4XX1E

Low resolution structure of lcat in complex with fab1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
227
structure length
219
Chain Sequence
VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSNKFYEDSVKGRFTISRDNSKNTLYLQMDSLRAEDTAVYYCAREGAAVRSFYYSYYGMDVWGQGTTVTVSSASTKGPSVFPLAPTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSHSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The high-resolution crystal structure of human LCAT.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
molecule keywords Fab1 light chain
total genus 43
structure length 219
sequence length 227
chains with identical sequence H, M
ec nomenclature
pdb deposition date 2015-01-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xx1E01
4TTDC 1OTUC 2UZYB 5ENWB 1FNLA 3TWCL 3CVHB 4DN3H 2XZAH 5IBUB 3DWTA 3BN9D 1A4JB 5T3XH 4U7SA 1RZ8A 4OFIA 4Y5YA 4NJ9H 1QSFA 1YN7B 5MENB 1FRGH 4XP6L 4TSBH 1U92B 3P30H 4U4BA 3RTQB 2F8XC 3EOYG 5CSZA 2VWEE 4YXHH 4GS7C 3V5HA 5A2JH 3ZE1F 2J8OA 4M03A 4Z7WB 1XF3A 3ZKSD 1CCZA 3DVIA 4LPXA 3GMNB 3IU3B 5FCSH 3O3DA 1R3JA 4K9EH 4GW4A 2E9WA 4W70A 3QEQD 4Z18A 4ZUWB 4KH2A 1CD1A 2F54B 3PJSA 3BPCA 2W0PA 4ODTH 4TPRH 3PWPA 1IGTB 4K71C 3EFDH 4CU8A 4JFHD 3TNNB 4ODUB 4XNXH 2FGZA 5JDJA 5DD3H 1BZ7A 1H5BC 5HGHB 2DQGL 4IM8A 4UTAH 3MRIA 4KY1L 3TIDB 1CD0A 2YEZA 2QEJA 4LCCC 5D6CA 4JFZH 1KG0B 1CFQB 2XIDA 3BP6B 5FHAH 1CFSB 4U2YA 1U8PB 4IRSA 1N59A 1ZLUH 4HAFA 4NNPH 5EA0L 3QEUB 2WLYA 5I0DA 4O2CB 4KQ4L 5ID1A 4PJCF 2CLRA 5DVNA 3W0WD 4I4WB 4LASL 1K8DB 3QT2A 3GSUA 1G1CA 4NRZA 1TCRB 3FQXB 3QULA 4R96B 4NKOA 5T1MA 2JKXA 2FLRT 1U42A 3NMEA 3GHBL 5FFLA 5FO8A 4L3EB 3STBA 1KLFA 1P2CB 3HZVB 4P5KA 1QKZH 3RDTB 5HGBB 1MI5D 3VFOA 1BAFH 4DGIH 4IJ3C 1H3PL 2FHCA 5F9WB 3WJJC 1IEBB 1OGTB 4L1HA 2FJGA 3ZMRA 1P6FA 4Y4KB 1AO7A 1J0ZA 1UH3A 2M26A 3CFCL 4F7TB 4JO3H 5BVJA 3NFSL 3P40A 5D71H 3HNSH 5DD0H 3WLBB 1H3XA 1X5YA 2BVPB 1WAAF 3GM0A 3QSKB 5IW6A 4M1CD 1H0DA 1S3KL 1T1YB 5TE4H 5ADOH 3DOSA 3K4ZA 1IGYA 1UB6A 2CIIB 3WN5C 1EUTA 1MQ8A 4NUJB 4WHTA 4YXLH 4KKNA 4KVCH 4R7NB 4TUOA 4O02H 4HIXL 4P4KC 2BVOA 2A6DB 3CLEL 2MWCA 3C60A 3QWQB 1EEZA 5IW1A 4FTVD 3EJYD 2PUQT 1PZ5A 4M6MH 4JQVA 5IJVA 5LGJB 3GSXA 1G7PB 3HG1B 3GSRA 3DX9B 4WO4D 5E6ID 2N7AA 3P2TA 3L3OB 3PDDA 4JRYA 3UPCA 1RULL 4GT7A 4QHMA 1WZ1H 5FKPA 1XF2A 4B5EA 1Z0MA 2ZP0T 4OLWL 2YA2A 3CH8A 2DLFL 3E6HB 1IGJB 3LSOB 4H20L 4QWWC 4ZTOL 1JRHH 1GPOH 4WHYG 4QRPA 3SGKC 1I8IB 4O58H 3V4UH 2OI9C 5I19L 4Z77A 1G0DA 3FRPA 1HHKB 4CDGC 4OB5H 5GS0D 3LKPA 3HI5H 1KCRH 4P5MB 5I17A 2XACC 3DSFL 2PYEB 3VA2C 4NHUA 2E8ZA 5HYSB 4X6CE 3VH8A 4PFEA 3MRJA 2H6PA 1R5WB 1MNUL 1C5DA 2FX8L 4WCYL 4XP6H 3P4NB 4CDHA 1NANH 4PRHE 4KAQL 3RIAF 5AYUH 3RWEA 2OR8A 2RCSL 1KN4H 1QLFA 1A1NA 1T4KB 2VDPL 1S9XB 3QUXD 3IAPA 2FATL 4F7CB 2PR4L 3TIEA 5BJTA 3HE6B 2WQ8A 4AM0A 2MSPA 2KH2B 2ZG1A 4YZFE 5ADPL 5HHPA 5DHVH 4O2FA 5CIPH 4RMTA 3MV9B 1NDMA 4JVWA 3VDAA 4X4XB 3VFPB 3SBWC 2YUXA 5HGGS 1DUYA 1FNFA 1MJ7H 4KK8D 5IK3B 2A77L 4P0DA 3MRQB 2VXVH 1F3DH 3QRFM 5L7XH 5IMOA 3FO9B 1MIML 3GFUA 2IH1A 4PTTB 2R56L 2BY1A 4WGWB 2CSPA 3LD8C 1EEQA 2OTUB 3UJTH 2QQNH 2YBRB 5ISZD 1J0YA 1L0XA 1SMOA 3EJJX 2Q8AL 1QSEE 4PJHA 4LSVH 4KXZH 4HKJB 3P4OB 4FTVA 1REIA 3HUJB 4ESKA 4ETQA 3O4OB 3S5LA 2HG5B 2AJYH 2FIKB 1T66D 4KHXL 1E4JA 5MEQA 4IHOB 3CZFB 4KJWC 3IJSA 1IAOA 4OGAD 4JDVB 5KVEL 4IDLA 4R4FH 1ZT1B 4D8PA 4MXVF 5BMFH 2Q76A 3ARFA 3OKOA 4ZMAT 4YWGL 4EIGB 3M8OL 4HIXH 4TSBL 3CFEB 4U49A 4LARL 4XPTH 4G8GB 5H35B 5D7JA 3DURA 3ZDZF 2CUMA 3NN8A 4L8DB 4I0KA 4HFWA 4YLQT 1CIDA 1J18A 4O9HH 4KKCC 3IDNA 4OZHF 3RVTD 5DA0B 4G80A 5K9QG 1FN4A 4YHZH 2D7PA 2QKIA 4KKAC 2B20A 2OTPA 3WDHA 3TO4A 5DSCA 1CLYH 3AS0A 4LSQL 3MLUL 5ANMB 4NKQB 1XF1A 2IQAB 5DC4B 5I73C 3PWUA 2F15A 4RAVA 3VI3E 4WWKC 3OF6D 2ZSWB 1AIFA 3NOIA 1JMZA 1MCDA 4FA8A 3H42H 4K7FA 5HJ3A 1DUZB 5FK9B 3TBYA 2P5WA 2HFGL 1FG2A 2IEPA 4PJ9D 2VXSL 3DVGB 4A6YL 3MV8D 3BT2H 1J7VR 3FMGL 3G9AB 4MSWB 4AG4H 3HE7C 2DQCH 1IZKA 2XTJD 5C71A 5TE6L 3LZFL 5JW4M 3I3BA 1DANU 1GGIH 2EKSB 2R1WA 4PJXE 1P9MC 5JMOC 4OJFL 1EUUA 3B6SB 3JV4A 4KDTC 2NY7L 4ELMA 3OKLB 2PTVA 5MEOB 4LHUA 5E08H 2BY2A 3G6JF 1SHMA 3TZVA 1F02I 4R9HA 3MRLA 3QJHA 1QFUL 4EUPB 2JIXB 3Q6FA 4Z0XA 5C0EA 1SM3H 3VG9B 3NIFF 3TA3C 1E6OH 4XAKE 5IHZA 1DBJH 3KYMB 3B9KC 1WZLA 3DMMD 3BIKA 3CNKA 4JFZL 1M1SA 1OOAA 1RHFA 1OT2A 4PRAA 1ORQB 3SDXA 3GI8L 5DRZA 3VD7A 4OTXH 1E4KC 1N26A 1MRFH 2X44D 5H37G 2P44B 1GCFA 1KIQB 3HS0A 4I8DA 4X99B 2OJEA 4PLNC 4P46B 2PO6B 4RGND 5KG9A 4PJDF 4XNZB 4OZFA 4OLVL 5I16A 1UJTA 1XGPB 2FEEI 3BUYA 4HK3N 4RBPK 2A83B 3NZHL 5DK2B 3BHBB 3LHPH 3RKDD 4XT1C 4TVPE 4WGVB 2W65A 2XRAH 4KI5C 4XCEB 3P0VL 5BRZB 1QFPA 4GBXD 4WI9A 4Q9QL 1HKLL 1S7XA 1KPUB 4L8CA 3OWEA 3UTTD 2YA0A 4WO4A 3FO2B 4LNVA 4QRRD 2D7QA 2PW2B 3W2DL 5CAYB 3QWOB 3E8UL 2LTQB 4HG4K 2LU4A 3ZL4L 1QFUH 5FGRA 1DDHA 3SOBL 5DRNA 2YZ8A 3NBNA 1G7HA 2BOCA 4GAFB 2P7TB 4QLRA 5ECJE 3OTTA 1B3JA 4X4YA 4M6OH 5BRZD 2E9IA 2YA1A 4LAQH 3TFKC 5IVOA 3GJFK 3RUGB 4JQXA 3LZFH 4G8IB 2BHUA 4FXGA 1JYXA 4CVUA 4MCZA 1OARL 4UIMA 3CFKA 4IBLT 3O3BA 3F7YB 3D1MC 5E8EA 4JFHE 2IH3B 3TYGH 1QR1B 4RMWA 3V6FB 1BQHB 3HI1B 3AM8C 3OJDA 43CAB 1OAYH 5F7EL 4Y2DB 3R0NA 3W9DA 1HSBA 1ZVSA 3OQ3B 5ILTL 5SWQB 4Q6IB 3LS5H 1S7QB 1BP3B 3KDMB 1Q0YH 4RFOH 2XNAA 5E4EB 4PGEA 3L3KA 3TT3L 1N5YH 1JGEA 3MRMA 1J10A 1T5WA 1YEDA 4XXDB 3HPJA 2BNUA 3PL6A 1QSEA 4H0GA 1I1RA 4FG6D 4NHCH 1D9KA 1N2RB 5T33H 2LVEA 1EEUA 3EYOB 1HHIA 4PTTA 3MRRA 3N1FC 1I1AA 5FA4B 5KANG 4L8SC 1I1CA 3TM6A 2VDKL 3TGXA 1GXEA 4PRHD 5CD5D 3O6FD 1F4WH 4JREC 3MJ8B 1OAQH 4M48H 4N8CH 4YK4C 2YRZA 1A2YA 5D5MB 3BP4A 4F33B 4OZGB 3MV8B 3D85D 4XVSL 2ITDA 4X6EB 4UTAL 2B1AH 1NKRA 1JUFB 5LJYH 5KBNC 1YECH 2CPCA 4UILL 3MOBL 4Z5RB 1ZOXA 4D0BB 4N0FA 3IDYC 4L4VB 1IL1B 2HVJB 3D69A 4MX7B 3WFBH 1GJIA 2BY0A 5E7BA 3TNMA 4GJTB 4M7LL 1AJ7H 3SDYH 2OQJA 5JUEH 1WBYA 3UTTA 2CO7B 1EEYA 5HHXL 4EEEA 5C70A 1BFOA 1U95A 4MJ5B 4QRRA 4Z9KB 3W5NA 2MPAL 3Q1SH 5T5NG 2F74B 4UAOB 5D7IF 4XBGA 2E6PA 2DQTH 4ZYKA 4QHLA 4L9DA 2YD9A 1ODAA 5DMJB 4OF5A 2Y06H 4IMKA 3QUMH 2SEBB 4E42A 1U3HD 4KRPB 3AU1B 4G9DA 3LKOB 3CLFH 1Q9OB 4B50A 3HC4H 2V2TA 3GJFH 5F89B 3WV0A 2VXVL 3RY4A 5IR1A 4IIQB 2VXTL 3SO5A 4OQTA 3EGSA 3EW3B 1BF2A 3X13B 1WGOA 1MCQA 5EBWB 3MNZA 3QWRA 3B2UC 3LPWA 3AXLA 2JB6A 3ARGA 3FQTA 1NC4D 3O2VH 1VKXA 4PJAA 1QNZH 2BMKB 4TTDD 5C0FA 1N8ZB 1QD0A 1OTUD 4ZFZB 4JN2A 1RFDH 3UTZB 3S88H 4K3JH 2E7BA 1ZANL 4ZPVA 4XH2A 1DVFC 4V1DA 4PJIE 5DQ9A 2WZPD 2XA8H 3VGEA 1IEBA 1I7TB 4X6DF 3VXQB 4WV1C 4M8QA 2APWA 4WWKB 1CDCA 2J6EA 1P7QA 5CMAA 4CVWA 3I75A 4AEIH 5GGUA 4JLRA 3AVEA 1U2CA 4NRXA 5FYLH 1QFWH 1KEML 4YHYC 3DO3A 5I1IH 4YEFA 3L3HA 3DHMA 3MYJB 1S5HA 2AAVA 2VXQH 2IJ0C 4UNVA 1J5OH 3N9GH 5I19H 5E5MA 1SY6L 4XNUH 5IWLC 3C5JB 4R0LC 4AEFA 1RHHB 5CP7A 1WIOA 5JQHC 4XTRD 3CU7A 1Q1JL 1XR9A 4YFLI 1C7TA 4P2QB 4EI6B 1CWVA 2BCKB 2B4CL 3SE4C 4HZLA 1KYOK 2ZUVA 1H3GA 1W8NA 1KCKA 5FECB 5FYKE 4E41E 3OX8B 4QRPE 3EJZC 4PJ8A 3H3KA 2X7LA 3MLWH 4X9FA 4R3SA 1U8LA 5DK2A 1DCLA 4AG4L 1R3KA 1QBLL 4RMSA 1K4DA 1ONQB 4PYHA 5B39G 2BC4B 4LU5L 2V9TA 5A40E 2NLJA 1WCBA 4WJ5A 4RZCB 3QXAA 4OZGF 5IB3A 1J8HD 1KXVC 1FVDA 2BHZA 3FOMA 1S9XA 3NPSB 5GSRA 3BKYH 4Z77B 4ENEC 3LKSB 5GRUL 1G7HB 5L8JB 4A2LA 2MNUA 4Z76A 3NACH 2VLMD 5GIRB 3WE6A 1DBJL 4MD4A 3E6FB 2EDQA 2D7TL 1F13A 2FGWL 3ULUL 2BX5A 5KAQG 5C0BD 5FHBH 1NDGB 5IMOB 1ETZB 4Y19D 5T3XD 5ERWB 1HILA 5HHQB 1WBXB 4YHZL 3HG1D 4IRJD 2IH3A 1A1OB 2FRGP 4QXGH 2OL3H 1QFWM 4DK3A 43CAA 5I1DB 3WEXB 3ES6B 1G7IA 5FOBB 5I9QB 3IDYB 3S34L 2CKNA 3TF7C 1VGEH 1IEHA 1H3WM 5FYJE 3C5ZC 4P4KD 5F3HA 4IRSD 3HRZA 4M4RA 3LN4B 1KXTB 1OAXL 4RQQB 2V9QA 4R4FL 3SQOH 3V52L 1MWAB 3GSVB 1MVUA 4U31A 4PJ5D 3ARYA 1T80A 2YMXL 2YZ1A 4WO4C 1Z2KA 5E6IC 3QAZB 3GJFB 4L8BB 3B5GA 1T89C 2VAAA 1SVZA 4R4ND 2JLLA 2AEQL 3IF1B 5CZXC 2YUZA 4HFWB 4PS4H 1HOCB 2ITDB 5IIEA 4YFEA 1KLGA 5D7IE 3TNNA 2C7UB 5D96C 3MV11 1FH5H 4LLYB 4LEXL 4R8WH 4L3ED 1CIUA 2DD8L 5HYJB 2R0KH 1FIEA 1UZ8A 1V8HA 4OZGE 4R4BB 1VPOL 3TO2A 1PW3A 5EWIH 1CFSA 1WBZB 2QQKL 3DX8A 5E70A 1ZT1A 3TNMB 3D85A 1OGAB 4Z8FL 1SYSB 1OWWA 1N3NB 5GGSA 1DQDH 1PAMA 3TA3A 3O9WB 2DQEL 4GG6B 4XRCA 3NH7L 3ILPA 3W0WB 4CMHC 4EI5A 3NFNA 3JWNC 5L2JB 5D7JB 3GI9H 4XVJH 3SJVB 1EHLH 4KUZL 4P4KB 4RRPA 4XAWH 4K23L 1D3CA 2A6KB 4L5FH 1U41A 4LKCA 5I9QC 4XVUC 1HSAB 4K94H 2RCSH 5IF0B 4N1CA 1UKSA 1ZVHA 4NDMB 3IJYA 4NBXB 4S10A 4E41A 1J1XL 5FUZH 3K2UL 1I1FA 1I9RH 2IBZY 4X8XA 1BLNB 1LEIB 1CZ8L 1CD9B 3NABL 3RI5K 4YHLH 1TTUA 3MNZB 5J9PA 4NQSB 3PIQA 1MIEH 2G60H 1A6WL 4WI2A 2PETA 5DZNA 3PQYB 5T1MB 1XCQB 3SO3B 2NY5H 4NZJA 4PY7B 1GOFA 5D7KD 4DGYH 1KCSL 4QXWA 1KIPB 5HYQB 3S36L 2IBGA 4NZTL 4XNMA 2CRYA 5DJXB 5H94A 2PTTB 2O61B 3KJ4B 1JI2A 5IHZB 1MLCA 3MLTA 2ENSA 2G9HA 3MJ9H 5TDNA 1OPGL 2YHGA 4JQXC 3MV01 5EZIH 3FOLA 1FZOB 2DTML 1XGTA 3FFCD 5CBEB 3O2DH 1RUKH 1U8NB 1SEQH 3V8CA 1YEEL 1OAKL 1YEFH 1R24B 3UJJL 1DQQA 1MCJA 1T66C 2Y5TA 3DUSA 1I85A 1YNKL 4KJWD 4OGAC 5I1AA 4RMVA 1UJ3A 3BRDA 1JYVA 1JHTA 5DTFA 4KRLB 4MA3A 3ZTJG 4F58H 3AMLA 5IT2L 4HC1H 5DXWA 2J1KA 3GIVB 2BP3A 2CUHA 4Z0XB 3I6GB 1IGYB 3DI2B 5D9SB 1VFAB 3Q3GB 4HKBA 5L0QC 3ARUA 1UM4L 4OF6A 4OF8A 3JV6A 1GC1C 4U6HB 5C0GA 5DMKB 5HYFA 1ZHNA 1VADB 4KKCD 5ESQB 3O6MH 5EFIA 3HZKA 3ZHLA 5E7FA 5CGYC 4R0LB 1WVZA 2BNQD 1VCAA 1MWAH 3LKPB 2PO6A 1UCBH 1G7PA 5ICZB 1YPZA 4XPBH 4PS4L 5FM4A 2FX7L 3ZSTA 5EUOA 5GS2D 1T7XA 4KTEL 4RIRA 5ICXA 4BFBD 3BHBA 3B9KA 4WWKD 3PGFH 4C56D 2R4RH 3ARSA 3LN5B 1GGBL 2D3VA 2Q7NA 5DUBB 3H7BA 3D25A 2DYPB 4Y7MA 2AV7B 1BBDH 2ZPKL 2EC8A 1S9YA 4PJ9C 5DQJB 3GHBH 3VXMB 4M7ZC 3S4SG 4QRSB 2VLKD 5KJRH 5DRNB 3BPNB 1MCKA 4UU9B 1XCTB 2CDEA 4BJLA 4W6XB 3IFPB 2HN7B 5EU3A 3CCHA 2NW3A 5C0DB 4NHCL 2XKSA 3BZFB 3NA4A 4FQQA 1X5ZA 3HE7D 3VFNB 2PR4H 3S5LG 3V6OA 1U8JB 2B1HL 2XTJC 1IBGL 2O5YL 5ALBH 3OKMB 2EH8L 3SDXE 4HEPG 1WC7B 5SWSA 4MNQE 3X14A 2J8HA 4U1MB 5L9DH 2NY5L 4LOUD 3MACL 1KB9K 1FORL 1QSZA 1YY8B 2YXFA 5IB5B 1FNGA 5DD3L 1BIIA 3D2UB 4MGXA 2R29L 1FFPB 5IP4A 5I0ZA 1LEGB 2AJ3A 1GZPB 1JPSH 2HFFB 3WEXA 4XGZB 4YGAB 5DRXA 2R23B 3P9LB 3TA3D 2FGWH 1A9EB 4XP4L 5FYJH 4ELME 5FA3B 5TJWK 5FOJA 3P3YA 5I8CB 2QQQA 1CDBA 4KGLA 1HIMH 3VU2A 3CSBA 5CILL 3FTGA 4HKXA 1LNUB 1T7ZA 1G9NL 4PG9A 3RU8L 2Z0BA 1T5WB 3S5LB 3AC0A 3GMOB 6FABL 5BS0A 1HQRA 4JDVA 3KAAA 1RJCA 3QH3B 2DJ4A 1JPGB 2NPLX 3HNTL 1J11A 5DVMA 3FQUB 4HGKC 5F9AC 2VR9A 4NKMA 3WKMH 4PJEE 2IFFH 3VE0B 3ZL4H 5LWYL 1KC5L 2ADFL 3RHWF 5CUSH 1Q9KA 3CFIC 5J1TC 3JSSA 3QG6B 1AR1D 3O6KH 1QYGL 3B8SA 4BZYA 1NCDL 4XBGB 4MA7L 3QO0A 2VC2L 4PJFA 3VCLA 2BY3A 1X5XA 5D7LA 4J12A 5D4QA 5CD3B 1Y0LB 2DQHL 2O5ZH 1J0IA 1O7VA 1YYML 1NFKA 1SYSA 5J06A 2UY6A 3TFKD 3O9WA 3RX7A 4GG6A 1CFNB 3X11A 4IOIA 1G9NH 1ADQL 3WS6A 4OFKA 4JHAH 5IM7B 1Z6JT 4KRNA 3NN8B 1ZT4A 4HBCL 3MCLH 1MQKH 2A6KA 5DUPH 3SDDA 4R90H 1I3GL 3DI3B 3SDCC 3I6KA 1N8ZA 4Q6IC 1FG2B 3RUGE 4PJHF 5DDHA 4GRMB 3UYOD 4ONFH 1PLGH 2J6EH 4XPFH 4NBZB 3ROOA 1KNOA 1EO7A 5EORH 1INEH 2R15A 4X7TA 2VZOA 2OMNA 4NQCD 1XIWB 2MHAA 1AE6H 5HYIA 1U3JA 4X8JB 3MV7E 2DJSA 4UOW0 2EYSB 4FG6C 3OV6A 2VXUH 4TUJA 1B4RA 4NZRL 4OT1L 1WQVT 2HJKA 3PV6A 1SJHA 4F9LA 4LVNC 2DRUA 5CD5C 4XB8A 1DP0A 1P4LA 3O6FC 4X6CB 4D9LL 4HBQA 1K4CA 4OFVA 4P5TA 2PYEE 2ZKHL 2QSCL 5C2BH 3ET9F 5DQ9B 1P5VA 2BSED 1T7WA 4S1DD 3WHE0 5JORA 4R8WL 1DQMH 3P4MB 4PJBB 1A7OH 4MSWA 4X6FB 3SQBA 3VGFA 3LRSB 2OYPA 1YPZF 3WFBL 4R7DB 4UT6H 1ZXQA 3AAZB 3BPLC 2H1PH 1X5LA 4IRZL 4XWGH 1DBMH 5GS2H 1GRWA 2H1PL 3G5ZA 4YNYB 4NQXA 2MPAH 3Q1SL 3QCVH 4J1UB 4R3SB 3OGCA 5GRYA 2VLJD 4LDOB 1M71A 1BJMA 4HFUH 4EN3B 1SQ2N 1A3LH 3FJTA 1T0MB 5D72H 4XX1G 1OP5H 1ZHKA 1OAQL 1YQVH 4M48L 1OAKH 1YEFL 2WUCL 3B5HA 4NO2B 2XXCB 4ZAKA 1CE6A 2AEIT 2PN5A 3PHOA 4P2QA 3GMPB 1LO5A 5EU4A 5IFAL 5EBMA 4HIIA 3L3GA 5DJ2B 1XR8A 3QUZA 5DRZB 4JFFE 4HMCA 4HXBL 4LLQA 1DDHB 2B4CH 2EEAA 4CJ0A 3FB5B 1MCFA 3SHSA 1U3HC 1A6TB 4L1DA 3QWRD 3UTSD 1OCWL 2VL5A 5F7DA 3TPUA 1KTDB 2OR9H 4UQ2A 4S2SA 5F1KC 1H3UA 5ADOL 3RDTC 2OSLA 1I9EA 1OD9A 2D0GA 3K4AA 1AO7E 1N6VA 4I0PC 1QG3A 3ZYJA 3VW3L 1FV1B 4L9LC 3O6FA 1FO0B 1UGNA 4XP1H 1J8HB 5LG1A 4GRLC 1PVHA 1KJVA 1DQLH 1L0QA 2EDLA 5F96L 1I3GH 1JCKA 5I1DA 4MJ4A 3DRQB 1ZLWH 3WFEL 3KGRA 5FDWA 2DLGA 2G75B 1A6VH 1DVFD 4G43A 5JIPA 1W0VA 2FBOJ 5ABDE 1NGXA 1H3PH 4WI5A 3GUTB 1ZHLB 1OAZH 4B0MM 4ELKA 4PGJA 5DR5H 5CLTA 3V5KA 5CJQL 5T1LB 4GG8A 5I1JH 3GEWB 3CSYA 4M61B 5FYKL 1KFAL 1WC7A 3RIAK 1ND0B 2BXZA 2P8PB 3KPRD 1BVLB 3VFRB 4K71B 3HNVH 4Z7WF 1NH6A 5IB5A 1D9KB 1J8KA 5M95B 4OAWA 4Y89A 1GC1L 1QPXA 3OBAA 3U4EA 2OL3B 4MJIE 4LNRA 4JRXE 4EUPG 4P2RD 2VAAB 1AGCB 3G5VB 4U1IB 1KTRL 5CEYA 2XFXA 4HDIA 4C59B 4RFNC 1MCIA 4XTRC 1Y6NR 4LBEB 3E2HB 4ZOBA 2DWEA 3U30C 3CU1A 3QIUD 5D7SH 5B22A 2PXYA 3DECA 1EA9C 2XNAB 4WCYH 4I48A 3OR6B 3MV8E 2X1PA 3GO1L 5K33A 1YEDB 5TPWH 4XPBL 5BS0B 2J5LB 3EJZD 4ALAH 3DX6B 3SEPA 4JM2C 3VXRA 3U2SB 2FEDC 3IU3A 1LDPL 2W0KA 3N1MC 5IW3A 5I1KL 2DDQL 4FZ8L 1F4YH 3MOAH 1AY1H 4IS6B 5CILH 4TN9A 4X7SH 2DLEA 4NQCA 2EC9T 4XXCA 4PJGF 3UPRB 5KVFL 1OP5K 4O58L 4UNUA 5HVGB 1ZLVH 2W0LA 4M7JH 4H1LH 2BSSB 4JO2H 5F6IC 1AQDB 5KW9L 1EHAA 4Y5YC 1CXLA 4IIQC 4ENED 3Q5YA 1DTUA 2NY7H 5CD3A 4ZS7L 1MHHB 5E2VH 4PJHE 3FCTB 4Y4FB 4XP9L 3S36X 3DX7A 4JRXD 4FXLA 3I50L 4ZS6C 3FO1A 4DW2L 2VE6A 3FQRA 1WLHA 2ZUQC 5EDXA 4PJCA 2ZJSH 3P77A 1MFBL 4P9ML 4LSRL 4IIQA 4M7KL 5C9KA 2AI0H 4LCWB 1X4XA 4NRZB 2ITCB 4MAUL 3U79A 2NY3B 1WBYB 1QRNE 5CEXA 3RL2B 1AXTH 1Y18A 4OCYH 2DL9A 2Q8BH 3VWKD 1YDPA 2IPTH 4IRJC 3S34H 1EXUA 1UA6H 5I1LB 1WTLA 5HDLA 1HHJB 4YDVA 3FKUS 1I4FB 1AGFB 1AC0A 4ODVL 2V17H 3D0VB 3DUHA 4YGVA 4GRMA 2VUOA 4M5YH 1BQSA 3DYPA 2OL3L 2XOTA 4NNYA 5TDNB 5KS9B 3GB7B 3JTSB 1R3HB 4NCDA 3BGFC 1GSMA 3D3VB 3I2CL 3C5ZD 1Q9OA 1ZLUK 4IRSC 4I9WD 3VXQA 1MNUH 4UDUB 5LXGH 3L95A 1HDMA 1KLUA 4PBWD 4C83B 4OI8A 8CGTA 4U1SB 4U1GB 3T2NL 5TF1L 4HS6A 1NLDH 3SKJL 3TPKA 1U8MB 1K9TA 4HH8A 4JZOA 2ED8A 3MNVB 1IM3A 2DDQH 3QBTB 4GKNB 5ESAA 5I30H 5IFHL 4R4NC 4KI5F 2EEBA 1RHHA 4ZFFB 1J0HA 2BFVH 4OCXH 5CZXD 3NFPA 1RUQL 4N1HB 4YC2C 4YX2L 2E8YA 4PR5A 1AFVL 3G04B 2VZTA 3HMWL 5FGBA 1A21A 4PLOB 1D5XA 2VLKE 3HC0B 3EOAA 4LLUA 4WW2A 1H8SA 2VUYA 4Z8FH 1N6QL 2GIYA 1F90H 3UTSE 5B8CB 5B21A 2X42A 3DETC 4PRDA 1CGSL 3I50H 3G6AA 3L3OA 4D3CH 1D5IL 5C92A 1NBYA 1TQCB 4PRBA 1BPVA 3WIIL 1M71B 4XPTL 3GNMH 2VQUA 4JFQB 4Y5XC 3CXDL 4OQTH 2VABB 4WY7L 4HIHB 2P46B 3D25B 2V2XA 3UPAA 1RUPH 1N0XH 2ADIA 3QHFL 5EBMB 4XVUD 2NY2C 1H5BB 2Q7YB 1I8KA 2HJFB 5D1ZC 4JDZA 3DVNB 5LKNA 1HZHL 1XT5A 5DD6B 5EBLA 2W07A 4LF3B 3TJHD 3UCRA 1R5IB 2DKUA 3O8XA 4PJ8B 3BDBA 5IHUL 4XC3L 1S7SB 1NEZA 1UC6A 4XPAH 5HYSA 3VRLE 3B2VH 4NKDB 4JO3L 4P59H 1NBQA 5LXGL 4Z78A 2XWJA 1RPQA 5FUZL 2AJXH 2EXWD 4W81A 3VXNA 3RIFF 1YY9C 3H9ZA 3RA7H 4U1LA 2MOVA 1OHQA 3DPBA 5ERWA 4NZDA 5DI8B 2ATPA 4L4TD 5C86A 3L3IB 5AWNL 4TSCH 4TRPL 5D1QD 1KIRA 1YC8A 1FNSH 4M1DH 4MDJA 2WIIA 3ZDXF 1R3LA 1S9YB 4QNPF 1BD2A 4O2EB 4QRSA 1QNZL 4TTGA 2JK5B 4LHUG 3FMGH 2XQYK 5AYUL 1I3RB 1AXTL 2Y36H 4OCNC 3WSQL 4A6YA 4B53A 4WNQB 1FIGL 4PB9L 2MCG1 1PG7L 4DZBA 1JHLH 3E6FA 2O93L 3HRZB 4BA8A 4PJDB 1CK0L 3W11D 3BKCH 4EDWH 3MRQA 4R90L 5CLWA 5L2KB 3SKMA 5SWSB 1ND0A 1T1ZB 5FO7A 1DVFA 2NMSA 3N50A 3MCKA 1YEJH 1HILB 5HHQA 1JGVL 1MPAL 2BNRA 5DS8A 3D2UA 3ZKQD 4GW4B 4GKSA 1FVEB 3NZHH 1WF5A 5CEYB 4KJYA 5I71B 4LIQL 1EGJA 1ZK9A 2EDDA 3PJSB 2A2QT 2GT9B 3QG6A 3PGCA 3KPRA 4QHUA 4TNWK 2NX5D 3LV3B 3ZLQC 3EYVB 2F19H 4RMRA 2YKLH 1FNEA 2C7UA 4OF7A 5CGYD 1J87A 1DE4A 1Q9LB 2HG5A 1KBGL 1FL6A 4HW6A 3QUYA 4M43H 1A3QA 4YAQB 3QHZH 4GLRI 4JY5L 4ODXB 3C5SA 1E4KA 2X5PA 5TGBB 1BJ8A 4JAMB 4JFPA 2XN9D 3KYKL 5A2LH 3U4BL 5I8EA 4Q58C 5DFVD 5EO0A 5SWZD 1GH7A 3GSUB 5F6HJ 2D2OA 4OLXL 4HCRA 2ORBL 4OV6F 4KMQA 1BREA 4XNQA 2Z4QB 4F7MA 1OP3K 5BCAA 4JDTH 3VMPA 3KPRE 2IANB 4WI3A 1YEHH 5I6XC 4G80B 4L4TE 2DF3A 1P84J 2V5RA 1HIML 3KLHD 5D2LF 5EZIL 2ICWA 4JRXB 2R8SL 4Y4FD 4JHWL 3QEUA 1UEMA 1KFAH 1PEWA 3P77B 4EBQH 4ODSL 5ANMA 4P99A 2VZSA 1B4JL 1CFVH 4YE4H 2ITCA 3KNBB 5AZEH 4LOUC 1XFPA 3EKCA 4C57C 4GSDL 4Y1AA 3V0VA 3VXSD 1W0WA 2EH8H 1UACL 4JR9H 1JZ2A 3N1GC 4K8RD 4P57A 5E1HB 3VFVB 4G8GD 5DQDH 1OAYL 4PLJD 2A6IA 4WTZG 4KI5E 5HGAA 1JTTA 5BS0D 3C8KA 1PGRB 1NBVH 5B38B 4P3DA 1HINL 1A6UH 4AEHH 1T21A 3A67L 5IVXA 3MBXL 4G6MH 1OSPH 3LRSA 2ZNWA 4NNPL 2E3VA 5EA0H 1FZMA 3DLQR 4Q9RL 2Y5TB 1IC1A 4I5BA 4O4YL 1DL7L 4HC1A 1VSCA 3QEQA 4ELMB 2YD7A 2OZ4L 2FL5A 1IVLA 3MX0A 4OD3H 3S7GA 1I7RB 3G9VA 3O8XD 3ARWA 4PRPE 1LDSA 3KHQA 5KW9H 5IFAH 3GIVA 3EFDL 5E6ZA 2MJWA 5JPNA 3G08B 3GSNH 2B7DT 3D9AL 2P8LB 3Q3GA 1AR1C 1HNGA 1DANT 2WSKA 4QXUL 3ARED 3WS3A 5EFIB 3TT1L 3TBTB 5D1QA 2IQ9L 5KS9F 3EO1A 5D2NC 5MHSE 2Z91A 3CFJB 2YPLD 1P4BL 3ROLB 4N0UA 1D5MB 3P73B 4P4RB 5E2UL 2QHLA 1F4HA 4NQXB 4WY7H 5BRZE 1J1OH 4ODTL 5J1SC 5C0JA 5J6GA 1YJDL 2W65B 1LVEA 5JPMB 2EDNA 1B2WH 2CRIA 5GGRB 4X9HA 1T0MA 2VLRD 1VFBA 2V2XB 3BW9B 1BBJA 3FO0H 2J2ZA 2C1PB 2R4SL 1YEEH 3V52H 1FG9C 3SDCD 1B90A 4NNXB 4FQIH 5JOPE 2W9EL 2OXGA 4YFDB 5B4MD 1OL0A 4WEBL 5HHVH 4Z7UF 4AEEA 4PREB 4LEOB 5D1XA 4QY8B 4YHNB 2PYED 3PWNA 1V3LA 4X4YB 1DLFL 5DURB 3DXAB 4LLVA 4XXCC 6FABH 1GGIL 4GG8B 2FATH 4DEPB 4MCYB 5TQ0H 5DLMH 3O4LB 2DMCA 2EIDA 5CWSA 3VMNA 1FHGA 2XPGA 4LLDB 2BVQB 4QRQA 5TH2A 1FYHB 3TCXA 1JZ6A 1J0KA 3QEGH 5ICYB 3U4EB 3MUGA 4NQDB 5TE7H 4ZQKB 2EIEA 4YHLL 4KROB 5IBTL 5M7QA 4CAGA 2P47B 2AQ2A 1IM9A 2ZSVA 5BZDA 1SVCP 1ZVSB 3B2VL 3SE3A 4G7VH 4BQ8A 1MQKL 4QTHB 3PHSA 4QCIB 5SWZA 1K6QL 2NNAA 1OLZA 2DN7A 1RZIB 2ARJA 3IFPA 4S1DC 2W59A 2VISB 4BQBA 2XWBA 4KV5E 3FRUA 5CIPB 4JO1H 5HDOA 4PG9B 1W72L 2IANE 3GSQB 3T4YA 3PL6B 4ZUVA 3SJVE 5MEQB 3EDKA 4BZ1H 3H0TB 3X14B 2HYMA 4H8WL 4KUZH 3FB7A 3MRRB 1MCOL 3IAGC 2DLFH 3MRFB 3LS4L 4ZUTA 4GKSB 1BJ1J 4OGZA 4LQFL 2X4OB 4XCNA 5DC0A 4NFDA 1L7TH 2AJ3B 2XFXB 4NQDD 1GZPA 1F42A 3MLYL 1CGYA 2DTSA 1X9QA 5KTEL 2Y4SA 1TZGL 3LV3A 1W8OA 2EDEA 2XZZA 3VGDA 4LEXH 1PBYA 4NC1E 3ZT5A 4LSTL 1WISA 1GGTA 4IHOA 4FS0A 5DVLA 2Y1VA 3TBWB 5JR1L 2VE6B 2A9NL 1QACA 1TQCC 5JW5A 3RDTD 4EKXA 3SDCB 3MRDB 1L6XA 2HKHH 2P45B 4I0PD 4NO5B 4ZUWA 3V9FA 4GFTB 4FQHA 4BUHA 4LCYB 2APXA 1Q0XL 2FHBA 4GRLD 5IM7A 4S0SD 4D9LH 5F7EH 3U82B 4LP4A 2Q20A 3WXWL 1I4FA 3VXPB 4HUWA 4MWFB 1PG7H 4PBVC 3PNWB 4PGBB 2WP3O 4X0KA 5IMMB 4YBQD 3ZKNC 5CJ8A 2DQFB 2AK4A 2YPLB 3KPQA 4OJFH 2UZIL 4AH2B 4JZJA 1KTLB 5D2NB 4YH6A 1NCCL 4U1JA 4G42B 4Y5XA 5A16A 3X3GH 2MHAB 3ALPA 5E2JA 1A4KB 4G6ML 3X13A 4MZ3A 5GGQL 3S3JA 4R97B 1JWMB 3F58L 1ERNA 2ZSWA 2E7HA 1EMTL 4QEGA 3VXUA 5ADPH 4M62H 5IMKA 3QJHB 5GRVK 1IFHH 2OK0L 1UKQA 1ZAGA 5DJZA 4ISVB 2HA1A 1VPOH 2GAZB 2YD4A 4O51A 5JDSA 3HMXA 3F6IA 3BH8A 1MHPH 1HWGB 1S8DA 4D0DA 4KUCF 4NN6B 1I7TA 5GISL 4OV5A 3L3JA 3QIUC 4NRYB 4Q6YA 3V6BR 3OKKA 1RURH 3C60B 1EJOH 4LSQH 3RJQB 5FGBC 1G9ML 2FH8A 5HHMB 3KPMB 4F15C 5EU7E 5IJVB 2HTKC 5LGJA 3BAEL 2N7BA 3G5YA 4JM2D 3QPQD 1A5FL 3KPPA 2FEDD 4HWEH 1KUMA 3TZVB 2XG5A 1IM3B 2A83A 1PDKA 3T3PE 2DQIL 1H0DB 5J11B 5E5MB 1IGIH 4PRIE 1MAMH 1TZGH 3UBXA 3IYLW 1VB9A 1NLBH 1KPUA 5DK3A 3UJIL 4YHOL 1XGRA 5CUSL 2NXZD 3WS3B 4C55A 4LARH 3HE7B 4W4OA 4M1GH 3DVNA 5F3BA 3IGAB 2VIRB 2BOCB 1LEKB 1IM9D 3HPLB 4P5MA 2UVEA 3M17A 4BYHA 3UO1L 4ZS6D 4OUUB 5EWIL 3NIGE 1CQKA 3OKEB 3LEXA 3TZVC 3WD5L 4ZFOA 1FBIL 2XXMB 4UQ2B 1MJ8H 5F7UA 1Z5LB 4X6BA 3ZSSA 4JRYB 1A22B 1PG7X 5F6HI 4HIJB 4LLWA 5IVNA 1VFMA 2DTMH 1JNLH 4XZUA 4JFEA 4QF1A 5BO1L 5C3TA 3O3BB 4UB0H 3NIGF 1MELA 3QXDA 1MCOH 3VWKC 2YD6A 3BW9A 5DJYB 3BIBX 4JHZA 1A1NB 4YPGB 3GMPA 4EI5C 3FAXA 2WIIB 2XN9B 4Y2DA 4JFXA 4F7CA 3RL1B 2RGSA 4Z95H 3W9DB 1F3JB 1IZJA 4IDJL 4ONHB 5FDWB 4YHNA 4QRTA 2ZG2A 4JPVH 2I9TB 2BNQB 4JCMA 1J9CT 5F1IA 4MDIA 4FABL 2QADD 4NQVA 2OZ4A 3GMLA 2F8VA 5HPMA 4NWTH 4GXUN 3SKOB 1NDGA 1T2QH 3KYNA 3B3IA 4HIEA 4HK0A 4RAHA 4LHUD 2KQNA 3O3EA 2R8SH 1NCAL 5D2NE 1BQLL 4MAUH 4CW1B 1MEXH 1LE9A 1QLRB 4GG6E 1X5AA 1QBML 3NZ8B 5ELIA 5DJ6B 1OB1A 5C0CD 5CBAA 3LY6A 4OZ4B 2NY4D 4M1DL 4YHIB 1M7XA 4EXPX 1I3RA 4TNVF 4YQXH 3ZE1E 5HHPB 4F8QA 4PJHB 3HA0A 4N8VA 5JIHA 3LN9A 2PXYB 4GQPH 5DT1H 4DTGH 2HRPH 3F8UB 4FQLH 4S1QL 1J1OL 4I48B 3RZCC 3RTQA 3BGAA 2FWOB 1YJDC 5J12C 1NUGA 3HHRB 1YQVL 4XI5C 3DETD 1KULA 5GS0H 2BOBA 3G6JE 4PGCB 2AJYL 2VZ1A 3NAAL 5TGBA 1A7QH 4OLUL 3UYRL 2B5IC 4LNRB 3QFJD 3TJEL 4QHNB 1AGCA 3TBSB 1LDPH 2X4PB 1TJIH 1E4WH 4L4TB 3H9HA 2RFXA 1BFOB 1CGTA 1U95B 4MJ5A 4PLKC 1DN0B 1AKJB 1C5BL 1FDLH 4M00A 5KVMC 1ITCA 1CU4L 3K1KC 3BP5A 5B39A 4H20H 5JO5B 5ID0A 3CXDH 3U0TB 3BDYH 1AQDA 5FYJU 2NY2D 25C8H 1DE4B 2KBGA 3CJJA 5D1ZD 4DKFL 2HH0L 4ETYA 4LRIC 3TJHC 2UUDK 4R4BA 1CLZL 5GJSL 1MHPL 5JXED 3ARGC 1WFTA 2D03H 5DSCB 1U8IA 1X6NA 5JLZA 5LVEA 4PRNA 2Y7QB 4OIBA 3UAJC 1NGWA 3MO1B 4DKEH 1CGUA 4TUKL 2Y72A 4ORZC 2EXWC 1IEAA 1YY9D 4QRRB 4N0YL 4Z7VE 5SWSE 2VDMH 3V6ZB 3EBAA 4H8WH 1EXUB 1W0WB 2NY1B 3K1DA 4WV1A 5D1QC 4GAYB 5I1LA 5I1JL 1HSAA 1KCSH 1FNAA 2Y23A 2Z92A 5F1SA 3QYCA 4OKVB 1HH6A 4I2XB 1P2CA 5AWNH 4ZPVB 5IJKC 4PJ7A 4RGMB 3QA3A 1GC1H 2VL4A 4M9PA 1JFQH 5CINH 5HYJD 4DZ8A 5I1IL 5J12B 5A2IH 1FL3A 3GHEL 4JKPL 4WWKA 3WXWH 3WUWA 3W11C 1N64L 4NWTL 3RGHA 5F7WC 5J9PB 5IHUH 3T1WA 2XQBH 2BNQE 2YPKB 3IDJA 2GUOB 1XEDA 3PWPD 1ZGLB 1P6AB 1XGQA 5EH1A 3CMOH 4PY7A 5I1CH 5GZNC 1IKFH 3MNVA 1QKZL 4JKWA 4DVBB 3KPSA 3F7VA 2GSGA 1JZ5A 4XH2B 3OAYK 1JRHI 2KDGA 1ADQA 4JG1H 3C8KB 1JGLL 1WIUA 3MOBH 2H2SC 1XF4B 5T3ZL 1NMAL 5BO1H 3GNML 3VMOA 1BVZA 3MROB 1KGCD 4EVNA 1JGDA 4LASH 4AENB 1HI6B 4BQ9A 2EIZA 3MGOB 1BJ1H 4P9MH 5DEGB 4N8VG 2HTLD 3V7AE 2H32B 2W9DL 5JHDE 4X6DB 1AH1A 4JFYB 3P73A 4RWYL 1KBGH 1GGYA 1IGCL 5J6GB 5LWYH 2H8PA 4O5LH 1G6RB 2WK2A 4YDLC 5DFVC 3QNXB 3JUYA 4MB5A 3ARQA 4LPTA 1NANI 4YWGH 4YXLL 5CP7B 3U9PH 4MNGB 5D8JL 1C5BH 1FDLL 1ZHNB 3ARVA 2BHYA 1TTGA 4LGSB 2DL2A 3AREB 3L3DB 1ORQA 3N9GL 1FE8L 5I76A 2P5EB 2DM3A 5L8KB 3LKSA 3O11B 3LRHA 3KLHC 3CFJA 4QT5B 1BOGB 2CXKA 1MH5B 5F97E 3O2DA 4Y4FC 5FYLL 4PGDA 1NEUA 4L9LA 1GGCH 4LLVB 5C9JA 1I1YA 1KPRB 4S1QH 1DBAL 5EU7C 1MVFA 2Y36L 5IVXE 3WSQH 4XNYH 3HLAA 5LAXB 1HHGB 5C0IA 5I8OH 1QA9B 4JFQA 1UZ6E 3GMMB 4KPHH 3RWEB 4X6CF 3STLB 1NMBL 4HIHA 1FYTE 4XMLH 5L7XL 1ORSB 4G6KH 4LCWE 1QLFB 2IALB 1ZV5A 2ESVB 2QSTA 3QRGL 4K8RC 5GHWH 1OGAE 3RWDB 4N90D 4PLJC 4LVEA 1JJUA 1S5IL 5FOBA 1HSBB 4HV8A 2UVFA 1LE5A 4LF3A 3BPOC 1PX4A 3I6LE 3L1OL 2IMNA 3T77B 3FONA 1QSFE 3VXSB 4LPYA 4H0IA 3LQZA 4D2NA 2VTFA 3H3PL 3BMVA 5TQ2L 2XPGB 4B41A 4HGWB 1B2WL 2ICES 3F7YA 5AZEL 4F9PA 4FQJL 4IDJH 5F1NA 2R1YA 3O8XC 4OF3A 3R0MA 3WFEH 2P43B 5DJ6A 2GYSA 4UZGA 2ICEB 4OIIH 5MI0B 1YMHA 2Z8RA 1D9KD 4TPRL 1N7MH 2C4FT 4QCIA 1P4BH 3KPRB 3ARDB 4K3DL 4PP2B 3VFTB 3AREC 4PJIF 5HD8C 5T1LD 1AI1H 2R2BB 1FZJB 3UTQA 3WIHH 3MUHL 4NSKA 3GSVA 2MCPH 5L2KA 5BXFB 4JY4B 4M93B 5KSUB 5ISZE 9CGTA 2BOBB 1B0RB 1DVFB 1WBZA 3BWAA 3LKQA 2R2EA 4D0CB 4L4VA 1SYVA 4G8FB 1RZJL 3QIWB 5JXAL 4UIKL 4RBPH 3SDCA 2FSEB 5CEZH 2DWDB 2OQJB 3P0YL 4G8GA 2X10A 4U0RB 3DURB 4UV4L 3BN3B 1J1PL 4Y1AE 2BRRL 1RUML 3FQWB 1CD8A 1QVOA 1TVHA 2GHWB 4GH7B 4L3CB 3BKJH 3MLYH 1HKLH 1LD9B 4WI7A 3VFMA 4DKAA 5IEKB 1VDGA 1X5FA 1DSFL 5B4MC 4JFDD 2A73B 1FL6B 4MQXC 1NLDL 3WFZA 4HKZB 3AU1A 1JGLH 1UXSA 1BHGA 3VFSA 5HSFA 4Y19A 5GGSB 2D0HA 3GMQA 3BDXA 2QHRL 4AZ8A 1OSZB 1WV7T 4HGMA 4KUCD 5IFHH 3QISA 4Y0GA 3MTRA 1K2DB 3A6CL 4QYOB 1S7TA 5IROA 4YHML 5KZCB 4MNQB 5CEZE 5FYKD 4HPOL 1A7NL 3RPIB 2IANA 4LSPL 3ZDYF 5E94A 5I1GL 3TYFA 4JKPH 5DDHB 3WDJA 2DI8A 1OT1A 2DMBA 4D9QE 4FQLL 4MS8C 2C3GA 1MLCB 3HR6A 4F37F 3TN0A 3TBVA 2ICWB 5E6IB 4Y88A 1I1FB 2O26U 4LSRH 5INCA 2D7NA 2NW2B 5CJOH 4N1EA 3EYUL 3ALWA 4K7PY 4HH9A 1F6LL 4X83A 3FB8A 2YS4A 2X41A 3DUUA 4K07A 4LKXA 3GJEB 4WFFE 5BZWA 3VGAC 1AC6A 3K3QA 2JJTC 2HAZA 3QNZA 4HCRL 3S4SA 3SOBH 1CL7H 4OD1L 5KVDH 2NTFB 2APTA 4J6RL 4FMKA 2BMKA 1F58L 1VFAA 3IAQA 4WUUE 2Z35A 2X40A 3VXTB 4A2MA 1S8DB 4RCAA 2DMKA 1YN6A 3UTOA 2NYYD 3KYMA 5JORB 3MROA 1HHHB 3P0VH 4YIQA 1NC2B 2CLZA 3BYYA 1QUNA 1YEGH 3KPNB 5TF0A 2WIMA 4ZTPL 4MXWH 4DVRL 1PSKH 1AKJD 4U6YB 1KN2L 3IGAA 3K8MA 3H9SD 1KIQA 4UI2A 2K7QA 4K3GA 3GRWA 1N4XH 1F11B 2QQNL 5EUOB 1NAKL 4QXTB 4EOWH 3FB6A 2NX5E 4NM4L 2OS7A 3U0WL 5EOTB 4CN6A 5GGRA 2QJDA 1C08A 5J7CC 1DQJB 1UCTA 5J8OA 1RVFL 4NN7B 1OTSC 3ULUC 1RUMH 4FQCH 5IB3B 2FEEL 4MJ6B 5HPOA 1T20A 4JKKA 3P11L 1CR9L 2JB5L 1MJJA 1OVZA 3RL1A 3WHXB 5E8DL 1AXIB 5E08L 4PJIA 4CVZB 1P4IH 5IB1A 4FP8H 4YBQC 1RIHH 3MRCB 4OD3L 5BMFL 5GGQH 1F6AB 3ZKND 3DV4B 4N9GA 1KTDA 1EVTC 4G7YL 3VFUB 3LEXB 5C9JB 3DXAA 1UB5B 4WUKH 4DGYL 1IAIL 3OXRA 4KTDL 3WIHL 1IKFL 3OKMA 4AQOA 3KYNB 4HIEB 3D5OF 2ARJQ 3QEHB 5DZOA 5LGHH 4F3FB 4GRWH 2X4NA 1UG9A 2VRAA 5F21B 5FM5O 4HS8H 2BVQA 4MB3A 5LCVL 1TETL 1BIIB 1HH9B 1WEJL 4XCCH 1BBJB 1A47A 2ESVA 4KU1A 3JVGC 1QO3A 1S7WB 4LSSL 3PGDA 1BQHA 2FECL 3K81A 4OZ4A 2VN4A 1EJOL 1LO2H 4OUOA 4X5LA 3U7YL 4AQ1B 1NGXB 1UENA 2NZ9D 1RZ8B 1OAZL 4HLJA 4LHQB 4X7EC 5T1KB 3BZFA 5GRUH 4YPJA 1X7QA 1LNUA 2XWBB 4XPGH 1AP2A 5HY9A 5BVPH 2A77H 2H41A 1U36A 2WBWB 4F7EB 2HTKD 3WFDL 4LCWD 4WI4A 4JFDA 2NXYD 4BSWA 3QPQC 2OL3A 2AXJA 1A1OA 1PG7W 3KPSE 4K7PL 3IETB 3T2PA 1NFDB 2ZUTA 4KK6C 4F9LC 1YMHB 3CH1B 1BBDL 1IM9B 2ZSVB 1C12B 1NGPL 3MJ8A 3X12A 1J12A 2GW5A 3ARDA 2ATKB 1OAUH 3C2SA 1IGTA 1CLZH 3O4LE 5K9JL 2NXZC 3V5DB 2VH5H 2HH0H 5IIEB 1ACYH 1RK0A 1A7PL 2R69L 5FYLE 1UYWH 3ILQC 2E6JA 1AR2A 4HF5H 2F5AH 1N4XL 1KEGH 4YJZL 1UWXK 3D18A 4XP5H 3VXRB 2V5TA 4FFZL 2F53D 1T04A 3FQUA 3TZVD 4XCNB 4POYA 2QSQA 3PWVA 3BPCB 4R96A 4FQHB 3ULVL 2AEPH 1IQDB 1I9IL 3VFMB 2AABH 4WFGD 1WWBX 4J6RH 3I6KB 4EI5D 1QSED 1UM5H 3FN3A 3TC9A 5C6TL 4Z7NE 3H7LA 1ZA3B 1AO7D 1JGVH 3MACH 1KELH 1UXSB 1AGEB 1M7DB 1YNKH 3QJFB 4P2RB 1YNTA 1JV5B 2ED7A 2QADC 4KC3B 5JLZB 3WHE1 5F89A 4EDWL 4OLYH 3F7RA 5KN5A 3EGSB 3QCTL 4ERSH 4OCYL 1DFBL 4NQSA 1JL8A 4RGNE 4ZUUA 1XGQB 5FHBL 1ZSDB 4ZG1A 4NPYB 3O3UN 3H9SA 3AXLB 1ED3B 3HAEB 5EU6B 3V2AR 2ZCLL 2W60B 5FO8B 2HFGH 3UTTE 1T1XB 2LVCA 2OLDA 4JANB 5MP6L 4HJGA 5HGBA 2NY4C 2APBA 2X89D 4AT6B 4G6JH 2FECI 3MLTB 4JHAL 3PP4H 4X80H 4NO0A 2Q1EA 1IMHC 2NW2A 5EZLB 3EDEA 5DEZA 1FO0L 3L7EB 4KHTH 4HUKB 3QFJA 3U46B 1EO5A 3RZCD 3MODL 4AIZA 3PDOB 3QXTA 3MA9L 3SDAB 1KJ2L 2BVEA 1KIUA 4JFYA 5AUMB 5GXBB 3OPZH 4XI5D 5HHMD 3S35H 3CSGA 3T65A 5FGSA 3OGCB 2DQJH 3T4AA 4CNIB 3MBEA 5F8QC 2WMPA 3BD4A 5CP3H 3ULSA 3SE8L 5D1ZA 3C5ZA 3VXTA 5DGRA 1PKOA 4PLKD 5JNYB 4HWNA 1WAAE 1GPOL 1ZHKB 2EDKA 4NO2A 2ILLA 4R7NA 2YRLA 4QRPB 4Y16B 1XR9B 1XF4A 4PR5B 5GS1C 3LKRB 2GY5A 4EI6A 1UFUA 2X09A 2E5EA 3OKKB 4AENA 1U8OA 3HNTH 2A1WH 4UTBL 5SX5K 2K1MA 4EN3D 1BGXH 1E28B 5JXEC 1R3IH 1JPTH 3B4NA 3ARGD 1CGSH 3G5ZB 1FGNL 1ITBB 4MD0B 1JVKA 1N6UA 1JPTL 2G5RA 2W9DH 2ZUXA 2KL6A 4CUCA 2DD8H 3UAJD 1L4IA 1TJGH 4ZDHB 5IG7A 2C4XA 2V6HA 3P4NA 3FB6B 2XKNB 2VKXA 1ONQA 2HLAA 2EE6A 2J88H 4NZUH 3IDXH 5DHYB 5CGTA 4OCLC 4XWGL 3BXNA 1G9MC 2IALA 4AIXA 5FCUH 3EYFA 12E8L 2P24A 2MQ0A 4HV8B 2H26B 3BQUC 3FB5A 1NSNL 3KLDA 1TQBB 5EIQA 4L29B 5C08A 1Z9LA 4K3JL 3HC3H 4S11A 4KROD 4NM8L 4HWZB 4L3EE 4KRMB 5BV7H 3MRJB 3BKCL 4EBQL 3CFCH 3IKCB 1EDQA 3MODH 1JHKL 2BK8A 4NFBA 2X4NB 1FPTH 1ETZA 1MCEA 1QZ1A 2WNGA 5DYOB 5KVGL 4G6FD 4ZAKC 5JW4R 4CW1A 4BZ2H 4KVNL 2FB4H 5GZND 5LBSH 1L9NA 3BYTA 3DXAD 4WU7B 1AE6L 3FHAA 5FKAA 3WO3B 4C4KO 2FZ3B 1D7FA 4UU9A 1MI5E 3DSNA 4KAQH 4PJFF 4XCFL 4PJ7E 2H2SD 2CLVA 4FTVB 5H37H 5AYQA 3IU4H 3KXFE 4NCC2 4NSKB 3KLSA 4DCQB 2HTLC 2FWOA 2R4SH 3BJ91 1A6AA 4MD5A 4FABH 4GAGL 1NCUA 4FQXB 5EC2B 3U0WH 4UOW1 4JKMA 4PB0H 3DROA 3W0WE 4PJEB 4ZNEA 2HVKA 1AJ7L 3T8XA 1T1WB 4OI7A 3NCEB 1OY3B 4NT6B 3V7MA 2YBRA 4ZOCA 3SN6N 5TDPA 3K4DA 4IRJB 2R23A 4BKLB 1DBML 1RIUH 1KEGL 3RVVD 3ULUE 1B9ZA 1LILA 4LMQI 5ID0B 1K85A 1NMCC 4PV8A 5DJCB 4PUBL 4PJXA 4X7SL 5KZCD 4G5ZH 1T2XA 1VESA 1Y0LA 2V5SA 3ARTA 5F9WC 3V5HB 5D6CB 4JY4A 1M7IA 5DMGD 5BS0E 3O2WH 2X89A 3ZE2E 4FXKB 1U8IB 4U1NB 2HJLA 3OAUH 1R3JB 3GO1H 5DEFB 4QRPD 4ZNEE 3DV6A 3LEVL 2VLLB 1WITA 1OTTD 3KPSD 1J8HE 4Z7OF 5L2JA 1LGVA 1Y18B 2R2HB 4CJ1A 5DWUH 2DBJA 2XZAL 3WJLC 4P4KA 4RX4A 1CF8H 4YDVB 2I9LA 1T5XB 3MXWL 1S9KC 3EHBC 3KXFA 1MCRA 4LKCB 2DICA 4R6UA 2YD8A 4QXGL 1T7VA 3CMOL 3HZMA 4K7PH 3UBXI 1EHXA 2DIBA 2LU3A 3U1SL 4HWEL 2CKBB 1BZQK 3DX7B 1NBVL 3LS5L 3BT2L 2QR0A 5I74B 5DD0L 4URTB 4Z7VF 4E41D 2GTWA 5C7XL 4LVHC 4JFFA 3OMZA 3PWJB 1CDIA 1TZIA 3KNBA 1FO0H 4IOIB 5B38G 5C0NC 2ZCKH 4PJFE 5DJAB 3D0LB 3JWOL 3C2AL 2BERA 4ZUUB 2XQYG 3C87A 1CFTA 1LP9E 3C2AH 1YEJL 5L9DL 1JWUA 2G60L 5MEOA 2NY6B 5ALBL 3S96B 4L3EA 3MLUH 4HMDA 4OCMC 2XN9E 5KAQF 1D9KC 1JE6A 2F58H 5IQ7H 2IPTL 1ZLVK 4OCRH 2O5ZL 4KTYA 3KLAA 4OFYD 3NCJL 1A3RL 3MGAA 5HD8D 5D7KE 5DK0A 3SY0A 1PEZA 1KLUB 5IROC 4OFDA 1WFUA 1CS6A 4P46A 4XBEL 1WZMA 3AUVA 1DQQB 5GGTH 2VDLH 4RMQA 2LU7A 4UV4H 3HG1A 1H3VA 4RAUB 1ZGLP 2GSIA 3QXUA 4MA8H 5EZJA 25C8L 2PF6A 1QBAA 4LK4A 4MLIA 4PRBB 5C07B 2PTUA 4EUPA 1XF2B 3RZCA 3ZYIA 3F7VB 5F93C 3TLRA 4QOKB 3BH9B 1DQJA 3ZE2F 1D5ZA 4HS3B 4WHTB 4P48A 2AQ3A 1A3LL 4OFPA 5AZ2H 5CCKL 5ESQA 3TBTA 4UV7H 2R1XA 5DHVA 2Q7YA 1MCPL 1H9VA 2HT4D 3O11A 5L0QB 4OZFG 4MQXD 1BF8A 1CG9B 5ETUB 1MAJA 4X6DA 3D9AH 1MH5A 5I71C 5JR1H 3GSRB 2P48B 3IJHA 4ZTOH 4QO1A 1KTKE 4M7LT 3ZTNH 3RUGA 5EC1B 3OXRB 4LSUL 4LLAA 3PP3H 1PJ9A 3GMRA 3HLAB 3SE3C 3LQAH 4TOYH 2IPUK 4EN3A 4DN3L 1GIGH 1S9WA 1OLLA 1M6OB 1X44A 3BXNB 5E8NA 1FLTX 4NN5C 2P8MB 2DKSA 4WVRA 5JQ6H 1U2HA 1SEQL 1F4WL 2COQA 2VQTA 2HJFA 3VXMA 1A0QH 4PREA 4AM0B 3BD3A 4CADA 4MS8D 3THMH 5HXMA 3B83A 1T0NB 5DUMH 1F6AA 3S35X 3GUTA 3WFDH 3CXHK 1T6VN 3LVEA 1YMME 3BKMH 3BVNA 2GJ6E 4Y5VC 3MRGA 2VITA 4K9EC 3LKNB 2EDBA 1U6AL 3UTPD 3SGEH 2ATPB 2BNRB 5B3NA 5JHLH 3JTTA 4JO2L 1NFDA 4L8SB 4QOKE 2X70A 2XT1B 1RV6X 1FLRH 3LH2H 4M7JL 1BVKA 1IKNA 3QI9A 4LSPH 5BV7L 2FZ3A 2D7TH 1S7UA 4OCWL 4IMKC 4QHUB 4LBEA 2NYYC 3OB0H 4A6YB 4X6EA 3MOQA 1RK1B 1UM6H 1U8QA 5GRVL 2DM2A 4JFOB 3JBG7 3FRUB 5CIPA 1D6VH 3HUJA 3FTGB 2LABA 4HX1A 2F5BH 2WAHA 4C56A 3G5XA 3LQZB 4FQXA 3FB7B 4GW5B 3U7AA 1BVLA 3MRFA 5JZ7D 5FYJD 4PJGB 5HHOD 4I77H 5HI4D 4IS6A 5CHNB 1CR9H 2JB5H 2K3TA 5EPMB 1JI1A 2IGFL 5KVEH 5E00B 1NLBL 4XBEH 3C6SB 2LE9A 4R2GB 5K93A 2DWEB 1OTSD 3ULUD 4OIAA 3TN0D 3EYVA 4UOJA 1VEOA 1BGXL 5DJCA 1CXFA 5E2WH 4MXVE 3P0YH 3LHPL 4PJFB 3CLEH 2FBJH 4M1GL 1FN4B 1FZJA 4ZO9A 1VEMA 1NEZG 3C9NB 4YO0A 5FYKH 3I02B 3MLRL 3C5SB 3VDCA 1T83C 2MCPL 2MTPA 3GRWL 4OFYA 4K8RH 1HQ4B 1ROWA 1IGIL 3DV6B 5F7KC 3UTTB 3SGDI 4Y4HC 2WW8A 2ZOKB 4XNQB 1S7TB 3U36A 3FQTB 1ED3A 3HAEA 4P9HL 4PRHA 5IEHA 3D3VD 4P57B 5IQ9A 3OAYH 5KSVA 4U33A 3U6RB 1FIGH 1TFHA 3D0VA 4PB9H 4YGVB 4X0KB 2A6IB 3RDTA 2SEBA 4E42B 2PO6D 2NZ9C 4J3TA 1S5IH 4DGIL 3VFGH 1TPXB 4HAGA 5EZLA 5FB8B 2JF1A 3QFJB 3U46A 2IBZX 2IG2H 1YUHA 3L5WB 3L95B 5GGUB 3HFML 3HCVA 2B0SL 4K23H 5LBSL 1WIPA 1F4XH 3E1F1 1C16B 4OZIB 2Y06L 2NXYC 3ULVF 3QDMA 1ZVYA 4FNLH 5KJRL 2YK1H 1FAIL 2AJUH 5EO1B 1T1XA 4LGPB 3ULSB 2AJZA 4KK6D 1MUJB 3GSNA 1AGFA 5E94B 4FQCL 3CGTA 4HUMB 2GQHA 3H3BC 5HHXH 4G5ZL 4NRYA 4DEPC 4E5XB 3NPSC 1YC7A 4PY8I 5FUCC 1M05B 4GRWE 3ILQD 4UT9H 2E7CA 4OI9A 1TJHL 4R7DA 3HS0B 4X99A 2YC1A 3QIBA 5E1AA 5ITBL 4RAUA 2OP4H 4I1NB 1LK2A 4JM4L 4CU7A 5BOPA 1U8MA 1XGPA 3BUYB 4CNIA 4ZDHA 1DSFH 3I6LD 4S1RH 2WINA 8FABA 5H2BB 4QTIL 4UV7L 4PJBE 1P7KA 5DHXB 2BC4A 2J5LC 4DAGH 1O0VA 4GAGH 1CICB 5C6WH 4JB9H 2GITB 2EE9A 1NCWL 3MRBB 1R5VA 3NIDF 1YN6B 1FYTD 2CLZB 4P2QD 4MJ6A 3T0EC 5CSBA 1I8KB 3LMJH 3MREB 3D3VE 5F70A 4YX2H 4PJIB 4CVZA 5KS9E 2YWZA 3ROLA 2NR6C 4N0UB 5AG9A 3PWNB 2Z93B 4OZIE 3JWOC 5I17B 1BZ9A 5HHME 2GCYB 4FQPA 1D6VL 2ADGA 4JRYD 2EEDA 1P5UA 2HFTA 5EO9B 1GYAA 2XKNA 4J4PD 4XZUB 1K5NB 1RJYB 3LIZH 1FP5A 4XCEA 5J13C 1CGVA 4FFVC 2B5IB 2FJFB 5DJYA 1EFXD 3A6BH 5D71L 5DVOA 2ZUSA 1ZGLM 2EICA 4CN1A 1VERA 3NVQA 4APQC 3UBXG 4JFXB 2EDXA 5E8PA 3QWOA 1VENA 3AB0C 3JUZA 4NO3A 5JHLL 1IC5L 4Q2ZB 1KB5H 4JO1L 3DRQA 1N5YL 4QRTB 1S3KH 5TE4L 2FCBA 2JK5A 4U1KB 1S7QA 1ZTXH 1R5IA 2W92A 3B9EA 4KZDL 4NP4L 3MV9A 5F9JB 2DS4A 3LN4A 5I66A 2B1HH 4Q9CA 1NCBH 4FOMA 1MWAA 2DAVA 4HT1H 43C9A 1BM3H 4KFZC 5CWSB 3CFKB 3E3QC 3HZYB 3QCTH 4MQSB 2HVKB 1JWSB 2IH1B 5LGHL 1HH9A 1BAFL 1QTYT 2V7HB 4Y19E 1A6ZA 1VACB 3T04D 5IESL 1QEWB 4YHIA 4BKLA 4BSVB 2D4FA 1MJUL 1RZIA 1OM3H 1TDQA 1NAMH 1KENH 5I8OL 1UM5L 4C54A 4OD2B 3FQNA 3O81A 4RQQA 2QTEA 3G5XB 2GTZB 2XWTB 2X4QB 4EN3C 4CBPA 2IAMD 1MFDH 5CP3A 3MCKB 3V4VL 1KCRL 4L8BA 1I8LA 1N3NA 5E99L 4FZEL 1B0GA 3BE1L 4KY1H 2X4OA 1NGZB 4NYLA 5EO0B 3CFEA 4I0CC 3FHQA 5I1EH 1PYWA 2Y07H 4IRJA 2O5XL 2D9CA 1QFWL 1LP9B 3RNQB 3HUJE 1JN6A 2ERJC 3TVMA 3VXPA 1LO3H 4FQJH 4JY6B 3BQUD 4K9EL 1SBSL 1ZHBA 3QQ3A 3ZE0F 5MP6H 4LVNB 4KROC 3QJFA 4P2RA 2OJZL 1BFSA 2GJ6D 5L2KE 3ILPB 1G7QA 2XICA 2R2CA 4RNRA 3EYSH 3QQ4B 4NOBA 3QCUH 4NO5A 1AFVH 3VFWA 4OT1H 4U3CA 3V6ZA 5I75B 1TXKA 4ZAKD 4QRUB 1JWUB 5FO9B 1A7RL 3P0GB 5E4EC 3ZZ1A 1RAMA 4NQCE 4HUWB 1UKTA 2DIJA 5IESH 1NJ9B 1FNSL 1DLHB 2FB4L 5IMMA 4N68A 2QR0B 5F7MC 4Z7UE 1OF2A 5DJ0A 5KS9A 2GTWB 5CBEA 3D3VA 4M8QB 1N64H 4H26A 3SY0B 5I15L 1MCLA 1IC4H 1R24A 2JELH 1NCBL 4WHYH 3WMSA 5TFSH 3R8QA 5JUEL 4W6WB 1Z0NA 4PY8J 4JPVL 1HZHH 3OKLA 2RQ8A 2X6MA 2AJZB 4HPYH 5E6YA 1RZ7L 1YEKH 4ISVA 4L3AA 1X5GA 3CDGB 3BEWA 3K80A 1K3IA 4J4PA 1EHLL 3RVVC 1L7IH 3NFPB 3HZKB 2HMIC 3S6CA 1EFXA 3WXVH 1JPFB 2VH5L 4MHHI 4OSUL 4UDTA 4CU6A 1FSKC 3H2WA 3EOTH 3MGTB 2D03L 3G5YB 4O9HL 1Q94A 3DRTB 4P2OB 4UINH 1XZ0B 5DMGC 4M43L 3QDGE 3BMWA 3IJHB 1GHFL 5L88L 2IGFH 3L3HB 1QBBA 3LQAL 4EQ2A 3VD3A 5IG7B 3SGKA 1KJ3L 1Y6KR 4RGNB 3QUMA 3U4BH 1OTTC 4QOKA 3BH9A 1ZLSH 35C8L 4KZEH 5DMYA 5ITFA 2XZCL 3BWUC 3IFLL 2VZUA 2VLKA 4DVRH 4MJID 4WHCA 3EHBD 1MAML 1AI1L 5JIIA 1MRFL 1GZQA 4RFOL 4PG2A 4QTIH 1MPAH 3TH3T 5F3BB 3DTXB 2M2DA 4HWUA 2FD6H 3ZTJH 3OX8A 5DF0A 1CG9A 1D5MA 4UT7L 1NC2D 5I75C 3ARPA 4KXZI 4P2YA 3REWA 3DJ9A 1K5NA 2CXGA 2AEWA 3I2CH 1RJYA 5C0ND 2VSCA 4NZRH 1W0YT 3MCG1 1ACYL 3IDGB 3IXTA 4X80L 1S9WB 1FORH 2ED9A 1HXYB 5F71A 1JZ4A 2XTJB 5GISH 5TQ2H 1ORSA 3RNKA 1X4YA 3NZ8A 4PRIA 2AV7A 4ORGB 3WIFB 3VG0L 4H8WC 4WENB 2ZCLH 4MQTB 2P24B 1KB5A 4LEOA 2UWEB 3O6LL 1T3FB 1BOYA 4HZAA 4MDIB 2EZ0C 2R0ZH 1FFNB 1MFBH 2KPNA 3S36H 2ZPKH 3LCYA 3MR9B 4C56B 1FC1A 4ZUVB 3VRIB 1QSEB 1KN4L 2Z31C 1HYSD 2IAMB 4D9QD 2HKHL 2X4RB 2ZCHH 2NCMA 2YSSB 2V5MA 3BDYL 3TBSA 4UUJB 1DBAH 3OG6B 5C6PB 5BZDB 2DI7A 4P59L 3SPVA 2YPVH 2XY2A 1G6RH 1A2YB 2MKWA 2VR4A 4YDIL 3BSZH 1E6JL 1J1XH 2ARJB 2EXYC 4ZTPH 4LPWA 2D31A 4F33A 3WIIH 1MREH 3MV7A 3MMEA 1PD6A 4WFGE 3UYRH 3BE1H 2HT4C 1MHCA 3WD5H 4UINL 3V4UL 3MXWH 2AK4E 4HULB 3PXJA 4JVUA 4YAQA 2R2EB 1I7ZB 3BRGC 3QH3A 4QRRE 1AGDA 4ODBD 3N06B 4U1NA 1NGWB 3UROR 2G5BB 3T8XB 4XRCB 2YN5A 3W0WA 4WTWA 5GJTL 3HB3D 4UAOC 4TSAH 3W5MA 5C07D 3QG7L 3WO4C 3DARA 4XMKL 2QQKH 1MHEB 4L3CA 3F12A 4Y4HA 4N8CL 1QLEL 1PKQE 5IQ9B 5H8DA 2GEEA 1HH6B 4I2XA 2DYPD 2IF7A 4JY6A 3C8DA 4Q97A 4W6YB 1MI5A 4U1HB 2I5YL 3NCJH 1CE1H 3OPZL 1G6RL 1BM3L 1FL3B 4YBHA 4DOHB 2JJTA 4YDJB 4QNPE 1BLNA 1LEIA 3GK8L 3MLVL 4HUUB 3VXME 5D7LE 4UT6L 4RNRB 4U6VH 4P2QE 3U9UB 5IB4A 3MLSH 3TT3H 5T1DL 2EH7H 2R0LL 4KDWA 3MXVH 3NCYS 2AJVH 3ISWA 5C0CA 1RJZB 3MXVL 4I13B 3K74B 3PQYA 3PV6B 1S7VA 4YHPA 5JW4N 2WWKT 1LO2L 3WBDA 4MWFA 1KIPA 4ZPTB 5C08E 5JOFB 4WDIA 4K3EL 4NDMA 1A7BA 3KWWB 4X6DE 3EYSL 4WW2C 5L6YH 3MLXH 1U91A 2IFGA 3PE9A 3QXWA 1KTLA 5D2NA 5D7LD 4HH9B 2ZZUT 1FBIH 2R0WL 3RQ3A 3RBSA 2H9GB 5FIEA 3VG0H 1A4KA 3HCVB 2VDPH 3SJVD 5KOMC 2YC1B 3ARBB 3QIBB 2CD0A 5E1AB 3KPMA 2ESVD 1NUNB 5C0AA 5DWUL 3MUY1 5DJAA 4Q7DA 5HBBA 5JZ7C 3O9WD 4OM1H 1FL5B 2NTFA 3S8WA 4XC1H 1OGAD 1CXKA 2WINB 5HI4C 8FABB 3FFCB 5H2BA 5J57B 2AV1B 3KPSB 4E9LA 4GRLB 4XCYA 1II4E 3RY6C 1JYWA 2VZ3A 3C6LA 4O51B 4WFEE 5KVFH 1W72B 3HC3L 1UWGH 4APQB 1MWAL 3TN0C 1VADA 4Q9QH 3L5XH 3QPXH 2D9QB 2DJUA 4OB5L 2VQ1A 5E2VL 4YC2B 1I9JL 1P7QD 5D1QB 3EO1B 1CVRA 5BW7C 2LFGA 3QZWB 5I6XB 1BZ9B 4PGDB 4AEIL 1TJHH 3KPPB 4S2SB 2YD5A 3KPLB 3MRKA 5EUOF 1FRGL 1A7OL 1JF5A 5C07A 3B9DA 4Z7OE 2DB8A 4XVSH 5JPMA 2AKRB 2EO1A 4ZUSA 4Y4HD 4RWYH 4V2CB 4HJJL 3B9VA 1TPXC 3RWHA 4RRPG 1VFBB 4MXQC 3IDMB 1F90L 2DYPA 3FOMB 2AVGA 4UTBH 1VFUA 3HTLX 3D6GA 1RD6A 3ZDZE 3D39D 2G75A 4BH8B 3VXOA 2C9AA 5GS3A 2PO6C 5D1XD 2HN7A 5EU3B 5T3XL 4ELKB 1JNNH 2H3NB 2PYEA 3WJLA 1R0AH 4WEUD 3VH8B 3BUTA 5E8OA 1TIUA 3BEVB 3H9SE 3VXUE 4RA3A 3GMRB 2P8PA 2Q87A 1AHWC 4HGWA 1A3RH 4LLDA 2ZCKL 4YE4L 1FNGB 1W2KT 4X5XB 4OZHB 4BFIA 4EDXA 1FFPA 3RPKA 4MNQD 1OB1B 3RWGB 5IBTH 5BJTB 4Q2ZA 2E6QA 4Z7UB 3RGVA 2E7LC 5LQBH 3O4LD 4FHBD 1T3FA 3MJGX 1INQB 4Y5YB 3SDYL 3BIAX 1XIWC 3T1FB 5F1IB 4PD4J 5DLML 2VISA 1UXWB 1EO8L 2CMRL 3JWDC 3GMLB 4M4PA 1B4JH 2CK0L 3SKNB 4Q0XL 2VITB 3QAZC 3VRIA 5K9QI 5KSUA 5BXFA 1BIHA 3O3EB 3OSKA 4JFDB 4PJ5B 3U9PL 3UYPA 4BSWB 3BWAB 1RIHL 4GG6F 2PYFB 1FAKT 1QHOA 4UILH 2NY1D 5GQBA 1KJ3H 3VW3H 4NWUH 4JQIH 4LCIL 4GQ9H 5D7IA 3T0BA 2VLRB 1QOKA 3LDBC 5ACLA 4XGZA 3QI9B 5AAWA 1I1AC 5DC9B 5FA3A 1OP9A 2CRMA 4HKJA 1HOCA 2R9HC 4JHBA 4MMZC 2N4IA 1QSFB 3VXSE 3QIWD 4N8VB 2IFFL 1V7NH 2UWEF 3MRPB 3T0ED 4ETQB 1BZ7B 4U2ZA 4M93C 3D18B 3QFJE 5HGDB 2F54D 3FT4A 4JZJC 2DQTL 2NR6D 2X2YA 2WANA 4D0CA 5GPRA 1AHWA 3FZUC 3ABZA 5BV7C 4RA0C 2FSEA 3MO1A 4AJ0A 5CHNA 4J4PC 2EDWA 4X5WB 4S1RL 2X4PA 1FE8H 1CD1B 3KR3H 2JCCB 4FFVD 1CBVH 2V2WB 3V79C 3SJVA 4QRUA 2OXHA 3U7WH 4WV1B 3QDGD 5J1AB 3QO0B 1G9MH 2AERT 2DI9A 4APQD 2CGRH 3NCMA 2VSDA 2HRPL 5TE7L 1SBBA 4XC1L 4HK3J 1RZJC 1MHHA 5IF0A 4RISL 3SCMD 5F72S 3V4PH 1FVCA 2PXYD 3OJMB 1KNOB 3PUCA 2I07A 5IOPA 3CK0L 4G8EA 3LAFA 5AD0A 3X11B 2LQRA 3WS6C 2IQAA 1DLFH 5KVGH 2EYSA 5KSAB 5C0CB 3TVMC 4LRNL 3KPOA 2BVPA 3RI5F 1S7VB 3JXAA 4YHPB 1ZS8B 4LRNH 3QCUL 3F58H 4MNQA 5EU6A 4EQ3A 4BELD 4GAYA 5HVHB 4M7KH 4NGHH 1SJVA 1HN1A 5GSVB 2ZJSL 4DVBA 5C08D 2EE2A 5F88B 4ZFFA 1A9BA 4GUPA 4HJJH 5F9OL 1D6EB 3SKUD 2G2RA 3A6CH 3DMMA 3M1BB 1HYRC 1OF2B 5DJ0B 5GGVL 4DKFH 1XGUA 4F7PA 1FJ1B 5MERA 4DZ8B 1YJDH 1KB5L 1HEZB 4ZSOA 3GRWH 1AO7B 3WUWG 1LK3L 1JPFA 1J05A 4X4ME 1CZ8H 2FX7H 3FT3A 3BP7A 3MRHB 3F7PC 2YN3A 1MCHA 1Q94B 3DRTA 3Q5OA 4GMSH 2IAMC 4FMFA 1WAAA 3GGWA 4HBCH 4J1UA 5I1AB 4AYFA 2IWGA 1T7YA 4MA3B 3NAAH 4LLMB 2Z8WC 4K94L 4X6CA 1ZLWK 3V4VH 5GS0L 3MLWL 4KDVA 5EOTA 1YPZE 3UC0H 4QGYA 2A9NH 3BEWB 4NUGH 3JZ7A 5C0AD 5KOVC 5TPWL 4N0CD 4NJAL 5ANME 4TUOB 4E5XA 1NAMB 3VXRD 4PJBA 4X6FA 5CEZL 5I76B 1CXEA 2HFEA 3S37L 1D5XB 1K8IB 1RZJH 3EOAB 4LLUB 4F37K 3DYOA 2WUCH 2W1NA 3FN0L 2Z93A 1MLBA 1ZEAL 5D72L 4JGMA 2NXZB 5TE6H 3EOTL 1P53A 4I3GA 1OW0C 4N0UE 4Z78B 1G9NC 2AK1H 1L7TL 1Z5LA 4X6BB 3VI4E 2A1WL 1MREL 4XBPA 2AKRA 1IGJA 4JM4H 4OCSL 5HVHC 3GMMA 5TF1H 5JHDD 3QDGA 4OZHE 1KJ2H 1UH4A 2RJMA 1KJVB 5I74C 5ITFB 1T2QL 3WL9B 1T4KA 5DQDL 4ORGA 1ZWIB 1T20B 1H5BA 2E27L 1GZQB 1IARB 3TIEB 3HMXH 3I85A 4AMKH 15C8H 1MCBA 2UWEA 2ID5A 5C0BE 1NGYB 4GW1B 4G6JL 1IILE 2J8UB 1RZFL 1RFDL 3S88L 4DZBB 3CUPB 4XP4H 4X4XA 5FYJL 1IGML 1NKOA 5EG6C 1RMFL 2BRQA 4NQVB 5HPMB 4NC1C 3QR2A 1VGKB 4J8RA 3VD5A 4HWBL 1OAXH 1E4XL 1T1ZA 4RGMC 3T0EA 1U8KA 3V7AG 1FV1A 3PWPE 3W39B 1CE1L 3ALXA 5DYOA 2J12B 1DN2A 4X5XA 1F00I 3HZYA 3IFNL 1F4XL 1JK8B 1LE9B 2R1YB 1FVEA 3T0VA 4PV9B 2B0SH 3WIFA 2YXMA 1PY9A 1KCVL 4I9WE 4HUXA 2ICEA 3ZKXC 2JTDA 3SE4A 1QEWA 2QQLH 3BKML 5ENWA 1P7HL 1KSRA 3SE9L 1ZHLA 4FP8L 3TV3H 2HMID 3HI6H 4CVXB 3IT8D 1U92A 4XXDA 4KQ4H 3UJIH 3WIHA 1P9MA 3WNOA 4Z7WA 4C58B 3LKQB 1JTOA 3CC5A 1I1AB 2FIRT 3DVFA 4V1DE 5FA4A 3L6FA 3LDBB 3RWCA 4NKMB 1KT2A 1NFIB 3BJLA 4NQCB 4P2CG 3FFCE 5D7JC 4L4TA 1C7SA 3WYRA 4CKVX 3CVHA 1QRNA 4RSVA 4OZGA 1EV2E 3UJTL 4UB0L 1E4WL 3CPLA 1FNEB 1GVIA 5C09B 5LGKA 1KJ2B 5I1EL 1N5AA 3GBNH 4Y2OA 4PJCE 3OR6A 4I18A 2QL1A 1MHCB 5HGDA 2FIKA 1CTOA 2WLZA 2VC2H 1OAUL 3MRIB 3TIDA 1EK3A 2BDNH 2OTWA 4LCUB 4ODXA 3FQRB 1EAJA 3GMNA 2DBLL 3QIWA 3MYZA 1F3DJ 2VLLA 5KN5B 3OL2A 5TDOB 5MENE 2MFNA 4LPUA 2F54A 2OM5A 3EDJA 3BO8A 1G7JB 5E03A 3T3ME 1TQBC 3RNQA 3C09B 7FABH 1MCSA 2ICWJ 3F65A 2HLFC 2F5BL 1KCVH 4XVTH 1J88A 3HZVA 3DVGA 4P5KB 5I1CL 1KF9B 5HI3D 1MEXL 2AS5M 1CFBA 4OLZH 1K6QH 4LSVL 4ONFL 4QHKI 4GS7B 3EDDA 1JZ8A 4K7PX 5IVXB 2EZ0D 4HWBH 1FCGA 2RAMA 2VXSH 5EZOL 3GHEH 2Y5EA 2CLRB 3N85H 5EBWA 1CLCA 1Q0XH 4I3RH 3P9MB 5IB2A 2NY0C 3OAZK 1O7SA 3BISA 2Z31D 1BX2A 1HYSC 2ARWA 1AIFB 3ARGB 4ELMF 2Z9TA 4K55A 3MFGB 4K2UL 1VKXB 1HHJA 5E2TH 1CFVL 1N0XL 3QHFH 5KANI 3VWKB 5C0EB 3MLRH 4HJGB 2XZCH 1KGCE 1NJ9A 3R1GL 2HKFH 2PW1B 5GRJL 2NY3C 5HGAB 2P8LA 1DLHA 1F45A 1W72A 1X5JA 4Y16A 2DQHH 5DURD 4KK9D 2EXYD 3EZ8A 4LSTH 3ME0A 2JIXD 2DM7A 1NC2A 1HEZA 1WZ1L 3LIZL 3FT2A 4ZSOB 5E2WL 3L7EA 1TZHA 1IAMA 1MRDL 4Y4KA 2Z91B 2H9GA 3D2UD 1CLOL 3AFLA 1NCDH 1SJEB 4LCCA 2BDNL 1XF5B 2E9JA 4DQOH 5I1HH 4ONGL 2GJ6B 5I18H 4XMKH 3GJEA 1Z9SA 5E95B 5I16B 3V4PL 4P9HC 3WNLA 1LO4L 5KSBA 2H8PB 4QHMB 32C2A 4PRID 3RZCB 4IEFB 5E9DA 3HB3C 1B6DA 1NFDE 2QLVB 3PF2A 5JW3H 3QUMB 3P11H 3E6HA 4BK5A 2D4DA 4MB4A 2ZOLA 4YHOH 1RIVL 2H2PD 5HDQH 3PABB 2O5XH 3BIKB 1RZ7H 1YEKL 3QHZL 5A3IC 3Q6GL 3AS2A 2Q86A 3G04A 1IRAY 1DQML 2HFEB 3EUUA 2C1OA 1CDUA 4PP1D 3GBNL 3HC0A 1G1YA 3W9EB 4GKOA 3C8HA 3DTXA 2P7TA 3QZWA 2RHEA 2DIAA 4B7IA 1TTFA 5E5RB 1UB5A 1ZKAA 1J0JA 3TV3L 5FKPB 1EPFA 1C5DB 4LMQE 3U30B 1MAKA 3QEHA 1V7NL 1KENL 1YA5A 3V8OA 1L9MA 4QRQB 1WTGT 1XGYL 1VEPA 4O4YH 3ZYOA 1HXYA 3VD9A 4WU5B 5F9OH 4Y16C 1I8IA 3HI1A 4MAYB 4NO0D 3EYFB 4U7MA 4J3VA 2YRPA 4KKBC 5D6DA 1BWMA 3PQYE 5IB1B 5DUML 4NQUA 1FPTL 1LE5B 4Z7VB 1SY6A 3KDMA 4LVHB 4O2FB 4P49A 2RR3A 1H8NA 1NEZB 5E8OB 4PJDA 1RSFA 1VGKA 3VXSA 3SKNA 1W72H 3IVKA 1DUYB 3MCLL 1DEEA 3EYUH 1KCUH 3QDME 4PJ5A 5K9OA 2GFBA 5IKCB 2UYLA 3O9WC 1LO3L 4NQDA 5EOQL 2X4RA 1JIBA 3MLSL 2XQBL 2FX9H 3EAKA 3FAWA 4G8GE 3V6FA 3RZWA 4L8SA 5EB9A 4ZD3H 3DO7B 2B4CC 5EIIB 2VLRA 5EZOH 1GGCL 4Z7QF 1C12A 1RMFH 1JZ7A 3PGCB 4NIKB 1JFQL 5C0AE 3BP4B 1INQA 2X9YA 4KMTH 5E4IA 1A14H 4MYWB 3L3KB 4GXUM 5CCKH 4ODWB 2J8UF 3STZB 4KTDH 3LPGA 5IK3A 4KRPC