1GSMA

A reassessment of the madcam-1 structure and its role in integrin recognition.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
b'VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLIEGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1
publication title A Reassessment of the Madcam-1 Structure and its Role in Integrin Recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA01
1KNOA 3H9SB 4JKPH 3FAWA 3T1FB 1FN4A 2BOBB 4D0BA 2Z91A 3BZ4A 3ZKQD 2V9RA 3EIFA 1TETH 3L7FB 4G7VH 4PJ5E 1WSST 1T0MA 3SDAD 4X7SL 1INEH 4NQTA 1FSKC 4PRAB 4U1JA 5GHWH 3TZVB 3VGGA 1SY6H 4OLUH 1NSNH 3GMPB 3ARDC 1OARL 3F7VA 2FNBA 4MB4A 3DSNA 4JY6A 4LHUG 3WCYA 4PJFA 4R8WL 5HHVL 3QUML 4JKMA 1NCBL 1P5UA 4FZEH 4KKLC 3S36H 4HFUH 2BXYA 3BKMH 4PGDA 3AB0B 3BQUC 3JV5A 2P5WE 5GIRA 3TIDB 5CEXB 5E1AA 2OX5A 2W60B 3NFPB 1FNEB 2OBGA 5DLML 1GZQA 3QHFH 4JZOA 4H1LB 3W39A 4S1RL 3DBXB 5CJBA 4J6RL 4F7PA 3KYNB 1I7ZA 3MLWL 2E7HA 5IB3A 1H3GA 1N0LA 1UWXK 4PGEA 4OV5B 4UDUB 5TF0A 2YA1A 2FIKB 2ITDA 4U49A 3PP4L 1TCRB 4Y5VC 5K9KB 3KS0H 1BAFL 2AS5M 4RFOL 4NRYA 3HZKB 1EA9C 4P2QE 3MLYH 4JZNB 4NFCA 35C8L 3S88H 3DO7B 4JQVA 5T5FL 1X4XA 2PNDA 5EU6A 1VESA 1JGLL 2PR4L 1N5YH 4FG6D 3LN9A 3BPNB 1IL1A 5CILH 5JA9A 5D71H 3MLTA 2JJVA 1BFSA 3K7UA 1QACA 4MJIE 3S37X 3AU1A 3AGVA 4UQ2B 4FXKB 3HG1A 1R3KB 2AEPH 4OD1L 4Y2DD 5EULV 5L88L 1IMHC 1OM3L 4JO1H 4F33B 2VL5B 1N7ML 3BWUC 3EKCA 1KSRA 1WTLA 3O41A 4QRQB 1HKLH 3VU2A 2LVEA 1LK3H 5IMKA 1YZZA 1ZGLB 1DL7H 2BVTA 5CZXC 1A6VL 2AI0L 4MCZB 1A6ZA 2SEBA 5A2KH 2F58H 1GOGA 1T20B 1I8LC 2CDFB 1CFQA 1H8NA 1QYGH 2IFFL 1A14H 2NY6C 4ZYKB 4BFBD 3O2VL 5TQ0L 1WICA 4X6FB 4XPTL 5D7IA 5D6DC 2OSLA 3SBWC 5JDJA 2Q7NA 1D5XB 1ZT7B 2F8VA 2Z92A 4LPTA 3U46A 5I19L 1OTTD 4FOMA 3B9KD 2PXYA 1HHGA 4XI5D 4PJXB 4Y19B 1OP5K 3TIEB 4TRPL 4KDTC 1T7XA 3BMVA 2FZ3A 4OLWH 2GTZB 3G6DH 5JUEL 3GZKA 2V2WA 4FZ8L 3NZHL 4MAYB 3CU1A 1IEBB 5IK3B 2EICA 1MVUB 2XQBL 4LU5H 2HJKA 4XBEH 3HTLX 5D1ZA 1Q9LB 4L4VD 1UJ3C 3FOMB 3QPQC 2EKJA 4IOIB 1IKFH 4NZTL 1QBMH 1DR9A 1UXSA 4MJ4A 3T65A 2XA8H 5E8OB 1OWRM 4NC1E 5C0BB 4Z78A 4DWHA 4CN6A 5EIIB 4RMTA 1XF4B 3SCMC 4F7TA 2IADA 2BX5A 4OZIA 3IGAB 3IDYC 5MEQA 4ZTOL 3WNKA 4LFHG 4YHZH 3SKJH 2HWZL 2X4RA 2DD8L 1Q1JL 2DLHA 3PQYE 3RUGE 1U8JB 2VOTA 1BD2B 3PDOA 4LSRH 2NPLX 1LK2A 4YDVB 3FQNB 1I1RA 4U6VL 2YHGA 5I15H 1FORH 4M7JH 2ATPA 5GISL 1J1XL 1L4IA 1T83A 3UXFA 3H9SD 4LCWB 3PXJA 3BDXA 3WDJA 1LNUB 3W11C 4LDOB 2NYYC 1CXEA 1B9ZA 5INCB 4XPBH 3GMOB 2H41A 5ADPH 1NCCH 2GITB 5GZND 4WI9A 3UPRB 1KENH 1BMGA 1CVRA 4TPRH 4PJAA 3QFDA 5CS7A 5C0DA 3RBSA 3GBNH 4WNQA 2R2HA 4GKNA 1NBZB 1T0NA 4JDVA 1JRHI 1NAKH 1I85C 2YUZA 4TOYH 1MHPL 5F96H 1FIGH 4L4TE 3RVWC 3TA3D 2PYEB 3OWEA 1CDYA 4PIRF 1EEYA 4P9HL 4Z8FL 2X4UA 2VLLB 3NOIA 1P53A 1G1CA 4YZFF 2WWKT 1AY1L 5D6CB 2FLRT 2QHLA 5JPMA 1MFBH 2N7AA 5GRUH 2ICEA 4R90H 3O2DH 4DEPC 4H25A 4HH9A 3W5MA 4HCRL 5C6TL 5DD0L 3IDJA 3PHSA 1N2RB 3O6MH 1UM5H 3ARTA 3GNMH 5AYUH 3H0TB 2P5WB 2FO4A 3MRGA 2VAAB 1P4BL 1NEZA 5DJ2A 3PIQB 3STLB 5DFWH 1VFBA 3H9HA 2I27N 1JPTH 4YUEL 3LHPL 3U4BH 1G7QA 2NXYD 2KH2B 1IGMH 3V4UH 4ZQKB 5JNYA 5I1AB 5DTFA 1KC5L 4DK6A 2J4WH 2G5RA 3TBSA 3C6LA 5EZOH 2H3NB 3PWNB 1A1NB 4XPHH 2LVCA 3EOBB 2JK5B 3SKMB 1F13A 3FZUC 5AD0A 2Y1VA 4KWUA 3PWVA 4D9RE 2HAZA 4GRLB 2YA2A 3BVNA 1C5BL 2H2PC 4N0UE 3GHEL 2JJSC 5ENWA 5EO0A 3WSQL 2AJXL 2V6HA 5D2LE 4UV7H 5DHVB 2CSPA 4A2MA 5CIPH 2ZUXA 3MV8A 2FHFA 3C09B 1W0VB 5C08B 4NZUH 2DQTH 1DUZA 4OZFB 3BD5A 4MXVF 2DM2A 4PRHA 1I1FA 5FDWB 3KLHD 4ONHB 3LRHA 2EDBA 1DANU 2D7PA 5J3HC 5DDHB 2NTFA 3PHQB 3FQRB 3IKKA 1VHPA 4BSWB 5DUML 4QOKE 2FHCA 2GCYB 1TJGL 3L3GA 4I4WB 3BISA 2MNUA 2MTPA 4U6XA 4LVOC 3BZEA 3HMXA 4M3KB 4GO6B 1C12B 3CXDL 3ULUF 4ZUWB 3G5XA 3DGGA 1CFNA 3PWUB 5FO7A 2HG5A 2DWDA 3DI3B 4PJDA 3VXMD 3RVXD 3OJDB 3RPIA 3X11A 2VE6A 4GQ9L 3GSXA 3BIKA 4P2YA 2HMIC 4NWUL 5I1IL 4XPGL 1ACYH 4XC3H 4MD4A 2Y9RT 3VI4F 4K3DH 4HUVB 4NQDA 1F6LL 2F53B 2VUYA 2NR6D 4OJFH 1I1YA 2OP4L 2IF7A 4F9LC 1H5BC 4HX1A 4JO2L 3WDHA 2PW2B 2VQ1B 2E7LC 1HCFX 1BD2D 1H3PH 3QULB 4CAGA 1S7UB 2H26A 1HI6A 4LL9A 4HKZB 2A83A 5FK9A 4R26H 5IOPB 3WXWL 1BQHA 3FCTA 2CO7B 4DKAA 2YD2A 4L4VA 1WAAE 4K9EL 1MFAL 4LASH 3QFJE 4LVNB 5FM8A 3RI5K 3SKOB 5D70L 4U33A 3TWCH 4XGZB 3SDYL 3EJYD 1BX2B 4CDHA 4ZXBB 4A6YB 1KB9J 2XKUA 3K1KC 4LLVB 1CR9H 3B3IB 3PQYB 3RUGB 3DVNA 3VXOA 2WP3O 3VWJC 4QRTB 3C60B 1OAYL 4RQQA 4CL7A 5FUOH 4JJ5A 4HPYL 2AV1B 1MIEH 3LQZB 2C7UB 4O02L 4NSKB 1JHLH 5MHSD 5E2VL 4HS3A 2EC9U 2PW1B 1KBGH 1UYWH 1FFNA 2FJHB 4MNQE 3BJ91 4Y5XB 5ACMA 3V7AE 3ULUH 3T1FA 2P48B 2BOBA 3V6OA 1G6RL 3W82A 4PJFF 3UYRH 5FUCC 3SE8H 2BVOB 2FHBA 4TQEH 4AEEA 1QRND 3L7FA 4J2XA 1KXVC 1ADQH 4ORZC 1QZ1A 4PRAA 3RPKA 2IPKB 3TZVA 4ODSH 4PJBE 5IVXB 2RFXB 1PVHA 3GMPA 4FQCL 5IROC 4YHKH 4KMTL 1NCAL 3HE6C 4NRXB 1MJUL 2DQCH 3AMLA 1CFBA 1WBXA 3CVIH 5LGKA 4U1GC 2FDBP 2DMCA 3CX2A 4KHXL 5I71C 3O3DB 3LKQB 3WKMH 2PKDA 2YD3A 3O3BB 3QUMB 5DEZA 3TIDA 5CEXA 3TV3L 2EDFA 2W60A 3NFPA 4ZAKC 1FNEA 4PJ9C 4N5ED 4H1LA 2WAHA 5LGHL 5I1DB 3DBXA 1W0YT 3KYNA 4FFZH 3GUTB 2CXKA 1VDGA 3MCLL 1PKQE 5ADOL 2O5ZH 4OV5A 1IC5L 4UDUA 4J3VA 2X7LB 3RHWF 2FIKA 4M8QB 4JDTH 2FX8H 1T89C 3VH8G 4KKAD 4Y5YC 1TCRA 1AGCB 5K9KA 3WV0A 4QKXB 4B7LA 1NC2D 3HZKA 2WW8A 3TJEH 2Y7QB 2LAGB 3AREB 1JGDA 4Q74A 4JZNA 3AS0A 2YPVL 3DO7A 2ZJSL 5C09E 4UBDD 4NNYB 4BSJA 1IGFH 1KGCE 3FO1B 2EKSB 2DJUA 3ARSA 3IU4L 2Y25A 3TEUA 3G04B 3LS4L 4M6NL 2O5XH 5C08D 1F6AB 2WBKA 5IHZB 3P0YH 1T1WB 4J3OC 2B1AL 3S35L 3S5LG 1ORQA 5GJSL 3JV4B 2LU4A 3LB6D 2BDNL 3TVMC 1T2XA 2C5DC 3KLAB 5B21A 4UQ2A 4FXKA 3WN5C 4IOFC 3V4PL 3KLDA 3KPRD 4BH7B 4KUCD 3UJJL 3WNOA 2VL5A 4N0UB 1I3VA 2QQNL 5D7IF 5TE6H 4QRQA 2XICA 5D2LB 4XPFH 3I3DA 4P0DA 3TBYB 1DQLH 4M1DL 1XF1A 2H32B 1ZGLA 3AM8A 1MIMH 5K33A 3T0EC 3MRJA 2CRYA 3OAZH 1GIGL 2O61B 2NY5C 4L5FL 1T20A 4PJEE 2CDFA 4X6EB 3LZFL 3P4MB 2D0FA 2V9QA 4X6FA 3K4ZA 1INQB 1QKZL 4YDIL 1FRGL 3RY4A 4NP4L 4XP5L 3UBXB 3RQ3A 2OI9B 1JI1A 3MV01 1D5XA 3MJ8A 1ZT7A 5I73B 1X5LA 3LRSB 3B9DA 4U7KA 4NQCE 3ZDXF 5I1KH 5HJ3B 1BM3H 3QQNA 1CXKA 4PJXA 4Y19A 3TIEA 4M62H 2DTSA 1OCWL 4G8EB 2HJFB 2GTZA 1I3GL 2IQAB 4FFWD 4MAYA 1H3XA 4OZIF 1Q0YL 1IEBA 2DF3A 5IK3A 1EZVY 1MVUA 2WINB 1SMOA 3BE1L 1Q9LA 3H6JA 2ADJB 4KJWC 3FOMA 5FFLA 4RMSA 4NC2B 5F9WB 1I8KB 5E8OA 5C0BA 3SE3A 1CT8B 5EIIA 3EJJX 5DJDB 1XF4A 2HRLA 3I50L 4HZAA 4OCLC 1GHFL 3BP4B 2M8XA 4MMZC 3IGAA 4YDLB 1RQ5A 3IVKB 1U8JA 1BD2A 4U0QB 1I9RH 2AK4E 2VXSL 3EGSB 5GPRA 1T21B 3ARZA 3C2AL 4YDVA 3FQNA 1P7QD 3QFJB 2D03H 3UTTD 5T1LD 1OTSD 2BNRD 3FB8B 3NCBB 5KBNC 2C3WA 5FO8B 4HK3N 4LCWA 1ZLVK 1QA9B 4UT9L 4XNXL 2P4AB 1LNUA 3HB3C 4PJAF 4L8SB 4AL8H 4KDWA 3CGTA 1CL7I 5INCA 3EAKA 3VI3F 4WRLA 3GMOA 1CICD 2AJZB 3FQTA 3B2UC 2DQEL 5EU4B 1OT2A 2GITA 4G9FE 2FGWH 3UPRA 3OXSB 1A1OB 3DYMA 5F21B 1ETZB 3MMEB 3OAUL 5E0QA 1CXIA 3GHBL 3LQAC 3O3UN 3PGFH 4MNQB 4ERSH 1FGVH 2X1OA 1NBZA 1A6WL 1QLFB 1FPTH 3JWOH 4WEMB 5BXFB 3U79A 5EFIB 1S9KC 3IF1B 3VXTB 5EOQL 5J8OA 2CK2A 2VLRB 2PYEA 5ANMB 4LEXL 3DRQB 5B39G 1DBBH 2VLLA 2RCSH 4BZ2L 4MDJB 5HVFB 3QEHB 5D6CA 3IS0X 2ED7A 4BQ9A 1A7BA 5E70A 1IC7H 1TIUA 4M6OH 1PY4A 4DAGH 4KY1H 4X7DC 5CHNB 3D6GA 2VSDA 1JBJA 4FQ2H 4DGIH 4LP5A 3T0XA 1DVFC 1DQTA 1N2RA 5A40E 1NL0L 1UH3A 1Z9OA 4ZOBA 2OR7A 4JREB 3H0TA 2P5WA 4UV4H 5F1OB 3HI6L 2VAAA 1N6VA 4LRNH 2BRRH 2J7LA 1EFXB 1NBYB 3PIQA 4BUHA 5CUSH 4OI7A 4CJ0A 4DGYH 4J4PA 5H8DA 4XCCL 1RI8A 5E5MB 4X9GA 3RDTB 3KHQA 4LPUA 3ZKXB 1PKQB 4UI2A 4NQXB 5DRXB 3WNMA 1LE5B 4KK8D 3QUZD 4TSBL 4ZQKA 1AXSB 1T2QL 1JZ4A 5JQ6H 2WUBH 5I1AA 1ZS8B 1K5NB 1U2CA 1PLGL 2XRAL 3L5XL 2H3NA 3PWNA 3ET9F 1A1NA 2XWBB 1CD1B 5KAQF 1RUMH 2NY2C 5TPWH 3EOBA 2JK5A 3SKMA 5T1KD 1IRAY 2Z31D 4I0PB 3ULVH 2EO9A 3MZGB 2Z93B 5C09B 1FE8H 4GRLA 2QSCH 5FHAH 5L2KD 4Y4KC 1I8MB 2X4SB 3L3OB 4F7CB 1MCRA 2FB4H 4XMKH 4B0MM 2MMXA 3OGOE 5DHVA 5HSFA 1SEBB 2J6EA 1LD9B 3B6SB 2FATL 4XP6L 3BKJL 1NUDA 1W0VA 4HMCA 4PRDB 5I2IB 2X1WL 4OZFA 4KJYB 1TPXB 2XTJD 1ORSB 2VDKH 3HC4H 4FRWA 5FDWA 4ONHA 4PJDF 1AI1H 5DDHA 2FJGB 3PHQA 4LGRB 4Q9BA 4Q6YA 3FQRA 5KSAB 4WJ5B 5BZWB 3X3GH 4BSWA 3QXUA 2GCYA 3TH3T 3L3DB 4I4WA 1FAIL 3RIFK 4MWFB 5JXEC 4J1UB 1C12A 5FAAA 1KF9B 4U2YA 4ZUWA 3PWUA 1KXTB 3PL6D 3DETD 1ULVA 4X4YB 2Z0BA 3L3HB 2HFTA 1YEJL 4UILH 4CVWA 3IFLH 2VN4A 3OJDA 4PBXA 2F54B 2DLTA 4JHWL 3U7YL 4QXWA 1CLYH 2DDQL 4ONGH 1OSPH 3MRQB 2B1HL 2VDLH 4NQCB 3RFZC 4CU6A 3CNKA 4TSAL 3MNZB 5C2BL 4HUVA 3LVEA 3TBWB 2F53A 2HLFC 3HNTL 3BN3B 3QI9C 5EBGA 2PW2A 2VQ1A 1WCQA 4ZDHB 2XZQH 3G6JE 3QULA 2R0KH 1S7UA 1YA5A 4HKZA 2QADC 5DT1L 3KPQB 3LH2L 5IOPA 4ONFL 5I17B 3MBXH 1OTUD 4JPVL 4R7DB 4HGWB 4XNUH 4RGNC 3MUJA 5DD3L 4OGXL 3SKOA 2J88H 4OLXL 5IGXL 3QHZL 4PTTB 4S11A 2YMXH 4XGZA 1KYOK 3MREB 3ARWA 5ALCH 1BX2A 1J8HB 1I9JL 1QSED 2R0ZH 4A6YA 4ZXBA 1HYSD 4LLVA 3U30B 3VW3L 3B3IA 4R97C 4TVPD 1GYAA 3DI2B 2J8UE 3PQYA 3RUGA 1QG3A 3BGFC 3OGCB 2AK4B 3HMXH 3C60A 4QRTA 1EPFA 4Y7MA 3QNXB 2EDNA 5T3XH 2AVGA 3TN0D 2AV1A 1TITA 2FD6L 1ND0B 3GI9H 3UC0H 5JOPE 3LQZA 4PG9B 5D8JH 5J06A 4S1SH 1NGZB 1RK0B 2C7UA 3QCTH 4NSKA 3HNVH 3MLSL 3NA4A 1JGVH 4HULB 4NNPH 2PW1A 1AC0A 3OBAA 4K71C 5BMFH 2FJHA 5KOVC 4Y5XA 3SOBL 1QO3B 2P5ED 2VLRD 1F45A 2EH8L 2VDNH 2N4IA 1UZ6E 5JO5B 5JXAL 1RUPH 3ARDB 2BVOA 4NM4L 4CVXB 1P7KB 1NCNA 3FOLB 4JFZL 5F7NC 3DVFA 1G6RB 1VB9A 43C9B 3GDBA 4LOUC 1EHAA 2IPKA 4W4OC 3WHXB 5KJRH 1L6ZA 5IVXA 3TT1L 2RFXA 5T5NF 3EZJB 4QEGA 1NPUA 3BQUB 3LEYH 3TF7C 4AY0A 3CMGA 4ODBD 2E27H 4NRXA 4JFPB 3RTQC 1Y6KR 1YNLL 3CMOH 5KS9E 5C0JB 3MLRH 4R9HA 3O3DA 3LKQA 1MCQA 1OT1A 2EIDA 3O3BA 3QUMA 4KJQD 5C0EB 2P47B 5I18L 4YHLH 2XQYK 1MF2H 5FUZL 5E5RB 2QQKL 1EEZB 2C3VB 5HI4D 3NABL 3O6FD 4Y5VB 5I1DA 5HGBB 1DANT 3O8XD 3GUTA 2DM7A 3CDCA 5TFSL 4YXHL 2X7LA 3GEWB 4M8QA 1UH4A 2AXHA 3ZKMD 4JPKH 2ZPKL 3LN4B 4GAGH 4PRPE 1T03L 1AGCA 3O6LL 5LQBH 1BIIB 3QH3B 3MLZH 2Y7QA 4FQXD 3AREA 2UVFA 3I3BA 3KS0J 1CCZA 2VZUA 1MCHA 2E6QA 3ARYA 2YRZA 4NNYA 2PO6C 2EKSA 3FO1A 4WY7L 5JQHC 3LPGA 3G04A 2A9ML 1A64A 1F6AA 4DTGL 5BCAA 5IHZA 1D7FA 4Y88A 1UB5B 5BOZG 1T1WA 5I30H 2XFXB 1X5HA 3STBA 4HV8B 3VDAA 3O45B 2IALB 2IPTH 3JV4A 3GIVB 3KLAA 3BKYL 5KSAD 5LKNA 2Y23A 4G8GE 5F7FA 2WV3A 3TH2T 4BH7A 1YMMD 3RWEB 1LP9E 1AFVH 1BOYA 3S37H 1DE4B 2HKFH 4N0UA 4GXUN 1JF6A 2NY6B 2KPNA 5D2LA 1SM3L 4GXVL 5TE4L 3TBYA 5FYJH 5J89A 1YEGH 4BJLA 2H32A 5IQ7L 3MXVH 4M6MH 1RZFL 1JZ2A 2MOVA 2O61A 2W9EH 3ARFC 4PJXF 4GUPB 1N6UA 2F54D 1EUTA 4X6EA 3ARVA 3P4MA 4OQTL 2Q3AA 3V6BR 4JHAL 1EDQA 2UZXB 2DQIL 3ZL4H 4N90E 1INQA 1PJ9A 3QNYB 3UBXA 1E6OH 4RMUA 3ULVD 4QOKA 4KTEL 3LRSA 3MLVL 2VLME 1IFHH 1BVZA 1IGCL 1CGYA 5HJ3A 3W2DL 3BH9B 1UJ3B 1VPOL 3KVQA 4G7YH 1SJEB 5KW9L 4AEHL 1WIOA 2EC9T 4G8EA 1JHKL 2YUWA 2HJFA 2IQAA 3V5DB 1G9NC 4E5XB 2WINA 15C8H 1EGJL 2ADJA 3SCMB 1IGIL 3OB8A 3DX7B 3IDYB 1GOHA 1JGUH 1QLEH 1I8KA 3WLWC 1CT8A 1J8HD 4O4YL 4R4BB 5E2TL 2XNAB 4WEBL 1S9WB 4IIQB 3BT2H 5DJDA 3BP4A 4IRSC 4OLVH 2P8MB 3K74B 3MPCA 3KPSD 4P5TC 1J18A 2BFVL 5DMGC 3IVKA 2VQUA 2FBJL 3NCMA 1T0PB 2E9WA 4LAQH 4UOJA 5DA0B 1EHLH 3EGSA 4JPWL 4Y4HC 2BSTB 1T21A 12E8L 4XCYB 2NXZC 3QFJA 4M02A 2AEWA 3OB0K 5DUPH 5AUMB 4WFFE 3WFCH 3FB8A 1XF2B 2NY0B 2W59A 5FO8A 5FUCE 3D39D 1QA9A 3ES6B 1BREA 3LQAL 4B53A 2EDKA 4L8SA 4LVEA 2J8UB 1A0QL 4JVPA 3SDDD 4DFIA 5I1CH 1LE9B 1Q9KB 4P4KD 3EFDL 3E0GA 2AJZA 4WI8A 1MHEB 5EU4A 5IFAL 1N3NB 2ADFH 1NUFA 3OXSA 1A1OA 1ETZA 3MMEA 5C0FB 1PEZA 3DX6B 4H20L 3V2AR 2W9DL 4PBVC 5CP3A 4MNQA 3MX0A 1IKNA 4YEEA 4PS4L 2X6MA 1XIWC 5C0AE 1QLFA 2WQ8A 5DR5H 5FCUL 2AJVL 2VDQH 1KTKE 5BV7H 3FB6B 5BXFA 3WJLC 5EFIA 3IF1A 3VXTA 2R0WH 4XH2B 5HHQB 5K9OB 4NUGH 2VLRA 4N8VB 5ANMA 2RAMA 4DEPB 5IJKC 1CQKA 4JM4L 3DRQA 2YA0A 4UZGA 1IAMA 1ERNA 1MHCB 5HVHC 1TVBB 4MDJA 1I7UB 3QEHA 3QDGE 5T3XD 2OCFD 5L8KB 2WNGA 4Y0GA 2CUHA 3C9NB 3FMGL 3LEVL 1A22B 2W07A 3RBGA 2VZOA 1LHZA 1NANH 1YY9D 5CHNA 3KYAA 3K8LA 5KS9B 4G80B 5BZDB 4HCRA 3FO9B 3IDNB 5CSZB 4GRWE 1EFXA 2AV7B 1NBYA 5GSVB 1JNLL 3MRIB 5E08H 2YK1L 5E5MA 3MCKB 4LCCB 3RDTA 1PKQA 2D9QB 4NQXA 1LVEA 5DRXA 1N4XH 4F8QA 2ZP0T 1AXSA 1DBML 3P4NB 4WTWA 3OL2A 4K3JH 1BQHG 1K5NA 1ZS8A 4PRPB 1FH5H 2X4PA 1V3MA 2XWBA 1CD1A 3MR9B 4I18C 2M26A 1Y0LB 1LO2L 3SY0B 1S7QB 4I0PA 4YDJB 2Z93A 5C09A 1HH9B 4M43L 1I8MA 2CGRH 2X4SA 3L3OA 4F7CA 3T0EE 1MCSA 4HIXH 5EA0H 4JGMA 4POUB 5EZLB 5JHDB 2BZDA 4TULH 2ESVD 4EOWH 1SBSH 4LCIL 3CFKB 5DD5H 1AR1D 1SEBA 3B6SA 5DQ9B 2VDPL 1TJIL 1UWGH 4EN3D 4PRDA 4KJYA 1EAJA 1ORSA 4I1NB 5ITBL 5GGRY 4G8GB 4LLWA 2NLJB 4LVOB 1QHPA 1ITBB 5CJXA 2R23B 3HUJE 4NZJA 2FJGA 5KSAA 3OR6B 4WJ5A 4MJ2A 5BZWA 4JQIL 1XR8B 3L3DA 4MWFA 3N85L 4J1UA 3QQ4B 3SJVD 1SHMA 3N0PB 3UTSE 1B0WA 1BZ9A 4IM8A 4Z7NE 1CQYA 2X09A 1P9MC 4P57B 4RNRB 3T08A 4X4YA 4YR6B 5GS3A 5HHXH 3L3HA 2Y72A 4GAYB 3RGVC 3VFPB 2DWEB 5T1MB 2F54A 4LKCB 5HHOD 4D9LL 1H5BB 5KVDH 4X4ME 5JR1H 3MRQA 2MJWA 1MAMH 5MEND 1FLRH 1KUMA 2Y6SC 4NQCA 5C0RH 2CDEA 5I9QC 2A9NH 2EDQA 3QP3A 3MFGB 3MNZA 4LAJH 43CAB 3TBWA 4K8RH 5IHUL 1UQSB 3Q1SH 4Y16C 4PY7B 5FYJD 2APBA 3S97C 4C57C 4GBXC 4ZDHA 1U36A 4N8PA 4BK4A 5T5NG 3MV9E 4H1LG 4LQ1A 5DHVH 4R4ND 1CLZL 4P4RB 4HWBH 3BH8B 3KPQA 3RUGF 2JE8A 1BEYH 1WQVT 4CADB 2IQ9H 4X6BB 1E4WH 4XB7A 4Y8AA 4NYLB 4OZFH 2VC2L 2K9UA 4R7DA 5MP6L 1I1CA 3CK0H 2NY0D 4HGWA 4KMQA 1BZQK 4WWKC 4OI9A 5HYIA 3T2OA 1N64L 4LF3B 3VFUB 5L6YH 5SWQB 1LEKB 4PTTA 1TXKA 3OKKB 3K4AA 4Y8DC 3MREA 4OCXL 1J8HA 2WBJD 1SVCP 5DURB 4RWHA 5E94B 3HR6A 1DQDL 3OGCA 1KN4L 1X6LA 2AK4A 4DKFH 4BZ1H 3QNXA 5A2FA 2VDRH 3U83A 5GGQL 4FNLL 4UT7L 1ND0A 4PG9A 1RK0A 3ALXA 1S9VB 4MNGE 4X6DF 5AAMA 4AT6B 2NY7H 5HGGS 4S1DC 2RJMA 2APFA 3QXWA 3S4SG 5IVXF 2PTVA 2R1XB 5EBMB 1QO3A 4I48B 4EI5C 1UCBL 4QRRD 4LSVH 2GY5A 5GGVH 3BI9X 5JO5A 3ARDA 4CVXA 4G42B 1P7KA 3FOLA 3HE6B 1IBGL 5E7FA 1R24B 4H5SB 5I1EH 4U1SB 4Z76B 1G6RA 2DYPD 43C9A 4KHTL 1AR2A 4MQSB 2WWKO 4HC1L 5HHMB 3WHXA 5I71B 5MEPB 2OZ4H 3BFOA 3BQUA 4ODWB 3OG6B 5C0AB 4ZAKB 5CD5D 4PJ9B 4JFPA 4K3HA 3ECBB 4BFGA 2AJYL 5C0JA 1DFBH 1RZGB 1MLCB 1ZV5A 4A6YH 3GGWB 4PLJD 2EO1A 5C0EA 2HKHL 4XNYL 3QDGB 1WUNT 5AYQA 2ICWI 5KSVB 1MCKA 1RZJC 1EEZA 1K8IB 4Y5YB 4Y5VA 5HGBA 1N6QH 1LO0H 2HVKB 3ZT7A 2AXFB 1FP5A 3MLXH 1KCUL 1IM9D 5SV3A 3FONA 2V17H 2ZUYA 3QEGH 3RU8H 3LN4A 1BIIA 3QH3A 3UO1L 1T1YB 2EYSB 3B8SA 2ATKB 1WEJH 4YHNB 1P5VA 5KZCD 4M48H 1F4AA 4R4FH 3TVMB 5AZ2L 3OJ2C 5F9DC 3WN5B 4JG0L 1Y6NR 4U6HB 5D2LF 1MH5B 3RL2B 2DLFH 1UB5A 2XFXA 3UJIH 1FL6B 1XH3A 4ZFOL 4HV8A 4CJ1A 1FGNL 2X9WA 4C4KT 3O45A 4Z7VE 2IALA 3MNVB 3LPWA 3TM6A 1I4FB 2FEEI 3GIVA 2ZUWA 5TQ2H 1NCDL 4IJ3C 5D5ME 1TZGH 1U3JA 1B4RA 1DLFL 3AC0A 3MOBL 3RWEA 1RFDL 1OARH 4DGVH 1XGTB 1DE4A 4K55A 3CSYB 1MRCH 3EUUA 1NGPH 1RY7B 4OTXH 1HIML 4R8WH 5HHVH 1UWEL 4WFGE 1QFWL 3O4OC 4EQ3A 1HWHB 5IWLC 3DSFL 3SBWA 1RIUH 5DRNB 5J1AB 4GUPA 1AQKL 1V8HA 2CMRL 4N0YH 1E4KC 3MV7E 3GIZL 3HUJB 4WENB 4MLSA 2YSSB 3QNYA 1MCLA 3MLWH 3MRMB 1G9NL 1JL8A 2G2RB 3WUWG 4KDTA 3D3VE 3FN0L 5GZOC 3ARBB 1EZVX 4I5BB 4XZUB 4ZS6C 3QDJB 2Q1EA 4NUJB 1CLOL 2GTWB 2VISB 4POZC 1GGCL 1BAFH 3BH9A 1UJ3A 3UTSB 2XI9A 2EXYD 2CLZB 4OFYD 1NBVH 4RDQG 1SJEA 3V5DA 1UM6L 5HHPB 3AXLB 4HWEL 4RGNE 3GMQB 4LSDA 4NN7C 4XAKD 4E5XA 3NCEB 5IB5B 4OIIL 3SCMA 2HA1A 4KI5D 4Q58C 4JQXC 3HZVB 3JUYA 1KJ2L 1PW3A 4R4BA 2XNAA 3S6CA 4JFDE 5C1MB 1S9WA 3PWJA 3I84A 4IIQA 4BM7A 4OD1H 4XT1C 2J5LB 1U6AH 2WWMD 3DXAD 3MV9B 1OM3H 1AGFB 2H32H 3RP1A 4K2UL 5DEFB 3KPLB 2BSTA 1KG0B 4D3CH 4E42A 1V3JA 2VXTL 4NOBA 4XCYA 2X89D 1FBIL 1DEDA 2AI0H 1OAZL 3GKWL 1KPUB 1KEML 5AUMA 3WHE1 1ZHNB 2AJSL 1XF2A 2IFFH 1H3WM 2DJSA 2X1QA 4P2QD 2CXGA 3ES6A 3O2VH 1DEEB 2J8UA 3RI5F 4Z95H 4M7KL 1ZKAA 3TP4A 1Q9KA 5CFHA 4XC1L 1F90L 1L7IL 5I19H 4OCWL 3MC0A 1MHEA 1N3NA 5HHMD 4FABL 3NACH 3SDAC 1I85A 1E28B 1NLDH 4MJID 3LOWA 1JNNH 5C0FA 5BO1L 3BOVA 3Q5YA 5C07E 3DX6A 1UENA 5C6PB 3V4VL 4OZFG 4R6UA 1OAKL 5JUEH 5DJXB 3NZHH 1J86A 4OF0A 2EE2A 4UOW1 5L0QC 3FB6A 4UTBH 2KKQA 3N1MC 2VTFA 3ZHDA 4V1DE 4XH2A 5HHQA 4N8VA 5LCVL 4E0RB 4LIQL 1RJLA 1MHCA 4FQPA 1TVBA 1DVFB 3LKSB 1I7UA 5FV1L 3WDIA 1QEWB 4ZTOH 1R3IH 4JO4H 2DQDL 2HWZH 1Q1JH 3FTGB 3E2HC 1L6XA 4RGOH 2EDXA 4AIXA 5CLWA 5KSUB 2FX9L 3PF2A 3QO1B 5KS9A 1UA6L 4G80A 5BZDA 5FYLL 1CDHA 3IS1X 4WWID 3IJHB 3FO9A 3IDNA 4U6VH 5A2IH 1JV5B 5CSZA 4YAQB 5GISH 4WHYH 1J1XH 1F4XL 4D94A 1KCSH 2AV7A 1MFNA 3O3AB 5GSVA 4G3YL 1CIUA 3QDME 5HDLA 4HXAL 4EI6B 1EHNA 3MRIA 3OPZL 2O5YL 3MCKA 4W4NA 4LCCA 3I2CL 1W0WB 2FWOB 4LVHC 2ZWLT 3GSUB 3U1SH 1NQBA 5FGBC 1LO3H 4Q6IC 2HTKD 3P4NA 4PJ8D 4FG6C 4F9PC 5GGTL 4PRPA 3SDXF 4IDLA 5GQBA 1K3IA 2EDWA 5E6IB 5CP3H 2JJSA 3MR9A 3FT2B 1Y0LA 3SY0A 1S7QA 4RFNC 4Y2DC 3LRGA 4YDJA 1HH9A 2VKXA 2VR9A 5CMAB 3CFCL 1UXWB 3ZLQC 5FHBH 5DSCB 2UUDK 2BMKB 5FYKU 2BNQB 5ESQB 1RUAH 3CLEL 1VEMA 5EZLA 3ARRA 5JHDA 3CFKA 4PGZA 3HC3L 2VXVH 4O51A 4EQ2A 1T1ZB 2VLJE 5DQ9A 4Z7VB 3H42L 5F3BB 4Z8FH 2DRUA 4LEOB 3E8UL 3VGBA 1KB5H 1AY1H 4G8GA 3WFDL 2NLJA 3QG6B 2R23A 2A74B 3ARBD 3TT3L 1JP5A 1AD0B 1A5FL 3L3JB 3D2UD 1MWAL 3OR6A 5C6TH 3BESR 2F5BL 1L0XA 1OTTC 1XR8A 5IVOA 3B9KC 4HPOL 4JR9H 4X8JB 4OGZA 1IAIL 1KELL 4XI5C 3EYSL 3DIFB 3QQ4A 3RKPA 3GJFH 4LGPB 4P57A 5LJYH 4RNRA 3KYMB 4YR6A 5IEHB 1CGSL 1FVDB 3MV7B 2AJ3B 4XVUC 4YUEH 1DTUA 2JJTC 4GAYA 3VFPA 2DWEA 5T1MA 2R2BB 4K7PX 4KK5D 3QI9B 4LKCA 4F9LA 1H5BA 4GFTB 3SGJC 1AGDB 2E7LA 1AO7D 2I24N 3F58L 5IW6B 2I9LB 2BY3A 5FF6B 1CYGA 1QQDB 1KC5H 3PJSB 2QADB 3VXUE 4P59L 43CAA 1TCMA 2IGFL 4GAJL 1UQSA 3WS6C 4PY7A 2OR9L 5LVEA 5EU5B 1QOKA 4G6KL 4RGNB 2GEEA 5E6ZA 4DVBB 5B3NA 3NVQA 4XVJL 4WI4A 4P4RA 1C5BH 3BH8A 1YEKH 2Y06L 3PWPE 1HHJA 3DMMD 3GHEH 4Q2ZB 4ODXB 4XTRD 4IRJC 4X6BA 1VEOA 4NYLA 1X5IA 4M7LH 5IBLD 3BGFB 4FQIL 4Q9RL 3VWJA 2M2DA 3VFUA 4LF3A 5D93C 3UX9B 5SWQA 1NC4B 1LEKA 3AMKA 3GBML 3OKKA 1PQZB 3ZKND 1V7ML 2OL3H 4L3EE 1F5WA 4U1LB 3S36X 1CZ8L 5DJAB 5E94A 3VFGL 1B4JL 4EIZC 4FS0A 1IQDB 1TJGH 4K71B 1U92B 5GZNC 1VCAA 3BHBB 1QSVA 2JTDA 5CEZL 1SJVA 3CXDH 2VR5A 1S9VA 1PX4A 4YZFE 4C56D 3OAYK 5CGMA 4D9RD 3PWLB 3K81A 2R1XA 5EBMA 4I48A 3ABZA 2YWYA 1HH6B 5F7DB 3AB0C 2C3XA 1BVKB 3VWKD 4NWUH 1WZ1H 3TA3C 5I1IH 3S98A 3O4LB 5IROA 4G42A 1J1PH 4NO3B 3HE6A 1KFAH 1R24A 4H5SA 4PRIE 3RTQB 4U1SA 4Z76A 5C07B 2OP4H 4PJGE 3VRJB 1NKRA 5K93A 4JO2H 4N0RA 1JYVA 1F2QA 3UZQA 4UQ3B 4EUPB 1RZJL 3MACL 4G6FD 1CD0A 4ODWA 2JELH 5C0AA 3IAQA 4P3DB 2J1KA 3UBXG 4ZAKA 5T1DH 1BFVL 4PJ9A 2DS4A 5B4MD 3WXWH 3ECBA 4F57L 4X4XB 1HEZB 2J8OA 2DI7A 1RZGA 3RA7H 1MLCA 4R7NB 3GGWA 5IFHL 3JSSA 3QDGA 3SDYH 5FYLE 5KSVA 1S9XB 1K8IA 4Y5YA 1IT9L 2E7BA 2OLDA 2ITCB 2NXYC 2WK2A 2OK0L 2HVKA 2AXFA 1MFEH 4ZG1A 5L7XL 3VXPB 1J1OL 1OAYH 5E6ID 5I76B 5E5UB 3CLFH 4I3RL 4HPYH 1F4HA 2YS4A 2PO6B 3KXFD 4QRSB 4YC2C 4PG2A 3SE9H 2Z4QB 1T1YA 2EYSA 1KT2B 5E2VH 3QDMB 1P6FA 2ATKA 4ZFZB 4YHNA 1IQWL 1N26A 2BNQD 3EO0B 2NX5E 3TVMA 1SMAA 3AM8C 3WN5A 3HI5H 2R9HD 5CJQH 4WEUD 2VLKE 3HNSL 2BSED 3FHAA 4MJ5B 4U6HA 1MH5A 3RL2A 4LPYA 1FCGA 3U7WL 3QJHB 1FL6A 5F8QC 2IAMB 1RHFA 1S7RB 3WNLA 5HGHB 3MNVA 2EH7L 4OM1L 1I4FA 1ZGLM 5GS1C 4XVSL 1WZLA 3J7HA 3PDDA 3ETBF 5DWUL 4ZFOB 3KLHC 5F6HJ 5JHLL 5BRZD 4FQCH 4MMXC 5F89B 1XGTA 5FYKL 3ARFB 1NCAH 3CSYA 3FN3A 4KMTH 5HGAB 4WHYG 3P0VH 4F15C 2K3TA 4NWTL 1E6JL 1MJUH 1MHHB 1LGVA 3VI4E 4ZOAA 2YXMA 5DRNA 5J1AA 3ARGD 1GPOL 3RVXC 1FNSL 1RK1B 3MOAH 3HUJA 1OF2B 5DRWB 4LHJB 2YSSA 5SX5H 3MRMA 1PSKL 2G2RA 1A8JH 3MCLH 4Z7UB 3D0VB 5JW4R 4OQTA 1IC5H 1N0XL 3V7AG 5I1JH 5I1HL 3ARBA 5I0ZA 4I5BA 4XZUA 2QJDA 3QDJA 4NUJA 2GTWA 1RJCA 3ZTNL 5D7SL 3DHJA 2DQUL 4M03A 5EOCL 3UTSA 2NR6C 4QTIH 2O93L 2CLZA 3H7LA 3SEPA 3VXRD 3RIFF 1TTGA 3UCRA 5SWZB 3V0VA 3LPFA 2YPVH 1MFCL 3AXLA 5HHPA 3GMQA 4X4MA 5IB5A 5J11C 3DECA 3IU4H 3D85B 4JRWA 4IRSB 4LARL 4P5TB 5HYSB 1MOEA 4L8DB 4MQ7B 3NGBC 5F7MC 3EO9L 1OOAA 3HZVA 2CKBL 2B1AH 3QDAA 3S35H 1EGJA 3CFEB 2IJ0C 3ZYJA 4KRNA 4Y4HB 1NUGA 3EJYC 3V4PH 5GRWA 1KJ2B 2NXZB 4HK0B 5EBLB 3ULSB 3H9ZA 4PJHE 3MV9A 1BFOB 4QXGL 3UJJH 1AGFA 3BKCL 4KUZL 1ZAGA 2J8UF 3PWPB 5DEFA 2R15A 3KPLA 2DBLL 4NQEE 3CFBB 1KG0A 1GXEA 4PJ7E 1HNFA 3WL9B 2LAAA 1C1EH 2WIMA 1CU4H 3M07A 1RUKL 1KPUA 1GIGH 1RZ8B 5DVLA 1ZHNA 4L5FH 1NGYB 5HPMB 4L3EB 3I02B 5DJ8B 4GS7C 3LZFH 1HHHB 2C1PB 4HMEA 2YZ8A 1YECH 1DEEA 1I1AD 2ORBH 4YDIH 1TTUA 1FRGH 4XP5H 3O4LD 4ZO7A 5DHYB 3F7YB 4J3XA 1GGIH 1NFDE 5FCSH 5I8CB 5M95B 2R0LL 3LMJL 4HUNB 2OMNA 1OW0C 2UZIL 1XIWB 5K9QI 2BK8A 4H8WH 5CSBA 1CFVL 6FABH 1E28A 1CN4A 1R5VB 3CSGA 1KCKA 1KV3A 1NAML 3QYCA 3WXVL 4P5MB 1OCWH 1OD9A 1NJ9B 4X9HA 4RAVB 2XY1A 4OF3A 1MQKH 3LQMA 2ZKHH 3N1PC 5DJXA 1Q0YH 3K8MA 4MD0B 3ZO0A 4WFED 1XR9B 2IH3B 2GYSA 4M93B 5KS9F 3PV6B 1DQML 1HKFA 4E0RA 3P11L 1BIHA 2I07B 5JW4N 4FA8A 4PJGB 5EC1B 5T33H 5BS0B 3I50H 4N5EC 1DVFA 4UIKL 1GHFH 3LKSA 5GGRB 5I8EB 4J3SA 3HZMB 1QEWA 3H3BC 3KJ6H 3QCVL 4UTAH 2XYCA 4WI3A 4ZTPH 3FTGA 3RWHB 4AMKH 3HFML 3NZ8B 5KSUA 1KEGL 1KTLB 3QO1A 3C2AH 3MTRA 4KKAC 4N8CL 3OKEB 3IJHA 1VFOA 3VGHA 1JV5A 3WD5L 3QIWD 1GRWA 4YAQA 2VO5A 1CGUA 1QBLH 3O3AA 4G6MH 2XKNB 4UT9H 4CVUA 4EI6A 4XNXH 3EYUL 4UBDC 3L7EB 4PP1D 1W0WA 2FWOA 2Q8AL 3GSUA 4I3SH 2IAMD 4JFHD 1KTDB 1O7SA 2CH8A 2Q87A 4ESKA 2DQEH 4XX1E 5E6IA 3LB6C 3OAUH 4PD4K 5LAXB 3FT2A 5AZEL 2CRZA 4WI6A 4U05A 1A7OL 5CMAA 2APXA 2DTMH 5D72L 1BGXL 1CDCA 5DSCA 4HG4J 2BMKA 3GM0A 5DI8B 2BNQA 2VLKB 5ESQA 4CN1A 5ISZB 3S34L 4NBZB 2NY4D 1JE6A 2F19H 3HAEH 4K23L 4XAWL 3UZEA 3ZDXE 2D7NA 4UT6H 3CIQA 1T1ZA 5F3BA 4Z7VA 4LEOA 1V05A 3QG6A 3ZE2E 3S96A 5JXEA 3NN8B 2A74A 5CCKH 4OZIE 1FYTE 2XWTB 5H94B 1AD0A 4TNWK 5CEYB 5IVZB 4ODHH 3QAZC 3L3JA 5CINL 4JRYB 4LQFL 2GSGB 4M9PA 3HLAB 5T3ZE 1J0YA 3IDIA 3RGVB 4X8JA 1MWAB 3MRDB 5SWZD 3DIFA 1UC6A 3HI6H 1QSZA 5E6YA 3UPAA 3PABA 3JZ7A 4ENED 3GK8L 3KYMA 5IEHA 5JW3L 2QQQA 1FVDA 2R29L 3MV7A 4FFWC 1YEFL 2AJ3A 2Q8BH 4XCCH 1X5ZA 1ZTXL 5KVEL 2R2BA 1DCLA 3QI9A 4P9ML 4Y16B 2K7QA 3RWCB 5F9AC 4YX2L 1AGDA 4GBXB 1T2QH 5IW6A 2GK2A 2I9LA 5FF6A 1QQDA 4Y4HD 5TDNA 3PJSA 1PLGH 3L5XH 3B5GA 5JLZB 1XCTB 3NIGF 1KPRB 3CFIC 1J0IA 1CVSC 1U8PB 2HFGL 4KI5F 5E24E 1KJ3H 4BFIB 5EU5A 5ICXB 1R3HB 4WWKB 4JG1L 1WLHA 4PJAE 4DVBA 4S2SB 2B39A 2B20A 3O0RL 4Q2ZA 3VI3E 2ZUQC 4ODXA 3K0WA 4DQOL 3GSRB 1U3HD 4HUUB 5IVNA 4N5UA 2BY0A 2FATH 4XP6H 5FGCE 1OTSC 3BEWB 1NC4A 1UH2A 2MFNA 3ZSSA 3ZYZA 3RKDD 1PQZA 1A7QL 1BJ1J 5DD6B 1EVTC 1SQ2N 4PJHB 5BVPH 5JDSB 4PYHA 4QYOB 3CFJB 5E95B 5FECB 1ZLWH 5DJAA 3VFRB 4LGSB 3GSQB 4ETYA 1XIWD 1A7RH 4NQEB 4C55A 1CICC 4PJ7B 3FHQA 5CZVH 3M1BA 1B0RB 1IQDA 2RB8A 1U92A 1M71B 4YHYC 3W9DB 3BHBA 1FZMB 4YGVB 3BSZH 4EI5B 1LWRA 5HPOA 1G9MH 3SGKC 1I7RB 4G6JH 1YEJH 3PWLA 5HDQL 4L9LC 2AABL 5C0ND 1T04B 4OKDA 3QQ9D 1HH6A 5F7DA 1NFDB 5K9JL 5IMOB 1BVKA 1RVFH 4HKBB 5BS0D 3O4LA 1G7IB 3VG9C 4TSAH 1H0DB 4HW6A 4NO3A 2EDJA 3RTQA 5C07A 3T04D 2C4XA 5E56A 2B5IC 1ES0B 3AAZB 4UQ3A 4EUPA 1CE1H 1PDKA 3EDKA 4G7VL 5CJ8A 5E8NB 4P3DA 3C5ZB 4HC1A 3DLQR 2FCBA 3LH2H 5DMIH 4ZFGL 3VA2C 1U8OB 1KXQE 2RBLA 3GSOB 1SY6L 4J3TA 4X4XA 3P40A 1HEZA 4OLUL 2FECI 1B6DA 4KJPD 4YK4B 4QY8B 4R7NA 1U8NB 3QWRD 3MV8E 1NGWB 4OGXH 5DD3H 3QHZH 3JTTB 4U2ZA 4ZSOE 4MS8D 1MPAH 1AHWC 1S9XA 4FZEL 1I9JH 4WV1C 1ZXQA 2XZAL 3BKML 3VW3H 2ITCA 2DN7A 4NT6B 3E3QC 2ENYA 4KK8C 3QUZC 2K1MA 4FTVD 3VXPA 5DO2D 1Z5LB 2N56A 5I76A 1Z6JT 1OGAD 4BSVB 5EORL 2FD6H 3MOQA 2I5YL 2PO6A 2ICCA 4QRSA 3REVB 2Z4QA 2XKSA 3N9GL 2Z31C 4TYUA 1KT2A 2VDOH 3QDMA 4IMKC 1JPFB 1J9CT 2V5MA 4ZFZA 3R1GL 3EO0A 1EEUA 3UZVB 3JXAA 1R0AL 1Q94B 3THML 5B3JF 4IJ3B 2EH8H 5E4IA 5CGYD 4MJ5A 4NM4H 3QJHA 5BVJB 4WI2A 2IAMA 1S7RA 5HGHA 3UPCA 4RBPK 1AE6H 2XTJC 3PV7A 3WNNA 3O4OB 4DUVA 1N5YL 4ZFOA 2IBBA 3PXHA 3WFEL 4JRYD 5CILL 5D71L 1MRFH 2H2SD 3S3JA 3IB4A 5F89A 3ARFA 4O9HH 5HGAA 2X1XR 4ZPTB 5JA8B 1MHHA 3DPBA 1YNLH 4MXQD 4JZJC 4YFEA 1YEHL 3MGAA 4L4VE 1GGTA 3PL6C 1KOAA 3IRPX 3P2TA 5I18H 1LK3L 2Y07H 1MY5A 1RK1A 5TE7L 1OF2A 1FYTB 5DRWA 2R4RH 4U3XA 3UTPD 1CBVL 5EDXA 5I75C 4G43B 1U8IB 4Z7UA 3D0VA 3QJFB 1QYGL 5TFSH 4YXHH 1QFOA 4GRWH 1ZT4B 1ZT1B 3B4NA 5TDOB 1BF8A 4NN7B 4NQVB 2ZPKH 4N8VG 1SJHB 3O6LH 2DQGL 1U3ZA 4XVTH 5JMOC 2YBRB 3ILQD 5SWZA 1OD7A 1II4E 1KCRH 1FDLH 1MLBB 3WO4C 3BRGC 4GQPH 4WY7H 3H9SE 3D85A 2JB6B 4IRSA 4P5TA 3GB7B 5HYSA 1OTUC 4MQ7A 4L8DA 4Y4FD 2B4CH 3CH8A 4MXWH 3CFEA 4XBEL 4L8SC 4Y4HA 1HOCB 1IKFL 1OAQH 3BKYH 2CKBB 3BPOB 2NY5H 4IHOB 2XA8L 1A47A 1VEPA 1KJ2A 4HK0A 5EBLA 3ULSA 1HYSC 2XTLA 5AWNH 1BFOA 1RJZB 3V79C 3AS1A 4OFKA 2B8OT 3TJHC 5C9KA 3U9UB 3PWPA 4QHNB 1XGYL 3CVHL 2CDGA 2JB5H 1UVQB 5TE4H 3CFBA 3MCG1 3WL9A 3TN0C 2WLYA 5IQ7H 1J12A 4QRPB 4QXTB 4YHZL 3U4AA 3KPTA 5FGCB 4F37K 2CKNA 3UAJD 1A4JB 2J8HA 4YHOH 1RZ8A 2D4FA 3EOTH 1NGYA 1EO8L 4OFVA 5HPMA 2IAND 4L3EA 3I02A 5DJ8A 5IT2L 1HHHA 4OQTH 1PX3A 3OF6D 1U58B 2DQIH 3SDAB 1T80A 5I15L 4NBXB 1BQLH 1FORL 4U6TA 1JVKA 5F8RC 1X4ZA 2Y36H 4RA3A 5DHYA 3F7YA 4KTEH 5I8CA 1JRHL 3MLVH 4H0GA 2Q6WB 1IGCH 2OYPA 1XIWA 5L0QB 1WWAX 3W0WD 2DM4A 1R5VA 4XPBL 5LBSH 3WJLA 4EEEA 5KW9H 5EUOE 4P5MA 1NJ9A 3C5ZD 1JHKH 5IJKA 1NCCL 4RAVA 2B0SH 5B22A 3B83A 2EDLA 1QD0A 3UYPA 4D9QD 3HMWH 4P46D 1NAMB 1MCPL 1A6AB 1JUFB 2HH0H 1JTPA 2VWEC 4MD0A 1XR9A 3NTCL 2HT4D 2IH3A 5DVOA 1VGEH 1S8DB 3K2UL 5FGSA 5KVFH 4H88H 3PUCA 3PV6A 2LE9A 1X5AA 1INDH 2JJWA 3E2HB 2I07A 4O4YH 5A2LH 4PJGA 5EC1A 4KJQC 5BS0A 5HHNB 1WJ3A 5F96L 1FIGL 1H9VA 5GGRA 4D2NA 5I8EA 5HI4C 3O6FC 2WANA 3HZMA 3O8XC 4UDTB 1ONQB 1EBAA 4N90D 4UAOC 3V0AC 3RWHA 3TPKA 3LSOB 3NZ8A 5DZNA 4JPWH 1DQJB 3ZKMC 3MRRB 5GRUL 3O2DL 4LVHB 3OKEA 3JWOC 4ZOEA 1ZGLP 2HTLD 4Q6IB 4FQXC 3L3KB 4ZSOB 3VDBA 1M05B 2XKNA 5C86A 4ZNCD 2ZCLH 3LQAH 1UM5L 3L7EA 3GNML 1RZ7H 3ARXA 4U4BA 4RFNB 2NZ9D 4Y2DB 4MA1C 3EFDH 4OIAA 1T3FB 2NTSP 1KTDA 4RX4D 3IDXH 5GRYA 3U4BL 4FQ1L 2GKIA 5CJXC 5LAXA 4Z7VF 3WIHH 3SN6N 4JM2D 4C4KO 3V4UL 5GRXG 1BVLB 5GGTA 2ADGB 1HCVA 1E4XL 2J4WL 2W9DH 4MA3B 1K85A 5EZOL 5C8JB 1LMKA 4OGYH 1AH1A 2DQHH 4XPHL 1WBZB 5FCUH 5DI8A 2VLKA 1CDJA 5ISZA 1FNFA 3D25B 4OIBA 2W65B 3VXME 3S3PA 1PGRB 2P43B 4TUOB 4JM4H 1JK8B 1WWCA 2WLZA 1GL4B 1KLUB 4WFFD 1QBAA 3WO3B 1JMXA 2XN9D 3B9KB 3QUXD 4UV7L 4HEME 3NN8A 2XWTA 5H94A 4HIJB 3LEVH 3MUZ1 3HCVB 2DQTL 5IVZA 5CEYA 1BOGB 3ULVC 3UTZB 4JRYA 2GSGA 3T2NL 1BD2E 1NCTA 3HLAA 1UGNA 4FN0A 4AQ1B 3RGVA 3DUUB 1MWAA 3MRDA 1WZMA 5D7JD 4XRCB 3MUY1 4XHJD 3I6LD 3QEUB 4OAWB 4GAFB 1JNLH 5F44A 2QR0B 2JF1A 5IP4A 2YK1H 1RU9L 3FT4B 4ELKB 4Y16A 4PR5B 3ZZ1A 3RWCA 3FQXB 2GJ6D 4GBXA 2IH1B 2MKLC 4HBCL 5SX4H 1DBMH 2BP3A 2X9YA 2W9LA 5JLZA 3JV6B 3RNQA 1XCTA 4MCYB 4IRJB 1U8PA 4DKEH 4ZOCA 3P4LA 1ACYL 4BFIA 1A3RH 1R3HA 5ICXA 4WWKA 3WIIL 4K3DL 5D93B 4S2SA 4OJFL 3A0OA 2PCPB 4QRPD 4MQXD 2M1KA 5MHSE 1J88A 3QXTA 3MO1B 1SYSB 2UY6A 3R8BB 1XGRB 2IMNA 3GSRA 4LCIH 4MJ6B 4E41D 3MSPA 1HDMB 4HUUA 4GH7B 2PYEE 5SX4I 1TJIH 3BEWA 5ITBH 4WFHD 3MRNB 2G75B 5DD6A 3PNWB 1QRNE 4PJHA 5C0CB 4LASL 1N8ZB 5JDSA 4QYOA 3CFJA 5FECA 5J57B 3SDDC 3VFRA 3GSQA 4P4KC 4LLMB 1DJSA 4YHPB 4LHUD 4NQEA 1L0QA 3BPLC 4PJ7A 4GMTL 1B0RA 1Z0NA 3QZWB 1XCQB 2BSSB 1MY7A 3W9DA 1FZMA 3BDYH 4YGVA 3U36B 4EI5A 8CGTA 4NO0B 4HWNA 1OVZA 4UINL 1ZEAH 2F5AL 3TA3B 4HQQH 5FUOL 2V7NB 1Q72H 1I7RA 1I7TA 1MIEL 3RJDA 3ROOB 2HT2D 4ELME 1UEMA 2EYRB 4D9LH 1T04A 1HE7A 1NFDA 4WUKL 5IMOA 5DK2B 4HKBA 1KBGL 4KAQL 3OXRB 1G7IA 1FL5B 1H0DA 3JWDC 2IWGA 4PFEA 3P30H 4DOHB 5EUOB 1A4KB 4S1QL 2GJZB 3SE8L 3A6OA 3ISWA 3ME0A 4TQEL 1ES0A 4ZO8A 4HKJB 3AAZA 4RWYL 5J1SC 5C71A 1X7QB 4I77L 3ZE0F 5E8NA 5MI0C 3C5ZA 1YY9C 3SGEH 5IBUB 3RZCD 4PY8J 1FZOB 4Y89A 1U8OA 4ODSL 3GSOA 4I0CC 4PLKD 1CXLA 5MP6H 4ETQB 2NXYB 4K3EL 2A6DB 4QY8A 1U8NA 3LY6A 2ED8A 2MPAL 1BP3B 3CVIL 3JTTA 5C08E 1P2CB 4GG6E 3FFCB 4OCXH 1ZA6B 4G5ZL 3VXSD 1S3KH 4AEIH 4YC2B 4UNTA 1Q38A 4NT6A 1ITCA 4LRIC 1KIRB 3RIAK 2XOTA 1VENA 1DQDH 2YWZA 1Z5LA 5IF0B 3KPRE 4BSVA 2NNAB 5GGQH 1UACL 4UT7H 2A2QT 2COQA 3REVA 5F97E 2O5ZL 5DQJB 4Y1AD 4JDTL 1JPFA 4RRPA 4NDMB 3DWTA 1Q94A 5GS1B 4DN4L 4F7MB 5GS0H 4XP1H 5CBEB 4YXKH 4X99B 3B9VA 1AR1C 5D2NC 5TGBB 1RMFL 5BVJA 4LSQL 1IGFL 2HRPH 1IBGH 1XF3B 4F15B 5DYOB 4EN3C 2AQ2A 2VABB 4KHTH 1DDHA 2F53E 2O5XL 3RVVD 3B2VL 4HC1H 3P73B 5IWLA 5E2JA 1TQBC 3ZYOA 1OLZA 4XVUD 1IEAB 1PG7X 1JZ7A 1ZVSB 2BXZA 4YXLH 4ZPTA 4Z7UF 3VXMB 1E4KA 2E5EA 2GQHA 2AJYH 4QF1B 1CFSA 2OQJB 2XY2A 5TE6L 5GRJL 1AKJD 2AQ3A 4B7IA 4LLDB 4XPFL 1DQLL 1JZ5A 1T6WA 5LGJB 4OZGB 4NNXB 1EO5A 3SQBA 1OY3B 2BSRB 1FYTA 1MIML 4LFHD 4EBQH 1Z9LA 4G43A 1U8IA 3DO3A 1U8MB 3Q3GB 3QJFA 2W0KA 4YQXL 5HBBA 1KCUH 1ZT4A 4ODVH 3SKUD 4F7EB 4XCEB 4IIQC 3OKMB 4IRJD 5TDOA 4NQVA 1SJHA 3MBED 1AXIB 5J11B 3G6AB 5ABDE 2AERT 2YBRA 3NGBB 1J0KA 1L7TL 4JQXA 5DS8B 5I1KL 1J8KA 3UTTE 2MHAB 2E9IA 1IAOB 4R4NC 4TVPL 5AZ2H 1MLBA 4LDLB 1T7WA 2X70B 5CBAB 3ZE1F 2JB6A 3GB7A 4LSTH 1T2JA 1MI5D 1FJ1B 2NY0C 2E9BA 1HNGA 1JWSB 3S3SA 1FGNH 3MNWB 5C0CD 2EDRA 1HOCA 4X6DE 5CJOH 3EYQD 2CKBA 4KU1A 4IHOA 1F4WL 2WBJC 3SDCB 2GHWB 4U1HB 3MOBH 2FGZA 1RFDH 1RJZA 5IVXE 2EIBA 3U9UA 4QHNA 4GS7B 1UVQA 5IW1B 1CL7L 1MJJB 4NKDB 3DNKA 4N0FB 4NO0D 1UWEH 2P42B 2Q7YB 4P2OD 2LQRA 2MCPL 2VKWA 1CD8A 1F8TH 4QRPA 4QXTA 3CVHB 3DSFH 4URTB 3QISA 4KKCD 3MJ9H 1A4JA 3F6IA 3QHTC 1MEXL 5F7LB 4RAHA 1QRNB 5ERWB 4FQLL 3GIZH 2CK0L 1U58A 2D03L 3SDAA 4Z7QE 2APWA 3FN0H 1GAFH 5D7LD 3ZMRA 3RWDB 5DGQA 1Q0XH 1YQVH 4Q9QL 2CRIA 3Q6FB 1CLOH 4Q0XL 2Q6WA 4AL8L 1XGQB 4Z77B 4PJGF 2A6IB 3R0NA 1P4LB 1HXYB 3BAEH 1JTOA 2ERJC 2IPUG 1UM6H 4ELMB 2FGWL 4HWEH 2RHEA 4R3SB 1NAMA 3T4AA 5DUBB 1A6AA 1JUFA 2E8ZA 2JJUA 4UUJB 5CD5C 4OIIH 3SO3C 2KZWA 1S8DA 4PJIB 3BGMB 1OP9A 2QV2A 3PGFL 4WFGD 2F15A 4LLQB 1FGVL 1F11B 2A73B 4YO0B 3FFCD 2D4DA 4IEFB 3JWOL 1FPTL 1C5DB 1AP2B 3E3QE 4PLJC 4LCCC 5HHNA 3T3ME 3TGXA 4UMGA 3S7GA 5CKGA 4GOSA 1DBBL 4M5ZL 1ONQA 3OHXB 1NC2B 4UDTA 1JPSH 2D7TH 3D0LB 2YEZB 5A2JH 3DURB 3D3VD 3DYPA 3LSOA 4BQCA 1DQJA 4AG4H 2VXTH 5IM7B 1FBIH 1A9EB 1IC7L 5BV7C 5FGBA 4DAGL 4HKXB 4Q6IA 3WIFB 4FQ2L 3VE0B 3L3KA 2AJSH 4ZSOA 1YNTB 3S5LB 4F9PA 4GG6B 4APQD 2EXWD 1M05A 4NZDA 4UV4L 4JFFB 4BQ6A 2XTJE 4LRNL 3PGCB 2BRRL 4M7KH 3PE9A 4Y2DA 3QQ3B 1Z9MA 1F90H 1T3FA 1L7IH 3KPRB 5KANG 4DGYL 4OCWH 4YBLB 5J12C 4ALAH 1S5IH 2GT9B 3TO4D 5FOBB 2D7OA 4FABH 3VD9A 2WIIB 3GSNL 2R2EB 1BVLA 3LKNA 5BO1H 3CX5J 5JQ6L 2ADGA 4R2GD 3V4VH 4MA3A 1OAKH 1S7WB 4XBGB 2EEAA 1WT5C 5C8JA 4KZEL 3OAZK 4ZD3H 5TPWL 1KYOJ 1WBZA 3ULVL 4OLZH 3D25A 4L29B 2OMBA 2W65A 1EIBA 4XCFH 3PP3H 3B9AA 1O5DT 1DN0B 5D1QD 4XP9H 5LCVH 4TUOA 1JK8A 4XMKL 3QAZB 1FNGB 2OXGA 3Q5TA 2YD9A 4U0RC 1KLUA 5HYEA 2IEPA 3BP6B 1QUNA 2AKRB 3B9KA 1TNMA 3LS5L 3RL1B 4P48A 4OF5A 5FYJU 1EMTL 3GSWB 1FAKT 1T6VN 4HIJA 3HCVA 1F4YL 4KRLB 1BOGA 5CIPB 1NGXB 2VDKL 3HC4L 4M3JA 3RHWK 5LWYL 2JJTA 1FVEB 1AI1L 5FYLH 3VD7A 3IDUA 3SO5A 4TN9A 2EXYC 4M8VA 2R56H 3SGJA 1U41A 3QEUA 5GS0D 2DAVA 2EE6A 4OAWA 3GSVB 4NHCL 4G3YH 4W81A 4HXAH 2QR0A 3OPZH 4NKQB 4P99A 3WHE0 3FT4A 4EUPG 4ELKA 3WS6A 4PR5A 4R96B 2VZ1A 3FQXA 2IH1A 4JB9L 4KI5C 3BP5B 1QSEE 4UILL 4X80H 1U42A 3IFLL 4TVPE 4OM0L 5EWIH 2DB8A 2K7PA 3SDCD 1VFMA 3JV6A 1CLYL 1OSPL 2ZUQB 4MCYA 4IRJA 2VZSA 2VDLL 4OBSA 2WWMC 5D1XD 1P7QB 2LU3A 3UTTB 5T1LB 4PJHF 3CFCH 2BNRB 4PV9B 1C08B 2BJML 3VJ6B 3G5YB 2PCPA 4M00A 2C3HA 3H9SA 3BDBA 5KVMC 4HWUA 3MO1A 1SYSA 4UOW0 1XGRA 4PJ7F 2XWJB 1RPQA 2R0KL 1S5HB 4MJ6A 4DN3L 3BMWA 1HDMA 3I6KB 2VLRE 5ANME 4NRZB 5AG9A 1U91B 3H42H 1JMZA 4M61B 4RIRB 1CICB 4X6DB 3TCXA 2YD6A 4ZFFB 3MRNA 2G75A 3PNWA 4YHYB 5C0CA 1N8ZA 4Z0BH 4XNUL 3O9WD 2CR6A 3DX8B 1QRKA 1U8LB 5KTEH 4TTGA 1UFUA 4LLMA 5H2BB 2F5BH 3BN9D 1NFDF 5ALCL 3QZWA 4XBPB 3EDEA 1XCQA 2BSSA 1ZE3C 4L9LB 2DKMA 3U36A 4XMLL 4PRNB 3JWDL 2VWEE 3EYSH 4NO0A 5HI3D 4NFBA 4HGKC 4IBLT 4QHKJ 5DFVD 2BVPB 3TA3A 3DHMA 5B39B 2V7NA 1CGSH 5T3XL 3U9PL 3VG9B 3VGAC 5DD1H 3ROOA 3EOAB 3GI9L 3UC0L 1D6VH 2C4FT 1FFRA 2EYRA 4F58H 3QCTL 4X4ZA 2FLBT 3M8OH 2B5IB 5DK2A 4NNPL 3F58H 4KKBD 4M1CD 5INDB 1FL5A 1HQ4B 2VLJD 4X5XB 1EV2E 4EVNB 5EUOA 1A4KA 2OR9H 5SWSB 5GJTL 2GJZA 1RUPL 4JHBA 4P23B 5I8OH 1DQQB 4G6KH 4HKJA 1W72L 1EXUB 1A3LL 1FO0L 1X7QA 3IRZA 4XVJH 3G9AB 4QNPF 3O2WH 5F1KC 3G9VA 4FFYH 3UP1A 1B88A 2FEDD 1FZOA 3PHOB 3X13B 4PG2C 3F12B 2EIEA 1AHWB 4WV1B 4ETQA 4JFED 3SDXE 2A6DA 3IXAB 3V52H 4FQIH 3QUZB 3TYFB 2DIJA 1SY6A 2Z8SA 3QSKB 3GBMH 2QQLL 1P2CA 4JFFD 1R3KA 3FFCA 4KFZC 1ZA6A 4N68A 1HILB 1OAUH 5EG6C 5KVGL 5E9DD 2ID5A 5GGUB 4F33A 5T1KB 1KIRA 2Z31B 1RIHH 3QG7L 5F6IC 4HJGB 4YHLL 1WC7B 2HTKC 1MF2L 4PJ8C 5IF0A 5L2KB 5ID0B 3MA9H 1YMME 2NNAA 4NC1C 2UWEE 1MAKA 3CSBA 4MCZA 5DQJA 1LDPH 5GRZA 2ICES 4WUUD 4ZYKA 4JPKL 4LSUH 4NDMA 5IQ9B 2OS7A 4GAGL 2DM3A 1AD9B 1BLNB 3D5OF 3OV6A 4JM2F 2XTJB 5GS1A 2F54E 4F7MA 4QXUL 4RISH 1JHTB 5CBEA 5A3ID 5E4EC 3X3FL 4X99A 4MHHG 5TGBA 3DX9B 1XF3A 1D9KD 4H0HB 5DYOA 2VABA 4X98B 1P4IL 3RWJB 3P73A 1YJDH 5I30L 4JZJB 1S7TB 4O00A 3ZE2F 1RZJH 4KGJA 3ARBC 3PL6B 2IPTL 1IEAA 4HUXB 1ZVSA 1EJOH 1UG9A 1YYLH 3VXMA 3KPMB 3V6FB 2NY1B 4IOIA 4KRPD 5E7BA 3HRPA 1MFDH 4QF1A 1VADB 1AFVL 3O6KH 3S37L 5I75B 2HKFL 2OQJA 1NGQH 1RAMA 3MFFB 4LLDA 3WFBL 1VACB 3CC5B 5FYJL 5GGSB 5LGJA 1YEGL 4OZGA 1D5IH 4NNXA 2BSRA 3CDGB 1IT9H 3R0MA 4KQ4H 1BBDL 1J8HE 4C54A 4KK5C 4HT1L 5GIRB 2DOCA 2W9EL 1MSPA 4JLRB 3Q3GA 1U8MA 3QEQB 1J1OH 3NBNA 4S0SD 3KPSE 4PGBB 4XCEA 3OKMA 3ZL4L 2J5LC 1E6OL 3WO4B 4TNWF 3NH7H 4PYGA 1KLFA 4OCMC 3G6AA 3HI1B 2Z8VC 4KZDH 1TJHH 3N1GC 2NW3B 5DS8A 3VFNB 1GH7A 5C7XL 5HYJB 1FLTX 2MHAA 1JFQL 1IAOA 3BZDA 3C5JB 3DMMC 4XTRC 3BYTA 2X70A 5CBAA 3D39E 1QSEB 5AAWA 3HNSH 4KC3B 5IBLC 4AK1A 1FJ1A 4WDIB 1MCIA 4I2XB 3U7WH 7CGTA 1JWSA 3MNWA 5HXMA 1IC4H 3ZKNC 4XVSH 2ZG1A 3JV0A 3TN0B 5F1IB 3K46A 5DWUH 2BHYA 3SDCA 5HGDB 4U1HA 5JHLH 3CXHK 5IV2B 1X3DA 4KTYA 1MVFA 2L0DA 3AU1B 4NWTH 1E6JH 5IW1A 3HHRB 1MJJA 1UB6B 3ALPA 4N0FA 5EBWB 2Q7YA 4NOFA 5AG8A 4JPIB 2P5EB 3CVHA 1AQDB 3DROB 3NCJH 2VH5H 1EHLL 1X9QA 2KBGA 2VSCA 1QRNA 3EDFA 3OKYA 1OW0A 5ERWA 1FNSH 5T3ZH 3NCYS 4JRXD 2Z9TA 2FBOJ 4LLYB 1G7PB 5A43C 1A6UH 1N0XH 3VWKC 5T3XE 4X5LA 2DQJL 1ZLSH 3RWDA 3Q6FA 3CFDB 3UROR 5SWSD 4MAUL 3GRWL 2DQUH 4P23D 3U2SB 5HDBE 1XGQA 3ULUD 4Z77A 4PRBB 2CUIA 2I60L 1H15B 1P4LA 1HXYA 3STLA 3V5KB 3KYKL 4ELMA 1MFCH 1JYXA 4R3SA 5DUBA 4DJMA 4UUJA 2YN5A 4EJ1C 5B4MC 2X2YA 3BGMA 3O6FB 4PB0L 3O8XB 2YXFA 2EDTA 3EO9H 2CKBH 4LLQA 5EB9A 1F11A 4KKNA 2A73A 4YO0A 4UAOB 3OKOB 1V7NH 1C5DA 5DR5L 1AP2A 2AXGB 5BV7L 1JJUA 3RVTD 4M5YH 2R0WL 1FHGA 1X5KA 4MA8L 1SEQL 2AEIT 2AGJH 5JZ7D 3OHXA 2A1WH 1NC2A 5C70A 3D0LA 4FQXB 1PEWA 3DURA 2KL6A 5E6IC 2DBLH 1HINH 4JEGB 1D5BB 1U9KA 3SDXB 5IM7A 4L4JA 4GT7A 1A9EA 4OV6F 4MA1B 4EIGB 3QCUH 4HKXA 4NJ9H 5EO1B 3I9GL 5C08A 3WIFA 2ESVE 3VE0A 4GG6A 1YNTA 3S5LA 5IR1B 3O2DA 4XNMB 4C83B 1L0YA 4CDGC 5D2NE 3QO0B 5C0GB 2H6PB 1WBYB 4OUOA 1QR4A 4K94C 4JFFA 1QSFD 2R9HC 3PGCA 3UMTA 4OI8A 3KPRA 1YMMB 1YQ2A 2R0LH 5E08L 3LMJH 4F2MB 1RV6X 3RAJL 2GT9A 5FOBA 2UZIH 2UWEB 4LSSL 2WIIA 3NCFB 1CFVH 2R2EA 1N4XL 2V2XB 3OJVC 5EZIL 3QT2A 4ZS7H 5J1TC 4NZRH 4OFPA 3I85A 4K3JL 3GSNB 1FH5L 1S7WA 4XBGA 2NY1D 4XNZC 3SJVE 3SPVB 3W9EB 4KRMB 1MCNA 5F7UA 4X83A 4Z0XB 4G6AD 4L29A 2WQRA 4DW2H 1WFNA 1UADC 2CGRL 1DN0A 5D96B 1DQMH 5CZKA 5HHOE 4P2RB 2W92A 3P11H 4HIXL 1FNGA 1P84J 3GMMB 2VDML 3BP6A 1UJTA 3ARGC 1OP3H 4TULL 4EOWL 5MENE 1SBSL 2R69H 4UIKH 3M17B 1DUYB 4YBQD 5DD5L 3QEQD 3RL1A 4O5LL 3GSWA 1H8SA 2ZOLB 5FYJE 4DKDC 4OFDA 5CIPA 1NGXA 2ZSVB 5JPNB 1CGTA 1FVEA 1RHHB 4CBPA 1OSZB 2LFGA 1J5OH 4YPJA 3IKCB 3WD5H 5HYJD 2VL4A 4NPYB 2WZPD 3V0WH 3GSVA 4JO3H 5I6XC 3D18B 3K80A 4HXBH 5I74C 4IRZH 5E8DH 2Q8AH 4R96A 1U93B 3TJHD 2YD1A 2NCMA 4WW2B 3KPSB 1VFBB 3BP5A 5EU6D 2PF6A 4XPAH 2WBWB 1XGUB 4Q9CA 5J56B 5JR1L 5AZEH 1MAML 1FLRL 1P7QA 2A9NL 3HG1D 3UTTA 1TTFA 1NLBL 3D1MC 5T1LA 2RQ8A 2BNRA 4PV9A 1BGXH 1C08A 3VJ6A 3G5YA 2R39A 4OD3H 1NDGB 2R8SH 3Q1SL 3D39B 1S7SB 7FABL 3U0WL 3LD8C 4OCSL 3PWVB 3U4EB 2XWJA 1S5HA 4ZO9A 1SJXA 3SDDB 3RNKB 3I6KA 1CF8L 1DBKH 5LXGH 3FO0L 4NRZA 4OB5H 4P4KB 5I8KH 1U91A 4D0DB 4QRRE 1N59B 4M61A 4RIRA 1BEYL 1CICA 4X6DA 3SQOL 3BPLB 2YD4A 3I3EA 2IQ9L 1E4WL 4ZFFA 4YH6A 3CK0L 1I1AC 4TSCL 3HA0A 4OCYL 2QEJA 3QWOB 3LKPB 3TPUB 3DX8A 4PP2B 3GMNB 1U8LA 1J0HA 5H2BA 4JVWA 1MCBA 5ALBH 1EERB 3SGKA 3C6SB 1FNHA 1YNKH 2E8YA 4XBPA 1G7MB 4O58H 2P45B 4L9LA 2CJUL 4XX1G 1JIBA 4PRNA 4HSQA 3S9DB 2PXYD 4DKFL 2MCG1 2QSVA 2BVPA 5EUOF 5B39A 2R29H 1NCWL 2V5TA 1YEFH 1A3QA 3EOAA 4LKXB 3WFHB 5KVEH 1FNAA 1UKQA 4P9MH 2CLRB 2NY7L 4YFLI 3R06B 3QA3B 5D1ZD 3IJSB 2OTUB 5INDA 1S7VB 5MI0B 1HQ4A 4WGVB 4X5XA 3B9EA 3IDMB 3DV6B 4EVNA 1FFOB 2YKLL 5SWSA 4JANB 5IHLB 4P23A 1DQQA 1CLCA 2EE9A 4JG1H 2QSQA 2XZZA 5I1EL 1EXUA 4HS6B 4P49A 4WW1B 3O0RH 1MRDL 3PHOA 1JWUB 2LU7A 3X13A 3F12A 1AHWA 1W72B 4WV1A 4XB8A 2W0FB 1FO0B 4DQOH 5JHDE 2OZ4L 2VZTA 3IXAA 5F88B 1J0JA 3EFFB 3F6LA 3MGTB 3QUZA 3QIWC 3TYFA 3SGDH 3MJ6A 4LSPH 1CE6B 3EBAA 1DFBL 5DK0B 4P3CL 4WCYL 4PP1C 5GGUA 1KN2H 2Z31A 4GMSL 5T1KA 2IAMC 4HJGA 4QHUB 4IMKA 4HG4K 1WC7A 5D7KD 3DRTB 3CAFA 5L2KA 5ID0A 3DUSB 1MELA 1LO0L 5JTWA 5CKAA 4H1LH 2ESVB 2UZYB 5TF1H 5D2NB 1RUQL 1IC1A 2V17L 2FEEL 5IQ9A 5F6HI 3SGDI 1LO4L 3KPNB 4Z7OF 5HDQH 1AD9A 1BLNA 4EN3B 1CDIA 3ORJA 2AABH 4P2RD 5K9JH 1LDSA 1JHTA 4EDWL 1WEJL 2NY4C 1TQBB 4M48L 4ODTH 4BYHA 4R4FL 3DX9A 1VFUA 2ZCKH 2V5YA 5B38B 2BVEA 4X98A 3VFSB 2J2ZA 5DZLA 4L1DA 4HIIB 3RWJA 2DLFL 3W5NA 1GCFA 4JZJA 3UJIL 1S7TA 1QFWM 4OZGF 2DL2A 3DTXB 1A6TB 3SJVB 4PUBH 3CCHB 3PL6A 3S35X 4HUXA 3IT8D 1NMCC 4RSVA 4ZFGH 3BGAA 5TQ2L 1TZGL 3KPMA 3V6FA 3WKNA 3ZTJG 4AYFA 5DMKB 4YHIB 5HHOB 1VADA 4XAKE 4DGVL 5BOPA 5JOFB 1MRCL 1PG7H 1NGPL 3QPXH 1QFUL 1YEEL 3NIGE 2DLIA 2OM5A 3MFFA 4OTXL 5MENB 3X12B 1WBXB 4ENEC 4KI5E 3ARQA 1FFPB 1VACA 3CC5A 3FQUB 5GGSA 1NEZG 3CDGA 2XZAH 4NM8H 3F5WB 3RVUD 1WV7T 1JNJA 1RIUL 4HS8H 4JLRA 3QEQA 1JZ6A 4N0YL 4PGBA 4P3WA 5E99H 3DXAE 5EORH 2BVYA 2I5YH 4KK6D 3C6LD 3HI1A 4J7RA 3N9GH 3UJTL 1C5CL 3AROA 3G5VB 5ESVB 1JZ8A 2NW3A 3R1GH 3VFNA 5HYJA 4YHMH 5ELIA 1R0AH 1KJVB 3THMH 2EIZB 3BP7B 1NBVL 3C5JA 5D4QA 1JGDB 2WBJB 1QSEA 1F3DJ 2W38A 3X17A 4OZHE 1U3HC 1K3ZA 3MODL 4WDIA 1CTOA 4I2XA 2DMKA 2X4QB 2VXQH 3TBVB 3WFZA 1U8HB 4NQUA 1HZHL 5JIHA 2VIRB 3MV8D 3P0GB 1XGPB 3ZHKA 2XG5A 3RKDC 5KAQG 2Z8RA 2X41A 2YUXA 3TN0A 5F1IA 3NCCB 5HGDA 5HHME 3WFEH 2BOCB 5IV2A 1ORQB 4PRHD 4PJCB 4F3FB 1GC1C 1R3LB 1Z3GH 1PYWB 4NO2B 3KDMB 3S4SB 1UB6A 4FP8H 5EBWA 1U6AL 4JPIA 1FL3B 2P5EA 4KVCL 1AQDA 1YEHH 4QRRB 3DROA 3RWGB 1CTNA 3MLUH 1MJ7H 5C9JB 4YE4L 5E1HB 1F02I 4WU7B 4D3CL 4LPVA 5F7EH 3PGDB 4KV5F 5TE7H 3C8KB 2Q86B 4M93C 1CBVH 4ELMF 2DYPB 1NMBL 4KROD 3MRJB 5C0NC 5I1LB 2AJUL 2Y5EA 3QQ9C 4LLYA 1ZLUH 1G7PA 5H37G 1DBJL 2ERJB 2X9XA 2QLVB 4PJIF 4PGCB 3CD4A 4YNYB 4O2EB 2AP2A 3CFDA 3MRLB 4GSDL 4QGTA 2H45A 4Z95L 4X6CB 3SO3B 3U2SA 2PN5A 2DQGH 1A7NH 3MJ8B 4PRBA 4NQDD 2WUCH 1H15A 5B8CC 3CH1B 5JW5B 3V5KA 4I0KA 2AEQL 2F74B 3NACL 3Q6GH 1NLDL 1JNNL 4RAUB 1UT9A 3DVGB 1UZ8B 1LE5A 3O6FA 3O8XA 4KJPC 2CUMA 1KACB 1NANI 3OKOA 1IM9B 2AXGA 3MXWL 4UTBL 1KCVH 5JMRA 3WJJC 4MS8C 4GXUM 4GG6F 1K2DB 4H8WC 5BV7B 4UU9B 3ALWA 1EBPA 4FQXA 4K94L 1XGYH 3CVHH 4MVBD 5DO2C 2YPLB 5B3JE 3LN5B 5KZCB 4TTDD 1D5BA 4KUCF 3SDXA 2XACC 1EEQA 1R3IL 4JO4L 4U1MB 3NAAL 4YEFA 1LD9A 2BRQA 4MNHB 4RGOL 2EC8A 5EO1A 4XNQB 2QTEA 5I2IA 1EO8H 5IT2H 5IR1A 5J12B 4XNMA 5IG7B 4CVZB 4C83A 4YPGB 2HP4A 3QO0A 5C0GA 2H6PA 2YPKB 1WBYA 3E6HB 3QRGL 1KCSL 1RURL 5CGYC 1EK3A 1YMMA 1JRHH 5E2WL 1WCBB 4F2MA 2D0HA 3HE7B 3D9AL 3RY6C 1MREL 3QDJE 2UWEA 4XMPH 4JY5L 4WO4C 5DJYB 3RIAF 3U1SL 4RGMC 2V2XA 1LO3L 5FA4B 3QIUB 4I8DA 4DVRH 3FQTB 4I13B 3GSNA 2H2SC 3TZVD 4OLYL 4U0RB 3SPVA 2ZZUT 3W9EA 1LQSR 1DBAL 1MCPH 3NTCH 1OPGH 2EDEA 3K2UH 4FFVD 4Z0XA 1T5XB 3WMSA 4MXQC 1JCKA 4AJ0A 4NC0B 3WUWB 1M7DB 3QZWG 4P2RA 5FHBL 4JDZB 2Q3ZA 3GMMA 1RUAL 1AO7E 4YDKL 3M17A 1DUYA 4I9WD 2VXVL 4PJ5B 1IAIM 5DJZB 1CIDA 2ZCHH 4J8RB 2ZOLA 2QHRL 1KB5L 2J6EH 2D3VA 1UWXH 2ZSVA 2BC4B 4XWGL 5I17A 5JPNA 4JFYB 1RHHA 1OSZA 1BJ1H 3IKCA 1OQOA 1DZBA 1MCWW 4NPYA 4AH2B 3ILQC 4WHCA 3FRPA 4JR9L 5DQDL 1IILE 4LNVA 3D18A 1XT5A 1ZANH 2R4SH 2XZCH 3FT3B 1U2HA 1U93A 4PLOB 5C3LD 4WW2A 2IBZY 25C8H 3KPSA 4Y4FC 5IBUG 3DXAB 5C6WH 2O26U 3VG0H 1VGKB 2H1PL 1XGUA 4D8PB 4FQ1H 1K4DB 5IMLB 1NGZA 4AIZB 2BHUA 1RIVH 3MRKB 4KMLB 1E4XH 1UM4L 3OX8B 4EXKA 4YJZL 2P46B 3A6CL 1NDGA 1NFIB 3MRHB 3D39A 4P2QB 1S7SA 4NKIH 4C56E 4IDJH 3U4EA 2R2CA 4OZHB 4KVNH 5KOMC 2PYFB 3SDDA 3RNKA 3C08L 1RULH 4P4KA 3UAJC 4D0DA 1G84A 1N59A 1YEKL 4AEFA 1VKXB 2XV6B 2V5SA 1NCUA 5M7QA 1F97A 1X4YA 4M7LL 5CAYB 3INUH 3QWOA 3LKPA 2C3GA 3TPUA 4MJIB 4Z7QF 1K4CB 1GGBL 3GMNA 4PP2A 4OUUB 1NDMB 1E4XI 3U7AA 2OL3L 3VGAB 3T2NH 3FO2B 1JI2A 3C6SA 2ZG3A 4KH2A 3VGEA 1G7MA 3VRLF 2LTQB 1R5IB 4XXDB 4HJJH 5EU7C 3QXVA 1A02N 2YD8A 4Y19D 5ID1B 3C5ZC 1OP5H 4D0CB 1LO5B 2C3VA 2BCKB 4LKXA 4PB9L 4P46C 4LLUB 3WFHA 1RU9H 2ARJQ 3MRCB 4MAYD 2HT4C 2CLRA 4YK4C 2P8PB 4KK9D 1R6VA 3R06A 1UCTA 2ARJB 3QA3A 4BQBA 4HBCH 4WHDA 1AIFB 3IJSA 2OTUA 1TVHB 3NFSH 1BZ7B 1S7VA 4O2FB 4FMKA 4PV8B 2X4NB 1F58H 4ONOA 3IDMA 3DV6A 1FFOA 5C0BD 5IBTH 3TFKD 3T3MF 3VFTB 1WZ1L 4JANA 3CPLB 2YPLD 4EZMA 1J1PL 1KFAL 3KXFE 3WIIH 1MCCA 4LHQB 4HS6A 1KTRL 4WW1A 1G9MC 4OSUH 5BJTB 1JWUA 2YD7A 2DIBA 1V5JA 1W72A 2BNQE 2ICWB 1FO0A 2W0FA 4NJAL 2JELL 5F88A 4LRIA 2AQ1A 3EFFA 3MGTA 2HTLC 5F6IB 1X5XA 3AUVA 5T1DL 4PJ8B 4X7SH 5EU3B 1CE6A 4QCIB 2ED9A 4XWOD 5DK0A 3RA7L 1G0YR 4LCWD 4XP4L 1EO7A 4FQHB 1WFTA 3HE7D 2NZ9C 1ACZA 1I9IL 4QHUA 3DRTA 2ZUVA 3KHOA 4GMTH 3DUSA 3QIUD 3QUMH 5BRZE 2YUVA 1NCBH 1G0DA 1MFEL 4JM2C 1K6QL 2ESVA 4UINH 2MWCA 2F5AH 5E4EB