4XX1E

Low resolution structure of lcat in complex with fab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
219
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Fab1 light chain
total genus 43
structure length 219
sequence length 227
chains with identical sequence H, M
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E01
2A0LC 4H20H 5B8CC 1IM9B 3T2QA 4HUVA 1UKQA 3O6FC 5EZJB 5GGQL 3UJIH 4UQ2A 4NQSB 4XWOD 4OD3H 2IANE 1S7WB 1MCOH 2YZ1A 5CKAA 1BECA 5CBEA 2HN7B 1R3KB 4JKMA 1BZ9B 3O8XA 4JPIB 2IPKB 4Z0XA 4JFDB 4MJ2A 3DHJA 4LLWA 5GSRB 4XCCL 1EPFA 2BVYA 2X6MA 4G80A 5DYOB 5F89B 1XGPA 3JVGC 3MO1B 1ACZA 4MQ7B 3T0XA 2BDNL 4GKSB 4XAKD 3W2DH 2HT2D 1A6ZB 3IETA 2JCCF 5FYKU 1KNOA 4H8WC 1DBMH 2PR4H 4DN4H 1U8HB 2R0LL 4KU1A 5D2NA 2VIRA 4PJCF 4QRRD 1I8IA 1FVCA 1CF8L 4S2SB 5ICZA 5IV2B 3MC0A 5D2LA 1OB1A 1A5FL 4K8RD 2EC9T 5H2BA 3U9UA 3T0EB 3P4OB 4G8GD 1Q0XL 1I8KA 3NGBB 1EJOL 4OBRA 1Q94A 5B39A 2W9EL 5LQBL 2UWEB 4LDEB 3BISA 4UAOB 3U0PB 3MLSH 3U7WL 3WSQL 2R69L 3WIFB 3AAZA 1AGCB 1DUYB 2R2BB 2PYEA 4PJBB 2C4FU 3DETD 1YEGL 3QBTB 2ITDA 2YPKA 5CJOH 5FK9B 5J1TC 3VWJA 1JF1B 1AGBA 2WIIA 3MJ9A 5DJ0A 1LNUB 4YEFA 3CNKA 5GGSB 4HFWB 3F7QA 5CFHA 1FGVL 1OCWH 3P3YA 3CX2A 2P5WA 1IM3B 2R1XB 3F65A 3BPOC 4GAYA 1OT1A 4HG4J 1IC7L 1KGCD 4KUCF 5GJTH 3UCRA 5L7XL 4OLWL 4U3CA 4ONHA 4M93B 2OLDA 5DC9B 3P4NA 3V52H 2YD7A 3VDCA 4YDLB 4LCWE 5ICZB 1MCKA 1MRDH 3KPSE 4ERSH 4CL7A 2EE6A 4LHUB 4H5SA 1ZSDA 4O58L 4J12A 2E9IA 3FQNA 2NY7L 1FH5L 5D70H 3VXNB 4ZPTA 4E41A 1DJSA 3E6HB 3STZA 1OP9A 1A47A 1JWMB 1S9WA 1CICD 4ONOA 3TYGL 5HHPB 3D3VD 5I0ZA 4YHZH 5DJCB 1WBXB 3VG0H 3F7YB 3ARRA 2H32B 2EDEA 1CU4H 5JO5B 2D7PA 3QO0B 1JF1A 5D1ZC 5E6IC 1JPTL 4GBXA 2OP4L 1QD0A 3QIBA 5ALBH 5EO1A 5C0IB 1AH1A 4OD3L 3PWLB 3NZ8B 2R1XA 3H7LA 1SEQL 1YN7B 1KCLA 2IJ0C 3CU7A 2E7BA 1WT5A 3V4VH 3WN5B 1A7QL 1FFQA 3E0GA 3GMNA 3GI9H 4HF5H 5F7UA 2ADGA 3JV5A 1T5XA 1GJIA 3HZVB 4RIRB 3X11A 5D6DA 1NCDH 4HIXL 1I7UA 1T1WB 1AGFB 3HI6L 1F3DH 4WU5A 3QDJB 2AJVH 3DWTA 1NAMH 3FFCE 5FOBA 4HIJA 1ZLVK 4OLXL 1QLEH 4QRTA 1JL8A 3O3EA 4PG9B 1AIFB 4BFGA 2HRLA 2ICEB 5F88A 1J0YA 4TVPL 5D96C 1VGKB 2Q76A 5HGDB 1A1NA 2FO4B 3IKCA 3ARDA 1ES0A 3WUWB 3UJJL 1YYLH 4RCAA 1U95B 1PG7W 3ROLB 2C9AA 1QNZH 4HX1B 3TN0B 1I8MA 3RWGB 2YBRA 1J0IA 3ARXA 3GMOA 1TZHB 2YRPA 4LDLB 4YFDB 1VEPA 4CMHB 4IHOB 3RA7H 2X4OB 2B4CH 4NNPL 2AJZB 43CAA 5HGHB 1UCBL 3TA3A 3FTGA 1JJUA 3Q5OA 5EWIL 1KULA 1MI5D 1YUHA 4RGOL 3PL6C 1ND0A 4NGHH 1FFPA 2R1YB 1Q72H 3CFBA 3VXMD 5CBEB 2NY1C 5CZVH 3MNZA 5EA0H 4EQ3A 3VFSA 4F9PC 4OTXH 5KANI 5FA4B 3MJ9L 2YUVA 4ZQKA 5DTFA 5C2BH 4P5MA 2CKBL 3NGBC 2PYED 3BRGC 4NT6A 1NPUA 1Z9LA 1YEEH 5DD6B 2EIEA 3PGDA 1CLZL 1T20A 2KQMA 2XRAH 5C9KA 3B5GA 2BFVL 2IGFH 1FH5H 5D70L 1IAIH 2X4PA 1JBJA 1QEWB 1P7HL 3U30C 3ZYJA 4K3DH 3C5JA 3D6GA 5BRZD 4PJXA 4QRPE 1F90H 1FNEB 5ICXA 5D5MF 1K6QL 3WJLC 3QR2A 1GIGL 4YFLF 3RBSA 5JXAL 1L7IH 3JUYA 3NAAL 4G9FB 1S5IH 2J8UA 1BQHB 1WSST 5I1CL 3U0WH 3BZEB 1FGNH 4YC2C 5JW5B 1EX0A 1H0DA 4FQJH 2EYTB 4O02L 1FCCA 3LKOA 4L4JA 5FYLH 1EEYB 2BC4B 3X14B 3GJFK 4N68A 4BZ2H 1P5VA 1CE1H 5T5NF 4PJAA 1KENL 2R0LH 1CE6A 5SX4I 1OW0A 4WHYG 2B2XL 2CD0A 4LQ1A 1KN4L 1NFDB 2GCYA 5CBAB 4JB9L 1KIUA 3BKML 1IBGL 3H9SB 3IFOA 3QUXD 1E0OB 4NO5A 1UXWA 4EN3D 5F7MC 2EC8A 4GW1A 2DMBA 1MCBA 2X4SA 1XIWD 4NOBA 1X5ZA 2BNRE 1YYMH 3AY4C 3MNWB 3IGAA 1AC0A 1U3JA 3ZE0F 1KTDA 2EEDA 5JDSB 3WDHA 4HLJA 5BJTA 3WIFA 2FJFB 1KEGL 4G42A 4G3YL 3DHMA 3MV7D 4ODUA 3MLUL 3HE6A 4LNRA 2CMRL 3ULUH 5F7LB 4WGWB 3VFSB 1P5UA 1QVOB 2J1KA 5FUCC 1ETZA 1L0YA 3G5XA 3MBED 1F6AB 4K07A 1CFVL 5D8JL 4XB8A 4PJAB 5DJZB 1K2DB 3CFCL 2F74B 1HHIB 4QHNA 3S34L 1HNGA 5I1GH 3AU1B 3VFPB 1A2YB 4FQPA 4QOKD 5C2BL 4Q0XL 4MVBD 2CUMA 3RY4A 4J1UA 2LTQC 3O2WL 1P7QA 4NRZA 4PJXB 3SE8L 2VDPH 3ARDC 4KDTC 3ESVF 1B2WH 3Q0HA 5L9DL 2CRYA 5T1LA 3L5HA 4EI6B 2Z9TA 5L6YH 4AG4L 1LO2L 1KOAA 3UTTA 4HC1A 4YK4C 3FKUS 1INDH 4AEEA 1GPOH 5B3NA 1FZJB 3T3MF 4JGJA 1AD0B 1VENA 4CU7A 3NAAH 3RI5K 4F2MB 4JM2A 5GS0H 4O2EB 4UV4H 4AEHH 4Y4HB 3DX6B 1L7IL 3HMXA 4U1LA 3WIIL 4KK9C 5DDHA 3R8BB 3QCUL 3GI8H 3WFDH 4MX7B 1QSFB 5FYLL 1E6OH 4P99A 1TVDA 5D1XA 1CXKA 4LSSH 4PJAF 5L88H 2AK4B 1J1OL 1G9EA 1QHOA 1BQSA 3QIBB 4PR5B 5EO1B 3QJFB 3PWLA 4Y2DA 3RGVB 3WS6A 1CXLA 2RCSL 5FGSA 2VLKD 4X7DC 5E7BA 2UVFA 1A9BB 3ET9F 4MNGE 1G1CA 3O4LD 1ZGLB 5HHMD 3T0VA 1WWCA 4YHLL 5C1MB 1NJ9A 3HZMB 4X6CE 4M4PA 3T4AA 2MPAH 3BPNC 1JZ6A 2PW1B 2ZOKB 3OXRB 2ZSWB 1BOGB 1U58B 4GQPH 4P4KC 1KEGH 3KHOA 1NFKA 5FYJE 3P9LA 4XP5H 2NY3C 3KPQB 3PP3H 4IOFC 4M9PA 4OJFH 5CILH 4PREA 1LEGB 3NIFF 1NGPH 2Q76B 4ONHB 5HGDA 4PG2A 2PXYA 4NIKB 4AK1A 3T1WA 4JFHE 4YHZL 1JHKL 4JY4A 1QFPA 1G7PA 3QJFA 5DJYA 3MLWH 3SDAA 5ESVB 1IAOB 2RFXB 3MOAL 4MAUH 2Q7YB 4WEBL 1JNLH 4JO2H 2P43B 4GG8A 3K0WA 1SMAA 2VQ1A 4FXKA 3V6OA 2AP2A 1HSAA 4IIQA 3EYFA 4JDZA 4P46A 2ORBL 3ARFA 4LBEA 1EHLH 4F33A 4KMTH 3VD3A 2DDQL 2YWZA 4AEIL 3FB5A 3RWFA 2EO1A 3NPZB 3RX8A 4WHYH 4GRLC 4G7VH 3BD3A 4HZAA 1ZEAL 4TTGA 2E9WA 1NCBL 5FO9B 2EDXA 1AR1C 3WFEH 1XF5A 2OSLA 3B9VA 5E6ID 5I30H 5MEND 3IVKB 1EFXA 4MXVE 3H7BB 4N0RA 1HH6B 1T22A 3CDCA 4Z7UB 2MSPA 3PDOA 3ARUA 2NLJB 3WKMH 3ARYA 3ZDXE 4DUWA 5DRNB 4ZXBC 1KCUL 1X5HA 3LEVH 1TLKA 3KLSA 1AQKL 1EZVY 3MV01 3L3IA 4CU8A 1XF1A 1A64A 1LDPL 2X1PA 1ZA3B 3EHBC 4Y5VA 2OZ4L 2JIXD 3LHPH 4WU7B 5EC2A 3WFZA 5DRXA 3T08A 5I71B 3QULA 2BY0A 2GTZB 3HMXL 3J8F7 3U82B 2VL4A 3PP3K 4MD5B 3TBYB 3VFOA 1MNUL 3QRGH 1C12A 1T2XA 3OAYH 5I1JH 4UDUB 3SKOB 3GGWB 4H1LA 2I24N 1S9YA 3TLRA 3N9GH 3FT2B 4I2XB 1CFQB 2CRMA 3PWNA 1IC5L 1DQQB 2EE3A 4I48A 3UTZA 1MCDA 3SE3A 3LKSA 1MHCB 2X05A 5EO9A 3P30H 5BS0E 1OTUD 3DVIA 1TETH 4NO2A 1YEEL 2BY3A 4XP4L 2VZSA 4MJID 3MLZL 3SGDH 3NACH 1Q8MA 4GLRH 2LAGB 2IQAA 1EMTH 2VISB 2O5YL 4BYHA 4L5FL 3FFDB 4TSBL 3MUHL 25C8H 2HRPL 3TP4A 4P3CH 2DQCL 3S4SA 1S7TA 3RZCD 1SM3L 3G6AB 3CC5B 1MY7A 1NANH 3O6KH 4X5LA 1NGZA 3QDMB 3SGKC 4H25A 4MA7L 4L9DA 1GGCL 1ZT1B 3BO8B 4PP1D 3RWCB 1TIUA 5I18H 3TNMA 2ERJB 3SDCB 5HYSG 3VD4A 4HQQH 3G5VA 4BJLA 2EDKA 4BFIA 4YAQB 2EDOA 4OFYD 4OFIA 3GJEB 3KWWB 1P4BH 4ZYKB 2RAMA 1UH2A 1IAKA 3HE7D 3EOTH 3NA4A 4YC2B 1IEBA 1RK1A 2JE8A 5B3JE 5IMOB 1KT2B 1JHTA 4K55A 4JZNA 5A1AA 1YEIL 2FX7H 2GAZA 2AV1A 5IR1A 3L3JB 3A6CL 1DBKL 5ELIA 2GTWB 4KUZL 2GITA 3ALPA 4LLDA 2BVPA 3HPJB 1F2QA 3B9KB 2CQVA 4OLEA 5ICYB 4NT6B 4N8VB 4J7RA 1NAMA 5J9PB 1KTLB 2GSGA 4HIIA 3MRIB 2W9EH 5LQBH 5I8EB 1LP9A 2NTSP 1MJ8H 2X41A 3MUY1 1J1OH 1BJMA 4ZO8A 5T5FL 1L7TH 2A74B 2D0HA 4XCYA 2H9GA 1OP5K 4WHTA 4MA8H 3KPSA 1D5MA 3OX8A 4PGBB 1JUFA 1EH9A 3BEWA 3WS3A 4XBPA 1H3GA 5E56A 3EYQD 1QSFE 2VAAA 4GSDH 1PYWB 4JZJC 5I76A 5TJWK 4GMSL 4L29A 3RQ3A 2JF1A 5C0AA 4O2CB 1NFIB 4PBXA 4PRIA 1Z9MA 3MRBB 4J8RA 1BPVA 1A2YA 3GM0A 1O7VA 4RQQA 1HDMB 1UZ6E 2X44D 4Z77B 3N1FC 4F3FA 2PXYD 3D2UA 5FO9A 1DN2A 4WV1A 2HP4A 4P3WA 4OB5L 2EH7H 1JN6A 1T1XB 5I1HL 1K2DA 3QEQA 2C5DC 5E2VL 3MV7B 5CJOL 2FX9L 4A6YL 4DVBB 1U2HA 1KSRA 2OL3H 1F13A 3WUZA 1GGIL 4XC1L 1JFQL 1J1XH 1CTNA 4LFHG 1MHEA 2ITDB 2ICWJ 3QEGH 4YX2H 1A7OH 4WFHE 5DF0A 3WL9B 4MA7H 4WEBH 2NY3B 1BGXL 4F7PA 3U7AA 5JPMA 4QTIH 2X09A 4RBPK 5E95B 4OT1H 2UWEA 3GSNL 4MJIE 2DQUL 1MFBH 3H9SD 2IG2H 1FBIL 1RUAL 1ZV5A 4MCZA 1UJ3C 5D7JC 1CGXA 1EEZB 3QO1B 3SDDD 2X4QA 3BAEL 3UXFA 3EW3B 3V0AC 1AGDB 3IDXL 4GG6B 2P5WD 5ID0B 5TFSL 4GQ9H 1OARL 4K3HA 4K7PY 5DJYB 2HA1A 4HLZG 3HZKB 4F2MA 4XWOC 4WV1B 2DICA 1NUNB 2XA8H 1LDSA 4PJ5D 1FNAA 5CJ8A 1RZKC 5GGRB 3B5TA 3KLAA 2DAVA 2YK1L 5EU6A 4H88L 1KUMA 1NANI 1U8HA 2QQNL 4GRWE 5IQ7H 4E5XA 3D3VE 5SX5K 1VCAA 1R0AH 5D1QA 3FQRB 2JIXA 2FEDD 5GRUH 4CW1B 2PW1A 2ZOKA 1JI1A 1Z9OA 2P46B 1WZLA 3HC4L 2Z31B 3V8OA 1QNZL 3F5WB 1X9QA 1T2QL 2WNGA 4R26L 1LEKB 4WFGE 2CSPA 3B9KD 2YC1B 5TDPA 1H5BA 1NGXA 1T6WA 1ZGLP 3L3OA 1RZJL 4LLYA 3DRTA 2R0WH 3CVHA 5T5NG 2FNBA 3SDXF 3KJ6L 4Q6IB 3UMTA 4QWWC 3TPKA 2M26A 1QPPA 3TH4T 1N6VA 4UV7L 5EN2B 3S37X 2C1PA 3D39E 5C09A 2R1WA 1Q9LA 1H3XA 3TO4C 3BH8A 4LPTA 1SVCP 1CDHA 4JFQA 4KAQH 1QZ1A 1CZ8L 3A67H 3EKCA 4LKCB 5DHVH 5KBNC 3IDIB 5EU4B 1DQTA 4QGYA 2GK0B 4YPGA 4LLVB 5I1HH 1LE5B 2AABL 4K3EH 2CDGB 3MV8B 4NQED 4YH6A 3BPCA 3ZTJH 4P48A 4PBWD 3WDIA 5DZNA 5AD0A 2XWBA 3FT4B 4KMTL 1FZOB 3KVQA 4ZNCD 3GSQA 1J1XL 3RVUC 3QDMD 3VE0B 2FECI 3U2SA 5LKNA 5DFWH 1XT5A 1A6ZA 3IETB 4I77H 2WWKO 4YHPB 4MQTB 2P47B 4KRLB 4NSKB 1TJIL 4OGXL 2BSRA 3BSZL 5E6ZA 3UDWA 3EFFB 4HEPG 4XAWL 5KG9A 1OAXL 4TSCL 3CZFA 2EDBA 4P4RA 5F6HI 3WIHA 2QV2A 2VJXA 3F62A 4F57L 3X3FL 1ZANH 2PW2A 1BVZA 4ZUSA 2DBJA 1JPFB 4GOSA 3C6LD 1BP3B 4YHML 1IGIL 3MV8A 1XF3A 1TCMA 1A8JH 1BFOA 5DJDB 5DR5H 4PIRF 1DSFH 3INUL 1GOFA 3AS1A 3UPCA 3PGCB 5IM7A 5E08L 1TCRB 1K6QH 2ILLA 4XVTH 1E4XI 5GPRA 4JB9H 1G7QB 2O5XL 2FWOB 4AH2A 4IJ3C 1FE8L 2GCYB 4FQIL 1LE9A 3E1F1 5KSBB 1E28B 1IVLA 1FDLH 2VLKA 2VRAA 4AIZB 2GJZA 4GFTB 5MEOB 3QFJD 5C0CD 4X6CF 5IEKA 4X6BB 3VW3L 4MA1B 1DDHA 5IK3A 3TVMC 3LRSB 5SWQA 1L7TL 2XG4A 1S7UA 4XCEB 4F58L 2FX8H 4PJHB 1RI8A 4N0YL 3AREB 5C8JB 3CFEA 4X7TB 4J6RH 4KKLC 1F11B 3JVGA 4NWUH 1EFXB 5FIEA 5FECB 3IFPB 4KJPD 3TZVA 2ZJSH 4KJYA 4LHQB 5D1QD 4AQOA 3L7FB 4JDVA 5HHME 5TDOA 4MSWA 3CVHL 1KJ2A 1IAII 4XX1E 2EZ0C 3MQIA 4YZFE 1OAYL 4ZAKA 3BUYA 2XV6B 5EZIH 1QSZA 4M1GH 1MFCH 2GFBB 3S36L 5D96B 2ZUVA 4NHCL 3EDKA 5ALCH 2B1AH 4PJ8D 1MFNA 5C0GB 3ZDZE 1F5WA 3U6RB 1J05B 2H8PB 1OAQH 4LP5A 3ARGA 4MNQB 1EAJA 1KTDB 4Y19E 3TN0C 2IBBA 2Y07L 4U7MA 3PGDB 4NQDA 1MCEA 2EXWC 2HG5B 3EYOA 1DQDH 3SKMB 4TUJA 4PJDF 1DE4A 1A7OL 1AGBB 2WIIB 1FVEB 5DJ0B 5E8OA 1MHPL 1OAKH 4KC3B 5HHQB 3IDNA 3KPPA 4GAGL 5LXGH 4JGMA 1FLRH 5FYLE 4JZOA 1RIHH 2UZIH 1LEKA 5AG8A 2YA2A 3X17A 4HJ0C 4L9LC 2JCCB 5HHOA 3WLWC 4OGAD 5JHDB 2X10A 4FQLH 1I4FA 2GJ6A 3DRTB 1RK0A 4NKOA 2IMNA 4XXCC 4DGVL 4PJFE 1JV5B 2XY2A 2P8PB 2V9QA 3L3DB 3MLRH 4HC1L 1X7QB 4MCYA 1D5XA 5DEGB 4APQC 3BP5A 3DSFL 3KYOA 4UIKH 3MLVH 2ZG3A 2J4WH 4EJ1C 4ZOBA 1K5NA 1UM6L 2DQFA 1XGRB 3MXVL 1I9IL 1OD9A 3ABZA 3BOVA 5DD3H 2SEBB 5IW1B 5I0DA 1NLBL 4Z5RB 5BVJB 1WJ3A 1BFVL 1A1OB 3HC0A 3WIHL 4YEEA 5J8OA 2DYPA 4Y2DB 5D93B 1NJ9B 5HHOE 4ZFZB 3U30B 3ULUC 3KPOA 5DURD 2ARJA 3P73A 3KJ4B 3GZKA 1A9BA 4MDIB 5GHWL 2FGWH 5F7FA 4TN9A 4FQQA 1PQZA 5E94A 3FB6B 1HYSC 4PGBA 2HT3C 3IKKA 4JO1L 3OXSB 1Q9KA 5JXEA 2GYSA 1VGEH 2MOVA 2YR3A 5TF1L 4NFBA 1LK2A 4LSVL 5C6TH 5KW9H 5DS8B 1I1AC 2FEDC 4NFCA 4O5LL 3OKYA 5JOEA 3AC0A 5FYKL 4G6ML 5D1XB 4NJ9H 2NY6B 5GJSL 4UOJA 4ETQA 2VXUL 5D6DC 1T0MA 4DEPB 5T3ZL 2IPTH 3NCJL 3V5HA 4O2EA 3LN4A 3IJSB 5ITBH 4LPUA 1IGCH 4XCNA 1FZKA 1ORQA 5C0DB 5EU5B 3CDFA 3UJTH 4Z7NE 3V79C 1AP2A 2H8PA 4AQ1B 1H5BB 1NGXB 5F9DC 3RZCA 4HV8A 3OKOB 3TBWB 3LRGA 3LMJL 1T83C 4YGVB 1KELL 3VXUB 3DUSA 2WUBL 3STLA 4UT7H 1BVKA 1PQZB 4BK5A 3FB6A 3KXFE 1M7DA 4LGRB 1B0GB 1KJVA 3LPWA 4FQ1H 3W9DB 3MV7E 4PB0L 3HB3C 3OKNB 1HWGB 3RWHA 3HFML 3VG9C 4ZUTA 1MHPH 1U8QB 5HXMA 4U1KB 1BD2D 2NXZC 2CRIA 1OOAA 2AQ1A 5D2NB 5IJVB 5DC0A 2ICWI 1HHIA 1P6AB 4OZHE 3VFTA 2YXMA 5I1KL 3ARZA 3AU1A 1RK0B 4G6JL 5CP7A 3CD4A 4PJIA 1KCVL 1MRFL 1A0QL 1MCCA 4ZS7L 2K3TA 5L2JA 1J0KA 4TSAL 4QRRA 4PY7A 3DGGB 3ZT5A 1MH5A 1DN0A 4LPYA 2V2TB 2VXSL 1X5GA 5DJ6B 3RVWD 3QUMA 3WHE0 1TTGA 2A1WH 4HWZB 4K7FB 4R4FH 1XGQB 1T4KA 4P2RA 1IGFL 1BBJB 2FGZA 4MX7A 5F1SA 5IGXH 4TUOA 4ZDHA 3L7EA 1BQLH 4G42B 4GAFB 3U0PA 1FFOB 3WFHA 1IC1A 5ALBL 4YR6A 4LIQH 1NKOA 3SCMA 3JV0A 4FOMA 1NC4A 3CCHB 4ALAH 3IDYB 5IMKA 4WUKH 1Q0YL 1T66C 1NCWH 3G08A 2OZ4A 5DVLA 3GBML 3HUJA 4KXZI 4GO6B 3QUKA 4R0LB 4UT9L 3BXNA 2XA3A 1UA6H 3GHBL 4JO1H 5IFJA 2AS5M 4Y4HC 2DS4A 4OZHB 2V17H 3LKOB 2X7LA 3BJ91 4AMKH 3RAJL 2HT4D 4FFVD 2H26A 1K8DB 4FMKA 4HW6A 1T22B 4P9HH 4DAGH 1BQUA 5HDBF 2IQAB 4NZRH 4KDTA 5EOTA 4JFXA 3IU3B 1RZKL 4FHBD 5FUCE 3D1MC 3NN8B 3I50H 5AAMA 5CEYA 5ITBL 3L3DA 1FZOA 2N7AA 4WI8A 4G6FB 3IS0X 4X5XB 2X4UB 5EZJA 1JNNH 5F3BA 5C07D 4YHYC 1JIBA 2IBZY 2QEJA 1PLGL 5DUBB 1OAUL 3GSXA 4LLUA 4Y16A 2HLFC 4NUJA 3WO4C 2F53B 4KGLA 1TETL 1XGUB 5I9QB 2ZPKH 4N8VG 3PIQA 1Q72L 3TH2T 1RUQH 3O6FB 1I1RA 1KIQA 4M48H 4XVSH 1CDIA 3HC3L 2WLYA 1P1ZB 5D1XC 1DLFL 2IC2A 3U79A 1I1AD 2J8UE 2BMKB 2VDNH 4L8SB 2OK0H 5C09B 3G6JA 3VXMB 3EYSL 4GXUN 5C0ND 3OQ3B 4XNMB 5IG7B 3NCMA 2ZUQC 4JO3H 5HGBA 1MRCH 2C4FT 2FHFA 4Y4KC 5JW3H 1C08A 4WCYH 4JFXB 5FUZL 2VLJD 3GSOA 4KZEH 2JTDA 1U42A 3TN0A 5KVGH 4OZ4A 1F3JA 4JN2B 4ODTL 1RFDL 2NXZD 4B41A 5E24E 1G9NH 1D5IL 3QUZC 3MCG1 1BMGA 2HJFB 5L9DH 4P3DB 5D5MB 4RZCA 1K3ZA 2BNQD 1F11A 2FECL 4HKZA 4PJ5E 2HKFL 2R2CA 2XFXA 3HI6H 1FG2A 4IRSC 4EKXA 4YHPA 1BVLB 1LO4L 5JLZA 2PYFA 4I9WD 3RJDA 3VFUB 1NCWL 3QZWB 3B5HA 4JRXE 4R8WL 4LCIH 1M7DB 3JUZA 4XNZC 2Q8BH 3RWEA 4X9GA 4F8TA 1KJMB 2W60B 4KHXL 3OR6A 2R23A 2VQ1B 1IL1B 4NQXB 4IRJC 5IVXB 2AEQH 5ESAB 3W0WE 1KENH 1YMMD 1MUJB 4LBEB 1L0QA 1HXMA 3IXAA 4H1LH 5J4MA 3FONA 2E6QA 1N6UA 1QSEE 1E6JH 5DWUL 2OL3L 1UCBH 1RZKH 1L9NA 3ARPA 2HTKC 2W0KA 1WT5C 1HSBA 1NBYB 3OPZH 5C07B 1MHEB 4Z78A 5C9JA 2VXVH 1LHZA 4LSUH 3TC9A 1Q1JL 4S1RL 5FCUH 5BOZG 3CXHJ 5B3JF 4OZIF 3QQ4B 4KH2A 1QFWM 2H32A 3MZTA 3FFCA 1T21A 5DQ9B 1OTTC 2Z35B 3JTTB 4U7KA 4XPTL 3MRLB 4A6YA 4FNLH 1KYOK 2CMRH 1T80A 1T0NA 3VCLA 2ZSVB 4OJFL 2IAMA 5DMIH 2YA0A 3KAAA 2VZTA 3QDGB 2AJUH 5BV7C 2B4CC 3WJJA 5CGTA 3IJYB 3PG2A 4GAYB 3ZLQC 4HKXA 2Z93A 3HI1A 3PXJA 2IQ9H 1D5ZA 1DLFH 4NFDA 1C5BL 4G8FA 1H8NA 1EV2E 1N7ML 3LQZB 2NY5H 4KRPB 3MREA 3TV3H 1DLHB 5E9DD 3WIHH 5GGRA 4UI2A 3BZFB 1JNLL 4CVWA 1G9ML 4KTEL 1AGEB 1D5BB 1G0YR 2Y23A 3W5NA 4PGDB 1T1ZA 2DQUH 2RJMA 4QGTA 1JZ2A 1MRCL 4UU9B 1X5LA 3UAJD 3W5MA 1U8MA 2OMBA 1MLBA 5EOQL 1D9KD 1ODAA 3GSVA 2HJLA 5C0BB 3MRCA 1G9MC 3BIBX 4P0DA 1L4IA 1S7VB 3T4YA 5L6YL 3LKRB 3LQAH 1IRAY 3TYFA 4XPAL 1KB5H 1SYSB 4FZ8H 1QBLH 4P59L 1WTLA 4IMKC 1ZLWH 4N5EC 4NO0B 4PJIE 5GGUB 4M93C 5L8LB 1EIBA 4AEHL 3A6OA 4ZS6C 2KUTA 3IF1A 2R23B 4FZEL 2F5BH 4Y19B 1NAKL 1YA5A 1XGTA 1KCKA 4MMZC 5IB1A 2IAND 4XRCA 1VEMA 3PF2A 2VDOH 3C8DA 2YSSB 4J23A 4CUCA 1WCBA 4MB3A 1U41A 3MRNB 4KHTH 5CIPB 5FKAA 1CL7H 1AQKH 2FRGP 3NCYS 2MKWA 2MWCA 1LO3L 5EU6D 3LKQA 1WZMA 4CVZA 3OKEA 4RQQB 2E7LC 2ZUYA 4NRYB 3BGMB 2YWYA 1FL6A 3BN9C 4UQ2B 4HS6A 4CMMB 4LKXA 4Z5RA 4WNQA 3L5JA 5ISZD 2ED7A 4YXLL 1XCTA 1W0VB 2W0FB 4WO4A 1EBPA 3KDMB 5K9OA 3V8CA 1H3PH 4F7CA 3VXOA 1B4RA 4XVUC 1WBYB 1QSFD 1P7QD 3WS6C 4WI2A 1UB5B 4Y16D 4HFWA 4Y8DC 5TQ2H 5JUEL 5IMLB 1CFTA 3C5ZA 3BDXA 3G5XB 4ZS7H 4Y4HA 2KPNA 2OL3A 3VA6A 1DFBL 2YPKB 4Z7QE 3EOBB 3SKUD 4OD2A 2MTPA 1LO0L 4XAKE 5FYKD 4G5ZL 5JIIA 1QLRB 2ADIB 5JQ6L 1Y0LB 4NO3A 5T1KB 2B8OT 4WDIA 1QLEL 1KTLA 1WZKA 2GSGB 5IBUG 3L9RB 3PWJA 1F4HA 1CGWA 4ACPA 3PIQB 2R0KH 3T2OA 3HG1B 1NDMA 3G04A 2Y36L 2CJUH 3UZEA 3UJJH 3N1PC 1FSKB 2UWEF 3UJIL 1U6AL 4NRZB 4ELME 1LK3L 4PG2C 2EEBA 3V6BR 1AI1L 4OIIL 4AG4H 3IDGA 3UDWC 4BKLA 3MXWL 4V1DD 3O6LL 2Z4QB 1LO4H 3D39B 3FQUB 2OP4H 3NCCB 3PQYA 4ISVB 4RA3A 4U1GC 4WY7H 1HKLL 4QHLB 2MHAB 1IKFL 4IRSD 4NKMA 4Y2DD 1OCWL 3FQRA 5JNYA 3MA9H 4JM4H 2I26N 1YEKH 5F7EH 1F3DJ 2X7LB 5B22A 4NKDB 2ESVB 5SWQB 3MUZ1 2Z8SA 1MJ7H 4Z8FH 3I3EA 4F37K 5C70A 1HOCA 5BMFL 2A9ML 3BJLA 1WLHA 4WW2B 5EO9B 2OBGA 4JFDE 4C54A 3QIUA 4MZ2A 2DB8A 5J6HA 2NW3B 3KPRD 4NO0D 4Z7WF 3NH7L 1UB6B 2HKHL 5DD1H 2VDOL 1AQDB 2MFNA 4U6VH 1YPZB 4OZGB 1FL3B 3B9KA 5AYUL 1JGEB 1Q1JH 1BBDH 1BFVH 3ZKSD 4WGVB 3FN0L 4LAQH 2YPLE 4YXHL 4PJ9A 1N8ZB 5DA0B 5GSVA 2GT9A 5D7JA 1G6RB 1PG7H 5FM5O 3TJEL 4UUJB 5CSZA 2H6PA 3EUUA 2ZCKL 3QFJE 4K8RC 5C0CE 5CBAA 2VR9A 1FIGH 5K33A 3MTRA 4HF5L 5IB4B 3OPZL 1WBZA 4KRPD 5ANMA 1AHWA 1G7MB 5SWSD 4OZHF 1J10A 3O8XC 3DV6A 3RU8H 2NY5L 4HJJH 4FNLL 4YGAB 2D31B 4IRZL 4NJ9L 5GJSH 1QUNA 1UXSB 5KG9B 2PO6B 3NACL 4HGWB 5F72S 3BZDA 3RNQA 4JFZL 5EZOH 1EFXD 1T0PB 3TGXA 5J13C 3BDYH 5LCVH 3KPTA 2XZCH 3KYNA 3TYGH 2XRAL 3DVNB 5HSFA 5C0EA 5F1IB 5IT2L 1V3JA 3MRNA 5FKAB 1X5IA 3ARDB 7CGTA 3MCKB 2FEEI 4MJ4A 1X4ZA 2VLRE 4L3CA 2HFFA 35C8L 3VXRD 5EULV 1PAMA 1DEDA 4HULB 1YQVL 3QFJB 5C0CB 1U36A 2NZ9D 2BRQA 3Q1SH 5JHLH 3PL6D 2WP3T 1N0LA 1U3HA 4HS8L 2W0PA 5IHBA 3WNNA 1OAZH 3MOBH 1BIIA 2ZUXA 1VKXA 4C83B 3GMRA 2IAMC 3PWNB 4KKCD 3WKML 2AK4A 1FYTB 4QY8A 5GGSA 5JA9A 2UYLA 5EU4A 1A6UH 4HXAL 4NZJA 4YXKL 3SKOA 3GB7B 4S1SH 4RWYH 1TZGH 1JWSB 1S7VA 5ESQA 4EQ2A 3LKNB 1VFBA 3BZFA 1YEKL 4V1DE 4Y5YC 1WZ1L 5KVDL 4U6YB 1CXEA 3A6BH 1QSEA 3D25A 2P5EE 4HFUH 4M03A 2GI7A 3F7YA 4ODVH 3WEXB 4F7TA 3OAUL 1O7SA 3DX8A 4KTYA 2H2SD 2IH3B 3NIGE 3QXAB 4OIAA 3DO3A 4P9HC 2IGFL 2FJGB 4MHHG 1U58A 5KZCB 4Z76A 1F8TL 3REVB 1SJVA 2WINA 4KHTL 2DYPB 2QHRH 3BHBA 4I0PD 1A21A 1P4IH 4S1RH 1F4WH 1RD6A 3MRLA 4A6YB 1H3UA 3FHQA 1AO7B 2L4OA 2DQFB 5D2NE 1FRGL 5IB3A 1EEQA 3GMLB 4RBPH 4DW2H 5BV7L 2VLJB 4HAGA 3P30L 1S7WA 2BNUA 1KJ2H 3KPNA 4M8QA 1DQJA 4LSPH 3QDJA 4HSQA 5GRYA 3TJEH 3FFCB 3T65B 1PG7X 1YY9C 4ZXBA 4XCCH 3S7GA 3DRQA 3MZGB 4GMSH 2X4QB 4NQEB 3O3EB 3FT3A 3QEQD 4MNHB 2FHBA 2JB6A 1PW3A 1FNFA 5DUPH 3WEXA 4HS3A 1DBAL 3DX8B 5DC4B 3V6FA 2FJFA 4NM8L 2DTSA 3O6FD 3RNKB 4KQ3H 4LLDB 4LSQH 3WNMA 5I73B 1AI1H 4OIIH 5BZDB 4JFQB 5EDXA 4LNRB 3KXFD 4XPBH 4WFGD 5I1GL 5JQ6H 5DS8A 2AV1B 1EUUA 4LASH 2IH1A 4D3CL 3IAQA 3TT1H 4FQXC 4DFIA 3HPJA 3BH9B 3I50L 5E70A 2R0KL 4ZUVA 2XZCL 3BPLC 4NZTL 1ZHKA 2EXYD 4ODWA 4G6FD 1E4XH 1T5WA 3MGOA 4YBLC 4CW1A 2DLHA 3PDDA 4OZFA 3QEQE 4YO0A 5ACLA 1N2RA 3KPLB 3FRUB 2GJ6D 4QRQA 4EI6A 4R7NA 3HC0B 4EBQH 5T3ZE 1EHNA 4PLKD 2ATPB 3P0VH 4JPIA 4BFEA 3RJQB 4AIXA 4MQXC 4HDIB 5DYOA 4R0LA 4U6VL 3CH1B 4PJ5B 4YBHA 5JPNB 3QXAA 5LWYL 5FO8A 1WFOA 1H3WM 2CLVB 4P23A 4NN5B 2P5WB 3LKPA 4NCC1 5JOFA 4R97B 5ERWB 4YHOH 3MV8E 3SDDB 1L0XA 5GRUL 3WFHB 5D72H 2HKHH 1MVUB 1SBBA 1Q0YH 2AJ3B 1UVQA 4XNXH 5GXBB 3OG4B 1E4WH 3NTCH 1G7QA 4Y2DC 5D93C 4NO2B 2GUOB 4PRHA 1S7QB 4QHMA 5EBMA 1BBJA 4G8GE 4U0RC 4BSVB 3UTPD 1DFBH 5KVMC 5JPMB 1IJ9A 4L9LA 4NNYB 3KYKH 3VGEA 4WW2A 3MGAA 4MXWH 5IHLB 3G9VA 2FSEB 4OB5H 3Q3GB 3OJVC 4UV4L 3CGTA 2FD6L 2VWEC 1YMHA 4IDJH 4UZGA 3D9AH 1ZHNB 4ZTOH 5HVHC 2AQ3A 2DBLL 3MYZA 4JN1H 5CJBA 2AEQL 4YDJB 1A3RL 2GTZA 2C7UB 3B6SA 5HGAA 3UYPA 4HWBH 3O6MH 3B83A 4OKDA 3TM6A 1FSKC 4U1NB 4RFNB 1KN2L 5DVOA 4Q0XH 1CE1L 4KJPC 5DQDL 2D31A 5E9DA 3FZUD 1HXYB 2JJVA 2AJYL 1GGBH 4JFOA 4L3EB 4DEPC 1S9VA 4C59B 3QJHA 4XMKL 4Z6AT 4PRNB 2DD8L 1IM9A 4LPVA 5IROA 2B1HH 2H3NB 1J8HA 4N0UA 2DQHL 3D39A 2EDLA 3FQUA 5C09E 3WUWA 4RMTA 4KGJA 2N1KA 4OCLC 1MREH 4HWEL 1YYML 3K8KA 1FNEA 1CBVH 3F58L 4P46C 3SKJH 4CVXA 3L3GB 3GSUB 2PO6C 1N4XH 2K7PA 2B4CL 4NNPH 2VLMD 3AXLA 3W9EA 1IZJA 5E2UH 3O2VH 1A3LL 5IKCB 2OL3B 2F58H 5D1XD 2EIZA 1T89A 5ITFB 3TCLA 1QLRA 2ADIA 1QKZL 1IGIH 1QBAA 3P0GB 3NMEA 2VXTL 3MJ7A 3O2DA 5KTEH 2QHRL 1N7MH 4JHWL 4F7MA 1TFHA 2AXGA 4FQXB 4XXCA 1ZLWK 4CKVX 4NC0B 1YUHB 2OZ4H 4QRRE 2CKBH 1NSNH 3OKLA 1CICA 4POZD 1HCFX 4C4KO 1IQWL 2YHGA 4U1KA 3PWPD 4XPGL 2O5ZL 1FDLL 4NJAH 1GC1L 3O2WH 1N5AA 1BFSA 2GIYA 1CIDA 2PETA 2UY6A 2V7NA 3GI9L 3CDGB 3BHBB 3QHTC 4WTZA 1MF2L 1XF4A 4Y5YB 5E5UB 3CFKA 4QHUB 3P9MA 1PEWA 4F37F 3VWJC 4IRJD 1HK6A 4O51A 4TULL 1MIEL 2BCKA 1ITCA 1RVFH 2J5LB 4G8GA 4RFEA 1ZGLM 3IKCB 2I9TA 4ODHH 1MHCA 3WD5L 1PZ5A 4MNGB 2BZDA 4LOUC 5GS0L 1A5FH 1A6AA 4LP4A 4MJIB 5JHDD 1I85C 2X70B 1WUNT 3O0RL 1JI2A 5TH2B 3RY5A 4X5WA 4NKOB 1K4CB 4ETQB 5ISZE 5HHXL 5J13B 4J3XA 3VGBA 4YIQA 4R0LC 1IGCL 3T3PE 1RZFH 4U1JB 4K7PH 1DVFA 3P77B 2R69H 3O3DA 3MV9B 4GW5A 1X5XA 4M1CD 1EZVX 1VFMA 2B1AL 3I84A 1EHAA 2WBKA 1NEUA 1YY8A 3SJVB 3T1FB 3BWUC 3I6LE 2QKIB 3O9WB 2OS7A 3QULB 5DHVA 1S7SA 3BVNA 1DQDL 3BEVB 4TUKH 1MLBB 1KLFA 1GGBL 4NQCB 5D7SH 3O81A 5ERWA 2VR5A 3VFOB 3HG1E 3NPSC 3WJJC 3O11B 2NYYD 3O3AA 2MQ3A 4LCWD 2Z31A 3B2UD 4NUGL 1BAFH 3EBAA 1D7FA 4JPVH 1SEBA 3WXVH 1ADQA 4KROD 4HH8A 2WBJA 5LBSL 1UH4A 4Y4FA 2HFGH 2IAMD 4JFPB 3FCTB 4X7CC 4OF0A 4P2OC 3IYLW 1Z5LB 4Z7VA 1TTFA 5I1EH 5EOQH 2P4AB 2BFVH 2J4WL 2P42B 3HZKA 4HUNB 1IT9L 5E99H 3T09A 4EOWL 2BVOA 1LGVA 3S34H 1UFUA 1VHPA 1MJ8L 1EEZA 4AL8L 4GJTB 5T1MA 2I25N 3LKRA 4JGUA 1FVEA 4HUKB 4XBEL 4Z7QF 3O2DL 5D7JD 4M7ZC 1T7ZA 1GIGH 1NCAH 1OF2B 2VLRB 3S88L 2XWTA 3LEXA 3VFRB 4NQCE 5CD5C 3QQ3B 1N3NA 4OUUB 5E8OB 3SDXA 5BZDA 1NCDL 5IWLA 3P4OA 4X6DF 1HXMB 3IXAB 4LSQL 5JDSA 1WAAF 4ZUWA 3EOAB 1FNSH 4WHDA 3ZHLA 5DFVD 4XP4H 5TDOB 1OSPL 4ELMB 1MJJA 5I73C 5ALCL 2VXUH 4X4XA 2K1MA 4GW1B 5IVZB 3HNTH 2X4RA 5F7HA 4LCUB 5HI3D 1XGRA 5IW1A 1TTUA 3MODH 3MMEA 4WO4C 3L1OH 4PRBA 4YXLH 3BKMH 1IBGH 4J8RB 3U9PH 4I0KA 2D7OA 1RIVL 3UZVB 4HK0B 1F6LL 4D9RE 2AEPH 1A14L 3B3IA 3REVA 5D71L 2Z35A 4KPHL 1JWUB 5EIIB 3MPCA 4OI9A 4Q2ZA 2MHAA 3QI9A 4QTIL 5FEBA 4JREC 1CFSA 4ZUUB 2L0DA 2PN5A 5FDWB 1KFAH 5AD0B 3P4NB 4DCQB 4PGCA 4XT1C 3FOLB 5DVKA 4RAUB 1R3KA 3VDBA 4Z0XB 5HYEA 2FWOA 3HFMH 2NZ9C 5GGVH 4AH2B 2E5EA 4PJ7F 2X9XA 1NMAL 1O0VA 3HRZB 4BQ6A 5FYLD 3OV6A 1EDQA 4MB4A 5CLTA 1WVZA 2J6EH 5IF0A 2OTPA 3HPLA 4FQXD 4GBXD 4WWKD 3U4EB 2DWDA 5JW4M 2APXA 2A73B 1RJCA 5F8QC 3V5DB 3MLXL 4F15C 4JY6A 1G1YA 1QBML 3O2VL 4XI5C 4NM4L 2P49B 4Y4HD 3ES6B 2HFGL 32C2B 4N9OB 5H94A 3RWDA 3ULUE 1YEFH 5I1AB 1B2WL 3MA7A 1FO0L 3EO9H 3F6IA 1IGTB 2A83A 1BEYH 1IGMH 4U05A 2OR9L 3KGRA 1FNGB 5F96H 3OGCA 1F4XL 2J8OA 5DRXB 3PWPA 4PGEB 1HE7A 5DEZA 4V1DA 3X12A 4U0RB 2G5BA 5TF1H 3ETBF 1GPOL 5BS0A 1QRNA 1B90A 5KW9L 1EXUB 2KH2B 4E42A 4C56B 2D7MA 4QOKA 1RZGA 3MLTA 5DHYA 4OZ4B 3QCUH 3VWKC 3C60C 4ZTPL 2JJUA 4YDJA 4JFED 4UDTB 4F57H 2CDFB 3QH3A 5LVEA 3WFBL 1ZKAA 2F8VA 4K94H 4KKNA 5MERB 3M8OH 1BWWA 2PXYC 2WANA 3ARBB 2F19L 3ES6A 1C5CH 4LSRL 5EU6E 3SBWC 4LLAA 4LKCA 4PV8B 5DEFA 1DSFL 3INUH 4LAQL 5HDQH 3HNTL 4ODHL 4LLQA 1XR9A 4JRYE 4B7LA 1IGTA 2A83B 1TZIB 4Q9QL 1CG9A 4EI5A 3MX0A 1ZS8B 3UO1L 3N85H 1AY1H 2V5MA 3KPPB 4NZRL 1M1SA 4P49A 1JFQH 1S3KH 3C60D 3RL2A 3I75B 5CP3A 4P2RB 3TBTA 1CD8A 3TFKD 5BO1L 2DQDL 1UXWB 3F58H 35C8H 1A7RH 1H8OA 4NQUA 4FFWD 3MLSL 2OJEA 3U7WH 1IAIM 4X8JB 1UCTA 1WWAX 4GG8B 5T3XH 4BELD 1JGEA 4P2RD 1XIWB 4DW2L 5BV7H 4ZOEA 4WJ5B 3OZ9L 2IG2L 5HPMB 2R56L 3CFDA 5B4MD 4JY4B 4J6RL 2ZG1A 1Q9WA 5D7SL 4H0IA 4JFZH 4DUVA 2B5IB 2D7TH 3MNZB 5DMKA 5MI0B 3UC0H 2OXHA 1VFAB 3CK0H 1KF9B 1JTTA 2NY2B 1F97A 3DGCR 43C9A 4NP4H 4ZFGH 3L5IA 1X5YA 2X89A 4RGMC 4F3FB 4LRNH 3IS1X 1OLLA 3AGVA 1DBJL 1V3MA 2YK1H 4ZO9A 8FABB 1PEZA 2WBJB 3QHFH 5HI5C 1MCSA 1MFEL 3BQUA 1PZUB 4OCSH 4YWGH 5TE6L 4JKLA 4B53A 2P8PA 4MCYB 5IVZA 3G6JE 4Z76B 3HC4H 5SV4A 3DIFA 3ULSA 4EXPX 3U1SH 2AEWA 3ZYZA 4H5SB 1R24B 4ZO6A 5KSBA 3BRDA 4WFFD 1BGXH 1Y0LA 3OKOA 4NO3B 5LXGL 1YEJL 3DETC 4KK9D 3PHQA 4W68A 1FZKB 5T1MB 5ESQB 3RVTC 3D18A 4K71B 3X13A 1YNTB 4X5WB 2A77H 2JELH 3UTTE 2LVCA 4NO0A 5LJYH 3RIAK 4FQLL 3AAZB 4FZEH 1KEMH 1BJ8A 3ARFD 2A6DA 1KCUH 4X4ZA 1KXTB 4QRPD 3SGJC 5FK9A 1VPOH 2YRLA 3CLEL 4GBXB 1NC2A 1XR9B 1FFRA 5I1DB 2OJZH 3EYVB 3NFNA 3GNML 2V2WA 3GBNL 4PREB 4Q9CA 5E6IA 5GS1A 1CGSH 1NLBH 3RUGB 3QEQB 2FBJH 2HTLD 5F71A 5BS0D 1EO8L 1MI5B 1AXIB 3QRGL 4OF8A 4MDJB 3T8XA 1XF2A 3F12B 3FFCD 4IOFD 4MAYC 1ONQB 2VLLB 4OUOA 5E8NB 2R0ZL 3THML 2DQDH 5J1AB 2J88H 3REWA 5DJCA 4ZO7A 1GOHA 4Z7WE 4J4PC 3TN0D 1OAKL 3L6FA 3GUTB 2B0SL 1T2QH 1AGDA 3LPFA 1LO5A 5ETUA 3WXVL 4FTVD 1KFAL 2YUWA 5LGKA 4I0PB 2P8MA 1XFPA 1U93B 4R6UA 1XH3A 1KJ3L 2XZQH 4N1EA 4JO3L 4LLVA 4JZOB 4RFOL 5H35B 5ADOL 4LLWB 5D7IF 4V2BA 5GS0D 4QNPF 2APVA 3L5XH 3OKMA 3CPLB 1F6AA 4Q9BA 3EYVA 5I2IB 5IB2B 1R5IB 3QNYA 1AKJD 2R29H 3QDJD 4R9HA 3FONB 4OLZH 1OLZA 2CIIB 4HXBL 2EH8L 3VXME 5D6CA 1OGAA 3T0BA 2JCCA 1MQ8A 5JQHC 3NZHH 3UPAA 2DF3A 5ESAA 1JPTH 4R4BA 2EH7L 5DUML 5C08A 1T5XB 5J56B 1Z2KA 2VLRD 3L3JA 3LN9A 1GGTA 3Q6GL 2XG5A 3U9UB 4KTDL 4EBQL 2AQ2A 3JWNC 3GBLA 1MFEH 4KK5D 4U1MA 2AKRB 3JWDC 4PJXF 4NO5B 5BCAA 5CJQL 2XTJD 4JQVC 2CKBA 1Q94B 4RMSA 5B39B 5KSBF 4LU5H 4K3DL 3SDXE 1ZHBB 5I66B 1X3DA 3VW3H 1C5DA 5E00B 3K1KC 5FM5M 3KYKL 4J3TA 1BOYA 2P48B 2G75A 4ZFZA 3ARDD 3K4AA 4U1SB 5TDNB 5LWYH 3D3VB 1CI5A 5E4EB 1TPXB 1KBGH 4OCNC 4ONFL 4O5LH 1KNOB 5GRVL 2YA1A 3ME0A 4M5YL 1ED3A 2IAMB 4CU6A 2F74A 4FA8A 3ZSTA 3GK8H 4LHUD 4KROB 3SDYH 4KK6C 4HCRL 3SOBL 5K9QG 4FQHB 5MENB 1NLDH 4R2GB 5CIPH 1MEXH 1IGFH 1MIML 2A6KB 4CJ1A 4YDVB 2AW2A 4UBDC 4LCWB 1CGSL 3B8SA 1LE5A 4DQOH 3IU4H 1KYOJ 3CSYB 3GNMH 4PJCB 5D7LE 1M6OB 4NKIH 1QFWL 3BKJH 4N1CA 1P1ZA 3EJZD 5K93A 3B9DA 1PG7L 4U6XA 4BSWB 4PJEE 3P11L 3T3ME 5DMGD 2ZOLA 2ED8A 3CXDL 1X6NA 1NMBL 3HPLB 1YZZA 1P9MC 1MF2H 1VADB 4XWGH 1JYWA 3BPOB 4X6CB 3GBMH 2NX5A 4P5TD 1CICC 3MACH 3I3BA 4PJBE 1MJUL 4EUPG 1D3CA 4LLQB 3O6ML 1G7HA 1KJ2B 1IAOA 2RFXA 4XP5L 3GSXB 1FG2B 4JFFA 1A6WH 3EGSB 1ACYH 3O3BB 4P3DA 5D5MA 3VFUA 4TTDD 5ENWB 4YHNB 4X8XA 4A6YH 3QIUB 2DQCH 3TT3L 5JW5A 2IALB 4QF1B 1GGIH 4FXGA 5FYJD 4IS6B 1JGUH 1CDJA 1XIWC 3TIEB 2Q3AA 3OKKB 1BQHA 4LRIC 1KXVC 1S9XA 3TZVC 4LRNL 3O4LB 1FORL 4N8PA 3D2UD 3MCLL 5IEKB 3T4AB 4KRNA 4X4ME 1T2JA 3RZCC 1U3ZA 3PWPB 1ORSA 4K9EC 4IRSB 3RGVD 4GQ9L 2BRRL 4FMFA 1LE9B 4ZFFB 1DVFD 2VDLH 3F12A 4NWTL 4XHJC 2DI7A 2HFEA 4JPWH 2AK4D 2JK5A 4D8PB 3IF1B 1GHFL 3TO2A 2OX5A 3ARFC 4XNZB 3S4SG 4HMEA 4QHKJ 3QNZA 3VXTA 3GHBH 1IM9D 3BSZH 1AJ7L 4OZIA 1HHHA 3EYSH 3RGHA 3MYJA 3GBNH 1T1WA 3VDAA 3HCVB 4J3VA 3QCTL 1KBGL 1MVUA 4H88H 4Y4KB 3FQWA 1KB5A 4KJQC 1IAKB 3NFSH 5T1KD 5A2JH 2YPLB 2QQLH 5T1DL 5MENE 3VFGH 4U1HB 5EOTB 3SGDI 1ITBB 1T04A 4FQQB 4OD1L 5FYJH 4GLRI 5HGGS 1RZJH 1YPZE 2XZAL 3SDDC 4DVRH 3N1QC 2ATPA 1EEUA 4K71C 3R4DA 4DQOL 1RUPL 4HCRA 3W82A 5C3LD 2WINB 2F54E 4NQEE 2IMMA 5EUOF 3GSQB 3HUJE 2V7HA 4GSDL 4LQFH 5ISZB 4D9QD 2N4IA 2QADB 4UT6H 2NY1B 5AZEH 5J1AA 2DLEA 3HAEG 3K7UA 3HS0B 3TA3C 1QRNE 3AM8A 1KPUB 5I17B 4PYGA 4WHTB 3GIVA 3ZYOA 4X9HA 1QPXA 4WHCA 4HJJL 4OM0L 1DBJH 5E00A 1MWAB 4BQBA 4NM8H 1VFBB 1AP2B 2VH5L 5T33L 1W0WA 1QR1B 4KI5F 5E9DE 4JHZA 1RHHB 4G9FE 3KG5A 4GG6A 2EE9A 3V7AG 3LAFA 4OF7A 3S36X 3QNXB 3GEWB 1P2CA 4MAYA 3VXPB 2JJSA 3EOYG 1IGYA 4TSBH 1S8DB 3RX7A 3VFMA 2HVJB 2QKIA 3NCYP 1BX2B 2D0FA 4OZGE 4DKFH 4U1LB 1OGAB 3I6LD 4EN3B 1ZVYA 3BPNB 1TXKA 3O3DB 4GW5B 3QQ9C 3DI2B 3RY6A 5TPWH 3SN6N 1AGEA 1D5BA 2Q1EA 1YNKL 1OAZL 3U6RA 2Q6WA 5C0BD 4M7LL 2EYSA 5TFSH 4XVSL 4G8FB 1B9ZA 4Y4FB 2ZUWA 1UXSA 5CSGA 1NH6A 1FV1B 4PYHA 4QTHB 5DFTA 5HHPA 2NY0C 1JPST 3VWKD 3GMPA 3LOWA 5E9DB 3TVMB 4HFUL 4Z7VF 2Y9RT 4Z7VB 5KVDH 3SE4C 3ILPA 1U8PA 2QSCL 3GJFA 4X7TA 4JRXD 1IAMA 3RWJB 2Y6SC 3MODL 3HAEA 4Q97A 5C0JA 5C7XH 1XZ0A 1V05A 4YK4B 5TE4L 3OAZK 5HYSA 4HUXA 1D5MB 5IK3B 3O4OB 4LARL 3GSOB 5FHAH 3BEWB 3JTSA 4ZPVA 2MQCA 5CEZE 5DK3A 4PLOB 1H3TA 2ZWLT 4XNQA 3QPXH 5DO2C 4HV8B 5A40E 4HIXH 3ESUF 4GXVL 4M43H 3MRKB 5KVEH 4DWHA 1UACH 5E1AB 4KROC 1PGRB 2GW5A 4JRYD 1W0YT 3RRQA 1IFHL 2DMCA 2ZOLB 3C2AH 2LE9A 2IWGA 5IUSA 3MRDB 5IR1B 2YRZA 2F54A 3HE6C 1QACA 1FZJA 3VXUE 5J89A 1YMMB 4JQIL 4PJIF 5IMOA 3RL1B 1I1YB 3TIDB 3TPUB 2PTTA 2XQBL 3QNZB 4E0RA 3OF6A 4NQXA 2Y06L 2V17L 2IFGA 1OGTB 1HOCB 1PX4A 2WUCL 2Y07H 2IPTL 3NCJH 5L0QC 1QSED 4P4KB 1MCNA 2ESVA 4ODSH 1CXFA 3S35H 3TZVD 2CPCA 4FFYH 3KPSB 1UM5H 1U95A 3QDME 2XKSA 3VH8B 4NC1E 4ZSOE 1CN4A 4HWEH 4RX4A 2F8XC 4GKOA 2VISA 4LCYB 5ID1A 3DVGA 5HVWA 3NPSB 3S37L 4I3SL 2Z4QA 4JHAH 1MCLA 3WMSA 3FMGL 1SJXA 4XCFL 3VGAB 4BH7A 1A3LH 4JANA 4P23D 4MXQC 1CGTA 1YMMA 3IDXH 5DD6A 2VR4A 2HFTA 4M7JL 2CUHA 5E7FA 2GT9B 2HMIC 2IQ9L 2A9NH 1CQYA 4Y1AB 2X2YA 3VA2C 4I18A 3U7YL 1AJ7H 5FA4A 1A7BA 4PD4J 3C87A 3DBXA 1LMKA 3HMXH 1UH3A 2NMSA 5D7LA 4W4OA 1XF3B 4TSAH 5IFHH 2EE2A 5IKCA 2DL2A 5JIHA 5CHNA 3GJEA 3WNOA 4JPKL 5T3XD 4RISL 3R1GL 4ORGA 2CR3A 5GHWH 3BP4B 4LLYB 5I1JL 4EN3C 1YEDA 2VN4A 5CEXA 3IXTB 4QKXB 4O9HH 4U2ZA 4MSWB 5D2LF 4Q9RL 4N9GB 5KSUA 1KPRB 3OB0K 2QQLL 4HS6B 4TNWK 3EDDA 5CEYB 5T1DH 3V5KB 2UZXB 4P46D 5DD5L 2PKDA 5C0AE 2GFBA 2FHCA 5D1QC 1TVHA 3FOMA 3UBXG 2FIRT 1KCRH 4N0YH 4X6EB 4Y4FC 1S7UB 2WAHA 4XCEA 5KAQF 3QDMA 5E8DL 1UT9A 4TVPH 4U1SA 2C1OA 2B2XH 2PO6D 3RL1A 1RZGB 3MLTB 3TF7C 4WI3A 4Y19A 4PJDB 5I6XC 3QHZH 4RAVB 1UA6L 4HWBL 4UTBH 4ZAKD 5DZLA 4Q74A 1RJZB 5AUMB 1IARB 5EZIL 1HH6A 4R7DB 5JXED 5SWSE 3TBVA 3RAJH 1DQLH 4WI6A 5HHNB 1UJ3A 4HHAB 4JY5H 4KWUA 2J6EA 1JWSA 4FXKB 3DOSA 5CZXC 3QQ3A 2WUCH 2B1HL 4WY7L 4O4YH 5DMYA 2LVEA 1KGCE 1PVHA 2EIDA 3ULVH 3LQAL 1IGYB 2RB8A 5EC1B 3U4EA 1MCIA 1QQDB 1RSFA 3CMOL 2X5PA 3SKJL 5MP6L 3LVEA 4PP2B 3W81A 4PY8J 3LS4H 4ZFOL 5HDBE 5IMLA 5I75C 2EZ0D 3E3QC 4RDQF 4U6HB 1RJLA 1G7JA 1A0QH 1M7IB 2VXSH 1LP9F 5EPMB 3BMWA 1IGJA 4RAVA 5C0EB 2YBRB 5E94B 5C7XL 3QEUB 2NY7H 1H0DB 4JFPA 4QYOA 3SO3C 2LU7A 3DUUB 3L95A 4HKXB 2VDNL 2BSSB 4HUUA 5FYJL 2OK0L 4KMLB 5D2LE 4J4PD 4G9FA 4GG6E 3TVMA 3BIAX 4JFDD 5CINH 1OD7A 2FBJL 4HJGB 2EDFA 4DOHE 3RKDD 1P4LB 3S5LG 2BY2A 4OZIE 3QXDB 3PWUA 4JFEA 3KYOB 1MFAH 1J0HA 1NEZG 2O5XH 2I07B 3U0WL 1S7XA 4P57A 4PP2A 3VXQA 1QYGL 4UIMB 1W72A 4Z78B 4OAWB 1NL0H 5C9JB 1U8OB 3QIWD 2MQ0A 4XH2B 3D25B 3ZDYF 5ACMA 3VRJA 2XN9D 4EVNB 2E7CA 5KJRL 2NX5D 1H9VA 2VH5H 3SE4A 1LNUA 2OMNA 4RWHA 2EKJA 1VACB 3S96A 5GS1C 2QHLA 3ARGD 3FJTA 4P9HL 4F58H 4DAGL 4TVPE 4PJEB 3AXLB 3W9EB 2NNAA 4YDKL 2FX9H 3KYMA 2VLRA 5SWZA 3MYJB 3FO0H 2VYRE 5DDHB 3SE3C 5A16B 3C2AL 1Q9KB 5C2UB 5ITFA 4YBLB 1MEXL 1HIMH 1QR1A 3CVHB 1RZFL 1BVLA 2W60A 4HJGA 2J8HA 1RIVH 3OJDB 2BXYA 4D0CB 3MREB 1F4WL 3BGFB 2BNUB 5J11B 4JG1L 2ZSWA 3CJJA 4MQ7A 1MHHA 3BIKB 4H0HB 4PRPA 5EZLB 5L8KB 1HEZB 2M1KA 5K9QI 4JHAL 4Q2ZB 1V8HA 4XTRD 1RHFA 1HKLH 1VERA 4HWBA 3SGKA 1ZGLA 5GGRY 5CWSB 5GGVY 5E8PB 3U48A 4PPTA 1FC1A 2WZPD 3IDMA 5B38B 1P7KA 3CMOH 4YHIB 4L8CA 4MJ5A 3ULVL 1D5XB 5FUOH 3PQYE 1WC7B 2QSCH 1INQA 5K9JL 1CXHA 5DT1H 5CCKL 3UBXI 1AGCA 1DUYA 2R2BA 5TGBB 5JW3L 4R96B 3BDYL 5LCVL 2EDQA 2LU3A 4LARH 3FL7A 3MLYL 4NBZB 5J12B 3OR6B 1QFWI 2A9NL 32C2A 5F6HJ 2I27N 4WIQA 2WQ8A 4UDUA 4WI9A 2K7QA 2A73A 1N5YH 2ICWA 3T0EE 3DBXB 2EECA 3MCKA 4Z95H 3V7AE 3D85B 3O2DH 5JOFB 2XTJE 3VD5A 1M6OA 3P11H 1UB5A 1CGYA 5HVHB 2R9HC 4ONFH 4KKAC 1V7MH 3SHSA 4O9HL 1MWAH 1RV6X 4F7CB 7FABH 3Q6FB 4HXAH 2P24A 1FL5A 1ZXQA 1BLNA 1HINH 2VLKE 4P2YA 4HCRH 3SOBH 5DGRA 5A3ID 1FCGA 1EJOH 3O3BA 2BHZA 3A6BL 4ODVL 4PLKC 1DR9A 3KLHC 4E42B 4ZSOB 4Y5VB 4HMCA 4X6EA 4XP9H 2A6JA 1CCZA 5I76B 5EZOL 1W72L 3HUJB 3L1OL 2DQTL 4D3CH 4TOYL 4CJ0A 1MAMH 3OR7A 2BMKA 2H6PB 3UX9B 4LVHB 3AROA 3BMVA 5D1ZD 2AXJA 5M7QA 3T0DA 4W6YB 4KY1H 1R3JA 4NNXB 3LS5H 3LD8C 3CFIC 4P46B 3FB8A 5GSVB 1I7UB 4ERSL 1UJ3B 1G6RA 2P5WE 4FFWC 1QEWA 2BY1A 2R15A 1VSCA 3QEHA 4P5TA 5IB2A 2R4RH 5I6XB 4APQA 3EYUL 4PJFF 1A6UL 4Y1AA 5C0BA 2I60H 2D03L 4OI7A 3VMNA 2V2TA 2HLAA 2H2SC 3EJYD 5B39G 3V4PH 1S9YB 2W9LA 4I3RL 2VDRH 3LIZL 1HSAB 3PWVB 5EO0B 4I0CC 4JN1L 2AV7A 3VG0L 4GKZB 1PJ9A 4OI8A 2VIRB 3RU8L 2I5YL 3HRPA 3C6LB 1HYSD 5C08E 4RISH 3BO8A 4OLVH 1T7WA 1FHGA 1TZHA 3MR9A 2CLVA 4P23B 1J86A 5INDA 4AEIH 1PSKH 2FLBT 4JEGB 3U0TA 1JWMA 1S9WB 4BH8A 3L6FB 1ZA3A 3GJFH 3RPIA 1SMOA 1BVKB 1LEGA 2PTVA 4MD4A 4Z7UA 3IFLH 4X80H 5EFIB 2G75B 1RZIB 5KSAD 4HG4K 5K9KB 1IQDB 4H25B 1YEDB 3OKEB 2XPGA 4X9BA 3OKNA 2GSIA 1ZHLB 4LVOB 1MCWW 2FATL 5KS9F 3U46B 1CVSC 3KR3H 4HKBA 2VABA 2XACC 4PRPB 3KPLA 1ERNA 4L9LB 4NZUH 4F9LA 2Y25A 3OAZH 3FO0L 5EO0A 4DN3L 1NDGA 1AIFA 4M61B 3ZE0E 4NQCA 2GUOA 4PRHB 4TPRL 3D9AL 5DJ2B 2VNCA 1X5JA 3MV8D 4BZYA 5IOPA 3QIWB 5C08B 3PV6B 1Q9LB 3LKSB 2VXTH 2VDQH 5BZWB 3FB5B 5F8RC 1Z3GL 1YJDC 3QUYB 3K46A 4Q6IA 2FYYA 3C60A 5EIVA 3EOBA 5GGTH 1W0WB 4DGYL 2HVJA 4P2QA 1FYTE 1MAML 2BVTA 4JRYB 2F53D 1E27B 3MROA 2LV4A 2Z0BA 4OSUH 1G0XA 1WBXA 3KPNB 4M8QB 3H3KA 5GISH 2YD4A 3DXAA 4B7IA 4UT6L 4L4VE 4XHJD 1G7IA 4PUBH 1ONQA 4C4KT 2UZIL 4WU7A 2XWJA 1AO7A 2ADFL 3W2DL 3FO1B 1S9XB 1MI5A 2Z8RA 1JCKA 2X4OA 2UWEE 4FTVA 1UACL 4OM0H 3QDGE 1PLGH 2VLJA 4L1HA 4B50A 2VLLA 4C56E 2J5LC 3EFDH 3GMPB 1S7RA 3LSOB 2ZNWA 1PYWA 4Y5XC 3H0TA 2NY6C 3NA9H 5DK0B 4BA8A 4LDOB 4JRXB 5EPMA 3U4AA 4UNUA 2AI0L 2D03H 2W38A 5F70A 4CADB 4HUMB 3Q6FA 2P24B 3EO9L 3JTTA 1B4JH 3CK0L 3I2CL 3BH9A 3MRFA 4LMQE 5E2JA 3SO3B 4PJHA 1KCVH 2CIKB 5BXFA 1SEBB 4U6YA 1QVOA 4IRZH 4QRTB 4JRYA 1T5WB 3MGOB 1CL7I 3RY6C 1J12A 3RIFK 4C57C 4F7MB 3WO3B 5SV3A 1DEEB 1PSKL 4M62H 4R4BB 1RUAH 2VZ3A 4JG0H 5CJXC 4OLVL 2O5ZH 5BRZA 1MQKH 3HB3D 3Q2CA 4M1CC 3WFCH 1OARH 4EI5D 3JTSB 4R4ND 4ZPVB 5I8CA 2DKMA 3PHOB 4XPAH 4K3JH 1UWEL 1OB1B 3PGCA 1RJYA 4G9DA 3T65A 3BQUC 2GJ6E 1I9JH 3DX7A 5GRWA 5BMFH 1U8MB 3T0AA 3EJZC 1U8OA 1IL1A 4MNHA 4XCFH 3MBEC 5F1IA 1MCHA 3MOBL 2VL5B 2PYFB 5FO8B 4K8RL 6FABH 3KR3L 4U7SA 1ZTXH 4RSVA 3UYRL 1NUFA 4GRWB 5DD1L 3UTTB 4EUPH 4PRIB 1NFDA 2BOCA 1ZAGA 4S1QL 3CFKB 1S78D 4AIOA 1I3RA 2E9JA 3QA3A 4M6OH 1DUZA 1P84K 4EUPB 5IHZB 2QL1A 3TBSB 1GOGA 2EEAA 3B4NA 4XX1G 4D9RD 2R2HA 4Y16C 3OZ9H 2HTLC 1N0XL 3BXNB 3HNSH 3IDUA 1U3HD 1BLNB 3QXTA 1ZK9A 2R0ZH 3THMH 2XWJB 4S0SD 4U6TA 3IDYC 2DN7A 4POYA 3QG6A 5DHVB 3VXUD 1A7NL 1CDGA 3CXDH 3V6OC 3BE1L 4JY6B 2YMXL 4TUJB 5A43C 2CUIA 2VXVL 3HMWH 4LFHD 4AM0B 3ZTNL 5DT1L 3UYOD 4Y4KA 4LVEA 3WJLA 3SBWA 3RVTD 4NN6B 3L7EB 1TJGL 3MFFA 2QSQA 5IVXA 5HDLA 1OY3B 2C1PB 3LPGA 4BH7B 4N90E 5FGBA 2X4UA 4KQ4L 1PZ5B 2PUQT 4MNGA 2XOTA 1MLCB 4P2QE 1IEAB 2J12B 3KPSD 3QDAA 4PRNA 5CKGA 3RVXC 3E8UH 4FQHA 4PJCE 4CAGA 4LCCB 1ND0B 3I85A 5MERA 1DQML 4P4KD 1CU4L 3BP7B 4YDVA 1U8KB 4ZS6D 4LASL 2AGJL 1K8DA 4G8IA 3EO0B 5DMGC 3RA7L 1JP5A 4JJ5B 1XR8A 4YHYB 4Z7UF 2DI8A 1JPSL 4NZUL 4GRWH 2JJTA 4HIHA 4OZHA 4LU5L 1K5NB 3QJHB 3MNVB 1RAMA 4FXGB 5C0BE 5TF0A 3NIGF 1KEML 2H26B 1B6UA 3KYAA 3DROB 3IDGB 2Q3ZA 4RWYL 5HYJD 1KCRL 4PGEA 3AB0B 3H3BC 3SDAD 4XP9L 4ODUB 4P23C 2FSEA 2HYMA 3QIUD 1NC2B 1EBAA 4TRPL 1MLCA 3LH2H 4DTGL 1EO8H 1V3LA 4X8JA 3SDYL 1CDUA 1ZHNA 5IWLC 5IB1B 1U8IA 5JORB 5EORL 4W6WB 1DQQA 4I48B 1K4DA 1JPFA 5B38G 2EDWA 4Z18A 5CGYC 2HG5A 4ONGH 4WUUB 1I3UA 5E8EA 5IVOA 2MCPH 1DANT 5BQ7A 2XKNB 2RGSA 2OI9C 4P5TB 2VSCA 4WWID 5A2FA 1R6VA 3C5ZB 2X4TA 1NSNL 9CGTA 1UB6A 4YHKL 3QI9B 4TUKL 4YJZL 4KKBD 3QP3A 4AY0A 1HZHL 2F9BT 4OSUL 2HJLB 1IMHC 3MRPA 5EC2B 3HKFA 1I7TB 2KDGA 4RNRA 4JE4B 2IBZX 1H15B 1Y18B 2AI0H 4Y4FD 4Z0BL 1CLYH 4C58B 2C1OB 3NOIA 2JJWA 2J6EL 5IMMA 2JIXB 5E5MB 3VH8A 4PJGB 2I5YH 3HR5A 2VQTA 1P53A 4PLJC 4QXTA 3NZHL 5F7YC 1IILE 3CX5J 3AREA 1KACB 4MVBC 1RULL 1DBBH 1WFTA 1U8QA 3EOAA 3L95B 2FZ3A 3C6SB 4NM4H 4XRCB 3WD5H 4AENB 4R90L 5DXWA 2VAJA 3CIQA 1TVBB 3WE6A 3N06B 4O4YL 1F45A 3FZUC 3O6KL 4JZJB 3MA7B 1ZT7B 1UZ6F 5GZNC 3VI4F 1J18A 3QUMH 3ZKXB 4Z7NF 4WEUD 4DKFL 5T3XL 1TCRA 1T04B 5HYQA 1BX2A 1BJ1J 1RIUH 3FQTB 1GXEA 4TSCH 2COQA 4MD0A 4AT6A 1MFAL 4M4RA 2NW2B 2DQGL 5FGCE 1XGQA 2B39A 3VXRA 3QPQD 3QUXC 3ILQC 1HKFA 1MQKL 1Z0NA 3SKMA 4CDGC 1XCQA 3GMRB 4PJFB 1T0MB 3DSFH 5J6HB 1UKSA 2DLIA 2NY1D 4I2XE 4JVWA 1NDGB 4M61A 5HI4D 3HE7C 1LO5B 5ETUB 3M8OL 1KPUA 5I17A 3C6SA 3UZQA 4X7EC 3VD7A 3QT2A 1UM4L 4I0PA 4M6NH 3DIFB 3ULSB 4NSKA 3NFSL 4OCMC 1UWXK 2NR6D 4LGSB 2VMFA 1G7IB 2Y72A 1CS6A 4K23L 3I6KB 2Z93B 3HI1B 3C9NB 5SWZE 4JJHA 3VCLB 4MHHI 4MB5A 1GL4B 4HT1L 2YPLD 4OQ1A 3GMQB 2IADB 4ZUTB 4DVRL 4FTVB 4ZODA 1UG9A 2KQNA 1C8PA 4HAFA 4KFZC 4LCCA 4RMRA 3DXAB 1EVTC 3O3AB 2XI9A 2CLRA 3I6GA 1ES0B 5DD0H 3MRIA 4HIIB 4I4WB 4XPGH 5AG9A 4FFZL 1JZ3A 5HHMB 3ZKNC 4JN2A 3QB7C 4XBEH 5HPMA 2VITB 1C7TA 5DA4A 5IW3A 2E6PA 5KN5A 1EO7A 2NX5E 3T4YB 1YDPB 3KXFA 5JUEH 3K81A 1BZ7A 1NGYA 4CNIB 1UZ8B 1G9NC 2EDNA 4XCNB 5JW4Q 1KIQB 5DJXB 3NCBB 5D7IA 1LK2B 5SWZD 3L3GA 3QWQB 4FN0A 5K9JH 3V6FB 1E4KA 1UJTA 1C16B 1XGUA 4NP4L 3QIWA 2P8MB 1DE4B 5JOPD 2XN9A 4OZGA 2H3NA 5AEAA 4X6FA 4MXQD 4PV8A 5H2BB 3PGFH 1CFTB 3RWEB 2MKLC 5HVGB 2OI9B 2B7DT 1DZBA 4OIBA 2KZWA 3BT2H 4OFVA 1WK0A 3GMQA 5B4MC 1U91B 2E8ZA 4RGND 4PB0H 4E41E 1EUTA 3UEZA 2EDJA 2HJKB 4ODSL 1ROWA 2C3WA 4X98A 2DQEL 2FBOJ 3TO4B 5BVJA 4I77L 4QOKE 2BSTB 3L3KA 1LWRA 1JGDA 4PLNC 2HJFA 1M05A 3BQUB 3KPOB 3I02A 4G43B 5JMRA 5FA3A 5GSRA 3VGHA 5CILL 1ZWIA 2IF7A 3T3PF 4B0MM 1RZJC 2X9WA 5E2WL 2VUOA 1I7TA 4RNRB 4X4XB 4HZLA 4P2CG 4N8VA 2VERN 4OLYH 2CO7B 4Y88A 1Y6KR 3BW9A 1I3GH 3UROR 4U4BA 1J88A 2PYEE 1JVKA 4OD1H 4LSDA 3X13B 5DMJB 2XIDA 2ZCHL 3IRPX 4DK6A 4PTTB 1AFVH 2A2QT 3MLXH 1GC1H 4YHOL 2UZYB 1SY6L 3ZZ1A 2HH0H 2ICWB 1R3JB 5I1AA 4J3OC 3PABB 5FHAL 2F53A 3VMOA 5GGTA 5BO1H 3F7RA 3FB8B 3T2NL 3AB0C 1HINL 4Y89A 2X42A 2ADJB 3Q5YA 4LCWA 4AL8H 1KIPB 3WFEL 4G3YH 3V9FA 3GKWH 5ESVA 4WVRA 1DL7L 2X4SB 2CXGA 2UVEA 4PJXE 5B8CA 2H32H 3TWCH 1UEYA 4ODBD 5HHXH 3LCYA 1MVFA 3TESA 1A1MA 1GZQA 3UPRA 4TOYH 4U3XA 1NFIA 4Z9KB 4L4VB 1ZA6B 4NBYB 4NDMA 2CDFA 3QH3B 4FG6C 4PRDB 3ZMRA 2IPKA 2CH8A 2IANA 2BOCB 4UTBL 1DBAH 1GGCH 2XTJB 3KS0H 4MA1C 2WUBH 3QI9C 4N8CL 1DUZB 5ADPH 2X4NA 4ELMA 5HDQL 2DOCA 2L7JA 1XIWA 3CMGA 4NKQB 4RX4D 1BM3L 3EO1A 4JO4H 2Z92B 3L3HA 2ADJA 2DKSA 5F7WC 5GZND 5FAAA 4C56D 2J8UB 4MDJA 1HILB 4FFYL 3T8XB 1XF2B 2FCBA 3ALWA 3RVVD 5IIEB 3IAPA 2HT3D 5F93C 2PCPB 5EU5A 1F6FB 1AHWC 4NOFA 4CDHA 3MUJA 1MJJB 4M48L 3V4PL 1KPRA 1CBVL 3C09B 3FQWB 4JDTH 5CZKA 2GK2A 4D0BB 1RPQA 1RIUL 2VLJE 2YEZA 3MBXL 2IBGA 1TENA 5C0FB 4AEFA 4PJEF 1A9EA 1F58H 1JYXA 5IOPB 1G84A 1OQXA 3L5XL 4ZXBB 3RNKA 3DO7A 1LD9A 2MCG1 1QKZH 3GM8A 4YXKH 5H35A 1KG0A 4MD5A 3TBYA 4KV5E 4I5BA 4HDIA 4P3CL 4X0KB 4P9ML 1Z3GH 4DZ8B 4LVNB 4RAUA 5JPNA 3KPMA 5T3ZD 3LB6D 4UMGA 1OM3L 4KZDL 1FN4A 3IU4L 4YHKH 1U3HC 2DLFL 2NQCA 4NRYA 5IESL 1NCNA 5CD3B 2BSRB 3WLWD 5GIRB 5DK2A 3S88H 3SDCD 3H9YA 4CVZB 4HX1A 1HYRC 3OTTA 3CDYA 2F5AH 4UT9H 4HK0A 3BKYH 4HT1H 3T0EC 3HNVH 4IHOA 3D0VB 3BP6A 2FX8L 3ARFB 3D0LA 4GUPB 1RULH 4LSVH 1MCFA 3BVNB 1LP9B 4FFZH 2YD5A 4PJ7A 3WXWH 4NC2B 2YPVH 2IPUG 4U6HA 1DL7H 3AM8C 4I5BB 2OM5A 2YXFA 3H42H 5FCSH 5B21A 4B5EA 3LEVL 3Q5TA 6CGTA 2FYYB 4WTZG 4IDJL 2NNAB 3RTQD 4ZTOL 3QEGL 4FQCH 4YX2L 2DIAA 4Z7WB 3CFJB 1FO0B 25C8L 1G6RH 2HRPH 3U9PL 3VJ6B 3D48R 3SDDA 3FQTA 1FYTA 2Y1VA 4QY8B 5I71C 5DJXA 1MUJA 4PUBL 5FCUL 3J7HA 2EDTA 4I4WA 1OTSC 1PKQE 1TJIH 4OGXH 5BZWA 3QAZC 4JKPH 3EAKA 5CJ5A 2D2OA 1B0RA 4XNUL 1A7NH 3I3DA 3PP4H 4LIQE 3QXDA 3GIVB 3NN8A 5CUSL 1ORSB 4ETYA 2A6IA 3HMWL 5KANG 5GZOD 1JGLL 4MD4B 2QADC 1SBSH 3IJYA 5EA0L 4HGMA 2H2PC 5F9JB 2XFXB 1AD9A 1XZ0B 1R5WA 1H5BC 3LKQB 1F58L 2AERT 5SWSA 3FO1A 4LMQI 4G80B 5F89A 2ICCA 5EUKB 3O4OC 5KS9A 4QXTB 4UINH 2A74A 4XCYB 2XTJC 4XPFL 1NLDL 1F4AA 2Y7QA 4G8EB 3KS0J 4AIZA 1UKTA 5FYJU 1RURL 5J7CC 5CEXB 2OQJB 1Q9WB 3ARBC 5IG7A 4PJGF 3PL6A 3TYFB 3LRSA 3IDNB 1F4YH 5IHUL 2R8SL 2AK1L 3GHEH 3ZSSA 1N8ZA 5CZXD 4NQCD 4XMPL 3SE8H 2VWEE 5A2IH 5IQ9B 3ARBD 5T1LB 4OZGF 1JE6A 3LB6C 2QLVB 1GHFH 1XAUA 5GRZA 5DRZB 2X70A 4JFFD 3QFJA 5C0CA 1JHLL 5D9SA 3MV9D 3H9SA 3IFOB 4JRWA 2FL5A 5DQJB 3SQOH 2W91A 3BUYB 2AJSH 4UTAL 1KB9J 4G8GB 3IFNH 4YAQA 1GGUA 4KUZH 1NKRA 1W8NA 5J3HC 4HKZB 1BJ1H 2VC2H 4KJYB 3BQUD 2DQTH 1CLOL 2UUDH 4X99A 4BK4A 4GG6F 4ONGL 4J4PA 3MRQB 4FQCL 2P8LB 2OJZL 3EO0A 3S35X 1MIMH 5TQ2L 3OSKA 3QUYC 4XPHH 1KN2H 4YBQC 4RGNB 4RA0C 1IC4L 5ILTL 2RCSH 3OKLB 1XF5B 1YEHL 2OSLB 3T0WA 2FR4A 1G0DA 3T1FA 4X98B 4BQCA 1C5DB 3P0VL 1S7TB 1NAMB 5J9PA 4PV9B 4OCXH 1E28A 2VLKB 1ZLVH 1G7HB 5E2WH 1JF5A 3UPRB 5GGVL 2APWA 4YNYB 5CGMA 3PV6A 1R5VA 3OGCB 4X6BA 3DUHA 4XGZB 3QIBD 1RUQL 2DL9A 4X6CA 2OR7A 3P0YL 3VFVB 4PJEA 3VD9A 2O93L 2Y36H 4MJIA 1SBSL 5DZOA 4NNYA 1SHMA 4JM2B 4KKCC 3V4UL 5GS3A 1FL3A 1AFVL 4JQXC 3BWAA 4HWNA 1GC1C 2Z31C 5DJ8B 4O58H 5TE6H 3QHFL 3PV7A 5IQ7L 1CR9L 4LL9A 1T03L 5H37G 1E4WL 4CVXB 1YN7A 1ZVSA 2I9LA 3OKMB 2NY0D 2ZKHH 4JVUA 5HHVL 5IROC 2Q8AH 1IKFH 2ZG2A 1S5HB 4P5KA 1RURH 2EH8H 3DGGA 4BFBD 2ZUQB 3S3PA 2CDEA 3E6FA 4HPOH 3TJHC 3MNVA 5E8PA 5ABDE 1KV3A 3RWJA 2DLFH 4ZOAA 1YEJH 4OM1L 3BP7A 4DKEH 1HEZA 4KTDH 1JZ5A 4DK3A 1QRKA 3C2SA 4UILL 4BH8B 1MWAL 5J1SC 3QCVH 5DRNA 5F88B 4WENB 3RWGA 1NCAL 4QOKB 1KLUB 3BKCH 1HI6B 3QUZB 4ZPTB 4LVNC 4G7VL 3QA3B 4IDLA 4OZFB 1A3RH 1CL7L 2X4RB 4JFFB 3U4BH 1XGYH 2G5BB 5I8OH 1YY9D 3MV11 2XTLA 1ZE3C 3VE0A 2W92A 3FRUA 5ENWA 5IMKB 5FDYA 5FV1L 1FQ9C 2AKRA 5DJAB 2ITCA 4WFED 1EGJA 4I3GA 4GT7A 1NCCL 3MBEB 3QUKB 3UO1H 1JYVA 1CFNB 3DSNA 4NBXB 3MRDA 4JLRB 1FJ1B 4S1DC 1WIPA 2EC9U 4ZNEE 5E6YA 1RJYB 2W65B 4G9DB 1WTGT 3BPLB 4L8DB 5F1NB 4NQVB 1VKXB 5MEQB 4OD2B 3V95A 2B0SH 2HLFD 3LHPL 3DNKA 4WWKA 1OWWA 2Z92A 1R3HA 2FJHA 1TZIA 3TBVB 1VA9A 1UC6A 2ADFH 1IC4H 5HY9B 1OT2A 4RDQG 4XAWH 2E6JA 3MRGA 1U8NA 4IOIB 3EYUH 4OZFH 4XBGB 1XCTB 2W0FA 3MLRL 2Y5EA 4RGOH 4XPFH 2A38A 1CQKA 2BNRA 3MLYH 4JAMB 2VOTA 4G6AC 1T89C 4JPVL 4D0DB 1F02I 2YN3A 3MOAH 4MAUL 4OTXL 3KLHD 4G8IB 1AD9B 2IFFH 3Q3GA 1PKQA 1TPXC 3DYPA 1T7VA 3MJ8B 3WHXA 5DO2D 4EZMA 1R3LA 3O9WD 1OGAE 5DQJA 3C9NA 1NBQA 2AK1H 3DARA 4ELKB 3SJVD 2WWKT 2VTFA 4IRJA 2EKSB 3MUGB 2ORBH 3MRHA 3C5ZD 3R1GH 4IJ3B 3IDIA 4WUKL 1J8HD 2F5AL 3UTQB 2BOBA 4HBQA 1UM5L 4YFEA 3BDBA 3BP4A 3ARSA 1BWMA 1I4FB 2GJ6B 4M5ZL 3HLAB 4JFYA 4WUUD 2RHEA 5BRZB 2M8XA 4WI7A 5FOJA 5GS1B 1NCUA 4TULH 1FFOA 4URTB 4PJ9B 1ZLSH 3MFFB 5BOPA 4Z8FL 1GAFH 5MP6H 4EN3A 2WMPA 2XKNA 1DEEA 1I9JL 5FYKH 5HYJE 4HUVB 4UILH 4PRHE 1YDPA 4U1JA 2GAZB 4RMWA 4OM1H 3C8KB 1DTUA 1NC2D 3H2WA 4Z7WA 4PS4H 2V2XA 2VITA 4LEXL 5D7IB 4QRPA 3UYRH 4LLMA 3ZDZF 2J8UF 4P2OB 3GK8L 3FAXA 5I8OL 4HWUA 3KXFB 3HE6D 3ULVF 5DK0A 1HHGB 5EBLB 4XC3L 5KSAC 3LMJH 1OHQA 1MWAA 3SQOL 3QZWA 3VRIB 2X1XR 5IJKC 2WWMD 4KRMB 3QCTH 1RJZA 5AUMA 3RNQB 1JGVH 3LS5L 1P7KB 3OXSA 5JR1H 4XNUH 4FXLA 3RKDC 4YBQD 4LHJB 2ENSA 4LRIA 1NMBH 4TVPD 3U0TB 2YD3A 5T3XE 4JFOB 4XNYH 1NEZA 4C56A 3I6KA 3MRRA 3QG7H 1EGJL 1CDYA 1X7QA 3N9GL 4YE4H 1RY7B 5C0AD 1JUFB 4MLSA 1VFAA 5HI4C 3FO9B 1A6WL 4UQ3B 5C0DA 4I8DA 3CC5A 3DI3B 2YPLA 4H26B 5J12C 1RMFH 3LZFH 4NQSA 4WW1B 5KZCD 2UYLB 2UUDK 3I9GL 3B8YA 1A3QA 2X40A 4M7JH 4L5FH 4FRWA 5IGXL 3LKNA 4D8PA 3QPQC 1T3FA 1REIA 4L4TA 1GH7A 3TT3H 1C5BH 1HH9B 5I15H 4P5MB 2G9HB