4XX1E

Low resolution structure of lcat in complex with fab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
219
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Fab1 light chain
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 219
sequence length 227
chains with identical sequence H, M
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E01
4UV7L 4FTVD 2GEEA 1LK3L 4MA3B 3QXUA 5INCA 1RJYA 3QG7L 2XN9E 1G6RH 1MJJA 5DJ6B 4QXUL 4P5TB 4XVSH 2VLKB 1R3HA 4QHUB 4CVUA 1DBJH 5F6IC 2GK0A 4JKMA 4PR5A 3HNSH 5E5MB 3G6DL 4HKXB 3VFVB 4OJFH 1A64A 1U9KA 1JPTH 3SDCB 2COQA 4P2RA 3TH3T 3C9NA 1LO3L 4PGZA 4QHLA 5CJXA 3O3DB 5EBGA 5F1SA 1S7SB 2FLBT 3MLTB 1HI6B 2VOTA 1XFPA 4HIIB 4X4XB 2DWDA 4UU9A 1MCPL 4OLUH 5I2IA 2J2ZA 2EDJA 1GJIA 1G7QB 1VFAA 4POZD 3UROR 4J23A 1HSAA 4JFFA 1CGUA 1F00I 4NNXB 4KTDH 3OZ9L 5L2KB 4HX1B 3TBWA 4F33B 1BVKB 2I5YH 4Z78A 4P3DA 3KLAB 3FTGA 5EO0B 5I9QC 2Z8WC 4KDTC 1JCKA 4FQ2H 5LGHL 4JY5L 2VH5H 3LH2L 5TF1L 3ARFA 5TDOA 4KY1H 2BVTA 3CH1B 5E6ID 1AP2A 4AT6B 1DJSA 3LRGA 1FZJB 2IF7A 4GRWE 2EDNA 3DNKA 5FUOL 2I25N 3K80A 1CDCA 1YQVH 1U8KB 4GRMA 4NQEE 4GQPH 4YHYC 3CMOH 1OHQA 5MEOA 5HPMB 3HC3H 1QTYT 5EA0H 4M8QA 2I07A 4HUWB 3P11L 3SKOB 3HZYA 4LKCA 1Q1JL 3MA9L 5HTSA 4Z7WE 4B0MM 1DL7H 3GMOA 5DEFA 3OG4B 3FOMA 4R96A 4XPTL 5C2BL 4YFLI 4N5ED 1KULA 2YEZA 3DVNA 2IGFH 3D25B 1S9XB 7CGTA 4LCUB 1MUJA 2QSQA 3L3KA 4NFDA 2P45B 4XXCC 1WIOA 1NKOA 1ZVHA 2VDML 9CGTA 3WS6A 4G80A 2DQJH 1CD9B 3S37H 1ZS8B 1T1YA 4JQXC 2NY4D 3TP4A 2EH8L 3CDCA 2DM3A 1P7KA 3KYOA 4TRPH 3EJJX 2PYED 1KTRL 2W9EL 2XXCB 1FNGA 4ZQKA 4PGEB 1VACA 4NQVB 5GGRA 1V3LA 1JGEA 4MNGE 4OB5H 2X4OA 1MFDL 2RAMA 4NO3B 5E8NA 4BQ8A 3P40A 1T2QH 3OX8B 3RIFF 2I26N 4X6EB 3MRGB 5EU4B 3TZVD 2X1XR 5C0IA 3STZB 2XTJB 1FQ9C 3JSSA 1BVZA 1RMFL 4AH2A 5EU5A 1KCUL 4AEIL 4Z5RB 4OKVA 4Q6YA 3MRRA 3VMOA 3S88L 3NIDF 4TSCH 5D7KE 1UWEL 1G6RB 4OLWL 5I1HL 3AMKA 2J88H 3QQ9C 4Y89A 3NIGE 3TH4T 5EUOE 4KK8D 4M6OL 5C0CB 4AL8L 3BUYB 4PJ9B 4URTB 4P59H 4MAYB 4WFHD 3VXQB 2IC2A 4QRPA 3FQTA 4AIZB 4UV4L 1KELL 3E8UL 2YOCA 4KKAD 4HS8L 3DTXB 1C5CL 3VCLA 4HWBA 5EU3B 1PKOA 4W6YB 1R3LA 5C1MB 4X7TB 5HI5C 5CBEB 4NC1C 3PDOA 4JFXA 3F8UB 4LLVA 5IB3B 1X5HA 1G9MH 4MNHA 1S7UB 1LO5A 1MWAL 1K5NA 3FB7A 1IEAA 4YC2C 1FZMA 1XIWD 5C9KA 2JB5L 5D1XB 4FFWC 3MLYH 1DTUA 3MLRH 1QBML 5MP6L 3O6FB 3ZSSA 3L3GB 3OMZA 3L95B 4HUXA 5B38A 4YBHA 3ET9F 1XGUB 3ILPA 2NX5B 4OGYH 3QJHA 4Y4KA 5ESVA 3T2NL 1GGUA 4YIQB 4F7MB 2YPKA 5DQDL 3S4SG 5J57B 2C1PB 3CFKA 5IB4B 2VR4A 1WC7A 5FUZH 4YGVB 1OP5H 1YY8A 2V7NA 4FXKB 1CS6A 4LSDA 2YUXA 3MBED 2F19H 4I9WD 4QTIH 3MFGB 3UYPA 1VEPA 1M05A 5EZOL 5FA3B 3QDME 4YQXH 2NLJA 3RWHA 1NCBH 1BLNA 4MA1C 4XPBL 5DI8A 5GS0C 5D1QC 3HZKA 1ZWIA 5ESAB 4XWGL 2CUIA 2P1YA 4OCNC 2YWYA 3FQRA 3QBTB 5GIRA 4F7TB 3TV3L 3QDGA 4P0DA 5E6IB 2CMRL 3E3QE 3IXTB 3BOVA 3KLSA 1OW0C 3QJFA 3AROA 3OJDB 4XCNA 1MCWM 1IQWH 3W39A 1FFOA 1QQDA 4S1RH 5DFVD 3NACH 1TENA 2YD7A 2XFXB 4P2QD 5KSAD 1IGJA 1RK0A 3K7UA 4NHCH 4LSQL 2A83B 2BHYA 3D85B 3G6JF 3HG1D 4XP9H 1WIUA 2EC8A 4PJXA 3BZ4A 3BSZH 3MLPA 2PN5A 1TVDA 1AGCB 1G1YA 3Q48A 1FVDB 2UY7A 3MRLA 2G5RA 4PP1C 3D39D 3MCG1 1FFRA 1I7TA 4G43B 1A5FL 1DQQB 5FUCC 3I9GH 2AK4E 4AENB 2P5EE 2IH3B 1A7QH 4MB3A 3VXSE 3RQ3A 4OLZH 3QIWC 3BH8B 1QHPA 1HYSD 5IVXF 3DX8B 3P0YH 4DCQB 2VDPL 1WEJL 2NY4B 3KYNB 5D6CA 2MCPH 1QLEH 4B5EA 3MLZH 5A2JH 4KVCL 4QTHA 1DQLL 3RWIA 2PYEB 4QY8B 4ZUVB 3BZEB 5C6TH 1EGJA 2EYRA 2A1WL 4KGJA 2ZUTA 5KG9A 1ITBB 5AUMB 2GJJA 4PREA 5C6WH 1J1PH 1Q94A 4P2OA 3WNMA 3DV4B 3L6FB 4YHZH 3TZVB 1IGFH 4XMKH 3WL9A 1XGYL 1C7TA 2X1PA 3C6LC 1IKFH 1IGIL 4G7VL 3GJEA 3IDJA 5DJ0B 2X9XA 1M6OA 1TZHB 1KNOA 5CJOL 5J6GA 4QHMA 4H1LG 3KHOA 2N4IA 1KACB 5J11B 1EFXD 3L3HA 1UCBH 5J8OA 5FF6A 3BPLC 4K71C 1RZ8B 3GSUB 4MB5A 1C7SA 2GFBB 4NUJB 32C2B 3MV8E 1MPAH 3VDBA 2P8PA 3IRPX 5CJQH 1HHGB 4HIHB 3FB8A 3KYMB 1P4IL 2BVOA 1GCFA 4JB9L 2MKLC 4YDIL 5CSZA 5FHBL 1YN6B 4YBQC 3IDMA 3RTQD 4Y1AA 4MD4A 1J5OH 3LMJL 4L3EA 4RRPA 4E0RB 1J0ZA 2VE6B 4XI5C 4JFZL 1FL5A 5K9QG 2YWZA 4PRIA 3SCMD 3FFDB 2C3VA 2VIRA 4WI8A 5DJAA 1U3HC 3KPRA 3FZUD 1INEL 4LDOB 2X7LA 1H3VA 4BH7B 1N59B 2X4NB 4ZFFA 1BD2E 1BHGA 4XNUL 5J9PB 3EFDL 4XCCH 3T08A 4K7PY 3RWJA 3ULUD 4L9LC 3RVXC 1NCCL 3O9WD 1WBZA 4EN3A 4KMQA 3KDMA 4M7JL 3QFDA 4U1GB 2HKHL 2YC1B 5DRZB 1GOHA 1I7UB 4JHWH 3A6OA 1A9BA 2YMXH 1PJ9A 5MEND 2PNDA 3T0AA 3V4UH 2P7TA 2GHWB 3RJQB 4HCRA 1UZ6F 2J3SA 4OQTH 3MCLL 4NNPH 1NMAH 2AJXH 4L8BB 4C83B 5I1CH 3MBEB 3SKJL 5CEXA 3V79C 2YUWA 1EEZA 1GC1C 1P2CA 2EXWD 4LAJH 4RAHA 3VXRB 2O61B 5D2LB 3SQBA 1HYRC 4PJEB 2A2QT 3BH9A 3PP3K 3LN4A 4JRYE 3ULUH 3GMRB 1QLFB 3QHZL 1KENH 1WCBB 4JZOA 4RQQA 5AG9A 2AK4A 1NC2A 2H2PD 1S9WA 4ZAKD 1S7TA 1CD1B 3HMXL 4JKLA 3CSYB 1NCAL 1A1OB 4F8QA 2V2WB 5BRZD 3X13A 3VWKA 3BP6B 4HSQA 3P4NB 5KSAB 5CMAA 3W11D 1LO4L 4WHCA 1LO2H 4APQC 5IJKC 4FP8L 4LVOB 4EBQH 4U2ZA 3HG1B 1FYHB 3L3DA 1ZSDA 3C6SB 4OIBA 3KS0H 3L5XH 4JM2A 5FCUH 5AZEL 4N68A 4Y0GA 5ISZA 2P8LA 4OF5A 2ADIA 4OV6F 4ODWB 1I7RB 5HHME 1A22B 2UVEA 2BOCA 1XF2A 4XP6L 5F9OH 3CLFL 2DQGL 4ENED 5DMYA 2NYYD 4K8RC 4GKNA 3DYPA 1DQML 2VAAA 1FL6B 4JZNA 4LHUD 4DN3H 1IGMH 4LF3A 5C07D 5C70A 5GISH 1NGPH 3P9LB 1N5AB 3L9RA 4K3EH 5IIEB 3SE9H 1T5WA 1U8NA 2HVJB 4L4VE 5IF0A 4D9LH 1F58L 4I18C 1T0MA 2DL2A 2VABA 1FO0B 1QR1B 2NZ9C 4YXHH 2Z0BA 3HI1A 1AR1C 4QHNA 4W68A 4F7CA 4LQ1A 2XA8H 1F45A 2VLKE 5J6HA 2C7UB 2Y5EA 2J7LA 2ICCA 1YJDC 3CFBA 3NIDE 4O4YH 1CR9L 4IEFB 3JWNC 15C8H 3RY5A 1F8TH 1NUDA 2WANA 3RPIA 1KLUB 5C0AA 3DXAB 3DRTA 1N64L 4WWID 2J8OA 5I1DB 2OR8A 2AJSH 3DSFH 2DM7A 1NC4A 3GEWB 4ZFOA 3OPZL 2GW5A 4H8WC 1Z3GH 3BXNA 1A4JA 2VDNH 5D7IB 1G6RL 4NOFA 4XVSL 3RI5K 4PRAB 3CDYA 1U8OB 4KRLB 4UI2A 3EDJA 3HNSL 2YA0A 3K8KA 2ZUXA 5ICYB 4OJFL 4NKDA 3VGHA 1EO8H 4JPKH 5L2KE 1JPTL 5ALCH 2CRMA 1ZAGA 1JNHA 1HHKB 2PXYB 4YH6A 2VITB 3SGKA 4I48B 4WGVB 2XICA 1WT5C 4P23D 4RA3A 5DHXB 5D7JD 4WFGD 4F7PA 4WWKB 3U4EA 5DHVH 3ARXA 3CU1A 3O9WB 4POYA 2CDEB 4PD4J 3E6HA 4QCIA 4KTDL 4RCAA 1INDL 5JW5A 5GSVA 2I5YL 5AEAA 4NQSA 2AJYL 1VKXA 5MENB 2DQDH 3LKOB 4FQ2L 2VH5L 4KY1L 2Z8RA 1NGZA 2IH1A 5IKCB 3DBXB 4OFVA 3AREA 1UA6H 2CIKA 3E6FA 2QQLH 3I6LD 1N26A 1EDQA 4YHOH 1YQVL 1DN0A 2L4OA 3O81A 3IJYA 2DTMH 3CMOL 4PJIF 3FRUB 5D9SA 5F9WB 1UJ3A 4G8GA 3WSQH 3EJZC 3HC3L 5EA0L 3UP1A 4BZ2H 3AUVA 3UTQA 1BPVA 5DR5H 5I0ZA 1A7BA 3HAEG 4RMVA 5F1KC 4BK4A 1DL7L 4XNMA 1TVBB 1G0XA 5DD6A 2E5EA 1OLLA 3GGWA 4K23H 1D5IL 1KLFA 2IGFL 5HGGS 4U1IB 5FCSH 4M6NH 4WHDA 2EO9A 2YA1A 1MCLA 3CAFA 4U0QB 5F1OB 3ZDZF 5EOCH 2DQJL 2BZDA 3S37L 2ESVB 2LVEA 2Y1VA 5SWZD 2XTJE 4M61A 4PRPA 3ULVD 5EWIL 3QRFM 3L7EA 1NCDH 4R2GB 4TRPL 4XTRC 1LEGB 2R2BB 2BSTA 4WO4A 3NTCH 1D5ZA 5DK2B 5IVZA 1V7NH 4EOWH 4DKFH 5C0CE 4OB5L 5DRXA 1MRFH 2CLZB 1T2QL 4QXTB 5J56B 3N0PB 5E00B 4J1UA 4JGUA 4JFQA 2XPGA 1ERNA 4KXZH 3VXTA 2NW3B 3WS6C 2ZJSH 4LHUB 4Q2ZB 5A16B 1FNHA 1WBXB 1JHTB 1FL3A 1OAZH 5GRYA 1UVQA 4TSCL 3TT1H 1AFVH 1QPXA 2J88L 1U2CA 3EYVB 4KQ4H 1YDPA 3O4LB 2IANB 4N8VB 2H32A 4RNRA 4WI7A 4YDJA 1KN4L 1B88A 2BSRB 3ZKQD 4G5ZH 4PIRF 5JZ7D 4NCDA 4F57H 3WKNA 4X4YB 1HILA 5BS0A 2NX5E 3IT8D 2EDRA 5CAYB 1LE5A 1YMMA 4GAYA 1MY5A 3I2CH 1JE6A 4FQ1H 1P4BH 1WIPA 1P69B 1G9ML 2DI9A 3FT2B 5C0BD 4JGMA 4GBXA 3NCBB 2ITDB 4NBYB 3CSGA 1HDMB 4ZFZB 5FO8B 3KPLB 3MLYL 1G7HA 3MLRL 3SGJA 2FR4A 4LLQA 1WCQA 3CFDB 1U8JA 1QRNB 1T1ZB 2FJHA 4OGYL 1R5WA 3RU8H 1ED3B 5DHYA 3Q3GB 3LRSA 2D2OA 3S4SA 1QNZH 3UX9B 3JBG7 2R1WB 5H94B 1NQBA 4A2MA 4ODUA 5GHWH 3IFPB 3DGGB 3QUMA 4PS4H 2R0KH 3CCHA 1LDPH 2ZG1A 2IPKB 5JW4R 2R0LH 3BFOA 2P8MB 5HVHB 1ITCA 3WJJC 5BV7C 2IFGA 2F19L 2CRIA 4QTIL 1QBBA 2ZOKB 2MHAA 5DT1H 2W0FA 5JXED 4LCWA 3T0XA 4D2NA 2QHRH 1KPUA 3QR2A 4N0UB 5F89B 4YQXL 5HVWA 1A1NA 1NCBL 4Y4KC 3S3JA 4U1SA 2VZ1A 1NGYB 3RZCA 4TULH 1D9KA 3QPXH 2NTFA 3DI2B 4P2YA 4IMLA 4I3GA 3G6JA 8FABA 4XBGA 3EUUA 2VMFA 3TFKC 1HH6B 4KGLA 5EU4A 1CFQA 2OYPA 2BVQA 4GW5A 1MREH 3RL1A 1QFWM 1F6LL 3ARZA 1IQWL 3MFFA 4S1RL 4GXUN 3NACL 5HD8C 4NHCL 1Z0NA 3NIFE 3VRIB 1JZ4A 4JN1H 4XP9L 5IUSA 3BSZL 5IVXA 1EZVX 2XRAH 3VDCA 2CKNA 3QCTH 2XXMB 4LNVA 3MRBB 1X4YA 2PYEE 1KF9B 4HJGA 4KKNA 2YPLD 1MCBA 4JO3L 4N0CD 5MEPA 4X7TA 3OV6A 1A7QL 4MGXA 3H9YA 4PJ5D 4OLZL 2NXZD 3CVHA 1IEBB 2ZUQB 1A3QA 1NFIA 4GRLB 2JIXA 3FOLA 4D8PB 3EDFA 2DRUA 3HI5H 1R24A 3P0YL 5SWZB 4JFOB 2Y4SA 4WTZG 3EO1B 4A6YH 5D1XA 2MCPL 1QLEL 5HVFB 1V3MA 3R06B 3MLZL 4KK9C 4MA7H 5DFTA 3GSQA 5HGDB 3QULA 5C6TL 1H3XA 2F8VA 2XG5A 1FG2B 4GT7A 3QG6A 4CRPA 3GB7B 2NY0B 1J1PL 5K9OB 3U2SA 4NJ9L 4YHZL 1IGFL 4XMKL 2WV3A 5C6PB 1OF2A 2WWMC 1IKFL 1DN2A 5C0JA 3U48A 3KPNB 5IHZB 1DFBH 4D0DA 1DANU 1XCTB 4Z7QE 3RKDC 2YXMA 2JJSA 4XVUD 2FECI 1IGCH 4NZJA 1UCBL 2WBWB 2OI9B 2D3VA 4KC3B 1MPAL 3ARGA 3P4OB 3V7MA 5CJQL 3U0TB 1ZGLM 3MCKA 5K59F 2K3TA 1KGCE 3CZFA 3ETBF 4P2OC 5C9JA 4JVPA 3S8WA 3OXRB 4P5KA 2HFFA 12E8H 1QSZA 1MNUL 4OAWA 3SKUD 1J5OL 1JWSB 4LVNC 3STBA 1YNKH 5C0BB 4F7TA 3LSOB 3KPSA 4HWUA 4PD4K 1WZMA 1OTSD 4POUB 4YFDB 5IMOB 4OD3L 3UO1H 3K4ZA 3OKYA 5SV4A 1NBYA 4S2SA 4XCCL 4HGKC 2C1OA 3TBYB 3STLB 5I30H 4I9WE 1K2DB 5JORB 2UWEF 2XZCH 3LQZB 3VXRE 1RZFL 5D2LE 3MBXH 2Y7QB 4MHHI 4PJEE 3TJEH 3C5SB 2L0DA 3V8OA 4JHWL 3LZFH 2YUZA 1RUPH 3S5LG 1ES0B 4GW1A 3WFHA 2EIZA 1CK0H 5I18L 2YMXL 3ZDXF 4XWOD 3U9UB 5MI0C 3MJ9A 1I8IA 5EU6A 3V4UL 3T2PA 2IH3A 4FFZH 5B39G 2Q3ZA 4XH2B 4OQTL 4NNPL 1NMAL 2AJXL 2B20A 2ATPB 1URLA 5I1CL 4TNVK 2P43B 3GFUA 5FKAA 4FFYH 3PHQA 1JF6A 2Q86A 4EN3C 1UH4A 1GZQB 4O2EA 2CRZA 5KSBF 3ULUL 1KENL 3HG1E 5KVEH 4LCCA 3DARA 5ANMB 1PQZB 2ICWB 2AJZA 3OG6B 1NEUA 2RCSH 1MFAL 4KMLB 3W2DH 3SBWA 4NQXB 5E8PA 3IGAB 3C60B 4A6YB 5IK3A 1BIIA 3FQXB 2CDFB 3MLUH 2Z31A 4F2MA 1LO2L 3IAPA 4JLRA 1RURH 1IBGH 4EBQL 1CFNB 3N1QC 3VFGH 5GRZA 3ZYIA 1HQRB 4LKXB 4ZPVB 1T3FA 3U79A 5HYQB 3L5XL 1UKTA 5FCUL 1H15B 4Z8FH 5ACZA 1KJVA 4YHLH 2DYPB 4KJYB 4WHYH 2F74A 4MCZB 1JPFB 5KOVC 4Q9CA 4MMZC 3TBTA 3OAZK 5F9OL 4RX4D 3U36B 1G7JA 4HGWA 5DUBB 3VWKC 1HKFA 2IAMA 4FS0A 3H0TA 4RMWA 1BQHG 3EFFB 4DN3L 3Q0HA 1IGML 1CXIA 1KCKA 2HTKC 3OQ3B 4L8DA 5ABDE 5L8JB 3SE3A 1EFQA 3ZKMD 3SPVB 1NGPL 3DXAE 3QH3B 4K3EL 3GIZH 5CZVH 3SE9L 4JPWL 5I1AB 4QEGA 4JM2C 2IJ0C 4KUCF 1L4IA 3X14B 2AK1H 3BX7C 5D7IE 3WXWH 2XA8L 2Y25A 3KXFB 1I85C 1S7WB 1T83A 1I75A 4IS6B 1X4ZA 4O4YL 15C8L 4RWHA 1F8TL 2JB6A 2J8UB 2EYSA 4OCSH 2MPAH 2AJSL 1AH1A 2CSPA 3DSFL 3OKDB 1XCQB 3QNYB 1UCTA 1F4AA 1Z3GL 4XP4H 4X6BA 4ZNEA 5T3ZH 1F11A 1L0YA 2FECL 3C5JB 3MRMA 2VDNL 4IRJD 1JPGA 1UYWL 4M9PA 3PWNA 4PV9A 1TZGH 1D6VH 1QFWH 1BMGA 3R1GL 4OFKA 4NBXB 3MRCA 4RMTA 1EO8L 1G7MB 2VXUH 5I76A 1CGVA 5ALCL 3JXAA 4W4NA 4MJ6A 4HUNB 1H3UA 4JQVA 1SVCP 5MENE 4U49A 2EZ0D 2J8HA 4JFED 4YBLC 2EEAA 5SX4H 4M7LH 5CD5D 2BJML 5SX5K 1ZHLB 3VI4F 5EIVA 4LDEB 1SMOA 3TF7C 2PO6D 4P9MH 4MJIA 3G5VA 4BJLA 5D1ZC 1YNLH 3RNKB 5DSCB 2FL5A 5CCKH 5BJTA 4HHAB 4YFLF 5EZJA 3AGVA 4M93B 5I8EB 2DQDL 2X4UA 4PJIA 3ARDD 4YNYB 4JY6B 4FMFA 2CO6B 3NFNA 1A6UH 1UG9A 4YEEA 3SGKC 3T0EA 1IAIM 3NGBB 3ZZ1A 3EYSH 3FN0L 1UA6L 3WIIH 1MIMH 3AVEA 4NFCA 4IIQB 3PGDA 1SMAA 3MOBH 4U1JB 4YHOL 3PIQB 3RX8A 3TVMA 3O11A 1BQUA 2XWTA 1N0XH 2ESVE 2DTML 3F5WB 4NKMB 3WSQL 4BZ2L 4ZD3H 2DJSA 3UAJC 4E41B 5DR5L 1SYSB 5HYJD 3S3SA 1J0JA 2XY1A 1XGQA 5LWYH 4HH9B 3MLVL 1AE6H 5BOZG 3UTZB 4K23L 4MDIB 4PBWD 5I66B 4TN9A 3MRQB 2PTUA 2VYRE 3MV7A 4KKBD 4M6NL 1J05B 2W60A 3DX7A 3AREC 1P1ZB 5DZLA 2F53A 3U0PB 5EOCL 1OWRM 2R29H 4JN2A 2A74B 3B2VH 1T20A 3ARPA 3PV7A 1X5XA 1NCDL 1FVEA 1EHXA 4PJFF 1ZA3A 3X11A 4NRXA 3ME0A 3NTCL 5BVPH 5L0QB 4YDLC 1V7NL 1CT8B 2GYSA 4DKFL 1FNLA 2IANE 3O4LE 1MRFL 2QTEA 4ZSOA 3TO2A 4LCYB 3IYLW 5D8JL 4U1HA 2NW2B 3VXPB 5H2BB 4I2XA 1XGRA 2VLRD 4EXKA 3B9KD 4C4KT 2ZJSL 4ZDHB 2DI8A 5BO1H 1LP9F 6FABH 1OAZL 3H8NA 5HY9B 1K4CB 1CU4H 4PRDB 1MJ7H 5DJZA 4TNWF 1AFVL 43C9A 1LEIA 1AGDB 2X9YA 1C5DA 4Y5YA 3NN8A 4KQ4L 5D5MB 4B53A 2NPLX 1CQKA 4G5ZL 5EU7C 2E6QA 4FQQB 5GGUA 4F57L 1MI5B 5AD0B 1QRNE 1CXLA 4FXGA 2HLFD 5GZND 5KZCD 5D7LA 1B6UA 2AXJA 1FAIH 5H37H 2V5RA 3HZMB 4QRRD 4FQ1L 3CZJA 1RZKC 3VFMB 1P4BL 2PCPA 1QSVA 3LD8B 4YHMH 5CKAA 4GS7B 4WV1C 3RWCB 5KSVB 4I4WB 3FO9B 3IDNB 3AU1B 1HQ4B 3IRZA 4HFUH 4P4KA 4U1KA 1DVFA 2DMCA 4WFGE 2HJKA 1YN7B 4NRYB 3RU8L 5EUKA 5IEKA 4Q9QH 1PKQB 4TQEH 1T04A 1XR9A 1QNZL 2DBLH 4N0UE 2GITA 5JMOC 3MODH 4OIIH 1IC7L 2HKFH 3GBLA 2OJEA 4W70A 3BKJH 4J4PA 1KJ2B 3EHBD 5GHWL 4Z7OE 2XKNA 1JYWA 5MEQA 4PS4L 5EFIB 3HE6D 4GBXC 3DMMD 5K9KB 5T3XD 1VADB 2YKLH 3BD4A 1LDPL 8CGTA 2Q6WB 4JJHA 5DMGD 5HI3D 5IROA 1HCFX 2R0LL 4R4ND 1KIPA 4UT9H 2FB4H 2ESVA 3D6GA 1U8MB 2R0WH 4X5WB 3SGJC 5ID1B 3G5ZB 3ESVF 5DT1L 3IFLH 2QHRL 5EBWB 4CVXA 3VGGA 1QA9B 2H8PA 3QPQC 3AXLB 4X5XB 3B3IB 3FKUS 1N3NA 3D18B 2ZUSA 1KXVC 3RVVC 1MCDA 3QPXL 4CMHC 2EDDA 2CLZA 3ARDB 3QUZD 4MXQC 3MC0A 3EIFA 4RFNC 5JDSA 4UOW1 5C0ND 3MRIB 1MREL 3MRHA 5I8CA 1EO5A 3L7FB 1T66C 5GJTH 1WBXA 1ZGLB 1TQCC 1CICD 2NY1D 4GKZB 2KZ1B 4X6CB 5HDQH 2BHZA 4I5BB 4GUPB 4NO0B 3BWUC 2DMKA 3KPOB 3DRQA 4ZXBA 2HVKA 5SWZE 5D2NA 1CFSA 4JN1L 4ZYKA 3HB3D 3DPBA 3QNZA 1N6QH 3RZCC 1XF5B 3VU2A 5HYJB 1RJLA 3QCTL 3L3OB 1D9KC 2YBRA 2ZUUA 2ICEB 1RHHA 3U9PH 1ZT7A 4X80H 1KG0B 1CE6A 2ATKA 2Y07H 3TYGH 4NN7B 3C2SA 3HR5B 3UZVB 2Z9TA 5E0QA 1ZK9A 5I6XB 1MHEA 1WZ1H 2VSCA 5DEGB 1F4YH 2BNRD 4HQQL 1AGFA 4A6YL 4LASH 2V7HB 5KSUB 1G9NC 4ORZC 1MSPA 4MA7L 2EDYA 2VN7A 4PGDA 1W0YT 2MFNA 1SJVA 1DLHA 1T7VA 3CJJA 1QRNA 4HIJA 4MSWA 2G75A 4LPYA 4HS6B 4K7PX 3DV6B 2BMKA 5IT2H 3PWUA 1J8HD 3ZT6A 3QAZC 5FYKH 5IP4A 1YYML 2VLRB 3B9KB 5C8JB 5J1TC 1NAMH 3UTOA 2QL1A 1DFBL 5IMLA 3EZ8A 4L4TA 2QKIB 5FB8B 3QUXA 1UWGH 3TN0A 2FO4A 3F62A 3ZE2F 1BZQK 4MNQA 2R1YA 3CPLB 1S8DA 4PJ8A 5FOBB 3FO2B 3C09C 4S1SL 1BJ8A 3SJVA 5TPWH 3T65A 4M6AA 4OSUH 1UGNA 5GGVH 1I1RA 1ORSB 1IAIH 12E8L 5KZCB 2HJLB 1E6JH 1YNKL 2UWEA 3F7YA 2VWEC 2F9BT 2XA3A 3C2AH 2P48B 1RZIA 5SX4I 3ISWA 1KXQE 4MLIA 2A6KB 4LIQE 5FK9B 2JJSC 5HHOD 1Y0LB 1H5BB 2HJFB 3UO1L 2XZQH 3WO3B 4I3SH 5DMKB 3ROLB 3GMPB 4R0LB 4N90E 2N56A 2BNUB 4I0PB 2Q7YB 4BM7A 5D71H 5I30L 3OTTA 2ZG2A 2XZCL 1CDBA 3S5LA 3TA3A 1FSKC 3MBXL 3TJEL 3QEQD 1OY3B 3WN5A 1F6AA 3LZFL 1RUPL 1CK0L 5JOFA 2W9DL 1AGBB 1VGKA 4LARH 3CLEL 4DGIH 4X6CF 1EHAA 4ETQB 4QRQB 5ANME 2XACC 3HE6B 3I3BA 4KKCC 4WUUA 5GSRB 5KSBA 1T21B 3IDYC 3ROOB 4HKJB 4ZPTA 3T4AA 4O00A 4GRLA 1PG7H 1IRAY 3VWJA 3NZ8A 3V0AC 3P4MB 3FB6A 2GK2A 3OJ2C 4JDVA 4V1DA 4FFYL 2C4FU 4JCMA 3RGVB 1OCWH 1RI8A 5B4MD 1NH6A 1YNTB 5CWSB 5F96H 2VDQL 5IR1A 5DD3H 1AD9A 5KVEL 1ZXQA 1WWWX 3JWDC 1IC5H 4FZ8H 4XBPB 4BFIB 1FZOA 3QUZB 3QUYD 2WINA 2RCSL 4LK4A 3K2MC 2UYLA 3W2DL 3L3IA 1K85A 1KPRB 3ZE1E 3VD4A 1ZT1A 4MQ7B 1CICB 2NY1B 1JMXA 2QQQA 5JA9A 1UEYA 4G8FA 4BSWB 3MLUL 4JRXD 5CSGA 4NQDD 1RURL 2EECA 3P77A 3VFGL 3S35X 1S3KH 4FFWD 5BZWB 2ZCKH 4LCCC 4BUGA 1F3DH 5HGHA 2XY2A 4N9GA 4X4ME 4Z8FL 5EDXA 4PJ7B 3S97C 4GXUM 2LTQB 4YHLL 5F1IA 1KSRA 1NJ9B 1BOGA 1F4WH 1J1OH 5KVDH 3LKPB 5F6IB 1L0QA 4R7DA 3HC0B 3K4AA 3SBWC 3GIVB 4PRNA 4DZ8B 2FBJH 3KXFE 2DQTL 4P4RB 3OKMA 3GMLA 4HKBA 5IJVB 2HWZL 2Z31C 5F44A 2J8UE 1IM9D 3S96A 4X6FA 4BUHA 3U7YH 3MNWA 4NNYB 3MRNA 4OZIB 3GIZL 1QLRA 5CZVL 4IRSA 4FQXA 1MRDL 1PZUB 4DUXA 3FT3A 1OTUD 2CXKA 2AK1L 2BOBB 3C5SA 3WXWL 2EXYC 4IOFC 4X0KB 4DW2H 3OJMB 3WUWA 4UAOB 4NKQB 3UBXB 4NQCB 4LLYA 2OL3H 5I9QB 2IAMC 1FGNH 1QPPA 1MAMH 1AXTH 1FH5L 2APTA 4R26H 3MJ6A 1W0WA 4JANB 4OCSL 3SE3C 4X6DB 5CD3A 4PY8J 2MPAL 3U46A 4ZUUA 1MY7A 1UXSB 4WTXA 3V0WH 2B5IC 3JUYA 3ZHKA 3ZE0E 2P5WD 3CFEB 3JWOC 4OIAA 4XP4L 3NFSH 5DC4B 1BAFL 3DO3A 1QSED 4YHYB 5JHDD 3PQYA 3WNNA 1ZA6B 4Y4FC 1U8QA 3NMEA 1A14H 1TZGL 3TBVB 1D6VL 1QFWL 1T83C 4NP4H 2HRPH 5EC1B 5CZXD 3SDXB 1LD9B 2VXUL 4GQ9H 2FGWL 4PP1D 3QNXB 1UB6B 3O4OC 3OGCA 3BO8A 5HHOB 1V5JA 5TE4L 3WD5H 3OKKB 5C86A 4PJAB 1KFAH 2JK5B 4M7LL 1OSZB 3LEYH 2FH8A 2VLMD 5E1AB 4O2FB 2JKXA 3S3PA 3O45B 3M17B 5C92A 3GNMH 4HUUB 1IEHA 4P9ML 4PJCB 3B6SA 1FC1A 4ZTOH 4XNQB 5GS2H 3W0WA 4OF7A 4RAVB 5HYQA 1O0VA 4KK6C 4XP1H 3EJYC 3TO4A 5CCKL 1LNUA 1S7XB 4JQIH 4X7DC 5F21B 1ZLVK 4RGNC 3RGHA 4NYLA 3NCYP 4E41E 4FNLH 3P2TA 1MCIA 3UC0H 3HPJB 3GMNB 4JQVC 2EICA 5I15H 5C0EA 5CINH 3I50H 5DUBA 1A6UL 3OHXA 4U2YA 4HKZB 1EA9C 2ADGB 3EYSL 1LVEA 3I6GA 1QSFB 3OAUH 1NDMA 2BC4B 1MIML 1S7RB 4QXGL 5F3BB 1OD9A 3K0WA 2LU7A 4HD9A 3SPVA 3BPNC 4EIZC 1S7QA 2PW1B 1N0XL 4NO5A 4HJJH 2GKIA 3U6RB 1FVCB 3V95A 4H88H 4JPVH 4BFGA 5LAXA 3O3EB 4ELMF 2YHGA 1FHGA 1QO3A 2BDNL 3QUYB 5LWYL 4BH8A 1MELA 1AE6L 3HZVA 4PJFA 2HFEB 2KQMA 4D9RD 3FO1A 4R3SB 4HK3N 1BBDH 1DEEA 1I8MA 2R23B 4XI5D 5FEBA 2NCMA 3OKDA 2R29L 5KW9L 3TVMC 5CGMA 4JRXB 3NCYS 4NQDB 1NANH 5JQHC 4Y8DC 4YC2B 3B2VL 1EO7A 3HNTH 1N4XH 2HT2D 5DQ9A 3MXWH 3VXMD 5T3ZE 5F6HI 4EI5C 1TQBC 2CK2A 4CUCA 1LP9A 1NBVL 1OSPH 2AKRA 3F12B 5BVPL 3FO0H 3OF6D 3DETD 2RR3A 4X6DF 2X4PB 1BF2A 2OL3B 3GJFH 3QA3B 5D5ME 4LPWA 4U1NB 3CFJA 5FM8A 3WE6A 3SKNA 3CUPB 2H41A 3HE7C 4BSVA 2J5LC 5JIIA 2AEQH 1MI5E 3MO1B 4CU7A 3TNNA 1KEGL 1HOCA 1I1AD 1NEZB 4YDVA 2QHLA 2BCKA 4GG8B 5E8DH 5BO1L 4NO2A 2P4AB 1IM9B 4UOJA 1CU4L 4DGYL 3E1F1 1MJ7L 1HN1A 1XT5A 4UQ3A 4H5SA 4XPHL 3NA9L 2EE2A 4R7NA 5C0FA 3U30C 3Q6GH 4TUJA 2XNAB 3FQWA 3JTTB 4MA1B 4YZFF 1D5XA 4IDLA 3MNVB 2ZSVA 3FFCA 4PJAF 1JZ5A 1PKQE 4Z77B 1EAPA 3HRZB 3HPLA 2GY7B 3ZYJA 4BQCA 2Z35A 1FAIL 3PJSA 3O41B 4FN0A 4JEGB 4D0BA 5K9JH 1JYNA 1S9YA 1FCCA 2AGJH 2H45A 5HGAA 4G6KL 1N6UA 4YHML 1PW3A 4G9DB 4LLUB 1BZ7B 4X9BA 3ZTNL 1EJOH 1N8ZB 1JP5A 4HFUL 1A6AB 2DF3A 4Y5YC 3TCLA 3ULUF 1R6VA 3O2VH 4B41A 1I3RA 3QZWB 1FV1A 3PDGA 4JHZA 5FO9A 3VXUA 4E41A 2HTLC 3PWLB 4UNUA 1A2YA 4Q9QL 4K2UL 5JO5B 3A67H 4TQEL 1OP9A 2AXGB 2DBLL 4XRCB 3MODL 4OIIL 2HKFL 4TSAH 2DQHL 3BKJL 3V4PH 3OSKA 2XWBB 5EIIA 3HLAB 1U8IA 2VZOA 4JFYA 3LKSB 3ARBA 4H25A 2YKLL 3BHBB 1G7PB 3EYQD 3QIWB 1H8NA 2OS7A 2FB4L 3H9HA 2D7OA 4Z0XB 4MB4A 1QVOA 1HNFA 2R0WL 4OI9A 3GDBA 4QF1A 4P4KC 1DVFC 3TESA 4CMMB 1UQSA 1OGAD 3GO1H 3IFLL 1ZHNB 4X6CE 3SDDA 1IT9H 3CIQA 3NOIA 4FQLH 1JNLH 4UT7H 1NFDB 4LQFH 3UTTB 3GMMA 2NZ9D 5HYJE 1AR1D 1TJHH 4J8RB 3B9VA 3E2HC 4YPJA 1Q9LB 3MZTA 3IF1A 3EDKA 5ICXB 2BVUA 2VR9A 4CVZB 5H2BA 1SBBA 2X89A 5IROC 1EBAA 1C08A 5GJTL 4U3CA 1I4FB 5DLMH 5T3XL 4GOSA 4U7MA 3KYKH 5HDQL 1XF4B 4U6YB 1MHPH 1HHHB 3VXNA 1AO7B 5I1LA 2VDRH 4P5MB 4H0IA 2CJUH 2NY2C 3BPLB 3D87B 4K71B 1N6QL 3QWRA 4LHUG 3GJFB 3KAAA 4G9FB 1VPOH 3U9PL 5F9JB 5E8OB 3KS0J 4HLJA 4X80L 1EJ6A 4P57B 5D96C 2Y07L 1MFCL 5E9DA 2ENYA 3TYGL 3LKRB 5EO1B 2BNQD 1I9IH 3BGFC 4PJDA 1ORQB 1PYWA 4N8VG 4YHNA 1A7OH 3G9AB 3TNMB 1WZ1L 3GI9H 1YJDH 4OLEA 4TOYL 2X4RB 1WTLA 2VLRE 2HMIC 1D6EB 2VLJA 4NWTH 1A6TA 3UTPD 4L3AA 4LASL 5E6ZA 1U3HB 4ZXBC 1QRKA 5D2NC 4XAKD 4Z95H 3OB8A 4UDUA 2CGRL 4NJAL 4RBPH 3WFBH 1U93B 5HGBA 4L9LB 4RZCB 4NZRH 5SWSA 3UZEA 2PTTA 2Z91A 3I84A 3MMEB 2IMMA 3DROA 4FTVA 1Z9LA 1EHLH 4Z7UB 1NUFA 2FSEA 3G5XA 3RPKA 5F1NB 1KJ2A 5DK0B 4P2RD 5DJ8B 1NAML 4LRNH 1MVFA 4EEEA 5IB5A 4KWUA 2DI7A 4CKVX 4DEPB 4GLRI 2X4SB 3QXDA 2CDGA 4MHHG 1CGYA 2V9TA 3IDGB 2I9TB 2OTWB 2VXSH 5TGBB 4HDIB 4LBEB 1UWGL 4OT1H 2BP3A 4UIKH 3Q6FB 5EOQH 4PRBA 5EBLA 4OQ1A 3V6OE 3O6MH 3IETB 5K93A 4IOIB 2NY6C 1MJUH 1X5YA 2V2XA 1RJZA 3VH8A 4KTYA 5JLZB 4JFFD 4WW1B 5TPWL 4CBPA 3QO1A 4ZODA 3BP4A 3EJZD 4OSUL 1S9VA 1T2JA 4JFPB 5GGVL 5IW1A 1OTTC 2RBLA 1IAIL 1XGTA 1OP5K 4MJ5A 1UZ8B 1YUHA 3N50A 4M5YL 1E6JL 3D3VA 1PBYA 1S7VA 3C2AL 4QNPF 4WVRA 1H8OA 3RHWK 3GSOB 4OLYH 3ARFD 4MVBC 4UUJB 4ONHA 1K8DB 3QUXC 5EZLB 2XZQL 5EO9A 3BQUA 1NGXB 1BBJA 3DURB 4I3SL 4PJBB 4PLJC 5I71C 4I5BA 1NFDF 2SEBB 3TIEB 2FH6A 4PJ8C 1JGDB 5D71L 3PHOA 4APQB 3WLBB 1C12A 4EQ2A 2D7TH 1JWUA 4XGZB 4JG0H 3VG9C 4LLWA 3VFOB 2NY3D 1L0XA 3OR6B 4C4KO 5LBSH 3QYCA 1MCKA 3P9MB 1ETZB 5I19H 1FJ1A 4LARL 4DGIL 5HHVH 3GSXB 2FJFA 3UPRB 4LP5A 4YR6A 3D0VB 5C2UB 4HIEB 1BVLB 1PG7L 1P5UA 3ZKND 5M95B 2FBOJ 4UNVA 4S0SD 4G6AD 3MJ8B 1A6VH 3LV3A 5EBMB 4KROC 1BREA 2AXFB 4XP5H 1KTLA 1CLCA 4S11A 3X17A 1OCWL 3UDWA 3TA3C 2PF6A 3WN5C 4CNIA 5TH2B 1R5VB 3LKNA 4I18B 2VQ1A 5F3HB 3EOAA 1IC5L 1MHHB 5E1HB 4FZ8L 2VTFA 5DXWA 3PGCA 3VD9A 5C71A 4XMLH 4PJ7E 3WIHA 2VL4A 2WUBH 3LIZH 3IXAB 5FYKE 2NXYC 1WWAX 3VWJC 4OTXL 1H9VA 4KFZC 5H35B 4E5XA 5E94A 3QDJA 2GUOA 3ULVF 5EOCJ 3V7AE 5ITFA 3RWGB 3WO4B 4MS8D 4K07A 3UXFA 1U91A 1X5IA 4OZHA 4D0CA 4E42B 2ZCKL 4X99A 5DYOB 3EAKA 2Q8AH 1XZ0B 3V0VA 4OZIE 4HXAH 2AEPL 5CHNB 1ACYH 3MGTB 1F4WL 4NCC2 1J1OL 5KVDL 1DLFH 2WW8A 5T1KD 4C56B 3BZFB 4NOBA 2MNUA 1SJHA 5CILH 1U8PB 4I0KA 2FBJL 4CDGC 3QRGL 1SYVA 4JO1H 1I7ZB 2E9BA 3MYZA 4NQCE 2WZPD 1K8IB 1WUNT 2ERJB 4QT5A 5ADPH 1P6AB 4X6DE 1J9CT 3U7YL 4WU7B 1V7MH 2VZUA 2V2TA 4XNYH 3ECBA 5INCB 1RJYB 1F2XK 2NR6C 4Q9RH 1MJJB 4KJQC 1NLDH 4GSDL 3OB0H 1R3HB 1JBJA 2A77H 2OQJA 2GK0B 2GSIA 4Y4KD 4PR5B 1BQLH 4TUKH 3C9NB 3QIBA 1MAML 1AXTL 4QHLB 4R26L 2LFGA 1R3JA 3S36H 2BY3A 3TFKD 3SDXE 3PP4H 4I3RH 1KIUA 3BIKA 3T3ME 4NQED 4Y5XC 2DWDB 5HHOE 4KZDH 4IRSC 4UU9B 4FQXC 5I2IB 1I9JH 3CC5A 1VFAB 3NFSL 4PJAE 4HF5H 4LMQI 2JJVA 4X7SH 1HSAB 4JFFB 3AM8A 2WUCH 5BV7H 3LQAC 2ED7A 5EG6C 4GG6F 4PJCE 5DD5H 4JVUA 1A14L 3TBWB 4Z78B 4P3DB 4NP4L 3FTGB 3TJHC 2HRPL 1KIQA 3FT4A 4OCXH 4GQ9L 5FDWA 1ZVSA 4NWUL 3RVUC 3ARFB 1AIFA 5TDOB 3S36X 3ZTJH 5FYLE 4ZO6A 2EDHA 3QDGD 1H3WM 1AP2B 3WD5L 5C09A 1B90A 1KFAL 5BMFH 4RMQA 3LEYL 2L7UA 1FC2D 1QSFE 4GRMB 1KB5A 5MEOB 2I07B 4P2QA 3HZYB 1WQVT 4X9FA 2NY3B 2HFTA 4NM8H 4LKCB 4XP1L 4OM1H 4JQIL 3GMOB 5DEFB 3VDAA 3FOMB 4KK5D 4R96B 1QP1A 3UC0L 1CL7H 1X44A 1ZEAH 2YEZB 3DVNB 4HBQA 3HC0A 5CEYA 5I15L 3BJ91 1MUJB 3L3KB 5CINL 5HHQA 3I50L 5L9DH 2IEPA 4ELMA 4YJZL 3D39A 2MQ0A 2UUDH 1ONQA 3OAUL 4G80B 5D7KD 3EGSA 1T1YB 2KDGA 4NC1E 2CD0A 4P46D 4Y19B 3KLHD 3KYOB 2FX7H 2OSLA 4NT6A 4HJJL 4XNXH 1CLYH 4JRXE 4NQDE 4MDJA 3TO4C 4H88L 1FNGB 4ZQKB 4ONFH 1VACB 5GGRB 2GT9A 3VW3L 1JGEB 2X4OB 3E0GA 5E8NB 4G6JH 2FD6H 3NAAL 1FNEA 1LQSR 1HXMA 1GPOL 5J13C 5T33H 3SKMA 3HMWH 5C0IB 2ICWJ 2X4TA 2E3VA 1BBDL 2F54A 5DO2D 4XHJC 4X6DA 3G5YA 2WIMA 4AH2B 5EU5B 1QKZH 4CN1A 3QEUA 2NY5C 4OKVB 3SO3C 3MRRB 2B0SH 1PZ5A 1PSKH 3HNTL 4R90H 1N4XL 3OJVC 3MXWL 5T5FH 1I8KA 1W8OA 3LY6A 4QOKB 1OSPL 1MCWW 4N9OB 3FO0L 4QRPB 3FQTB 4WEMB 4X9GA 5HDBE 1EFXA 2AV7A 3O3AA 1DP0A 3VCLB 4JDTH 4WI5A 2B1HH 3DIFA 1CDGA 1R3LB 1SEBA 4Y1AD 4WTWA 2AEQL 3PDOB 4JFXB 3RBGA 3BVNA 4LLVB 2EE6A 3C5ZD 3FQNA 4PUBL 4MNHB 3TLRA 4CW1A 1LO5B 4PRID 4NPYA 1K5NB 3FB7B 1IEAB 3MJ7A 3N1FC 3OKKA 5E8DL 3RTQA 1XF3A 4M3KB 5BQ7A 2JLLA 2O5XH 1MCEA 3KPRD 3DVFA 1FZMB 5CGYC 5IBTL 4OQTA 1A02N 1CGTA 3NPSC 4DVBA 5BV7B 4KI5D 2QADC 3O45A 4EVNA 2R56L 3SCMA 5C0DA 3Q6GL 1UADC 4HUXB 5B38B 4ZS6C 3ILPB 3QI9A 3EYOA 3QJHB 3SGEH 1DZBA 4Y4KB 5ESVB 1IM3A 2YPKB 4YAQA 4P99A 5E4IA 3CFKB 1CF8L 5K9JL 2A6DA 2AGJL 1W72A 4GMTH 1WC7B 3WDHA 1QSFA 2NMSA 1YY8B 3L5HA 2V7NB 1OVZA 1SJEA 2BC4A 1S7RA 1EJOL 5FUCE 1EEYA 1MCQA 2X70A 1M05B 2OBGA 3O2VL 4OZGB 5D6DA 4HPYH 2NLJB 1VSCA 2VZSA 3RWHB 3A67L 1WK0A 1RD6A 5DI8B 1IZKA 2AK4D 2V9RA 3HZKB 2P5ED 4TSAL 3V4PL 2FDBP 2G2RA 1NFDE 3FQRB 3UTTE 3KJ4C 1MF2H 4N0YH 1YPZF 2W0PA 4NN5C 3QDGB 4U6HA 4WHYG 4XC3H 5TE7H 3QJFB 4H20H 4XCNB 3W39B 3VWKD 3B5HA 4HCRH 1FFOB 1QQDB 1RUMH 1IGJB 1RK0B 4JFDA 3QEHA 5E2UH 3O3BA 5BRZA 5FHAH 1QD0A 2D03H 1KCVL 1T0PB 3GO1L 1ZHKA 4PJXB 1IT9L 1M71A 1AO7E 3BZ4B 5LGJB 1QACA 3INUH 4FQLL 1JNLL 1W8NA 4UT7L 3MRLB 4LQFL 1WAAF 2OX5A 3GK8L 4ZNCD 5ISZD 3CX5K 1TJHL 1I7TB 2HH0H 3ARBC 4G9FE 1JYXA 3WFEH 3FRPA 1U8HA 1VB9A 2ADJA 1KN2H 2H2SC 4LPXA 3R8QA 1X5KA 2ZCLH 4ZO8A 3KYKL 1CFTA 4AIXA 4KZEH 1CE1H 1MHPL 5D6CB 3SDDC 2VDRL 3HA0A 3MV8D 1MAJA 4QTHB 2CJUL 3RWIB 1JPSH 3UPAA 5C07A 2EYRB 4BA8A 4W6XB 5KG9B 4PREB 1VPOL 1CDHA 2E7HA 1Q94B 4P2OB 1ZT4B 2VERN 5D1QA 3WL9B 1I9IL 1GGCH 4Z7UE 2QBWA 3GJEB 1A7OL 3GZKA 3IDJB 4FG6D 1M6OB 3D2UA 3QIUC 3REVA 1YJDL 5C0AD 4DK3A 3MA7A 1KNOB 5SV3A 4NWTL 5J6GB 4QHMB 1J0KA 3EYFA 4NZUH 4NN6C 3V5HA 3EDEA 2EO1A 3L3HB 4QRSB 2A6IA 3LB6D 5FF6B 1GOGA 1LO0H 3DUSA 5JOPE 1WJ3A 3WFBL 4JO4H 2O5ZH 5C3TA 2P8PB 4NZRL 5DHVA 3PWPA 4HMEA 2AXGA 2N7BA 3FB8B 1FN4A 1EHLL 4RISH 5CSZB 3I6KA 3IDMB 4Q7DA 4DTGH 4Y1AB 4MD4B 4L3EB 5TE6L 3SE4A 2OMNA 3IU3B 1T03H 4LRNL 4OZGF 5MI0B 1FL5B 3LPWA 2KZWA 4PRIB 2BFVH 4HC1H 3IJSA 3MNZA 2VIRB 5DJAB 5I17A 3KPRB 4LSPL 2VXSL 2X7LB 4RA0C 1FZKA 5JIPA 1U3ZA 4OT1L 3SO5A 4ZOEA 4ZFFB 5EOQL 3F6IA 3X3GH 4CMMA 2Z92A 3RWJB 4JRYD 4V2BA 1FIGH 4LOUC 4PJBE 1MJUL 3TC9A 3T2OA 1WBZB 4EN3B 4OF0A 1UC6A 3KDMB 3QFDB 4P23A 1QFUH 1NFDA 3UTTA 1A9BB 1NGQH 1U95B 2D7MA 4OBSA 2J4WH 2P7TB 2BERA 4U05A 2YZ1A 4OLYL 5GRJH 3LQMA 3DWTA 3LDBC 4NSKA 3C6LA 5KAQF 3ZKSD 2I60H 3J8F7 5IW3A 3O2WH 1RHFA 5CEXB 3BE1H 2AEWA 1EEZB 5F72S 3MZGB 1P2CB 2V5YA 3GSWB 4YDKH 4P5MA 2A0LD 3VE0A 3BH9B 2D7TL 3GBNH 1AC6A 3LN4B 4MWFA 4OZFA 4JG0L 2Y23A 4JZOB 5EPMA 4RQQB 4EJ1C 4L1HA 4POZC 3ZLQC 4G9FA 2VLLA 5LBSL 1NC2B 1CL7I 4W6WB 4LSVH 3REWA 1S9WB 1MFEH 2ENSA 5L8LB 5I19L 1S7TB 4LHJB 1QBAA 3KPMA 5HHVL 1JHKL 1MEXH 3IKCA 3UJIH 5CFHA 1DANT 5EH1A 2G9HA 1D7FA 3X13B 5IESH 3VWKB 1T7ZA 3QISA 3OKLB 5F7DA 5EN2A 5CMAB 1WFTA 4PRPD 3QQ4A 1RV6X 1OL0A 3L3DB 1ZSDB 4WO4D 4PJHF 1U58B 4JM2B 2VLKD 2BRRH 2DKSA 3QCUH 1RJCA 2CH8A 1QFOA 4YK4C 5ISZB 1P53A 2P8LB 2ADIB 1BFVH 5JQ6L 4NM4H 4R4FH 4PLOB 4XMLL 2BOCB 1R3KA 3HC4H 1XF2B 2WP3O 3D0LA 2WUBL 3JTSA 2X1WL 1M7DA 3LIZL 3SDCD 1INQA 3PV6A 4GKNB 1E4KC 1AQKH 4C56E 3T3PE 2VAAB 4JZNB 4LF3B 4KTEH 5CLTA 3VI3E 1NBQA 1UM4H 4HDIA 5H37G 1TTFA 2X4QA 4K7FA 4ZUWA 3L9RB 2Y06L 3UDWC 3IETA 5I1JL 1T5WB 1U8NB 5IF0B 1KLGA 1T0MB 2VABB 4WW1A 1B4RA 4HXAL 3HI1B 4QHNB 4JKPH 5ETUA 1ACYL 4F7CB 5L2KD 3O6KL 4NDMA 1DLFL 3AY4C 2X1QA 5J6HB 5A3ID 2FCBA 1A7RH 5J89A 3CFBB 5CILL 5CGTA 3RPIB 4GAJH 2QQNH 4JO1L 5C0AB 3DRTB 1ZVYA 1NC4B 4OFIA 1RZKH 4ZFOB 5ADPL 4YBLB 1V7ML 3ARRA 1KIRA 4XNYL 1A4JB 5F9AC 4APQA 4Q9RL 2VXQH 2A9NH 2A77L 1NCNA 3VFOA 2E6JA 2H32H 3QPQD 4JFFE 3M1BA 4NKDB 1MLCA 4TUKL 4LNRA 5KS9F 3BDYH 4KKAC 1JNHB 4MXQD 3S36L 5IOPA 4CJ0A 3GKZA 3D0VA 3EKCA 3PP4L 4GG6A 4I3RL 3VFTA 2WBJA 2VXTH 2XYCA 3TGXA 3GHBL 3NFPA 1PX4A 5IBLD 3NBNA 5D93C 4KZDL 1T7WA 3U4BH 4F7PB 5MERA 1I9JL 1VFOA 3U4EB 3N85H 4HF5L 4MCYA 1XIWC 4X7SL 5BV7L 4CADA 2WUCL 5I1EH 4L9DA 3E6HB 4QCIB 3SDAA 5BW7C 5DD5L 5JW5B 1BGXL 5GSVB 3JVGA 3MRPA 4NQSB 5GGSA 1UKQA 1VKXB 3QIBC 1OB1A 1DQJA 1I1YB 4PGJA 4OGAD 1NGZB 1QYGH 1X4XA 3QUMH 2IH1B 1IL1A 3AREB 2CIKB 5C7XH 3E6FB 2ITCA 3LEXA 4X83A 5BMFL 5EC2B 1DN0B 2G5BA 3P3YA 3IJYB 4DFHA 2P42B 3AM8C 5D9SB 5GRXG 1KJ3H 2AJ3A 2AQ3A 1UJ3B 4G8GB 1P84J 5C0CD 2BHUA 3UTQB 4O51A 4Y19E 5HI4C 4OM1L 4MAYD 3BP7A 3BPOC 1KXTB 3FONA 4XNMB 1AQDA 2W91A 4YDLB 5DD6B 4HBCH 4X8JA 4OCMC 3GGWB 1ZLSH 1CL7L 1ZEAL 4EDXB 5E7BA 2ORBH 4D3CH 3G9VA 4H26A 1U8PA 5BXFA 2OTPA 5L9DL 4C55A 5DVMA 5DQJA 2APVA 4RFEA 1F3JA 2JIXD 1K4DA 1Q0XH 4PJ5A 4M61B 4PRPB 5D1XD 3L7EB 1KC5H 5DFVC 2FX7L 4XNXL 1CLYL 1OARH 2BSTB 3O6FD 4WO4B 1D5ZB 3V7AG 4J3XA 2X40A 4ONFL 5IVZB 5AAWA 2NX5D 3VRLE 4QOKE 4G6JL 5DRXB 2FD6L 4MAUH 1UM5H 1TPXB 5B8CA 4QRPE 2WK2A 4J1UB 5DVLA 5T33L 4JFQB 4KRPC 2XPGB 3HMWL 3VXTB 2Z93A 2VDOH 3N1MC 4B7LA 4NGHH 1IILE 1ZHBB 4XCYA 3ALWA 1SHMA 1FL3B 3CVHH 1QKZL 4WV1B 1S78D 1UVQB 1HYSC 4TTGA 2YRPA 2B0SL 4R90L 3UBXG 4BKLA 5T5FL 1YDPB 4S10A 4Y5VA 2H32B 4R4BA 4RNRB 4YDJB 3ARGD 4M1CD 4DKEH 5F6HJ 4HXBH 5E03A 4ZOCA 4UILL 3OBAA 4JDTL 1HZHH 1HILB 1JTPA 2B1HL 5BS0B 4XX1G 5GJSH 4KPHH 1LE5B 1YMMB 3RNQA 4GAYB 4HUMB 2J6EA 1B0WA 1SM3L 5DWUH 2XKSA 4GBXB 4R97C 4HWEH 2KKQA 4KKCD 1OQXA 4ODHH 3KPSD 3ARTA 4WUKH 2O5XL 1I3VA 2EDTA 2RFXA 1MH5A 1RIVH 3WXVH 3RVTD 1G7HB 5I73C 4MXVF 3MGOA 2FR4B 4LLQB 3D85D 4NKOA 2ARJQ 3KPTA 5BOPA 1FNSH 1A4KA 5GRUH 1U8JB 2FJHB 1R5WB 4OZGE 5DHYB 3LRSB 3S4SB 4G8EA 4M7ZC 5DK3A 5DD1H 3RFZC 4ODUB 1ZGLP 2C4XA 2WBKA 1NAKH 3QUMB 5JDJA 3CCHB 4GMTL 4QWWC 4AEHH 4MLSA 1OPGH 3RTQC 3KPQA 4L29A 3WHXA 4N8PA 1HHJA 3LS4H 5SWQB 3QDGE 1TQCB 2GSGB 3SCMC 2YK1H 4Y19A 2MHAB 2W0FB 4LCWB 3QQ3A 1YPZA 4PV8A 4LSUH 2CKBL 4XAWH 4HPYL 1KPUB 3VGAC 5I16A 3QI9C 2RB8A 1J86A 3WLWC 3RA7H 1A1NB 1CIUA 1YZZA 4U1SB 2B4CH 2X9WA 3ULUC 2F15A 3RZCB 4ISVA 4PJXE 3JZ7A 1D9KB 2NTFB 4IMLB 2R9HC 3G6JB 1T1XB 4XBGB 8FABB 4I0CC 4Y8AA 1CFQB 3JWDH 3U7WH 3GM8A 3L3JA 2BVQB 4GW5B 4N0YL 3RL1B 1SVZA 3MJ9H 4XC3L 2GQHA 1YEKL 4H20L 1WAAA 4HCRL 3MFFB 2EDWA 2I9LA 1RUML 3IAQA 3O0RH 3EDDA 2V5MA 1JI2A 1K6QL 2IQAA 5D6DC 3BD3A 2JF1A 4WNQA 3IVKA 5FHAL 1Q9OA 2D03L 5E2WL 2Y36H 1JF5A 1EVTC 4QOKA 5IVXB 2EXWC 1PGRB 4WDIA 5DTFA 5BVJA 3INUL 3F7QA 4LPTA 3KJ6L 4HJGB 3RI5F 4PRHA 2HH0L 4QLRA 2G60L 4AEEA 1KT2A 4Z7VF 5MEPB 2H2PC 1RU9H 3WFEL 4ZAKC 3CVHB 2IALA 4RIRA 1KN2L 1NFIB 2JIXB 5JIHA 3FOLB 1J12A 4B7IA 1R24B 3CSPA 2OXHA 1CDIA 3EOYG 3KPPA 4KZEL 1CE1L 4K9EL 2GTZA 2OR9H 3WJJA 4FZEH 2FIKA 1JPSL 3GSQB 1KGCD 3QULB 2H26A 3QXAA 1G7LA 4RDQG 3T1WA 3TBSA 1Y18A 1WVZA 3QG6B 1F3DJ 2FEDD 3C09B 5L6YL 3CDGA 3U2SB 1GGCL 5DF0A 5M7QA 1OF2B 5C0JB 4MQSB 3AAZA 4D0DB 4Y1AE 4J6RL 1A7PH 4ENEC 4L3EE 1X6NA 4HG4J 5L88L 5HHPA 4NZUL 4PRIE 4ALAH 2FZ3A 4WFFE 3KPRE 3PE9A 4OZGA 3VXRD 1DDHA 1LO0L 3AS0A 3ARGB 4JO4L 4KI5E 2O5ZL 3MCKB 4XB7A 1V3JA 3CZFB 5C9JB 4OFYA 2VKWA 4HS3A 4P5KB 4RISL 2HFFB 2VB5A 3QUKA 4IRJA 4DTGL 4OAWB 4G8IA 1A0QH 1VDGA 1BFOA 3B4NA 3VD5A 1T03L 3QZWG 4OD1H 1IAKA 2ZSWA 4WU5A 3KPSB 4HC1L 1J8KA 4OCYH 4M4RA 3T09A 1NBYB 4S2SB 3DUUA 3K4DA 3X3GL 1UM6H 2C1OB 4ZFOL 4OD2A 4JFEA 4YO0A 3BW9A 5CS7A 4Q9BA 5LGJA 1BQSA 1UACH 1OQOA 2R1XA 3DX9A 1QFUL 4GW1B 3WFHB 2EIZB 4HWZA 3SE4C 1NDGA 2ID5A 1CG9A 1I8IB 5EU6B 2J4WL 5GRJL 5EULV 3T0ED 1P84K 4HEPG 2I60L 4KHTH 3O2WL 4WW2F 5FKAB 3PHQB 4YDKL 4JREB 2Q86B 3BWAA 4ODBD 4P23C 5D7JC 2YD2A 4O2EB 1T4KA 3N1GC 3RUGF 4LCCB 4X7CC 5DJXA 2B7DT 4LSVL 2AJZB 5ESQB 1ZT4A 4OF8A 5ERWA 2AXHA 5DS8A 3ZT7A 3C8KA 4O58L 2WIIA 5ISZE 1IGYA 1MEXL 4PJHA 3UJIL 2FHBA 5IESL 5E8PB 3RVWD 5I75C 3KWWA 1JZ2A 5IK3B 3DXAD 4BFEA 1BIIB 4HULB 2D4DA 2GAZA 1QG3A 2Z31B 4F2MB 3O2DA 4JLRB 3V6ZA 4QRSA 2CLRA 3VJ6A 2A73A 1B0RA 4Q0XH 2DN7A 2DLIA 4XPAH 2YSSA 1JMZA 1T3FB 1BM3H 4HEME 4K3DH 1KJVB 2BRRL 3TT3H 5ACZB 3QCUL 3VGFA 2F74B 4TTDD 1FO0H 1BFVL 4NM4L 4R4FL 3HC4L 3TBTB 4P9HC 2YZ8A 4F3FA 3QP3A 3C08H 2X09A 3VFRA 3VXOA 1G7JB 2MKWA 3IU3A 4HGWB 1AQKL 1ADQL 2ZKHH 2IAMB 3H0TB 1YC8A 5ILTH 3IS1X 1FE8H 4XCEA 2PXYD 4L8DB 4KTEL 3MROB 1UM4L 4DAGL 1HKLH 5C0AE 2APXA 3DHMA 2DLGA 2B5IB 3RJDA 1N5YH 4F37F 4WWKD 2GJZA 5ECJE 4KJWD 2CUMA 3ULVC 1Z9SA 4OGZA 3PWJA 4JKPL 1JF1A 2VUYA 1FRGH 1LILA 5IHLB 5HYSA 1U95A 1A7RL 2E7BA 4JDZA 2XV6B 2K1MA 5D7LD 2C26A 1II4E 3V5KA 2JB6B 1CBVH 2EYSB 4GAJL 2QQNL 3O4OB 5KTEH 3KYAA 1TJIH 2EIEA 3GBML 1NBZA 4QYOA 1RZKL 2C4FT 5KS9A 1T2XA 3MSPA 3GSWA 3M45A 4X6BB 1F11B 3MRMB 1K3IA 1JPGB 4FMKA 2VXQL 2A9NL 3PWNB 4PV9B 1NMBH 5F7WC 4LPVA 4UIMA 3CFIC 1T1WA 1KOAA 1J0IA 4Z7NF 4LU5H 4AZ8A 3MRCB 1PG7W 3BDYL 5I76B 3S7GA 4GKSA 4J4PD 5JHLL 1ZKAA 4MJ6B 5ADOH 1AD0B 1VERA 4EUPA 2VXTL 3OKLA 1U92A 5T5NG 1D5MB 3KNBA 5DZNA 2ESVD 2BXYA 2PUQT 1ODAA 3DMMA 4HZLA 1I9RL 2NNAA 3BPNB 3N85L 4MJIB 4R2GD 3G5VB 1W2KT 2YPVH 5I1EL 4XCFH 5JMRA 1FDLH 4ELKA 4RFOH 1U58A 5T5NF 1NL0H 2FL5B 4RAUA 3O3UN 2NY2D 4G8GE 5BJTB 1CD8A 5EZJB 4IDJH 2YD8A 1ZTXH 2X4UB 4PJIB 1PLGL 5IQ7H 3AS3A 1FNAA 4L8SA 1TCRA 1I85A 1CIDA 3RWEA 3WNKA 1KCSH 3NFNB 2WBJC 3T0EB 1QYGL 4DKDC 3QUML 3EO9H 2XWJA 3DX6A 5C7XL 3PGDB 3Q1SH 3BP5A 3CK0H 1T5XA 5DJCA 3TVMB 3O11B 4HV8A 2XWTB 2D7QA 3ES6A 1KJ3L 3G04B 3SDAC 4PJGA 1W0VB 5KANI 2ZPKH 3O4LD 2IAND 4PRPE 5AG8A 5BCAA 5JXEC 3JVGC 5IB1A 5GS1A 1TQBB 1GOFA 1YA5A 3T0BA 1XGQB 2OP4H 4HBCL 1ZLSL 4U1MA 1RPQA 2ORBL 3BEWA 3PNWA 2ZOLA 4PY8I 4D3CL 3MV7B 2A9MH 2W60B 2J5LB 2CR6A 3DX7B 2XZZA 4K3JH 4LGSB 3BEVA 4JAMA 4KKLD 3RAJH 2F53B 1EMTH 3SE8H 2FHFA 1NAMA 4UMGA 3B43A 4JN2B 1Q0XL 3ARQA 5I8KH 1T20B 4UQ2A 1KC5L 2UV3A 1AY1H 4DGVH 1FVEB 4YFEA 1ZA3B 4LDLB 1DE4A 3N9GH 1OARL 1FFPA 4NRXB 5A2LH 3X11B 1MIEH 2Q76A 2BNRA 2E7LA 3U30B 3NCJH 4OUUA 5D1ZA 3PWVA 1DBJL 1QRND 1CTOA 5E8EA 1Y6MR 1UM5L 4KV5F 4ZSOB 3TO2B 4CDHA 2HT4C 3QG7H 3WIFA 1H3TA 3PL6A 4U1HB 3MV9A 1BJ1H 4I2XB 4OKDA 1XGRB 5BS0E 4N0CC 3FHQA 4UTAH 1YMME 2AI0H 2HP4A 1DUYA 3G6DH 5ACMA 4F58H 3CVHL 2NXZC 1HCVA 1J8HA 3TN0D 5DJZB 2O5YH 1J87A 4TNVF 43C9B 4OLUL 1LEIB 4Y5YB 1C5DB 3NN8B 5HYIA 3BYYA 1RUQH 2BVYA 1Q9KA 4PJ8D 1CYGA 3SJVD 5GGUB 4DKEL 5B8CC 5IW6A 3MV11 3G08A 1HZHL 4FXGB 1DQTA 5GJSL 4KPHL 5D7LB 1D5BA 5GRVK 3TYFA 4YPGA 3V8CA 3OZ9H 1I1YA 2PCPB 3UTSA 3HCVA 1EVUA 5DWUL 4HWEL 3I02A 4ODHL 3U7AA 4WUKL 3BMVA 5LGHH 1RIVL 3WXVL 5EC2A 4Y5VC 4YHPA 4P4KB 4U1KB 4KJPD 1DVFB 1P7QA 1G84A 2HJKB 2MMXA 1FNSL 5GRUL 5DRNA 3RBSA 5EUKB 4W4OA 5IEKB 1ND0A 4LCWE 3TA3D 1T80A 1T04B 1XR9B 4GJTB 2GITB 1BJMA 1CZ8H 2BY0A 2DJ4A 1PDKA 3ARVA 5DD1L 2OJEB 4EDXA 5F8RC 2XKNB 1NAKL 5MEQB 1Q0YH 3P11H 4MD5A 3E2HB 3QEQA 3GM0A 4WUUD 4AEHL 4UTBH 1OPGL 1UH2A 3G6JE 4OV5A 4L3CA 4GRLD 1KIPB 3VFUA 3VWJD 3ZL4H 5DC9B 3LS4L 3O6LH 3OKEA 3RP1A 1XR8A 2YK1L 1OTSC 4S1DD 1A3LH 5BZDA 4LSUL 4XAWL 2P49B 4CVXB 5GZOD 2H8PB 3RA7L 3B5GA 2EKSA 1N3NB 3AB0C 2NY2B 2ZUWA 2OR7A 4N1HB 2B4CL 4U3XA 3LRHA 1NGWB 4LVEA 4RGMC 5A43C 2EH8H 3WHE0 5IVXE 5DJ2A 2NY0D 5D96B 1MFNA 4JKKA 3U7WL 5JDSB 1IJ9A 3MYJA 4Q6IA 4HW6A 2A38A 3MRHB 5I8CB 1FYTB 3MJ9L 3BGFB 1MFDH 1ZHBA 1SY6A 3RY4A 2D0FA 2VKXA 3H9SA 3O0RL 2VDKH 4WV1A 4Z7VA 4HLZH 4OF3A 3DRQB 4LGPB 5A2KH 1PFCA 2HVKB 4ZXBB 5D2NB 1CFSB 1JRHH 5AYUH 4ZYKB 5A2FA 3FAXA 4F15C 2Y36L 3QNZB 5KN5A 4P59L 1Z2KA 1RJLB 3MX0A 3PGFH 2YBRB 5FGSA 4YXKH 5KVMC 1RHHB 1ZT7B 3BGMA 1EAJA 4JKWA 1OGTA 1CE6B 2ATKB 2HYMA 3TIDA 1U6AH 2E27H 3WBDA 1IMHC 4J3OC 4HK0A 1B6DA 3WHE1 1RU9L 2Y5TA 1J10A 1RZJH 4KUCD 1KELH 1MHEB 4K55A 3LN9A 1CVRA 4YE4H 3UMTA 4XXDB 2R4RH 4U7KA 4PY7A 1AGFB 5ID0A 2VWEE 3UEZA 4C54A 2OR9L 1K9TA 2O93L 2HN7A 4FZEL 1IGTB 3GJFK 2MTPA 4PGDB 4FQXD 1GVIA 2FGZA 1U8LA 1QEWA 1DLHB 2WWKT 4HIJB 1KTKE 43CAA 5LGKA 1S5HA 2FWOA 4MSWB 5TQ0H 3LN5A 2G75B 5IHUH 5MP6H 3W9EA 2BMKB 3PWUB 3B9EA 4OLXH 1LGVA 3Q2CA 5E24E 4Z76A 3RVUD 5FUZL 5IMLB 2DL9A 4L4TB 1A7PL 3TPKA 1CQYA 1DQDH 4N90D 3QUXB 5SWQA 5CLWA 5IM7A 3TN0B 4F37K 2FO4B 4ALAL 2GSGA 3KPSE 5J1AA 4ERSH 3BKCH 3ZTJG 5I71B 4MNQB 2R1YB 1S8DB 4PJ8B 5HHXH 3SJVB 2P5WA 3T65B 1UZ6E 5CIPA 2MJWA 3VD3A 1HSBA 2K7QA 4JM4H 3IFOA 2C3GA 2DQEH 2W65A 1T1XA 1QSEA 3LQAH 1ZLWH 5JHDA 1A0QL 2UWEB 3F7YB 4GRWF 4PGBA 5C08E 3FQUA 1RZIB 2H1PH 4OD1L 4X7FC 2MOVA 1TITA 4LIQH 4HT1H 5EU6E 4KQ3H 3C60D 4OCYL 4DZBA 3ZT5A 1HK6A 3GRWA 3QO0A 2DM4A 1UM6L 4KROB 4Z7WF 1MOEA 4PP2A 2EE9A 2E8YA 1KPVA 2WM0A 1T0NA 3S5LB 1YEFH 3OL2A 3LOWA 1UACL 3TA3B 2ARWA 4WW2A 3WN5B 1F6AB 3TO4D 4IRJC 2DYPD 1MAKA 2YUVA 5JOFB 4M48H 1OAQH 1VGKB 2FYYA 3I9GL 2LABA 3H9ZA 1SEQH 4WUUB 3RUGA 5KSBB 5T1MA 4S1QH 4ZPTB 5GQBA 3T4AB 1VFBA 2NXYB 4XBEH 5F88A 3VWJB 3NZ8B 3V6BR 4KHTL 4XHJD 3FB6B 4JDVB 4V1DB 2EZ0C 3OKOA 4O2CA 3V6FB 2D7PA 2R4SH 3BN9C 2BVEA 4A2LA 2HFGH 1RUAH 5E4EC 4WJ5B 2BRQA 3IKKA 1OP3H 5IR1B 3M8OH 1AD9B 1A8JH 2PO6C 3ZHLA 1AXIB 5DDHA 3V52H 3IDIA 2EH7H 1FZOB 4JY4A 2L7JA 2WINB 3OAYH 3VGEA 3KXFD 1MCFA 2UYLB 3B5TA 3L3IB 4JHBA 4MZ2A 5ENWA 3VFNA 1ZANH 3KG5A 5HJ3A 4H1LA 1ZT1B 1TLKA 3BGAA 3NIGF 4LLDA 3BKMH 4OBRA 5EUOF 1E28A 4G8FB 2EEDA 5LVEA 2QJDA 2BY1A 1X7QA 3QFJA 2B8OT 1Z0MA 3P77B 5E2JA 1V3KA 4U0RC 3H3BC 4Q0XL 4LSSH 4XPAL 2NY5H 5HGHB 4N9GB 1BM3L 4K3DL 3TT3L 5F1IB 3IDUA 5DURB 1BOGB 1FO0L 3RWDA 4MX7A 3VXMA 2CLVA 4R7DB 1GH7A 4FFVC 2Y6SD 3C08L 3OF6A 4PRNB 1WBYA 1UXWA 2ZKHL 4QKXB 1OM3H 1FE8L 2FO1A 3OKMB 3GMLB 4HKBB 3HI6H 4RBPK 4NUGH 4KKBC 3S96B 4X6FB 1HKLL 3MNWB 4AM0B 4Y5XB 3MRNB 1I1AA 1DBKH 2VAJA 1QLRB 1N5YL 1M7IA 5FO7A 4IRSB 5GGSY 1P4LA 4FQXB 3VA6A 4ZNEE 3FT3B 4GAGH 4EI6A 3GSNA 5C08A 3WUWB 4P3CH 5DD0H 2AV1A 4LLYB 3S98A 3ALPA 4KAQH 4XVJH 5ICZA 3BRGC 2VISA 2NZIA 1W0WB 4XZUA 1CBVL 1YEDA 5AAMA 5CD3B 1Z6JT 3U46B 3VA2C 5KTEL 4GMSH 1TJIL 1B2WH 4ZUUB 2AJVH 4HAFA 3B9KC 3R0MA 5HYEA 2KBGA 3T77A 1JNJA 25C8H 4ZO9A 1WZLA 4L5FH 3TWCH 3H42H 2V5TA 2HAZA 3GSVA 3PQYB 4J3WA 4NHUA 5DA4A 4E41D 1U8QB 4MJIE 2VQUA 5DVKA 2AJUH 5ESQA 4LU5L 5HVGB 2X44D 3MR9A 4WRLA 4G6MH 3QHZH 4OCWH 5ADOL 4HUVA 3ARBD 3OGCB 5GZNC 4PJIE 1AGEA 3WDIA 2D0HA 3BO8B 2QQKH 2KUTA 3T0EE 2H2SD 3KGRA 4LLMA 2XQYG 1PEWA 5I74B 1EXUA 1IARB 2FX9H 1UENA 1QHOA 3B6SB 3SDDD 2YPVL 3RDTA 4XCFL 3W0WB 1FDLL 6CGTA 2ZP0T 1HEZA 5DJYA 4RFOL 1HHIA 3DVIA 1NL0L 3TO4B 1Z5LA 3MPCA 1LNUB 3C8DA 1OGAA 2DOCA 4IDJL 4NYLB 3ZDZE 4ZOBA 5JPMB 1ZTXL 3RL2A 4XVTH 4KXZI 3LPFA 3K8MA 5C0EB 1KCSL 2X89D 3OHXB 5J13B 4I1NB 3EHBC 3EO9L 1A6ZB 3I6GB 1NDMB 1G7IA 3MV7E 1L7TH 1YC7A 3DMMC 5GISL 3MROA 3Q1SL 3ELAT 1CXEA 3CLFH 2DQGH 5DMGC 3CK0L 5T3ZD 3HS0A 4R4NC 1S7QB 2F53E 4PYHA 3MRFA 4NO5B 4CGTA 4D9LL 1DCLA 2ZPKL 2EDFA 1GGBH 5LAXB 5KOMC 3GUTA 3QWRD 4YXHL 1XH3A 3MV01 4Y4FA 5E99H 2DQFB 1QO3B 4NIKB 4GW4A 2OP4L 4BH8B 1MI5D 3HZVB 4L8SC 5E9DD 1T6VN 4PJFB 5F7LB 3T8XA 3FO1B 4GH7B 2A9ML 2H3NA 4ZSOE 1DEEB 1I8MB 3RAJL 4HJ0D 1EMTL 4I2XE 1HE7A 2EC9U 4WIQA 3SE8L 3OR7A 2BNQA 2VLJD 3G6AA 2VO5A 4WI6A 4ODTH 5I8KL 2W59A 1AY1L 4DGVL 5DQ9B 3B8YA 3NPSB 1KTDA 3N9GL 2IADA 5GS1C 1RK1A 4QRTA 4J2XA 1LP9B 1PX3A 2AKRB 3NCJL 1YEGH 4LOUD 1L6XA 1EHNA 1UB5A 2VJXA 4LSRH 3CFJB 1MHCA 3WE6B 3SKNB 5GGTH 4JPKL 4BSVB 2LTQC 4PLKC 1KCRH 1AD0A 3TNNB 1HOCB 1WWCA 1G6VK 3V5DA 5D7LE 3L1OH 4YDVB 4UTAL 2AI0L 2BCKB 2UVFA 4NO2B 4F58L 5FYJU 1TZIA 3OB0K 1D5MA 4NFBA 3OKNA 4JG1H 2O5YL 4NRZA 4UQ3B 4H5SB 1C16A 4R7NB 4X9HA 2E7LC 5H8DA 2BY2A 5C0FB 4TUJB 1RUQL 3PF2A 4AQOA 35C8H 2DLEA 3MREA 1JYVA 3FQWB 2QEJA 1D5XB 4OI8A 4Y16A 3PXJA 3PL6C 1XF1A 2ZSVB 3FFCB 5DJDA 1EAPB 3HPLB 5FGBA 2Z35B 3PJSB 4D0BB 4KH2A 1S9YB 3CX2A 5HGAB 3D3VD 1INDH 1KJ2H 3P0GB 2MWCA 2QSCH 4HGMA 4UAOC 1TETH 3KJ4B 2X5PA 4IHOA 4NN5B 2AJYH 1IC1A 3NZHH 1BX2A 2QQLL 3BQUD 1O5DT 3VMPA 5FFLA 5GXBB 2V5SA 3TCLB 4NO0D 3L5IA 1I3RB 1JGLH 3HAEA 3G04A 3HKFA 1HINH 1FV1B 1H0DA 1W0VA 2GJ6A 5T1LA 5FO9B 1UH3A 5IBUB 4HZAA 3VXUB 1DBMH 1A2YB 4EI5A 1LDSA 1JHLH 2LVCA 3PABA 1X3DA 1IVLA 1CZ8L 1RQ5A 5E08H 2ICWI 3BN3B 1JZ6A 1N2RA 2OJZH 4F9PA 1Q0YL 2P24A 5EIIB 1U8IB 4JFYB 3ARBB 4H25B 1A7NH 3HE7A 4UTBL 2DAVA 1B0GB 3H9HB 3ZL4L 1D5IH 1QVOB 2EKJA 3O6LL 1FYTE 4QF1B 3B2UD 1UQSB 3A6CH 2WLZA 1A3LL 1G1CA 3SDDB 4W4OC 3Q5TA 4TUOA 5JW4Q 3U4AA 4EOWL 2HG5A 5D2NE 5IMMA 2UUDK 5EWIH 3GMMB 1TVHA 1HH9A 4G7YH 2AAVA 2YD4A 4PB9H 3IF1B 1C08B 1O7SA 4ODVH 3QDJD 4MD0B 3QIUB 4XB8A 3UCRA 2VDKL 3VXNB 3TT1L 5I1LB 1EUTA 2WQRA 4NN6B 1JRHL 5AYUL 1F4XH 1F97A 1AHWA 3S37X 1R5IA 3PGFL 1F13A 2XN9A 5B4MC 4YXKL 4UT6H 1P6FA 3OXSA 1NCUA 2ZZUT 1E4JA 2LAAA 5E9DB 1U6AL 2E27L 1U3JA 1MLBA 2XZAH 4Q6IC 4M3JA 1KN4H 4PJDB 4X8XA 3I2CL 1PYWB 1RZJL 4ZMAT 1CWVA 3QUYC 3WIHH 1M4KA 4YHNB 4YE4L 1X5JA 5T1KA 2R4RL 2VLJB 1A6TB 2W1NA 1JTTA 2X41A 1MCNA 4C57C 5K59E 3WNLA 3P30H 4L4TE 2AW2A 4YUEH 2KL6A 3EOTH 5IG7A 3AS2A 1CDUA 4UDUB 4M02A 4I0PD 3EO0A 5EOTA 5HGBB 5SWSB 2PTTB 2Z91B 1IKNC 4MNQE 1GL4B 1JN6A 5TQ0L 3DROB 4FTVB 3Q5OA 4UOW0 3SJVE 5IHUL 2FSEB 4QRUA 3FAWA 3O8XA 3G5XB 2O26U 4OLXL 2R0KL 3QIBD 1JV5A 4K94H 3SEPA 3W9DA 2MCG1 5IB5B 3FHAA 3N06B 3QXDB 2CDGB 2UWEE 5INDA 4JR9H 1DQDL 3LDBB 4NZTH 4Y4HA 1VFUA 3K74B 4PRBB 5EBLB 4ERSL 3BKCL 3RGVD 5C0GA 2R2HA 3ZDXE 2V2XB 5HHXL 1RJZB 3VH8B 4NQEA 2JE8A 4TYUA 3QO1B 3BP4B 1S9VB 5IW1B 3C8HA 1NGWA 4JM4L 4TULL 3MUGA 1XGTB 2DQEL 2Z8VC 1Q72H 5HI4D 1XGPA 4MJ5B 4Z7WA 1YUHB 3LQAL 1OTUC 1VESA 1E6OH 3UZQA 5J3HD 5D4QA 4ODXA 3D3VB 4DOHB 1S7VB 2H1PL 1FYTA 4HFWA 4ONHB 4LIQL 4HT1L 4KQ3L 4WUUE 3ULSA 3VFPA 1A1MA 5KSBE 5HPOA 5EO9B 3BQUB 5C09D 1BBJB 4YX2H 1NMCC 1Q9WB 3PHOB 3DECA 1C12B 4V1DE 5JXAH 1JWUB 5KBNC 4DVRH 1YEFL 2XRAL 1GZPB 4LLWB 1AXSA 2E7CA 3ESUF 5FECA 4ZOAA 2DWEB 4M48L 3CVIH 4OZ4A 1OAQL 1FJ1B 4YK4B 2GI7A 4PGCA 5FYKD 1CGWA 4K7PH 4MNGA 4FQPA 1SEQL 2FJFB 1YEHH 4HIXH 5IV2A 4YR6B 4S1QL 5CZXC 1A6WH 3WFZA 5E5UB 4KRPD 4WTZA 1C5BH 2D7NA 3HI5L 4XBEL 4L8CA 4XXDA 3EOBA 4JO3H 5CBAA 3MRDA 5F7KC 1RUKH 3LV3B 2OTUB 2XQBH 1KTLB 1S5IH 1MVUA 3RY6A 2R4SL 3NA4A 2HFGL 3RWFA 1IGTA 3RKPA 3RX5A 3UJTH 1RUAL 3I75A 1KB5H 4QHKJ 4PJDF 4WW2C 2XQYK 2YN3A 2H9GA 3M8OL 5EUOA 4CNIB 5A2IH 3BPCA 3LKNB 4P46A 2VQ1B 3EOAB 3VRJA 1EEQA 3V52L 2EH7L 1RZGA 3PGCB 4IM8A 4PG9A 4M1DH 3W5MA 2RIKA 4NQCD 3DO7A 1ZANL 4E5XB 5AZ2H 5E94B 2F54D 3QWQB 3QDJB 4H0HB 4NJ9H 3BKML 4FRWA 1AI1H 2GUOB 2D31A 4HWNA 4HK3J 5ITFB 1IGCL 3FN9A 1U91B 1E27A 4OZHB 4D0CB 3MRKB 4X99B 4LSSL 2NY5L 3V0VB 4NQTA 1QFWI 3P73A 4ZUSA 4LLAA 2AQ2A 5JPNA 3NCCB 1BP3B 2IG2H 1F5WA 4JPIA 4Y2DA 1SJHB 4P2CG 1E0OB 2GCYA 4KU1A 2X2YA 3F7PC 1SYVB 1OM3L 4UDTA 3HI6L 3JV4A 4ORGA 4QWWD 4U6XA 4NUGL 4MJ2A 1MNUH 4LAQH 4U4BA 4QT5B 1X5FA 2J1KA 3C5ZA 1DBKL 2V2TB 1YYLH 2A6JB 3ECBB 4GAFB 5D93B 3FJTA 3GSRB 4OD3H 1XIWB 2HT2C 2OQJB 4GAGL 3QI9D 3QDMA 1YMHA 2CKBA 3WLWD 4I77H 2GSIB 2GTWA 3PQYE 4P3CL 2M1KA 3DETC 5B39A 5FYLD 5DD0L 4WCYH 4XVJL 4KAQL 3VI4E 3QIBB 4PLNC 5JW4N 1RZFH 3DHJA 2R9HD 4FFZL 1CDYA 1R3JB 4IMKA 1KJMA 4RMRA 2WAHA 3BIKB 4GMSL 5C3LD 1B2WL 5I18H 2AJVL 1QSFD 3D69A 1I1AC 4ONOA 4DEPC 3V6FA 3BD5A 2OMBA 25C8L 2WQ8A 3CC5B 1T6WA 1VHPA 5IB2A 1J11A 4WJ5A 3S35H 2XG4A 4L5FL 3TWCL 3H42L 3QQ9D 3WEXA 1JWMA 2MSPA 3W0WE 2AJUL 2IPUG 3DVGA 1KIQB 5CKGA 3BPOB 3FT4B 2CR3A 5FDWB 1ZVSB 4G6ML 1B3JA 3VFSA 4OCWL 5KANG 5FYLH 5DUMH 1AIFB 1AKJA 2BSED 3LKQA 2CPCA 5HI5D 2P5EA 1W72H 3NIFF 3VXSA 1RZ7H 2QQKL 4ONGH 5C09B 2WWKO 1WGOA 1MFAH 1MWAA 1KB5B 3MQIA 4JFDD 1IBGL 3DI3B 5F7NC 3MACH 2FX9L 4R9HA 5K33A 4U33A 1IC4H 3PDDA 5IEHA 5I1IH 5EORH 4P2QB 5GGVY 4DJMA 2VDLH 3QQNA 2VC2H