1GSMA

A reassessment of the madcam-1 structure and its role in integrin recognition.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
206
structure length
206
Chain Sequence
VKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQWRGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPNQLTVSPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDEDVLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUCOSAL ADDRESSIN CELL ADHESION MOLECULE-1
publication title A Reassessment of the Madcam-1 Structure and its Role in Integrin Recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion protein
total genus 29
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09085 Adhes-Ig_like Adhesion molecule, immunoglobulin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1gsmA01
3QDGD 1QSFE 1NJ9B 4Y4HB 4KROD 1A6WL 5E5MB 3QQ4A 2DLIA 3GI9L 4E0RA 3VXMA 2GK0A 2Z4QA 3FTGB 2IAMC 5KTEL 3OPZL 4GW4B 3CSYB 2VISB 3RVTD 4ZXBC 4P3DB 1ZS8A 5D70L 4DKFL 3W82A 4MMXC 3FB8B 3FB6A 3VFTA 3RX8A 3WLWD 5DUBA 4JREC 4LVOC 2FJHA 4JZNA 1FFNB 2AABL 3TBWB 3BN9D 3AREA 1F3RB 3P30H 3G5ZB 1W0WA 2AK4B 3WFBH 4G42A 4GMTH 4KY1L 2Q8AH 5GS0L 3FB7B 1CVSC 4RQQA 2GYSA 3X11A 5CUSL 3UJIH 5DJ6B 1Y0LA 4M62L 4UUJA 4XPFH 2Q8BL 1AIFB 1KIUA 1MJUL 2V7HB 2K3TA 3DX7B 2VLJD 5C0CA 4LCYA 5HPMB 2WK2A 5F97E 2H8PB 4RA3A 1D6EA 3CLEL 4NC2B 5F7WC 5GGVY 4D0CA 4OM1L 2AXHA 3QWOB 2HWZH 4NNPH 3S37L 4Q0XH 3QCTL 2V9TA 2C7UA 4W4OA 1PY9A 2DQCL 1L7TH 4X0KB 5TPWL 3QUMA 5E8DH 4LCWA 1QUNA 2Q86B 4M6MH 1Q9OB 1G0YR 4P2QD 3U36A 4LNRA 1YPZF 3SCMC 4NUJB 5ANMA 1OGAE 2ITCA 1MELA 4APQB 3CDFA 4LSSH 4YXKL 3UYOD 3WLBB 3TCXA 5FCUH 1A4JB 2Y7QB 1A22B 4KPHH 3C87A 3JXAA 1UKSA 1QA9B 3WL9B 4H88L 3FQNB 4M9OA 1IT9H 5L88L 1AI1L 4HH8A 4MAYB 1E28B 1CFBA 2YPLA 4LP4A 2G5BA 1QO3B 4G7YH 5IMMB 4DN4L 5CJ5A 4BFIA 4BSWB 1A6ZB 4UQ3A 2VIRA 1NFKA 2LQRA 3NAAH 2C26A 2OR8A 3LV3A 1N0XH 4X6DB 4YNYA 1VESA 4BH8A 2JB6A 1BVKA 4QHMB 2F53D 2C3XA 4N8VB 4NRXA 4Z7NE 4HJGA 1IGCL 1OQXA 2H2PD 1TFHA 4AIXA 1C16B 2XZQH 3MJ9H 4F9LA 3DUSA 1FG9C 1RSFA 3IFOA 4BKLA 2DLHA 2UZIH 4BZYA 2EIDA 4PJIB 3H3BC 4FFZL 3HZYB 4AEHL 5DJ8A 5E4EC 1MCDA 1KJVB 5BS0B 4P9HL 3KYKH 3QQ9D 2P46B 4XCFH 4FXKB 4W70A 4OLWL 4FQ2L 3UYRL 3FQWB 1Y6MR 3U0PA 2VZOA 4HQQL 1M7IB 4LFHG 3LKPB 2B20A 1GIGL 4Z77B 1BD2B 1DANT 1L7IH 1MRCL 2E6PA 3DURB 3PP3H 2J8UA 1WBXA 5HHVH 1CFTB 5AD0B 5JUEH 4E42B 3RY6A 2AV7B 4L9LC 1JZ7A 1A7OH 3TCLA 3UBXB 2PETA 5E1HB 2DYPD 5FM5M 3GNMH 3B4NA 1H3PH 3FFCA 5F21B 4U7SA 3MUY1 3I9GL 1MPAL 2L7JA 1INQB 2UYLA 4P59L 4HH9A 5C7XH 5DHVH 3U83A 3BJ91 4ZO9A 4D3CH 2R0ZH 5CD5C 5BZDB 1C5BH 3O3DA 3QQ3A 5FGSA 4WY7H 1DSFH 1U93A 1ZA3B 4Y5YB 3MROA 5DUML 4IDJL 1I3GH 2EEAA 2FGWH 4G5ZH 3VFOB 1VSCA 2W9DH 1U92A 1I8MB 1AGDB 4DQOL 1S7SA 1YMMA 3HB3C 3QXTA 4OLYL 4MQ7A 2R2EA 1ZLSH 2ZWLT 3ZDXE 5E94A 4RDQF 5DZNA 3RWIB 4P9MH 5E2VL 3STZA 3EKCA 3IT8D 3RY6C 3P4OB 4GLRH 1EO7A 4EIZC 1EHXA 3RWFA 4ZTOL 1TETH 2YD7A 4HJ0D 1I7TA 4N0YH 4IOFC 5KBNC 1IGFH 1FSKC 3KPSB 2VZSA 5A43C 1DQLH 1KPVB 2P8LA 4CBPA 1WBYA 1HOCA 4MNHA 2VE6A 4X6CE 4LU5H 4Y4FC 5K59F 1VFMA 5C09D 4YDJA 3RX5A 3ILQD 1KCSL 3TN0A 5DFTA 3OKLB 2M8XA 4FXLA 3CGTA 5CJOL 3ARBB 5DMIH 1B3JA 2QQLL 1QSFA 4R8WL 2HMIC 4HIHA 1DDHB 1N59B 2GTWA 2VXSL 4WI9A 2ZSWA 1AKJB 1PJ9A 5DT1H 1RIUH 1F3JA 1GRWA 3MLYL 3TYGL 4MCYA 1GYAA 2AK1L 2DWDB 2WAHA 3HE6D 3UJTH 3P0YL 2AJZA 1Z3GH 2OQJB 3CPLA 2R1YA 3I6KA 3MA9H 4Y5VB 5CFHA 4PRIB 4HK0B 1J8HD 3H0TB 4PRHB 1BAFH 2DJSA 4UZGA 4Z76A 1CZ8L 5TQ2L 4Y16B 1IEAA 2IMNA 2OTUB 2YN5A 3FQXB 5J3HC 4HKZA 3RQ3A 3TN0C 5IB3B 2A6JB 2BMKB 1KSRA 2R69H 1DBBH 1SJHA 4RAVA 5HI3C 4WCYL 4U1HA 4LBEA 1V7ML 3P11H 5GGUB 3E6FB 2V6HA 1ZWIB 4NM8H 2DTMH 3PQYE 3QXDA 4GMSL 1UB5A 2HP4A 2WUCL 4DW2H 4RRPG 3TO4A 4KWUA 3RWDB 5BW7A 3FN0L 3PGCA 1DBML 4OLVH 5ETUB 4DK3A 5M95B 1KJ2B 1UGNA 3CSPA 4JPIA 4Q9QH 1HKLH 1S78C 3RKDC 1H0DB 3V5HB 8FABB 3DOSA 1CGXA 3HG1E 5ITBL 1JUFA 3KPQB 3JTSB 3PWUB 4YFLI 5LQBL 3EGSB 4KGLA 2XXMB 3V0WH 4N90D 3T3PE 4GRWF 2HJFA 2QADB 1G7PB 3CDGB 4Q2ZB 3FRPA 1AXIB 1OGAA 2BP3A 3JTTA 3VRJB 3QFJE 4EUPB 1RUQL 1KTRL 2PW1B 4MD4B 3REWB 5GHWH 2UWEE 4J3UA 1YNLH 4U1LA 5AAWA 2EDEA 1JRHL 4OZGE 5E70A 3ESUF 4LLVA 1X5GA 3DVNB 3PJSB 3SE8H 3QUKB 1P2CB 2ADGA 4ODBD 4KI5F 4DN3H 2V5RA 3TO4C 1WK0A 4TUJB 1PZ5A 1G84A 5BW7C 1KTKE 4NQCD 4MZ3A 5FGCE 3BPOC 1IGJB 1FL3A 1XGPB 4OGXL 2FR4A 1J5OH 3H7BB 5IFAH 2EIZA 3C60D 4LSVH 1N5AB 3SDXB 2LVCA 4XVUD 1I1CA 2O5YH 1RJZA 1OCWL 1C08A 3U0TA 1QLRA 3ZKXC 5DHXB 4JPWL 2D31B 2VXUL 3SGDI 1UFUA 4I8DA 3SKJH 4UV7L 1PLGL 2APBA 3LKSB 3WN5A 4P4KD 4IRJD 3G6DH 5C2UB 4LSTL 3Q6FA 3R4DA 1MEXH 2C3VA 1TNNA 3Q5TA 1C1EL 1KN2H 4RIRB 4XCNB 5D71L 1BVLA 4DUVA 1FZJB 4GUPA 4QOKD 2EO1A 2HT4C 4ODTL 4PJ5B 4HKBA 4E41E 5CSBA 2FDBP 1ETZB 1AJ7H 4OF7A 5F8QC 1NCCH 3NCJH 3V79C 4OSUL 2ZKHL 5HD8C 1IM9B 2ZOLB 4MYWB 3GSUA 4NCC1 3CFDB 1MREH 3CFEA 1AO7E 3OQ3B 3IAGC 3QI9D 4LSQH 4WFGD 4JHWH 4J3SA 4RZCA 3KYNB 2HKHH 4HUWA 3BPNC 2EH7L 4G9FD 4X8JB 1MUJA 3LZFL 3SGJA 1U6AH 3WN5C 5J11C 1XGUA 3BWAB 1XGTA 1INEH 1XR8B 3OJDB 1H15A 4PTUA 3U7WH 4XMKL 2WUBH 1KNOA 1UB6A 1KLGA 1Z5LB 4CADB 1MCPL 1WFNA 1QFWL 2WBWB 3QNYA 5BZWB 1N3NB 1CFVL 2FEDC 1DFBL 3P9LA 5EPMB 3MRLB 4XNZC 1YEFL 4BQ9A 4JO3H 1PX3A 1MRDL 3QH3A 3BQUB 4PRAB 3ZE1E 5I71C 3NFNA 5MEOA 5IW1B 2X70B 3RKPA 1A3QA 3HCVB 4C56E 3MACH 3MRMA 1K8IB 4Z95L 3BJLA 4P3CH 4DZ8A 4O58H 3S4SB 3JV6B 3G6JE 2LAGB 2FNBA 3MLZH 3T4YB 1T5XA 5F9WB 3QRGH 2VO5A 3M17B 3B9DA 5F9AC 2BERA 1CICA 2J7LA 4RFEA 5ICXA 4QNPE 4M1CD 4YHKH 5FK9B 3Q5YA 1S7UA 5C2BL 5EBGA 3O6FD 3QCVH 1E6OL 5C92A 4X6CA 1JN6A 4R26L 1GZQA 1JPGB 2CXKA 2JIXA 2B4CL 2ARJQ 2YD4A 4L8DA 1JWMB 4S10A 2NY4D 4HZLB 1R5WA 3IXAB 1VGEL 4X5WA 1I7UA 3VW3L 3GSWB 4JPVL 4M48L 5FYJL 3JZ7A 3KG5A 1U8MB 3O8XB 3FZUD 1AXSA 2ZSVB 4U1MA 1ED3A 3O4LE 2HYMA 2ZNXA 2FH8A 3MRPB 3SDDB 1OB1B 2P5ED 1XGYH 2EYRB 1OGTA 1J12A 3P4NB 4WV1B 5J12C 1L9MA 3UZEA 5CINL 1C5CH 1ZMYA 3ZTNL 5LKNA 2CDFB 1VPOL 2QQKL 5EIIA 5IB1A 1MAJA 2DLTA 2HTLC 4QTIH 4LCCB 4F57H 1HSAA 2NY1D 4U1JA 3STLB 1CICC 2G9HA 2HT3D 1QNZL 3DVGA 5F3HA 3MV11 4EDWH 5CKGA 4ZFOB 3MLWL 3DNKA 3QB7C 3U4AA 5EOQL 1KG0B 4GRLC 3O81A 1R3KB 4MXVE 3BKCH 5FM8A 1P6AB 1BFVL 1SJVA 1KGCD 4ZUSA 4YX2H 5HVWA 3BO8B 1XIWA 3MCLH 2XOTA 5JDSB 1NBZB 1ZGLP 4OT1L 2IJ0C 4N0CD 3ULVH 4OI9A 3MV9D 1D6VH 4KK9D 3SJVD 3VA2C 3EZJB 3PQYA 4EDXA 4TTDD 1JPSL 1NC4A 4KTEH 3WEXB 3HNSH 4X6BA 3DV4B 4K3DH 4X4ME 5DJCA 1QYGH 3FMGH 2EE2A 3VFWA 1AXTH 1I4FA 1OF2A 4WTZG 4NT6A 4AZ8A 4X83A 5ECJE 3HG1A 5E5RB 4KKLC 5I0DA 2BNQE 3VFRA 2BNRE 5HI4C 5IMLB 3HMXA 2ZUYA 3T0EC 3VDBA 1TVBB 5FKAB 4LIQL 5DTFA 1R3LA 3QFJA 3MBEA 1OLLA 2DWEB 5H37G 4BZ2H 2P24B 2UWEA 1XIWC 1ZVSB 1DQQA 4PJXE 4ZFFA 4OZGA 4OCYL 2VXQL 4NNXA 2G2RA 2J5LC 4DZBA 5D7LB 1QBML 2NW3A 4NZDA 4R7NB 1NC2D 1SJXA 4Y1AD 1UM6L 5FO8B 5CLTA 5D6CB 1UM4H 4XBGA 3WNPA 1I1AA 1IFHL 2H3NA 3BMWA 4JFZL 2UZYB 4QXGL 3PP3K 3CC5B 1YEHL 4JQIL 5F93C 1T0MA 5ENWB 5T5FL 1CG9B 1NMCC 3MUHL 4OM0H 4QRRB 1KJ2L 3BVNB 1TQBB 3FFDA 3SDAD 1JFQL 3NVQA 2JE8A 3BIBX 4PJEE 1V7NH 2VTFA 3MBEC 4MDIA 1XF2A 5C6PB 4PJGB 5KVGL 3RVUD 3VXUD 3D3VE 1WCBA 3CFBA 2IH1A 4HCRL 1EUTA 2MTPA 3GSOB 4OB5H 3WSQL 4E41A 3M8OH 4PP2B 5C0JA 5D2LB 3VG9B 3KYMB 1CGSL 3JV0A 1CFQB 4M8VA 2PW2A 1PX4A 1IC7H 4KKAD 4XNUH 4IM8A 3L9RB 1YMHA 3KYAA 5K33A 1I1AC 5MI0C 3MODH 1WWWX 2G60L 5BV7B 3VFGL 3PHQB 4L4TB 4CN6A 2PR4H 5TH2A 1AO7A 2H26A 5HHMD 5GISH 1GOGA 2JJWA 3IFLL 4XCYB 4X5XB 4LOUC 5B39B 5DD6B 1T7YA 2MHAA 4LMQE 4BK4A 4ZUVA 3AS0A 1ZGLA 1I9IH 3V6ZB 4FQ1H 1F90L 1F8TL 4GW1B 1JGDB 1H9VA 4M6NL 4P46D 3EO9H 1HYSD 2D4FA 4JM2B 3WFHB 4NNYB 3WKML 5JHLL 4H1LH 4LLUA 2FX8L 1ORSB 3QEQB 4K71B 1YDPB 3L3JA 2VAAB 3TBYA 1GAFH 1OAKL 5ITFB 4GXUM 3KDMA 4X7SH 5DJYA 2IC2A 1BLNA 4LSRH 5ACLA 2GAZB 4C56A 3VH8A 1JGEB 3RTQB 4AM0A 4G8EB 2FH6A 2A77L 5ACZA 5DEGB 4WFHE 3RWHA 1WUNT 4HXAH 4NO0A 3G6JA 1F4HA 2AJSL 4ZG1A 1CT8B 3U7YL 3HC3L 1D5IL 1WWCA 1WCQA 2VRAA 4NKOB 2APFA 5C6TH 4PLKD 3QDJD 1NLDL 5T33L 4XI5D 1F4YL 3WJLC 1A6AA 4XNYL 5IMKB 1A21A 3UC0L 3SDCD 4NBXB 4OJFL 5C08D 2YA2A 5IVXE 4JCMA 3H42L 1A9BB 2NZ9C 2CKBA 5CEZH 3O4LA 4G43A 4K7PH 4YQXH 4OLUL 5IM7A 3MV7B 1FFPB 2K9UA 2R1WB 5T1MB 4Z78A 3U0WL 2VMFA 4XVSH 2XNAA 1M7DB 1BX2B 3S35L 1QACA 2GJ6D 3U7AA 2P8MA 4I0PB 5ILTH 2A0LC 1VB9A 4LARL 3BRGC 4FN0A 1S9VA 2PO6C 3GMLA 4P0DA 4OTXH 4IEFB 4OD3H 4F3FA 4P2OA 1JMXA 3WBDA 5JTWA 4LSUL 3CFCH 3TJHD 4S1RL 4ZNEE 1FZOA 3ZDXF 1XR9A 1G7IA 2BJMH 5F88B 1ZTXH 4JHAH 1JWSB 1S7XB 3KPNA 4JR9L 2A74B 2NXYC 3QAZB 4BM7A 3QO0B 2FECI 4KUZH 1HQRB 2BVEA 3KJ4B 5JHDB 3BUYB 1HWHB 15C8H 4PJBB 4WEBL 3VXQA 4YUEL 5BXFB 3WS3A 3HAEH 1E4XL 2CK0L 4HFUH 3NZ8B 2X4TB 1B2WH 3X3GH 3QDGB 4X4MA 3JWOL 3LQZB 4X6CF 4I1NB 1UM5H 2I9LB 4KROB 1SJEA 1OW0C 4PLJD 2BNUB 4PBWD 1W0VA 4X6DE 1CDJA 4OLXH 4P2OC 4QXWA 4XP4L 5KSUB 4K7FB 1Y18A 4TNWF 2VLME 4P5KA 3VFPA 3MNVA 2BNQA 2BNRA 3BP4A 3P0GB 4P9HC 3K46A 3PGFH 4PR5A 5D1XB 3TT3L 2E9WA 4HWZA 1MCWW 1ADQL 1EPFA 3HR5A 3BH8A 5I8CA 1KXQE 1OAZH 4IHOB 3K4ZA 3MRBA 3PWLB 4PJIE 4NSKB 4L1DA 5E8EB 3HS0B 2IPKA 4JHZA 4KDWA 3QXVA 3KPLA 5BS0E 3E2HC 4ZFOL 4PJXA 4YHNA 1H8NA 2FB4H 2E8ZA 2IPTL 5HGDB 1RHFA 2C9AA 3MRHB 1D5XA 1MAKA 4LHUD 1BD2E 2IG2H 3MSPA 3U46A 5E2WH 5EUOB 1T21A 3U9UB 5L2KB 1FORL 5DR5L 1MIMH 3L3DA 5JO5B 4I5BA 4NN7B 4DKDC 1T2QL 3LH2H 1J0YA 1QEWB 4DOHB 3FT3A 2WIIA 4YHMH 5LWYL 3OKYA 3EJJX 1BEYH 1OM3L 3THML 1AR1D 4P2QB 4PJEA 3DXAB 5CMAB 5HGAA 5BVJA 4QHLA 3JWDC 1H8OA 3B9KC 5EORH 5FYJE 3D3VA 3EHBC 5IGXL 1SEBB 2NMSA 4YZFE 4DCQB 3ZSTA 2NY2D 2BSTB 3MREB 4JY6B 2IBBA 4JZJC 4JFQB 5KAQF 1FO0A 1MLBB 3FJTA 3ZE0E 4X4YB 4JGMA 4FQCH 2P5WD 2XKNA 1ES0A 4EVNB 4LAQL 5DRNB 3WNOA 2YXMA 1CXKA 1A6TB 4TPRL 3O4OC 3OKOA 4K9EL 1RZIB 1YECH 3TWCH 3MLSH 2BY0A 4OZGF 3C5JB 3QDMB 3KPSE 1A14H 2DQTL 3H9SB 2WZPD 3MLTB 1UZ8A 4ZMAT 5EUKA 1F2QA 3FOMA 1TCMA 2ZJSH 5D8JL 4NPYA 3OAYH 1IM3A 5E2JA 3ULUL 3AROA 2IAMD 3NFSL 2NTFA 4PJHB 3C6SB 1MQKH 4ZXBD 4HDIA 5EWIH 1QFOA 2YK1H 1ONQB 3EW3B 4I3RH 4OD1H 1J0HA 3CIQA 1A2YB 2H41A 2XQBL 1NJ9A 4Y4HA 5E5MA 1I7RB 4JFHD 5HYJD 1UCBL 3QCUH 1QBLH 2VABB 3FTGA 5TE4L 3D0VB 2DOCA 2FL5B 3WS6A 4GW4A 3CSYA 2VISA 2R0WL 4P3DA 4XTRC 1RVFL 3NIDF 5GGQL 1OTSC 2D7NA 1UQSB 5BV7L 4TN9A 2KQNA 1RZ7H 5MEND 3FB8A 2QKIB 4LIQE 4R96B 5CUSH 5DC4B 1N8ZB 1JE6A 4PRIE 2DYPB 4PRHE 1FFNA 1BQHB 4NJAH 3TBWA 1SMOA 4ZO6A 3G5ZA 3VXMD 4Y5XB 3TV3L 5KVDH 3WXVH 3FB7A 2VC2L 4B5EA 4Z7OE 1QR4A 3SE3A 5IIEB 2CSPA 4KMTH 5DJ6A 3U6RB 2CGRL 1AIFA 3FB5B 1QFPA 5JIHA 5IVXA 3O3EB 2GTZB 1D5BB 2Q3AA 2V7HA 4Y4HC 3DX7A 3LMJL 1P6FA 3GIZL 3I3DA 5EOCL 5HPMA 1DP0A 2QQQA 4FQJL 2A9NL 2H8PA 4K3JH 3SCMD 4TQEL 4KAQH 3WS6C 3EDKA 1Z2KA 3OKEB 3QWOA 3W39B 1LO5B 4JRXD 4XWGL 4L1HA 3LKNB 4K3EL 1BF2A 3ZKNC 5B4MC 1OPGL 2Q86A 1Q9OA 2D3VA 1R5VB 4ZNEA 3IKKA 5IHZB 4XBEL 1CYGA 5CP3H 1I85C 3MRKB 4NUJA 1XH3B 5I30H 2ED9A 3ZE1F 1HNGA 4NZUL 1GGYA 4APQA 3WLBA 1LE5B 3SE3C 1OL0A 1A4JA 2Y7QA 5FV1L 1T6VN 5IOPB 1FIGL 1O0VA 2YC1B 3G6JF 5ESAB 3WKNA 4MGXA 1QA9A 4LCWD 3WL9A 5C09B 5HBBA 3O2VL 3FQNA 1MFCL 4S1QL 4MAYA 1E28A 4QNPF 3T0BA 4XPGH 1QO3A 5IMMA 3MXVH 5J4MA 4LCIH 2LV4A 2AQ1A 1U3HB 4BSWA 1A6ZA 3SN6N 1MIEH 5BOZG 4X6DA 1ZVYA 1KXTB 1AGFB 1A7QL 4P4RB 1H3TA 12E8L 4PJDB 3SDXE 4OCRH 4ALAH 3V5KB 2F5AL 4QHMA 4J3VA 4N8VA 1C16A 2YPLD 1EFQA 2HFTA 4XPAL 1J8HB 1UWGL 4PJIA 5GZOC 3CMOH 4FS0A 3HZYA 1H3XA 4DGVH 3GM8A 1QPPA 1KJVA 5BS0A 4OFYA 3ZYIA 4FXKA 4PJ5E 2QR0B 4MAYC 3FQWA 4NHCL 1M7IA 3LKPA 4K23H 4AL8H 1MJ8L 4D9RD 4Z77A 1BD2A 3DURA 2I60L 1PSKL 1X4ZA 2BOCB 2WV3A 4HS8H 3H6JA 1CFTA 1V8HA 5AD0A 4A6YH 5CD5D 4E42A 2AV7A 2Y06H 4LPTA 3AMKA 2IBZX 3Q2CA 5BOPA 1UXSB 3UBXA 5TF1L 3MOAL 4G8FB 1ZHKB 5IHUH 2AP2A 3GJEB 2ZCHL 2OMBA 3GHEL 1OT1A 3HB3D 1K4DB 1INQA 2XICA 4RX4D 2NY5L 2P43B 2OBGA 2XQYG 1HHGB 3RNQB 4OLYH 4LLDB 2UY7A 5BZDA 4Y2DB 2YD3A 1EHLL 2JJSC 4GS7B 4LK4A 1MCOH 2A9ML 1ZA3A 4TSAH 4Y5YA 1SHMA 4LPCA 2IFFL 3UROR 1E4WH 3VFOA 4TVPD 5CGMA 1I8MA 1AGDA 4IOFD 1GGCH 2I07B 5J6HB 5IMOB 3WNKA 1FFQA 4TSCH 4ZD3H 3RWIA 1YYML 5E00B 3I75B 1N4XL 2FWOB 4PJAB 2XWJB 3P4OA 3DBXB 4JFDB 3MBXH 5A2LH 4KVNH 2E7MA 4Y4FD 3RIFF 1MVUB 1X5JA 4PJXF 4CW1B 3OXSB 5MEQB 3KPSA 4NJ9H 3C60B 5HSFA 1U95B 2B4CC 2D7OA 3RBSA 1N7ML 1KPVA 3PDOB 2HMID 3WFDH 1WGOA 3HI5H 5GS2H 1LK3H 1BWMA 4XMPH 4Y5YC 2Z92B 3AMLA 4OCMC 4J1UB 3GBML 4K94H 5CS7A 3NA9H 1MY5A 1LDSA 1A47A 4MA7H 3OKLA 4FHBD 2DMKA 1QVOB 2CUHA 3ARBA 1ZLVK 3RZCD 5CZVH 4M6OL 1DDHA 1N59A 3D69B 1AKJA 5IHLB 1JHKL 4HBCL 4EBQL 5TQ2H 2DWDA 1U9KA 1I9JL 2BOBB 4HW6A 2ICWB 5J3HD 3TN0D 4XCCH 3CFIC 1DLFH 2PYFB 4S1DC 5FAAA 2OQJA 5GRJH 3P0VH 4Y5VA 5HI3D 4PJ7F 1QSFD 4HK0A 1PYWA 4PRIA 4G9FB 3H0TA 4PRHA 4NC1E 5KOMC 4ELMB 1GGBL 3DVIA 3ZZ1A 1CU4L 3CK0H 4N0UB 4PJFB 3ZTJH 3MO1B 2LU7A 4H0GA 4Y16A 1BGXH 2OTUA 5F89B 3FQXA 5IB3A 2A6JA 2BMKA 4RGOH 1T0PB 1JNNL 4N8CL 5DA4A 4G6KH 1PD6A 4M03A 3RKDD 4KKBC 4NQSB 3PL6C 5GGUA 3E6FA 5C9KA 1ZWIA 1XF1A 2ZUUA 3HFMH 5ID1B 4AY0A 3RVVD 4FQXB 3RWDA 4WHTB 1LDPL 5ETUA 3HZKB 2XA3A 1KJ2A 1LQSR 1RIHL 4UILH 4ENEC 5JR1H 4HG4K 1H0DA 1I7ZB 3V5HA 8FABA 5I1GH 4Y5VC 4FA8A 4X7CC 5E95B 3KPQA 1SQ2N 3JTSA 3PWUA 3V4VH 1G9NH 3EGSA 1JPTL 1WZMA 1G7PA 3CDGA 3FCTB 3V6BR 4Q2ZA 3TO4D 1IAIL 1AH1A 5KS9F 1T2XA 2BY3A 2HT2C 3VRJA 3O6FB 3SGDH 4EUPA 3N1GC 4HK3N 4MD4A 2PW1A 4YDLB 1CLZL 3DRTB 3RWEB 3ARFB 5ALBL 2NY4B 3DVNA 3PJSA 3QUKA 1P2CA 3AAZB 1KN4H 4MA8L 2GSGB 1KPRB 1EGJH 5FUOH 1KYOJ 4TUJA 5D7LE 3S37X 1V3KA 1KEMH 4YC2B 3F65A 2FD6H 1I1RA 1PLGH 2P5EB 1IGJA 1XGPA 2IQ9H 3H7BA 1A7PL 1N64L 3SGEH 3ARYA 3F7VB 1N5AA 3PHOB 3SDXA 4DFIA 2H9GB 2V5SA 4JM4H 2HT4D 2MPAH 3JUYA 2D31A 2EDFA 2QADC 4H5SB 4QRRE 3ULUE 1JNJA 2EEDA 4H0IA 3VXOB 3LKSA 1C8PA 4NOFA 4FXGB 1UWEH 2YRLA 1OAQL 3GGWB 4XPHH 2FHBA 4PJGE 4UB0L 5HD8D 1PG7X 4RIRA 4XCNA 1FZJA 1X9QA 2HKFL 2V9QA 4PJ5A 3S36L 3IDNB 5K93A 3GSNH 4FZEL 5F9OH 2W9LA 5D2LE 2ORBL 1IKFL 3M07A 1ETZA 4KGJA 4QGTA 5IV2B 2E7LA 4J7RA 2E7HA 4JAMB 5C71A 3MV9B 4WHYH 2JTDA 2FIKB 3MLXL 1IM9A 1XF4B 2ZOLA 3OXRB 4Y2OA 1CBVL 4L4TE 3CFDA 1RZKH 4Q9RL 1REIA 3KYNA 3I2CL 1G7HB 3BFOA 3TEUA 2AEQH 1MRFL 1TJIL 4IRZH 4X8JA 2D03L 2FEDD 1QFWH 4YPGB 3U2SB 1NFDB 2ERJB 3BWAA 1LWRA 4GQ9H 4HWNA 4URTB 3ULVC 1LEKB 5E2TH 3SOBL 1XR8A 2O5ZH 3ECBB 1SYSB 3T0XA 4DVRH 1GGIL 4GAGL 3ZE2E 3IETB 3OJDA 4AT6B 4ISVB 1JGVL 1KELH 5CILH 3WHXB 5H35B 1Z5LA 2DN7A 4CADA 3OAYK 4HIIB 4X6DF 1U8KB 4NP4H 3VD5A 5BZWA 1N3NA 2N7AA 3QEQE 4XPTH 4LLQB 1QSEB 2D7TL 4S0TD 3R1GH 1TJGL 4YO0B 2E7LC 5EPMA 2MKWA 2VL5B 1PKQB 1RMFH 2VL4A 3MRLA 4NRYB 5CEXB 2H1PL 2DQUH 5JPMB 2AQ3A 3BQUA 4PRAA 4S0SD 2R23B 1JPST 4CMHB 5IW1A 2X70A 3HCVA 3A6BH 1AFVH 3W0WB 1K8IA 3G5YB 3S4SA 3JV6A 2XV6B 3T4YA 5I8EB 3BEVB 4YAQB 3S97C 3M17A 4F58L 4X4ZA 3V4UL 1T7VA 1KTDB 1TTFA 4ONFL 5FK9A 3QIUD 1ZA6B 3VGGA 1OAUH 2BVOB 2V5YA 1VFBB 2I5YH 1JPGA 3EYUH 4X9IA 4M00A 1JWMA 4HZLA 2VSCA 3LEYH 3IXAA 1M71B 4FQIL 3GSWA 2CLZB 3KJ6H 4CL7A 1U8MA 3N85H 3O8XA 2ZSVA 1CICD 1NCBL 3OKNB 2H32B 3BQUC 1RUMH 1CE1L 4O51B 3MRPA 3MV7E 3SDDA 1OB1A 3PV7A 4MXWL 5F7KC 2EYRA 2F58H 5K9OB 3P4NA 4WV1A 1L0YA 1J1PH 2JIXD 4GRLD 5JOFB 1W72B 3C2AH 3MX0A 3WE6B 3RFZC 1DTUA 2CDFA 1A7RH 2F8VA 2O26U 2VKWA 2YA1A 5GQBA 5J1TC 3GK8H 4LCCA 1ADQA 1JMZA 3DSFL 3STLA 4X9HA 1KPUB 3X13B 4MXQC 4JN1L 5KJRL 4Z5RB 5MEPB 3ZE0F 2RJMA 1FFOB 5TE6L 4ZFOA 4OT1H 2VZ1A 5J13B 1KG0A 3OB8A 1R3KA 2XA8L 1TPXC 1PGRB 3FT4B 2BFVH 4GXVH 4F7MB 2BXYA 1RIVH 4QYOB 3GEWB 5JIIA 3JWOC 3BO8A 3O8XC 4S1SH 5JHDE 5I17B 3C08H 5JDSA 4PJBE 4U6VH 4ZS7L 3K2UL 3NCYP 3B2UC 4NQED 4POZC 3TO2B 4KKLD 5DD0L 1OWWA 3VFNB 5HI4D 3KR3H 3RI5K 3BKJH 3PWVB 4WV1C 3WEXA 3QDGE 3DV4A 3T0ED 2E27H 2X7LB 3DX9B 3JV5A 5DHYB 1MHPH 2FBJL 4LCCC 2VXVL 5F7NC 5L7XL 1XIWD 1JZ5A 2Y5TB 4NC1C 3DO7B 3O11B 3EYSH 5IMLA 3ARRA 3ORJA 1MCRA 1YPZB 1NC4D 5IFHH 1AE6H 2MQ3A 1TVBA 2P47B 3KVQA 4W6YB 5FKAA 1QFWM 1OAXH 4FFVC 1NBYB 3ARWA 2B39A 1MCNA 2DWEA 2P24A 3QDJB 3ARGB 4J6RL 2AJXL 1ZVSA 5ALCL 4QXGH 3RUGF 1F6FB 3HG1D 1IC1A 3CVHH 4ZDHB 3TA3C 3WDIA 4UQ2B 3VFMB 3GSVB 5D7LA 4R7NA 5FO8A 1GL4B 2Z35B 5D6CA 1IC5L 3QFJD 5EUOE 3MBED 4KK5C 3CC5A 4Z7OF 2EDJA 3CX5K 3LHPL 2Y07H 5ENWA 5L2KE 5KVEH 3UTPE 1CG9A 2GJ6B 2M2DA 5KVGH 4ZODA 4Z7VF 3E1F1 2X89A 5DD5L 4HCRH 2XXCB 2UY6A 1IILE 4QRRA 3O2WL 1D7FA 1LGVA 2GI7A 3BVNA 4DOHE 2DD8H 4XP1L 1Q0XL 2X4NB 4YXHH 4P2QE 4BFEA 4I77H 1HXMB 3DXAE 4K8RH 1I1AD 2W60B 4PJGA 4YWGH 5DZLA 2YPVL 1LO3H 2KH2B 4FRWA 2GJZB 2F8XC 2D4DA 3DIFB 3GSOA 2X10A 2ARWA 3VDAA 4PP2A 1A0QH 5D2LA 2OL3H 3KYMA 1CFQA 3VMOA 4J12A 4K9EC 4MA3B 3L9RA 4LOUD 4U3CA 1T22B 4HIJB 5DQJB 4KHXL 5JNYB 3PHQA 4L4TA 2EDNA 3T2PA 1S7QB 5L6YL 2E6QA 3K4AA 4E41D 5D7SH 3ZDYF 5DMYA 3ULUC 3QDME 1UKTA 4LQFL 1TQBC 2HRPL 5LGHL 3H9SE 4XCYA 4X5XA 5CJQH 3WKMH 5B39A 4XC3L 5DD6A 3ZL4H 3WFEH 1CN4A 1GC1L 2QSCH 1G7JB 3R0NA 5B8CB 5DQDH 3DTXB 5HDBF 4IJ3B 3NGBB 3V6ZA 2GUOB 5C1MB 2JELL 1AO7D 1JGDA 4GW1A 5E2UL 4Y7MA 2F5BL 4PJHE 3UO1L 1J0IA 4JM2A 4NNYA 3VG9C 3WFHA 1ORSA 3QEQA 1FDLH 1SYVB 1YDPA 3C09B 2VAAA 3PGDB 3NCYS 5DFVC 4J2XA 5ITFA 4UDUB 5DJ0B 4FQLH 4GKZB 5BV7C 2YD9A 4KRLB 2GAZA 4ERSH 3IU4L 3ULVF 3GMRB 1JGEA 3RTQA 2B8OT 1OT2A 5DEGA 5D96B 3QXAB 1WAAF 4LQ1A 2VDOH 5DYOB 5EOTB 5DDHB 1CT8A 2VERN 2E9IA 5C8JB 2NZ9D 3L95B 4M7KL 5AZ2L 4RGMB 4RCAA 1W2KT 4NKOA 4JG1H 4AG4L 2Y23A 4ZFGH 3NZHL 4GAJH 4KZDH 5I19L 4OLUH 2CMRL 1A5FH 1NGXB 3IDXL 1UCTA 1J88A 1H8SA 4JM2C 5IMKA 2NY7H 2FHFA 4K71C 2A0LD 4HJJH 3UJJL 5D72L 2JKXA 2PO6D 1JNHB 3NPSB 1A9BA 1CLOH 2IGFL 4KQ3H 4MDJB 1EMTL 1IEHA 3MV7A 1FFPA 3RTQC 3FO2B 2R1WA 4TUKH 5T1MA 1M7DA 2P5WB 1BX2A 1MCCA 4G6JL 4NZTL 3T3MF 4YGAB 1YEGH 2NXYD 4I0PA 3PV6B 4LVHC 1DBKL 3PIQB 4PRDB 2VR5A 4JKWA 4G9DB 1DUZB 5F88A 3IJHB 1A9EB 1J1XL 1ZEAL 1JWSA 1S7XA 2VDMH 2A74A 3VMPA 1SMAA 1P5UA 3QO0A 2AJYH 2ARJB 1HQRA 2VDRH 4JVUA 3WUZA 1NAMB 1Y6KR 3BUYA 5JHDA 4PJBA 3MRDB 5C09E 5BXFA 3WDHA 1UWXH 1VFUA 4X9BA 2X4TA 5DD1L 3QDGA 5I66B 1GHFH 3LQZA 2I9LA 1G0DA 1MAML 4I0PC 1RU9L 5F3BB 2BNUA 2BHYA 1K3IA 4PJDE 1NBVL 4MJ4A 3FO0L 3MA7B 3NABL 1J0ZA 1OSZB 3DMMB 4MJID 5KSUA 4K7FA 1W72L 4XGZB 2AEPL 5D1XA 1ZE3C 1KC5L 1J8HE 1DZBA 2OLDA 3PWLA 3QAZC 4NSKA 5E8EA 3VRLF 3HS0A 25C8L 2A2QT 3KJ4C 4UIKH 1A6VL 2H45A 2XN9D 4GG6F 3MUGB 1HEZB 1J05B 3QRFM 1P7KB 5AWNL 5HGDA 2BNQD 4WUKH 3MRHA 4NKQB 3ET9F 5ICZB 1JGLL 4TULH 3MC0A 3OZ9H 3N1PC 3HE7B 4R4FH 3BMVA 5F96H 5EUOA 2BZDA 1NLBH 1NL0L 5SWSB 3SCMB 1OVZA 3O6LL 3KAAA 3U9UA 2NY5C 3B9KD 3VFVB 5C0GB 5L2KA 4OCXH 3EHBD 5JO5A 2QSVA 4JRXB 5AUMB 4M7LH 5D1XC 1QEWA 3DWTA 3WLWC 2JCCF 3GBLA 4P2QA 1SY6L 2YPKB 5CMAA 3DXAA 1IRAY 3HRZB 1EUUA 2VDLH 3V7AG 1MCHA 1SEBA 4DCQA 1U8HB 5GGTA 3MLPA 2OK0H 2BSTA 3MREA 4JY6A 3PDGA 2FECL 1RUAH 3IU3B 3KXFD 2B1AH 4JFQA 3O9WB 2YZ8A 1MLBA 4LASH 3R8QA 4X4YA 3BAEH 3GSRB 2XFXB 4EVNA 4U31A 5DRNA 2WSKA 4PJAE 4PRNB 4DUXA 1VFOA 1A6TA 1MCIA 5MP6L 1WZ1H 4JFDE 3D3VD 4Q6IB 4CU7A 3U1SL 2KUTA 1RZIA 4NN7C 5DC9B 5DMGC 3NBNA 3KPPB 4LKXA 2AJVH 3MLRL 3C5JA 3QDMA 5E4EB 3V95A 4PJCF 3H9SA 3MLTA 4LF3B 4TSBH 4C57C 2FATL 4U3XA 3E8UH 4LDOB 2VXTL 1N26A 4HUXB 4PJHA 5EC2B 3RGVB 2ZPKL 3C6SA 1ORQB 3DROB 4XTRD 5HHPB 4KDTC 3BE1H 1OTSD 5I73B 2LTQC 5JQ6H 1ONQA 2HLFC 4L9LB 3V9FA 3B5GA 3LS5L 3ULUF 2PN5A 3LY6A 5E9DB 1A2YA 4WI4A 1ODAA 5DJAB 1I7RA 5ADPL 3OKKB 1IGTB 1X7QB 2VABA 3D0VA 1NCWL 2QLVB 1JF6A 2FL5A 5B22A 3GBNL 4IOIB 3VCLB 1KT2B 3LN4B 2ZOKB 1UQSA 2B1HH 4YHZH 2VC2H 5T3XH 4OF0A 2A83B 2CRMA 1PEWA 4KU1A 2QKIA 1B4JL 4UT9H 4U0RB 4XPBL 4UI2A 3V6OC 4R96A 1E4KA 1N8ZA 2Z8RA 2DYPA 4G9FE 2GCYB 1BQHA 3QIWD 4ELME 4N9OB 5DJXB 5E99H 1GGTA 4N0UE 4PJFE 4Y5XA 3GB7B 3RIAF 4LGRB 2I24N 1D5MB 3QUXB 6CGTA 2R56L 5IIEA 4POUB 1YC7A 3U6RA 4HT1L 3FB5A 3O3EA 2GTZA 1D5BA 3AS1A 5DJ2B 4R4BB 3GHBL 5B4MD 1G1CA 4ZOBA 3T65B 3ZKND 3MOBL 4K3EH 4M61B 1IGIL 2MFNA 3UTTB 4DEPC 4P57B 2GQHA 2AK4D 4OZ4B 4UTBL 5C07D 3OKEA 4QHNB 1R3JB 3W39A 3T8XB 4JB9L 1LO5A 4PGBB 2O5XL 4NFDA 1KV3A 3FRUB 3MRGB 3LKNA 4JM2F 1E4KC 1CVRA 4Y4FB 4PV8B 1FGVL 5DGRA 6FABL 1R5VA 5IHZA 4LAJH 2DAVA 5DLML 3MRKA 5F8RC 4Y5XC 3O2VH 1XH3A 1JCKA 3GJFH 1U8NB 4I2XB 5GJTL 4HLJA 1LE5A 4NGHH 4U6XB 1LP9F 5I8OH 5IOPA 4JJHA 4G6ML 2YC1A 2HAZA 1R0AL 5ESAA 3G04B 3JWNC 4JPKL 1IC4L 5E5UB 2HTKC 3EFDH 2OZ4H 5C09A 1CDHA 3WHE1 2DQJL 1O7SA 2ZCLL 3H3PL 4FQQB 3RZCB 4AQ1B 3FOLB 4KXZH 4U1SB 4HPOH 1JHLH 4NQDB 4X5LA 1U3HA 3IF1B 2P5EE 5GZOD 1Z0MA 3FO1B 5D2NC 2V2WB 3LS4H 3RWGB 1AGFA 4P4RA 4PJDA 4HJ0C 4BQ6A 1JF1B 2BHZA 1QLEL 3PXJA 3V5KA 4DKEL 2ADFL 2HG5B 5CBEB 4MAYD 3L5XH 3IDUA 4Z18A 4Z8FH 1E0OB 4H8WL 5BVPL 2R0LH 4QY8B 1P1ZB 3QFDB 1J8HA 3F6LA 3O0RL 4ZTPL 5JW4Q 3O6KH 5I74B 5T5NG 4FZ8L 1BFTA 5DFWH 4L4VD 2QR0A 4YDIH 2XYCA 5TE7H 1Z9SA 2D2OA 3OAUH 4L5FL 1NAML 4U2YA 2ZCHH 2PTUA 2BOCA 1U3HC 3MV9E 1YYLH 3HMWL 3UZQA 5DJZB 3SE9H 5LCVH 4YHOH 3VI3E 1QBAA 5BS0D 3D9AH 3C8HA 3O6MH 1G7QB 3MRQB 1UXSA 4G8FA 4JKPH 1RUKL 1ZHKA 3M1BB 4XP9H 3GJEA 1G6VK 1NCDL 4PJBF 5HVFB 1NAKL 2CUIA 2N56A 2RB8A 1K4DA 4JVWA 1NFDE 4YE4L 1HHGA 3RNQA 2EDQA 3H9YA 4LLDA 5KANG 2N7BA 4Y2DA 2W92A 4U05A 4H1LG 5EZLB 1IARB 4ODUB 1FVCB 4K3GA 3X3FH 1I8IB 2AI0L 3AS2A 2FEEI 1J87A 4OCSH 1U8JB 1QSEE 2I07A 3IGAB 5J6HA 4I3SH 5IMOA 1ZT1B 3SQOL 1PKQE 1KLUB 3ZKXB 5E00A 3I75A 4WFFE 1JYXA 2DIAA 2FWOA 4PJAA 2XWJA 5GRWA 3DBXA 4JFDA 2DI8A 2NPLX 3TM6A 3W0WE 5D4QA 2J12B 1FH5L 4LSPL 4PG9B 3EDJA 1MVUA 3JSSA 4CW1A 3OXSA 1P5VA 5MEQA 1LO4L 3C60A 1NEUA 1UA6L 1U95A 1G6RB 4NUGL 5HDQL 3PDOA 4NDMB 1KJ3H 2OJEB 4Y2DC 3U4BH 2Y36L 4GS7C 5F1NA 2DLEA 2EO9A 5EUOF 2Z92A 2BVTA 4J1UA 1K9TA 2VLLB 3VWJD 1CK0H 2MJWA 2B2XL 3KPSD 3FHQA 1QVOA 4S1DD 1EEQA 2X9XA 3L5IA 5DWUH 3AB0B 1AY1H 4IMKA 1DLHB 1R3HB 3BT2H 1HQ4B 3GZKA 3VA6A 3D69A 1QKZL 2ZG1A 1F42A 5EU6D 2H2SC 3UTSB 5EU5B 1BQLL 3EYQC 2FX7H 1YQ2A 1KCVL 2BOBA 3FN9A 2ICWA 2DICA 3HN3A 3RU8L 3SY0B 2P44B 2PYFA 5IW3A 3WXWH 1FPTL 2A6IB 3R06B 4KKBD 1X6LA 4G9FA 4EQ3A 5LXGL 1AHWB 3PL6D 4QRSB 4ELMA 3UX9B 5EBLA 1AKJD 4N0UA 4PJFA 2ZUSA 3MO1A 4UNTA 3BIKB 3ME0A 4XNZB 5F89A 4LEOB 4XVJH 2YD1A 3HAEG 1CGTA 3ETBF 4FNLL 1RZGB 4UINL 5DUPL 4ENED 5D7JB 1VEPA 5FM5O 4NQSA 4OFPA 2CJUL 4PRID 4XBPB 5FYLH 3K7UA 4EN3B 5ID1A 4PUBH 1AQKH 3P9WB 1UWXK 4FQXA 2Y4SA 3BZ4B 3HI6H 1OARL 4WHTA 3VXPB 5J9PB 3SO5A 2HT2D 5CJBA 5HYFA 3HZKA 2X4OB 4PJHF 3GMMB 1I7ZA 1MWAB 4FTVB 4PJ8B 3SKMB 4OAWB 4HIEB 5EBMB 1FAKT 1ZAGA 3FCTA 5EA0H 1YPZE 4PGJA 4XCEB 1BM3L 3T77B 3L3OB 3QIUB 1AC0A 3O6FA 4L3EB 3MRFB 3T2NH 3QDJE 4DVBB 2BC4B 3CFKB 2D9CA 3DRTA 3RWEA 3ARFA 3NIFE 2E9BA 3AAZA 4U1GB 3LN5B 2GSGA 2QADD 1KPRA 2RHEA 4FQXC 4HPYL 3BZDA 3LQAL 5F7EH 1CIUA 1YEKL 4Z0XB 4XP6H 4TVPL 3HUJB 5H2BB 1GOHA 2P5EA 3C8DA 4ODSH 2L7UA 3F7VA 3I84A 3PHOA 1T5WB 4GRLB 2GJ6E 2H9GA 3O45B 4LCUB 4UT6H 4I18B 2OTWB 2DMBA 5GS1B 3HHRB 3ZHKA 3CFJB 3VFUB 2CPCA 35C8H 4JGJA 1CFSB 3W81A 4H5SA 1CLYH 3IRZA 3DSNA 3TZVB 3VXOA 4M1CC 4F9PA 2FZ3B 4FXGA 2R29H 4GBXC 4KRNA 2MWCA 3GGWA 4YDLC 5GGVH 3ARFC 1QRKA 3IFNH 3MLXH 2CIKB 3KLHC 4CNIB 3T0WA 1FNEB 4M4PA 3IDNA 2HFFB 4PD4K 4U4BA 3O2DL 5IV2A 1MRFH 4YC2C 4NQEB 4JAMA 3ULVD 5C0DB 3MV9A 4JO1H 5CIPB 2FIKA 1XF4A 3OXRA 5IB2B 4JFFB 4Q9BA 4W81A 4OFVA 3INUL 4UT7L 1GC1C 1GGIH 3T0EB 2YUWA 3B43A 1IJ9A 1G7HA 4R97B 4O2FB 1NSNL 4MQSB 4I9WE 5IB4B 4YPGA 3U2SA 1EO8L 4A2MA 1NFDA 1CR9H 4LLYB 1N0LA 4F9PC 4KQ4H 1LEKA 5ABDE 3ECBA 1SYSA 2D7TH 4R90H 2DM3A 3CCHB 3IETA 4AT6A 1Y6NR 2CO7B 4ISVA 5L9DL 3ZKMD 4TRPL 3WHXA 1URLA 5H35A 5I76B 4HIIA 2FO1A 1U8KA 4MLIA 5HXMA 4YFLF 5BCAA 5IFJB 3T1FB 2CDEB 4LLQA 1TZGH 1QSEA 1OD7A 1FVEB 1SEQH 4YO0A 2VL5A 1PKQA 3H9ZA 4NRYA 5CEXA 4GXUN 3S88L 5JPMA 1INDH 2BHUA 1NMCB 3VJ6B 2R23A 3NTCH 3Q6GL 4TTDC 3W2DH 3ELAT 4OIIH 1QPXA 3UTOA 3W0WA 3LIZL 4Q9CA 3G5YA 3RVWC 5I8EA 2VQUA 3BEVA 4YAQA 4ZUWB 4WTWA 2EEBA 4KKCC 2ERJC 1IAIM 1KTDA 4RMSA 2CRIA 1Q8MA 1ZA6A 3BQUD 1JPFB 1P69B 1NQBA 1S5IH 2JJVA 1KACB 1NCBH 2BVOA 4DAGL 1QBBA 1NCAH 1VFBA 5FHAH 2F9BT 2R0KL 2AVGA 3L5JA 4PG2A 3MNWB 3EOTL 3K3QA 5J1SC 5KW9H 4ODVL 2NQCA 5K9QG 4J8RB 1M71A 5K59E 4X6FB 5FO9B 2CLZA 1NGZB 1T80A 1HCFX 5DD3L 3IKCB 4JFEB 5D1ZB 2UVFA 3OKNA 4HC1H 4MXQD 5DQ9B 1A3RH 2H32A 4CMHC 3QEUB 4O51A 4O9HH 1HINH 3S3JA 4CMMB 1I1FB 2PF6A 3W11C 4JQXC 1K85A 5K9OA 2DQFB 3ZMRA 1J1OL 2P5WE 1MF2H 5JOFA 1W72A 4XVTH 1U0QA 4G7VH 3WE6A 4NQXB 3U48A 4HV8B 5EU3B 3P77B 2EXYC 1KPUA 3O8XD 3I50L 4ODHH 3X13A 1BREA 4ONGH 5JXAL 4QXUL 4Z5RA 2VDQH 4RRPA 4POZD 5MEPA 2EYTB 3OX8B 1EFXD 1FFOA 2Q7YB 4GW5B 3T0VA 3CH1B 1K3ZA 4PG2C 3LRGA 4MJ2A 5CZKA 1G6RL 3FT4A 1NDMB 2APVA 5JW4R 3GJFK 3RVUC 5I1KH 4F7MA 4C4KT 4WHDA 3WO3B 4PRBB 4MJ6B 5FYKU 4QYOA 1RUPH 2VDPH 3MJ7B 5I15H 1UENA 1HN1A 4XAWL 5I17A 4GSDL 4JVPA 5I1AB 3TO2A 1KJMB 1KB5B 3VFNA 5CSZB 3HNVH 5GGSY 3LKQB 3PWVA 2VQ1B 3TH4T 2DQHH 1A64A 2DQEL 4R3SB 2X7LA 3DX9A 5DHYA 2K7QA 1LNUB 4FFVD 2XACC 3A67L 4Y88A 5AEAA 3GRWA 4WENB 1RZJH 1XMWA 1SY6A 4WGVB 2Y5TA 3UXFA 5HPOA 2KBGA 3DO7A 3TA3D 3O11A 5EO1B 3VGBA 5C0IB 4L8BB 1BBJB 1R3IH 1YPZA 5GSRB 4Z7WF 1DQDL 3D1MC 2VDKH 1NBYA 2R4RL 4OZFH 1BVZA 1I3RB 3QDJA 4KK5D 4J3TA 3ARGA 3UTQB 2X1QA 3ZHLA 1M05B 1UH4A 4ZFZB 4ZDHA 2VJXA 3BIAX 3IDJB 4LVNB 4UQ2A 1EBPA 4EIGB 2E9JA 3IS1X 3VFMA 1FBIH 3B2VH 3CSGA 3NACH 2PO6B 3GSVA 1F02I 3DARA 4ELMF 5ADOH 4KI5E 2MMXA 3L7FB 5KVFH 5CEZD 1YN7B 2VN4A 2DIJA 2Z35A 4C59B 4PRPB 3OJVC 5KANI 5SX5H 1RZFH 5SWSE 1NMAL 1DUYB 3DECA 1N5YH 4QXTB 2GJ6A 1BBDL 1MFEH 5GRUL 3DUUB 3F8UB 2W65B 3N9GH 4UOJA 4JRXE 1CE6B 5SWZB 4UTAL 3RWJB 5D7LD 3OB0K 5LBSL 2GIYA 4DKAA 5FO7B 1YJDH 3QJFB 1MWAL 2X4NA 5JPNB 1HXMA 2W60A 4LEXL 3CVIL 3WFCH 1JI1A 5JW4N 3ARGC 4P23B 4CRPA 3AY4A 2DKSA 1Q72H 2GJZA 4KHXH 1G9ML 3DIFA 5FUZH 4YDKL 1Q9KB 3WD5H 2X89D 5FYKH 1OSPH 2QHLA 5TQ0L 4QRRD 5FKPB 3ULUD 4RGNB 4MA3A 4YFEA 4L8CB 1T22A 1UH3A 4HIJA 5DQJA 5JNYA 4BH7B 2W9EL 5GZNC 32C2B 1S7QA 2A1WH 2GITB 4OIBA 4OLZL 4PBVC 3EYFB 2QL1A 4G3YH 4NFBA 1GVIA 2AQ2A 2DQDH 2VUOA 1FLTX 4XH2B 3UO1H 4NN5B 3X17A 3QWQB 5AG8A 3VXSB 4MJIB 5DFVD 2ED7A 1CL7I 1FRGH 1Q0YH 5IUSA 1G7JA 3L1OH 3QWRD 5B8CA 3DTXA 5EZIH 3S36X 2W0FB 3AY4C 2GUOA 2WIMA 5JW5B 5E08H 2CD0A 1E6JL 5CD3B 1KEGL 1R6VA 4XP5H 3QSKB 3TBSB 4F37K 1SYVA 1DBAL 5HYSG 5HY9B 2XN9B 3PGDA 1E27B 5E9DE 4UDUA 5DJ0A 4GKZA 1YEIL 3V6FB 1K6QH 3Q3GB 4XNXL 3GMRA 1HYRC 4D9RE 1WC7B 5J89A 3UPAA 3TNMB 1N6VA 1IGMH 4NM4L 3NZHH 4DGYH 3QXAA 4JM2D 5DYOA 2K1MA 5EOTA 3LPWA 1K8DB 5DDHA 5F6IC 4HG4J 4XZUB 1TZHB 3ZTJG 2D0GA 5C8JA 3L95A 3QULB 1LO2L 4FP8H 5B8CC 2HH0H 2E5EA 4ZYKB 4ODXB 3B5HA 4IJ3C 3DV6B 4JZJB 1F4XL 5BO1H 2GK2A 3RTQD 2DBLL 2Z93B 4K2UL 1NGXA 1FNSL 4YHLL 1FE8H 3VI3F 1JGUH 3C09C 1XGQB 5CEYB 1V05A 3WIHH 1JNHA 4HWEH 2AKRB 4JKKA 4TVPE 2PXYB 4MDJA 1NFDF 3KXFB 3UTTE 5IT2L 2DDQH 3L3HB 3FO2A 5ERWB 1AQDB 2UUDK 5AZEH 3ALPA 4XNMB 1ZHLB 2P5WA 3OHXB 5KZCB 5D96C 1P4IL 3LEXB 4K3HA 5I75B 1SBSL 3PV6A 5ISZB 2CIIB 5GSVB 3PIQA 2XG5A 3RY4A 3W5MA 4PRDA 4RGMC 1TJHH 1BPVA 3MV7D 4G9DA 5F1IB 1XFPA 4PJ7B 1DUZA 2BCKB 3IJHA 3EJZC 1A9EA 4I2XE 4FFWC 4WTZA 3DRQB 2DRUA 3TP4A 4YXLH 4I0PD 2ARJA 4OZHF 1NEZG 1NAMA 5E03A 4JO2H 3DETC 3NPSC 1A3LH 4PS4H 3MRDA 4JO4L 1B0WA 2G5RA 1J0JA 4OQTH 5F7MC 1YZZA 2WMPA 4DTGL 4CAGA 3L5WB 1RQ5A 3LB6C 1NGPL 4NQDE 2XKSA 5F3BA 2AJUH 3QQNA 3MXWH 1TZIB 2CLVB 1FL5B 4FABL 1UACH 1DBJL 3MA7A 1OSZA 4P2RD 3DMMA 4XGZA 4O5LL 1YEJH 1W0YT 4M1DH 3MMEB 4UU9B 1QG3A 1J9CT 5LGKA 3QIWB 1FHGA 4H25B 5KS9B 1KTLB 1KBGL 2XRAH 5DHVB 5F9JB 2L4OA 3MUGA 1IAKB 1HEZA 1J05A 3VI4E 1P7KA 3GUTB 3B5TA 4WHYG 1QFHA 2ATKB 4LRNH 3ZLQC 4HXBH 4RFOH 3AGVA 3MZGB 5D1XD 2RCSH 5ICZA 2KKQA 4PIRF 5I8KL 4YEFA 1XZ0B 2L0DA 1MH5B 3G9AB 4P2CG 1JZ4A 3MJGX 5HHNB 3HE7A 4QGYA 5SWSA 1KB5L 3SCMA 2DQIH 2O61B 2AXFB 4QO1A 1M4KA 1RFDL 2NXZD 2A6DB 5C0GA 5C07B 3VFVA 5HHXL 3DMMC 5D7KE 2V17L 1H3UA 4JRXA 5AUMA 1JZ2A 1RULL 3V52L 1DVFB 2YD6A 5JMRA 1FAIH 2B5IB 3ALWA 3KHQA 4F2MB 2BY2A 5GJSH 3CXDL 2YPKA 1FGNL 3HRZA 3HPJB 1HZHH 3RHWK 4UDTB 5L2KD 1I9RH 4S2SB 3UTPD 1U8HA 4OLEA 1Q1JH 1WEJL 3ESVF 5DMGD 3TFKC 1TMCB 3BGMB 4MLSA 4MCZB 3IU3A 2X1WL 3QG7H 4PB9L 1PFCA 3O9WA 4KI5C 4NBYB 3GSRA 3HE7C 2XFXA 2XZAL 3DXAD 1ZANL 3BSZH 1HNFA 1BZ7B 1QFUL 5K9JL 4PRNA 4HWBH 4IBLT 3S7GA 4Q6IA 4JG0L 1EEZB 2HFGL 3GKWH 2A73B 2FATH 4O02H 4UV4H 3KPPA 4KTDH 4XC1H 2DQGH 4JFOB 3NIFF 2R8SL 5K9QI 3G08B 4R2GC 1P4LB 5I1IL 1T03H 2ZPKH 1MNUH 2HLFD 1EVUA 2J6EL 2E6JA 2VLKB 2W0KA 3I3BA 4LF3A 1PG7L 1MHEB 4KHTH 1DR9A 2AGJL 1KENH 2FX9H 4E5XB 1RV6X 1DN0B 4NZRL 4HUXA 2CKBL 5EC2A 4XWOC 5H94B 3RGVA 3VG0L 4ZUTB 1ORQA 3DROA 5HHPA 3BKYL 1MVFA 3QDMD 3O9WC 4UBDD 2WQ8A 2YUZA 3H9SD 4L9LA 3ZYZA 4HF5L 1F00I 5E9DA 1FYTD 4L4VB 5DJAA 4KRMB 3B8YA 1KFAH 1RURL 4PV9B 3OKKA 4Q6IC 1IGTA 1X7QA 4M5ZL 1DANU 3UTSE 5DURB 1JL8A 4IOIA 4X9FA 1KT2A 4KVCH 3VCLA 5C0RH 2X5PA 2PUQT 3LN4A 2ZOKA 1UYWL 3QEGL 4NWTL 2A83A 1CGUA 2GCYA 3TYFB 2GKIA 3QXWA 1OY3B 5DJXA 4XXDB 5HVHB 4Z0BH 4RX4A 3GB7A 2X4PB 3PWPD 3RGVC 1D5MA 3QUXA 1NANI 5I73C 5IBUG 2PYEB 5ICYB 2XZZA 5DJ2A 4R4BA 2Z8VC 3T65A 2BVYA 1E4JA 1JK8B 4M61A 5C0BB 2DM4A 3N06B 3UTTA 3P30L 4BQCA 4P57A 1FGVH 3WFBL 4GMTL 2Q8AL 5I2IB 4OZ4A 4XMLH 3DJ9A 2OMNA 3EFFB 4QHNA 2XY2A 3B3IB 3T8XA 5I1JH 4TNVK 4PGBA 2GJJA 3UJIL 4QTHB 3DYPA 3FRUA 3CX5J 3MRGA 5CKAA 4XPFL 4U0RC 4FTVE 4Y4FA 4PV8A 4ETYA 2HTKD 5A16B 4MVBC 4Y4KC 5I1CL 2CLRB 4O2CB 3JWDL 3QHZL 4ONHB 1D9KB 3V4PH 1FLRH 1U8NA 4I2XA 4X9GA 4GOSA 4HUKB 2HWZL 3QUXC 4L3EE 4NNPL 4U6XA 5D1QB 5FHBH 4Q0XL 2NY6B 4FMFA 3LQAC 4CKVX 3O2DA 1L7TL 3V2AR 3G04A 4M6ML 3VWJB 4FFYH 1BIIB 1MCJA 5IJKA 1XGRB 4FQQA 3RZCA 3BDYH 3FOLA 4U1SA 5I18H 2R4SH 4LSSL 3HC4H 4WWKD 3HUJE 4NQDA 3IF1A 5FCUL 2BSSB 4KPHL 5T1DH 4ZPTB 1CXEA 2V2WA 5EU6B 2BVUA 3RWGA 2WWMC 3TIEB 1FP5A 5SX5K 1T66C 3T0AA 3RGHA 4BUGA 1JF1A 1IT9L 2OR9H 3ZKSD 2HG5A 5CBEA 3L3KB 2JB6B 4G7YL 1OAYH 4GT7A 4QY8A 1DE4B 2JB5H 1P1ZA 4WU7B 3QFDA 3BGAA 5JLZB 3PL6B 1YNKH 1O7VA 1U3HD 3O3BB 3QA3B 3NAAL 1FC2D 1N0XL 3L3IB 1JTTA 1FO0L 4W6XB 2EH8H 3RUGB 1X5XA 5IJKC 2XZQL 3MJ9L 3CXHK 3RZCC 4TOYH 4LPVA 5I1LB 5FF6B 2UZIL 4NQEE 1OTTC 4EI5B 4V1DB 4JFFE 4C83B 5DJZA 2FLBT 5DSCB 3KYKL 4XCFL 3T0EE 2AV1B 1G7QA 3MRQA 1EVTC 1TIUA 3HLAB 3M1BA 3U9PH 3NIGE 4YHIB 4OFKA 4Z7VB 4GRWH 2AI0H 5IBTL 5F7LB 3F58H 3LQMA 5HHVL 5TDPB 2C4XA 5JUEL 3SQOH 5EZLA 4H20H 5I74C 4ODUA 4JLRB 1A7OL 1FVCA 1I8IA 4WFEE 3P4LA 3GNML 3CZFB 1H3PL 1WT5A 1YC8A 1BJMA 1U8JA 2J4WH 1TTGA 3FQRB 3IGAA 4BQ8A 1ZT1A 5C7XL 1KLUA 4D3CL 1S3KH 3JBG7 2R0ZL 1U8QB 1EAJA 5KSVB 1C5BL 1WIPA 1X5ZA 4Y2DD 5I16B 4WY7L 3RVVC 1DSFL 5C86A 5DVKA 1IMHC 4NQUA 1DQMH 3SBWA 1NMBL 2AW2A 4AYFA 1I3GL 2FGWL 4G5ZL 4NWUH 3FHAA 2W9DL 4PG9A 1T0NB 2I27N 3MLUH 5D6DA 1U2CA 5LG1A 2VR9A 1ZLSL 1QD0A 1FNGB 1G6RA 4XX1G 2W91A 2B2XH 4P9ML 4NDMA 2OJEA 3RAJH 4JFDD 1LHZA 1TETL 2H2SD 4Y19D 2Q20A 4N0YL 2VLLA 1ITCA 3EYQD 4ZO7A 1IGFL 4IS6B 1WT5C 1ZV5A 1WZLA 2OJZH 3QUMH 4WJ5B 1JRHI 2RBLA 1DQLL 3QG6B 4LRIA 4JFEE 1MJ7H 3D18B 1DLHA 1R3HA 4MB5A 1HQ4A 3P4MB 4J3XA 1OP3H 4LU5L 3GDBA 3JV4B 5LXGH 3AVEA 3SBWC 3CSBA 5EU5A 2ZG3A 4NHUB 3LCYA 3UTSA 4EOWH 4RMRA 2J88H 3PP4L 5D6DC 4PGZA 2IPUK 3SY0A 3NIDE 4JY5H 3K81A 2OP4H 5DMIL 2A6IA 3LPFA 1F6AB 3R06A 5EC1B 5L8KB 1AHWA 4QRSA 1RPQA 3EDDA 1XCQB 2P45B 5DT1L 1RIUL 3TJEL 2X42A 3BIKA 3SGEI 4OZIF 3DHJA 4LEOA 3ILPB 2R2CA 1FVDB 3UJTL 2JLLA 1A6UH 1BZQK 1KUMA 1Z3GL 1RZGA 4XB7A 1NGQH 4LRIC 5D7JA 3AB0C 3MA9L 2FEEL 4HWUA 1BAFL 4XBPA 1DL7H 1XF3B 3EDFA 1T7WA 1P4BH 1WISA 4RMUA 4O4YH 4EN3A 2VN7A 4PB0H 5GPRA 4WNQB 1NFIB 3BZ4A 1P84K 1ROWA 2DLFH 3VXPA 4L29B 5J9PA 2DKMA 4XAKE 2X4OA 2AXJA 4Z9KB 2R69L 3GMMA 1DBBL 1MWAA 4FTVA 4PJ8A 1OHQA 2VLRD 2WP3O 3SKMA 5AYUH 4OAWA 1L0XA 1AHWC 3P11L 5EZOH 3AC0A 4LKCB 2BRRH 4HIEA 5EBMA 4NM8L 1LO0H 2DTML 1ACYH 4DW2L 2OSLB 3I3EA 4FQXD 4XCEA 2GY7B 4D9LH 3WFZA 4OLVL 3T77A 3L3OA 3QIUA 4Z7QF 1X5HA 4L3EA 3MRFA 2PNDA 4HUNB 4DVBA 3CFKA 4Q9QL 1HKLL 5D7JC 1QFWI 3C8KB 1MFBH 4U6TA 2BXZA 3V0WL 4LDEB 4EN3C 3LN5A 5IR1B 4OGYH 3WYRA 2W59A 2VQTA 3QP3A 5JOPD 4Z0XA 4PRPE 3MRCB 3HUJA 2P1YA 4GBXD 5H2BA 1PQZB 5GHWL 1YQVH 1YNLL 1KCUH 5I1HL 2LVEA 4PJ8C 3ARFD 1MSPA 1T5WA 1F3DJ 3OKMB 4GRLA 3O45A 4LCUA 2XZCH 1TPXB 2OTWA 3SE8L 5GS1A 1NUFA 3KLHD 5SWZE 3CFJA 4J3WA 3VFUA 4RWYH 1CFSA 4DN3L 4MD0B 3BI9X 1G9MC 5J7CC 2QHRH 3TZVA 1I9EA 4ZUUB 2RAMA 1MHCB 3UBXI 1KLFA 3QIUC 4RA0C 2FZ3A 5T3ZE 3I85A 4KMLB 3SDYH 1EFXB 3PWJB 1J5OL 5IFAL 5EIQA 5JMOC 3QHFH 4LSVL 3HNTH 1HHJB 2O5YL 2CIKA 1A1OB 4CNIA 4U1GC 4GG6B 4GUPB 4LFHD 2HFFA 1FZKB 3C6LC 2YKLH 3A6CH 3SKJL 2VDNH 4RGNE 4HMDA 4RAUB 4NQVB 4U1NB 5LGJB 4NQEA 3VXNB 1BQUA 4H1LB 5C0DA 1MEXL 5CIPA 4X7DC 4JCLA 1YY9C 5IB2A 4JFFA 5IW6B 2FHCA 1KN2L 4AEIH 3NCMA 4D0BB 1CDBA 3T0EA 1MFDH 4I18C 5FDWB 4GFTB 5GS1C 3LEVH 43CAB 4O2FA 4AEEA 1G7MB 3V0VB 1AJ7L 1NCCL 2YRZA 5IB4A 3TZVC 3VXSE 4C54A 3NCJL 4LLYA 3IDYB 4MJIE 2XTLA 3S34H 3TT1H 3TA3B 2JCCB 3CCHA 1JYWA 1JNLH 1MREL 5EN2B 3I6LD 5I76A 4JHWL 3NH7H 2HKHL 3RVWD 5IFJA 3T1FA 2MCPH 2CDEA 1U6AL 2XN9E 1FVEA 4KKCD 4N0FB 5CAYB 1INEL 3LRSB 3PHSA 3VJ6A 3DPBA 3U7WL 5E8OB 1FNLA 2WUBL 5DJDB 1HI6B 2X41A 5DMJB 4R97C 4DAGH 3BD5A 2FRGP 1UG9A 2YD8A 5A2FA 4ZUWA 3VI4F 4ZS6C 1QSED 5HGHB 4N5ED 3WUWG 1VEMA 2DB8A 4PJCB 4JO3L 4U1IB 4BZ1L 4UIMB 1QSZA 4BYHA 1JPFA 4WFFD 3MACL 3OR7B 3W11D 3W0WD 1J86A 3MNWA 4CN1A 4P3CL 4O58L 3C9NB 3MLZL 4J8RA 3W9DB 3QRGL 4X7FC 1VGKB 3QUYB 4X6FA 5FO9A 1NGZA 3IKCA 4JFEA 2EXYD 4YHKL 5D1ZA 2ENSA 5DQ9A 1F2XK 3DYOA 3ARTA 3QCVL 3QEUA 3ARZA 3KXFE 4CMMA 1I1FA 2O93L 1U3ZA 2DQFA 4M7ZB 3HAEB 4MAUH 3LOWA 4NQXA 3VGFA 5ISZE 4HV8A 1L0QA 5EU3A 3P77A 4BJLA 3G9VA 5IB1B 2YOCA 3TVMC 4HX1B 1IBGH 4X80H 5CCKH 2EYTA 3OX8A 1BFOB 1XGYL 2Q7YA 4PJ7E 4GW5A 3CH1A 3RX7A 1C5CL 1NDMA 3C2SA 4J4PD 2YSSB 1S7TB 4QTIL 4PRBA 4MJ6A 1JZ6A 4F57L 4D94A 4OGAC 5F1OB 3MJ7A 3L7EB 4NKIH 5D1ZC 4N8PA 5I1AA 2FJGB 1KJMA 1KB5A 5CSZA 4EDWL 4LHJB 4XHJC 3LKQA 5C0FB 4G6FD 2VQ1A 3CU7A 5TFSH 4R3SA 2Q76B 3BKCL 1F4WH 1LNUA 2GW5A 4DGIL 4YX2L 3CLFH 4CVWA 3MCLL 3WJLA 4YBQC 4JDVB 2SEBB 5FECB 2C1OB 1CD9B 3EBAA 3ULVL 5IB5B 1D6VL 3BD3A 1BOGB 5EO1A 3W9EB 5C0IA 4L8BA 1BBJA 1FNHA 4KTEL 2XY1A 5GSRA 3HNSL 3ROOB 1HXYB 4K3DL 2R2HB 3BW9A 3O41B 1QYGL 3FMGL 1H3WM 1AXTL 5KS9E 5TJWK 5GGSB 1I3RA 4HIXH 3UTQA 1CF8H 4NCC2 1KCRH 1LP9B 4HKXB 1M05A 9CGTA 4ZFZA 1M6OB 4OUUB 3IDJA 4LL9A 4ZSOB 5I1EH 4LVHB 1Z6JT 2OR7A 2PO6A 1OP9A 2NYYC 4K55A 4CU8A 3HPLB 3L7FA 2ILLA 1YN7A 4PRPA 2EDOA 5LBSH 1HILB 4BZ2L 4KJYA 2AK4E 3ARGD 2J6EA 1DUYA 4OFIA 3UPCA 5C07E 4QXTA 4F8QA 3K1KC 3D2UB 3DUUA 1IGYB 1ZLVH 5SWZA 1CE6A 3QIBC 1HH6B 4HGWB 3RWJA 1YY8B 1T1XB 3C5ZD 4PLOB 5FO7A 3QJFA 2F19H 5JPNA 1UM4L 3MR9B 4RMWA 3WNNA 4M1GH 5FFLA 4QHUB 4P23A 1TVHB 5GZND 1CL7H 1T7XA 4Y8DC 2ZCKH 1A6PA 1EJOL 2EDLA 1Q9KA 4M5YL 1OW0A 4LVNC 1JWUB 4OM0L 5L0QB 5FKPA 1WFOA 3QISA 1FCCA 4L8CA 1MI5B 1V7NL 1S7WB 3MV01 3Q1SH 2J8HA 3E3QE 1LEGB 4R0LB 2EDRA 4ONOA 1PVHA 1DQTA 4BH7A 32C2A 2M1KA 2GITA 5HGGS 5LJYH 4OB5L 3EYFA 3M8OL 3RA7H 2BDNH 1RJLB 4XH2A 3D25B 4MSWB 3MRRB 4XNUL 1IC7L 2VLKE 3VXSA 4P2RB 4MJIA 2YZ1A 3MODL 1DBAH 1N2RB 5FCSH 4P23C 5DGQA 2W0FA 3HZMB 3HUJF 1T1ZB 5JW5A 5TF0A 1EBAA 2A6KB 5GISL 5CD3A 3TBSA 4RGNC 4I9WD 5F7FA 5HY9A 2XN9A 4ZPVB 1E27A 4FQHB 2VH5H 1E4XI 1HIMH 2CRYA 1FL6B 4L4VE 2B0SH 3V6FA 5A3IC 3Q3GA 1I9IL 3H3KA 3F62A 4M7JH 1WC7A 1QRND 1OP3K 3EO9L 3TNMA 1SM3H 2YRPA 3E6HB 4NN5C 5L8JB 2P4AB 3GMOB 4YHLH 1K8DA 1VHPA 3B9KA 2NXZB 3IDGB 4XZUA 1TZHA 1GAFL 3WIIH 3QULA 4MZ2A 4X7SL 2W1NA 2WBJC 1N6QH 4ZYKA 4LSRL 4ODXA 5JW3H 4HMCA 3DV6A 4JZJA 3X12B 2Z93A 3LKOB 4G80B 5D5MF 1GPOH 5C0NC 4HXAL 3J8F7 4JZOB 1F58H 5CGTA 2PYEE 2YMXH 3GO1H 1XGQA 5CEYA 4Z7UF 5HJ3B 3NIGF 4KZEH 2AKRA 1NDGB 1MY7A 2PXYA 1NUNB 3HMXH 4MNQB 5C0BE 4NIKB 1IZJA 1CWVA 3TNNB 3KXFA 5C6TL 3L3HA 3BDBA 5ERWA 1AQDA 4UOW1 4XNMA 5T1LB 1ZHLA 4QCIB 4F7TB 3EJZD 3OHXA 4FFWD 3LEXA 5INCB 4JDTH 7FABH 5ISZA 2CIIA 4OI7A 3ARUA 2YWZA 5GSVA 3K2MC 3BKML 2V9RA 3DETD 1WQVT 3EOAB 4HAGA 5CEZL 1S9VB 2LFGA 2XTJB 3D39D 5IQ7H 4YQXL 4K7PL 1KIRB 4L8SB 1HE7A 5F1IA 4PJ7A 2LTQB 1ZT4B 3O3AB 2BCKA 4XVSL 1A7NH 1EHAA 2WINB 4ORGB 3DRQA 4OCWH 5ILTL 3LB6D 2CKNA 2P49B 3MJ9A 2JK5B 1L6ZA 4OTXL 4OD3L 4AMKH 2PXYC 4M43H 3ABZA 3CFCL 1BJ1H 4PD4J 2DM2A 4U7MA 3X14B 1ZTXL 4JHAL 4KJPC 3Q48A 4YJZL 1FYTB 5DRXB 2VB5A 3L5WA 5ESVB 5I75C 3WO4B 4AIZB 4KUZL 1TZIA 2CLVA 1FL5A 5EU6E 2X1XR 1A6WH 3DI3B 15C8L 3GI9H 5KTEH 4A6YB 5FV2A 3OPZH 3G5XB 4WUUB 5T3XD 1QLFB 3JUZA 4HFUL 3MMEA 4P5KB 3KGRA 4UU9A 5D70H 1B2WL 3X3GL 4BELD 2EXWC 1NCUA 4DKFH 4QRTB 4UNUA 1UM5L 3QIWA 2NY0B 4H25A 5KS9A 1KTLA 3WHE0 4DEPB 2AABH 4OLXL 4PTTB 4YIQB 3MCG1 3PWPB 5DHVA 5F9JA 3PUCA 2ENYA 3B83A 1IAKA 3DMMD 4KY1H 5GS0H 1ULVA 3RUGE 3MUZ1 3GUTA 2ATKA 3KPOB 3PGFL 1JZ8A 1XAUA 1XZ0A 1RULH 1OAZL 3T2QA 4M62H 5HHNA 2Q8BH 4KUCF 4V1DE 3V7AE 1MJUH 2RQ8A 1I85A 2AK4A 2O61A 2AXFA 2A6DA 3QDHA 3IB4A 2FB4L 5C07A 3CLEH 4S11A 3TFKD 3FQUB 1DVFA 4OM1H 1B0GB 4Z7VE 4WI2A 2DI7A 1J0KA 4F2MA 3KLSA 4KI5D 3S37H 1VFAB 3QCTH 3QIWC 2DQCH 3HE7D 5E2WL 1NUGA 5TPWH 3HPJA 4UDTA 5SWSD 3B6SB 4P5MB 4HS3B 3EDEA 1MIML 1B90A 4S2SA 1R5IB 3TBVB 2YUVA 3BGMA 3LH2L 1CFNB 4MCZA 4R2GD 4YXKH 5D2NB 4F8TA 1YEEL 5FOJA 3BP7B 4YHML 4X0KA 4JRYB 1BEYL 2X44D 3ALXA 3RPKA 1BZ7A 3H7LA 3ES6B 1Z9MA 5EORL 4H88H 1EEZA 5L88H 1AI1H 2A73A 4WWKB 2C5DC 3MGTB 4XWOD 5HYSB 2ID5A 4JFOA 1DVFC 2HJKB 3G08A 3VRIB 3OTTA 2RIKA 4DN4H 1GGUA 1P4LA 2CKBH 2B5IC 3CD4A 3O9WD 3GMNB 4ZOEA 2VLKA 3ZDYE 3KPRB 4FQCL 1OTUC 3GMPB 1P53A 2VZTA 3WJJA 1MHEA 3KNBB 1DJSA 5CP7B 4ZQKB 1RY7B 1VERA 4E5XA 4Y89A 1DN0A 1IGCH 5HDBE 4NPYB 1YECL 3RL2B 2Q7NA 5H94A 3TWCL 3MLSL 4ZUTA 4N5UA 4MA1B 3NOIA 3L3GB 1PDKA 3M45A 4FFZH 4AEHH 3BHBB 4M02A 1NANH 3E3QC 4P9HH 4L4VA 3T2OA 2ZJSL 5IESL 5CWSB 4OLWH 4PV9A 4FQ2H 2VYRE 3S96B 3UYRH 1X5KA 3ULVE 3QJHB 4HQQH 3RGVD 1MQKL 1V5JA 3AM8A 1HSBB 5EWIL 4RBPK 1GIGH 1MRCH 2YK1L 3DI2B 2JJSA 4I3RL 4OD1L 1WAAE 4KK6C 2GT9B 4KXZI 5E9DD 3WJJC 5H8DA 4LGPB 3TYFA 4OV6F 3F7PC 3QCUL 4XXDA 1QBLL 2VZVA 1AC6A 3F7QA 2X4PA 3I9GH 5IQ9B 1MPAH 4P59H 1XF5B 1RZ7L 2PYEA 1VENA 1QQDB 3VXTB 4NO2B 1ZLUK 5ICYA 2I9TB 1JK8A 3MRIB 4MVBD 5C0BA 3LKRB 2DTSA 4NJAL 4XT1C 1AD9B 4Y4KD 4EXPX 5DUMH 2XPGB 5IVXB 4IDJH 5IVZB 5B38G 4DJMA 5I2IA 4DQOH 5I1CH 5KVDL 3WXVL 2W0LA 3EFFA 3AM8C 3B3IA 3JWDH 3ARDB 1ND0B 1NEZB 3QHZH 2J3SA 3QUXD 3T3ME 4QTHA 4KMTL 5DMKB 1ZGLM 5E2VH 4P5TB 1U8PB 2EE9A 4W6WB 4BK5A 1U41A 4L9DA 5A16A 5F7DB 1LMKA 4ZTOH 2IH3B 3TIDB 2CLRA 4OZFG 4O2CA 3UTTD 4K3JL 5HVHC 1QTYT 1HH9B 2Z91B 4KAQL 4ONHA 1D9KA 3AREC 2A38A 3S98A 1S7VB 5SV4A 2OI9B 5D1QA 3K74B 3KYOB 4D0DB 4HZAA 2WWMD 4Y19B 1T66D 3VWJA 3QZWG 3RJDA 3BN3B 1BIIA 4JFYB 2EDTA 4PYHA 1XGRA 5I30L 4QHKJ 4U6HB 1KCSH 1JF5A 3P3YA 5E6ID 1IZKA 3GSNB 5CJOH 4CGTA 2BSSA 1S9WB 2QQLH 4QHKI 4MQTB 4R8WH 4ZPTA 1FNAA 5EU6A 3TIEA 2VXSH 1KULA 1TXKA 4W4OC 3OR6B 3MLYH 1FO0H 3TYGH 1EZVX 3REVB 1D5ZB 2AK1H 3RNKB 3L3KA 5TGBB 4JKMA 4XPGL 1D9KC 3MXVL 5SX4H 2NCMA 1DE4A 4LCIL 3NFPB 4WU7A 5GGTL 5GS3A 5JLZA 2ITDB 3P0YH 4Z7WB 3PL6A 1OTTD 4NQDD 2F54B 4O2EB 4LNVA 5D1QC 3O3BA 3QA3A 2NY6C 1MIEL 1DEEB 4RNRB 5C0AB 3L3IA 3BRDA 5FUCC 3VRLE 2Q6WB 4OCRL 2FSEB 1CZ8H 5J6GB 3VWJC 4ALAL 1X5IA 3RUGA 4GG6E 1EEYB 1AP2B 2QJDA 4WEMB 1VA9A 4PBXA 4IMLB 5B3NA 5I1LA 3AU1B 4CN4A 5FF6A 1CGVA 2NY3D 4EI5A 1M1SA 3CMOL 4V1DA 5FYLD 5IBTH 3SO3B 4WCYH 4DGVL 3L6FB 3IVKB 4C83A 3AXLB 1V7MH 5DSCA 2LU4A 3BYTA 2AV1A 4GMSH 5C0EB 2WUCH 3HLAA 2VUYA 4EQ2A 3FN0H 4H26B 4YHIA 1DBMH 4Z7VA 3K0WA 3K1DA 4K23L 4TNWK 1X5FA 2VLRB 4Y0GA 3QR2A 4AL8L 4F9LC 3OWEA 3V8OA 2BVPB 2GHWB 5TDPA 3UZVB 4HS8L 2JCCE 4A6YL 3G5VB 2XI9A 2Y06L 4HUMB 5ITBH 5LQBH 2OTPA 4JLRA 5D7KD 3BZEB 3OGOE 1WBZB 3FAWA 4KV5F 3D6GA 5IHUL 3ARPA 3CZFA 5E7BA 2IQAB 1NMBH 4MJ5B 3FQRA 2XQYK 1RUQH 4Q97A 4EI5C 4HUVB 1U8QA 1JRHH 5KSVA 1HHKB 4EI6B 5I16A 5DK2B 1MCOL 4TSAL 1UH2A 3F7RA 1E4WL 3MLVL 5CEZE 2EE3A 4GBXB 2X6MA 1T0NA 2EDXA 3OJ2C 2OX5A 1GGCL 5F71A 4KI1A 3REWA 4WW2F 3CNKA 2E8YA 1FNGA 4OGXH 2X4RB 4LPWA 2EECA 4TSCL 4ZD3L 4PJCE 4AENB 1MCFA 1OCWH 1IAII 1RZ8B 3DHMA 4JPWH 3MBXL 2VXUH 1PKOA 4KVNL 4UV7H 4IS6A 3MFGB 4KJWD 4WJ5A 1JI2A 4NJ9L 4LSTH 3MQIA 4CU6A 3GI8L 3QG6A 3S3PA 3PP4H 1C1EH 1KOAA 3D18A 5FIEA 5D71H 2IPUG 3P4MA 4N1HB 5FYJU 3WFDL 3HI5L 4ODTH 1LK3L 4XMPL 3JV4A 2X9WA 4NHUA 4K94L 4CVUA 5IBUB 5J06A 2RGSA 3NA9L 3TJEH 4MA7L 4OSUH 2ZKHH 2DKUA 1WAAA 5EC1A 1F6AA 5CZVL 3ZT6A 2AAVA 2EYSB 1XCQA 5EBWB 1PYWB 2EH7H 5HYEA 2OM5A 3UTSD 3LZFH 3ILPA 5HYIA 1FVDA 1P7HL 4XCCL 1DLFL 2V2TB 5GRJL 1DQJB 3P0VL 4XMKH 2Y6SC 1XF3A 1MCPH 3T4AB 3PE9A 3CK0L 3LDBB 2PCPB 5AG9A 4WNQA 1CFVH 1NFIA 2AJ3B 1BGXL 2ZUXA 1LK2B 3CVHB 4LHQB 4N0RA 4L29A 1DFBH 3KWWB 1G0XA 4RGOL 3D0LB 1J7VR 2ICCA 1YEFH 1MRDH 4G6KL 1EZVY 5D7JD 2YEZB 4LKCA 1MQ8A 4Z95H 2XWBB 3HFML 3ZKQD 4EN3D 4WU5B 2OSLA 4KK8C 4ODWB 2NX5B 1WLHA 4GRMB 1F3DH 3ZKMC 2QSQA 3A0OA 4UILL 1L4IA 1UVQB 3S5LG 5JR1L 5C2BH 4CVXB 5I1GL 1LP9E 1E6OH 3C8KA 4FTVD 4PJ8D 5IG7B 4OZHB 3C5SB 3V4VL 1X3DA 4OD2B 1G9NL 4R26H 5I1HH 1QR1B 5IR1A 5KSAB 4ZSOE 2B4CH 3VGHA 1H3VA 1VGEH 3VW3H 3OAZH 2OL3B 3MRCA 4JPVH 2ZNWA 1VACB 2J8OA 4M48H 5FYJH 4L3ED 1PQZA 3DX6B 4R6UA 5IROA 1S9XB 1IE5A 7CGTA 3VD9A 2V2XB 3OKMA 3OG4B 2RFXB 5DEFB 4GAYB 3RDTB 1KN4L 5CINH 4MD0A 4QF1B 1EGJL 3C6LD 5FUOL 3ZTNH 1VPOH 2QQKH 4N1EA 4ZUUA 1MHCA 3IXTB 1KEML 3OL2A 4B7LA 2FD6L 4WRLA 4M3JA 1EFXA 1A7BA 1QNZH 3MFFB 3PWJA 4QRPD 2IQ9L 2EDYA 1IQDB 1QP1A 1YY9D 4TVSa 1HHJA 4JM4L 1A1OA 2MPAL 3KHOA 2Z31B 3MLWH 5EOQH 5FOBB 4GG6A 1FZKA 3FONB 2XT1B 4AEFA 4KJQC 4MWFB 5DRZB 4RAUA 3TZVD 4NQVA 4U1NA 1BFVH 1FCGA 1MI5E 3VXNA 5LGJA 1UWEL 2V7NB 3F12B 4H1LA 4XPHL 1I3UA 4NO5B 1JVKA 5IROC 5IW6A 4G6FB 4D0BA 5FDWA 2D7PA 1X5LA 1JPSH 3GSNL 43CAA 5F9OL 3FQTB 1G7MA 1P9MA 3V0VA 4P2RE 2D7MA 1NBZA 1R24B 5DVMA 4LPXA 3TA3A 4ZAKB 2JCCA 4U1KB 1OWRM 2JJUA 4JFFD 5EN2A 1RZKL 4JFPB 2AEQL 3KLAB 3EOYG 4IRZL 1FZMB 1CDGA 3RJQB 4LIQH 5ESQB 2CUMA 4ZS6D 4N0FA 4GQ9L 4HUUB 5E2TL 2O5ZL 4DVRL 3LRSA 3EIFA 4OCYH 2HVJB 1PBYA 2VXQH 5E8OA