1GSMA

A reassessment of the madcam-1 structure and its role in integrin recognition.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1
publication title A Reassessment of the Madcam-1 Structure and its Role in Integrin Recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA01
4BSVB 4YXHH 1DQML 5L88L 2E9BA 3FB7A 4NYLB 3FB6B 1M7DB 1HYSC 4M7ZC 1CU4L 4XP1H 3FRUB 1P4LB 3ARGC 2GJ6E 1ZHBA 2XACC 5SWSE 4NQXB 3L3OB 5F7DB 1MLBB 1B90A 5TDPB 3OKOA 1DANU 3DX9A 2HT3C 1FL3A 1TQBC 4U3XA 3WFEL 1IGIL 4PRIB 1OP3K 4OLEA 3KYMA 3PWPE 4IJ3B 3SN6N 3CFCL 3O2VL 4Y2DB 3QUXA 1QHPA 3VFVB 1A3RH 1JPTL 1PSKH 2ZUQB 4X6BB 5DK0B 4E42A 1CXHA 4YWGH 3CZFA 1CFQB 1K9TA 5EZJB 1LHZA 1FG9C 4DN3H 4X6EB 1I3VA 3QDGA 3O41B 4OBSA 2QQLL 1NMCB 5FYKU 3BVNB 4NKMB 3LKOA 3IDYB 1UB5A 1I7ZA 2VITA 3IB4A 1DVFA 2EC8A 5GIRB 1J0ZA 3IFLL 3U4EA 5JIIA 4HKZB 1CFVL 2HFGH 3IKKA 3VXNB 4ELME 1PZ5A 1KB9K 4IOIA 5KAQG 1VPOL 5LBSL 5DLML 3G6JE 5EIIA 1EGJA 2ESVB 2IAMD 1YYMH 4KMQA 4YGVA 3BSZL 3CGTA 2EZ0D 1NGXB 4YAQB 2VLKD 4G42A 4MNQA 5T3XD 1PEZA 3BJ91 2WBJB 3QZWG 5CWSA 3OGCA 4LGSB 8FABA 5JNYB 4N0UE 1F6AA 4WW2A 1KGCD 2X4SA 3DVFA 1LO5B 3CDCA 4KTEL 5SWQA 3B3IB 5C1MB 3K2UH 5DO2D 3QXAA 1IJ9A 4U1NB 2Y25A 5CEYB 4HJ0D 1D5XA 2C1OA 1U8OA 1WFNA 4U7SA 3BP6A 4XP6H 3RY4A 2Z35B 5CSGA 3UPAA 5GGTL 4AK1A 1ZLUK 1YMHB 5DMYA 3D85B 3MRHA 4KK6D 4S1SL 5JHLL 4U2ZA 1UACH 1H3GA 4MYWB 2ADJA 2DQFA 4UB0L 2FATL 2DICA 3O2DA 3FO0L 3A67H 1NCAH 4NCDA 1R3KA 5HYJB 2DLTA 1NMBH 3MXVH 2X4PA 1BQLL 2V9RA 4K23L 2VLLB 3BKCH 2SEBA 1Z9OA 5I66B 1FRGL 3BH8B 5KJRL 4PJDB 1WGOA 5DHXB 3ZDXF 3LOWA 3REVA 4WV1A 2YPLA 1KJVA 4BFBD 2C4XA 2VDQL 5CUSH 1EDQA 1FYTB 3NIDF 4JE4B 5FHBH 1A7PL 4HIJA 4PRPE 4WU7A 4PJ8A 3VFGH 3U9PH 1TETH 4EUPB 2IAMC 3UJJH 3A6BL 5JHDA 5HVFB 1T7XA 3HZYB 3GB7B 2AK1H 3TZVB 1CDBA 4NUGL 2AKRB 2R0WL 3H9HB 3KYKL 4PREA 1UM4L 3QQ3A 3BW9A 1INQB 4G7VL 3GGWB 3MBEB 5D1QA 3X12A 4FQHB 3D0VB 4AENB 4L9LA 4JRYB 4XPGL 3H9ZA 2ADIB 4HJ0C 4NUJB 1MRFH 1RUPL 4JJ5B 5GGQH 1N5YL 3P3YA 2H32B 3ESUF 5TFSH 5DQJA 5I74C 3O45A 2AJUH 3P4NB 4NC0B 3V6OA 1PLGH 1CE1L 2WMPA 4D0DA 1LK3H 1F2QA 1GC1L 4KK6C 1DQMH 2P5WB 5L88H 4G8IB 4LCWE 1S5HB 3OGOE 3PIQA 2FEEL 5I18H 1CU4H 1JL8A 1R5VB 2P43B 3QNYA 3ULUD 3WFEH 3D18B 5KTEL 1IGIH 1MCFA 1GHFH 3VXMD 3F5WA 4MD4B 5FUCC 2VZVA 3L3IB 4YO0B 3CFCH 4OCLC 1ZKAA 3O2VH 3TGXA 2PN5A 2ADFL 3L6FA 3OPZL 3L3HA 3T0EE 2CO7B 5CGYC 1JPTH 3MRNA 4RQQA 2FJGB 1CCZA 2ZG1A 3ULSA 2EO9A 3E6FA 2EDDA 1J0JA 3U0WL 1I75A 4ZFZB 1XZ0A 4EQ3A 1EHXA 2WIIB 2RFXA 5ISZB 2QQLH 3WLBB 3GSWA 1HKFA 3IFLH 1CGXA 1EFQA 4BSVA 1YEGH 2XTJD 1CFVH 4NYLA 3FB6A 5INDB 1M7DA 5JOFB 1PW3A 1EA9C 3FRUA 4ZAKD 1VPOH 1P4LA 5LBSH 5DLMH 2EDQA 1ZLVH 2HT4D 4IRSB 4NQXA 1HHIA 3L3OA 5TDPA 1EZVX 2BOBA 4OLXL 1XFPA 5DURD 3BSZH 2A6JB 4NZJA 1AFVL 3DURB 4JPKL 4PRIA 3V7AG 4JO4L 3CFDB 4CNIA 1VDGA 4UTAL 1JPGB 4Y2DA 5I1LB 3D39B 1J12A 5HVGB 5J11B 3VFVA 4KTEH 3OQ3B 3P9LB 4X6BA 3ULUC 1T0MB 4CVXB 3RGVB 1DEEB 1HILA 2LTQC 5EZJA 3UPRB 4NQCA 5T5NF 4KQ3L 4RFOL 2EE9A 2VZUA 5GGTH 4ZS7L 3VMNA 1BWWA 2A74B 4HS6B 4LLAA 4S1SH 5FUOL 5JHLH 3QEHB 4K2UL 3GM8A 3BVNA 4NKMA 1NUNB 4UDUB 1UG9A 5EOTB 5AUMB 2FATH 1GIGL 5GIRA 1CFBA 1CGUA 3KPMB 4PGZA 1G9ML 3FTGA 2E9IA 2LVEA 4U6YA 4HKZA 1BQLH 1CR9L 4K23H 3VXNA 1JZ4A 4EI5A 3RVVD 2Z8VC 3N50A 5T33L 3C8HA 1FRGH 4JFQB 5KJRH 3O6ML 2ESVA 5C0AE 2UUDK 3N1PC 3KLHD 2AEQL 5HHOD 4TVSa 2WBJA 5DXWA 4LRIA 3BXNB 3N06B 2ZUWA 5JNYA 3VGDA 5BRZD 4ZAKC 2NY1B 5HI4C 1UH3A 5HYIA 5KSVB 2HT4C 1LO5A 2CUMA 5DEFB 4MDJA 3A6BH 1HXMB 3WFDL 3OV6A 3B3IA 1RHHA 4U1NA 4NUGH 2R0WH 5CEYA 3LPGA 3KYKH 3ARSA 4HF5L 3IF1B 1UM4H 3QWRD 1OPGL 3K8LA 2Z35A 4G7VH 4R4BB 4G3YL 4WTWA 1NBZA 1YMHA 5KSBE 4XPGH 4KFZC 3D85A 3J8F7 2B5IB 4XMKL 1RUPH 2XA8L 4YFLI 1N5YH 4LK4A 5L7XL 4H0HB 4I2XE 4EDXA 4Y2OA 1A6AB 3GM0A 1CE1H 5CD3B 5HPOA 1NFKA 1RIUL 4LFHD 3HG1D 1GC1H 3EGSB 3CFJA 2R29L 5ACZB 2MSPA 5I66A 3GSNL 4U2YA 1QLFB 4WFHE 2P5EE 4HUXB 2DQEL 4PJDA 4FQJL 3VXUD 4YE4L 4FFZL 5EH1A 4PJBB 4PG9B 1KENH 1CDGA 2AS5M 4X9GA 1FYTA 2E6QA 4L4VB 1ZTXL 4J1UA 4EUPA 5CEZD 1JTPA 2ADFH 2XY1A 3OPZH 3GB7A 5IBTL 1HCVA 3EYQD 3OTTA 4XTRD 2AKRA 2IEPA 3U48A 3KPLA 4ZSOE 3H9HA 2RJMA 5F7NC 1CIDA 4WNQB 5F6IC 3SKMB 1CICB 3MBEA 4FQHA 3U0WH 3D0VA 2Q7NA 4AENA 4IRJC 2IFGA 3LAFA 3MROB 5EU4B 2R2HB 2ADIA 4NUJA 5BW7C 4JJ5A 3ZE2F 1MFCL 3QHTC 2H32A 5LGKA 4X80L 35C8L 5E2TL 1P5UA 3T0WA 2IALA 4KROB 2NCMA 3P4NA 4DFIA 2B4CC 3DUUA 1AHWC 5I8KL 4HAFA 2P5WA 3GK8L 4G8IA 1H8NA 1OY3B 1S5HA 2BNQA 5E4EC 1IFHL 5EU7E 4P2QA 5C08B 3LPFA 2APTA 2VDML 4IMKC 1X6LA 1R5VA 4MQ7A 2L7JA 4XXDB 2ADGA 4OLXH 4RX4D 2G9HB 1QSVA 3D18A 1AFVH 5D70H 3EUUA 4JPKH 4UZGA 4NIKB 3CLEL 4UTAH 2Z31D 3UTZB 3ZDYE 5DFVC 1FNSL 2QSVA 5ESQB 1CBVL 1AGBB 1WZMA 4ENEC 4PJ7A 3TA3C 3GJEB 4JKLA 1MJJB 5MEND 4ZFZA 3M1BB 3MV8D 2YRPA 4KQ3H 3O3DB 4P2OB 4RFOH 2WIIA 3EYQC 1A0QL 3MREB 4ZS7H 2UWEB 2NY5C 1NC2B 4HS8L 2BVPB 5ISZA 4PS4H 5FUOH 2NMSA 4B5EA 2EDLA 4K2UH 4HCRA 3MMEA 4KAQL 3WLBA 5IJKC 3OG4B 4ONFL 3GSXB 2HVJB 1GIGH 2YD7A 1FH5L 5HD8C 5DD3L 3E6HB 3QIUA 4BQ8A 3NH7L 1CR9H 1U6AL 1X3DA 3IFOB 2JTDA 5INDA 2DQUL 4GW4A 1JYWA 2M1KA 3ORJA 4LPCA 5T33H 1U8KA 1WQVT 3O6MH 5D1ZB 3QSKB 3ZDZE 3JWDL 3RJDA 1X6NA 1H15A 3KXFB 5D2NB 2A6JA 3Q5YA 1TZIB 2YMXH 3STBA 2QSCL 1T0NB 1KB5B 2HT2C 3CFDA 3GIZL 3X13B 3RVTD 4GLRH 3PABB 1JPGA 1F58L 1PKQE 4PJBF 5I1LA 3D39A 4JGMA 4NZTH 2B1AL 5EU6B 3WFDH 3P9LA 1T0MA 4JFOB 5DD5L 4CVXA 2AABL 4OKDA 3RGVA 3KPRD 1A21A 2OR7A 3LIZL 1DEEA 1BBJB 4Y16D 3UPRA 1OPGH 1I9RL 2Z31C 1P2CA 3WNPA 1U9KA 4G3YH 3G04B 1XR8B 2VRAA 3RY5A 2A74A 4FQXD 4YHYC 5J06A 3QEHA 4XMKH 3OKLB 1LDSA 2XA8H 2ZCLL 3SY0B 3ES6B 5EOTA 4OB5L 5AUMA 4L4TD 3P0GB 5IBUG 5L7XH 3KPMA 4QRPB 3GSVB 3SDDB 2PW2B 3BGMB 3LKRB 1RIUH 5GJSL 1LD9B 4R97B 3U30C 2R29H 4U49A 3ILQC 3LQAC 3GSNH 4JFQA 3OKNB 1VFBB 2DQEH 4TNVK 2IBZX 1ETZB 5H37G 2RQ8A 3NCYS 3UBXG 4Q9QL 1QRNB 4FQJH 3MACL 4YE4H 2VOTA 4FFZH 2X89D 3DBXB 3SE8L 3NGBB 2EDHA 2IANE 2OL3B 4DGVL 2ZP0T 4JFEB 4MCZA 1ZTXH 1KTLB 4KI5D 1Q1JL 3JV4B 1W8NA 4U31A 1HXMA 3V6FB 5DZOA 1V8HA 4KDVA 2X9WA 5IBTH 1JF5A 1FIEA 2VTFA 4QOKA 4Y4HB 5CD5D 1A22B 1J1PL 1WAAE 2VKXA 3T3ME 5J1AB 5T5FH 3GHEL 1I7RB 3KYAA 4P4KB 2V7HB 2W0PA 3RVTC 4R4BA 1JZ7A 2YWYA 2AV7B 5F7WC 2NY0B 1B9ZA 3OKYA 2VZOA 4OZFG 5KN5A 5TE7L 1G7QB 3CJJA 3MUGA 3AY4A 4NM4L 5HDBF 5K59E 4UT7L 3KPPA 4V1DA 4Y16C 1MFCH 1MCOL 5E2TH 3KPTA 1BQHG 1E28A 2UWEF 1A6AA 4JPIB 4OZHF 4S1RH 5JDSA 4FQXC 5EU5B 5I8KH 3MGOB 3RHWK 3DYOA 3GK8H 3N1GC 5ACZA 5IP4A 3R0MA 3OX8A 1IFHH 1H5BC 1QLFA 1WT5A 4HUXA 1T04A 2VDMH 5I6XB 4MAYD 4L1DA 3ZHLA 1X5JA 1TENA 4PJBA 1KSRA 4PG9A 3OG6B 2CKBL 1IAMA 3EDFA 3VXPB 4L4VA 1G7PB 3N9GL 4N1CA 3ZHKA 3CLEH 5K9OA 2XN9E 1IQWL 2P42B 4FS0A 2EXYD 1FNSH 3BOVA 3WV0A 3BKJL 3ZSTA 3EOTL 4WNQA 3SKMA 1CICA 32C2B 5FYLL 4KI5C 4TULH 4CJ0A 3UTSB 4YEFA 4XMLL 3WFHA 3PJSA 2YC1A 5EU4A 1C12B 1KCUL 1A0QH 4HS8H 2R2HA 4KAQH 2CLVB 4ONFH 1KNOB 1GGBL 4I77L 1YYLL 1NUDA 1T2XA 5DD3H 3EYUL 4DFHA 5HGAB 2X70B 1U6AH 5C08A 3ZTNL 1IKFL 3L3DB 5CMAB 7CGTA 3P4LA 5FDWB 5D72L 3UPCA 4JFHE 4JFDD 2QSCH 2X5PA 3GIZH 3EO1B 4MAYC 1HQ4B 1XF4B 2OMBA 3R8QA 1F58H 1XGPB 3UTZA 4P5MA 1FDLL 1ZHKB 2G75B 2B1AH 4U4BA 4MA7L 3KS0H 1A47A 5EC1B 2DM2A 5DD5H 5ESQA 5DA4A 1AGBA 2XKSA 4LMQI 1NFDA 2AABH 2R2BB 3LIZH 5J12B 5LVEA 1D9KC 3GJEA 5ALBL 3HZKB 1I9RH 2EXYC 3M1BA 1U2CA 1AGCB 3O3DA 4P2OA 4XAWL 1JYVA 1KG0B 3MREA 2UWEA 1NC2A 4OQTA 1NCDL 4P5TB 3VGAC 2P45B 1LP9E 4PPTA 3T4YB 2HJLB 3TV3L 2WWMD 2ZCLH 4OB5H 3GSXA 2B7DT 2Z9TA 4EZMA 1YC7A 4G8FB 3QUXD 2WLZA 3E6HA 1Q9KB 2BRRH 4QHMB 5HY9B 2AK4E 5F6HI 1E4JA 4CUCA 5L9DL 2KQNA 4Z7OF 5L2JB 1WIUA 4Y4KC 3SGKC 4FG6D 1VCAA 5D1ZA 3ALWA 1QNZH 3KXFA 3MACH 1TZIA 5BQ7B 1MHEB 3SE8H 3QDGD 3SCMA 1T0NA 2X7LB 4Z7QF 1HHGB 2H1PL 3C87A 3X13A 4DGVH 3QDJB 2CQVA 3VWJC 4R7DA 1Q1JH 1EJOL 1DVFD 5EU6A 5GRVK 4O51B 4LEXH 1U8NB 3WDJA 4YZFF 2M8XA 5J8OA 4U6VL 4H1LH 3GHEH 3BJLA 3U0TA 5C0JA 3QDAA 4FZEL 1XR8A 1EUUA 4NOFA 2EDFA 3ISWA 3PWPB 3P4OA 1BZ7B 5TE7H 4K7FB 4PJCE 4PRPD 2WINA 2F19L 3BZ4B 4UT7H 3V4PL 3OKLA 1OTSD 3SY0A 1NDGB 3DWTA 4BSWB 3QHZL 4QRPA 3GSVA 3BGMA 2EDXA 1XCTA 2NX5B 2AAVA 3U4AA 4TNWF 1VFBA 2YK1H 1G0YR 1ETZA 3VD4A 3DHJA 1X5XA 4WWKB 1WVZA 1MRDL 2CKBH 3GMMB 1OCWL 4HUWB 1RUQH 4FG6C 4HKBB 3N9GH 4F7MB 4JFEA 2D4DA 3KJ6L 1KTLA 1R3HB 1IQWH 3BYYA 4C56E 4ELMB 3V6FA 4F33B 4GRWH 4HJJL 4Y4HA 3G6JB 3BKJH 1XH3B 3TBYB 4Y5XB 3LEXB 5J1AA 3EOTH 2OLDA 2V7HA 1U91A 3VW3H 5FYLH 2X40A 5DMJB 3RNQA 1HOCB 5F88B 4QRSA 4XMLH 4QGTA 1OLZA 3P9MA 3ZMRA 1KCUH 1G7QA 4K7PH 1BJ1H 2YPLD 4PBXA 2I9TA 1J11A 4JPIA 2NY3B 1GGBH 4I77H 4ISVB 1YYLH 1T7ZA 5JHDD 1EO7A 4LHUD 2Y4SA 3EYUH 43C9A 1P4BL 1HHJA 4NJ9H 3ZTNH 4CU8A 4RISH 1IKFH 4WW2C 2RIKA 1QBBA 4JREB 3NVQA 5D1QD 5D72H 4G8GB 1OP9A 3EZJB 2BSRB 3HUJE 3VI4E 3VXPA 4RMUA 1G7PA 1ORQA 3B43A 5CZKA 3UMTA 3CU1A 2QHLA 5DRNA 4CL7A 1FDLH 4MA7H 1ZXQA 5ID1A 4OCXH 4KDTA 5KVFL 5IK3A 4CDHA 5ALBH 3UTSA 4M61B 1EEZA 3BD5A 5KVDL 1EERB 5JXAH 1DL7H 2P4AB 1C12A 1GAFH 1UQSA 3X14B 1NCCL 4WGVB 4X9FA 1MOEA 3AREC 5T1KA 2YD9A 3TV3H 5EC2B 2CLVA 1KNOA 2X1WL 3RL2B 4TN9A 3M17B 3Q6FB 1CFSB 2B0SL 3PL6B 4K3EL 2BSTB 4LHJB 2EKSB 4WV1C 1DBKL 5H35B 2HH0L 1VA9A 2X70A 5L9DH 5HVHB 3L3DA 5CMAA 4U1HA 4ALAL 1QBAA 5FDWA 2APXA 2VB5A 3STLB 3HN3A 5JW5B 2EDNA 4NO2B 4O58L 3ESVF 4UNVA 1DDHB 1QFOA 2H1PH 3SO5A 3EO1A 1HQ4A 1J8HA 1XF4A 3V8OA 3S36X 2VAAA 1XGPA 4XT1C 1DUYB 1FL5B 2CPCA 4LCWB 4NNPL 2G75A 3BWUC 1EJOH 4L9LC 2HG5B 4Z7WB 5EC1A 4HFWB 4RA0C 1J05B 1F3RB 2JLLA 4ZFOL 5EU3B 3DV4B 4KC3B 4U6VH 4ELMF 4HZLA 3HZKA 1G84A 1MCJA 1S7WB 4B0MM 4FZEH 3G6JF 4GT7A 4QXTB 3V6OC 3ZT5A 2J6EH 1UA6L 2LQRA 2QSTA 2DN7A 4XI5D 1QSZA 4P5TA 4HGKC 1Q72L 2F19H 4PRID 3T4YA 4FQIL 3T0EB 4OCRL 3V4PH 1FPTL 2LVCA 3P73A 1TPXB 2D31B 4R26L 3RVUD 3MLRL 2P47B 4WENB 4JR9L 3QB7C 4G8FA 5HY9A 4QHMA 5DD1L 4F8QA 5L2JA 2XXMB 4G6FD 4XB8A 3EDEA 5FCSH 3UTPE 1KPVB 1T2JA 4AM0B 2YZ8A 4NQCD 2GQHA 5JOPE 5BQ7A 1MHEA 5IKCB 2AV1A 4JHZA 2BVYA 3WJLC 4LSPL 1MRDH 3H2WA 2X7LA 2JCCE 1OCWH 1HHGA 4U1IA 3QDJA 4HIEB 3V6BR 1G0XA 1V3KA 3KJ6H 2VISB 3C6SB 3UYRL 4HLZH 4O51A 4HJJH 2APWA 1U8NA 2DMCA 1AP2B 3SJVE 4DZ8B 2EDYA 1GGUA 3PGDA 2FYYB 1ZLVK 4EI5D 1XMWA 4L4JA 2DLIA 4JZNA 5BOZG 2ESVD 3KDMB 3MLPA 4M02A 2HLAA 3PWPA 1KIQB 1OD9A 1BZ7A 4Y88A 3BZ4A 2F9BT 1BD2B 2FIRT 5EFIB 1NDGA 4W6WB 5DSCB 4BSWA 3TIDB 3BI9X 1R3JB 4LF3B 1U8QB 3S5LG 1UJ3C 2BSSB 1UXSB 3IU3B 3T1WA 4IS6B 4BFGA 2NX5A 4FFVD 3IDJA 4LP5A 5E70A 1W0YT 1P4BH 1W8OA 1YY8A 4APQB 3FHQA 1MCQA 3RI5K 4NCC1 1DQJA 4LDOB 4WHTB 4WWKA 5IVXA 5TE4L 4RGOH 5IOPB 3MYJB 3GMMA 4HUWA 3EHBD 3W81A 3SHSA 4HKBA 1U8MB 3OXRA 4F7MA 5B38G 2DDQL 1S9WB 4LOUD 1VACB 1WK0A 3GDBA 1R3HA 4F33A 4YBHA 3SKNB 3C6LC 2F15A 1X44A 1H8SA 1XH3A 3TBYA 5J13B 1RJCA 4Y5XA 2VLRA 5KVFH 1WTLA 4CVWA 1PZUB 4LKCB 1FIGL 1J7VR 2R1WB 5C0IB 2WP3O 4Z7WF 1T5XB 1NCCH 2QJDA 3QEGL 1KCKA 1B0GA 1K85A 1F3DJ 4PUBL 4EI5C 1I1YB 4LLVB 5F96L 3MV9E 5E7FA 5BJTB 4ISVA 2BSED 2B0SH 4K3EH 4L9DA 2E5EA 5EZLB 2EEDA 1TQCB 5FGSA 1S7SB 1DBKH 2HH0H 4KVCH 5KSBB 2F8VA 4ALAH 4EIGB 2C4FT 4G8GA 1XR9B 3QYCA 1JK8B 4O58H 3V7MA 1U36A 1VADB 5JA8B 3OKKA 3WHE0 1WCBB 1ZLSL 3VFTA 3B5TA 5IMKB 1YECL 3H3BC 4NNPH 4TVPL 3L3KB 1F90L 5DVMA 1KIRA 5IMOA 4AIXA 2UZIL 2E9JA 3QXTA 2BNQD 4GUPB 1IC1A 4P2QD 4M61A 1K4CB 2CH8A 4XNXL 3QZWA 1MCLA 3X14A 2AXJA 1UA6H 3QXUA 5EU7C 2QADB 4A2MA 4MGXA 4KJQC 4ZUUB 5I8OL 3SDCC 1B6UA 1Q72H 3INUL 4FQIH 4OCRH 5EC2A 1FPTH 1I8LA 1WWCA 1ZT7B 3M17A 4FP8H 4L8SA 1CLCA 4R26H 3Q6FA 3MLRH 1CFSA 3PL6A 2DBJA 4B7IA 1T3FB 1Z9SA 2BSTA 3IJYA 4DOHB 5DD1H 4Y5VA 1P4IL 3Q1SH 4NGHH 3D6GA 4LHQB 4JG1L 4HMDA 3KVQA 1AQKL 1UENA 4MNGE 4NO2A 4FQ1L 1JZ3A 1P84K 4LKXA 4LSPH 1DDHA 5ISZD 1QR1A 5ANME 1UFUA 1F97A 3BD4A 4MWFB 5ENWB 5T3ZH 1N0XL 1A9BB 4Z7WA 2OP4L 4HFWA 3SDXB 1J05A 1R24B 3QIUD 4EBQL 5EU3A 3DV4A 3VD9A 5J3HD 2F54A 4MXQC 3VFNB 5FYJE 2DIBA 2EH8L 1BLNB 1S7WA 5EUKB 1FO0B 4QXTA 1KJ3L 3LMJL 1HKLL 4I0CC 3HR6A 2A73B 2EIBA 5E8OB 2DIAA 3EYVB 2GKIA 2D31A 3FFDB 4XP4L 2XKNB 4X5WA 4MHHI 3D39D 2V2XB 4F7CA 1I4FB 2CR3A 3RWDB 4CKVX 3RGVD 5B4MC 1U8JB 2OZ4L 1KPVA 3R06B 4BK5A 3LS5L 1X5FA 3F7YB 1YY9D 1QFWI 1OL0A 1XF2B 2XRAH 3ULUL 5KSBF 5TE4H 1BFOB 3BPNB 3BUYB 4PD4K 3QFJE 4OFYD 2DDQH 1U8HA 2VISA 1RZJC 2VDOL 1SVCP 3BEWA 1TTFA 2YBRB 4EDWL 2VXSL 3FQNB 3RJQB 1VHPA 5A43C 1AP2A 4DZ8A 3W5MA 1FIGH 2IGFL 1UKQA 5D7KE 3WCYA 1MJ8L 3EKCA 3UBXI 4UOJA 4X6CB 1KIQA 3QIUC 3QEGH 1MCHA 1PKQB 3BISA 4KH2A 3VXRB 3P0VL 2EC9T 1BD2A 5J3HC 4PUBH 2PO6C 3GI9H 3DXAB 4NWTL 4U1JB 5DSCA 3F62A 4QCIB 1R3JA 5F96H 4PRBB 1H3UA 4OZGA 4QOKD 5BS0A 5AYUL 2KL6A 4PJGE 4FFWD 4HFUL 3ARFB 3S35L 4F7TB 2F53E 4UBDD 1U2HA 4WHTA 3ZYJA 4NQUA 5T3XH 3X11B 3MYJA 3HI5L 4NQEE 2Y6SD 3W0WE 2MHAB 3QPQD 5D7IA 4YR6B 5CFHA 1VACA 3KJ4B 4V1DD 3C60C 1YY9C 2V17H 1YECH 3JUYA 1SMOA 1F90H 3HCVB 4LDLB 4TVPH 1LWRA 3TC9A 3NN8B 2NR6D 1VGKB 1C8PA 4QTIL 2Q20A 4LKCA 4MDIB 2D9QB 2UZIH 4MD5B 3RUGE 5EZIL 4YHLL 2R1WA 5IB2B 2DWEB 2IANB 2EDWA 3SDXF 1RPQA 4XNXH 4NKOA 1T5XA 1QSFE 2BFVL 4F37K 1KLFA 3QPXL 5D8JL 1BM3L 5SWZB 3QT2A 3QO0A 4E0RB 3GSQB 3V6ZB 5K9QG 4X5LA 3JWOC 5LCVL 3HS0B 1I1YA 3INUH 5I76B 5BJTA 4DUXA 3G08B 2Q7YB 1YNTB 2IPUK 1DN2A 4TRPL 5EZLA 4DGYL 2YD8A 3LRHA 1P4IH 4H20H 2C26A 1N7ML 2VH5L 2WUBL 3MGTB 1CICD 4JG1H 4LCIL 1I7TB 4IDLA 3FFCB 4YBQD 1JJUA 3QIBB 2VL4A 3HI6L 4HC1L 3MLVL 4JO2L 4YX2L 3AVEA 3DX6B 1AQKH 3HLAB 3SDAA 1XR9A 4QKXB 1Q9OB 5E0QA 1JK8A 4XMPH 5FM5M 3QULA 1VADA 1QKZL 4FFWC 4K8RD 1WCBA 4S0SD 2DBLH 3IDXL 4P0DA 5IMKA 3B5GA 3DO7B 4WGWB 1IVLA 4UBDC 3L3KA 1G7MB 4XCFH 2OP4H 1P6AB 2Y6SC 3MNZB 4ORGB 4EBQH 1FFQA 3QEUB 4GUPA 4UIKL 2WNGA 4RCAA 2EH8H 2B4CL 3RL1B 4KGLA 4KRPC 3K2MC 4QRRE 2DL2A 1KJ3H 2B1HH 3ZDZF 3LMJH 4YC2C 1HKLH 2NR6C 4Y5YA 4FOMA 4ZUUA 3H42H 1UCTA 2IMNA 2YN5A 2HKHL 4AIZA 4Y4FA 3ULVE 4WEMB 4X6CF 4XP4H 1MFNA 1T3FA 5F7EL 4I3RL 3SDYL 4KMLB 1WTGT 1KV3A 5IB4B 1OAUL 3RVXD 2JF1A 2OZ4H 4OZFB 4I0PB 3LS5H 3ZT7A 1TFHA 2NQCA 4HIXH 4HWEL 4P2OD 2GITA 3W5NA 3QUMA 1U95B 1TVBA 1V05A 2Y72A 3ULUH 1NC2D 4HHAA 4L8CA 4GAJH 4F9PC 1P5VA 1WBZB 1BQHB 3C5ZB 2HP4A 3OWEA 4MWFA 5IW1A 4YBQC 5C0RL 5ENWA 2BDNL 2E7CA 2VDOH 4JO1L 3OB8A 1A9BA 3SDXA 2NXZB 1R24A 4EDWH 2NY5L 1MPAL 2VXSH 2HFFB 1MUJA 2HN7A 4EN3B 4K8RC 4K9EL 2CIIA 3VFNA 3TIEB 5D7JD 2IGFH 2GAZA 5EUKA 5C0BB 1FO0A 5D1ZD 1QQDB 4QF1B 1MJ8H 3UTTA 4KK5D 1KYOK 4Y19E 3RX8A 2OI9B 1RUAL 4HWZB 3IFPB 3P0VH 5E8OA 2XWJA 1H3PL 3SCMD 2VDRL 5C9JB 4NWTH 3FFDA 2XKNA 4MLIA 4EEEA 4NM8L 2V2XA 2B2XL 1I4FA 1YQ2A 4ODVH 5HHMB 3RWDA 1GOGA 1NANI 3CSPA 1X5KA 5AYUH 1U8JA 2F5BL 4HFUH 2VDNL 3LKSB 3R06A 3CPLB 3F7YA 5DJXA 1LP9B 4LAJH 1XF2A 3F6LA 5ESAB 1BFOA 1T89A 3BUYA 3HI5H 4OIAA 1IAIH 3RVXC 4D9RD 2CJUL 2OL3L 5BMFL 2AK4B 5K59F 2PNDA 4HULB 5I1DA 4P2OC 4YQXL 4DVRL 4QNPE 3FQNA 2QLVB 2W65A 7FABL 4R0LB 4HG4J 1X5GA 4QTIH 1WIPA 4YHLH 5EZIH 2AEPH 2J7LA 3ZE1E 3VXSB 4WCYL 4X6CA 4ZXBB 4DKEH 2BFVH 1MWAL 3QPXH 5D8JH 1BM3H 4L29B 3VXRA 2H6PB 2NY2B 5L2KB 3FCTB 5LCVH 3LQAL 1G7LA 3DXAA 3WUWB 4U1JA 3G5VA 5D7JC 4OFIA 4QCIA 4PRBA 5KZCB 4OLVL 4KK5C 3H7BB 3T0DA 1T1ZB 3BP7B 4P99A 5HHVL 3L7FA 4TRPH 1KBGL 4DGYH 2XZAL 4Y4HD 4FN0A 4AT6B 3SCMC 4OZ4A 2VH5H 1E6JL 4G9FE 3ARFA 4LCIH 1T7VA 4AEIL 3HI6H 4HC1H 4JO2H 3MLVH 4F7TA 4YX2H 4TNVF 1PY9A 4OQ1A 3FL7A 1VFUA 4HIHB 2MHAA 2AJ3B 1PEWA 4YR6A 4KQ4H 1QKZH 3QUKA 1T20A 4WFEE 3DX8B 3IDXH 1XF1A 5EO0A 3MTRA 2FEDC 4NCC2 3VWKD 4PJEB 1TCRB 4QWWD 2MWCA 3NN8A 1VGKA 4ZUVB 4MD5A 4UIKH 5IB2A 2YEZB 2DWEA 1EFXB 1EPFA 2B4CH 5CJQL 1BAFL 2DMBA 5SWZA 4M6OL 1ZS8B 3PWNA 5MI0C 1VFAB 3GSQA 3V6ZA 1PGRB 1RULL 1SQ2N 2VN4A 3MZGB 5GRZA 2HKHH 4L5FL 5I76A 3H9SB 4RDQF 3CVHB 2Q7YA 3G08A 1A7QL 1JI1A 1YNTA 4JVPA 4NO0B 1HEZB 5F7EH 2IWGA 4I3RH 5CIPB 1I1FB 3SDYH 5D5MB 1OAUH 2D7NA 3RHWF 4TTGA 1E4KC 5HTSA 3FQXA 1ZVSB 2BVUA 3FFCA 3MRIB 3QIBA 4FMFA 4UI2A 5GISL 3IJSB 3DX6A 3HLAA 3HNVL 4NRZB 3QQ9D 3D1MC 5FECA 4ETQB 1WIOA 5T1KD 2YPKB 1X5IA 2AVGA 1LP9F 3WE6B 3MRFB 4K7PX 5DHVH 5C0RH 1GCFA 2BDNH 3T0VA 1G7MA 3I6GB 5ITFB 1OAXL 4PJAB 3MNZA 2NY5H 1MPAH 4ORGA 5I75C 4XP5L 3QEUA 2WZPD 43CAB 4PJ9C 3SO3B 3G6AB 3RL1A 3VWKC 1YPZB 4ODTL 3QI9D 4XCNB 3FT4B 1Y18B 1ZMYA 4QWWC 1P9MC 4ERSL 1KULA 5BXFB 1H3PH 1F4AA 4Z7UB 2CXGA 1J8HD 3B2UD 3E3QE 2BNRE 3O8XA 5EOCJ 3LRSA 4IIQA 4NM8H 1OM3L 5JQHC 2B2XH 3RBGA 2R2EB 3DVGA 4NZDA 5IB4A 4NHUB 5I0DA 2AJSL 1WJ3A 1V3JA 4HDIB 4OZFA 2CXKA 2EE2A 1DBBL 4I0PA 1U95A 1DN0A 5IROA 2VXQH 5FKAB 2UY7A 3D9AL 4LLUA 1GPOL 4KDTC 1WBZA 1AQDB 1BQHA 4P5TD 4LCUA 4HUUB 1RJZA 1U0QA 2OTPA 5BMFH 1CLZL 4M00A 3G6DL 3TLRA 4XWOD 1T66C 4N9GB 3OKMA 4YQXH 4LRNL 4DVRH 3QQ9C 2NTSP 2EEAA 1PG7W 7FABH 1DE4A 4H25A 5KSAC 4PJEF 1U93B 3HE6D 5C0BA 1T22B 1QQDA 1YZZA 1MCCA 4GOSA 5DFWH 3S3SA 4QF1A 3VFSB 4FTVE 4JPVL 1MWAH 1E4XI 4HWZA 3P11L 3BGAA 3IFPA 3MJ9H 4KJPD 1UZ8A 2UVEA 4MJ5B 4RFNB 3U83A 5CCKL 4G6AD 3TPKA 5C9JA 3LQAH 5DRWB 4P57B 1Q94A 4A6YH 3BYTA 1D5BB 3T08A 3QI9C 1J1OH 3JBG7 3QFDB 4OLVH 5C70A 3MLXL 4FQLL 3TBTB 5TJWK 1KBGH 2FHCA 2XZAH 2DQHL 4NRYB 4JN2B 1E6JH 3LKSA 4NSKB 4YFEA 3B2UC 2HLFC 3CPLA 3C2AH 2COQA 3IAPA 3HKFA 4AEIH 5HVWA 5D5MF 5ESAA 4KRMB 4KJWC 3SKUD 3CMOH 3VI3E 2HMID 3CSBA 2V7NB 1QSEB 1RUML 4GRMB 4N5UA 1BWMA 1IE5A 2NY7H 5C0CE 1RZGB 4R0LA 5DRZB 1MCEA 2NX5D 4ZNEE 1JHTA 3UEZA 2OTWA 2X4NA 2QL1A 3EZ8A 4PJAF 4OGAC 3VXSA 3QISA 4ZXBA 5CJQH 1BAFH 4P46B 3NAAL 4IM8A 4L29A 4M6OH 4P9ML 1VERA 2H6PA 1IEAB 2DI9A 1NUGA 1RULH 3FCTA 3HUJF 3VI4F 3WUWA 5L2KA 1YPZF 3HE6C 4L5FH 3SJVB 1A7QH 5C0GB 2RCSH 1VENA 3H7BA 1T1ZA 3BP7A 2JELL 3L5XL 4EJ1C 3QO1B 2P8MA 4Z18A 2GCYA 2GFBB 3CU7A 4KJPC 4AT6A 4CAGA 1S3KL 2VLRD 3S3PA 3VRLF 3B9VA 5EPMB 4HWBL 1S7QB 3QNZB 4WJ5B 3ARXA 1A1NB 4HIHA 3HNVH 4U1MB 2DKSA 2AJ3A 3HC4H 3LZFL 5FDYA 4HLZG 2OX5A 2XA3A 4V2CB 3LD8B 4PJEA 2NY3D 1ZHLB 1OAXH 1TCRA 3RIFK 4Q7DA 1JYXA 2MJWA 3MLYL 4DCQA 4XP5H 4FQ2L 2Z0BA 4PJIE 2YEZA 2ZUYA 1KTDB 3VFUB 1EFXA 3MRPA 1BX2B 4ODTH 4PYGA 5DMGD 3WO4B 5CLTA 4ERSH 3WS3A 3HR5A 5AZEL 5DRXB 4E41B 2PTVA 3H9SA 3IDIA 4K71C 3ROOB 2P8PA 3BPOB 4NO0A 1HEZA 4L8DB 1OM3H 2FX9L 4LPXA 1J0YA 1I1FA 4NC1E 5D5MA 2AJSH 4O5LL 5FHAL 4X4ME 3MRIA 1ZVSA 1O0VA 1DBBH 1LEKB 3IJSA 2V2TB 4RAVB 1JTTA 3RY6C 4NRZA 4PV8B 4XP9L 1U8PB 2DIJA 3D9AH 4ETQA 5EIVA 1GPOH 4NQVB 2JB6B 1ZA6B 4WI3A 3WEXA 1JHLL 2YPKA 3S5LB 1ZHNB 3WE6A 4NFCA 1CLZH 5LJYH 1AO7E 3I6GA 5ITFA 1MH5A 3WLWD 3PL6D 4PJAA 4JZOB 4LRNH 5F3BA 2ZSWB 4M7JL 5DJ0B 3F7RA 1GGIL 3G6AA 1YPZA 1G9EA 1MJUL 3FT4A 1Y18A 3CMGA 2FIKB 4JPVH 3ZKND 1G7HB 5BXFA 3P11H 5CCKH 4CU7A 3ARPA 3DX7B 2JCCF 4Z7UA 1HH9B 4GRLD 2DWDB 2HKFL 2Y5TA 3MRDB 1WEJL 5DMGC 1N6VA 3MUHL 3MLXH 2R2EA 4FQLH 4IBLT 3TBWB 3K4AA 4NHUA 5LQBL 2DQHH 2C7UB 3BRGC 4JKKA 4HDIA 5D7KD 1EEYB 5HYEA 1X5YA 3VXOB 3MC0A 1DEDA 4XHJD 2F54D 3K8MA 2L0DA 2ZOLB 1CZ8H 1IEHA 5FUZL 3W9DA 2VMFA 5TGBB 1AGDB 5I8CB 1BJ8A 2RB8A 5D7SL 5EBLA 3UXFA 4DUVA 4JFFE 5CJ8A 5CP7B 1C16B 1Q8MA 1RUMH 3U79A 4Y8AA 3D2UD 3EDKA 4OTXL 1FNGB 4MSWB 5MHSD 2FECI 4N0FB 4MNGB 1T1YB 2Z8SA 2F53D 1U93A 4PLJC 4BJLA 1PY4A 1T22A 4G5ZL 4PRHB 1X5LA 4Q9RL 1I8LC 4L8SC 5TF1L 3KWWA 3MCKB 3VFSA 4O02L 4P2RE 3SPVB 4OSUL 3NAAH 4P9MH 5E1AB 4Y5VC 3MJ8B 4MJ5A 3F12B 2MQCA 4RMSA 1OT2A 1TZGL 4O2FB 5DUPL 5DRWA 3S88L 3MOBH 1BFVL 3E2HB 3T65B 5D7LE 1D5BA 3GNMH 3QFDA 4JY5L 3TBTA 3ZKNC 2JELH 3L5XH 4MLSA 2M2DA 3FQUA 4TUOA 4ZD3L 4G7YH 1HXYA 4NRYA 1S3KH 4NSKA 3GSRA 2QTEA 4HWBH 4GRLC 3KPSA 2D0GA 5F7YC 3ARDB 1OP3H 1W0VB 3VFPA 3LZFH 4P4RB 5DJAA 3C5JA 2V7NA 1QSEA 5F89B 5JDJA 2VZ1A 3EJJX 3SGJA 1HNFA 4JCLA 1NC4B 5DRZA 4LSSL 2GUOB 5CLWA 5BS0D 2Z91B 1OSZB 3PQYE 4FQ2H 2XV6B 1FVEB 5F1IA 5JPMB 3QFJB 4AQOA 1S7XB 3EYOB 4KUCF 4L8BB 4P46A 5F1NB 4DK3A 1T6VN 4KKBD 1IEAA 3D69B 4U3HA 5AZEH 3QA3B 1SVZA 1J88A 1BZ9A 1LO0H 1I1RA 5C0GA 2Q76B 3TP4A 2FX9H 5FA3B 3VE0B 4L3EE 4KHTL 1AKJD 3T0BA 4D9LL 3BAEH 1CL7L 3IYLW 4XRCB 2NY6B 5FHAH 1PYWB 3O6FD 5EPMA 2FWOA 1KN4L 5C0ND 1S7QA 3L9RA 3BPCB 3GMPB 3QNZA 3WJJC 2WIMA 4KXZH 3RI5F 3PHSA 4WJ5A 4F7EA 2DQDH 2CO6B 3DV6B 5E03A 3VFMB 4XP9H 4MNHB 5DC0A 5K9QI 5DGQA 2BC4B 1JHLH 5T3ZE 5T5NG 4F15B 1A9EB 5KVGH 1M05B 3O2DH 3PGFL 1ZHLA 1NKOA 4ORZC 5GZOD 3MLWH 4GW1B 1N26A 4M7JH 4PP2B 1FVDB 2E9WA 2GSIB 1KTDA 3VFUA 3R1GL 4N8PA 5IGXL 4YDVA 1BX2A 5F70A 5GS2H 1MJUH 4DEPC 3SDAD 1CE6B 5DRXA 1A6WL 4E41A 4ZTPL 3S97C 1NGYB 4L8DA 4LSQL 2H3NA 1YUHB 3JZ7A 1WEJH 4KKBC 2I9LB 1NPUA 1PQZA 3PWVB 2PW1A 4O2CB 5LQBH 1QSFB 3QJFB 1LE5A 1FAKT 4PG2A 2GYSA 3JV6B 1LEKA 4OF8A 2F74B 2V2TA 3D3VB 5J57B 4P49A 4D0BB 1F11A 4WI9A 2WLYA 5FUZH 4PV8A 5FYKD 1DZBA 1U8PA 3U46B 3MZTA 2JB6A 1ZA6A 5I19L 5BOPA 3O6FC 3S5LA 5C0NC 1ZHNA 1NSNL 4Y4FD 1P84J 4NKDB 2EXWD 4OTXH 2YD2A 4JZOA 1U3ZA 1KN2L 2ZSWA 3O9WC 2N4IA 2BMKB 3P4MB 3DJ9A 3ULVC 3QQ4B 4NQDB 5DJ0A 2P49B 3U9UA 1RHFA 1F3DH 3U7YL 1UH2A 4JM2C 4Q9RH 4G5ZH 5C07E 3HZMB 5TF1H 3QCVL 2FIKA 4P3WA 4O02H 2A2QT 1G7HA 4OSUH 4RWHA 5F8RC 5C0FA 3DX7A 5GQBA 1TZGH 5DUPH 3VGGA 1PVHA 4X7DC 3S88H 5E24E 5HGBB 2DWDA 4JY5H 1FCCA 1HIML 3MRDA 3LV3B 1N3NB 5GGTA 3TBWA 3SDAC 4O4YL 4YHIB 1UWEL 4ZD3H 3SE3A 2C7UA 2X4RA 2HJFB 1N6QH 4QRRB 1EEYA 3U4BL 3VXOA 5C6PB 2ZOLA 2VLKE 4JRXD 5T3XE 1JPFA 1CXEA 2H2PD 3UTTD 1AGDA 5I8CA 2APBA 4PLKC 1XGUB 2DI8A 1MF2L 1KGCE 5CP7A 2VLMD 3GSNB 3S7GA 4PD4J 4WHCA 4CN6A 4MSWA 4I48B 4GS7B 4I18B 4D8PB 4LSSH 4Y5YC 2I5YL 4LPUA 3V5HB 4U1GB 2QSQA 3T4AB 4ZOEA 4PRHA 2J5LB 4Y4FC 3BZFB 4H26B 5I1JL 1FFPB 2EE3A 2ICWI 1ZVHA 3X3FL 2BY0A 4CRPA 3SPVA 5E1AA 4QY8B 1NLBL 3MJ8A 1HHHB 3F12A 4OF3A 4WFED 3BPLC 4CDGC 4O2FA 2CLRB 2PUQT 1YDPB 4N0CC 3NIGE 2EYTB 2Y07L 3MRLA 4XX1E 3WFCL 3KNBB 2YKLL 4QRUB 1AXIB 5B8CB 4PJ5A 2Q87A 3WNKA 4OI7A 4KHTH 4D9LH 1CL7H 4F80A 5ESVB 4Y19B 1RZJL 1KN4H 5KS9E 4JQVA 5HHNB 5KVMC 1WCQA 3S34L 3ARDA 3LCYA 1W0VA 3WYRA 4BH8A 2DRUA 5EIQA 5IM7B 4P4RA 2X4OB 3EJYC 3VXRD 1A02N 4HCRL 5DJZB 5F89A 3DXAD 4P23D 2K3TA 4OD2B 4GXUM 4IDJL 3PGFH 2G2RB 2Y06L 2H2PC 5I1GL 2YPVL 1NC4A 2GUOA 4YK4B 2Z91A 1OSZA 4XPHL 1FVEA 4Z76B 5I9QB 3QUZD 2ZSVA 2B39A 5JPMA 3STZB 3R1GH 1ITCA 3FAXA 3EYOA 5IGXH 3MRRB 4XBPB 5F1NA 3MV7B 2UY6A 3D69A 4ESKA 4AEHL 4W4OA 1A6WH 4ZTPH 5EUOE 3MRBA 2Q76A 1UCBL 3DIFB 4HH8A 4LSQH 5FA3A 3VE0A 5C09B 5IJVB 2W0LA 5KANG 1HDMB 2E8YA 2DS4A 1C7TA 1PYWA 4P3DB 3PWUB 5DC4B 1MEXL 3BPCA 1H3XA 4RIRB 2WUCL 1K4DB 2ORBH 3DV6A 5JW4Q 3VFMA 5SWZD 4DTGL 3VXME 3FONA 1CGSL 5I19H 2BC4A 3TN0B 1AC0A 2WBKA 1NSNH 1M05A 5I1IL 5J56B 5GGVY 4GW1A 5KSUB 1JGLL 4CVZB 1KN2H 2EIDA 1ZGLP 3JWOL 4JM2F 4PP2A 5E2UL 5FA4B 1FVDA 1VFMA 4XB7A 1KJ2A 2GSIA 3EOAB 2JB5L 4BSJA 3U7YH 1U3HB 3DVNB 4P23C 4KKCD 3FFCD 4NQSB 1SBSL 3QIBD 1DQDL 1XF3B 3QCVH 2HTKC 1CD9B 1IGJB 1RZ8B 4JRWA 5DWUL 4OZIE 5EZOL 1FZKB 1RI8A 4F37F 4NFDA 1CE6A 4R3SB 3LHPL 3QUZC 1D3CA 2W60A 3TM6A 3UO1L 3ZL4L 3S4SB 1NGYA 2XTJE 1RK0B 1HIMH 3ZLQC 5LWYL 2I9LA 3OF6D 2VDPH 1UWEH 4TUJA 3PWVA 2HFEB 4O2CA 4GH7B 2CIKB 1QSFA 3QDMB 3QJFA 3U4BH 1MI5B 2JE8A 4PJFB 3DI3B 2F74A 3GMOB 1U8IB 2ITDA 4KU1A 3D3VA 5GRUL 1K8DB 3BEVB 1AGEA 3T77B 4D0BA 4JQIL 1B6DA 1FZOA 4CN1A 3ZYZA 3H6JA 3U46A 4UT9L 3SBWA 1MF2H 4BELD 3IS0X 1AIFB 3T2NL 2YZ1A 3O8XD 5I71B 2PXYB 3G9AB 1QEWB 1V3MA 5I15L 4J3OC 5KOVC 3RWEB 3C08L 2BMKA 3NZHH 2J8UE 3RWIA 3VXQA 3QQ4A 4NQDA 4I13B 1QBLL 2I5YH 4JFYB 3MRGB 4GBXB 2K1MA 5DI8B 3ARBC 4M43L 1JBJA 3MJ6A 5I1JH 5MEPB 3HZMA 3NCMA 4LQFL 2R1YA 4UTBL 3FO2A 5LGJB 2YD3A 1NLBH 1U92B 5C0CD 4H1LB 1KYOJ 2BOCB 3U36B 2IC2A 3IETB 5DK2A 4OF5A 3LV3A 3DVIA 4ODXB 5IFJB 5M94B 4JCMA 1LO2L 2YKLH 3VMOA 2DM4A 4QNPF 1LK2B 2HJFA 1JZ8A 2R4RL 5EBWA 2W92A 1CD0A 1RZJH 2BERA 1EVUA 1GGYA 3EFFA 4WFFE 5C0BD 4FNLL 5HHOE 3S34H 3WXVL 5ICYB 1MHHB 5A2KH 4X4ZA 4BKLB 5FB8B 5BRZE 3NFPB 1NLDL 1S7RA 2BNRB 3Q3GA 4ACPA 4X5XB 4DJMA 4K8RL 2H2SD 4ETYA 2KQMA 2JIXB 4HCRH 5DS8B 3GSNA 2HFTA 5FGCE 1FNFA 5BZDA 4RSVA 4IDJH 1D5IL 4RA3A 3ARZA 2L7UA 2Y06H 3VXTB 5I1GH 3DARA 1CGVA 2YPVH 4Z7VE 4I18A 5DMIH 4GW5B 5B3JE 5HHMD 4LASL 2CKBB 3UJTL 5ITBL 3T4AA 4XPHH 1CIUA 5AG9A 3BZFA 4H26A 4ZFGL 1FN4B 1FFPA 3R0NA 3O8XC 4H8WC 4R2GB 3WIHL 4IIQC 5IBLD 4QY8A 4GRWB 4C58B 1Q9WB 4GXVL 4AEHH 2CLRA 1YDPA 1FFRA 3DGCR 4U05A 3HG1E 4M6AA 3GJFA 1YMMB 4KTYA 1IMHC 5F9JA 3KNBA 4QRUA 3WS6C 5B8CA 3LN5B 4LCCC 4XPBL 1QYGL 1EBPA 1T21B 4U0RB 4F9LA 4FTVB 1U3YA 2OTUB 3RWCB 3QIWD 5ESVA 2Q3ZA 4LLQB 3VXUE 2BVEA 4GG6E 1MEXH 3HFML 5HI5D 5HHNA 4F3FB 3U82B 1MFAL 1T1WB 2WUCH 1ACZA 2GHWB 4ZXBD 4ZTOL 3RTQB 3MLSL 5IM7A 2X4OA 4DTGH 1VESA 4PJFF 4WO4B 5DJZA 1OAZH 5L2KD 5CEZE 3WNOA 1B2WL 1OWWA 4OD2A 1JFQL 4NN6C 3PDGA 4Q6IB 5JZ7C 1OGAA 2G2RA 5T1MB 5KZCD 5I1IH 3AB0B 2FDBP 5FOJA 4Z5RA 1JGLH 1KXVC 3JWOH 1HINL 4MJIA 5E2UH 4BZ1L 2H2SC 5F9OH 4M93B 4Z76A 2JB5H 3STZA 1K3IA 1FQ9C 3MRRA 1SBSH 2BY1A 4XBPA 4OV6F 1BGXL 4J6RL 1DQDH 3MV7A 5DWUH 4JZJC 3C09B 5EZOH 12E8L 2R1XB 3AAZB 5D96B 3LHPH 1AO7D 4LVNB 4OFDA 4UU9B 3PP3H 4FQPA 1JHKL 5E8DL 3UO1H 3ZL4H 4LEOB 1CDIA 3CVHL 2JJUA 4AY0A 5LWYH 5C09A 5IJVA 3QDHA 4GQPH 1HDMA 3VG9B 3IVKB 2HRPL 4P3DA 3PWUA 3Q0HA 3PV6B 1KLGB 3HC0B 3K74B 1EFXD 5HPMA 5GRUH 3BQUD 4JQIH 2XZCL 1AR1D 1Z0MA 5EULV 4R0LC 4HK0B 3DUSB 3G5ZA 1KIPB 4UT9H 3IDUA 3TN0A 3QIWC 2FR4B 9CGTA 5HI5C 1T5WA 3H9SD 4GKSB 1Y6MR 3T2NH 4XP1L 4NO0D 1I1AB 3HE7B 4Q9CA 2DOCA 5KSUA 5I15H 2W38A 5E6IB 5CJXA 2ZNWA 3C08H 1YEHL 1QBLH 1NDMB 5MENE 3MV8E 1U3HA 3VH8G 4AIOA 3DVNA 4M43H 4NQSA 5EN2B 4LQFH 1RZ8A 3PE9A 4UTBH 1FZKA 2JJWA 5ELIA 4B41A 4R3SA 3QUYC 4TTDC 2OJZH 2CRMA 4GRWF 1RK0A 4PJIB 4AQ1B 3OSKA 4GXUN 2HFEA 1LO2H 2CIKA 3QDMA 1MI5A 2R23B 2R4RH 4PJFA 4MQTB 3GMOA 2M26A 1U8IA 2BHZA 4POUB 1GJIA 1K8DA 2ARWA 3BEVA 4FNLH 3LKNB 3WXVH 5IB5A 5JIPA 5CHNB 3DYMA 1JMXA 1NLDH 2Y1VA 4OCNC 4K8RH 3L5IA 4HJGB 4P9HC 4IRZH 2PXYA 2YWZA 3BRFA 3BQUC 1D5IH 2BXYA 3KPRE 3RWEA 1AR1C 4JFYA 4HGWA 1UVQB 3MRGA 4BQ9A 3UJTH 1YN6B 3B5HA 3MOAL 3I3EA 4X83A 5JLZB 1M6OB 3U2SA 4ZFGH 5MEPA 1CYGA 5ABDE 3O0RL 3Q6GL 2YA0A 3V0VB 2A77L 3BDXA 3WIHH 5F7LB 1MCSA 3EJZD 5LGJA 2WP3T 3KG5A 2VLJB 1DQQA 1U92A 3GBML 2J8OA 2AXGB 4GXVH 3UDWC 4L4TE 1CFNB 2AEIT 5E1HB 3R8BB 1MCIA 3VI3F 3U36A 3IETA 5CKGA 3O4OC 3MPCA 5E08L 5IFJA 1QD0A 1GGCL 1LK2A 4XPBH 1QYGH 3QH3B 1CLOL 2Z8RA 2A1WL 2AW2A 1KCSH 1O7VA 2MOVA 4S0TD 3HFMH 1CGTA 5ICXA 4G9DA 1KCVL 1MFAH 1MHHA 4B50A 4ZTOH 4BKLA 5FB8A 2Q6WB 2BNRA 1EO5A 4NBXB 4X5XA 3RZCD 4NZUL 1VGEL 4YHKL 4NKIL 4RGNB 4KRNA 5CJ5A 1EAPB 4XXCC 1B2WH 1JFQH 2BNUB 4TSCL 1D5MB 1IC4L 3VXTA 4I4WB 2E7BA 2CKBA 1HINH 4BZ1H 4LGPB 4BM7A 1A6UL 1G6VK 2PYEB 1S7UB 4PV9A 5FHBL 1MLCB 3KPSD 4J6RH 4LGRB 4PJHE 2VERN 1Q9WA 3SKOB 1JGEB 2AK1L 4M6ML 1DP0A 1LEGB 3QQNA 5CINL 4Y1AB 1QSED 1JHKH 1YEIL 1YMMA 4BA8A 4U33A 3EJZC 3ETBF 3LN5A 4M4RA 5IFAL 4FTVA 3RWCA 1KPUA 2OTUA 3S36L 2HRPH 4LLQA 4P2RB 1Z5LA 3QXDA 5DQDL 4PJIF 4F3FA 4OF0A 3VJ6B 2ERJB 2XZCH 4G6KL 4PGCA 4CMMA 1KT2B 3ZKSD 2K7QA 3GMNB 4WO4A 2HTLD 1LEIA 4U0QB 4MA1C 4YBLC 2RGSA 4Q6IA 5T1MA 2C3HA 5I18L 2H8PB 4GKZA 4YNYB 5MEQB 4JDZA 3RZCC 3BGFC 5T1LB 1JV5A 1YEHH 1QLEL 1VKXB 3TO4D 4MA3B 3WN5A 4KI1A 2DAVA 1Q38A 2R2CA 3IRPX 4XNZB 1OF2B 2NW3B 4JQXA 1GHFL 3PDDA 4ODWB 5ERWB 3L5WB 5E2WL 3IDGA 2LU3A 2R1XA 3AAZA 4GAGL 2DM7A 3ECBA 5GS1B 4BFIA 4ZFOB 4UU9A 2VE6A 1EX0A 4LEOA 1UWXH 2FZ3B 2CDGA 3IXTB 3LB6C 1HZHL 3TYGL 3IVKA 5C07D 3RRQA 2BVTA 1KLGA 1BIHA 4M7ZB 3HC0A 3DRTB 4DVBB 4FQCL 3ARGB 4JFDE 4HK0A 3DUSA 2A6IB 3B9KA 3QEQB 1TQBB 4PJXE 3LY6A 3WHXB 2FR4A 3JTTB 2RHEA 1YEGL 1Y6KR 5D2LE 4E41D 5DVKA 3W39B 4GKSA 2W0FB 1INEL 2H45A 3BKYL 3HE7A 5E6IA 4S1DD 1XT5A 4W6YB 1EJ6A 3RIFF 1ADQL 4NNXB 1NDMA 2HTLC 4ONOA 3MOAH 4JO3L 1CFTB 5CP3H 5EN2A 5FKPB 5FF6A 4PYHA 4L3CB 3O0RH 3Q6GH 2A77H 1J1XL 1DFBH 3GBMH 3GBLA 1R3LB 1S9YB 5I17A 5C0DB 4DUWA 3TO4C 1KELL 2DQIH 2AERT 5ETUB 2VQUA 5E08H 2IQAB 3VGBA 15C8L 1HI6B 1GGCH 5ICZA 1CLOH 1FFOB 1GOHA 2A1WH 2R23A 4LPYA 5IW6B 1IC5L 2Y7QA 2GT9A 4KY1L 3LKNA 1KCVH 3QDGE 5CHNA 4DAGL 1I8IB 3NOIA 2G5BA 3FQRB 1U42A 3H0TB 5GGRB 4NZUH 1VGEH 4YHKH 4NKIH 3D5OF 1EHLL 4D2NA 4TSCH 1IC4H 4PRNB 5TDOB 3RX7A 4GSDL 4OD3L 1UVQA 3RA7L 2X6MA 3GSUB 1A6UH 3ZYIA 1M6OA 4MX7A 3NPZB 4CADA 5J1TC 1T83A 1FAIL 4MNQE 4O2EB 5CSZB 1TNNA 4S1DC 2VLJA 2A83B 3OHXB 2AXGA 2EZ0C 4I1NB 1CFNA 4M6MH 3PHQB 4LHUG 4B7LA 4PG2C 5CINH 3KLSA 1NCWL 1YEIH 4HBQA 2NLJB 5E2JA 2JJTA 3H3PL 3QH3A 5DJCB 5FYJL 5IFAH 4OJFL 2OCFD 3NACH 3B83A 5DO2C 3S36H 5DQDH 3WKML 2X2YA 4PRHD 4KK9D 1RIHL 2D3VA 1IKNA 2Q6WA 4G6KH 1QHOA 4ZQKA 2ZUTA 1GH7A 5DHYB 2DD8L 3JWNC 2BNUA 1ZK9A 5IIEB 3CFEB 3DUHA 3WFZA 4QTHB 2PTUA 2NNAB 4PJ5D 4Z77A 2FJHB 1QLEH 2PYEA 1KENL 1S7UA 2FX8L 5B3NA 4HUNB 1WC7B 4X7TA 3U6RA 4NNYB 2YPLE 3SKOA 2OM5A 5E2WH 5HYQB 4H0IA 3SE3C 4GAGH 4PRAB 3FT3A 1EHAA 4Y1AA 5JHDE 5DD0L 3VGFA 4EVNB 5D1XD 2ED7A 5I74B 4KHXL 4I5BB 3K46A 1V3LA 1OTTD 2YHGA 1W2KT 1NC4D 1HZHH 3TYGH 2F8OA 4RGMB 3CCHB 2HAZA 3FHAA 3K80A 5AEAA 1ED3B 4WEBL 4FQCH 2RBLA 2XFXB 3EIFA 1KT2A 2NZ9D 2V5RA 3ZKQD 3GMNA 1FJ1B 1QTYT 2J12B 3CX5K 3V6OE 4P48A 2NYYD 4KK9C 4Y0GA 1KCLA 4YDLC 4YNYA 1INEH 3BKYH 4UQ2B 4XWGL 5F7DA 5DJ6B 1MLBA 2AI0L 5BV7C 1A4JB 5KANI 1ADQH 4LVOC 1VKXA 2NY6D 4MA3A 5D70L 4JO3H 4J4PA 5ERWA 1OF2A 2X4QB 5E99L 4ODWA 4KWUA 3ARWA 4LP4A 1FE8L 4X9BA 4XC1H 3ALXA 5IHZB 3MFGB 1J1XH 2CKNA 5DK0A 4ZFOA 4ODHL 1KELH 3P77B 3JTSB 4JANB 4JQVC 4O00A 5HHPB 2VYRE 2ARJQ 3MQIA 1CFQA 5EO9B 5CGMA 3IXTA 3SOBH 2DQTH 15C8H 4X6EA 3KPQB 1KLUB 5C9KA 4K3HA 4EIZC 3O41A 4HW6A 3RKPA 4PS4L 3P0YL 4XBEL 5D1XC 3VA6A 1IC5H 3DRTA 4KY1H 4DVBA 3BZEB 3JV0A 1OTTC 3RU8H 3B6SB 3AU1B 4FRWA 4DAGH 2A6IA 3QEQA 3WHXA 3JTTA 3W39A 2VIRB 1EHLH 2W0FA 4OFVA 2ICES 5D6CB 3O3BB 4GSDH 1N8ZB 4Q97A 2NZ9C 3ARRA 4OD3H 3ZTJG 4YAQA 1NGXA 3RA7H 4ZUTB 3NIDE 1T03L 4WFFD 2YMXL 5ID0B 4W4OC 2XTJC 1KEML 1CFTA 2NYYC 3D48R 5FKPA 2LTQB 3CDYA 4L3CA 1FAIH 3D3VD 5GGUB 3MLZL 1JNNL 5B21A 4PRIE 1IGFL 4NZTL 1FVCB 1R3LA 1S9YA 5C0DA 5IHLB 5J6HB 4NBZB 4FA8A 1NCWH 1ROWA 2EKJA 5DDHB 5ETUA 4BQ6A 1R0AH 4M5ZH 3SGDI 2IQAA 1HI6A 1FLTX 3H3PH 5FYJH 1P69B 4NQDD 4OJFH 5FV2A 4NQCE 5IW6A 3Q5OA 2ATKB 1BVKB 3WKMH 3IDNB 1NBQA 1RIHH 3DSNA 3DMMB 4Z7NE 3ULVL 3QJHB 5GGRA 5GGSB 5HYJA 2D7PA 1U41A 2VLLA 1UB6B 4ZAKB 2DD8H 3LN9A 3NIGF 5JO5B 4PRNA 3BH8A 5TDOA 5L0QC 1EMTL 3WIIL 1EHNA 3QAZC 5DURB 2X1PA 1DBML 1LQSR 2DYPB 2LAGB 5CJBA 2FX8H 3RDTD 2ESVE 5J9PB 3K4ZA 1VB9A 3RVVC 2DLGA 2NW2B 4O2EA 3UYOD 5CSZA 1ORSB 1LGVA 4AZ8A 4QHUB 2NXYD 3OHXA 4GO6B 3G5YB 3KLHC 3HZYA 3TZVA 3IRZA 3K7UA 3QRFM 3PHQA 5L6YL 5IWLC 5DD0H 1E4WL 5T5FL 1QVOB 4XH2B 4KHXH 1INQA 3VFWB 2KZ1B 2NLJA 1URLA 3D87B 3GGWA 5IVZB 1IGCL 3NZ8B 1G9MC 5DJCA 1KXQE 4JRYA 5GSVB 4Z0XB 1DQLL 3RNKB 4WEBH 2NY4B 3FO1B 4R7NB 1L6XA 4S1RL 4NWUL 3WFBL 5DHYA 4C54A 1NQBA 5IIEA 4NP4H 3CFEA 4QTHA 4XWGH 2AI0H 1M1SA 4WY7L 4PJDE 3F6IA 3SQOL 5F6IB 1WC7A 1RY7B 4DKDC 5E99H 4MD4A 3L3IA 4IRJB 4YO0A 3ULUF 3FQWB 1FE8H 4XPFL 1FYTE 1UJTA 5DR5L 4PRAA 4D3CL 5HHXL 4D0CB 4X7CC 1M7XA 2FJGA 3RDTC 2VUOA 4ODHH 3MRJB 4EVNA 2E7LC 1YEJL 2D2OA 4JG0H 4X6FB 1OARL 5EBMB 4LIQE 1OGAD 4TULL 1K5NB 2NXYC 3MJ7B 2FD6L 1AHWB 3TJHD 4P2CG 3TNMB 4XCEB 4MJID 4XTRC 4OZHB 3WIFB 1ED3A 3L3GB 3P0YH 5E4EB 4XBEH 1SY6L 3IAQA 3ZSSA 1W0WB 2XFXA 4HXBL 3MV7D 1G6RL 1FJ1A 2F5AL 3DROB 3O11B 3JVGC 1NAML 3O3UN 2GW5A 5JOFA 3O4LB 2P5WE 4UQ2A 3VXUB 2IG2L 3WSQL 5GPRA 4GG6B 4IRSA 2BNQE 5C09D 5D6DC 4P2QE 3NCFB 2E6PA 3DURA 1T03H 4OBRA 2BVQB 1KEMH 2X4QA 3TA3B 1BBDL 5DHVB 5HI3D 4W70A 3MLZH 1JNNH 2GTWB 5IHZA 1IGFH 5B8CC 5F3HB 4IHOB 3L7EB 4NO5B 3B9EA 3JTSA 5FM8A 4JANA 2PTTB 3I02B 3NPSC 2FBJL 3ET9F 3WL9B 4PJ7E 3KPQA 1KLUA 1L0XA 2X4TB 4RFEB 2FX7L 1FYHB 4HS6A 1RD6A 1U3HD 4XNQB 5K33A 3BZEA 3OR6B 3B9AA 4UDUA 4R9HA 1XIWD 5ISZE 3B6SA 3AU1A 4JJHA 4Q6YA 3TJHC 3ULVH 3IFNL 2BRRL 3PP3K 1Z9LA 1Z6JT 3CIQA 2VIRA 4P5KB 5E5UB 2OZ4A 1IZJA 5E00B 3CUPB 4X4XB 3O3BA 4ZOBA 1NBYB 1EMTH 1QNZL 4WUUB 1QRKA 3WIIH 3HRPA 4M1DL 1QO3B 1CS6A 1DBMH 3QDMD 5ID0A 4TQEH 1AJ7L 1JE6A 1MI5D 3OKDB 3BXNA 2Z31B 4X7SL 5GGUA 1FSKC 5KSVA 3ZT6A 3AUVA 5DEFA 4HG4K 3ALPA 1XGQB 1FVCA 4HAGA 4LEXL 4YHYB 3CH1B 5J6HA 4IEFB 5L6YH 3O6LH 3D39E 1ES0B 3P30L 1E4WH 3IF1A 5MENB 1JF1B 5HI3C 2PXYD 1UKSA 3V95A 1IGCH 4Z7VF 1MWAB 4M8QB 4HK3N 5DA0B 3U30B 1DQLH 5B3JF 3CXDL 1BVKA 3IDNA 1UM6L 1ZGLB 4JDVB 3TVMD 5GZND 2XI9A 4A6YB 4G43B 5E5MB 4J8RB 3B8SA 3JWDC 5E9DB 4DKAA 3DMMA 1YNLL 3QNXB 3S35X 5JPNB 3QJHA 5GGSA 2AQ2A 4NWUH 5CD3A 1MQKL 1V7NL 3EGSA 4Q58C 4Q9BA 3WFBH 3MRCB 1UB6A 4ZAKA 5IV2B 1XIWC 2BCKB 2H9GB 2YK1L 5J6GB 1ZLWH 8CGTA 4XBGB 4XVTL 2DYPA 5IMMB 1QFWL 4WY7H 1T0PB 5J9PA 2LFGA 3M07A 4RDQG 3SQOH 3QXWA 1RUQL 4OAWB 3TEUA 2R0ZL 1ZAGA 3LRGA 1N59B 1PX3A 1UXWB 2NW2A 4GG6F 1ORSA 4K3JL 3GI8L 4J3UA 3QUMH 3L1OL 1NJ9B 3DNKA 4XPFH 3V5KB 5I73C 4JB9H 5DR5H 4UAOC 1JRHI 4H5SB 4D3CH 5HHXH 4HPOL 4Y16B 1QVOA 3FOMB 1YEJH 3VW3L 4XH2A 3VFWA 1OARH 4QOKE 1ZEAL 5IVZA 5IMLB 4HLJA 1ZWIB 5AZ2L 3MROA 3VH8B 2FD6H 5GSVA 1IAKB 4FQXB 4Z0XA 2OQJB 4AL8L 5CD5C 4NT6B 4K7PL 4ZG1A 3RNKA 2W07A 4LVEA 1H5BB 1SY6H 3D0LB 4XGZB 3FO1A 4R2GD 4R7NA 4NN7C 4HXBH 4V1DE 3MNVB 1G6RH 4JHWL 2F5AH 5ADOL 4M5YL 5D93C 3TH4T 1IAOB 6CGTA 4NJ9L 1NAMH 3TVMC 4C59B 5FYLD 4H8WL 4NHCL 4RISL 5GZNC 2XPGB 4HC1A 1YMMD 1RSFA 3VA2C 2IG2H 3FB5B 4UILH 3WSQH 1S7TB 3FOLB 4XXDA 2G9HA 2F58L 4PP1D 1V7ML 4PJBE 1BBDH 3GKZA 4PY8J 3BT2L 4IRJA 5JW4M 1IL1B 3FQWA 3SKJH 3WUWG 1IQDB 4CW1B 2FO4B 4D0CA 4PBWD 3GFUA 5BW7A 2XQYK 4OCXL 1T7YA 1UT9A 4Z0BL 4JPWL 1CTOA 5EBMA 4ONGL 5DUBB 1MJJA 1K5NA 2N7BA 1MAJA 2FBJH 4HIIB 2A0LD 5JXAL 1DL7L 1MIML 1RUKL 1GAFL 5CEXB 1KJMB 3TNMA 4OZHA 3OB0H 2BVPA 2VZTA 3WIFA 2FX7H 3L3GA 5FAAA 4KRLB 5GJTL 4IMKA 3QHFL 5B39B 3U7AA 2HVJA 1PX4A 2K7PA 3SE9L 2C3WA 3IFNH 3ARUA 3O11A 3IFOA 1G9NC 3T3PF 1MNUL 4MAYB 2HRLA 3O4LA 2IPTL 1BVLB 4GG6A 3AM8A 4WDIB 5C08E 4M1DH 5D2NA 4HXAL 2R69L 4KV5F 2BVQA 1AJ7H 5FGBC 4QHKJ 3TA3A 1D9KB 1KB5A 1H0DB 5DHVA 4X7SH 3PABA 4OI9A 5F9DC 3UC0L 4P59H 1JPSL 5EWIL 5F3HA 4IHOA 3B9KD 4JFOA 4PP1C 4NO5A 3VGAB 2GJ6B 4W4NA 3K4DA 3ZKXC 5DJYB 5SWSB 1BBJA 3P30H 2GTZB 5DC9B 3DRQB 3HE7D 1NFDE 3WL9A 5E6ID 5E94B 3G04A 2J6EL 2X4TA 2OSLB 5FK9B 3CXDH 4MNQD 4Y4KB 1UM6H 3OR6A 2UWEE 3ES6A 5TDNB 3ZE0F 1YNLH 3SDDA 3IGAB 1CN4A 1FL6B 2PW2A 1CXIA 3LKRA 1QUNA 1MQKH 1V7NH 4M93C 1LD9A 1UWXK 1A2YB 3WN5C 5E00A 3PXHA 3VWJB 3CUPA 4LU5L 1QBML 2VUYA 4X4XA 2WWMC 1U8LB 4LVHC 3OKNA 3M8OL 1NBYA 4WUUA 3WUZA 3UROR 4RX4A 1QRNA 3MA9H 3QUXC 4XVTH 1CTNA 3DBXA 1N2RB 1QFWH 3OKDA 2OL3A 3KXFE 3OL2A 1FP5A 4KDWA 2Z31A 2R0ZH 4PJXB 5CSBA 4K3JH 3O3EB 2IADB 1IGML 3GI8H 3JV4A 4UDTB 4LSUL 3L1OH 1BVZA 1G1CA 3VG9C 4FMKA 4XCCL 3CH1A 4HPOH 4KI5F 1ES0A 3TPUB 5EU6E 1I7RA 4P4KA 1JF1A 1MFBL 3PXJA 1ZEAH 1ZHBB 2AV7A 1DVFC 5AZ2H 4M8QA 3OKOB 1KFAL 4N0UB 3B9KC 5A2LH 4AL8H 4HUVB 5JUEL 4P9HL 5KBNC 1OW0A 3RQ3A 5E5MA 1B0RB 3PV7A 5E9DA 5JPNA 4D9RE 5FO7B 5HYSB 4PJ8D 4NJAH 2VLJD 4PJHF 4JHWH 1QLRB 5EU5A 3MGOA 5ADOH 4E42B 4M5YH 4QRPE 3MRCA 2IBBA 3WNLA 5FYJU 1OTSC 2GY5A 2BCKA 2H9GA 4H8WH 4NHCH 5FEBA 1YEKL 2ZUXA 4PRDB 3CXHK 3QDGB 5IMMA 5JTWA 4RGOL 3V52L 2BXZA 2F58H 1V7MH 1UXWA 2VITB 3BT2H 1RJLB 4ZOAA 1NJ9A 3V5KA 2AXHA 1B3JA 4JFEE 4P3CL 1L9MA 4RGND 5TQ0L 2BP3A 2FGZA 4Z0BH 1CT8B 3FOMA 32C2A 4IOIB 4JPWH 4KKAD 4U7KA 3AXLB 4Q2ZB 5DEGB 4ONGH 1ZWIA 3VH8A 1IAKA 1MIMH 1RUKH 4FQXA 4CBPA 1EIBA 3EYSL 4K3DH 3LKQB 4G42B 5I0ZA 1RZKC 2OQJA 4OLZL 4PRPB 4RMQA 4HX1B 4NT6A 4Y7MA 5EA0L 3L5HA 2PYED 1H5BA 1SEQL 1WWBX 3B4NA 3OGCB 4GMSH 4R4FL 5GJTH 3OAYH 1F6AB 3QHFH 4WW2B 1QA9B 3TESA 2X4SB 5A3ID 1G1YA 2JK5B 3MNVA 3SE9H 4E9LA 3X3GH 4ZPTB 5K9JL 1IAOA 5HGAA 1A7NL 2C1OB 4KVCL 4Y1AD 1U8OB 1MNUH 2XPGA 1YNKL 2X44D 4HZAA 2IPTH 3FB5A 4PJ8C 1MY7A 1SJVA 3VCLB 3FOLA 5JIHA 4LSTL 3HMXL 4HXAH 2MKLC 5M7QA 2MKWA 2R69H 5F21B 3JSSA 4NN5C 4OM1L 3HNTL 3MV01 1IL1A 2WAHA 5D1QC 1IQDA 3UC0H 1ZHKA 4CW1A 4YZFE 2FO4A 1JPSH 1R3KB 4H88L 5EWIH 3AREB 2X4PB 3GSOB 3QWOB 2ENSA 4PJXF 2R2BA 4N90D 1SHMA 5D2LF 2HA1A 1CVRA 5FFLA 4HIIA 1AGCA 2YR3A 1IKNC 1KG0A 5IEHB 1WZ1H 4WV1B 3UTSE 3C8KB 2AGJH 1AI1L 1VEMA 4KKAC 1B4JL 1A7OL 2HJLA 4J4PD 3T1FB 4FP8L 5B39A 5IG7B 4Y2DD 1WWAX 4LHUB 4OT1L 1Q9KA 4CMHC 1FC1A 3Q1SL 4NGHL 3QQ3B 4LU5H 1QBMH 5A3IC 1BECA 3M8OH 4WDIA 4N68A 5FM5O 4ZUSB 2WQ8A 3MBXL 2Z8WC 5F1SA 1ODAA 1D9KA 4DWHA 2X9YA 1H0DA 1IGMH 5T3ZL 4LSUH 4D0DB 1J8HE 3QEQD 4WUKL 4XCCH 1DJSA 3MLTB 2GJ6A 5DJYA 5SWSA 3MODL 4KTDL 4KZEL 4ODUB 4S2SB 1MFBH 3DRQA 5E94A 2VDKL 1C7SA 5FK9A 1KFAH 3PWJB 4K7FA 4Y4KA 4DZBB 3SGKA 2WBJD 5JUEH 5I1EL 4P9HH 2VDLL 3F5WB 1BF8A 2PKDA 3L6FB 3IGAA 3L3HB 3MX0A 1FL6A 5CJOL 3MRNB 2R39A 4XI5C 4WW2F 2C4FU 1A2YA 3VWJA 3HRZB 4J4PC 2XICA 1NANH 3HI1B 2VN7A 5C8JB 1A5FL 2QKIB 4XAKD 4IJ3C 3RVUC 1WWWX 1TLKA 1YEKH 1CD8A 4Y2DC 2Q8AL 2XRAL 3QWQB 1ACYL 3D85D 2ZUQC 3V52H 4XNYH 1AE6H 4K55A 3O3EA 2UVFA 2V5YA 3HZVB 3RWGB 1JIBA 4UDTA 4ELMA 4LLMB 3QDJE 1N6UA 4X9IA 5E8PB 3G6JA 5HYJD 3TPUA 4P3CH 4YLQT 3LEXA 5C0AB 4JAMB 1NMCC 5TQ0H 1HOCA 5F88A 3IDYC 1HHIB 3BMWA 1UJ3B 3BN3B 1FNEB 2BOBB 2KPNA 1RZIB 4N0UA 3EYSH 3HAEH 4OLZH 4HUVA 5EA0H 1SEQH 1C1EL 4R4FH 1E4XL 3S6CA 4CNIB 5SX4I 3GI9L 1FYTD 3VFRB 4D9QD 4EXPX 2QEJA 1B0RA 5FO7A 5HYSA 3FRPG 2VL5B 1MFDL 1UGNA 1WICA 4JFXB 1QLRA 1Q0YL 3NCJH 3TZVD 5K9JH 4G6FB 2WBJC 1EVTC 4LRIC 1A7NH 1HILB 4HWBA 2NX5E 1JNJA 1YNKH 4NQCB 3H3KA 3MRQB 1N5AB 3C6LB 3MBED 1JGVL 4PRDA 3LDBB 4JRYD 4LSTH 5T3XL 1F5WA 4FFVC 2BSRA 3HMXH 4I2XB 3W11D 4N1HB 5E6ZA 1OAQL 4HSQA 2WM0A 5IVXE 2X42A 3DI2B 3EO9H 3HNTH 4OM1H 1RJLA 2V17L 3AFLA 3FTGB 4U6YB 4H88H 3RWHB 2P5EB 3EBAA 4LMQE 5GSRB 3EHBC 4ZDHB 1CT8A 2P5WD 5AAMA 4EI5B 3AXLA 4LOUC 1SMAA 4Q2ZA 5DTFB 4RZCB 2FCBA 5DEGA 1JWSB 2A9ML 5F71A 2VLRE 3LKQA 4PRPA 4HX1A 1RK1B 1AI1H 1B4JH 1DANT 1A7OH 1QA9A 1I9EA 3RL2A 3BFOA 4ZSOB 4MDJB 2JK5A 4TVPD 4YHZL 1RHHB 4OT1H 4YXLL 4ZPTA 4NDMB 2EKSA 2MPAL 5H35A 4H20L 3V4VL 2CUHA 4YHPB 1NAKL 3CX5J 3VCLA 4AH2B 1NBZB 4IMLB 3STLA 3C9NB 4V2BA 5FIEA 5JW5A 3MBXH 3EAKA 4XMPL 3TZVC 1T6WA 5TE6L 4G8GE 1PJ9A 2DBLL 4PGJA 4EDXB 1DUYA 1FL5A 4LCWA 3MBEC 4M62L 2HG5A 4XCFL 3AREA 5H8DA 3GSOA 3QWOA 3CFJB 4WUKH 3W11C 3SDCB 5M95B 4J3WA 3D25B 3MODH 4KTDH 3MFFB 4KZEH 1QG3A 3MGAA 2W1NA 2EC9U 4IRSD 5IEHA 2B1HL 4GAYB 5CGYD 2VDKH 3C8KA 2EDKA 4UINL 3H42L 3ARYA 3I84A 4UT6L 3TO2B 5I1EH 3T0EA 1SJXA 2VDLH 3T1FA 3ZO0A 1JTOA 4J1UB 5IG7A 3RKDD 3MJGX 3P2TA 4LHUA 2EDOA 5BV7L 1DTUA 2Z93B 5CJOH 3KPLB 1SM3L 4M7LT 2AJVL 1RURL 1A5FH 4MVBD 4AM0A 2W9LA 3EYFB 1RJYB 4ZUSA 4HIXL 3G5XB 1MSPA 2Q8AH 5IKCA 1ACYH 5DFTA 25C8H 4GAJL 1EK3A 4WIQA 4HIEA 2IALB 3C6SA 2R0LL 3W82A 2XZZA 1ZA3B 4IOFD 3DUUB 4RGMC 5DEZA 4Z7NF 3MLTA 4PTUB 3UCRA 3OJDB 2BNQB 4HEME 4R8WL 4P2QB 4ODUA 1ZANL 2FYYA 4S2SA 4Z7WE 4MQ7B 2ADGB 3KDMA 1A8JH 1F45A 2F54E 3PWJA 5GXBB 4GKOA 4DZBA 2KBGA 1CXLA 2ZOKB 1C1EH 1E4XH 4YHNB 5EFIA 2NY1D 4UV4L 3TIDA 2ZUSA 2ED8A 4IRSC 4LF3A 1U8QA 3UTQB 1MFDH 2BSSA 1UXSA 1KOAA 3IU3A 4QXWA 3UP1A 3WJLA 4IS6A 1Q0YH 4ODVL 3FKUS 3K1DA 3HRZA 4APQA 4PBVC 3CDFA 1F4WL 4MMXC 4PJ7B 5C8JA 3HI1A 1DQTA 5MHSE 2QKIA 2W9EL 4WU5B 3RKDC 3UX9B 1JGVH 5J11C 1QFWM 2Y23A 5IOPA 4OUUB 3KR3L 1A1OB 5F44A 1IAIL 3RGVC 3MMEB 1U8MA 4ZUWB 1OAQH 1S9WA 2UV3A 3BZDA 3HZVA 1FLRL 4MVBC 4UUJB 1SYSB 1GZPB 3RWGA 3ARQA 4LLMA 1BJMA 3DMMD 4WEUD 3SKNA 3QIUB 1OTUD 5E8PA 4X7FC 5C0AA 4JAMA 4GW4B 1EO8L 1CDHA 1I1CA 2PO6B 2YUWA 2P1YA 2XXCB 4WI5A 1J18A 2FECL 1U8KB 5HI4D 2RR3A 2A9MH 5C0IA 1UJ3A 2AEPL 4IOFC 1H15B 1FNEA 5IQ7L 1RZIA 4DKEL 1KJ2L 2DYPD 4PJDF 3TT3L 3VFRA 1PAMA 4KPHL 4L4VD 4LLVA 4G6JL 2VL5A 1R5WB 1BD2E 1WFOA 4JFXA 4YHZH 3ZDYF 1UC6A 4YXLH 1S7SA 2MPAH 4BYHA 2IBGA 3V4VH 5KSBA 2ICCA 4OD1L 3C60B 1CDYA 2NY1C 1P2CB 2AJYL 4OZGE 3MRQA 1MVUB 4RAUB 5BS0E 1N5AA 1NAKH 3C6LA 3TT1L 2AXFB 1WBXB 5JR1L 5H94B 1GSMA 4I2XA 5H2BB 5LXGL 4F58L 4KQ4L 3NCCB 5TE6H 2CDFB 4UB0H 2X10A 3MRMB 4MQSB 5EO1B 3FO0H 2NY4D 2IPUG 4KROD 5D7IE 4M62H 4QO1A 3CSYB 5DZLA 3K0WA 3RWHA 2P5EA 3EOYG 2LU4A 3B2VL 1UM5L 5GSRA 4ZDHA 4UOW0 3QPQC 2B5IC 3AY4C 4LLDB 2C3GA 3T2OA 5DTFA 4OF6A 4RZCA 2FH6A 5C08D 1T80A 1JWSA 1ZLWK 3S8WA 4NPYB 3SGEH 1K4CA 1MY5A 1TVDA 4J2XA 3DMMC 1OTUC 5C3LD 1TMCB 4DKFL 1MHPL 1RK1A 3VGHA 2VDQH 2XN9B 3U1SL 4UINH 1JUFB 3FZUD 3V0WL 4UT6H 1A7PH 1XCQB 3V7AE 3G9VA 4MCZB 1WT5C 1ZT7A 4ZSOA 3S37X 1IGTB 2PYFB 2QHRL 4IRJD 1F13A 5BV7H 4QOKB 5TH2B 4NDMA 5IB1B 1SM3H 3V79C 4YHPA 3QP3A 3LH2L 4K94C 5C86A 1BEYL 2AJVH 1RURH 2QQQA 4AH2A 4IMLA 3C9NA 5KN5B 1FNHA 3O6KL 4OUOA 2DI7A 3MUGB 4PJ7F 3RVWD 4ZO6A 3KPPB 4V1DB 4WI2A 3S96B 3FAWA 1CICC 4ZODA 3RPIB 1TTGA 4KRPB 1BOGB 1E28B 2XOTA 2R0LH 4OCYL 5CEZL 5CBAB 5JDSB 4YC2B 4I3SL 4LPVA 3SDCA 2BK8A 3NFNB 3D25A 3MFFA 1Y0LB 3OX8B 4R8WH 4U1KB 1T04B 1ZANH 3N1MC 3O4LD 5CZXD 2NY4C 4KROC 1I3RB 1BLNA 5HGGS 5DFVD 4GAYA 3KXFD 5KTEH 5IHBA 4ENED 5F1KC 2A73A 2HJKB 3TO2A 5FYKE 3TA3D 3EYVA 3KHQA 5K9OB 2DQGL 4UV4H 1QP1A 4GJTB 1MCWW 2Z93A 5EU6D 2I25N 3RBSA 3FZUC 1F4WH 1WAAF 4DOHE 5DF0A 3T3MF 3WFHB 3EYFA 1RJYA 2W9EH 2YC1B 3PJSB 3TH3T 3G5XA 3OB0K 5HD8D 2VXQL 3Q5TA 4JM4L 4X98B 3KR3H 1LO4L 1P7QB 1LILA 3H7LA 1FLRH 1ZA3A 5EG6C 4QRPD 2YBRA 1EEUA 4PTUA 3SDDD 1FZMB 3S4SG 3RVWC 3OJDA 2W0KA 3V2AR 4I9WD 2HT2D 1EO8H 3JUZA 3SDXE 4X9HA 4RBPK 1FGVL 2YUVA 4FABL 4WUUD 5IQ7H 4F8TA 1QRND 1SBBA 1PKQA 4JRXE 4IOSD 1KJ2H 3MJ9L 1RV6X 3KHOA 4LSRL 2ZOKA 3OKEB 4JO4H 3UTTE 3TT3H 4YHNA 3IKCB 5CZXC 2FBOJ 4FXKB 4KPHH 4A6YL 4JFED 3VRJB 1F2XK 4G6JH 3AM8C 4P5MB 5D1ZC 3UTQA 1J1OL 1NL0L 2VLME 2CLZB 1EBAA 1YQVL 4OGXL