2KS0A

Solution nmr structure of the q251q8_deshy(21-82) protein from desulfitobacterium hafniense, northeast structural genomics consortium target dhr8c
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
66
Chain Sequence
MDNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGLKAGQVEVEGLIDALVYPLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Combining NMR and EPR methods for homodimer protein structure determination.
pubmed doi rcsb
source organism Desulfitobacterium hafniense
total genus 5
structure length 66
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2000 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2ks0A01
2KYIA 3IPFA 2KS0A
chains in the Genus database with same CATH superfamily
1OPGL 4Y8DC 3IDMB 4WWID 5KG9A 5EU6D 3WIHA 3QG7L 2ZSVA 1O6TA 4QUOA 5C0DB 1WFNA 3M7FB 2DOCA 3T0EE 3BKYL 2AEPH 5E5UB 2J5WA 1A1MA 2HH0H 2HT4D 3GSUA 4N1CA 5KYUA 3SKJH 1OAKH 1ZOXA 2XICA 4Z7WA 5F6HI 3Q5TA 4KK5D 1MPAH 3BWUC 4RWYL 2E6JA 1X5ZA 1GAFH 4ZFOA 5F6IB 3Q9QA 4F7KA 4OM0L 1XXFC 1YN6A 1NFIA 5EORL 3UBXI 3OV6A 1A3QA 1E6OH 3UTSA 5C6TL 3MX0B 2WWKT 2FR4A 2PYFA 3AXIA 3GJEA 1PJ9A 5GQBA 4UTAH 1MXGA 2ADGA 3CX2A 5EG6C 3HC0B 1NFAA 1I9RL 1KCVH 1S7WA 2K6WA 4JFEE 3ABKB 3TNNB 2MOVA 1M7IA 1XH3A 2V8LA 3X11A 4M9OA 2DBLL 4KROD 5JMOC 3CTTA 4K94C 4OLVL 5I0YA 2JI2A 1S6NA 2VERN 5FWRA 2APWA 4GKZA 5T3XE 3DGDA 3SZKC 4I0PB 2QV4A 1RSYA 4NQQA 5CKAA 2D03L 3EYOB 3VD1A 4Z18A 3ZTDC 3ZZQA 5KS9A 3MOAH 4KTEH 4Y19D 3MCKB 4RGNE 3TNMA 1MRCH 1N0XH 4MCYB 4AYFA 2Q2EB 4YUEH 3WFEL 2GJZA 3KBFA 5ILTL 1OTSD 1QO3A 2KUTA 2EH8H 1ZY9A 2ZICA 3MLPA 3NVQA 3WXWL 1CXHA 2VDQL 3QFJB 4OZFB 4BGDA 1LMKA 3V6ZA 3QQ3A 2WIMA 3D4YA 3IU4L 5FLUA 4F27A 1UJTA 4Y5YC 4PUBL 3GS0A 4CVUA 2PXYD 4NN7B 1OHQA 1XIWC 3W39B 1S3KL 4G43B 5F7DA 4PRNA 2ZXDA 3FB6B 4I0PD 5CZRA 3D08A 1V05A 3LIUA 3A4AA 2FD6H 4CU8A 4KU1A 1U3YA 2AJSH 1W15A 2CUMA 3ZXAC 4OD1L 1AHWB 2EYSB 5GGQH 2WBKA 5HDWA 2GFBB 1MLCA 2WJ7A 4MCZB 5H8DA 2N3JA 3WS3A 2P8LB 2XN9B 1WF5A 1ACYH 3RVUC 1E8XA 1LP9A 1G7QA 1VAHA 1NIAA 1FVEA 2TRYA 2C1PA 4U1NB 3DX7A 4L2YA 4X7TA 1XL4A 1G9EA 3UTPD 2X70B 5F72S 2H9GB 5CEXB 1JJUA 3M46A 3BP5A 4PRDA 4E41D 4ZMXA 4Z6AT 1I7ZB 4BFGA 1NCWL 1WJ3A 4N0FA 4PJHB 2A73B 5AOIA 3QPQC 5EN2B 5EZIL 4FS0A 3WU1A 1T20A 3VGAB 5C0FA 2IGFH 1MUJB 3T0VA 4F9PA 5MEPA 4Z7NB 1A4CA 3MCLL 2I9TB 2JQMA 3SODB 4P57A 2NZ9D 5F3HB 5DMGC 1LILA 3BFWA 3EKCA 2IFFH 1FBIL 4P5MA 1M05A 1R3HB 2QGDA 4ZTOL 4PTUB 4X0NA 3WY4A 2ZAIA 3OPZL 1RZ7H 1NCDL 2B15A 1DVFC 2HVJB 3MRRA 3I2CH 4WI0B 5I8KL 3ZKND 3JWDL 3LN4A 1KCBA 2X1XR 1CR9L 1JYNA 1HKLL 1XR9B 4MB4A 5I16B 4XBEH 5DT1H 5GGTH 1RMFH 4NPKA 4XN7A 3SDXA 1L7TL 1UWGL 3OR7B 1O9ZA 5AOJA 5BQ7A 3B9EA 4G7YL 3TPUA 2NW3B 3C8KB 5LAXA 4PJXE 2RGSA 7CGTA 1Z9SA 4NNXB 3BZFA 3TYFA 5I1LB 1CFNB 5KJ4A 2CE6A 3US9A 2VWEC 4JQVC 4OQTL 4QD2E 1AZVA 1UATA 1OP5H 4ZW8A 4HFWB 3QDJD 2G0LA 3EJCA 3ZK0A 3UZQA 5HJ3A 3MLZH 4ZTEA 2IANA 3FTXA 4X7SL 3H8NA 3FB7B 4UOW0 5A6IA 4ZUUA 5ICYA 3ULUD 1N59B 4K2UL 4LDLB 2IVFC 3DXAE 5GIRB 2AV7A 4RDQG 1WS8A 1OZUA 3QNYA 1IAIM 5HI3D 4QWWC 4CILA 3DVIA 1UENA 5D6CA 3QISA 4F15B 4NPYA 4AVKA 3QZBA 5EEYA 3JTTA 5F7FA 1TQSA 3GRWL 3QHZH 4R26H 1UWEH 2JJSA 4HUUB 3CDZA 4OCXL 2MCPH 3BQUC 5GISH 1AP2B 1BIIA 5ANMA 1QFWI 3MRGB 4RFOH 4CU6A 1KPUA 1I82A 4ELKB 1E7VA 1S46A 3GSNA 5IMMB 4KQ3L 1SYSB 4OR1A 4PJ7A 4RWHA 5DHVA 3BJLA 5DO2D 5E08H 3ZOAA 3SCMA 3ZDWA 2BHUA 4LEXH 2PO6D 5CHNB 3VCLA 4BM7A 4Y4KA 4E9TA 3BIAX 3HC4L 4QHNA 3UTTA 5IEHA 1A4KA 5JW4N 4B3VA 5CR1A 3QZOA 3WFDL 1A7NH 5BZWB 4AOFA 2E8ZA 2JI3A 1XXDC 4IHOA 4C47A 5E5MB 3O0RH 1JGEA 2OMYB 1NLBL 2KQMA 4YHPA 2QHRH 4HIXL 2UXFA 4B60A 3H6AA 2YGPA 1U8LA 5J1SC 4TNFA 1KLFB 4BV1A 4NRXB 1DFXA 1PEWA 3LRLA 3D6GA 1BVNP 2AFNA 4RAVB 2ZCKL 3W2DL 5KVEH 4RMWA 1USQA 5I5MA 3L3HA 2X1OA 2C9UA 5TK4A 3SE3A 1BJ1H 4F1SA 5FA3B 4Z23A 3D18B 2FX8H 3OMNB 4LPXA 4LARH 3OC5A 3SKNA 4M1CC 4UI2A 3O3AB 3T3PE 3TXAA 1X5KA 3GIVB 3BUIA 3RFZC 4F7CA 3VM7A 1BQ5A 5E2TH 3ROLA 4TVSa 4JN2A 1EDYA 4MJHA 1NCCL 3FMGL 3HEIB 4K7PX 2GK0B 1N2RA 3D50A 3DRTA 5FM5O 4PR5A 4PB0L 5E95B 1QUPA 1KBWA 1BZEA 4PJGF 4OGYH 3O0LA 1MH5A 4G3YL 4A63A 1BEXA 3RZWA 3OWRA 4JRFA 2K45A 4P0DA 1MFAH 4OD3L 5EUOE 2H4EA 4PAZA 2G60L 1HH9A 3N3EA 2SEBA 1KXVC 3F12A 4NQDA 1D2OA 2V6HA 1AFVH 1L0YA 5ADOH 2NY4B 4M7ZB 1P1VA 2DIBA 2BVOB 4Y7MA 3S5YA 4YMPA 1HZHH 3Q0HA 4HG4J 3IWVA 3P2DA 4U31A 1ZS8B 2BNRE 1D6EB 3QUMB 3NEEA 1GMIA 4P2RA 3M86A 3TA3D 3NFSH 4NNPH 4BFNA 2XA8L 3MR9B 1J0YA 3DTXA 3DVGB 4QRRB 1ZHBB 3IJSA 3OJVC 5AVSB 3RVWC 3VG9C 4DUWA 5D9SB 4YOKA 3VD9A 3MKGA 1E50A 1TZIA 2I60H 1RPUA 2JKSA 4XVSL 1ONQB 1AY1L 1IARB 1SM3H 2VXQL 3HKZA 2AQRA 5B38G 5IB1B 4PREA 1URLA 2H41A 5HHXL 1KCLA 5C0EA 3SYQA 3NIDE 2IH3A 1L9SA 32C2A 4R84A 4OGXH 1DJYA 3MV7B 4M7LL 1KIUB 1VFUA 4M5TA 3GF8A 2OMTA 3QORC 3ARQA 3FBKA 3IDYB 2DQIH 1U6AL 4GAFB 5DCCA 5JHLA 2K7QA 2R4SH 1OGAE 5TDOB 2ZXGA 2P5WA 2CU9A 4PJXF 3NMEA 4FFTA 4AIOA 5JIDA 2D31B 3IBOA 5E8EB 3LH8A 1KNOB 3ZGHA 1U8OB 4MX7A 3SB3A 3KYNB 3SE4C 4EAEA 5IHUH 1D7FA 2VRQA 1SEBA 2D3LA 4X0KA 3WD5L 1OSPH 4QRRD 4UT6A 3GUTB 3GMOA 3QXDA 3PGDB 3UPAA 3DJRA 1KTLB 3A6CL 3RRQA 3KNBA 5SX4I 3KPLA 3ULUH 1RULH 1TIUA 3BXNB 2QQKL 3NZUA 4GSRA 1EGJL 4ELMF 4BFJA 3EJJX 2E0PA 3A67L 4EIZC 4KMTH 4G6FD 2DQJL 5AZ2L 5G2NA 1W72H 3IXAB 3H3KA 4H5SA 5DJDA 2B1AL 3U0PA 4R7DA 4IKIA 2OR9L 2A77H 2DEWX 3L3GB 4UUJA 2MNJB 4HPHA 2OTUB 4FG6D 3KJ6L 3PDOB 1EPFA 1WHPA 4JLRB 2BWQA 5E2WH 1J88A 5I6KA 3DUUA 1LD9B 4RZKA 1DLFH 4FFWD 3BVXA 5FUZH 2MQ3A 5FYJU 4Y4HB 4Q97A 1ZWIB 1PAMA 4HSQA 5I30L 4H4NA 3QPXH 2X2JA 2LQRA 4F7MA 3QDGB 1EHLL 4WU7A 3HB3C 2A6JA 4DZ8A 3L4YA 3P73B 1J05A 2ZAGA 2X12A 3FCTA 3CHSA 3G5YA 5CO1A 4DUXA 2D4DA 4J4PC 5ICXB 3U79A 2NRDA 2OJEB 1CICA 4UZUA 4DEUA 5J8OA 1NL0L 4G7SB 4GQRA 1G1YA 4JDTL 1K3IA 1JPSH 3NJIA 1PG7W 5ALBL 2W60A 1YYMH 3REWB 3KYOA 3DARA 4H26B 3UC2A 2GCYA 4MA7H 1JGLH 3VFSB 4JZJA 2K4AA 4DP9X 3GBNL 4GLRH 4H20H 3OKEA 4UYPA 5LQBH 3QRFM 4NQEB 3TIEB 4DKEH 4KKAC 2YSTA 4XC3L 1FHNA 4IIQB 1N70A 2MQCA 3OKKB 4AEEA 4KJYB 4Z1PA 3RWJA 4D9RE 4UILH 3QDGD 1J11A 4L8CA 4ODWB 3KL5A 1YNLH 1X9RA 2J57A 2XY2A 2FB4L 2EE0A 4OJAA 3LD8C 3GTVA 1JWSA 2B2XH 2XXCB 2H5UA 2ZWZA 4F7TA 2NXYB 3CZFA 5IT2H 1XGQA 1BECA 4N5UA 1LQBC 2D0FA 3AY2A 4YEFA 3CPUA 2FQGA 2F19H 4NB7A 2V7NA 2E9WA 2N01B 4NP4H 4PJAE 4O58L 3I6GB 3UZVA 3FXIC 2XKUA 4LE8A 5DURD 2Y24A 2IDCA 5J1TC 3N9GH 1G9NH 3BSZH 3ME0A 4JANB 2E7LC 1P6WA 2J6WA 5F89A 4G80A 4GW5A 3OXSB 4HDIA 3QO0A 4WZ9A 2ZPKL 2Z4TA 2WQWA 1MCWW 3PNWB 3STBA 1NC2D 4XTRC 4C55A 4EE2A 4F9PC 3TO4D 2YKLH 5LNGA 4JG9A 1Q72L 3RI5F 5LDSA 4PGDA 3MQIA 4AKOA 2V37A 3GJFB 5BRPA 3T71A 1A6UH 2Y9RT 4PLKD 4PP1C 5FYKD 2G30A 4DPRA 3CBJB 1M4KA 1EMTH 3NIDF 5AL0A 4CVZB 3VYOA 1ZT1A 3IYLW 4I88A 5CSGA 4ZTPL 1A7PH 2ZNXA 5MHSE 4JO2L 3RPBA 3B56A 1HXYB 3US0A 2Q2LA 3FUDA 4YLQT 3TO2A 3Q48A 3TBSB 5BZDB 1NFDA 1SNRA 5C07B 3WFCL 5T1JA 4ODTL 5TH2B 3D87B 1TZAA 4MJ2A 4P3DB 3V52L 4PJEE 1S5IL 1KPRA 5EU3B 4MZ2A 1C1EH 4PY8I 3KXFA 5CLTA 3ROOA 1M6OB 2WAQA 3LNHA 3PE9A 5F21B 3Q06A 4IBYA 3SN6N 4QAMB 3WE6A 3I02A 4V2BA 3GINA 4XNAA 4O2FA 4YBLC 4WFFD 1JF1A 4OB5L 3LNFA 3F7VA 3OMAB 4N6QA 4PS3A 3LEXA 2VMFA 1RZ8A 3KDPB 4IJ3C 5I1HL 3REVA 2OCJA 5JW3L 5EFIB 5JO5A 1B0GA 2K3TA 4DVBA 3NP3A 12E8L 3BEWA 3NGBB 4FLSA 2CKBA 4FNLH 1KTJA 3G6DH 5AVRB 1HESA 2CRZA 4GQQA 2N56A 1LK2B 1LO4L 4QRUB 4MNGB 1BMWA 1QAWA 2VSDA 4XZ4A 3VXNA 4XMWA 5GGSY 3KH4A 3RI5K 2JJSC 1BBJB 1BHGA 1GGIL 3CN2A 3OBAA 3HMWL 2WINA 2VN7A 5EC1B 3TOPA 1MW3A 4W4NA 5TE6H 3P9MB 3RLSA 1DEEB 4ZBJA 2HT3D 2XTJC 4KHXH 5EH1A 1V54B 2NUTB 2B59A 1KDJA 4OQ1A 2LAGB 3S5LB 1AR1D 4MJ5B 2J4WH 1NMBH 4OLYL 1E5AA 4LCCA 3ZR5A 4FYSA 2A4CA 3S4SG 3SCMC 2WXNA 4BUQA 5IV2B 4ZT1A 4HEPA 3HLAA 1CU4L 4Y4KC 2ZX8A 2CD0A 1X6LA 4N8VG 5CJQH 2OV0A 1T22B 4IJTA 1NCNA 5B1CA 3VXPB 4X8XA 3ZTCC 4D94A 3V0VA 2ZG1A 4FKEA 2EYRB 1U42A 3MLRL 3QS3A 4ZD3L 3ZRFC 3GDCA 5DD6A 2HFFA 1XGPA 2Z4QA 3UJIH 2Y7LA 4F8TA 3TS8A 3DX0A 3VXQA 3G6AA 4RMRA 4B0MB 4XXCA 2G2NA 3OG4B 3EO0A 1KYOK 2ESVB 4PW3A 1IM3D 4ZX5A 5FECA 2BOBA 4DJMA 1IJ9A 4U1SA 4QT5A 4Y9FA 4JZOB 3IB4A 4JNXA 3DOSB 2PETA 4HJ0D 5EA0H 5E1QA 3SE3C 2I7SA 3MJ9A 1RIUL 3CZGA 2A9ML 2J5LC 2I24N 4JHAH 4D0BA 2VXSH 2XJKA 3RWEB 3GSWB 3NFPB 2E9JA 3TFKC 2ZTBA 3G5ZB 1Z3GL 2EECA 3E9UA 3OKDA 3T2NH 2ED6A 3PGCB 2W9DL 4FQJH 5T5FA 2HPTA 5TE7L 4TL5A 2EINB 3VXRB 3FTGB 3V9FA 3LIZH 4NRYA 2AXHA 4IK6A 4QXTA 1MJJB 3S3CB 3VQ1C 1QSEE 2ZKYA 2HRLA 4PJAF 3GSVA 3RB5A 3DJSA 1DCLA 4WV1B 5CNHA 2AXGB 4FA7B 1P0SE 2X2HA 4Y4FB 3EHBC 1HH6B 1F90H 2XQYA 1D5XA 3OKMA 5CMAA 4EI0A 3DWTA 2WLHA 2OULB 3PWNB 1L9OA 5GS2D 3C6SB 4PRIE 3SZ6A 1C9SA 3RTLA 5GS1B 4IBUA 4RAHA 1UM6L 3OAZH 1CZ8H 2ENQA 4MJJA 5ADPH 1FH2A 1S7UA 1V7NL 2EE3A 2RHEA 4QO1B 1YA5A 5DUJA 1YUKB 3QJHB 3WGUB 1RHFA 4EBQH 1DQDH 1H3XA 4X6CA 1IB5A 1EUTA 4U1HB 3KBEA 1ES0B 1PBYA 1J9RA 5CIPA 3LJ3A 2MIZA 3RY6A 2VLRE 4FMVA 4UAOB 1W0WA 1ET7A 1PZDA 1S7QB 1UZ8B 2WQ8A 3POHA 4N8CH 4WGVB 5D4QA 4CDHA 1K9TA 1OAUL 5D1XB 1S7XB 2YIHA 5IROC 5E24E 4WNQA 4Y4FD 5I0WA 1MW0A 2NR6A 4LCIL 5L8KB 4ORGB 3WJMB 3IVKB 2DN7A 4YDIL 4GNKB 2F58H 3PUCA 1N7ML 2DDQH 3AQXA 1CGYA 3II2A 3DHMA 1JWMB 4PJEF 3H53A 1D9KA 1MN4A 4KK9D 3BAYA 3BI9X 4XE0A 4OKVA 5IHWA 4YK4C 5CWSB 3NCYS 3A47A 4X4XB 2UZXA 3SYCA 5DVNA 5AFAA 3IJHB 2ZUWA 4KUCD 3W82A 2DLTA 1TZ8A 1X4YA 2F5BL 3EOTH 4O51A 4HCIA 5CCGE 4LLMB 1KBGH 5IMOB 1X5LA 2ZZUT 4ONFL 3UBXB 4HJSA 3NABL 3V0HA 4AYSA 1JCKA 4XT1C 4BRJA 5JPNA 2VDNH 1SVZA 2X9YA 4M6NH 5D1XD 4DSYA 2HT2C 3G6JB 2YD4A 3QUYA 4ETYA 5JXEC 1AQDB 2A6DB 1QLEB 3BWAA 4HWBA 3K6DA 3ET9F 1G7HB 3MJ7A 3MJWA 4ADGA 1WISA 5ABAA 3OZ9H 1I4FB 3BPOB 1RZKC 4ES8A 3TEYA 2I27N 1EO8H 4HS6B 4MSWB 5IR1B 3HZVA 1E28A 1JBJA 4XO4A 5IKCB 1BYPA 3KPQA 2ADJB 2WXHA 4JO4H 4X5LA 5H94B 5F3BA 1RZIA 4ES9A 2DM4A 1LEKB 3L81A 1MCPH 1FO0L 1E9OB 4K5LA 2IAMB 3QB7C 3VRJA 4GMSL 3T6XA 1K8IA 4ZFFB 1AQKL 3KL3A 1FFPB 1JZIA 1HXKA 4LL1A 2VAAA 3Q3GA 4ONHA 3WG7B 3TT3L 1V55B 4YGVA 1CICC 3NJVA 4M62L 3RIKA 2DIJA 1JYVA 3MBEA 1PKQE 3KPSA 2VN6A 1A6ZB 1NGWA 2V4LA 5EZJB 1NCAL 4UMGA 2H2PD 4GIPD 5BOPA 1FZKA 1OL0A 3KR3H 1GJUA 4JZJC 1D2PA 1JDDA 4XPAL 4NXSA 4PG9B 4K5PA 2E7DA 4EOWL 3DX6A 3L5XL 3L6FB 3ESMA 3VXMB 4IRSD 3LZLA 3KYMB 3IKCA 2PCFB 1ID2A 5BS0A 2IAMD 5EBGA 3BIKB 2XTLA 2ZE0A 3LRHA 1U0QA 3R1GH 2X88A 4WW1A 4LSSH 3FFCB 3RUGB 5JOFB 1E5ZA 1KUMA 3D3VD 2QQNL 4HF5H 3IAGC 4ZO6A 2O6CA 4K9EH 4D8OA 5BMFH 4JJHA 1IEAB 2ZX9A 4FP8L 4Q6IB 3H9SE 2RH0A 3V0EA 4M48H 3PWUA 3T08A 1G7LB 5E9DA 2HFEA 4LGPB 2YXMA 4J1UA 4KRPD 2P48B 2W07A 3TCLB 4OFYA 3O2DH 3HAEG 3KXFD 5HHOD 2DQCH 1W8NA 2GTWB 3M45A 3PPSA 1KJMA 3MLVL 5BXFB 1QSVA 1KB5H 4YZFF 3C75A 3IU3A 4HK3N 2HLEB 3D1MC 3L45A 1IM9A 4I2XA 3BZ5A 3QXTA 1NGXA 2DWEB 4HD9A 1DEDA 5H35A 4IOIB 5F7HA 4PS4L 1R3LB 4BHUI 3TBTA 5EEVA 1IGJB 1GS6X 3QNZB 1VGKB 4MJ6B 5GS2H 3RA7L 2ZKHL 5GGSA 3LEVL 1QPKA 2Y06L 1DN0A 5C0CB 3VFPB 1GPOH 1Q9OB 3FFCD 1EAPB 4OZHA 5B1AB 1KYAA 1I1AA 3LKOA 4PRHB 1IBDA 3F58L 5LO7A 1IFHL 3SEPA 2FSDA 1WBXA 4KAQL 3LPPA 4TUOA 4D0CB 3FUJA 1IC4H 1M71B 4XX1G 1D7CA 4ZS6C 5MP6L 2C1OB 2UYLB 2X9ZA 4FFVD 5CILL 4WI5A 1YG9A 2XLLA 1V7ML 1MW2A 2BP3A 3G5VA 4LVOB 4E5XA 5JR1H 4JFTA 4F57L 4JDEB 4AGNA 2KQNA 4N2IA 4G8FA 4NQSA 4BZ2L 1JPFA 4YHKL 5HHNB 5D2LA 3QRGH 5DC2A 3QQXA 2CIKB 3OHXB 1KJVA 5C0CD 3B8SA 4HIEA 1W8OA 3K72A 1NPUA 2W65B 3G5XA 4YSPA 1JGDB 1CUOA 3VQ2C 3GMLA 3SY6A 4JFDA 1XD1A 3NPSC 1RVFH 1N3NA 4R7LA 2EYTA 4W68A 1JYXA 5C2BL 3BPNC 5D7HA 1JYWA 3MACL 3SE9H 1HEZA 4QPEA 1MAKA 5TDNB 1BM3L 3PV6A 4L5FH 4DP5X 1C16B 5I71C 1QR1A 3GFUA 4OZGA 5GHWL 1R5VA 5AUMA 1S9WB 4QHLB 2GT9B 4DESA 4DQAA 3IE9A 3BGAA 4LF3A 1V3LA 4S1QH 4C4UA 4KY2A 1SOXA 3GHBH 4R4FH 3QXAA 4J12A 1DYZA 1H9VA 1B6UA 1YJDL 3LYRA 3QUGA 2Q20A 4UDTB 4ZSOA 5I66A 4YDJB 5EOTA 5JNYB 4LCCC 4EPSA 4BXSV 2AKRB 4X5WA 3HCVA 4AK1A 5J57B 5LN8A 2KH2B 3VWJB 4EEEA 3O6FB 3GB7A 5IBTL 4KVCH 3O45A 4N86A 2WXGA 5L4FA 3U7WH 3QEQA 1C5CL 2J55A 3R0NA 4G6MH 5B22A 2OS7A 2PKDA 3MV8A 2H1XA 2F74B 4Y5XC 5DJ8B 4XXCC 1FL3A 5DSCA 4KJPC 5DUBB 4HX1A 3OJMB 2WXQA 1HL4A 4XE5B 2FEEL 4V1DE 4G6AD 2P5EE 1QEWA 3KPMA 3RU8H 4A7GF 5F8RC 4PJ5D 4P2AA 1KYOJ 4JCLA 2BDNL 2O6DA 4AEHL 1G7MB 3F5WB 3SYOA 1AHMA 2G2RA 4AYBA 4OGZA 5DI8B 4WUUE 4G7VL 2HCZX 1DVXA 4M5YH 2NR6D 3O9WA 3PJSB 3VWJD 5IQ9B 2FVNA 3IDMA 1MNUH 4NKQB 3B6SB 5GRUH 1SJMA 3ZE2B 1MJUH 1QVOB 4FLRA 1JVOA 1QNZL 5C0DA 5E8OB 4POUB 5MI0B 2K7PA 4HFUH 4IEFB 4KVNL 1OAQH 4J3OC 1YEEL 2B7DT 4AL8H 1T0NB 1MG2C 4PPTA 3VFUA 1I3GL 1IGTB 2CMRH 4IU2A 4BQBA 1PLGH 1N8OE 4NO0B 4JL1A 4R2GC 5BVJB 3EBIA 5MEQB 4NM4L 4AENA 2ORBL 2OW7A 4X5QA 1CMOA 3D39B 2AP2A 1UWXK 5D1QB 2J6EH 2VZUA 5HGHB 3WO4B 5E2VL 4ZMZA 4I89A 1BQUA 4AV4A 2YR3A 3P9LA 3KLLA 5KBKA 4BZ1L 2OP4H 1CXFA 4TSBL 4WLCA 4CSZA 3TNNA 5G4OA 4EUPB 3VGHA 4XH2B 2JSFA 3NIGE 4Y9CA 3ZDXE 3ASOB 4DO6A 2OA9A 1JHKH 4DKFH 5BJTA 4GOSA 5GRYA 2FSEB 1BQSA 3QIBD 4FEMA 3HW7A 2UVFA 1DQQB 3ERXA 2HSIA 5HDRA 3F05A 2Y0SA 4KK6D 2C3VB 1UZGA 4HAGA 4RRPG 2XOTA 3RY6C 2EDWA 2F7IA 4XNUH 3THMH 3UIYA 1FYTA 3Q2LA 4NO0D 3LZQA 4QNPE 4MCYA 2ZOLA 4U05A 3TONA 1BVLB 5DLML 1QR4A 4YE4H 1E67A 2XYBA 3U2SB 1UACL 2ADIB 1OHZA 2FO8A 5FR3A 2JV6A 4OZFA 3H0TB 1NAMA 1D9KC 3EW3B 1FP5A 3FB8B 4N8PA 4XAKD 1FUNA 1OSZB 2FJHB 4L3FA 5F0JB 4MQXD 1VHPA 2VISA 1QPPA 4H13C 4P2QE 1IVLA 3HLKA 1U8JA 4MZIA 1S3RA 4YDNA 1VACA 3EF7A 4A38A 2BFVH 3KWXA 5BOJA 3LHAA 3PGFH 2EYSA 3VDCA 3KPRE 4XP6H 3DI3B 3DV4B 4MCZA 1XEUA 5E0QA 3QUYC 3EDJA 4P5RA 2P8LA 2XN9A 4L4TB 4X6EB 2BVQB 2P7TA 1PTZA 3VW3L 1SY6H 1JFQL 4L4VB 2AQ2A 4KXDA 2H9GA 1XQ4A 3EAKA 3WNNA 4KNQA 1GYCA 3H85A 4JFWA 5IB2B 4X83A 1AYOA 1NMCB 4NFDA 1TKWB 2R2HB 4PJHA 1H6FA 1XZ0B 3MGAA 4ODVL 1ZEAH 4H8WH 5C92A 1TZGH 3WO3B 4ZNCD 4Y5VB 1MUJA 2WXFA 4PJBA 4ZXBC 4TQHA 1QFWH 1TMCB 2BNQE 1JTTA 4N9GB 3JZYA 2I9TA 1HJBC 1K8DA 1BWMA 5FA4B 4QHUA 3IFNL 3P4OB 1R3HA 2E4FA 4KJWD 1AZNA 4PTUA 3FUIA 4JAMB 4MVBC 2XX0A 3RGBA 2RCSH 3B4NA 1Z0NA 3MPCA 4U1KA 4KI1A 4WI0A 4L4TD 3SPCA 5GRJH 3EYFB 3MBEC 3U25A 1MDTA 3CMOL 3FB5B 1DE4B 4MXWH 3TTSA 4A1RA 1FVDB 3UTOA 4HOWA 5C2UB 5EU6E 3FN3A 2B1OA 3BQVA 2HJLB 3SO3C 3EXJA 2VABB 3OR7A 1L6ZA 4KPHL 5ESQB 5CIPH 1SLVA 1ACYL 3BN9D 5E6SB 5PAZA 4EZMA 3RJDA 4GG6F 2RJMA 3C9NB 5LKNA 5L2KD 1F00I 1HHKB 1RUAL 1MF2L 3HC3H 4NNXA 1EZVY 4XP4L 3EH5B 4OLEA 3UG4A 4YSQA 3BPLC 2ZCZA 1J0IA 1HHIB 1L3WA 4HFWA 3F84A 5ALCL 2QADC 4QAWA 4APQB 1NSNH 2YO3A 4Z7QB 4UWQB 2YGQA 1A6WL 2EVGA 4NIKB 1QLRB 3FB7A 3V8OA 2VSMB 2GJJA 3NJGA 3VXUA 4GMTH 5GIRA 2J73A 4GI8A 5D6DA 4LAJH 3N41B 4FXGB 3ZHNA 4K3HA 4OJYA 2WBWB 4FQ1L 1D5BA 4LLQB 1VZGA 4X6BA 1T0MB 5A2JH 4MRBA 4M8QA 4AKQA 1O6SA 3FTWA 3HNSL 4GQ9L 4IK7A 2CHWA 2R69L 1QSFD 3HBZA 3KH3A 3MRGA 4ELKA 1RK1B 5IMKB 5JHDE 2RIKA 5C08D 2A9NL 3IAPA 4HPOH 4N0UB 4WEBL 3VAEA 5IMMA 2BERA 4Y19E 2L3BA 3RWGA 4K7PL 2H1LM 5DRZA 1I1AC 4Z7IA 5EWIL 1X5IA 1CBVL 4WO4D 3F64A 3IPBA 1PQZA 3L95A 1UT9A 4TTDC 5CHNA 4OGAC 2ROYA 5DK2B 5FB8B 1KGCD 4UT9A 1HINH 1TETL 5KVEE 3M1BB 4QYOB 5E5MA 5AVWB 2OMYA 5DS8B 1KGXA 2IDUA 4ICXA 5D7SH 1JERA 1V10A 4O9HL 2FTAA 3HIZA 1O5PA 5D4IA 3BKJH 4QNPF 4RAUB 5DMYA 1TEGA 4U7MA 1CDJA 3FO2B 5A2KH 2BM3A 5DR5L 1K5NA 3INUH 3KE0A 1KGIA 1ZHNB 4HXBL 3HMXA 1IZKA 1UWEL 1MRDH 2FWLB 4QHKI 4EUPH 4M4RA 1BZDA 1HC1A 1JZHA 2A7BA 1RIVH 4JM2D 2VWEE 3L1GA 3WUWB 3CVCA 5E8DL 1MI5B 1OVZA 3OD3A 2UUDH 1NA8A 4NYLB 3WKML 2DQGL 3PP4H 4GI6A 3WN6A 3BZ4B 5LCVL 4GY4A 2K78A 4J3TA 3GIVA 1IGMH 5CZXD 1IBFA 1PFCA 3LS4L 4E41E 4M1DL 4LEXL 5AYUH 2ED7A 5J5EA 4JG5A 2QTEA 1UJ3B 3S3SA 3DMMB 2BP0B 2GK0A 1U30A 5DEJA 2C9AA 2CR3A 5TQ2L 4URKA 2BW4A 3NSFA 2YRZA 3QNXB 4U0RB 3L7EB 4JFFB 4AITA 4Z77B 1KN2L 3UTZB 1QYGH 3GBDA 5SX4H 1QI5A 1DVYA 5D2NE 3RX8A 5BV7B 5D5MB 4BFIB 4JO3H 4Z95H 4GKSB 2IALA 3L9EA 3SIKA 3NAAH 4HT1H 3QJOA 5KW9L 3POCA 2NY0C 4HGWB 4OLUH 1IAKB 1MI5D 5K33A 4Q9QL 1PZCA 1KYDA 1A1NB 5K9JH 1J0ZA 3QUMA 1DBBL 5HYJA 2D0HA 3O8XA 5BZXA 5L0QC 4OF8A 1NCUA 3LMJH 2ENPA 3MR9A 1ZLSL 3GO1L 2XWBB 4JY5L 2VW6A 2J72A 3DVGA 4NLHA 1ZHBA 1TSHA 2OL3A 1HAUA 2VJXA 3NRFA 4PM1A 5IOPB 1WVZA 4XN1A 3C5ZB 1AS6A 2YJLA 5HHVH 4HC1A 4CNIB 2GITB 2H2SC 3BVNB 4GRLB 1ONQA 3K4AA 3FDWA 3P4LA 5EO0B 3U36B 5A7EA 5IJBC 3EXLA 4W9EC 4G5ZL 4JFFD 3SDCB 5KSBB 2IOOA 4OVUA 1DDHA 1CYXA 3MV7A 2OYPA 3TFBA 3NN8B 2HT4C 3QDJE 4XVJL 3T2PA 1LE5B 1HU8A 3BLPX 3Q8CA 4Y2DB 1YDPB 4RFEB 1U8CB 5F1OB 4LOUC 1DP0A 3ULUE 4B53A 4KUZH 1JS4A 1YEJH 2VJ0A 3TV3H 1JPTH 5E8EA 1MFBH 5D71L 8PAZA 1KNOA 2RALA 3VSQA 1JTOA 4UTBH 4H1LG 3KYNA 4FQXB 1P6FA 2XWCA 2O6EA 4LKXA 2EILB 4M6AA 5AOKA 4Z0XA 4XMTA 1FN4B 5BRZB 2DMGA 3TWYA 2NXZB 3O9WC 1I9JH 5ICZB 3GUTA 3VQLA 2H32B 1HI6B 2VXUH 3EYQD 3C5ZD 1B2WH 2X4QB 3PXHA 4EI6B 4GRLD 3NK3A 3SDYH 3FT0A 3BXNA 4NKIL 3H2WA 3MBXH 2FRGP 4LDCA 2X1PA 4WFGD 2XDHA 5I82A 4NQTA 2ZAHA 4O2CA 5MENB 4P59H 1YYLH 1UVQB 4NO2B 3ZE1F 4LIQE 2D9CA 4UTCA 4TNEA 4ZMPA 1PKOA 2BIOA 3OB8A 1CXLA 3BW9B 1IO4C 4HKJB 3ZQWA 2OTUA 3NK4A 1LO0H 4K5NA 4XVUD 5F6IC 4B41A 1GRWA 1PX4A 2EZ0D 4U1GB 2QKIB 1OTSC 3ZE0B 1GHFL 3GIZL 2YA1A 3QJSB 2CNYA 3KS0J 2EVJA 2V2XA 4HW6A 4ONGL 4Y4HA 1OP5K 1N5YL 5TE4L 4FQXD 1ZWIA 3SD5A 3H7BB 2Z0UA 1ULVA 2R0LL 4KK8C 2C7FA 2CXGA 3HBGA 1VEPA 4DVRL 3SBPA 3EOBA 4FTVA 2YUZA 3P0YH 3P73A 4DIXA 2P49B 4XOCA 5MEND 4XNXH 1UGNA 2NX5D 5ICXA 1URZA 2OJEA 4JFPB 1N9PA 3B2UD 1F11B 3LH2L 4CVWA 1P2CB 1RUMH 5LGHL 4Q9RL 1MFCH 2QQLL 3OAUH 4H8UA 1RULL 3GKWH 4ATWA 3MYJB 3O3BB 2UWEF 4XN5A 1U8NA 4H26A 4LLYA 5IQ7H 1M42A 5E0FA 1EXUB 4AZ8B 4NQEA 2CWRA 4YZWA 1TJHL 1S9YA 2DLFH 2MPVA 1GGYA 1WPCA 2CDFA 2DQEH 3U83A 4KKPA 2FX9H 4YWGH 4ODWA 2VC2B 5HDBB 4FZEL 3PHSA 4AI7A 5JPMB 3ZKMD 4NN7C 4CKQA 5DHMC 4HEMA 1RUPL 3AWGA 4EVNB 4UMSA 1XGYH 5LDUA 1VZIA 4LIQL 1Q1JL 2QT6A 4OCSH 2YD0A 4LNRB 3BE1L 1JZGA 3IJ9A 2O6PA 3GM8A 3ZX1A 2NPLX 43CAB 3MLWL 3O6KL 2OMUB 2OFQA 2XWTA 3GKZA 1U58B 4N9OB 2HKFH 4Z7WE 2A1WH 5FHBL 4NCDA 3CLEL 5F7YC 2AQPA 1EVUA 4QRTB 4F8NA 3QAQA 1ZA6B 1R3IL 1ML0A 4TF4A 3PS6A 1QNIA 5EIIB 5C0NC 4JANA 1BOGB 3UTSE 4B27A 3KMDA 2YMXH 2DJSA 3OXSA 4UIKL 4WEEA 1RZFH 2WZPD 2WWMC 1QHPA 3A6BL 4U6VH 5I1EL 4O5LH 2ZUUA 3FQTB 2Y4SA 2LFEA 3LB6C 1MLBB 4L1LA 2OZNA 5E1AA 3BX7C 2PWDA 4TLSA 3SBWA 3QDAA 4U3SB 4ABQA 2CO3A 2FJSA 1QI3A 1J9SA 3DKHA 3QI9B 3TZVB 4YN3A 2ZQKA 3UJJH 3GJFA 1ZLUH 2VUOA 2WQXA 4XB8A 2FUQA 4R4ND 3I3DA 3K2UL 5C97A 3FSVA 3IMSA 3OWEA 4M5ZH 4YSCA 4CVZA 5HI3C 4ADJA 4UB0L 5BV7H 5I18H 3IJEB 3T0BA 1MHEA 4R5XA 4Y9BA 3RNKB 1M7XA 1G9MH 3OAYH 4K3JH 1R3JA 1KV7A 4FFZL 2FQEA 2ITCB 2N7SA 4HJJL 5C07A 3TBSA 3UEQA 3ULUF 4HLZG 4C83B 3T65B 2BP8B 3F83A 2R2EB 4P3DA 1LO2H 4NXKA 5EU3A 4XC1H 3WIHL 2WTOA 3PG2A 3DSFH 4KTGA 1WAAA 2J7LA 4H0LC 1X3DA 1HK6A 1PIGA 5EF2A 4ODSH 3VX0A 1N19A 2UY7A 4URTB 1LWHA 1O7DE 5I1GH 4ZFOL 2BIMA 4UV7L 1AO7A 4YFLF 5D6DC 3OL2A 4P46A 3NZ8B 2O93L 4ZMVA 1ZK5A 3VFVB 3U2IA 1IFGA 1LK2A 4MNGA 4F15C 1LP9E 1OGTB 2ZT9C 3R06B 2OZ4A 2VZOA 1PZUB 3UFIA 1GZPB 5D96B 1BBJA 3L5WA 2CGYA 4YC2C 4HIQA 1KXTA 4GW4B 4MS6A 3QR0A 3TBVB 1VERA 4GPVA 3U1SH 3F00A 4G1EA 1CD0A 5AZUA 4AJWA 5IHZB 1I7RB 5C0IA 2GI0A 5MEOA 2NUTA 2ITDB 1AGBA 3S5LA 4XXWA 3ZKSD 2IBGA 1LNUA 4RMSA 4DP0X 2PCPB 2A74B 2H32H 5SWSD 4MJIB 5IV2A 4U4BA 2VN5A 4ORZC 2WM0A 1NC4B 2PPAA 3QCUL 2PW1B 4MYWB 4PJ9A 1T22A 1D6VL 4X7DC 3V4VB 1RJLB 2EEXA 2KZ1B 4OIIH 2EYRA 2AJXH 3EOYG 1CGSH 4JMXA 4XMLL 5CINL 1PD1A 1E3ZA 3NA9L 1NEZG 3NTCL 1PY0A 3O8XD 5CU9A 4Y1AD 3R7RA 1Z32X 5TPWH 1H3VA 4YDVB 1SPDA 2APXA 2H6PB 4OFQA 1QBLL 3LSOA 3QHFL 4PGCB 1UOVA 2V0AA 5FGSA 3BAEH 3GMNB 4NRZA 3KBPA 2Q7YA 4V11A 3APNA 4JZOA 4J5VA 3DOSA 3DIDA 5CP3A 4BWTA 5IW3A 3CBRA 3MN8A 2KLTA 2CGRL 5LXGL 1ZLVH 4PV8B 3NFPA 3R8BB 2W95A 3MRJB 4LVHB 2IANE 2ZXCA 3I9GH 5JW4M 1SRDA 3PGCA 4FADA 4IM8A 4Y2OA 4JPKH 3VXRA 3FTGA 2NY5H 3EH4B 3VXSB 2OXHB 4GUPB 2B1HH 3DHUA 5IVXB 2Z91B 1MJJA 1NBVH 1QLFA 5HJGA 3QARA 1BMGA 4Z7WF 2R39A 2HLFC 3P3RA 3MUUA 5KBPA 1MCBA 2AJUH 4GW1B 4ANWA 3CSPA 3CZNA 2B08A 1P7QB 5F7AA 2F53B 3FU8A 2XTJE 1ODUA 2IMNA 5DD1H 2DPKA 4KTDL 1GGUA 3C6LA 2NY4C 3MRPB 4M7ZC 4PJ7E 4Z7UB 5FYKE 2VC2H 2ZF9A 4RGOL 5I9QB 5GS1A 1AHKA 1MVUB 3B5GA 2NW2B 4JFXB 3NJLA 4ANVA 1CF8H 2WLYA 3WIIH 1FIGL 3P11H 4LEBA 1L0XA 1KTBA 4QO1A 3UTTE 1EERB 3QJHA 3FAXA 3HS9A 3OQRA 3QWOB 4H8HA 4HV8A 2MTAA 3MUY1 4PRPA 5T33L 3QZLA 3VXSD 1ANUA 4U1HA 1RHHA 2WC7A 4I18B 4DEPB 1HILA 1WDAA 1UZ8A 5LBSA 1T89A 2PP8A 4JG0H 4X7EC 1OCCB 1RLWA 2ZONA 5F97E 3BH4A 5T1MA 2NY6D 3O6MH 1YYCA 2ITEA 4WFFE 5E6ID 1BCIA 3LKQB 4FTVD 4EKXA 2F53D 4YQXL 3WJMA 5A2FA 3IVKA 3IDYC 1AANA 1AG6A 1MCWM 1P4LB 4EQ2A 3AW5A 3SDDA 4FG6C 4HMEA 4BUGA 3GSOB 1TTAA 1NLDL 1QBMH 1QTYT 3M1OA 1JWMA 2QLYA 2YZ8A 4EF3A 2XN1A 2LU3A 5CWSA 3V4PB 4NJAL 2CLZA 3J2PA 4QXUH 3ZTNL 3IJHA 1J48A 5CGYC 5EOCJ 4EIGB 3U7YH 5J6HA 1OP3H 3ARDA 1Q8MA 1CD1B 2NY3B 5IEKA 1K4CA 1YRKA 1DJHA 2ZUSA 3LCYA 4LLMA 5IMOA 3H6JA 1G1CA 3SGKA 1DUYA 3RWHB 4BDVA 3E6FB 4NWUH 2ENJA 3G6JA 3P54A 4YDKH 2XWXA 1VKXA 3GSNL 3LKSB 2A6DA 2FDBP 4IOFC 5CBEB 1LP9F 3GXPA 4XI5D 4PIRF 4X6DA 4M03A 1QOKA 2AITA 5FYKL 5D72L 4PVMA 3OLIA 4XMKL 1QHQA 1G7HA 2AXJA 1BZ7B 4JO5A 3HUJB 3L4WA 3E2HB 4NQDE 4BD4A 1MZYA 2D3NA 5EF3A 2ICWI 4DCQA 5IR1A 4EKJA 3LN5B 4B7LA 1N6QL 1EAQA 4MXQC 1XF1A 2ZKMX 2QPEB 4Y4HC 2ADJA 5H94A 1YY9C 4N90D 3J7HA 4IU3A 3AUWB 4MQ7B 2ZKWA 2MMXA 3HZMA 4LLVA 1LEKA 1MCOH 2XZAH 4F2FA 3ARPA 2WXPA 3MV9D 3N1FC 2DLGA 2NY3D 3NIFE 4Y0GA 3RGHA 3CHOA 3UCQA 3LAFA 3ES6B 4ZFFA 1ECZA 1P4UA 3MRLB 3DV6A 3DK0A 2C4XA 3K1KC 3GSXB 5B38A 4IRJD 3ZL4H 5DYOB 1U93B 2G4EA 4HZ1A 2R2BB 2MQ0A 5AZEH 1CLCA 3S6CA 1YNKL 2HTLC 3U6RB 2YGVA 3V7AE 2N7BA 3L3DB 1OK0A 5EZJA 3DPBB 3NZHL 1RJZB 3QDMB 5EEWA 4UAHA 5DFTA 4M6NL 3WTUA 4A7SA 1SHXA 3ZDYB 1I8MB 1T83C 4U4IA 3BZEB 1BF2A 1NCBL 3GSRB 4PG9A 3CHPA 1FVCB 3VXMA 5DJYB 3KYMA 4FQHB 4P4RA 3WEBA 2PCFA 2E8YA 3HN3A 3TWCH 3H9HB 4K3DL 4GIAA 3RUGA 1OKEA 3X3FL 5JOFA 2ZXAA 5E2UL 3EO9L 2DTSA 6PCYA 1U3ZA 2NXYC 3LRSA 1Y6NR 4NQXB 3V4VH 1ORQB 4JO4L 2Z0BA 4LSTH 1IEAA 1IAIL 1HL5A 4GRMB 4Q6IA 4XCEB 3VM5A 5IW6B 3T6WA 1G7LA 5DFWH 2WV3A 3MRFB 2PMZA 2YPKB 5I1DB 3INOA 1IKFL 2PYED 1J12A 2YSSB 5BXFA 4K73A 3WE1A 2FGWL 4PU2A 4JFVA 3A23A 4P9ML 2G3XA 1UOLA 4GP8B 4UV4L 2JFCA 4NWTL 4LSRL 1IGJA 1ACXA 3IFLL 4LDEB 3N0PB 4WK4B 2R1XA 1AO7D 2CK0H 3IS0X 2JKIS 4E9RA 3FUHA 3VFPA 1EJOL 3LDBB 4JY6B 3VSVA 2CUAA 1Q9OA 5IIEB 1EAPA 3EG9B 4I4WA 3GQFA 4PRHA 3TURA 1D5IH 5A2AA 3SBWC 3N1PC 3VVVA 3MOBL 5HBBA 3RBGA 4GSDH 4NZJA 4OLWH 1CFMA 1M71A 5D7JB 4N20A 4HUVA 1KG0A 4OF7A 3AAZB 1N4XH 4JS7A 1EAOA 1ZVNA 2C1OA 2UYLA 2F0CA 3RWIB 3E3QC 4HWEH 4F8OA 3ZDZE 4OGQC 5JHLL 4HBCH 3H4HA 2XACC 4ZZFA 3AABA 3VFTA 3PHAA 4PJ9D 5HHNA 1N10A 1CGUA 4ENEC 1BFOB 2CDEA 2DAVA 4JUTA 4N2OA 5I28A 3OHXA 1FAKT 1CDYA 4UT6L 5SWZA 2F8XC 1VGEL 2HVKB 1QQDB 1Y18A 2EIJB 3ZMNA 2XZQL 3OAZK 4P04A 1JCVA 3EYSL 1SJHB 1BVKB 1KBKA 2VDPL 1N8ZB 3F62A 4L5FE 5GS0D 1GC1H 1JD7A 1BV8A 2HKHL 1JGDA 1AE6H 2Y6TE 1VADB 2EXWC 4A6YH 1XHHA 4JY4A 5EBMB 4FFYH 3GMPB 3U9WA 4YXKL 5HHMD 4XNZB 4XO3A 4H8QA 4XNQB 2XRAH 1F8TL 3LVTA 1TLKA 4K8RD 4NKMB 4G8GA 5TDNA 4P46C 3AREA 5EOQL 2HMIC 4K23H 4CMMB 1UA7A 5D7KE 1X5GA 2CR0A 3KVQA 4Z3GA 5K5YA 1S9WA 1H15B 5F3FA 5AW5B 2GT9A 3EFDL 4KZEL 5IB3A 4AKPA 4ZODA 3V0AC 1LQSR 2JB5H 2XZCL 5F88B 4WI9A 2P9RA 1AGDB 4WW2F 1YEHH 3BUDA 3VACA 3VD7A 2TSBA 4UDTA 4H8VA 4E9QA 4FDWA 5A3IC 2AZAA 1KTDA 4YDJA 4PJIA 3I6KB 2AKRA 2H8PB 1K5WA 3BMVA 2R29H 5JW4R 2FECI 3MU3A 4WI7A 5IJDC 3QQDB 4PBXA 3SKOB 3NQKA 3O6FA 4HS8L 5DA0B 2XQBL 4ZDHB 4JRXD 1IFRA 1YEWA 1OGSA 2EIDA 5J3HD 2ZP9A 3VU1A 2XVBA 2YEZB 1TJGH 3IFPB 3RP1A 5IESH 3S88H 1FNGA 4OF0A 3X1NA 1OAXL 2WSPA 2F74A 2W9EH 3D3VE 5DJ8A 4BIKA 3HRZA 1Q9WB 1Y6MR 1MEXH 3W38A 2F8VA 3FBQA 1R5WB 4WI6A 1T4WA 1E2VA 4NQVB 1JNHA 1NFDE 4PRPD 2XNAA 5GGVY 3KEHA 1TTCA 1JNNH 3NPZB 3BGMB 3V5DB 4FOMA 5IBUB 3S37X 3B5TA 5HHOE 3KXFE 1G7MA 2JIXB 1D5MB 1GKOA 1FNFA 1X5AA 1G4RA 4MB1A 5CEYA 5DI8A 3T0EB 4JKPH 2ITFA 2IDFA 4Q6KA 2IG2L 2IPUG 4JRYA 5IQ9A 1VRSA 2CO7A 4HIJA 4LHUB 3T6QC 1RIHL 3N5AA 2CA3A 3ARZA 4NHUA 2E47A 5DD3H 4RGMB 3B6SA 4HMDA 4MAUL 1IEBA 1LVEA 4HK0B 9CGTA 1AACA 4M1GL 1J5IA 3IDJB 1NDGB 2NY2B 4GFXA 2KZWA 4BKLB 3GXTA 5IB5A 3ZYZA 1P7KB 5DEGB 2ILLA 3SOBH 1RK0B 1WQVT 3HFMH 1J5OL 3GHPA 3QS2A 2G0KA 3FQ1A 5BVJA 5MEQA 2XBDA 3HPJB 4JFEB 4KC3B 2GEQA 5EU4B 3D39A 1QKZL 4MCNA 1JWUA 5HGHA 1SQ2N 1U3NA 1UD4A 4LVEA 3C6LC 3DPDA 1EEQA 1G94A 3I75B 1FDLL 2EACA 4XPHH 1FI8C 3T0ED 1OT2A 2G3ZA 3UJTH 3HI1B 5GS1C 1BFSA 1SGKA 4AVHA 1HCZA 4XP9H 5DD0H 2AABL 3WNKA 1MY5A 3MREB 1P84K 1DSFL 3BD5A 1GGBH 1U8KA 3FTUA 2FSEA 4WTXA 2W0FB 4F7PA 4MD4A 2NY2D 2YLKA 2JJTA 3ILQC 4AJVA 1C12B 5I8EB 2C3VA 4HUXB 1HIML 5I75B 4EI5B 1EZVX 3VWKB 2WQRA 5HPMB 3BRFA 1A5FL 4UAOC 4MMYB 1LO3H 1MCRA 1BBDH 1M7DA 2D9QB 3OZLA 5H2BA 3TP4A 2WD0A 1T89C 3HHMA 1KCWA 4L3CA 3TL5A 4JFED 4NC1E 1M9WA 2VITA 3ARRA 3NCJL 4NAQA 4ECNA 2IBZY 5GRVL 4DT2A 2R1WA 5EUKB 3T0XA 3V7AG 5F7EH 3RAJH 2UXVA 5F0MB 5LGYA 2VAJA 3MUGB 3PYCA 4FYRA 1E42A 2WWKO 3SDDC 4ODXB 4AMKL 4DHLA 4OU3A 5C70A 2PWGA 1Q94B 3H0TA 3Q2WA 5GS0H 4M3HA 4IDJL 3FB8A 3NSDA 4HJGA 1OSZA 2FJHA 3ULVC 2Q8AL 3EFOB 1ZANL 4RGND 3S36H 3UDWA 2NNXA 4QJ5B 4CRPA 1N12A 1NGQL 2CKBL 4A7VA 1VJSA 3QO1B 5HY9B 4DNLA 3MGOA 5KBLA 3ARDC 4FQLH 3LRGA 3WKPA 3VWKD 4EI5D 4K8RH 4QDGA 3NCMA 3SGKC 3B9KD 1B4TA 4QRPB 3DV4A 1J8SA 4FABL 1I7UB 5CZVH 5ESAB 2XUWA 5KVGL 1GIGL 4FTDA 5D4JA 5AVUB 4P5TD 1A7RH 1FIEA 4L4VA 5AKVA 5FKPB 4I1PA 3Q7JA 1WEJH 1BW8A 1JNLH 2VRKA 5IB2A 2I9LB 4UQ2B 5LXVA 1U8IB 1TKWA 3AZUA 1OPGH 1XZ0A 2Q6WB 4JQXA 4LLUB 4XPBL 4Y5VA 3QG7H 4HSCX 2X9XA 1PEZA 4GG8B 4F8QA 3BKYH 4BWWA 4CJ1A 2VLJB 3RDTD 3MRBB 3GTNA 4FMFA 1A21A 4OD2B 4S1RL 3P4OA 2FEDD 3II3A 1GJWA 4PJ5E 3JWNC 4W81A 4POYA 4YHNB 2Z9TA 4C4BA 2LU4A 5AW3B 3W11D 4GI9A 4RWYH 3CFTA 1OP9A 3W57A 4PJXB 5HSFA 3FB5A 1DE4A 3LRMA 1AH1A 4OM0H 1DQJB 3MJ9L 5EORH 3KLAB 5C6TH 3P4MA 4TRPL 3C60D 2HJLA 1NFDF 2H3NB 3WTSA 1F6AA 2DTML 1I9RH 3MRMB 1UXSB 3IRCA 5B3SB 2ZWNA 3C9NA 4S1SL 2UX6A 1Y07A 2DBLH 5E94B 1HHKA 5T5FL 4U7SA 3VFMB 4AV5A 5I1JH 5ACZB 4OLVH 3MTXA 3DXAB 1VDGA 1YAZA 3RL1B 3ZHKA 3EYVB 2KZKA 1W91A 3QRBA 1ZE3H 2FEEI 3B9AA 4I3RL 4APQA 4MA1B 2VDOB 4P4KD 2D03H 1X5FA 4Q6IC 2C3HA 1G7IB 3QYMA 1AZCA 5SWZD 1BVNT 2ODIA 1LGVA 5AW9B 2VXVL 4K55A 2EDKA 1YEKL 2Z6FA 1YC7A 2BVPA 3DIVA 4FXGA 2VRAA 3WFEH 4MAZA 2I07A 5ILTH 1I1RA 2Y36H 5DLLA 4LLQA 4MNQA 1D5ZB 1DO5A 4OFPA 4G1MB 4ZUVB 1GYWA 1TF4A 2AEWA 3WXWH 2J3SA 2VDQH 2E74C 2XIDA 3EADA 1B0RB 3ARBB 3ETBJ 5GGUB 4BH8A 2F1EA 3UCRA 3IU4H 3VMPA 1G7PB 5JA8B 4ODHL 3DX8B 1TTGA 2Y7QB 1RK1A 1Z5YD 5FOJA 5IMKA 2JH2A 3UEZA 3V7MA 4PUBH 3OJDB 3B2MA 1NBCA 3DXAD 2D7OA 1IZJA 1E4WL 1EZSA 1RZPA 1S3KH 1X7SA 1Z2KA 3TBWB 1UQSA 1XF3B 1KWKA 3IDUA 4OD1H 1L9PA 2DICA 4W9CC 4WU5A 4PB9L 1HDMB 3BP4B 3L13A 4J3WA 5IM7B 1F42A 1NGYA 3M1BA 4QYOA 2VDKL 3K5SA 3IFOB 3RZCA 3CXDL 1M2VA 4FHJA 5IVNA 5DS8A 1R75A 1XF5B 4ZW3A 1ZT4B 4LVOC 5DMJB 3TJEL 4RAUA 2DKSA 4U6HB 2YUWA 3ARBD 3FO2A 4DN3L 4ELDA 3GXIA 1CLOL 2AK4A 4WAFA 5EZIH 2QLVB 1XR8A 1ZHNA 3OHXC 3HR6A 3T3PB 5I1IL 3OMZA 5I2IB 4MJ4A 3WAJA 2YUVA 1BG1A 5E8NB 3BGFB 1EO5A 3MCLH 5BS0E 4M4PA 2DD8L 2EQDA 2VDRL 3X1BA 4DP7X 3WMSA 1FBIH 3T6ZA 2CO6B 2NYYD 4ZTOH 3OPZH 5T1KA 2X6UA 5I1AB 3UMTA 4LGSB 5IVOA 4DK3A 4WHDA 43C9B 5I8KH 1DO6A 4OAWB 4YBHA 3EBAA 2LW3A 3JWDH 4HWBL 4HWUA 4KI5C 3HVNA 1PL3A 5EUOB 1CR9H 1HKLH 1UJ3A 3DMMA 3AREC 2BP0A 4E9WA 4GAYA 5IMLB 2IOMA 3S4SB 1GZHA 1L7TH 1UWGH 5D7IA 2D3VA 3QNXA 4I2XE 4G7YH 4JRYD 4Z77A 4N8VB 1E6JL 2BNRB 4AMWA 3UTZA 1VSCA 3QIUA 5HI4D 5BVPL 2CCVA 3GYRA 5DVPA 4GKSA 2C7UB 3FFDB 5F1KC 3VSTA 4OQTH 4K3EL 5KSUB 4HGWA 4WEMB 1IAKA 2HRPL 4OZHE 4PTTA 4FNQA 1E4XL 1FZMA 2LV4A 1A1NA 4X7SH 4GKOA 4UQAA 4E36A 4MASA 1TEYA 3ISYA 3GXFA 4IDLA 4K2UH 3T2QA 3NIDB 3LY6A 2DQTL 2XWBA 1RIVL 3VA2C 5DMKA 4TVUA 3V9CA 4R5TA 4HOXA 5F7WC 3AT8A 1PLBA 3D85A 2AHIA 4HULB 1A2YB 4IBTA 2MNWA 3O6FC 1GSMA 4HEPG 2DI8A 5IOPA 5LHDA 3MODL 4CNIA 5L2KE 3BVNA 4KRMB 3GRWH 3U36A 4MQTB 1PYWA 4PSRA 1GYVA 4GP5B 2M2DA 1OGAB 5I76A 4OCXH 2UX7A 5KOVC 2R1YB 3SDCA 5KSBA 3MRHB 2DIEA 4LESA 3NCBB 4OZIA 1PG7X 1FFQA 2PP9A 3HRZC 3NN8A 1MWAB 4XN9A 1KXQA 3B37A 5D2LE 2DZEA 3L9BA 3I50L 1REIA 4KQ3H 4Y2DA 4Z76B 2WNGA 2Y1AA 5E56A 5KBDA 4XAWL 2P1YA 1YDPA 3QJTB 5C09D 4RFEA 1U8CA 1WIUA 1N0LB 4LQFL 3N40F 1C5DA 5KSAD 2H0EA 4XCYA 1IV8A 4NBYB 5AENA 1A02N 4RMBA 3VXTB 5K9OB 1AC0A 3WFDH 2JK5B 5C0RL 1FN4A 1NIFA 3FZUD 5ELIA 5BRZA 4H44C 4AYGA 1A6TB 2MPAL 3KGUA 1QSFE 3NACL 1HI6A 2RQ8A 2ZX6A 1NLBH 2A38A 2OI9C 5FYLE 4EI6A 3NZSA 3EYUL 4HIXH 1KIRB 1BG9A 2GBTA 1ZV2A 3IF1A 3JWOC 1ADQA 1KTRL 3OB0H 5C08E 3E8UL 5MI0C 4W4OA 3RFRA 5JTWA 3G08B 3MRKB 3QH3B 1O9VA 4NO2A 1KCUL 2EP6A 4Q7DA 4OZGE 1HNYA 3DA0A 3BWZA 1CPUA 2ZCKH 3W2DH 3OM3B 2Q3ZA 1P6AB 2J1KA 2K9UA 3NJMA 3BW9A 3ZE2F 2WSKA 1T66D 2X0VA 5D1QC 1LO5B 1KGCE 2DYPB 3WO4C 3C09C 3UO8B 1RV6X 1I8LA 2QKIA 1C08A 2J43A 2RB8A 5KAQF 1QBAA 4NN6B 2XQYG 2BRQA 4ZSOE 4DKAA 4P5SA 5TFSL 3ZMRA 3A0OA 2L7UA 5LNDA 1I85A 3TLRA 1CDBA 1CI3M 3APMA 2F6AA 1ERNA 1QASA 2J56A 2PW2B 2YD9A 4RRPM 4FNRA 5HI5D 3K4ZA 3NJXA 1NCCH 3FMGH 2JJTC 5FDWB 4AIEA 2JXMA 4PB0H 2VO8A 1P84J 3APCA 4ZK8A 4ZAKD 4FCAA 1BZ8A 1SFDA 1KB9K 5DRWA 1L0QA 3MV8E 4G3YH 4NUJA 4Y9GA 5JHMA 3KM1A 3CSFA 1W0VB 4OD3H 5D1ZB 3SDYL 2G60H 1T80A 4DP2X 1R5IB 1JOIA 2DIAA 3HZYA 3MYJA 3O3BA 4ZQKB 2DEYX 3B9DA 5I6PA 3CC5B 2DYPD 4WTZA 3FQYA 3SPJA 3VD4A 2BWIA 1ECYA 5EOCL 4F5CA 2X3AA 4WGKA 3FYIB 3WTVA 1ADWA 1UA6L 2XA8H 3BKML 1SYVA 4U33A 4M6ML 4QY8B 5FYLL 1DVQA 3UDWC 1OAYL 3QUZB 5JPMA 1HZLA 4MZRA 1SHWA 5AW0B 2X89A 1FSKC 4PJAB 4YHLL 3MSPA 4XVSH 4ACTA 1AY1H 2VXQH 4FEIA 3WNIA 3L9RA 4A7QA 5HHXH 3QWRA 5FCSH 1N5AA 1CWVA 2D8KA 1BD2D 3DBSA 4AYID 4M7LH 3DUHA 2I5YL 43CAA 4NUQA 2OMUA 1UWYA 1JAEA 4D9RD 1U58A 2G5BB 1R0AL 1U6AH 4QRTA 1E5CA 2D0GA 4LLWA 1F3DH 3TYGL 3ATBA 4LRNH 3HG1A 3V6OA 4PCTA 1SUHA 5HTSA 2R83A 2J1ZA 4KKZA 5EIIA 1BOGA 1SXAA 1WBYA 1K6QL 3RPKA 5JZ7D 3WD5H 1MOEA 1NMCC 4GRWH 3CXFA 3DUSB 2UUDK 4OZHF 5AQ0A 1AS7A 4GS7B 3A6CH 2GTZB 4JQXC 2WIIB 4KKCC 4Y5VC 5K39A 2QQKH 1MHHA 2OMNA 5KBMA 1EGJH 1IAMA 3A67H 2NY7L 5FHAL 3QI9A 5AZ2H 2DQJH 4JM4L 3TZVA 4O02A 2Z7WA 5E4EC 2B1AH 4LHQB 4MWFB 2OR9H 5AD0B 1FYTE 4LSDA 4UDUB 4G9FA 4PJEB 1H3GA 1G7JB 3KJ6H 1ED3B 2MHAB 1IUZA 5I6LA 4OVVA 4G82A 2MWCA 2X4NB 1NCOA 2AMUA 3DYMA 4GBXD 4JDVB 4CC4A 4GXUN 3MUHL 5D2LF 2H26B 3RNKA 1T04B 1XO8A 3OGCB 5T5NG 2C9XA 3K8KA 4WI8A 3O4OB 4XCNB 1MCKA 5I30H 1SEQL 2ITCA 1BZOA 3CCHB 2OYKA 1T7YA 3MVSA 3T65A 3C8DA 2R2EA 3P30L 5DVKA 4PV9A 1T3FB 2JCCE 4PWGA 3T0WA 2FO4B 1B6DA 3ARXA 1Z1WA 1FPTL 15C8L 4QHMB 3T8XB 1AIFA 1I8KB 2KL6A 2NCMA 4F91B 5F6HJ 1EZLA 4APQC 5HDLA 3NA4A 1NL0H 3PUUA 4Z7VE 4IOSA 4JDTH 2X40A 5DUPL 5TF0A 4BK8A 3DI2B 4IGBD 4JKMA 5ALBH 1SN0A 5BUAA 2VZSA 4FXGC 3FQUB 3VFVA 3UX9B 3GBNH 3F2LA 5FK9B 1SMOA 4FJZA 3R06A 5TTRA 4XC3H 1GZPA 3QNFA 5T1KD 4YPJA 1KC5L 3ML9A 4NAJA 3HE6D 1EEZA 4X42A 3TBVA 5J6GA 2NX5E 2JKXA 4FXTA 2FB4H 1F58L 1OOWA 5IHZA 4PY7B 1I7RA 1JZJA 1RUKL 1ZHLA 2ITDA 3GZPA 4FQPA 4Q14A 5CBAB 4IRZA 2VM9A 5JW5A 4DGVL 1UD3A 4PJBE 3TT1L 4X4ZA 2PCPA 4Z7NE 2BP5M 4MJIA 1HHHA 3DDGA 1QRNB 1NC4A 1N26A 4XCCL 2LOEA 4NM8L 4O58H 2V3DA 4IBQA 1PY4A 2C3WA 2DWXA 2BZ7A 4H25B 1S7SB 3RZCC 4B9GA 4JM2F 5E00B 1MQKL 4DOHE 3QVAA 2WTPA 4UINL 3GI8L 5TQ0L 1CLVA 1NAML 4LPWA 3PREA 4YDVA 4NI6A 3SYAA 4YEEA 3HZKA 4E5XG 3ESOA 1AMYA 2ZPKH 5F44A 1F1AA 4PGCA 4LLAA 5ITBL 1JK8B 4TTGA 3S48A 2NUPA 5EO1B 1F5WA 1AKJB 4LOEA 4H88L 3FTSA 3LZPA 2E6QA 4XBGA 4U2YA 3RX5A 2VE6B 1Q72H 1L5GB 4L8DA 1SQMA 5IG7B 4PV8A 4Q6YA 1CFVL 4LNVA 1OARL 2IF7A 5IQLA 3MRJA 4AQ8A 4A7TA 3FO1A 1QSEB 2J88L 3NCFB 4A55A 1KJ3L 3BVVA 1BSIA 4NFCA 2IADA 3D69B 5BO0D 5JOPE 2EO9A 3VXUE 3A4DA 1DCEA 1L6PA 5HYIA 1DVSA 4ZTPH 3QAZB 2OXHA 4GUPA 1UJ3C 3ZKQD 3DMMC 5IVXA 2Z91A 1TU2B 2Y5QA 4OY9A 2XT1B 4ZUSB 4PHZA 5HVHB 1GZHC 5CD5D 2HA1A 1KACB 2IO5A 3BAJA 1DJXA 4ODTH 4XZUB 5DJCB 3WFCH 5KYNA 3V52H 4I13B 5CP7B 5EZLB 1S5IH 4P2OB 3QIUC 4AE1A 1YC8A 3IDIA 5BV7C 1P7QA 3HG3A 2P5PA 2BSEA 4LSVL 1G9MC 4Z7UA 2W38A 3QEUB 3QXVA 4MAYB 1K4DA 4OB5H 4D9LL 2VLRB 5I1HH 1QSED 1U41A 1AGCB 5JW3H 5D5MF 2CUIA 4NLAA 1E3FA 4B9ZA 12E8H 5DJZB 4ZX6A 5LG6A 3QWOA 2WGNB 3SOTA 4WWKD 1LO4H 1GOFA 2F54A 1B3JA 3MRNB 1ETJA 4ODUB 2BS8A 1F86A 1GGIH 3D34A 1OLLA 3KVPA 3HMWH 4PRID 3PLYA 5FFOA 1SBBA 3SDCC 3BHBB 1YY8A 1TLMA 4R4BB 4HMCA 2N0KA 3H54A 1UD8A 5DA4A 5IK3B 4LEOB 1A14L 5KSVA 4TSCL 1OAJA 1S7RB 1XV8A 4AQZA 4Y2DC 3QE5A 4BSWB 1I1FB 1T7VA 2DH2A 1P4LA 4OLYH 4ZPVB 5AOLA 1FG2A 1JUFB 4XVUC 4MAYD 4W9LC 2JCCF 2Z34A 1CU4H 2EDHA 3V4PA 4R0LA 2R9HC 1FL5B 4BFOA 2BC4B 1WP6A 4ZMWA 2ICEB 1NM4A 3D33A 1KJ2B 2NXZC 4UQEA 4RVBA 3R0MA 3KD4A 3MLRH 1R17A 4P3CL 4ZD3H 1CD1A 1ZLUK 1FJ1B 4Z7VF 1DVZA 1UKSA 2AQTA 4J3XA 1U2CA 4C57C 4OI8A 3RWHA 3C6EA 3E6FA 4W4OC 1TJIL 2EKSB 4GKLA 3L5JA 4K9JA 3FH7A 2X4SB 2FT8A 4OCWL 4J39A 4KXAA 3V9EA 5SWSE 3GRGA 3K74B 3OAYK 1IQDA 4OCNC 1EO7A 2KLSA 4AJ0A 3B7YA 1BZ7A 1RIUH 2VN4A 3HAEH 2A9MH 3QWRD 4M3JA 3N1GC 3RWDB 2LGNA 1I8LC 4U1GC 2QKIC 3O6ML 5FO7B 1LXMA 2E6PA 2WKOA 4UNUA 4NKDB 5T1LB 3JV4B 4PVLA 1Z3GH 4UT9L 2QSVA 1IL1B 5HYJE 4MQ7A 2W9DH 2OMVA 4Y1AE 4LCWD 2B14A 1SXNA 1JRHL 4NO5B 4PJBF 5TE7H 4BQCA 2V5YA 3ZR6A 1PKQB 2ZG3A 3HG1D 3VE0B 4ALAH 3ES6A 1CYGA 3ZE0F 1TVBB 1XF4B 2X4TB 3GSXA 1DL7L 2J1YA 4GKNB 4HWNA 4MBRA 5E6RB 3SKMB 1UTDA 1U93A 2LTQB 2ZSWB 4FCHA 1O75A 2NY5C 3HMXL 1YQ2A 4MD0B 4MMXB 2WZAA 3L3DA 1ITCA 3DPBA 3HG5A 1RJZA 3QDMA 4MFHA 1KB9J 3H2PA 1B9ZA 3EDDA 1P1ZB 1EV2E 1I8MA 1F6LL 1EVTC 1OQXA 4S2SA 3BZEA 1UM6H 5T1LD 3K6SB 1FVCA 3H9SB 4HCRA 5DJYA 2H1PL 4FQHA 2L8AA 2EDLA 1V7NH 2OMWA 3TCTA 3B3BA 1F4YL 3FOLB 3H9HA 3QUXB 3ISRA 4M3KB 4OZFG 4DPAX 1U92B 4WJ5A 1QFOA 5JPMC 2QPDB 3TF7C 2WJ5A 3E7JA 4N5ED 3L1FA 1CD9B 4GRMA 3Q13A 5IW6A 4XRCB 3C8HA 1OAUH 5AWNL 4C4KO 3IRPX 1E43A 3UIZA 2JB6B 5I1DA 1S8DA 4LCIH 1A4JA 1CXKA 2YSSA 4YDIH 4U1MA 5DHEA 3K4DA 4YHOL 1N7MH 2C9RA 1NZRA 3ETSA 2AVGA 2F7RA 4BFBD 4DFHA 4RETB 3QUML 3V6OC 1U8PB 4IKNA 3FCUB 3JV6A 2XYCA 3N55A 3O81A 3LZRA 3MCG1 1OGPA 1S78D 2YS4A 1ZLVK 3QUXD 2OL3L 4HISA 2AVFA 1T2QL 4JY6A 3IJ8A 3MZTA 2F5BH 1GR7A 4UT7L 3WFZA 4HC1L 4X9HA 1XGRA 4MXVF 2R4RL 3Q6FA 3SQOL 4XPFL 4FTVE 4ONFH 5L9DL 2WP3T 3NABH 2WCSA 2UZPA 2ISDA 2JKNA 1HFUA 2EC8A 3EOAA 3FF7A 3IDNB 1NOFA 3QI9C 5D7JA 3TZVC 3OPUA 2VKWA 2V17L 3SGEI 3AAZA 2F7PA 3RWIA 1QACA 4YX2L 2BW5A 4P05A 3RGVB 4YO0A 2XWDA 3EGSB 3T09A 1FWXA 1EXHA 2Y5TB 5KANG 4FYQA 2PN5A 3KJ4B 4HLJA 2F15A 3UGEA 4IYKA 1BFOA 1EFXD 1OB1B 1JGUL 4KJQC 2GBUA 4MDIA 2IPTL 4PWIA 1PFOA 1ZK9A 1FO0H 1QQDA 4Q0XL 2WLLA 4AE0A 4GMSH 2GJ6D 4KDWA 2EDJA 1SJHA 1BVKA 1MCHA 1N8ZA 1T5WA 2FWOB 4XN4A 3GBLA 2E76C 5BO1L 4HEME 5EBMA 2F8OA 3GMPA 3TT3H 4I7ZC 4CAGA 2VUKA 4M62H 1T6WA 4W9DC 4MGXA 1RZQA 1T0OA 1BLNB 4XNQA 2YN3A 5KEZA 4JN1L 2VDMH 4NKMA 4A04A 1F56A 1NCAH 2PTTA 3TU6A 3O3EB 1ZTXE 4UZGA 4XXDB 3S37L 4N90E 3GGWA 3HE7B 3KLHD 4U6XB 1AXIB 3EFFB 3GMMB 4XNMB 4CMMA 4RX4D 3MA7B 2AXWA 3SQRA 4L8SB 4XPAH 4HS3B 3AC0A 1WCBA 5AB2A 5INDB 4EOWH 2NNCA 5D96C 1B9KA 1H15A 1ZLWK 3L5XH 3VH8A 1BPVA 2GSIB 1XB3A 2HX8A 4KOCA 3JTSA 5AKRA 2EUVA 1UD6A 1ZV9A 3VTMA 2WWOA 5B7FA 5F88A 3ELAT 1AGDA 2XSKA 3CVHA 1BEYL 2DWYA 4GFTB 3MNVB 2QQNH 3SDAD 3QEGL 2A3TA 5B4MC 2X2YA 2K0RA 4R8WL 4FP8H 5I5JA 2EABA 2IBZX 3I6KA 3HI6L 5CN2A 1OP3K 1QUNB 2A74C 4QOKD 1T1YA 4QRFA 4BA0A 4NGHL 2ZG2A 1WWAX 1S5HB 4JRLA 3QQDA 1QG3A 3SKOA 3EJZD 3UYOD 2Q76B 4TNGA 3MLVH 3CX5J 4ZDHA 4NNYB 5C0JB 3U1PA 2IPKB 1FNSL 3E3QE 4P3WA 5K59E 3HE7D 4PJ8A 1NDMB 2EDBA 4V1DB 2P5EB 3VYPA 3S8GB 2YEZA 2W81C 3IFPA 4GG6B 2CUHA 3E80A 4PS4H 3BD4A 4JGMA 5K1JA 4HIHA 3QQ9D 2ZKHH 5DD5L 3LEVH 3RA7H 2Y06H 2ZCLL 3FRPB 3GSQA 4NQVA 4N26A 3N1MC 4PCSA 1P4BL 1KCRL 5DHDA 3ZL2A 3PWLB 2XG4B 3B9VA 3BGMA 4PWFA 3U4AA 1UWXH 3F58H 2XKNA 3BESR 1RP8A 1IFHH 1D5MA 1FQ9C 4KKBD 1WAAE 3V55A 1RP9A 4KAQH 1FZJB 2HG5B 3D51A 4RESB 1ZSDB 4AQ8C 4LVHC 1ZTXL 5I17B 4LHUA 5MP6H 4MYPA 5JYLA 5CILH 3FCSB 3TJHD 4XWOC 1PW3A 4HK0A 1EJ8A 1V7MH 3IDJA 2DLIA 4V1DD 1AO7E 2P5ED 3LNDA 4BJLA 4F57H 2HX9A 2F7QA 4BZ2H 1P7KA 2RFXB 1TQUA 2PPDA 4YHKH 1OIOA 4R96A 1RK0A 2FIKA 3PWJB 3CFKB 4L3ED 5HP5A 1IAII 1XSJA 1OQOA 4WUUD 3ULAB 3HPJA 4FI7A 1GSKA 2NYKA 5EU4A 3HI5H 3ZDXB 2P80A 1NUNB 5C0GA 1OTUD 1OO2A 4NQCA 2Y6SC 3I75A 1SMAA 4LXFA 5K1NA 2FHCA 1T1XA 3ARFD 3MROA 3HI1A 5I9QC 4ETQA 1M6UA 4BWUA 5C2BH 1W80A 2W9LA 4G6JL 4OTXL 2ATKB 3MACH 5DJ6B 2W91A 3C2SA 3MREA 3QSKB 4JX0A 2QGEA 1CFQB 5EU5B 3B83A 1BM3H 2WBJD 2Z8VC 3BO8B 3TF4A 2NLJB 1JN6B 1CLYL 3PL6B 4QLRA 4FMKA 3WXVL 1C12A 4TVPD 2VQTA 2BY3A 5ES4B 1AIZA 2MH4A 5GHWH 4HUXA 1PLAA 3KWVA 4Q9BA 1XVSA 4LFHG 3GBML 1CT8B 1OF0A 4OH2A 4EN3A 3E38A 5F9OL 4L2LA 5F9JA 5JA9A 2P44B 2VH5L 1YJDH 4U1JA 4YIQA 5DZLA 5EUKA 1XCWA 1V8HA 4P2QB 3TTYA 4YJZL 3MUGA 2YPVA 1QW9A 4ODXA 3QIWD 3I6SA 4AK2A 2CPUA 1Q94A 2HP4A 2NMSA 4R0LC 5HGBB 2V3FA 3RTQB 3DGCR 4YGAB 3EFOA 4N2BA 4AZUA 4B96A 3KPRB 3H7LA 5IBTH 3FQ2A 1J1XL 4JFOA 3FU6A 5C0BA 3QO1A 1C5CH 1CDGA 2EC9U 4PJGA 2OZ4L 1MHPL 3RWFA 3TN0D 5EO9B 2W1NA 1ZLEA 4E0RB 2E4TA 3BH9A 4QRPA 2OMZA 1N6VA 4PW9A 4CBPA 4GINA 1TEFA 1A8JH 1ZAGA 2FEJA 1I7UA 5ESAA 3DLQR 4YXLL 2BVYA 3WENA 4QR7A 3QWNA 3KCWA 1AVAA 4Z5RB 1DBML 2MFNA 1KLGB 2BDNH 4AEHH 3OF6A 5CS7A 4CDGC 3N44B 3E2HC 2EDXA 4JRXE 3W5MA 1KXVA 5HYSA 2BNQB 2F18A 2X10A 2H0FA 4BINA 2O5ZL 4G7VH 4CADB 1BYNA 2I9LA 2FX7L 4UQ2A 4ZMTA 1AQ8A 4ZMNA 2G9HA 1U95B 4G6KL 3VD3A 4R7XA 5DHYA 1BVZA 1QRKA 4LLUA 2DKUA 2FBRA 3FO9A 1HJCA 1QNZH 4GG8A 3FT3B 2UY6B 2VLJA 4KVNH 4PRPE 2ZCHL 1OB0A 2QMJA 2VQ1B 3MRBA 4OD2A 1HXMA 1HN1A 3B2VL 1KLUB 1YEEH 4NKOB 1D7DA 4MKMA 4RNRB 4FC3E 2X0WA 1I3GH 5EU6B 5K59F 4HQQL 4XWGL 2YBRB 3MRIB 5DJ2B 4NM4H 5LGJB 3MNDA 3O2VL 2ORBH 2DLEA 1CQYA 5DDHB 4PJXA 1SHMA 2VTFA 5E2VH 3IMTA 3DGGA 1DQJA 4FL4C 3AXLB 4BZ1H 2BY1A 4XOEA 4TSBH 4J6IA 2BNQD 2H3NA 3M8OL 5CZVL 5AVTB 3MRMA 1UXSA 1A6VL 2PR4L 5EPMB 2NQCA 1OZTG 4H2CA 4OIBA 5E94A 3VFMA 1JV2B 4ELMA 2J2ZA 2O5YL 4RH4A 5ACZA 3RWCA 3FOMB 1WAAF 2AXFB 1RURL 4D2NA 4AX3A 3QJFB 3SE4A 3EYVA 5IVZB 4BELD 2Y2WA 3K71B 2IQAB 4P23A 3T4YB 4KROB 1QX1A 4F8LA 3DTUB 1G7IA 4EO5A 4KKQA 3M6DA 3UAEA 4MD5A 4LBEB 2IH1A 2OCCB 2CSPA 1AGFA 1SDDB 3G6JE 5DLMH 5J9PB 3RL2A 1H5BB 3L08A 3EJUA 3GWJA 4Y8AA 3CQPA 2ZUXA 3RKPA 3SPVB 4X6DE 4DGUA 1UACH 4X99B 5ID1B 4Y19B 2HYMA 4G1MA 1MCCA 4LSQL 4UNTA 1XIWD 4JFYB 3MJ8B 4L37A 4HZLA 1X9UA 1B0RA 4L4JA 2P8MA 4YHIB 1W6LA 1G7PA 2ATPA 3DX8A 3DBXB 2Y7QA 1HNGA 1ZRUA 2GQHA 3ECWA 2CLVB 3OJDA 4L18A 3Q8EA 3LDBC 2P43B 3RVVC 2MQGA 1H3PL 1DBAL 1LEIA 2GPZA 1J5CA 4JDZB 3VD0A 3RVUD 1XF3A 4WNJA 5DZPA 5I1JL 5LBSL 1ZJAA 2NNAA 3AT9A 4NQUA 2PXYB 2UWEB 3BP4A 1NJ9A 4I5BB 4TVPH 4WQOA 3SY0A 3VFNB 5IM7A 4GUCA 5D7JC 2PWFA 2DWDB 4J4PA 5JHDD 2E3VA 3LN9A 4FQ2L 2OX5B 3QPQD 3VW3H 1XF5A 4PGBB 5M7QA 1ZT4A 1JFQH 1CO1A 4MHHG 4HUNB 1WV7T 4HZAA 3PXLA 1BZ9A 5AKTA 1JGVL 1L7IL 5DRNB 5DTFB 5TDPA 4UM9A 5I0XA 5IF0B 3ULVL 2VZ1A 3BUYA 2WO2B 2VOTA 2BLFA 2XTSA 5DMGD 3WV0A 1G6RH 4C56A 2Y36L 4ODVH 4U3XA 5GS3A 5JQ6L 1Y1UA 5I2IA 5E5RB 4CA4A 1FCGA 4HUWB 1DVFD 4JVPA 3WS6A 4E41B 4BCZA 4HH9B 3RUGE 3BZDA 5E51A 1WC7A 2ADFL 4PFEA 3VFRA 3JVFC 2VLME 3IFNH 2MOQA 1E9QB 1B4JL 1PG7L 3BFOA 2CO6A 1WZAA 1AGEA 5I1AA 4I9WE 1R9FA 43C9A 1QLEL 3VG0L 3CFDB 4RDQF 4WJKB 4XNZC 3CMOH 1H0DB 4H1LH 4J7RA 5D2NB 3L8QA 5AVZB 1BVOA 1SZNA 5DK0B 1H3WM 6CGTA 2X4OB 5FXCH 1Q9KB 5KN5B 2C3XA 5KVDE 4KPHH 4MA3B 2X4RB 4MA8L 5G55A 3QEHB 2B0SL 2BNRA 4Y16A 3BP6B 4AYDC 4GT7A 4X6FB 1RUAH 2UZYB 1U36A 1MF2H 3N43F 3RILA 3U4EA 3ECQA 4PJFE 5L7XL 1IMHC 2QMKA 2C7UA 2R27A 4XP4H 3UZEA 2E7LA 2K8MA 2X2UA 3H2QA 3CK0L 2E7BA 4XHQA 2YPLD 1NAKL 3FQNB 3FRUA 3N6YA 1NEZB 5ALCH 5KSUA 5DXWA 3LQMA 2BVUA 4QWWD 4RMTA 3ZTJG 3GEWB 1CDUA 1A6WH 1RJCA 5GGRB 4PWHA 3O6LL 1P7HL 3S5LG 1I8IA 3L3OA 2R23B 4EN2A 1FNHA 3BQUD 3BVDB 4L29A 3QDJB 4NO3A 2EXTA 4PBWD 1A2YA 1NIEA 1C8QA 4FQ1H 4JHZA 4OT1L 2HN7B 1IT9L 4PJ8C 4F37F 4Z3JA 1OGAA 3G04B 4X80L 3HNSH 4GQ9H 5CLYA 1NEUA 2R1YA 3AQDA 2R69H 1VB9A 3MRHA 2A4EA 2VO5A 3UL4A 3ZPDA 2BNUA 3T8MA 1MWAA 4OJFL 3N1QC 2E59A 1W72B 2A9NH 1MFEL 4WEBH 4Z76A 3RX9A 1KT2B 4K7PH 5SWZE 4KOBA 4WEUD 1N0LA 5DS1A 2DI9A 4WCYL 5EWIH 5J13B 1CBVH 3EF4A 4RBPH 1IC5L 4JZNA 1IGYB 4G42A 2GSMB 5K9OA 3UYRL 3DVFA 2A0LC 1INDL 1TETH 4OLZL 3FU5A 4QXGL 2WVVA 3OGOE 4AQEB 3L3IA 4YDLB 3KPOB 2IGLA 4FQIL 2ZX7A 2CCWA 2PO6B 5KVDL 2CM6A 4G8GE 3VU2A 4O9HH 1KIQB 1NPJA 5FFLA 5IWLC 4F3FB 1YNTF 4WI4A 3MRKA 1NCGA 3BAKA 3QH3A 3S35X 5DR5H 3FCGA 1ZD6A 3WEXB 2YAFA 2CJUL 4HXBH 1E9PA 5IBLC 1I75A 2GUYA 3MFFA 1U4EA 4C58B 3OKNB 3MRQB 3WBDA 1LO5A 5CJOL 3CN3A 3K6NA 4F37K 5K9KB 2YAMA 3EDFA 3KPPB 4F80A 5E8DH 2WN2A 1KZYA 3V5KB 5F7MC 4LO9A 4EIBA 2VR8A 3RPIA 3WKMH 3PWPA 1YMMA 3L5IA 5HGAA 2DQGH 4YR6B 4PJIE 5LCVH 2VB5A 4CW1B 1R24A 2Y3AA 1J8HA 5AAWA 4HGKC 1T5KA 3V0WL 1NINA 3LS4H 1HT6A 4M1DH 4LBAA 4ERSL 1DLHA 4QJ4B 1BFVL 5TQ2H 3QORB 4JQIA 4U3HA 4LHJB 1IBYA 2X41A 3P9WB 1A3ZA 1LE9B 5I75C 3LQAC 3PQYA 4F2ME 1KPVB 3VWKC 1JXDA 1MHCB 3JWDC 1KN2H 3K7UA 4L9DA 2O61A 2HTKC 2W92A 5D1ZA 4BFFA 3SPIA 7FABL 5EZOL 2GABA 1KFGA 3VRIA 2C9QA 1NH6A 4DN4L 4EN3C 5E4OA 2V9UA 2HJFB 1XGTA 3CC5A 1RZJC 5KW9H 3NSJA 5B39B 5FOBB 1NBZB 3RVWD 1T6VN 5F1NA 4OCYL 4Q9QH 1NFKA 4OI7A 2Z93B 1DBBH 2FHFA 4AT6B 5KG9B 4N6RB 5CGTA 3IEAA 2DEXX 3LEYL 4TYUA 1ZLSH 3GO1H 2APTA 4JY5H 4KNUA 4UOQA 7PAZA 1A1MB 1AD0B 5GSVB 5E1GA 1YEFL 4JRYE 3QUZA 3GSUB 4HLZH 3PJLA 4Z7WB 3TA3B 3QORD 4Z78B 2IC2A 3MRDB 3GTTA 4BBWA 4ZFOB 4G5ZH 3QCVL 4N8UA 2X4UB 1XMWA 2OAAA 1AD9A 4XVJH 4GRWE 5CFHA 1FF5A 2PYFB 4L0YA 2YARA 4E9XA 3BVUA 3D2UD 1G9HA 1S7WB 2YAHA 5CCKL 2XVLA 1M7IB 1XH3B 4KRLB 5FO8A 1EBAA 3X11B 4UIMA 4R6UA 5D71H 3NOIA 3K5RA 3UO1L 4MZ3A 1GS8A 4PJFF 1OPOA 1HWWA 3P1VA 1WAPA 3VXOB 4JFQA 3FUMA 4GKZB 2P45B 4F33B 1CVSC 2UZIL