4XX1E

Low resolution structure of lcat in complex with fab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
219
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab1 light chain
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 43
structure length 219
sequence length 227
chains with identical sequence H, M
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E01
5B8CA 4LCWD 1M6OB 5KOVC 3MJ7B 4JPVH 1ZEAH 5E8PA 2D9CA 5EU6B 4U6XA 2QHRL 3F7YB 4RGNB 4ETYA 1FC1A 1N4XL 3QO0A 1MFEH 2X6MA 1U9KA 3QDGA 1KGCD 5BVPL 4HHAA 1BQLH 1JF1B 3KDMB 4PR5A 3MUJA 3DTXB 3DVGA 2EC9T 2I9LA 1P84J 4MXVF 2A38A 3ORJA 5EOTA 4OLUH 1CZ8L 4OBSA 4DFHA 1ZHNA 5D1QD 4OD3H 3MLWH 4P5TC 3SGJC 3SY0A 2BNRB 2BVOB 2X09A 1EJOH 5IEHB 1QBLL 5F6IC 5C0CE 4B5EA 1OSZA 4HFUL 5IV2B 4N5UA 2NY2C 4MA7H 4KJWC 4OZHB 3K7UA 4OCLC 2JIXA 1IGYB 1SJXA 5DT1H 3PHOB 3QFJA 5EZIL 3AXLA 3DVNA 3HCVB 4UB0L 3NIFF 4B7IA 3S88H 4PREB 5EBWB 2Y06L 2MCPH 4PG2A 4JHZA 1FPTL 1IZJA 4JFYA 4NZRH 5BMFH 4IS6B 2CLZB 2V2WA 1FP5A 3KJ4B 4S1RL 5IJVA 3SGKC 1IAKB 2JJTC 1WIUA 5F88B 4Y4FC 1GAFL 4PJDA 4U1GB 4Y4KA 3QDJB 1I7UA 5H94B 3MLRH 1F3DH 3C5JB 4I18B 2ZCLL 2WK2A 2H3NA 4OZFB 3ZTNH 5EB9A 2WUCL 4N68A 3ILPB 5IW6A 2A0LC 1NC2A 4L5FH 4GG6F 3HC4L 2QSCL 3EFDH 1S9YB 3BO8A 4YFDB 1OSPL 1Y6KR 4XNMA 3HPJA 5DVOA 3MUGA 1ZS8B 4PJXA 1RU9L 3TJEL 3L3IA 4GS7C 3R06B 4ZUWB 5I0ZA 2BERA 4KI5F 3U7WL 1ACZA 2BMKA 1R3HB 3KYMB 4HKJB 4X98B 3O4LE 4JQXC 5D2NB 3D9AH 2VXTL 3DV4A 5IESL 4YXHH 1GGBL 5D2LF 3O3EA 1MIEL 1N0XH 3RL1B 1II4E 3RU8L 2V7HA 3B3IB 2H9GB 4FQXC 3H7BA 4JY5L 3MROB 4K71B 3AREC 5F9WB 1IGML 2N56A 3HB3C 4H8WH 2NXZB 3Q0HA 3RWDA 5M95B 2AEPH 5FYLE 4OD1L 4F8QA 2CIIB 3JV6B 4K7PX 5L6YH 3BZEA 4P5TD 4DGYH 5DDHA 5E5MA 4KAQH 3GSUA 2ED8A 3O2DA 3LKOA 4HQQH 3BRFA 1WFUA 3VE0B 1CGYA 4PB9L 2NY2D 4X80L 4OM1L 4KJWD 3VXPB 3MPCA 1F8TH 3RIAK 3JXAA 5F1IA 2I9TB 3NCEB 3LQAC 4P46C 4KHTH 4UV7L 1EEYA 3D18A 4LEOA 4K3JH 2MWCA 3QUMA 3FO9A 1SY6L 5FCSH 5HHOE 4JKMA 4ZD3H 1K3ZA 5ACLA 1KCVH 4MGXA 1HSBA 5EBMA 1Z9SA 4PJGF 2VE6B 1TZGL 4V1DA 2B39A 4PRIB 1CVSC 4KVNH 4XHQA 5HGAA 4S1QL 3B9KC 1TQCC 2L0DA 3SKJH 1AQDA 1LDPL 1TZIA 3WDJA 1CLCA 3EJJX 1KELL 2PTTB 2AVGA 1NSNH 3WS6A 2NY0B 5K9JH 3LKPA 3MRFA 4HLJA 3TF7C 5GGUA 1E4WL 2FX9L 1KN2H 2VXQH 2YD1A 3HZMA 4HPYL 5I8EA 1EGJL 2A0LD 1AY1L 3MV01 1U8PB 3BT2H 2G9HA 3AMKA 1ZVSB 2HN7B 2YOCA 2ZUQB 2V5SA 4HMDA 4WEUD 2MTPA 4K9EL 5FECA 5T1LA 4UOJA 1V3KA 1H8NA 3OKOB 4OKVB 1CR9L 2XWBA 2C1OB 5C0EB 5IG7A 4PY8I 3T65A 2XKNA 5J89A 4AEIL 1UB5B 1WCQA 3VFTB 3IDGB 1F00I 4ZFFA 4IOIB 3EDJA 2R56H 3FB6B 3GUTB 5BV7L 1D5XA 1MRFH 2C7UA 5GGQL 4BFBD 2HJFB 1QBMH 3MRPB 2ICWI 4JFHE 4FQXD 3HN3A 3ARED 3HB3D 2XN9B 1KOAA 4L8CB 3V6BR 3QZWG 5DA0B 5T1DH 1N59A 5DJCB 3PV6B 2J6EA 5CJ8A 2FCBA 2VLLB 1X6NA 2AJXL 2V5RA 1QLFB 4MNHB 5L7XH 2RCSH 3WEXB 2NY4C 3OAUH 4ZUTA 2W0FA 2GK2A 1VKXA 3NAAL 4F15C 4ZMAT 2PUQT 1I7RA 3C2SA 4U1MB 4OLYL 1FQ9C 1SYVA 1ZA3A 3GMNB 1ZLVH 3ZHLA 3I50H 4JG0H 4NN6B 2DYPB 2OR8A 1RK1A 4U6TA 4U3HA 4J1UA 3IAQA 4P46D 3O4LA 1ZLSH 1U3ZA 3VMPA 4P0DA 4QRUA 1U8JB 1MCKA 4LCWE 1A4KB 4JFEB 3MV9A 5BO1H 3C9NA 3B83A 3EO1B 3L3OA 4G8EB 3UPRA 2ADGB 2ICWJ 3B6SA 4LEXH 2V2XB 1CD1B 1XGUA 1Q9OA 4CUCA 5CMAA 4NHUA 5E6YA 5LG1A 1CE1L 5E99L 1KGCE 3B9KD 3QYCA 2Z92B 3BISA 5AD0A 3NN8A 2QQNL 5F89B 3NTCL 3BP4A 2D7MA 3RJDA 5ETUB 4BKLB 1IEAA 3LCYA 3P73A 3IJSB 5IHUH 1RURL 1JPFB 2NY7L 2AABL 5GZOD 4BQ6A 3VWJB 2WIMA 3P9MA 4LQ1A 2CLRA 1YN6B 5IF0B 3V5HB 2VDQL 1G7IB 1VFAA 3C2AL 3HMXA 5D7LD 5BRZA 2X44D 1A7NH 4DZ8A 4MNGB 4IMKA 3QUXB 4UDTA 5I1IL 1T7WA 4AIZB 1OGTA 4X4XA 1EV2E 2M2DA 4FG6C 5EU3A 1CFTA 1DVFC 3DECA 4W6XB 4Z0XA 1W0VA 3P9LB 3RBGA 4F7PB 4QHUB 2IGFL 4GRWE 3EHBC 5I30H 2E3VA 4LLWA 3O2DH 3V4UL 4QKXB 2C3XA 5I19L 1SVZA 4QOKA 3IXTA 2VXVH 4RFNC 3BPNC 2QKIA 1AC0A 3PDOA 1KTLA 3O6LL 5I15L 1OOAA 1FNSL 3KYOA 3V0VB 1CG9A 3JZ7A 1NDMA 4DN4L 2NY4D 2CGRL 1LMKA 2B5IB 3BW9B 1UXSA 4YE4L 1N7MH 3QEHB 4CADA 3QA3A 1UACH 3OG6B 4ZOEA 1BF2A 3EYUL 1A1NB 3RIFF 5HHMB 1FHGA 5DD0L 1TPXB 2HLAA 1PW3A 1JZ4A 1AHWB 3CX5J 4M8QB 4EVNA 1YEJH 1ONQA 4KJPC 3GNMH 5FGSA 2M8XA 4XCFL 4UTAL 3ALPA 4KQ4L 2AW2A 5IGXH 4HUXA 1I3VA 4ODTH 1T22A 1L0YA 3KPQA 1NMBH 3L7FB 4D0BB 5I71B 3DURA 2MNUA 1M7XA 4FNLH 3UTSD 5D7KD 1CGWA 5E4EC 2FJGA 3TYGL 3T1FA 4ENEC 1I1RA 1JPTH 4ZTPH 4DCQA 3CFEA 5MEPA 1J0KA 3O3DB 2NY5H 2CDGA 5IVOA 5TQ2H 1UQSA 4OF5A 4YEFA 4X5WB 1FE8H 5FYJL 1T83C 4NQEA 4ISVB 4JO1H 1D9KA 3QI9B 4LNRA 3T8XB 5IW1A 5GRWA 1F90L 3B2UD 4LSUH 4RMRA 5E9DB 1G7MA 5HYJB 1FSKB 1J05A 3FN0H 4BELD 1Z5LA 4TSCH 4MA1C 5FA4A 3K2MC 3MRMA 3A6OA 2V5TA 3GIZH 1YN7A 4PD4K 2ZSVA 3F7QA 4XVTH 2J6EH 2E27H 4XB7A 1AGEB 5HDLA 1DVFD 1VADB 1R5VB 4GMTH 2KPNA 1MHEB 4YO0B 2D4FA 3QXDA 3HMWL 3PP4H 2W9LA 3O0RL 4HS8H 3IS1X 3DBXB 3N1QC 1MQKL 3L1OH 5IB4B 1V3MA 1W8OA 1U92A 2BRRH 2WNGA 5DJ6A 4FABL 3VFUA 1QYGL 1NAMA 1BLNB 1VACB 2E6QA 1J0HA 1YMMB 2J8UA 2XWJA 4H0GA 3MRCA 1TNMA 2F53D 3EOTL 2XZAL 4FFYH 1FLRH 3T0AA 5LXGL 5BZDB 2VL5B 5I1HL 5CD3A 3GHEH 3VI4E 4UTBL 4KKBC 3MOAL 3GMMB 1NMAL 4HBQA 4S2SA 4R0LA 3NCJL 3RPKA 1CF8L 5DK2B 3K1KC 4NP4H 5KSAC 1Z0MA 3P0VL 2LV4A 1KTDA 1A3LH 3QB7C 4NPYA 1LEIB 3MCG1 3HS0A 3VFOB 1I3RA 1KF9B 1FORH 2J8OA 3PHSA 4HX1B 4WIQA 4HIEB 2OMNA 1AQKL 1FYTB 4KJPD 5FYLH 1NDGA 1I1CA 2MPAH 1TVDA 5DHXB 1T04B 3MXWH 3F58H 2UWEE 1OD9A 4N9GB 3KPNB 4L4TA 1TJIH 3ZKMC 3HMXH 2F19H 2G60H 1JGEA 1U8LA 4Z7VE 3B8YA 4U7MA 4ENED 1YEDB 2BK8A 3ARWA 4LSQH 1FJ1A 3D69A 3NIDF 5I6XC 5EBGA 4YXLL 4TSAH 1S8DB 1TLKA 3MNZA 1EA9C 4X0KA 4KRPC 2LABA 3RJQB 5EBLA 2IAMB 4J6RL 1J0ZA 3WFBL 1R5IA 4HSQA 1MWAL 4PRHD 1XGQB 2ZCHL 3HZKA 1HNGA 4JDVA 3MCKB 2A6JA 5GS0H 2BVYA 2VITB 1I4FB 3CDFA 4QF1A 2DWEB 4M1GH 1JNLH 3SE9L 1J1XH 2ZCKL 4FQHA 3DXAB 4HUMB 1Q72H 2X4PB 2O5YH 3FOLA 4TN9A 4YHPA 3AM8C 4NZTH 1A21A 2EYTB 2A83B 4HJJH 5DSCA 5CILL 3JVGC 2FO4B 5ENWA 5GJSL 3VD7A 5IVXE 1RHHB 1IAIH 1U93A 3IDIB 4ZO8A 3K74B 4IRZH 3RWFB 4G6FD 4L9LA 4ESKA 2A74A 4GRMB 1AD0A 4U6VH 1GGYA 4WFED 5DO2C 4F9PC 4HUVA 3SQOL 2DL9A 3UP1A 3TNMA 1RZKH 1J87A 5JPMA 3O9WC 1IT9L 3CC5B 1RUML 4P9HL 3BZFB 5D7LE 5KSAD 4HDIB 4MNQA 4QY8B 5FKPA 2LE9A 4NO5B 3VRIA 4KVCH 4HS3B 4JEGB 4WFFD 4X9HA 4ZYKB 4PG2C 2HVJA 5B3NA 5FO8B 1GIGL 1LP9B 4R9HA 3PGDB 3JWOL 1S7QA 4P2QB 1O5DT 2X42A 1WSST 4KUCD 3KPOB 3O11B 2YN5A 1EHXA 3OXRA 5E6IB 3ZKMD 3RRQA 3N1MC 4WWKB 5C07A 3CCHB 3T09A 4OKDA 5E00B 1CDCA 1T1XA 5IFHL 3P9WB 4M48L 4J3XA 2VWEC 4Q97A 1GC1H 4XC3L 5GRJH 1N5AB 5KVDL 5I1EL 1QFWH 5DJZA 4JFXB 2H26B 3UDWC 1I7TA 3KPLA 4WHDA 4LLAA 4Y16B 1CXIA 1AXTH 2LVEA 5HHQA 4PJ8B 4U3CA 5A40E 4OSUH 3QJHA 4XNYL 5MHSD 4X7TA 4UIKH 3U6RA 4JFDD 1S5HA 3ZDZF 2AJUH 3IXAA 3RZCB 3VFVA 5IR1B 1NAMH 3VFNA 4OLZH 3HC3H 2P7TB 1KN4L 4X6DA 5I2IB 3OF6D 1P1ZA 4N9OB 3EYFA 3IFOA 5EOCH 5IQ9A 4P9ML 1MI5D 2IALB 5T5FL 3KPPB 3MV7D 3QEUA 4UT9L 4LLUB 2UWEA 1M6OA 4MHHG 3MJ7A 5JHDB 5CHNA 4OLXH 2FRGP 4KZEH 3UTSE 4OJFH 3LKQA 2BNUA 1NGXB 3NZHH 1VENA 3MFGB 2AEIT 3VW3H 3TO4B 2VXUL 4RFEB 1QSFD 2B7DT 4E0RB 3CFCL 4YFLI 4QHLA 3QR2A 1JF1A 3KDMA 1ES0A 2XQBH 3CSBA 3DTXA 3EJYC 1DN2A 4MA8H 5ACZB 1RZ7L 4OFDA 1KLUB 3BUTA 3O9WD 4XX1G 4RRPG 5T1KB 1XH3A 1DLFL 2BNRA 2BVOA 4KK5C 3SE8H 3EO9L 1QRND 4KUZH 2WINB 5IEHA 5D1XB 4HK3N 3G5YA 3U1SH 3TFKC 3AGVA 1XR9B 3O6FB 5D8JL 1NKRA 4UUJB 4OZHA 1PKQB 2EDHA 4Y19A 1DN0B 4DVRL 1IGYA 1U3JA 3U46B 2QADC 3UZVB 4JLRB 1S3KL 2VTFA 2WW8A 1TQBC 1T1YB 1AKJD 5C8JB 5FB8A 2VDRH 1FGNH 5D5ME 4PREA 3UX9B 3WUZA 1P9MC 1PG7H 1ZANL 2JCCF 3EOBB 5EIIB 4H0HB 2OLDA 2CLZA 5IVXA 1WJ3A 2FECI 1HWHB 4AL8H 3QEQB 1IAKA 3RAJH 5GSVB 5F88A 5GGSB 1INEH 2YPVH 2F53E 3QDJA 4H0IA 5HYSG 3C5JA 4I18A 4X6CE 1N6VA 5DMGC 1I8MB 4XVJH 2ESVB 3ILPA 4PRPD 1UA6L 4K3GA 2W0KA 1CCZA 4PGCB 3VI3E 4HKXA 1UENA 2BVQB 2VLRB 1S9YA 2W60B 4GAYB 4PJBF 1F97A 1ZS8A 3QXAA 4WTXA 4KDWA 4XWGH 4ZUWA 5CKAA 3G04B 3QDHA 4I2XB 1R3HA 4HKJA 4X98A 5DRWB 1CK0L 1I7ZA 2VKXA 1BM3L 4U49A 2D7PA 1I1AB 2DI8A 3LQZB 3N85L 2YD5A 5F9OH 2C3HA 3ARVA 4DTGL 4KMTH 3UZEA 3OHXB 8FABB 3B3IA 2H9GA 3MROA 1FBIH 3MGAA 2FEEI 1MCFA 5EOQH 1MFDL 1D5BA 1IC5L 2HH0H 1SYSB 4Y2DA 4LF3B 3ARQA 1G6RL 2CIIA 2B1HL 4LCCC 4OCYH 3JV6A 4Y2OA 2YHGA 1OTSC 4KK5D 4PRHE 3Q1SH 5T5NF 1BJ8A 1VGKA 2XICA 1JF5A 3VE0A 2DTMH 4HIXH 3SPVA 1OAKL 5EO1B 1P2CB 5SWQB 2C4FU 2EE2A 3KLHD 1GH7A 12E8H 1BZ7A 2QADD 3LIZL 2I9TA 5J12C 1WEJH 3MBEB 2WBKA 3E1F1 2RGSA 4XP4L 2WBJB 4EZMA 2WLZA 5I1JH 4QYOB 3MODL 1MCBA 4XCNB 4ZSOE 1X5GA 3QWOB 4P49A 2GY5A 5IMOA 3ULVC 1Q94B 1JI2A 1CLZL 5KVGH 1LP9F 2VE6A 4TPRL 3ES6B 4FQ1L 2R23A 3QSKB 5A2KH 4XMPH 5HI3D 4WFEE 5CEXA 1B9ZA 3DARA 4W70A 4Z77A 4M1CC 5GRVK 4RIRA 4M6NL 5I9QB 5I8KH 5AZ2L 5DMGD 4WO4A 3VA6A 2X4NB 4EXKA 1M05A 4FQ2L 4HIHB 4PG9B 2HRPL 4GBXC 4PJCB 4XTRC 1U8PA 4JZJB 1ADQA 3SO3B 1ZVSA 4LSVH 4JR9L 4OFYA 3KLDA 3TT1L 1XR8B 4G8GD 3BWUC 1K3IA 4WFFE 3QXWA 3OKOA 2MQ0A 3H7LA 4OKVA 1MCLA 4HUUB 1CFNB 2D0FA 1UB5A 5D5MA 3VFTA 3IDGA 4IOIA 3LN9A 3GUTA 4ZAKA 2HJFA 3MRPA 1D5ZB 5DVNA 3DSNA 1JZ8A 1P7QB 1R3IH 2GK0B 3E8UL 2R0KH 3P4OA 1G7HB 1HCVA 3T0EC 2VDOH 1U91A 4L8CA 1FV1A 4PJEF 5CJQH 4MQ7A 5DJCA 5ID0B 3PV6A 2VLKD 1E27A 5C0DA 4JY4A 1V3LA 4MNHA 1CGSH 1Z9LA 3FT3B 2W9EH 4L8SC 3TVMC 1UVQB 5MHSE 1HYSC 4OCXH 1OTSD 3DVIA 4JFDE 1F58L 4PLNC 4RAUA 4U1MA 1GGIL 3QQ3B 1OAXL 3E3QC 3GMNA 3S3PA 5F97E 5ESAB 2DYPA 2XZQL 1MI5E 1XF5B 4OZGA 3MV7E 4BZYA 1J12A 1U8JA 1Q9LA 1MPAH 1ZAGA 5CINL 1A4KA 5JIKA 1YUHB 4G43A 2AEQL 2ICWB 4JFEA 2E7HA 43CAB 4OI8A 4LPYA 3EO1A 4G8EA 2Q86B 3ULVD 1BFTA 2ADGA 2UVEA 5TDOB 1TIUA 3UJJL 5DRXB 2C4FT 1V7ML 2P5WB 5A1AA 1CD1A 8CGTA 2N7BA 5ALCH 4JY6B 1OAQL 4G6MH 3I6LD 3ULUL 5DJYA 5F89A 3N9GL 2E9WA 4PJ7F 5ETUA 1NCDL 3QCTH 2Z35B 3QUYB 1YQ2A 3CMOL 3IJSA 1I8IB 4NQDD 2Q8BH 1ODAA 2RR3A 1V3JA 4GBXD 4HC1L 3SCMB 2BSRB 3VWJA 4DOHE 1INDL 1YN6A 3QCUL 5J06A 4PV9B 4XTRD 1Q1JL 3SE3A 15C8H 2J2ZA 2EE6A 3PWJB 4HWBL 2Z91A 4LU5L 5HBBA 3QIBB 1YNLH 3TV3L 1G7IA 2DQDH 4GAGH 5TE4H 5IBTH 2R0LH 4Q2ZB 4JDTL 1C5BL 1NGQL 4MNGA 1H3XA 2AJYH 3QUXA 2ADFL 3SGDI 4MQSB 4QRPB 3G08B 1BF8A 1YEGH 4NSKA 2X4QB 3U0WL 1IGTB 3P9LA 4QHUA 4RRPA 3MJ8B 5D93B 1C08B 1DQQB 1L0XA 1IKFL 5KAQF 4HGMA 5DD6A 3BPLC 4JHWL 4XAWH 3T0ED 1WUNT 2VWEE 5CP3H 5E2WL 3BHBB 2GIYA 3GJEB 5CSZB 2FZ3B 1BIIB 1B0GA 3V0VA 2CDEB 3FRPG 3GBNL 1MLCA 1HYSD 4PRPE 3ZMRA 3BW9A 1J5OL 1A0QL 1LQSR 3CVHL 3QEHA 4NJAH 3D3VD 4KROB 4P3CL 4BK5A 2F5BL 1B90A 4JDZB 1KB9K 3DGCR 4WI8A 5K33A 3EYSL 1A1NA 3NCMA 4LASL 3CXDL 2OJZL 1HHHB 4G7VH 1AHWA 3ARFD 5HPMB 4M8QA 5J1AB 2XG4A 4J3TA 5T1MA 3RGVA 1W72B 5HYSA 4LLQB 5FOBB 3BKMH 2R4SH 1FH5H 5I1KL 2NZIA 1U8IA 2PO6D 1UM6H 4LCUB 4OF7A 1U58B 1WFOA 1N0LA 1R24B 3QNYA 2DB8A 2A77L 1ADQH 2F9BT 3HI6H 1GGCH 4D0BA 2VDNL 1S9WB 5DR5H 3CJJA 1B2WL 4EIGB 4E5XB 3DSFH 3MRJB 4Z7UB 3VGHA 4G9FB 4FP8H 1I9JH 5HY9A 3R0NA 1E4KA 1I8LA 3MFFB 3O3DA 2NY3C 3V5DA 1ORSA 3I3EA 4NO0D 3ARBB 1HH6B 4X5WA 1LEKA 4F7CB 3RVWC 3PWVA 1QO3A 4ISVA 2A9NH 3QI9A 3MRDB 5JOFB 2AKRB 1U8OB 2NTFB 2NX5B 1QG3A 2CK0L 2SEBB 4JM2B 5E1HB 3OSKA 3UJIH 2QSVA 4KZDH 2VZ3A 1QFUH 1PG7X 1AGEA 5DFWH 4TTGA 3RWCB 3X3GL 1VADA 5HHNB 3QPQC 2GJJA 1MHEA 3GMQB 2AXFB 4MX7B 4Y5XC 3FFDB 4O00A 4DAGL 3JSSA 2D03L 5D9SB 5GGRB 2EYSB 4JKWA 4KXZH 5IB4A 4MS8D 4YDIL 1IC7L 3BN9C 5SWZB 3K4ZA 3LVEA 5CGMA 3MLZL 1YMMA 5C7XH 3QISA 1Y6MR 1RIHH 5FGCE 1JF6A 3RPIB 3RUGB 1DBML 1MVFA 5BZDA 5EZOL 3X3FH 1SJHB 5JXAH 4RISH 3RWIB 3PV7A 4ODVH 2GJZA 3GMMA 3UYOD 1FRGL 2YD9A 5T3XL 1TVBB 5KN5B 4BQ9A 4G8GE 3D39B 1UGNA 4NKOB 4JO3L 3OG4B 4GKZB 1LEIA 1QUNA 3QUZC 3ESVF 2BHZA 1MCJA 4HIEA 1FYTA 4PJAE 3WNOA 4XNUL 5TE6L 1PQZB 4YHIB 4DKAA 2CO6B 2XRAH 2DRUA 1AGDA 4OGYH 4RGOH 3TBYB 4DN3L 3VRJB 1A6TB 2ZUVA 5BS0B 3KPNA 1I3GL 4XHJD 3IDJB 2XTJC 2FH8A 1I1FB 2BC4B 2N4IA 2RIKA 3A6CH 1HQRA 5C2UB 3C5ZB 2VLKE 5KJRL 2HT2C 2X41A 3FQUA 3EYVA 2NY3D 3BMVA 4KI5D 5D7SL 1WC7A 4WJ5A 3TCXA 4BJLA 4PS4L 1DBBH 3U2SB 1NKOA 3RVWD 5D7JB 3MUZ1 3B43A 3SQBA 4A6YL 5D96C 1FDLL 3GKWL 1INQB 1MFBL 4LBEB 2DWEA 4NNYB 4FZEH 5GQBA 3DXAA 4WEMB 3GSWB 4S10A 2X4PA 4OTXL 3QPQD 1ZSDA 3GRWL 1X5HA 3MLSL 4PUBL 5DZNA 5I1DB 4YQXL 2NNAB 4CL7A 2P43B 2UZIH 3ULVE 2O5ZH 3VXSD 2EYTA 2A83A 1NL0H 2FO4A 4KGLA 4MQXC 2R8SL 1RHHA 2A1WH 1CU4L 3IDIA 3BN9D 4WDIB 2VZSA 3RWGA 3HUJE 5I17A 3I6LE 2GKIA 4OLWL 5ADOL 4GRMA 3MX0A 5AWNL 3VXNB 1RZJL 3ZE0F 2JJSA 3ME0A 1LO0H 2EIZB 4NQDE 2FJHA 4YLQT 3SBWA 5KVMC 3RNQA 3VXUD 5BOZG 4M5YL 4K3EH 4OFVA 2ZNWA 2XQYG 4TUJA 3VCLB 3S37H 5D6CB 3DX6A 1PY4A 3BZFA 1P4BL 1MJ8L 1MRCH 3N0PB 1MF2H 1WVZA 2I24N 3HNSL 3CPLA 4HDIA 4JPIA 4HV8A 4NO5A 3QUZD 1XIWC 4XP6H 4JGJA 5JW3H 1FL6B 1YEEL 3P30H 4HF5L 4NQCD 4ZYKA 2DKUA 2Y07L 5FO8A 1WZ1H 4HW6A 1KCRL 4H5SB 4WI4A 3OXSA 4P2QA 4C83A 3KJ4C 4YHZH 1HHGA 1LO3L 3RY6C 1G0XA 3L5XH 1CE6B 4GAJL 1CFVH 3KPOA 1YEFH 5FCUH 4U1GC 2XTJD 4QNPE 1OWRM 5IUSA 3T0EE 4WWKA 2ED7A 3CCHA 4I0KA 1P7HL 5E00A 3ZZ1A 5DRZB 4Q9QH 3RTQD 4EXPX 2HT2D 4AEHL 3FO2B 4IBLT 4Z0BL 4JFXA 5ILTL 3WIHA 2VH5L 2H26A 3OKKB 4FMKA 5ERWB 1AP2B 4NKIH 4Y16A 5C71A 3D3VE 3JWDC 5GGVL 1KCUL 1TVHB 3H3PL 3E3QE 1M7DB 1A7PH 4MWFA 3RZCA 3WKML 1GPOH 1HZHH 5D2NC 2P7TA 1ZVYA 4W4OA 4KQ3H 5I2IA 4O51A 3FQRB 3ETBF 4ONHA 5A3ID 4W6WB 3KPPA 1EERB 3FRPA 5EU6D 1PDKA 4LLUA 5FV1L 1ZHKB 4K71C 1DQDL 4M6OH 2I26N 5JHDA 3MRIB 1CD9B 4MQXD 4NIKB 1RZFL 4M5ZL 3SDDC 1NGXA 4HT1L 4XWOC 2IADB 3OR7B 4RFEA 4E0RA 4WV1C 3DROA 4BYHA 3RIAF 1LO5B 4ZS7L 1TCRA 3NFNB 3DMMB 1YPZF 2DBJA 3VGFA 1AO7D 5JXEA 5ACZA 3BZ4B 4WU5B 1A1MA 5GRUH 1NCAH 4WTZG 2DLFH 2HMIC 2J12B 2DQEH 1NJ9A 2WINA 1MAMH 1T7VA 5D1XA 1GSMA 4AJ0A 4R2GB 1XIWD 1VHPA 4UUJA 1NC4A 1PKQA 4K7PL 4U1SB 5I73B 3Q6GL 4MXWH 5IB5B 1AGCA 5DC9B 1T1YA 1AR1C 1KEGL 4JVPA 1MNUH 4MXVE 4QXUH 3BP6B 1A6AB 3LS5L 2BSSA 3MA9H 2W0LA 5EIIA 1HILA 4I77H 1YYML 3V52H 5CEZD 1QBBA 4UDUA 1DQML 4I3SL 2IBBA 3KJ6H 3U7AA 5HPOA 3EO0A 1QNZL 4WW2A 3RI5F 1KNOA 5GGSA 4H1LG 5IROA 3IU4L 3FOMB 2C3WA 2X4UB 4JQIL 3SEPA 3L7EB 5F9DC 2P49B 3NIFE 5J57B 1NFIA 5D72L 2D3VA 3CFKA 1I8MA 4JJHA 1UCBL 1WBXB 2X4RB 2ESVA 2H8PB 1QFOA 3TN0D 4PGCA 4KC3B 3U82B 3K80A 5FYJU 1L7IH 1KB5L 2CJUH 2WANA 4K94H 2FJFB 1UKQA 5IP4A 1OAYH 4YBQC 4MLIA 2JK5B 4U7KA 4M6ML 4JRYA 5KSUB 1H3PL 4FQJL 3THMH 4E9LA 4LGPB 1EO8L 1YEKH 2EDJA 2OBGA 4BQBA 5GISH 5E08H 3QQNA 3QNXB 1I1AA 2JF1A 3H9ZA 5EUOB 4KPHH 1GYAA 3I2CL 1AJ7L 3OPZH 3LQZA 4GG6E 4PFEA 1EEUA 2WWKT 5CS7A 1FZMB 4ODSL 1D5IH 3SDDD 3OHXA 4HG4K 8FABA 2APTA 4XWOD 1CFSB 5CBEB 4WFGE 3UPAA 3A6BH 1YECH 5BW7A 5KANI 4QT5B 4TTDC 2OYPA 1J0YA 1UG9A 4KI5E 1PSKL 1SYSA 4LF3A 1SEBB 4QHKI 2OX5A 4Y5YC 4I0PB 1IM9B 4P5KB 1JWUB 1AC6A 5INDB 5D2LE 4NN6C 5K9QI 5HGHB 3X13B 3WFDL 2IH3B 3QULB 4BFGA 5EO1A 4Z95H 1P2CA 4LGRB 1D6VH 1FGVL 1A9BA 4B7LA 3HPLB 3IFLH 2O26U 3ZT5A 1FNLA 3MBEA 4WVRA 2BNQB 1MJ7H 2F54B 3WIHH 4PPTA 1UWEH 4IOSD 3GK8H 5CUSL 3ULUF 2CLVB 4QYOA 3MV8B 3QWOA 2IBZY 3ARDC 3NA4A 4FQIL 4IMLB 4TRPH 2ATKA 3D87B 4NDMB 2VDKH 3QUKB 1FZKA 4QWWC 2R2BB 2OR9L 1T7YA 5I1GH 4XMKL 3C08H 3N1GC 4AEFA 1B6DA 4EBQL 1IGIL 2VIRA 3BE1L 3I84A 1KJ3H 1N64L 2P24A 2X4NA 5KBNC 4PG9A 4HIHA 1YEHH 1ZXQA 5BCAA 2YD7A 1RZIA 2IPUG 4PJCA 4RCAA 4DGIL 3BKJH 3O2WH 4JZJA 2DAVA 4OZIB 2C3GA 3I3DA 3QUXC 4PJGE 5DHVB 2KL6A 1CYGA 4D94A 1DQTA 3OZ9H 1S5IL 4YBQD 3F8UB 3PL6D 1KLFA 4NQCE 1FL5B 3QFDB 4HUUA 1YJDH 1CFNA 1NBQA 4HUKB 2WBWB 1BQSA 5EWIH 1L9MA 4F9LC 3FO0L 1NCNA 1D7FA 3BDXA 4TNVK 1BEYH 1KULA 3D2UD 5F8QC 1MCPH 1BBJB 1D5ZA 2XTJE 1NBVL 1P7QA 3GSOA 4WHYG 2GK0A 4UV4L 4V2BA 3GI9H 3PGFH 4N1HB 3NOIA 4EUPG 1G7HA 3QHFH 3WXWL 4XXDB 1U36A 1ZE3C 2HJLB 3WNLA 1A7OL 4HXBH 5E4IA 4TTDD 3LH2L 3BH8B 3GHBH 5J3HC 4ZXBC 2NW3A 3CX2A 4WUUB 4ZUVB 1HK6A 3FT3A 3U30B 1JHLL 1UVQA 3RWEB 1JGUH 5DEGA 3DX7B 5JDJA 3HC0B 3VG0L 2AK4B 5C92A 1FYHB 2DMKA 1X4XA 2IJ0C 3QQ3A 4LLDB 2H1PH 1FVCB 1RZGB 4M7JL 4OCRL 1PEWA 5ESAA 4OV5B 1GOHA 2FSEB 4B0MM 2PNDA 3IS0X 3TZVD 5EU6E 2QSQA 1VFMA 3QCVL 5IMKB 4Z78B 5IMLB 5I71C 4PGEB 4ODUA 3L5WB 2RHEA 4UILH 1I85C 1YUHA 2IPTH 2ICWA 3GFUA 2FBJL 43CAA 2CRIA 4I5BB 5E2UL 3ARDD 3SN6N 5TDOA 5DRXA 1N26A 1F4YH 1I8LC 4JPVL 3V0AC 4JVWA 1VCAA 2ED9A 1T3FB 2QQLL 4JG1L 5B4MC 5CLTA 1SQ2N 4ZUSA 4EI5B 5ID1B 1IJ9A 4LHUD 3S37X 2EEDA 1AO7E 4OIIH 5IMMB 2Z35A 4ACPA 3QUYA 2D7TH 1FSKC 4APQB 4MDJB 3SCMA 2Z93B 4PV9A 4G42B 4KY1H 1M71B 3FB7A 3IYLW 1BZ9B 3QIBA 3B5TA 4XP9H 4OD3L 4CVUA 1S9XB 2HLFD 1EJOL 5LCVH 4GRLC 2YRPA 2FB4L 3PXHA 4MDIB 4MA7L 2G75B 3G08A 1JTPA 2X4QA 4HCRA 1IGTA 5DT1L 4ZG1A 1WWAX 4WTZA 1NLDH 4G7YH 5CEZE 3S88L 1C08A 1FNGB 2AV1B 2YK1H 4XXCC 5KZCB 3O2VL 5C0RH 3ISWA 2KZ1B 2HKFH 4YHMH 1KCLA 4YBLB 3C6LD 1C16B 3DRTB 2P8LB 1OHQA 4WEBL 4NC0B 1EHAA 3IT8D 4OM0H 5J3HD 4ZXBD 3HE6C 3BHBA 1Q9KA 3LQMA 3GJEA 4JHAH 5CSZA 4U1LB 1BIIA 2HWZH 4NYLB 3MLUH 2CDEA 3HE7A 2YKLL 1PZUB 1UJ3C 4BFIB 3W0WB 2Q7YA 3L3GB 4Z7NF 4JDZA 2FX8L 3FO1B 5D2NE 3BP7B 3V8OA 3GSNL 4Q9RH 4OT1H 3EFDL 1BBDH 4K3DH 1HHHA 4H1LA 5HPMA 2VZVA 5J1AA 3SDXB 1WK0A 1W72A 3OKYA 4LLQA 4YHKH 5FOBA 2Q20A 5GRXG 1W0YT 4NZJA 4R4BB 1IC4H 1F4XH 1SMAA 4PJIB 2IMNA 3QIUA 1GVIA 4IIQB 1BP3B 3O3BB 1U58A 1R24A 2VYRE 4XRCB 1OGAB 1RUPL 3L3DB 4YXHL 1MSPA 2WP3O 1S7VB 4E5XA 4Z7UA 3MRJA 5FUCC 1N0XL 5B4MD 1CFBA 3TA3C 1P6AB 2GYSA 5BV7C 1OARH 4G9FA 3D48R 2IAMC 2JB6B 1MHHB 1FAIH 5EZLB 1NCBH 3MFFA 4H8WL 4ONOA 5E9DD 3EKCA 1D5MB 1MIMH 3GEWB 4OGXL 1HH6A 2ILLA 4F7CA 4UBDD 2AEPL 4NGHH 5J11B 5JOFA 2AKRA 1U8OA 1X5JA 3PWNB 4HULB 2NTFA 2NX5A 1JCKA 4DGYL 2SEBA 4KAQL 4B41A 1EHLH 4HQQL 3WFEH 4RDQG 4JFFB 1IAII 4F3FB 1R5WB 4GRLD 3D5OF 4PRAA 3SGEH 3QRGL 2VISB 5FDWA 1F8TL 5HHNA 3G5ZB 4N0FB 3D0LB 4I0CC 5C08E 2GJ6D 3BD5A 1RD6A 4MX7A 4K3JL 3FFDA 1YEIH 1ZHLA 5D9SA 5F3HB 4BSJA 2EDOA 1HN1A 4ZD3L 2ITCB 1Q9WB 5SWZA 3WJJC 1G7QB 1KCVL 5IIEB 4LPTA 1WAAF 3W82A 3HE6D 1U95B 3DIFB 3PP3H 4KVNL 1UYWL 3RUGA 2R2HA 2DF3A 4G6KL 4JGMA 5TGBB 3KPRD 3MSPA 5EO0B 4MLSA 2K7QA 3HFMH 1BAFH 2VXQL 5KN5A 1TVBA 2VQ1B 2Y25A 3KR3L 4NKOA 4GKZA 1ORQB 2X70B 2H6PB 3UYPA 1RULH 5D1ZB 3KAAA 3FQTB 3U4EB 3TWCH 3P4MB 3ARRA 5F7MC 1UADC 5CJXA 2EEBA 1PQZA 4YHIA 5KSBF 1IM3B 5E6IC 3ARYA 1IAOB 3MNVA 4WWKC 1J1OH 2YBRB 1NUNB 4KH2A 1NGWA 1QFWI 2AI0L 4XNZC 5CGYC 1A6TA 3VRJA 2V5YA 1QBAA 1DQLL 3FONB 5E2JA 2HG5A 4YDLB 1AFVH 4XPTH 4X4ME 2R56L 1MRFL 4YNYB 1I1FA 1QBML 2OTUB 1WZLA 2BC4A 3TA3D 5K59F 3C5ZA 5JQ6H 3GO1H 2IAMD 4Y16C 4G9DB 4PJ8C 4XP5L 1AI1H 3SDCB 1AGBB 1T0MA 2K7PA 2BSED 5DD5H 4IRSC 1GXEA 4BSVB 3RZCC 3U2SA 3ARSA 5E8DH 1I1YB 4C4KT 3FHQA 3VXMD 2RCSL 1WBZA 3OAUL 1JUFA 1A4JB 5TDNB 4IDJL 3S5LG 1INQA 1SEQH 4LBEA 1S9KC 4MD4A 5D4QA 5FUOL 3CSPA 4NNYA 4JN1L 3GSWA 3IDMB 3I50L 4PB0L 3U4BH 4MQTB 3QQ9C 2BFVH 1TENA 1REIA 2FGWH 4N0CC 3WNPA 4AMKL 5I1DA 1GGUA 4EQ2A 3TO4C 3L5HA 3BP5B 1U8MA 3C60B 2DQGH 3S36H 2PCPB 4GSDH 4NN5B 4BZ2H 5E94B 1V7NH 4QRQB 2VABA 4GT7A 4WDIA 5BO1L 5DTFB 4G6JH 1NCTA 4WGWB 3VG9C 4PJHB 1I75A 4H1LH 3DV6B 1MREL 3VXNA 5BVJB 1W72H 2DQHH 7CGTA 2DM7A 5F93C 1XF3A 5E8EB 4QO1A 3CK0H 2PW1B 1WGOA 4D0CB 3O6FC 5D6CA 1CQKA 1DDHA 1T2QH 3KPTA 1G9MH 4N8VB 1BVZA 4K8RH 1SJVA 3UTQB 5MEQB 4Z9KB 4RA3A 1FL6A 3SKOB 1KJ2L 5D7IF 4X5LA 3H9SB 4RMUA 4FTVA 4H5SA 4AG4H 5C08A 2HT3C 3RA7L 3QHZL 5KTEH 2GSIB 1T6WA 1CE6A 1KPVB 3TO2B 3SDXF 2GUOB 5SX4H 4R4ND 4Z7WB 1T1ZB 4GW4A 5D70H 3ZT6A 2OL3A 4I3RH 5I30L 1VFBB 3O2DL 4YHLH 4XH2B 5IM7B 5DRZA 5LQBH 3CXHJ 5F1KC 1MRDH 3TIDB 4PJ8D 4XVUC 1LE5B 2AXGB 2EKSA 2G5BB 2EDEA 2EH7H 3FO2A 4IRSD 4D0DB 3LDBC 3BSZH 3OKKA 2GCYB 5ERWA 1AP2A 1XCQB 1I9EA 4P2RD 5KW9H 1TVHA 3L3KB 1D6EB 4GH7B 3KYNA 1D3CA 4YC2B 3QUML 4JM4L 4CMHB 3RWJA 2WUBH 1N7ML 1WICA 1A1OB 3PL6A 4NJ9H 5BOPA 4XCEB 4GJTB 1I1AC 3S9DB 5IT2L 1HINH 3FQRA 3B9VA 3QQ9D 4C56B 2Q6WA 1JBJA 4K23H 1ZLWH 3S7GA 4N0CD 1ZVHA 3TO4D 1ZHKA 1A9EA 4X4MA 5BW7C 2AJSH 3MRIA 3S3SA 3ZDZE 3WDHA 4LQFH 1FFNB 3OR7A 2Z31B 1NMBL 1LO4L 2AJZB 3WNNA 1O0VA 2VQTA 4Y4HB 4F7MB 1WT5C 5CD5D 3LHPL 1QVOB 2DJUA 1LO5A 5BZWB 5E9DE 3NFNA 3DMMA 3CDGB 5L8KB 3TBTB 3UTTD 1K4CA 3J8F7 4WU5A 2EE9A 4ERSL 4YEEA 2NY5L 3O6FD 5TQ2L 4RWYL 5T5NG 1WIPA 5KS9F 1FE8L 4XPFH 3NABH 5DQDH 1DJSA 3MBEC 4JO1L 5GS1C 4LSUL 5JPNB 5FYJD 3FN0L 2WBJC 3TZVA 3QRFM 4TSCL 1KACB 3GIZL 4JFPB 1Y18A 3U7YL 1UH4A 2GJ6E 3V9FA 4XVTL 2J6EL 3JWDH 2E27L 3MACH 3R4DA 1A6AA 3QEQD 2FH6A 1A6PA 4NBZB 4LLVB 5L0QC 4O5LH 1NGZB 5EIVA 5GS3A 4WHYH 5HDBF 3PP4L 3PWPB 1NLBH 4EUPH 2YPLD 3Q5YA 4ODWA 3G6JB 3ZKQD 3MRLA 3L3JA 2BRRL 4MJ6A 4XVUD 4LPVA 1QPPA 2YUXA 4JFQA 2X4UA 2R69H 2NW2B 3L7EA 5C09A 4X7EC 5DMJB 2OTPA 1CI5A 3KPRE 3V6FB 4Q7DA 2X4RA 2JCCE 2H8PA 3WKNA 3DUHA 1J18A 4X7SH 5JW4Q 1CDIA 4Z8FH 5I0DA 3GHEL 4LARH 2FO1A 3GMOB 2FJFA 3JUZA 2E6PA 4NP4L 4H26B 1NCWL 5LGJB 1A3LL 5KSUA 2AQ2A 2DQUL 5DURB 5HDQH 5I8OL 1UM4H 1FORL 5DFVD 3OKNB 1LO2H 1ZT4A 4JCLA 2LVCA 4DK3A 3QNXA 1TTGA 1IFHH 5FUZL 1ZOXA 2W9DL 1FZMA 5FUCE 1QHPA 3MXWL 1KXTB 3JWOC 4PJBE 3NPZB 3FMGH 1TJIL 2AEWA 3LPFA 3HMXL 4WFHD 5KVEH 2F19L 1VGEH 3PDGA 5JDSA 3QG7L 5IJKA 2V5MA 2P5ED 3EIFA 4OCWL 2FHFA 1J9CT 1A3RL 1SEBA 3DVGB 5EULV 5AUMB 4TSAL 2XT1B 4I0PA 1IM9A 4P5KA 3VXME 1JWUA 2P8MA 3MJGX 2R1WB 5HGHA 3TNNA 2YUWA 4FQLH 2RQ8A 2BJMH 2IH3A 4JO4H 3QULA 4F57H 1LDSA 2JELH 4Q74A 2OL3H 3ZSSA 1TMCB 2WBJD 5ALBH 1OSZB 4O4YH 3HHRB 4LLMB 4RBPK 2AGJL 2PXYB 5JZ7D 1P4LB 4PJ5B 4P59H 4UQ2B 3UYRH 1JNLL 3AXLB 1JFQH 1J1XL 2FIKA 3LRSB 1HDMB 1Q72L 3L9RA 3RDTC 5CJOH 1I9IL 1OLZA 2CLVA 3PIQB 1G6VK 2O5YL 3MV8A 4ELMF 2VQUA 1NBZB 3HG1D 4ONFH 4NZTL 3S5LA 5C6TH 1ZTXH 1CGTA 2V2WB 3SDAB 3QUYC 4NDMA 1U8KA 3S4SG 3QUKA 3BOVA 5A2FA 3SCMC 4IRZL 2NXYD 4PJDB 1IAIM 4Y4KB 1PGRB 2YWYA 1JNJA 4U6VL 1EFXD 1MELA 2Q7NA 1ZLUK 4ZNEE 2I60H 4QXWA 4EN3B 3E2HC 3JV4A 5JW4M 1MCHA 4WW1B 1F5WA 4M1DH 3FB8B 4OZIA 2CKBA 1YMHB 1O7VA 1LP9E 4L4VD 2UZYB 4XNMB 5J6HA 1FL5A 3CNKA 3QFDA 5L2KB 3HPJB 3WN5C 3GMPA 4PJXB 1JRHH 3L3IB 4KVCL 5D93C 3VXQB 2IFFL 4W6YB 5HGGS 2DL2A 4AM0A 2BVUA 4QRRD 5FHBH 1T03H 3IB4A 1BBJA 3BXNB 5FA3B 3DV4B 5ICXB 4P23C 2NYYC 2ZZUT 2H2PC 3U0PB 2V9TA 3O3EB 4EI6A 2LU7A 1U8QA 2FATH 2HJLA 3LOWA 1JNNH 2GY7B 3SOBL 3H7BB 1U3HA 4Q6IB 3I6GB 3BH8A 3CZFA 4HKZA 4PY7B 1KCSH 4KROC 4WUUA 3KHOA 5JIPA 4ZUVA 3VA2C 5GRJL 3VFRB 1F2XK 1QFWL 3TPUB 4P2RE 3DX7A 2B0SH 3HC0A 4P4KD 2Z8RA 4M43L 5HHPB 1BQUA 1AXTL 5TH2B 3BZEB 5SWSD 2XKUA 5DDHB 4OSUL 5CCKH 3LN4B 3TIEB 4LLDA 4R6UA 2Y1VA 1NMCB 1RZGA 5EN2A 5FDYA 4PJEE 2AJUL 3RVTD 2AJVH 2QHRH 1NAML 4OLZL 3HC3L 3ARGC 3WLWC 3ELAT 1N5YL 3S36X 3L5WA 5EOCL 1EO7A 3RDTD 3D18B 4LEOB 3T2NH 2VRAA 3MR9B 5CGTA 4I5BA 2ORBH 3FO9B 5C0BD 3AU1B 4N8VG 4PJBA 3K4DA 1HSBB 2F5AH 1T3FA 4KZEL 3ARBC 5J13C 3VD4A 1RMFL 4OJFL 5FO7B 3NZHL 5IVZA 1R3LA 3UTTE 2ZJSL 3WO3B 1JWSB 4WI7A 1JN6B 5IMMA 1TZIB 1RIVH 1PYWB 1I9RH 4APQA 4MDJA 5IFJB 4JM2C 3QDAA 4MA8L 2Z93A 3LV3A 5EZIH 4QRSA 4G42A 3LKPB 3MRFB 5GGUB 3HZMB 1BZ9A 4GG8B 3O3AA 4KRMB 2OCFD 1BVKB 1JP5A 2DJSA 2Y06H 1MEXH 5FYJE 5C0CB 3SE8L 4CDHA 4XMLL 3TM6A 4KXZI 1CLYL 1HHIB 3RHWF 3U1SL 4PJ7E 4MDIA 4TVPD 2CRZA 4RMQA 2E7CA 3QEQE 1GAFH 1KIPB 5F96L 4FXGB 4P23D 4BZ1L 4ZFFB 2NYYD 1FNGA 2AV1A 2ZCLH 5E95B 2YSSB 2WUCH 1J8HD 2KBGA 2YPLE 3KNBA 5JQHC 3HR5B 2P8LA 4R8WH 1MHPL 4HBCH 3HC4H 4AL8L 2BCKB 1OSPH 1N59B 3W81A 5J1TC 4U1LA 5CBAB 2H45A 1RU9H 1NBYA 1EDQA 3E0GA 4BFIA 1T4KB 2X9WA 1FNAA 1H3TA 3ZYZA 2GAZB 2W0FB 3L95B 4PRBA 4N0YL 1ROWA 3FO1A 5I18H 4MAYD 1I7RB 3BP7A 4MHHI 1JGDA 1MCOH 2A6DA 2HFGH 2WZPD 3ARGD 1XEDA 4JY5H 1FFPB 2JLLA 1LNUA 1IGMH 3O4LB 1QKZL 4R4BA 1B4RA 1S78D 1XGPB 1VEMA 4PJIA 5I8CB 4IIQA 3GMRA 3O3BA 5EUKB 3ZKXB 4OD1H 3H0TB 2CKBH 3BKCH 3NIGE 3U9PH 3L3DA 2Z8VC 2ZOKB 3EGSA 5DFTA 3ROLA 1S7TB 4BM7A 1S7VA 4WFHE 3ARBD 2YZ8A 4KMTL 2ZUYA 4P5MB 1Q9OB 3WO4B 4JRXE 1EHNA 2JB6A 4EEEA 2P5EE 3WIFB 5D7JC 5EZLA 1WITA 4FS0A 4P57A 4X80H 4OM1H 4JKKA 1CICC 5ISZD 1S7RA 1H5BC 3VGAC 3IU3B 3P73B 2HH0L 3PUCA 2CLRB 4PJDF 5B39B 1F3JA 5J9PA 4QHMB 1KB9J 1SY6H 2AQ1A 2R29L 1XF4B 4U1IB 2Y5TA 5EZJB 3FAXA 4HIXL 5DI8B 5JMOC 2EDNA 1TZGH 2VISA 3UC0H 2W1NA 12E8L 4JPWH 3G5ZA 3LEVL 3D0LA 4N0FA 5EU3B 1WF5A 2VR4A 1CFTB 3VH8G 1XFPA 3HG1E 4KV5F 2CKNA 4PJXF 1J0IA 3MLVH 4H25B 5HHOB 5F3HA 5I1JL 4POYA 1EEZB 4NQXB 3B5HA 4Y8DC 4LLWB 3MJ6A 4NM8H 5IVNA 4LFHG 1G7QA 1U3YA 1AY1H 5IIEA 1BD2D 4TUKL 3IXTB 1U41A 1U95A 4K9EH 2YMXH 3PDOB 4XMPL 1KTLB 4JFZH 3SJVD 5GZNC 2AQ3A 2O61B 4U0RC 1CR9H 3KYOB 1CG9B 3D39D 5I8KL 5CKGA 4P2OC 4MD5B 5HVHB 1UXSB 4PJFE 4L4VE 5FAAA 4HWZA 1G1YA 1ORQA 1LHZA 2AK1H 2X70A 2H6PA 4G3YL 4PP1C 5D1ZA 3QJFA 3P4MA 5DUML 3M1BB 2J3SA 2DLIA 4EVNB 1IM3A 3F12B 3FQWA 4QRRE 3RWHB 3GDBA 4O9HL 3X14B 1O7SA 3FONA 2AJXH 1C12A 4KJQD 1OCWH 4YNYA 4DGVL 3WJLA 1R3IL 1T6VN 1UH3A 1KEMH 3H9YA 2R0KL 1G0YR 4G9DA 3T1FB 5D7JD 1ZA6A 2VDOL 3KLAB 1VFUA 4GW5B 1AGBA 2KUTA 1A5FH 1CICD 4Y1AD 2J7LA 5CJQL 5K9OB 3BPCB 3PQYD 5DLMH 4GKSA 3KPSD 1UQSB 1LVEA 3PDDA 3OJDB 3U4AA 4NOBA 1CGSL 4XBPB 4TSBH 5SWSE 3TYFA 4TULH 5TDNA 4D8PA 4LNRB 3LD8B 2CDFB 1MCWW 5EIQA 3BRGC 4M3KB 4NWUH 5KG9B 1Z5LB 4Y5VC 5FA4B 3IDMA 4PYHA 5T33H 1YN7B 1WQVT 5LGHH 4QCIA 1K9TA 5JHLL 5E99H 4M4RA 4Y88A 4PJ9B 4LCWB 5C0BE 3BP5A 3C60A 4GMSL 2PCPA 1MPAL 5F7NC 4QRQA 2NY7H 2AABH 4FZ8H 1JWMB 1RUAH 1IKNA 4PJHA 3VDBA 4JRXA 3VFUB 2DDQH 4G5ZL 4Q0XH 5IB2B 5ALCL 2XWJB 1JMZA 1IQDB 3MRCB 5GZND 5E8EA 1E6JH 4RFOL 1T89A 2E9BA 3DHMA 2R4RH 1T7XA 2PW1A 4D0CA 1GJIA 4R2GC 4P2OD 4U7SA 2R0WH 3BD4A 5I1IH 4NO2B 5D1QB 3ULUD 2Q8BL 3FTGA 2LQRA 4ZODA 4AQOA 3L6FB 4G6AD 4N8VA 4S2SB 4R97B 15C8L 1BJ1J 4R0LB 5ADPH 2IGFH 3UTQA 2R2EB 1MCEA 1YNLL 4PP1D 2DQDL 4GAGL 5TE4L 3SKOA 3V4UH 4X4ZA 3ZE0E 3DGGB 1V05A 4L8BB 4UI2A 2QV2A 3BKYL 4IRJA 2AJYL 1RJLB 5I15H 5CWSB 2W38A 1YEGL 2LU4A 1KPVA 4M93B 3TO2A 1FNSH 2Z8SA 2GUOA 1J8HE 4CU6A 4Z7WA 2JJUA 1T1ZA 5DGQA 3CU7A 2CGRH 4JZOB 4YE4H 2EDWA 5IM7A 4XH2A 1U8LB 2FGZA 4XAWL 3AS0A 2AXGA 2EXWC 5TF1H 1FJ1B 2G5BA 2YD8A 3D69B 3CLEL 2Q1EA 4QGTA 4HKBB 4X6EB 6FABH 2GCYA 4RGMC 5F7EH 4X0KB 1FO0B 5C0FB 4QEGA 4HWEL 3L3KA 4MJ5B 4PJFA 1K2DA 1R5IB 4OF8A 4NJAL 3RBSA 4JQVA 1A1OA 1FCCA 3HZKB 3AAZB 2A6JB 4R7DB 1QSEA 2D9QB 3QZWB 4Y0GA 4G7VL 4C56A 4FQHB 4L3ED 2VXSH 5EU7E 3FN3A 2HP4A 1CL7H 5SV3A 3BKML 2R4SL 4YHPB 1FH5L 3AROA 3IDUA 2CK2A 2WSKA 1UM6L 3V4PL 2XFXA 4DZBA 1ZHBB 5FYJH 3BYYA 1ADQL 3K46A 2Z31A 2APFA 2AJZA 3OKLA 2IANA 1F90H 5DR5L 4A2LA 1QVOA 5BZWA 2ZUTA 3DSFL 2Z4QB 3MRQB 1IGCH 3TBTA 5ISZE 2XV6B 3G6AB 1C7TA 1I9JL 2UUDK 4HUVB 2HFFA 5JPMB 4P5TB 3ZYJA 2NLJB 5F6IB 4QLRA 2A9NL 3HMWH 2VDPH 5ICZB 3KXFD 2NY2B 1JZ6A 5JPNA 3MRNB 4KKAC 5FKPB 3BQUC 3LZFL 3VRIB 1KIQB 4FXKB 5JUEL 4X7FC 3QDMD 3CFBB 1WFNA 1YPZE 3UJIL 4PLJC 1QYGH 2HVJB 4KZDL 1QFUL 5TFSH 5BJTB 3U79A 4KRLB 2CUHA 5C1MB 2XZAH 3QIWD 5LXGH 4LLVA 5FXCH 1NGZA 1Z0NA 2YD3A 3PWPA 3OXRB 4UTBH 2RJMA 1BD2E 3VFGH 3TBWB 1JVKA 3G6JA 1NMAH 2ITDB 3NCJH 3VMOA 1UWXK 3OL2A 3NZ8B 2J88H 4YXKL 3P0VH 3SJVE 5GSRB 1KTRL 1A6VH 4BA8A 2XG5A 3D39E 4GFTB 1RIHL 5FM4A 5DJZB 3VH8A 3KPLB 1A22B 1RUKH 3X3FL 5HHQB 3QJHB 4LVNB 4RISL 5JXAL 5IOPB 4HAFA 3AY4A 4X7TB 2VUOA 3GMOA 4OUOA 4ODVL 3MZGB 5C6PB 3VFVB 2JJWA 4H26A 4NO3A 5LGJA 3F6IA 2ERJC 3JV5A 4BH8B 5T3XD 3EYFB 3IFOB 3IRZA 3OKNA 1Q0XL 4DK6A 3GM8A 5CJBA 4YXLH 3QEUB 1YNTB 4RGOL 2UWEB 5B39G 4LIQL 1JZ5A 1CXHA 1LILA 2R1XB 5CHNB 1BIHA 4FQXB 3WFBH 3AREB 1MWAH 4Z7VB 2BNUB 1RJZB 3LKQB 3U30C 5I1LA 1NFDF 2ZCHH 1MJUH 3A6CL 3GSRB 4Y1AE 4QHLB 3PQYE 1ES0B 3KPSE 5AUMA 3SE9H 2ZCKH 5MP6L 1T5WA 1CIDA 2R1WA 3VXOB 2C1PB 1EIBA 5MI0B 2J8UF 4M7KH 1XH3B 1FZOB 2BNQD 1FFRA 2X40A 5DK3A 4LSSH 2V17H 4KKAD 3WUWB 3G5YB 3BQUD 3WFCL 1RY7B 2XYCA 5GJSH 3QNZA 1B6UA 4LLMA 4C55A 4PLJD 4Y19B 2DICA 2PXYA 1P4LA 2VERN 4PJ5A 1YDPB 4UQ2A 1VERA 3LRSA 1HDMA 3IRPX 3ZHDA 3MMEB 5FB8B 1UC6A 3MRRB 1GOGA 4X7CC 3L5IA 3PIQA 5DMYA 1NBZA 2JJVA 4EI5C 5CIPH 4CGTA 4K2UH 2O5ZL 1IT9H 3SHSA 5DJ8B 5IVXB 3SDAA 1NL0L 4P9HH 1RI8A 3MRKB 3B9KB 2A1WL 3FQNA 1B0WA 4POZC 4L29A 5T3ZL 4LDLB 3D25A 4X9IA 4EN3A 3ULUE 4MJID 1LO0L 3CX5K 4ZOAA 1GIGH 1KIUA 1YZZA 4M7ZB 3FB8A 4WW1A 3UBXB 1YMHA 1A47A 3S37L 5D7LB 4HKXB 1UWXH 1MRCL 3HNTL 2KDGA 2ARJQ 1RZ8B 5IKCA 5L2KA 5DRNB 3D85D 1F4WH 3QXAB 3BVNB 4P99A 3SDYL 3VFSA 3VXQA 1GZQB 3V6OE 3P30L 3AFLA 4I8DA 4TNWK 3RL2B 5DEFB 3GGWA 4D9LL 1I7ZB 4M48H 4YBLC 2FR4A 3GJFH 3BXNA 5FA3A 5ICXA 4YHZL 3OKEB 3I9GH 5FGBC 3U0PA 1OP5K 4YDKH 3L5XL 1CFVL 3IVKA 1YEFL 1BFSA 4XNYH 1TXKA 4L4JA 4LRNH 3LS4H 4F7TB 3PF2A 1DBKH 4Q6IA 2WIIA 5ESVA 3I6GA 2CO7B 4PY7A 2ICEB 4L8DB 3T0DA 2AK4D 1AXIB 1D5BB 4POUB 1KN4H 1CTOA 3VFRA 4Y2DB 3TPUA 2AP2A 4RX4D 5T5FH 4NKIL 5HHPA 2HKHH 5TH2A 1OW0A 3MQIA 2CXGA 1VGKB 3OR6A 3LN4A 4FQQA 4HEPG 3TIEA 3MLPA 2ICCA 2QQQA 2F74B 2EIDA 4I48A 3SPVB 3NGBB 2GHWB 1DBJH 4L3EE 1BZ7B 3MRBA 2VXUH 3DUSB 2IEPA 2AV7A 3GSQB 2X89D 2EXYC 2J8HA 3MR9A 4PGBA 3K0WA 1L6ZA 2EDQA 1ERNA 1OP3K 3VD9A 4EI5D 3H3KA 3AU1A 1RZ7H 4I4WB 5I75B 5IMOB 4M6OL 4WI3A 4E41D 4ORGB 3TEUA 4OAWB 2R23B 5FO7A 4POZD 4Y4FD 4F58L 2QL1A 1OY3B 5CEXB 4YHOH 1JWSA 3PQYA 5E5UB 1JN6A 5DWUL 5HTSA 4X5XB 1PYWA 4Z77B 4RIRB 3SGEI 3C09C 4OGZA 1NAKH 2ADIB 5IFJA 4WO4B 1S3KH 4QGYA 1M05B 2E7LC 1NCAL 4CJ1A 4GG8A 1BVKA 2DLFL 3KXFE 2RB8A 5D71H 5C0CA 3JV0A 4OCSL 4NZUL 4UT7H 3MGTA 1MAML 1HHIA 3QDME 3VI4F 2PN5A 3RI5K 1QEWB 4MXWL 1KIPA 5D5MB 3VXRD 4FXGA 1MNUL 2VB5A 2X4SA 4QXUL 4ZAKB 3BFOA 4X6DF 4XVSL 2YSSA 1PZ5B 3V52L 3RVXC 3HR5A 5I76B 4RFNB 3P4OB 3KJ6L 1OTUC 3VWKC 3W0WD 4LLYB 1U91B 4DFIA 2HFEA 1FV1B 2F53B 2BCKA 5D6DC 4MQ7B 1Z9MA 2UWEF 2Y72A 5CBAA 4DKFH 1E27B 5C0DB 4WHCA 4UT6H 4X6CB 2WV3A 3BGFC 4JY4B 1T4KA 4NNPH 1FLTX 2GAZA 3L95A 5D1ZC 5B38G 1RPQA 4HZAA 1F4HA 3MCLL 2VR5A 1NGYB 3GMLB 4RAUB 3V8CA 1L7IL 1RJCA 2BVEA 1JGVH 1N3NB 3GB7B 2EDYA 5GRZA 1OAYL 3WBDA 5T3XE 3KWWA 3V6OA 4N0UE 1OGAD 1FFPA 5FM5O 3WHE1 1XGPA 2E8ZA 5I8CA 4OZGB 2AXJA 2YC1B 3AMLA 3THML 2EXYD 1CN4A 3PHQB 4ZO7A 2DWDB 2XA8H 5EUKA 1G9NC 1YEKL 1Q9LB 5MEOB 1ITBB 4Z7NE 4FQPA 4G43B 4OZHF 1HIMH 3H0TA 5E08L 1G6RH 2ZOKA 4KPHL 4XNXH 3SDCC 5JIIA 1S7TA 3OPZL 5E4EB 2OZ4A 4YX2L 4Y89A 1N8ZA 4P5MA 1TFHA 4WI5A 3A6BL 3WIFA 5DJYB 1OAKH 2EE3A 4NRYA 3IU3A 3WS3A 3LIZH 2GEEA 4KDTC 1KT2B 5EG6C 1K5NB 5B39A 2BNQE 2M26A 2DN7A 4QHMA 2Z91B 2PYED 1XF4A 1RJYA 1UKTA 3CVIL 3UTPD 4U1IA 5EZJA 4ZDHB 2XACC 3DOSA 3WD5L 2E6JA 4X6FA 4Z95L 5DI8A 4TPRH 4LDEB 4FQ1H 3IFLL 4NSKB 2E7BA 7FABL 3WIHL 5AZ2H 4H25A 5HHOA 1UWEL 3GK8L 4ZSOB 1EEZA 4NQXA 35C8L 3RVXD 5DD6B 4G6FB 4AZ8A 1OTUD 3VWKD 5SX5K 1E6OH 3NACL 5A43C 3R1GL 3HI5L 3QG6B 3M8OH 4JR9H 3TT1H 2VDKL 4HJGA 1UZ8B 2F58L 2QLVB 1SBSL 3GI8L 2O61A 2JB5L 2PR4H 1B0GB 3C08L 4MJIE 4CU8A 2MCG1 4MD5A 4OZ4A 1MLCB 1YEHL 3IFNL 2MHAB 3E6FA 2FL5B 3O2WL 5GPRA 1EUUA 5SX4I 1XGRB 1WAAE 3NA9L 3SKNA 3M1BA 3E8UH 3OZ9L 3FT2B 4NQVA 1PX3A 2CH8A 2I5YL 3F12A 5T1MB 3RGVB 1YJDL 5HYSB 3RWHA 5ANME 4XPGL 4CAGA 1FIEA 3X14A 3GBMH 1U8IB 2VDLH 1MCPL 3QNYB 3T08A 3SDCD 4JHBA 4E42A 1QR4A 3WUWG 5DHYB 1H3UA 4J2XA 1F58H 3PGFL 3KLAA 2DJ4A 3TPKA 1OAXH 1BGXH 3FT4B 4GW5A 4HXBL 2X7LA 3OAZK 4MZ3A 4HK3J 5KSBE 4HPOH 4YC2C 5HY9B 5K9OA 4CMHC 3BPCA 3G9VA 3V5DB 4PV8A 1ORSB 5FKAB 3OJDA 3UO1H 1LEKB 1NCUA 4XBPA 3PWVB 4H88H 1JGUL 4JFDB 1QO3B 2CDFA 4TOYL 5F21B 2V9QA 2AEQH 5K59E 2G5RA 3TLRA 4M8VA 5KG9A 1A2YB 5KVFL 3FJTA 2H1PL 3O3UN 2XZCH 1MI5B 3DRQB 4FG6D 1JV5B 3ULUH 4PJ9A 5M7QA 3N9GH 4LCWA 1NCDH 4UILL 3UBXG 4Y4HC 3T4YB 2B4CH 1C1EH 1LK3L 3EHBD 4HC1H 4XC1L 4E41E 1U2HA 1Q1JH 1JWMA 3OJ2C 5C2BH 5D5MF 1PEZA 4HWBH 4LU5H 1F4YL 5DXWA 2OXHA 3TV3H 5IB2A 3FCTB 1EJ6A 1IQDA 3PABB 5HYFA 2W07A 3DLQR 1C5BH 1AE6H 3O9WB 3RVVC 4PGJA 1Z3GL 2D7TL 4NO2A 5D1QA 3QBTB 1F42A 4DOHB 2R39A 2ZUWA 2OP4H 2NQCA 3U0WH 3DETC 3L6FA 4H8WC 2GJZB 5CZKA 3LEYL 3H9SD 4M61A 1X44A 2OZ4H 1JZ7A 2R2EA 1IMHC 2MKWA 4XP9L 4PGDA 2V7NB 1IKFH 3DGGA 4L8BA 2LU3A 2HTLC 3C8KA 5C0JA 1AKJB 4OUUB 1RJLA 3VXRE 5CWSA 3ZE2F 1AGDB 4X4YB 4UNVA 4J4PC 4R26H 3EFFB 1FNHA 1KBGH 4G7YL 1J7VR 1A0QH 4OI9A 3CVHH 4JZOA 5GGRY 4OZGF 4P3CH 5C0RL 2W65B 5AAMA 2HKFL 5C3LD 2V9RA 4YHML 1R3KB 1HQRB 1K6QH 3MRHA 5D7IE 5F6HI 3S34L 5FV2A 3TH4T 1UH2A 3CXDH 3FQUB 4OM0L 3EYVB 4HKBA 4X6EA 1RVFL 3AY4C 3OB0K 1AXSA 1WC7B 4WJ5B 3BDBA 1FO0A 4PRPB 4DEPB 5C0FA 3QH3B 3SDXE 43C9B 3AVEA 4U1JA 4MJ5A 1PY9A 4M62L 3O8XC 5I1KH 2FNBA 3AAZA 2A77H 3OAZH 4R7DA 4PBWD 4UINL 2LTQB 4Q9RL 3I02A 2VDNH 4OT1L 4LGSB 3QZWA 3VJ6B 1BBDL 1OGAE 2DM2A 1B2WH 4U3XA 5DK0B 5B8CC 3FB5A 1LEGA 3T2QA 4FFZH 3TP4A 1ZSDB 4PLKC 4NRXA 4Y4HD 1IC4L 2YD2A 4NM4H 4QHNB 1F4XL 1ZHBA 1HYRC 1RHFA 1CGUA 3RWGB 3NBNA 5I17B 4NRZB 2Z4QA 3MRQA 5I16A 5F6HJ 4CNIB 5E2VL 3G6AA 3RVVD 4LL9A 1FAIL 4IM8A 2FJHB 1RUQL 2NCMA 3RNQB 4NHCH 1MIML 4P5TA 4KKBD 4TUJB 2NLJA 3X3GH 3DETD 3T0VA 4NGHL 4ZOBA 5IHBA 3DX6B 1J1PL 5C0NC 1BVLA 2PYEE 1JGLH 2X9YA 5ICZA 3FQXB 3UTPE 3CPLB 3MRNA 3G6DL 4JPIB 5B3JF 3HRZA 4HV8B 1KIQA 4FXKA 4JB9H 1LE9B 3HLAA 3CFBA 1EHLL 3WFEL 2HTLD 1TQBB 5DEZA 4J3VA 3MLZH 5BJTA 3OXSB 4C83B 1HHGB 5ITBL 2RFXA 3DVFA 4J4PD 1WWBX 5KS9E 1FFOA 2OSLB 3W9DA 5EZOH 3QT2A 4UAOC 1MQ8A 4Y4KC 2JJTA 5GHWH 3TBWA 4Y4FA 1HKFA 1IEBB 4KTYA 4QRTA 1FRGH 1V8HA 1M7IA 2ITDA 4EN3C 5T3XH 4DW2H 1F3RB 3NZ8A 4IOFC 3BZDA 2NY1C 5GSRA 5FGCB 3I75A 5I66B 4G8IA 1JRHI 5E1AA 1B0RB 4U4BA 5DUPH 4KRPD 1S7SA 5HVWA 5TE6H 5HDBE 4MCZB 3O8XD 5IOPA 1B4JH 2PKDA 5DURD 3HFML 5F72S 1BAFL 4G8GB 4MWFB 4EQ3A 4JO2H 1Q0YH 2AERT 4D3CH 4YHNB 4BH8A 2FDBP 4LP4A 1VPOH 4JQXA 4O51B 1RULL 1DSFL 2A6IA 3JTSB 3NH7H 4ONHB 3CH1A 1DZBA 4PLKD 3EUUA 2YN3A 1JZ2A 4HXAL 5CAYB 1YNTA 4F7EA 5D7SH 4P4RB 2YRZA 3DUUA 2YD4A 4RA0C 1J1OL 4YGVA 4BK4A 4NWTH 3QDGD 2R1XA 4FQXA 4X8JB 5FK9B 4XPTL 1CVRA 1ACYH 1BREA 3AREA 5D7KE 4Z7VA 1RJZA 4WI9A 4A6YH 3MZTA 1KG0B 2VLKB 3GKWH 1MFBH 3GSRA 3DROB 5DO2D 4CRPA 5JQ6L 4XCYB 1TCRB 1OW0C 4LCCB 1GRWA 3WLBA 5E7BA 4JJ5B 1MCDA 1A1MB 1NMCC 4HCRL 4OTXH 4GLRH 3VXOA 4GRWH 2C1PA 1KCKA 3QPXH 3Q3GB 3EYQC 5E8DL 5C0ND 1FZOA 1AIFB 2P44B 4YQXH 2JIXD 4TVPL 1NJ9B 5JOEA 4KU1A 3QFJD 3ZKSD 3WUWA 1SEQL 1DTUA 1NC4B 4P46A 3FFCD 3MYJB 5LKNA 1YDPA 4TVSa 1BJMA 3F5WA 2VO5A 1CD0A 5ADOH 1AGCB 2ZSWA 3KYKL 4NUJA 4RSVA 4GQPH 3U4BL 3MMEA 3G9AB 1RZJH 3MRRA 1FO0H 2BFVL 2BSSB 3ZDXF 1HILB 3C8DA 1I3UA 4MD0B 4JKLA 1DCLA 4UDUB 5DJ8A 3S36L 2G2RA 2JE8A 3EO0B 3V7AE 3MRKA 1P4BH 1JHTA 3B9KA 3HUJB 4WW2B 1DUZB 4G6JL 4LSTH 3WS6C 2GITB 4IOFD 1KNOB 1WZKA 2NY1D 1HSAB 3ZKNC 1NC2D 1YEEH 4WNQB 1W72L 2DQHL 4HF5H 1NFIB 4GBXB 2CR3A 3CFKB 4ELME 5GJTL 1KCRH 3CK0L 3UBXA 1OM3H 4Q9BA 2ADJB 3H9SE 5F7HA 3EDDA 5FO9B 1LO3H 5D7LA 4GAJH 4HGWB 4ETQA 1T2QL 5HGDA 1MFAH 1X6LA 2NY5C 1RZ8A 5DRNA 3F7VB 4K8RL 1N2RA 3BVNA 4PGZA 2XPGB 3P2TA 1T0PB 1GZQA 4JRYB 3RL2A 1FNEB 5DEFA 3CIQA 2BVTA 3C5SA 1WISA 4XI5C 5ELIA 4AEHH 4AG4L 2ARWA 4YWGL 3M17A 3Q5TA 1SVCP 3OKEA 2PYFA 4Z0BH 1HHJB 1HHKB 3LKRA 3HRPA 1CDGA 3EZJB 3RX8A 3T0EB 3O6KL 5TE7L 3GSXB 4F7TA 3OKDB 1MJJB 5D70L 3H3PH 4I3RL 1UT9A 3ULSA 4YHLL 2ICEA 3MGOA 2IQ9L 4L8DA 5LQBL 5J1SC 3EJYD 4LCYA 4L8SB 5DS8A 2EZ0C 3UJTH 2OK0L 3FZUC 4O02L 4Y8AA 3D3VB 3EYQD 4KRNA 1PKOA 5KW9L 3AB0C 3TFKD 2F74A 2OI9B 3ARFB 5E70A 1A9BB 2LAAA 5CP3A 3UCRA 3DUSA 2IQAA 5F7DB 1FFQA 2PO6B 3GSQA 1G7JB 5C0IB 4K23L 1C5CH 1CLOH 4V1DD 2IWGA 2Y6SC 2Y36L 4AYFA 4I4WA 4L3CA 1ZGLM 1UB6B 4XGZB 3UTSA 4MAUL 5F70A 4ORGA 2XXCB 4OAWA 2ATKB 2EDXA 1A7RL 1FZKB 1OB1B 3ZKND 4X5XA 1F6AB 9CGTA 1L6XA 2ADIA 2VIRB 4WI2A 3REWA 2P24B 5T1LD 2YEZA 1EZVY 1RZIB 1EPFA 4F80A 4IJ3B 1MUJB 4AK1A 1PD6A 4IMKC 4CMMB 4X99A 4FHBD 4XPFL 5DQDL 3WHE0 3STLB 1A14H 4I3SH 4JVUA 1QNZH 4YBHA 1DVFA 1QEWA 3K2UL 3W5NA 3S35L 5EA0L 3RVUC 5DJ0B 3MACL 1JHKL 3W5MA 3CLFH 5GS0C 1OD7A 3BPLB 5EU5B 1PZ5A 1UCBH 3GSOB 3KHQA 4O5LL 5I76A 1XGYH 5DVMA 1QLRB 1NLBL 4LLYA 1NANH 1UKSA 4YPGA 1KB5H 4JKPH 3U0TA 4M3JA 2F53A 3LQAH 2IG2H 3QAZB 4WUKL 5EDXA 4L9DA 2HTKC 1L7TH 4L3AA 3IDYC 2NW3B 5JOPD 1KV3A 5FYKL 4X6CA 3QHTC 1TDQA 4M6MH 4ELMA 2ZG1A 2OQJA 1QSVA 5CP7B 3W2DL 1RFDL 5DEGB 5DJAB 4X7SL 1TJGH 2DD8H 3GMLA 1NGYA 4Z8FL 3BAEH 4DJMA 1AJ7H 4LARL 3S96B 4M9OA 1N3NA 3GB7A 4ODSH 1RZKC 3ILQC 3MV9D 3EW3B 3O6MH 2YC1A 3PHQA 2DWDA 4ODUB 1DP0A 1PSKH 5MEOA 1IEHA 2Y6SD 3OAYK 1MFCH 1HKLH 3QDGE 1R0AH 4X6BB 4BQ8A 1IFHL 5TQ0H 5E24E 1OAUL 5JA9A 2VAAB 2H32B 1H0DA 2X1WL 1QSFE 1F13A 3K81A 3FMGL 1EMTL 2X1QA 4ZUSB 5KVEL 1F4AA 1VGEL 4M1CD 1FGVH 4WWID 1D9KC 3LD8C 2V2TB 4P3DB 1T83A 4M03A 3MLXL 2UV3A 4WW2F 1KT2A 5BRZD 2CQVA 1K5NA 1J86A 5D2LB 1IRAY 4PRHA 5TJWK 3QFJE 3FB7B 1QRNE 2ZPKH 3BPOB 1VESA 1FN4B 4FQLL 2BJML 4JO4L 3ZLQC 4F57L 2BY0A 4ZDHA 2JELL 2OL3L 1LD9B 3FFCE 4LSRH 3RP1A 4JANB 5ALBL 4O4YL 5IWLA 1CDJA 2EDTA 2B20A 3RFZC 1JYNA 4LMQI 1TETL 2VDML 3GSVA 2VL4A 5I74C 3RVUD 5AG8A 3UYRL 2QSTA 1JFQL 2DLTA 3HI1A 1FG2A 4QOKD 4EBQH 1IGIH 3BE1H 5GGVY 4ZSOA 3EYOB 5CJOL 4UU9B 4BSWB 4OF0A 3NMEA 4ONFL 2YPKA 3BIBX 3ZL4H 4ODHL 2VLJD 4YHYB 5A16B 3QG6A 2HTKD 1UZ8A 1Q9KB 4AY0A 1XF1A 1U6AH 4R0LC 5C0AD 4JREB 3HE7B 1E4XH 1BFVL 4KV5E 3TVMD 1DLHB 4PJXE 1MH5A 2I60L 2OS7A 2Q7YB 2MHAA 5KSAA 1DUYB 2D2OA 4PJGB 4XBGB 5E8OB 2FL5A 1SJEB 2XNAB 3QUZB 1B3JA 1XGRA 1JTOA 5JNYB 5CJ5A 4NQCB 4UV4H 1C8PA 4H1LB 3FT2A 3ILQD 4ZFZA 1A7OH 3V79C 5JIHA 1MVUA 3QIUB 1H3WM 3M45A 2XTJB 4MB4A 4PBXA 4LKCB 5DHYA 3UTOA 1MY7A 3RTQB 2FATL 3T0BA 4U1NB 4K7PY 3FT4A 5F1NB 1OTTC 1A6ZA 4NQED 4M7JH 1D9KD 4F2MB 3S8WA 4WCYL 1KCSL 1A6UL 5FKAA 4ZPTB 1GZPB 2QQKL 4JFDA 1CL7I 3FN9A 5DJXB 2OR7A 3HA0A 5H37G 2FBJH 1A2YA 1JPGB 3OF6A 1DFBL 4OLEA 5CCKL 1XF2B 4P2YA 3LRHA 4LSPH 2BX5A 1A7QL 1RV6X 6CGTA 1MI5A 4PRAB 4PJCF 2ZP0T 3DRQA 2QQLH 4JG1H 2AJVL 4NUGH 5FDWB 3MV7A 1JV5A 5GIRB 1HXYB 3AM8A 3CU1A 4V1DE 2F8OA 2VZ1A 5DMIH 2B2XH 3JVGA 3T4YA 2BY1A 3DYMA 2WAHA 3MV11 3ECBA 4L9LC 3T2NL 1KYOJ 3Q5OA 2WM0A 1ZHLB 4D2NA 3LMJH 2ORBL 5DC0A 1QSFA 4LVHC 1OWWA 4NT6A 5DVLA 3FCTA 2F5AL 1X9QA 4F9PA 2WQ8A 3RHWK 4Q58C 3UEZA 1AO7B 3PABA 2A73A 1CDHA 3O9WA 2R2HB 2CIKA 4P2CG 2FB4H 1RIVL 1ZWIB 5SV4A 4U05A 3T4AB 1I9RL 1ZGLB 4DUXA 5EPMB 1QRNA 3U36B 2XTLA 3MREB 2FECL 1XIWB 1SM3H 3ZTJG 4U6HA 5DYOB 2V7NA 1MEXL 4RQQB 3O2VH 3FFCA 3H2WA 2FX7H 3QP3A 3BGMB 1JTTA 1AKJA 1CIUA 4OUUA 4WEBH 1V5JA 4L4TD 2AAVA 2BHYA 4MB3A 4X4YA 3MNVB 1K85A 1F6FB 3NCYP 1NGWB 3EFFA 2YKLH 2ARJA 1OAZH 2BSTB 2HG5B 2W65A 2QR0B 4LVOB 2Q8AL 1R3KA 1J0JA 4ONGL 4ELKA 2FX8H 3N1FC 1OTTD 3GSNH 4R8WL 4FMFA 4HBCL 5JOPE 3AC0A 1IGJA 4LVNC 3UDWA 1T0MB 1AR2A 3SKMB 4PRPA 3TN0B 1U8HA 3QH3A 43C9A 1QLEL 1KUMA 1WBZB 2R0ZH 1JUFB 5C9JB 4B53A 4EUPB 5I18L 4MD4B 4HMCA 2D7QA 1RUPH 1MCOL 3VJ6A 3MV9E 2FEEL 2P1YA 5DK0A 2HFGL 2BVPB 3EBAA 4YIQB 5H35B 1CXLA 1KJ2A 4DWHA 3G5VB 4RGNC 2DQCL 4QHNA 2E9JA 4ZO9A 3OJMB 1MCQA 1VEPA 5I1CH 1ZLVK 4OGXH 1U8MB 3SDDB 4B50A 1R6VA 1GCFA 1TJHH 5L9DL 2AXHA 2CKBL 3BKCL 4OIBA 2VABB 4WV1B 3U9PL 1T20B 3CSGA 4NRZA 2XY1A 4CNIA 3JWNC 3IGAA 1N6UA 4RAHA 5MI0C 1WIOA 5K9KB 1XF3B 4R4FL 3QRGH 5BRZE 4MNQD 3K8KA 5GXBB 1FAKT 4YJZL 1YC8A 3BD3A 3BUYB 3IJHB 1SBBA 4GXVH 3MYZA 5TDPA 2R15A 1DDHB 3FQXA 1WTLA 4S0SD 5I1AB 2KH2B 2VKWA 1WBYB 1NGPH 1LE9A 5HD8C 1WLHA 3ZHKA 2IBGA 4EDXA 1HCFX 3N50A 4FTVB 1P9MA 3UC0L 5C08B 3V7MA 3VGGA 3X12B 4QOKE 4JPWL 5C07D 1UYWH 4FOMA 4NCDA 2VZTA 4G6KH 5IHZB 2OSLA 3P0YH 4O58H 3TT3H 5MEND 3MLVL 4M7LL 4GW4B 1IEBA 1B88A 3VD5A 2OL3B 2VLJE 4I18C 5GZOC 4NM8L 3KR3H 4EDWL 4M7ZC 4S11A 1YQVL 5I66A 2EKSB 4TNWF 5C0AE 2YMXL 1B0RA 4JFZL 1M4KA 1BFOA 1E28A 5FHAH 4Z7UF 3OX8B 3NFPB 4MCZA 1BHGA 5CFHA 4PTTB 1A64A 5HHXL 2WMPA 3KYNB 1TTFA 2AI0H 4G8GA 3RWJB 1JYWA 1DQLH 1DE4A 3PL6B 4KTDH 5HVGB 4XPAH 5DD1L 4YHNA 2AK1L 3JTSA 4PJAA 2X1OA 5AZEL 5EORL 2Q6WB 4CDGC 3PNWB 3D2UB 2A2QT 4RGND 4JM2F 4XP5H 4J3OC 1BJ1H 4P4RA 1QSZA 3UROR 1A9EB 1H15B 5EC2B 1P6FA 5F9WC 2W0PA 4XPHL 2NXZC 2CR6A 4I13B 4X8JA 4XP1H 3MLYL 5FK9A 4ZFOB 1OCWL 4X9BA 1FZJA 4Y2DC 4IDJH 1WWWX 1KG0A 2VLKA 4M02A 1KEML 2E7MA 4NQEE 4XCYA 2P8PB 5FUOH 2BNRD 1K4CB 4LCCA 4Y5YB 3BIAX 5IW3A 3VFPB 4JN1H 4KMLB 4Z7OF 1A5FL 4OFKA 4JJ5A 4PB0H 5DLML 1F6LL 4XB8A 3PWUB 3NGBC 3Q3GA 3VRLF 4Y19D 1AIFA 3TC9A 4AMKH 1MCWM 2ZWLT 4PY8J 4TSBL 1IL1A 4TULL 3RUGF 1A6WH 2Y23A 4JPKL 1NFDE 3EZ8A 4O2FA 2C9AA 5HD8D 4NWUL 3TZVB 1IGFL 4MA3A 5EO9B 4Z6AT 3MYJA 3GIVA 3O45A 2DQIH 3VFMB 4X9FA 4YDVB 1T1WA 5T33L 5I75C 1MREH 1Y18B 5LGHL 2P47B 1BQHB 2B1AH 3ARDB 2J8UE 3DPBA 4JAMA 4MD0A 3QDJD 3KS0J 2PW2B 4J3WA 3QEGL 4U6YA 3HUJA 2A6KB 3NFSH 4FZ8L 5DZLA 1DUZA 2GITA 2NY0C 4ODWB 4MCYB 4WO4C 4LHUB 1RUAL 3MRLB 3L3JB 4MJ6B 1HSAA 4NKMB 1W2KT 4JFQB 2FIRT 3B2UC 2DDQL 5HYQB 4Q0XL 1Z9OA 4WNQA 4NQDA 5C09B 4LAQH 4GBXA 1KJ2H 1EH9A 1E6JL 2ZUQC 4KI1A 2P45B 1URLA 2R4RL 4NKDB 4HAGA 3RA7H 3DNKA 2ADJA 4S1DC 1SMOA 3QHZH 1NCCL 3KPMB 2R0WL 5DGRA 5FO9A 5IQ7H 4HGWA 1PJ9A 2MMXA 5ADPL 3F7VA 3T77B 2XPGA 2BXZA 3CD4A 5IEKB 4ZAKC 4YDJB 4L4TE 1KFAH 3VDAA 5HXMA 1FNEA 2GW5A 5CSBA 4ZFGL 2FLRT 1ZT4B 2WLYA 1HHJA 3RNKA 1HHKA 1Q8MA 5FIEA 4YR6A 4MSWA 2NXZD 1DQJB 1T66C 5E8NA 4C54A 3T0EA 3C6LB 3GSXA 1JNHB 2VLJA 3T3MF 2PF6A 3OKDA 3VU2A 1MJJA 4Y2DD 3QUMH 4JM4H 4ZXBB 1X5ZA 1JPSL 5JDSB 5C0AA 4L8SA 5TF1L 3TVMA 1HEZA 5IT2H 3CZJA 6FABL 1Y6NR 3D3VA 5F7EL 2P8MB 2JTDA 2HMID 1S7XB 3LPWA 3TNNB 1TZHA 3R8QA 3FHAA 4F8TA 1EK3A 25C8H 1M1SA 3I3BA 4FQCL 4GW1A 3ARFA 4J3SA 3V6ZB 2AS5M 1X5AA 2ZUXA 1OPGH 1LO4H 5F7DA 3G5XB 1KC5L 5F7LB 1AR1D 2J4WH 3LHPH 2PO6A 1G7JA 2FIKB 5C0IA 5IB1B 3RZWA 2DM4A 2DQTL 2VXSL 4PRID 3L9RB 3VXSE 1CL7L 4ERSH 4QTHA 2YXFA 3B9EA 2D0HA 1UB6A 4RWYH 4XGZA 4DKDC 4F37F 3S5LB 1EAPB 3ZYIA 4CJ0A 2NR6C 3ARZA 5FF6B 2NY0D 4WO4D 1U8KB 2DKSA 3OV6A 1OB1A 3BDYH 3VWJC 2RBLA 2N7AA 1F6AA 3SE3C 4NO0A 3N1PC 3QXVA 1CDUA 1IGCL 5C70A 4MNQE 3VXUE 1U42A 4OFYD 2V6HA 1MLBB 3U7YH 1BECA 3JV4B 4S1DD 2VC2L 4WHTB 1MUJA 2CKBB 4CMMA 3ARUA 4IHOB 3WSQH