OGCA 3DX7B 3RGVA 2A83A 3SDDC 1UXWB 1IGTA 3GSUA 1DR9A 2HFGH 4HC1H 4HGWB 3OKNA 1QRNB 4MNGE 2IALB 2F53D 2P49B 4HUKB 1GJIA 5K59F 2APTA 3V5HA 3OKEB 3LMJL 4KROB 3C60D 3TIDA 1CICD 1JF5A 4JGJA 1MSPA 1A6ZA 5KBNC 1I7UA 3GKWL 2O5XL 3OG6B 2QV2A 5GJSL 5FDYA 3TPKA 3UYPA 5KN5A 1GOGA 1P1ZB 4M6ML 3S36L 2FNBA 3QNYB 3VRIB 4L1DA 4RMUA 5C0FB 2VZSA 2EH8L 2Z8WC 4LLMA 3SDAB 2N1KA 2FEEI 3VH8G 4ONGH 3CDGB 4OD2B 4PG9B 4OD3L 4O9HL 3RVUD 4JRYE 5D1XA 3OKEA 1AQKH 3GJEB 4TQEH 3DRQB 1I3GL 4HLJA 3I02B 4JQXC 3H9YA 1NCWL 1K5NA 2RGSA 2FBJH 2GI7A 5IFJB 2C26A 2HA1A 5J13B 1MNUH 2JJVA 3VFUB 3DARA 1BM3H 2RBLA 1QR4A 5I1IH 4R7DA 3U4EB 2Q6WA 4PRIE 1T6VN 1CS6A 4WEBH 1F90H 2FHBA 3OKOA 3NOIA 3QDJB 1DVFA 3ULVF 1BQLH 3U9UB 3SJVA 4J8RA 2AJZB 2PTVA 3C5SA 2X4TB 1J87A 2C4XA 1CT8B 5SWSA 1BFOB 3BPLB 4Q2ZB 2NXZC 4PP2A 5DD6B 5KAQF 2YA2A 3K3QA 1HWHB 2FX8H 4RCAA 3VFWB 4YEEA 4HMCA 2LE9A 2H32B 4TTDD 1UENA 1Q1JL 4OTXH 4M61B 4YHPB 4FZ8L 3RY4A 4TNVK 3BI9X 5KW9H 1T0MB 5C0ND 3V4PH 1EBAA 2ZUWA 4JFEE 5H94A 2LU4A 1Q72H 4X7CC 5I1DA 3TYGH 4X7EC 1SY6A 4D2NA 1F6AA 1UG9A 5C08B 4QOKE 4I1NB 4OD1H 2AXGA 4HJGA 2E6QA 4G6FB 5TFSH 5LAXB 3LMJH 3STBA 1MF2L 4V1DD 1NLBH 5ALCH 4TSAH 5K9QI 2NX5B 4JZOA 2I07A 1CXEA 4B7IA 1PSKH 4LSUH 4XCEB 3IDYB 3QCUH 3HAEH 1RJLB 3ROOB 5ACLA 5A16A 3ET9F 5HGGS 3VXUD 3C08H 5E6IA 1J8HD 3JV4B 1YQ2A 2ARJB 2P5EB 4N68A 2DQJH 3N1MC 4ZPVA 4RZCB 4LEOB 5E5UB 3SO3C 4NM4H 1Q1JH 4OTXL 4PY8J 5J06A 1M05B 8FABA 3AREC 5FCUL 2X1WL 2W0LA 2Z8VC 3T65B 4K8RD 2ICCA 5C92A 4NWUH 4JO4L 4X99A 3TNNB 3KPPA 5FA3A 4FQXD 1OP5K 5MEPA 4ETQA 4IMKA 4KDVA 2DLEA 2VN7A 5IB5A 5EO9B 1WITA 4X5LA 3WL9A 3F12B 3WIHA 1QSFA 5EC2B 5HXMA 3P3YA 1IRAY 3BKMH 4L4TB 4I2XA 4YC2B 2JIXA 3SDXE 3KPSA 5CCKH 3OHXB 4G8GB 1UM5L 5DZNA 1NCDL 1RZJL 5IJKA 5IB4A 4BJLA 5F7DB 5I17B 1MLCB 2YEZB 5BZDA 2DQDH 4Z7QE 4XT1C 1FNHA 3MRDA 1VADB 5EIQA 1QFPA 1GGTA 3KVQA 4NM4L 5TDNA 4OFYA 4XGZB 1CLYL 3MQIA 1UEYA 1Y6KR 1BD2B 1VB9A 3NIDF 4MNQD 4NWUL 3O3DB 1OAXL 4W81A 1KXVC 2OTPA 3C60C 5IMMA 2WNGA 5E9DA 2BOBA 3HN3A 3QPXH 1BBJB 3TIEA 4F2MA 1WWAX 4GG6B 3BKYL 3DSFL 4XCCH 5D2NB 1KN2L 5DHYA 2W0PA 4LLVB 5EZJB 2BNQB 1UJ3B 2FATL 3T4YA 1UM5H 1W0WB 1FNFA 1FL5A 1MFBH 4IRZH 5F3BA 3JWOC 4JFED 5I1CL 3QJFB 1T1ZB 5DJ6A 4U3CA 1R0AH 1UKSA 4DVRL 1EUTA 4Y5YB 3GUTB 1YEEL 1EAPB 4UQ3A 1CR9H 1JVKA 1SJHB 5FV2A 3EO0B 1CLYH 1OLZA 4GO6B 4PS4H 2FHCA 4R4BB 1OD9A 4OZIA 3ARVA 4KUCD 5D2NA 4JKKA 2IQAA 1O5DT 4FFYL 3EYOB 5IHUH 2YRLA 3G6JB 4APQA 1W0WA 2JJUA 2A77H 4UT7H 2VSCA 2KPNA 1KYOJ 3F6IA 4P59L 3ILQC 5EFIB 1CD1A 4NM8L 4PTUA 4KRMB 4JAMB 4JFFB 4X6DA 4P46A 4JFPB 5DMKB 1HEZB 1GCFA 1A6WL 1X4XA 5EO0B 1Q0YH 1QBAA 2VXSH 4NWTH 5C0GA 4DZBB 4Y1AE 3PIQB 5I0ZA 2WUCH 1HCVA 4MXQD 3MRNB 4LHJB 4MJ5A 5TGBB 2BVOA 4GJTB 4XBGB 2Q7NA 4R4BA 3QI9D 3CZFA 2X5PA 3ZHDA 1MHEA 1RFDH 3QEQD 4WUKL 1R3JA 5KVFH 2HVJA 4GKSA 5D6DA 3UTTB 2ENSA 2AV7B 3FO1A 1R3IH 5FYLE 2ZKHL 5DMYA 1BMGA 4L3CB 1A9BA 1HHGA 3DETC 3EJZC 1P7QA 1ZMYA 4KJPC 1EFQA 1A5FL 3N85H 4BELD 3QIBD 4OIAA 3WSQL 5B4MC 4KGLA 1QR1B 4KMLB 3CLEH 4ODSL 2HJFA 3O8XA 4L3EB 4Y19E 3ZTNH 1YPZB 3QPXL 3LHPL 4PLKC 3VFSA 1S7WA 2YPLB 4P49A 1XR8B 2E3VA 1CDYA 3AREB 1EZVX 3TZVB 2XFXB 1OSPL 1QUNA 2G75A 3N06B 3O0RL 3FCTA 4K8RC 4A2MA 4NRZA 1GGIL 4M5YH 4F7CA 5C0BB 4GS7B 1L0XA 5C0EB 3RWIB 4OCRH 1QFWL 4NYLB 3CX2A 4FXGA 3V6FA 3ARYA 3TYFA 1ADQA 5CIPB 3MSPA 3CFJB 3HPLA 3WXWL 2YD1A 4HUWA 2AW2A 3QXDA 2EC8A 4KMTL 4LPCA 3VXUA 1EFXA 3RPIB 5KS9B 1I1FB 2DF3A 3L5XH 5B8CC 3R1GH 5HJ3B 1NMCB 3MOAL 5H37H 1MH5B 4LQFL 4ZQKA 3FQRA 2GQHA 4MDJA 3BP5B 2ZWLT 3RWDB 4OV5A 1LDSA 3GIVA 5EOCJ 1DLHB 4JFDD 3QEQB 4KUZL 1GIGH 4WW1A 3TT3L 3I3DA 4HKZA 1NL0L 4FQ1L 1YUHA 6CGTA 4JFXB 2EDLA 5ACZB 2XTJC 2NR6C 2NY5L 4O58L 4P23C 3RWJA 1UM6L 2NYYD 4DKFH 2CIKA 2IQ9H 2UVEA 4XNXH 5I8EA 3QNXB 3GSNA 4Q6IB 5JORB 3VD9A 2BY1A 1NKRA 1PZ5A 3IDNB 4IRSC 2YR3A 4M43H 1ZAGA 1NAMA 2VLMD 3INUL 3QQ3B 2W9DL 2RB8A 1FL3A 5DVKA 4R7DB 1OVZA 2YMXL 1A3QA 1UZ6F 5EBWA 4PJGB 2GY5A 2VLLA 2IPUG 4HH9A 2ADFL 4X0KB 1BECA 5DR5L 3GDBA 2YKLL 3CMGA 1OGAA 5JQ6H 1KPVB 3ARXA 4BFGA 1BIHA 2MCPL 3E1F1 2OBGA 1MCWW 4Z7WF 2BNUA 5F7WC 4LKXB 4QF1A 4J6RL 4JY4A 3DX8A 3H3PL 4D3CL 2Q87A 3ARGC 1EHLL 2CDEA 2VDNH 3SDCA 4U7MA 4X6DE 1SEQL 3S34H 3GMLA 1RZGB 5HHNA 3FT4A 3RP1A 2K7QA 1VESA 5D1QC 4EIGB 5KSUA 4EBQH 3V5KB 4XPHL 1I8KB 2GFBA 3OAUH 3S3SA 5BV7L 4M62L 4MHHG 5HSFA 1RIUH 4TVPL 3D18A 1FVDB 1IFHL 2GJ6D 2UWEB 4M00A 5EIIB 4KROC 2OYPA 1F11B 1I9JL 4GKZB 4QHKI 1KCUH 5GISL 1RUAL 1UQSB 3GGWB 2EYRA 2IWGA 4KK5C 1FYTD 2X1XR 3PG2A 2F58H 1V7NL 3MC0A 3K1KC 4MNQE 1ZHKB 5I1LB 3P77A 4NDMB 3QZWB 3AXLA 4X7FC 1T04B 2OJEA 2VE6B 2ZSVA 2PYEE 3RGVD 4HCRL 2ZOLA 3G9AB 2HT2C 4X6CF 1WC7B 2HTLD 5DD0H 3TM6A 3RVTD 3KNBB 3U4BH 4HIJB 5GRYA 3RA7H 4L4TD 3P9WB 4LF3B 1EEQA 4K3EL 3S4SG 2OQJA 5J57B 4POUB 4CW1B 3U6RA 1YDPA 1RJZB 3GSOA 1KLUA 2PYFB 4F57H 5FKPB 3NTCL 1RVFH 1KXQE 4S1SL 4KRPC 2DQEL 1XCTB 5TF1L 4NQCA 3CH1B 4WGWB 2FECI 2ZCKL 1NFIB 3RUGA 5I1AA 2YN3A 5FYKU 3J8F7 2YPVH 4U6HB 4W4OC 2JIXD 5DQ9B 3L3KB 1Z0NA 4HXAH 1GHFH 5B38A 4OM0H 4OFYD 2JE8A 1FIGL 4U6XA 4CW1A 4X80L 3KWWB 3W9DA 3PHSA 1I85A 1ZXQA 1E0OB 5C6WH 3WFEH 5KSAC 5FKPA 4JPIA 4OLVH 2HN7B 5DLML 3QDJA 4V2BA 1MAKA 3SE4C 3KG5A 2J88H 2NY1C 4NQCB 3C9NB 5CD3B 1YMMD 2MPAH 4WU7B 3LKOA 3C5SB 1ADQL 2NY4B 2E8ZA 4UUJB 5HI4C 1HQRA 4DZ8A 2AXHA 3I6LD 4ZFFA 3PHQB 3FB6A 5DTFB 2G5RA 2VC2H 3UTZB 1IC4H 3N1GC 4BK5A 4E41E 2JTDA 1G1CA 2W0FA 5GGTA 2VLRD 4WI8A 4L8DB 5GS2H 2BY3A 4UQ3B 1CK0L 1RUAH 4C57C 5HHQA 4OD3H 1KCLA 1Q72L 1MCPH 2XWBA 1CE1H 5IHBA 2A73B 4YHLH 4Z7VE 1D5XA 1RHHA 4ODUA 3UZEA 4F58H 4H20H 3NH7L 5IMLB 4HIEA 5DHVH 4X80H 1E6OL 5GQBA 1YN7B 5T3XD 3C9NA 5JLZA 1HHHB 1EH9A 1MNUL 5JOEA 1CTOA 1HQRB 2PR4H 4ZFFB 3B9KD 1T5XA 2YD4A 2E8YA 3IRPX 3CFIC 4XP5L 1JPST 3K80A 5DUBB 3HE6B 3AM8C 4YDVB 4Q7DA 3QDGD 1HIMH 5IUSA 1UADC 4U1HB 2E7LC 2GJ6B 1TPXC 2H8PB 1EPFA 5FCUH 3PE9A 4CN6A 4Y19D 3TVMB 5DMIL 3JVGC 1U8LB 5J1AA 3CXHK 1CE1L 5I1IL 3V79C 1NC2A 3VD4A 4CJ0A 3KYNA 4R4ND 2CDGA 4JHAL 1ZT1B 3NH7H 1IAMA 1A8JH 5DUPL 4OZGF 1I3RA 2J6EH 2AJSL 4UILL 4TVPD 3QCTH 5IW1A 4XCFL 3V4PL 3MACL 3EJJX 5EU6D 5IBLD 4U49A 1AP2B 1C8PA 3HPJB 3DURA 4G8GD 5E00A 4AEFA 1OTTC 1U3HB 2ZPKH 5KG9A 12E8L 1F6AB 5IBLC 3D2UA 3O3BB 4GUPB 2BMKB 1PVHA 1SJVA 4WCYL 1HI6B 4JHAH 1X3DA 3CFKB 1S7UA 1YY9D 3RJDA 4EXPX 2OTWA 3QULB 4OF5A 2AK4B 1WUNT 3TBVA 1RUKH 3TIEB 4OFPA 3PJSA 5E00B 3T0ED 1FNAA 5IM7A 5IVXA 4LLVA 3VFMB 3VH8A 3DMMD 3KLAA 1JUFA 1TVBB 3ZTJH 4APQC 1ZLVK 1KELH 3IS0X 4H1LG 1BQLL 1JJUA 3OXSA 4HDIB 1NANI 3W0WA 3KPPB 5FA3B 4WUUE 1E4WH 3V4UH 5CCKL 5IMKB 3SO5A 5BXFB 4WWKC 2VLKB 5EOTB 5JQHC 5TE4L 5EC2A 4R3SA 3S7GA 4P2OC 5DJCA 1ACYH 5E2JA 4CDGC 4XP5H 2YZ8A 3QH3B 4U1IB 2BSSA 3S96A 5ICYB 3MGTB 4LHUA 4NSKB 3C09B 4DW2H 5CSZA 1FNLA 5DJAA 1ZOXA 4OCSL 4KK5D 1MFNA 2CUIA 4Q0XH 1DQLL 4QHLA 1UZ8B 1LO5B 4AQ1B 3D3VB 5CEYB 4UZGA 1IM3B 4OD1L 5F89A 4LCWB 1T5WB 1T21A 4G7VH 5D9SB 3B9DA 3DVGA 2VZ1A 5KVDL 4MJ5B 4N9GB 2LAGB 5TGBA 2YPKB 5JPNA 3FRUB 3S96B 5ICYA 2E27L 3HUJE 4MA1B 1ACYL 1AD9B 3ULUH 4NQSB 3T4AA 4Z5RB 1F4WL 1CFSB 4BQ6A 1YNTB 2R1XA 3FO1B 3ZT7A 1IKNC 1FL5B 4G8GE 5F3BB 3QUYD 3MCLH 3RWCA 4L4TE 4DCQA 1BX2A 1T2JA 3MYJB 3NFPA 5H35B 1Z9LA 1QLRB 1R3HB 4AH2A 4K3DH 3HZKA 1EVUA 3V0WL 1WBYA 1AFVL 1QZ1A 2DM3A 4JJ5A 1Z0MA 5F7NC 3DUUA 3L9RB 3QO0B 3UYOD 4KU1A 1FYTA 4L8BA 2O5YH 3WHE0 4IMKC 5B39B 1MHHB 5EIIA 4JQVC 4U1LA 3IDMB 3MRBA 3AREA 2Q8BH 5CZXC 3C8HA 4N0UE 4PYHA 2NX5E 2IANB 3QBTB 2I9TB 1BF8A 2V2XA 3ARFC 1Q0XL 4EOWH 1ED3A 3B3IB 4I3GA 5EOCL 4JPKH 4U0QB 5CMAB 4EDXB 3Q3GA 4NDMA 1GZQB 1OAXH 4CU8A 1P7KA 5JZ7D 4WWKB 4JKMA 1LEIB 5LXGL 4KUCF 3QO0A 1MRFL 1PQZA 1QSEB 4MJ6B 4JO2L 4PFEA 3BH9B 3OAYH 2BVEA 3HC0A 2VZ3A 2IFFH 4U1JA 1NBVL 4S1RL 4U1LB 5HDBE 4K3HA 1TCRA 4ODWA 3NCFB 4ZXBA 1LQSR 1XGPA 3HZVA 1EFXD 1BZ9A 3D48R 2FYYA 4PJDF 1KGCE 5JHLL 3TH3T 1IGJB 2WANA 4MAYA 4MDJB 2P5WA 4XAKE 1KENL 4LAQH 1NL0H 3ZE1E 3DHJA 3Q6FA 1OAZH 3L3IB 3WNLA 3QO1B 4JHWH 4CMMB 5ESAB 1ND0B 1PQZB 1QSEA 4MJ6A 1WFOA 4HLZH 2D3VA 3FFCD 4JO3H 4MA7L 1ZHNA 2FBOJ 1DVFC 3NCBB 1FP5A 1DN2A 3P9LB 4RAVB 1NANH 4HQQH 1UWGH 4OCRL 4L29B 1BZ9B 4MNHA 3OB8A 3BIKA 3ULVE 5J11B 3CC5A 3EFFB 3OX8A 1SY6L 2NZ9D 4OLEA 3FB8B 3SGKA 4UIMA 4QHKJ 1YECH 1C1EL 4X0KA 2DWDB 4LMQI 4M7LT 1OAZL 1D5BB 3O6LL 3MO1A 2XN9A 3D0VB 3QUZD 4KC3B 5J6GB 2QQKH 4IIQA 5CD3A 3S36X 5CD5C 5IR1B 3GJEA 3HI6H 4PJ9D 4XNZB 1Y18B 1MPAL 1XH3B 3D87B 5KS9F 3FB6B 5DJYB 5DD5L 2RCSH 5AYQA 5DUML 1GIGL 2ICES 2P8MA 3TT3H 1TPXB 1I1AB 4ZO8A 1BFVL 3ULVC 3KPOA 3Q5YA 3OAUL 5C3TA 2F54A 1UACL 2E9IA 3JWDH 3WMSA 3LKSA 4G9FA 2BVTA 4HKZB 4HEME 1VACA 2G9HA 2P8LA 2VZOA 5EORL 2VZVA 2IPKA 3PV7A 3P4MA 2XWTB 1CT8A 1C1EH 4JO2H 4ZFOB 4AMKL 5JORA 5D6DC 1VGEL 1YNKL 2HTKD 4HIXH 3FQXA 3IDNA 1QBBA 3LS4L 3I9GL 5DUBA 3QQ9C 5E7FA 4LRNH 3UTTD 1MOEA 1LO0H 5A43C 3GMRB 3RL2B 5GGVY 3D69B 1SBSL 4WIQA 3PWPD 4I0PA 4KK8C 4K3EH 2VIRB 2ADFH 3MYZA 3VGEA 2IFGA 1MCDA 1DEEA 1OW0A 4MA7H 4MWFB 4NZJA 4QHUA 4A6YB 2IAMB 2W60A 3QT2A 4F7EB 3Q6GH 3BGAA 3PNWA 1XIWB 2D31A 5AAWA 3OR7A 4PJEA 3GSUB 4I0PB 1K85A 3SCMB 1FCCA 4BQ9A 4HUUA 4O2CB 2VISA 4KUZH 8FABB 3D18B 1IC5L 3CIQA 3LS5L 4FQ1H 1S7QB 5JZ7C 1AE6L 1TQBB 4YHNA 1V7NH 3KS0J 5DQ9A 4JHZA 4DKFL 1JHTA 3DPBA 3EUUA 4OGYL 4QHUB 4I3RL 1BQSA 3VFGH 5EUOE 4LOUD 3X13A 3WYRA 4WGVB 2RCSL 3G6DL 3EYUH 4ONGL 1AIFB 3IF1B 4RBPH 4FQIH 4KHTH 3VGBA 3ZKND 4AYFA 3BKCL 2AQ2A 1FC1A 4IHOB 4WW2A 1CFNA 4NQXA 2EZ0D 4YQXH 1JTTA 3MJ8B 4D9LL 5JIHA 1FAIH 1JPSL 4MS8C 1QKZH 3VFRA 3CPLB 1CFBA 3E2HB 4JPVL 4Y8DC 4C83B 5SWQB 1VFAA 1BD2A 3UBXI 1PW3A 4DFIA 4PLNC 4J3OC 2XV6B 4GW1A 4U1GB 3GSNH 1QO3B 4FMFA 2AABH 1J86A 4OKVB 2YPVL 1LNUA 5TE6H 2LU3A 5IBUB 1LD9B 3EOAB 3K2UH 4X9GA 3G04B 1RURL 2MWCA 5EA0H 4ELMA 4MYWB 3T0EE 3NVQA 5A2FA 1LO5A 4NRXB 1AR1C 1D3CA 2C1PA 4POYA 2OL3H 5ITBH 1MEXH 4FFVD 3GMOB 3B9KB 5E7BA 2Q76B 2C4FU 3VFWA 3C5JB 4R96A 3CXDH 4M02A 1G0YR 2LVCA 3GB7B 3DX9A 3TYGL 1E4XH 2FDBP 4DWHA 3VFPA 5BW7C 3SQBA 1JZ4A 1D5IL 5DJ0A 3G04A 1EA9C 2AJSH 3U0PA 5EOQL 4Y5VA 5AUMA 3QCTL 1B6UA 3M1BB 4LSUL 3RNKA 4ZTPL 1JWUB 5DLMH 2ZP0T 4GKNB 5D2LB 4PRPE 5D1QB 4JFPA 3ZKSD 4KI5F 4ZG1A 1TJIL 4XCEA 3AROA 2NLJB 1V05A 4I5BA 2QQLL 3PIQA 15C8L 4BSWA 2VYRE 1C7SA 5E6IB 2HKFL 2DS4A 3ARQA 2ADIA 4H1LH 3SGEH 3DIFB 4IRSB 4X4ME 5CBAB 1MHEB 2MHAB 2J7LA 3WLBA 4XNYH 3F7PC 4KHTL 1F4AA 2EC9T 2FGWH 1RVFL 1HHHA 5DMGD 4UTBL 3RNKB 5BVPL 4OGXH 5J6HA 4LPVA 3THMH 3TO4A 5EB9A 2R2EB 2ZZUT 3U0WL 5F1OB 4RIRA 5D2LF 5GSVA 3PDGA 4JKWA 4K23H 4F9LA 2J8UE 3Q3GB 4L5FH 4NJAH 3PJSB 1BVZA 5FHAL 5DJDB 2MHAA 1PG7H 3R0NA 3DETD 1XGYH 4FFWD 2LABA 3TZVC 2ATPB 4GOSA 1DANT 2EH8H 4TSAL 3MRFB 3U2SA 1KLFA 3QCUL 4L8CA 3PHOA 4P23A 32C2A 1U8JB 2CR6A 4QRPA 4XGZA 2FYYB 2DMKA 4TSCH 3MA9L 3C6SA 3EHBD 1OSZB 2OL3L 1CF8H 3BWAB 4RGND 3ULSA 4OF3A 4XCNB 4RA0C 4FG6C 1T1WB 4P4KB 1NLDL 4Y4FD 4OCSH 1FGVL 4XRCB 5F9OL 2FR4A 3BE1L 3ZDZE 5C07B 2SEBA 3RI5K 4FA8A 4PJHE 5IQ7H 2B1AH 4QGYA 4PJ5A 5FGSA 4Q9RL 1F2QA 1ZHNB 5I1EH 2KQNA 3VXUB 5GRJH 1JP5A 4PYGA 3ZKQD 1D7FA 1J11A 2DTML 5D1QD 3DXAE 2EH7H 4M8QA 3FZUC 4TN9A 4PD4K 2CDFA 1TVHB 2HVKB 5EBMB 3CMOH 3MRIB 4UDTA 1OLLA 5DMJB 3RVTC 3MXVH 3SJVD 4MAYC 4NO5B 3QUKA 2A77L 3GRWA 1BJ1H 4UIMB 2GW5A 5BV7C 2YSSA 4QRTB 2C3WA 1AJ7L 5D7LB 2VDQH 4PJXE 5GGTH 2XZQL 4UNTA 3GI8H 1NGWB 1PAMA 4L8SB 4QXTA 4P2QE 4PTUB 2FL5A 1B4JL 4QGTA 1J18A 1N0LA 5JHDA 1ES0B 4Y4KC 4K94H 5DHXB 1UH4A 3HG1A 4I0KA 4R4NC 4G6JH 5F93C 5MI0C 1S9KC 3KLSA 2VMFA 1H9VA 5FIEA 5ALCL 4G6AC 1H3UA 5TDOB 3QWOA 2X6MA 4P2YA 4PTTA 4F8TA 4DGVH 1DQLH 1X5GA 3CZFB 3T08A 4YHYC 3G6JF 5LGHL 4KDTC 4B7LA 2VUOA 3GO1H 2AXFA 1R3KA 4M1CD 4N0UA 1YEEH 1IKNA 2Y36L 3UC0L 4OZIE 4Z0XA 4P3DA 4ZODA 5IHZA 1CFQB 5F89B 4Q0XL 1BEYL 1GC1L 3MA7B 3GI8L 4MCZB 4GBXD 4LHUG 4ZAKD 1JGDB 2CLRA 4PLJC 2UZYB 4UQ2B 1B4JH 5ABDE 4Y4KB 2AVGA 2ED8A 4HJJL 3CFCL 3RU8L 1S3KH 3SDXF 1C5BH 3C8KA 1J88A 1OB1A 2XKNA 1N3NA 2VXSL 5C09A 1DEDA 1J7VR 3WJJA 1BBDL 3MCKA 4PJ7B 5BCAA 1KENH 2FCBA 4LAQL 5F88B 4HUVB 1G9MC 4CADB 5I30L 3JSSA 4Z78B 3V4UL 2X9XA 3AUVA 4MAYB 1J1XL 4LEXH 1IGFH 3LKPA 2R69L 2APVA 3C60B 2W9LA 1U8OB 2IADB 5TE4H 1N4XH 5GGRB 2B7DT 5D70H 5IP4A 3AXLB 1XGUB 5C0AE 1NEZA 4KTYA 2VE6A 1MWAA 1U41A 3WO3B 5IFHL 3TYFB 2K9UA 3LQAH 2K1MA 3C8KB 4JM4H 5A1AA 1CE6A 1K4CB 4Y5XA 1CGVA 3CFCH 2AGJH 5AEAA 3T77B 1E27B 5CLTA 3AMKA 4MA3A 2OTUB 3FO9A 1RJYB 2O26U 3CLEL 2V7HB 1ZT7A 2DQUL 3KJ6L 3LY6A 1AO7B 4LPYA 5L2KB 3MOQA 2V2TA 1FNGA 3T0WA 3HHRB 1ED3B 3QFJD 5FEBA 5GGRA 3GIZH 4MJIB 2F54D 1JPTL 1U8KA 2GT9B 5SWZA 1NBVH 4S1RH 3VI4F 4U2YA 5A40E 5HHOB 3E6FB 4GG8A 4H5SA 4CN1A 5GS3A 3V5HB 4QKXB 3TV3L 1ZA3B 1MRFH 1Y18A 3D3VD 1N5YH 3H9SD 3IU4H 4MQ7A 1A3RH 2OTUA 4TPRH 1FNSL 2X4PA 3D25B 4HKXB 2QJDA 2UUDK 2DI9A 3W9DB 4J3SA 1A4JB 4F7TA 1IC7L 2VLLB 4KXZI 2YOCA 3V0WH 5TQ2L 3LZFL 4HK0B 5HTSA 1OGAB 1NCNA 3H3PH 3RU8H 4XMPL 3ALXA 4S1QL 1KCVH 5J56B 3EGSB 4PUBL 3I02A 4HKJA 3SBWA 4TULH 3UPRA 1JHKL 1JPGA 4MZ3A 4LCCA 1OTSD 3RTQA 1FH5L 2RJMA 3BP4A 2CRZA 3VDAA 5HHQB 5TPWL 4JJHA 1RZGA 3WIIL 4F7TB 2X4OB 2AKRB 1X5IA 4UDUB 1U3JA 3X3FH 1O7VA 3GMQB 1AY1H 3VU2A 3LSOA 1I1CA 4X4YB 2H2SC 4LCIL 1MIEL 1U2HA 2UYLB 2E7CA 2QL1A 4GRWB 1OWWA 4NQEB 5IW6A 2J3SA 2P8PA 2WLYA 1DQDL 2BNRD 1U93A 5E8DL 2Y7QB 2IAMA 3PABB 3EDFA 2QSQA 5I1KL 4ERSH 5I1LA 3W81A 3BKJL 4KMQA 3VXQB 5MP6L 3QWRA 1FH5H 5ID1B 4LOUC 5TPWH 5ADOH 3S37H 5LCVL 5T1DL 1X7QB 3VDBA 1U58B 1S9WA 3L7FA 1H3PH 4TNWF 3MFGB 5D5MA 2VDNL 2AXGB 5ID0A 4JO3L 2EYTA 4RMRA 1VERA 4QRRA 3Q2CA 5GHWL 1KN4H 2J8UF 4FQHB 3C2SA 5EBLA 3T2OA 3IU4L 1A3LH 3PWJA 1I8LC 3MJ7A 2DQEH 5J13C 3SOBL 2P5EA 1CZ8L 2VABB 4XVUC 4PG2C 1YJDL 1FZJA 3D69A 3QG7H 3RBSA 3MRRB 3SKMA 3WFHB 4NOBA 3ILPA 1F02I 4ODSH 2FSEB 2X4UB 1XF4A 3O4LE 1OGTA 5MP6H 4IOFD 1UH3A 3RNQA 3IAQA 2ZNWA 5FGRA 5IB5B 2YZ1A 1H5BA 3F12A 4EN3A 4PPTA 4U1GC 4HH8A 3CGTA 5DJ8A 4M43L 3MJ7B 4OCYL 1KJ2B 1F4HA 3INUH 2J88L 5C0JA 3PNWB 4KTEL 2KZWA 3FFDA 1U8HB 4ELME 4F7MA 2HP4A 3EYQC 5F7MC 1L9MA 4OF8A 3UYRH 5ENWB 3Q6GL 1S9VA 4LCYB 3MRJA 4L4VB 2CKBA 4PY7A 3KYMB 4WU7A 3X3FL 5T3ZD 3VFOB 2O93L 1XF5B 1AI1L 5C1MB 3PL6D 3VXME 3KGRA 5DTFA 4KK9C 1RZ8B 1E4XL 2NXYD 2Y6SC 2VLKA 3G6AA 2X9WA 5EOTA 5K9JL 1TCMA 3NTCH 2H6PB 2JCCA 4XC3H 4D3CH 1ETZB 3IJYB 1UWEH 2QR0B 2R39A 3EOBA 3C8DA 3DNKA 6FABH 3QH3A 4GG6A 1VDGA 2YSSB 1YC7A 4XPBL 3BJ91 4KVCL 2EYSB 1UYWH 5I16A 1KIRB 1LO0L 3X11B 2DYPA 1DFBH 4KFZC 3NCYS 4LBEB 1KNOB 4EBQL 1NCAH 5ILTH 2HKHL 3IKCA 3NZ8A 1WCBB 3AAZA 3WKML 3GSNL 3EJYC 1LEGA 4OF6A 1OWRM 3HS0A 2Z31D 3ESUF 1NAKL 3QEHA 3LIZH 5KTEL 5HI3C 4PJIB 5L2JB 2MPAL 4U1HA 1AQKL 2ITCA 3LKQB 4AQOA 3V6OA 3ZHLA 4WTZA 5E4EC 1I3GH 2D7OA 3K7UA 1BZQK 4N5UA 4XC3L 3W9EB 3BEVB 4LHUD 4UU9A 4GQ9H 3EOAA 1A4KB 2VC2L 1NSNH 3ARDC 3EYOA 3T2NH 5HY9B 6FABL 4WW2C 2AK1L 3HG1D 2UV3A 5IQ9A 4ZUTA 2NW3A 1I3RB 1BWMA 3WS3A 5IROA 4A6YL 5EU4A 2Q3ZA 3NZHH 1R3LB 2Y25A 5AZ2L 3SDCC 4PJ8B 2ICWB 3DXAD 4RQQA 4P3WA 1AP2A 4RRPG 4Y4KA 1ODAA 3VFNB 3PP4L 1BAFH 1S7SA 4WTWA 3L9RA 1WICA 4ZFGL 5TJWK 3AS2A 1CQYA 1A4KA 5KG9B 1ZVYA 2VQ1A 1OPGH 4K7PH 2FX8L 1II4E 3TBSB 5AZEH 1F8TH 4P5TB 4QRQA 4YHKL 1A9BB 4GQ9L 3L95B 3P0VH 1U91A 5B3NA 2EXYC 4WRLA 3HRPA 5FYJL 4KKLD 5AYUH 3L3GB 3JWOH 3UROR 5C9JB 4I5BB 4XNYL 2H26B 2IGFH 3GSXA 4DQOL 1U8OA 1H8SA 2IADA 4MMZC 1AGEB 1M7IB 4P2QA 5K9KA 1QPXA 4Q9RH 4MCYB 3OKLB 4IRSA 1K4DB 1KJVA 3ZLQC 5DFTA 2AXJA 5IVXB 4UTAL 5MHSE 2VQ1B 1Y6MR 2ID5A 4XNZC 5HYSG 3PGFL 5HYJE 3RA7L 5IG7A 4YX2H 4O9HH 4YHOH 2DQJL 3F65A 3MNZA 5I73B 3T0VA 3I6KB 1F8TL 1JNLH 4HHAA 2DQHH 4KI5D 3PP3K 1IAKB 1P1ZA 2LAAA 4YXHH 3VWJD 5ANMB 3W0WE 3C2AL 2A38A 3LDBC 1K4DA 4WHCA 4PV8B 3WFZA 3FTGB 1MCRA 4L5FL 4XXCC 3BUYA 3VXMD 3L3OB 2Y9RT 1D5IH 3BPNC 4PR5B 4RAVA 3MXWH 4PRBA 3NGBC 4Y4HD 4I0CC 4HXAL 2OZ4L 1ES0A 3KLHD 5LBSH 1Y0LA 5F6IB 1IAKA 2DLGA 5GJSH 1CTNA 3VG9C 1H8NA 4B41A 1AC0A 2Z93A 3FT3B 1FZMB 1HYRC 2EXWD 4U2ZA 3MOBL 2F53A 4WY7H 2CMRH 4WU5A 5KW9L 2HFEA 5I76A 1N8ZB 3U9UA 2R1XB 3QXUA 1ROWA 2ZNXA 1WIUA 4JN2B 4HFWB 5SWZE 2VLRB 3EBAA 3MRPB 4FQJH 4P4KD 4X8JA 5AZEL 5DD6A 4CVUA 3S4SA 5HVHB 2DL2A 3GHEH 3P0VL 5EG6C 2VDLH 1EX0A 5SV4A 5GGTL 5DJZA 3KPOB 2O5YL 3QHFH 3W2DH 1GSMA 4JFQB 3MNVA 1MFEH 3DYPA 4N8VA 5ICXB 2Z31C 4PB9H 4L8BB 3EFDH 3RWFA 4BSJA 2PW2B 3QEGL 5ID0B 1N3NB 4WY7L 4G7VL 4UB0L 2BSED 1CCZA 2YBRB 4PJFE 3WS6A 4ORGB 1A6TB 1CI5A 4UV4L 5L9DL 4HV8B 4BSVA 2BXZA 3FQXB 4NQDA 3X14B 3MV9E 5E2UH 2WBWB 4HS8L 1FYTE 1QBMH 1JMXA 3MRGA 4JDZB 2IH3B 1PY4A 4OQTH 4WFEE 5FECB 5JO5B 4P46C 3WDHA 2CGRH 5KSUB 5B3JE 1NCDH 4PJ8D 1YYMH 2PW2A 2FX9H 4U6VH 3QHFL 1YN6A 4ZS7L 3W2DL 1R3KB 2YD6A 2BY0A 5D1ZD 4RBPK 3ULVH 4U3XA 1NUDA 3EZJB 1KEGH 1HSBB 4OLUH 5IVOA 1FV1A 1UZ6E 2VKXA 2QHRL 3C09C 4MWFA 5T1MA 5EO9A 4K71B 1DN0A 3HZYA 2X09A 4KTDH 4A6YA 1JGDA 5DK3A 1FGNH 3KJ4B 4BZYA 3Q6FB 5D7JD 1BJ8A 4Z7WE 4X6CA 3GI9L 1L9NA 3MXVL 5ESAA 3BO8A 1F6LL 3SKOA 3AFLA 3F7QA 3N1PC 2CMRL 1QSFD 2DBJA 4YBLB 1FNSH 2UY7A 5J4MA 4BZ1H 4XI5C 1CLZL 5F88A 4AENB 4U6VL 3B6SB 4PJ7E 1TTUA 4G6KL 4KRLB 1KEMH 3AS1A 2M1KA 3LKPB 4C56B 1KEGL 2CO6B 1FZKA 4ZOAA 5KVGL 2IFFL 4QRRE 1RIHL 3HNSL 4P2OB 3WLWC 4ZUVA 2OMNA 1XGUA 1D9KA 3FRPA 5D7LD 3ZKMC 3GMPA 4RMQA 4PS4L 3CDCA 5HYSB 5IEHB 3D0VA 3JUZA 4P57B 4PY7B 2PXYB 2HJKB 4H8WC 4DGYH 1BVLB 3DBXB 1KPRA 5FFLA 1OAQL 1QLEL 2GYSA 2ZJSL 2WBJA 1ZLWH 3O6FA 4I18B 1LO3H 3GUTA 1MI5A 5LG1A 2J4WH 3IJYA 1IMHC 2BNQD 4NZTH 4P5KB 1REIA 5D5MF 4C4KO 3NABL 2HLAA 2F74B 4H8WL 4OFVA 4O51A 2Y1VA 4OQTL 5KVGH 1AFVH 3GIZL 4JM2B 3OTTA 4LPTA 3HNSH 5F7UA 3P4OB 4APQB 1RFDL 4WUKH 3REWB 2JELH 4S1DD 4X4YA 4RGNC 4U1MA 1N6QH 1BVLA 1EIBA 3S5LA 4LRNL 4E0RB 4PJAA 4HT1L 1K5NB 2Q8BL 1N5YL 1A3RL 4ESKA 3GB7A 4OLYH 5BRZB 1J1OL 1F2XK 1A4JA 1ZLVH 4KWUA 5C0CB 4XBGA 1MIMH 1IL1A 4DUVA 2B2XL 5ID1A 3UTPD 3IAGC 2H3NB 1QP1A 4LLUB 4HGMA 3UJIH 1HINH 2B0SH 3QIUD 3TVMC 3ZT5A 1CXFA 1YZZA 1JPGB 4KKAD 2JELL 4KVNL 3CVHA 3BP4B 1I1YA 2IPUK 2X40A 2HTKC 5JXEA 4HPOH 2F8OA 4TVSa 4HKBB 2W59A 2H8PA 2VABA 3VJ6A 2C3VA 5CBAA 2P5ED 1KLGA 1I7ZA 3JV0A 1YPZA 4P5TC 1HH6A 4NCC1 2H3NA 4G43B 3NIFF 1IQDA 1OQXA 4QRQB 1G84A 2P5WD 3DXAA 4PJDA 1QHPA 1SEQH 1K3ZA 4XWGL 4LSTL 1P6FA 3VXSD 3OR6A 4DGYL 5IW1B 4AIZA 3TO2B 4XPHH 3P30L 1P84K 4F9LC 4LQFH 4D0DB 4KV5F 2EEAA 5KJRH 2MJWA 5E9DD 4AEIH 3U83A 3NABH 2BSRA 5CJQH 1A3LL 3QXDB 3RDTB 4NZDA 3Q0HA 3D2UB 3QG6B 2NZ9C 1KFAH 4YGAB 1EEYB 3SOBH 1V5JA 5LCVH 3HRZB 5E4EB 5T1DH 1CZ8H 4S1QH 2XG4A 3CPLA 4C83A 3PL6A 5IV2A 3QIBA 4OZHF 3OR6B 1YC8A 2FO4A 4OIIL 1HHKA 2BZDA 3O0RH 3RWGB 2Q20A 4NNYA 4LIQE 1FHGA 2JJSA 4XWGH 1FG2A 3QUZA 4G8FA 5INCB 1H15B 3T2PA 1OP9A 4M3KB 4IDJH 3B9KC 2VO5A 3H9ZA 2DYPB 5HGDA 3RWJB 3EO9H 4PJHF 3L3OA 3QHZH 5TDNB 5JA9A 5KSAB 3B2UD 3T2QA 1FE8H 1AXSA 5ETUA 4LCIH 3CFEA 3R1GL 1YNKH 3MOAH 3Q1SH 2W92A 3UJJL 1IKFL 3QFDB 5SWSD 2ZCKH 4KGJA 1MRCH 5D7KE 3KPRB 3VGAC 2C1OA 4HXBH 2BNQA 1MHCA 5ENWA 3C5ZC 4PREA 3E8UL 1CG9B 4FQQA 1LO4L 2EO1A 2NW3B 4ZUTB 5LGJB 4HMDA 1JGEB 1N6VA 5KSAA 1MI5E 5TE7H 3U36A 5HYIA 5T5NG 1P7QD 1KN4L 5JDSB 5IOPB 3K2UL 1RURH 5EA0L 3DLQR 5TDOA 5DK0B 5HHPB 3GMLB 2ADIB 3FT4B 1NC4D 2A6DB 3NFNA 5MERA 1FO0L 3AC0A 4MB4A 1VENA 4XNQA 1G7MA 3O4OB 1ZSDA 25C8L 2DD8H 3QRGH 4E41D 1XCQA 3IETA 1MRCL 1NAKH 2PW1A 4XPBH 1W0VA 5BQ7B 3BPCB 2YBRA 4KVCH 2CR3A 2YUZA 3BDBA 4WWID 1KTDB 3X12B 2IMNA 1UCBH 3MV11 4YNYA 3ES6A 5IB2B 4XPTL 1LO4H 2CLRB 5CJOL 5FKAB 5J3HD 4I3RH 4E5XB 2BDNH 5HBBA 2ATKA 2GHWB 4PJCF 3FOLA 4O2FB 2BX5A 1LP9F 3PWUA 2AQ3A 3H8NA 3U7WL 1VFBA 3N50A 1LP9E 5D7JA 4Q6IC 1PFCA 4HWZB 3GHBH 4MJ4A 4TSCL 1MHHA 3UYRL 1HCFX 1WBXA 1IFHH 2XTJB 3B8SA 4P23B 1MCNA 3T2NL 2XNAA 25C8H 1BQUA 2A2QT 2DD8L 1UEMA 3QRGL 1LO2H 3QUXB 5JPMB 3ZSTA 3L5IA 3ZKMD 1CVRA 3FN9A 4PJ8A 3LVEA 2HT3D 3O3EA 1T1WA 3GBNH 4PJGF 1IAIM 4KK9D 5K9QG 3RDTD 5ANMA 4ZUWA 4BKLA 1NEZB 3VCLB 4EI5D 3BD4A 4XHJC 3TH4T 3WHXB 3ARBA 1S7XB 1DBBL 1RHFA 1K9TA 5F7HA 5FYJH 3EIFA 4XBPA 2F19H 5IVXF 4F33B 1EDQA 3FTGA 3ZYIA 1MHPL 2DDQH 2YPLA 4LVHC 4PJ5B 1Q38A 2NTFA 1B2WL 3L3JB 3HI1A 4V1DB 1DFBL 1MY5A 3BZ4B 4DQOH 4QT5A 3TGXA 3CMOL 4DVBA 3HZVB 2XPGA 4YDLC 4XP4L 2DI7A 1RJCA 4GS7C 4X83A 1QYGH 3L3IA 3C5ZD 4AZ8A 3RWIA 4JO4H 3VFVA 1KPUB 4FQJL 3ROLB 3WDJA 3WKNA 2NTFB 2Y5EA 3IDIA 1F45A 5FYKL 4WTXA 3QWQB 3PXHA 2AK1H 5DO2D 5FM8A 4P5MA 4LRIC 3DOSA 2NY2C 4I2XE 3DGGB 4L8DA 3OX8B 4YHOL 4PGBA 1IZKA 1ZS8B 2B1AL 4OZGA 4PRPA 5HYFA 3QEGH 5JUEH 3VFVB 1XFPA 3F7RA 5J11C 5MHSD 2BDNL 4Z18A 2BHYA 1CGYA 4M3JA 3S8WA 5FUZL 1FSKB 1QBML 1ZE3C 3SN6N 3BDYL 3U4AA 3QUYB 1DBAH 2P5WE 4M1GL 1NJ9B 5IB1B 5E99H 4O00A 3THML 4PIRF 4KPHL 3SGKC 1TZGL 4XXDA 3UTOA 1O7SA 5HVFB 2EDKA 2IGFL 5IBTL 3HNTH 4WHDA 4WI9A 4XI5D 2BSTA 2CIIB 1KJ3H 4EI6B 3MGAA 4F58L 1U8LA 5J1AB 1U6AL 2XKNB 3EKCA 4JN2A 3V7AE 4Y5VC 5ESVA 3V8CA 3PDOA 1J1XH 4LEXL 3TBWA 1FGNL 5I6XB 1B2WH 3OXRB 1N2RB 4OZFH 5LAXA 3S88H 3OKKA 3CVHB 3P9MA 1WFNA 5D72H 4FFYH 2APFA 3QPQD 5F9JA 2JJWA 1CF8L 1BF2A 5HYJA 5FOBA 1DE4A 5BJTB 2QKIA 3TJEH 5TH2A 4YO0A 3SPVA 9CGTA 3BXNB 2BXYA 3DVFA 1M05A 4IS6A 5E2UL 1GC1H 3L7FB 4XH2B 1WK0A 2PXYC 4HF5L 5T3ZH