3JWNG

Complex of fimc, fimf, fimg and fimh
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
144
Chain Sequence
ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding/cell adhesion
molecule keywords Chaperone protein fimC
total genus 21
structure length 144
sequence length 144
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnG00
5FWRA 4XOEA 3RFZA 4X50A 1ZE3H 2UY6B 5F2FA 5F3FA 3JWNG 4J3OF 3BWUF 4X5PA 4AVIA 5IQNA 4AV5A 1TR7A 1UWFA 4LOVA 4XODA 4AVJA 5FS5A 3JWNE 5JQIB 4J3OG 4AV4A 4CSSA 2VCOA 5ABZA 5IQOA 5CGBA 3ME0B 4BUQA 4CSTA 5AB1A 1PDKB 4X5RA 4XOBA 5FX3A 3ZL2A 4XO8A 4AV0A 3JWNH 3MCYA 2JMRA 3ZL1A 2XG4B 1N12A 2XG5B 4XOCA 4ATTA 4AVKA 2W07B 3BFQG 1QUNB 1KIUB 5FLUA 5AALA 3SQBB 4AUJA 4AUUA 5AAPA 4XOAA 1N0LB 4XO9A 4AVHA 3ZPDA 4J3OH 2J2ZB 5LNGA 1KLFB 3BFWA 5IQMA 4CA4A 4X5QA 2JTYA 2UY7B 5LNEA 4AUYA 2WMPB
chains in the Genus database with same CATH superfamily
3B8SA 3QUML 3ULUE 5EZJA 4NIKB 5I1CL 3K1DA 2J8UA 5JHDD 2O6DA 1O5DT 1NLDH 4B60A 1YY8A 1CYGA 4UQEA 2NY0B 5DVNA 1E5CA 2K3HA 4KVNH 2AK4D 3O4LE 4OF0A 3T0VA 2Y2YA 3S3DB 3QIBD 1MHEB 1BREA 5G5DB 2QMKA 1BLNA 3OC5A 3UYPA 4OLWL 4EI5C 1E42A 1PCXA 4ZUWB 5KVMC 3V52H 3KMDA 4DGVH 4IHBA 3IE4A 4DPAX 1UTDA 4KQ3L 1R17A 2EDNA 3ZL4L 3FCBA 3GINA 4PGEA 3TESA 5FK9A 3LZFL 2WBJA 4AX3A 3VMPA 2DY2A 2DYPA 3BYTA 3NH7L 1GGTA 1S9VB 2OSYA 3CFKA 4YE0A 4KAQH 1F56A 1AE6H 2VMDA 2XG4B 4GYBA 4N0FB 2MPAH 1U3JA 1JS4A 1D5BA 3MRPA 2H2SD 5EFIA 1UD2A 1ZLWH 4Y8AA 4HV8B 1WT5A 1QR1A 1XXFC 2EICA 1U95A 1YQVL 4PV9B 3K6FA 2CBOA 2FX9H 4QUOA 3TO2B 4YR6A 3TVMC 3SDYH 1J8SA 3IFNH 3R1GL 5AL0A 1D7DA 1TMCB 1SEBA 1XGUB 1DQIA 3DSNA 2JJTA 5DQJA 4K7FA 4YHNB 5L2JB 1FHNA 1WCQA 2DQUL 1VACA 5MI0C 2Q5BA 3HLAB 3MLTB 2OMWA 3C6LC 3QFDB 3S5YA 3FB6A 5A2LH 3VXUA 4G6JH 2NX5D 2IAMC 2R2HA 2QPEB 1OQXA 3PXHA 1DVQA 4OB5H 2OK0L 3TT3H 1TUPA 3P9LA 4GBXC 4QXWA 5IKCB 1JWUB 25C8L 4OF7A 3D34A 1Q8MA 4MMZA 5EBMA 1PW3A 3L7FA 3U4BH 2IAAC 2VZOA 1A65A 3FFCE 3EDJA 5E5UB 3MNZB 3ABLB 4D9RE 2PWGA 5J6HA 1AJ7H 4CJ0A 4MS8D 4ERSL 2XSKA 3TWCL 2EIZA 3F00A 3QI9A 2OZ4L 4XH2B 5CZVL 4GFXA 1NKOA 3MUGB 1QSEB 4FQJL 4WHYH 1NANI 3BSGA 3OB0K 5DZPA 1XXDC 5JW3H 3TP4A 4AC4A 3AADB 3MVSA 4H8QA 3FQ4A 4R3SB 4GQ9H 2X42A 3DMMC 4MAYC 3QE5A 1M2VA 1F2XK 1KB5A 5F7UA 5TE6L 3D48R 3QAQA 3QPKA 2QKIC 4PJXE 2XZAH 4G2AA 3ESPA 4FI7A 1YUHB 4Z7QB 4JZOB 4V1DA 3LQAC 4HMEA 3N42F 4AJWA 4Z7AA 3H0TA 4DW2L 2FYYB 3PUCA 2NX5B 1YNTF 1Z2KA 4A2MA 5G2NA 2FWOA 5DS8A 5B3JE 4JHWH 4ZOAA 4HWEL 4FX5A 4GRLC 4XBPB 2WXJA 5PAZA 4PJDB 3DX0A 4P2QB 4EIUA 5FYJD 3CZKA 3OG4B 4JZJB 4OCYH 4F7CB 5DVMA 1JBJA 5IB5A 2W9LA 4X7SH 2D0GA 2VDKB 1WAAF 5DWUH 5FC9A 3DSFH 4IGBA 1BJ8A 1I1AD 1IARB 3ABMB 3CSBA 4FFZH 4Q6IC 2B4CH 4NO5B 3S48A 4Z7OB 4OQTH 2Z8VC 4PVLA 4CMHC 4KVNL 1S7RA 1HI6A 3TIDA 4TNGA 3AB0B 4NZJA 4AM0B 3DVGB 2J6EH 3SB3A 3P3YA 4WFFD 3VG0L 3HHSA 3CDCA 5ISZD 2QR0A 3NCXA 2MCAA 1AQDA 1T22A 4XPBH 3FN3A 4OI7A 2FQGA 3B5TA 1SY6A 4JDZA 4PIBA 3TZVC 3LIZL 3OPZL 4ZW5A 2ZWNA 4UAOC 1A1MA 3WTUA 3QORA 5GXBB 1JCVA 1KLGB 3AZUA 2AK4E 3MRBB 4ZFOB 5HI4C 4RBPH 2KZWA 4L29B 4Y7OC 2XIIA 3JTTB 1XD1A 1DDHB 3CWGA 3MV9A 4HZAA 1VRSA 2FLMA 3SDAD 5HHXL 4GUQA 5AD0A 4H88H 4A1RA 1N6VA 5E0FA 2K8QA 3PIQA 4OM1H 3TS8A 1HL9A 4GBXA 3VMNA 2YQBA 5DT1L 3U7WL 3T4AB 2QQQA 3O45A 4JE4B 3W5NA 1DQTA 2HUHA 3MO1B 5LAPA 4PSRA 1ZGLP 2J5LB 2XJKA 4X4ZA 3EGSB 3HRZA 3M1BB 3MV9E 1HCFX 5K9OA 1PZUB 3S37H 2LHAA 1FUNA 5D2LA 1R47A 3VXTB 2X1PA 2B1AH 4UTAL 3CJJA 1M57B 1IBFA 3NH7H 4G7SB 2ROXA 5F8QC 2ZYRA 1Q90A 3GIZL 4BA8A 4WEMB 3GGWB 1T0PB 1JGUH 1OAYL 1QFWL 2GK0A 4RMRA 5D8JL 3O41A 3PV7A 1KBGL 5DZNA 1PX8A 1L9MA 5T1JA 4J2XA 1KCSL 2CKBB 4BHUA 5F7AA 1W72A 3U79A 4HD5A 2VNCA 2HT3D 4K07A 3K71B 3C9NB 2KH2B 2CLVB 3KM1A 2VDOB 1FFNB 1QLEB 2O5YH 4RCAA 2IGTA 5D6CB 3SDAC 4X7TB 1SJEA 4QHKI 4TSAH 5DEZA 4OF8A 5C6PB 4ZUVB 2NZ1A 4XNUH 2HVKA 2X4OA 4LARH 1CFQA 2GB2A 2Z93A 1SN5A 3S5LB 3OAZK 3RY4A 5EN2A 1SYSA 1KJ3L 3JZYA 5TPWL 5CCGE 4YDVA 4MX7A 4B9ZA 1WFUA 5I9QC 3R8QA 4FP8L 3EYOA 4QXUL 5KBMA 5J06A 1RV6X 2JJTC 4P9HL 4FCAA 4KK6C 5ESVA 3SZKC 1MJUH 4OKVB 3V2AR 1MWAA 1GGBL 4F33A 2GK0B 3GI8L 2HT3C 3NCCB 3M7FB 4MDJB 5DD6A 1NGPL 4WFEE 1KB5H 4FG6C 1IJ9A 1Q0YL 4JRLA 2O5ZL 1NPJA 4IMLB 4XPBL 3KEDA 3ZKMD 1MFCH 2KS0A 3UAEA 3O3BA 1E8ZA 1UB5B 2IG2L 1E3ZA 5BPPA 2QPFA 2O30A 2D7PA 2ZUYA 3KPOA 1RERA 2HJLA 1JTOA 1RZJC 3AQYA 1XCQA 4PJ5D 4PJAF 1XSOA 4X7SL 3RWGA 2X9ZA 2B4CL 2FUTA 3X3GH 2J8UB 2V8MA 5DJ6A 2WXKA 1WA0X 2XPYA 4M93B 5EU6D 3Q8AA 4C56B 2IIJA 1BD2D 3WKPA 1D6VH 1TQVA 2EIJB 1WH0A 3TWYA 4WI2A 3VG0H 1EZUA 4N87A 4NQSA 5F1IA 4ZOEA 1TJHL 2XZCH 1QRND 1KTJA 4X83A 4JHWL 3LPGA 4NRXA 4RMUA 3QQXA 1PBYA 1KBKA 2A7BA 3N1PC 4OD1H 5CGYD 4TULL 3AXIA 4PQXA 5CJ5A 2EIKB 3RUGB 3VFWB 3TFBA 3FOLB 2VABB 1U8PB 1OZUA 1ZVSB 2OSXA 5F7BA 4EZJA 4ZW3A 5DLML 5BQ7A 5FW7A 5IB2B 5MEND 5D2LE 2IQ9L 5ABAA 3FUJA 3IETA 3Q8BA 5J12B 4Z5RA 1U8QB 4H8PA 2H0FA 3AS1A 1J0ZA 4PJAA 2WXGA 2OMVA 4OZGA 4TOYL 4I5BB 2NW2B 2QADC 4N8CL 3PDOA 2D03L 1T2QL 4XTRC 2EVIA 4WEEA 2JCCA 3DETC 4EBQH 2GY5A 3OJDA 1AGDB 4KO9A 1KSRA 4XNBA 2FO8A 3ULUF 3AWFA 3K72A 2W94A 4JG0L 1NUDA 1MCBA 1R6VA 5IGXH 1AFVL 3QQ4B 1B4RA 1BSIA 1CL7I 4G5ZH 3WTTA 3GRWH 3CDZA 2AK4A 5I76B 1HH6B 1OAKL 1MRDH 4P07A 5HDWA 3EKCA 4TV3A 3INUH 1T1ZA 3O81A 1PYWB 4ODUA 4L8CB 4LCCB 3BVVA 4HJJH 5IWLC 3WG7B 2VDMB 3NCEB 5I16B 1ZA6B 1BD2B 3N41F 1KTKE 5CFHA 4UV4H 4XXDA 5BQ7B 1OGAA 5SWZA 3LH8A 3TJEH 3WTWA 4YHLL 2UWEB 1BFVH 2YRPA 4F8LA 2L3BA 2FO1A 1FZKB 2YZ1A 3IDXH 3VFPB 1RSYA 1HKFA 2E27L 4NQCE 4XO3A 4NKDA 4JFDA 4LEOA 4ZUSB 1TKWB 3UH8A 2A38A 3QYCA 3FUNA 1NPUA 3QUKB 5EOCL 3DIFB 1I3GH 4OIIH 2BCKA 3C60B 3RFRA 5IHUH 4B9YA 1WS7A 3HA0A 1CD1A 5TH2A 3R7RA 3VGHA 4X4MA 5GRJL 1F02I 4GO6B 1S7UA 3MNWA 4O02H 3U9UB 4JKWA 3KPQB 3A67L 1XGPB 2CBPA 2VDRL 1GHFL 1OM9A 3OKKA 1WA2X 4JFZH 3EOBB 1Q0XL 3FZUC 3AU0A 2FX7H 2N59A 1MFDL 2P46B 4R90H 2GFBA 1P9MA 5D1XA 1UM6L 3II3A 4NLAA 5CUSL 4DZ8B 5HD8C 2DJMA 5DVOA 2DLFL 1R19A 1U58B 3MRPB 1OAUH 4FABH 1KB5B 2G0LA 3QXAA 2A3TA 3GS0A 2ADJB 5IOPA 2DQHL 3JWNH 4BH7B 5LAXA 2VR7A 5SV4A 5HVHB 1X5YA 3CDGA 4XP5H 5FKAB 1MCOH 2HSIA 2ROYA 2YBRB 3L9YA 2G2PA 4OGXL 3RX5A 3CH8A 3PHQB 1QUPA 4GH7B 4NN5C 4O2FA 4AOFA 4PH8A 1YEEH 4U7KA 1RZ8B 1OD9A 4P4KC 4KNSA 2YA0A 4WNSA 5T1DL 1NMAH 4R96A 2JXMB 1OCOB 2PNDA 5D71L 4GS7C 4FFVD 4ZXBD 4XP6H 4KQ0A 4JO1L 4WRLA 1I7RB 3C60D 3X17A 4DP2X 2A9BA 3F04A 2RCSL 3NTCH 3HC4H 4NKMA 4PWGA 1Z9MA 1O9WA 4HKJA 1C7SA 5IVZA 3SJVD 2VDQH 1BVZA 4GP5B 3VSQA 5KVEE 3PWLA 4O2FB 5AOKA 4LVOB 3VTTA 4QY8B 1QATA 2OMUB 3NIFE 4OFDA 4JFQB 1CFTB 4DOHE 2X2HA 1WYJA 3NIDF 1TVHA 1SDDA 2G2NA 5J57B 3NSYA 5BRZA 1SJVA 2CO6B 2BOCB 3LSOA 1M6UA 4L9LB 4PCKA 1BAGA 4X8JA 2Q6WA 4CAGA 1P84J 4JFXB 3GMLB 3CMOH 1A1OB 3LQAH 2EC8A 1YEFL 4R7LA 3B7SA 3U2JA 4XZUA 3K6NA 4IIZA 5AZ2L 1P7BA 2A4ZA 3MRLA 4AQ1B 1NGQH 2P45B 3D3VE 3MLWL 2DJ4A 1FFNA 1IE4A 4DAGH 4XVTH 4QJ3B 5ANMA 2C3XA 5H35B 4HUXB 3KVPA 5J13C 1W9XA 1OXYA 4PJEB 4XP4H 1H3PH 4HZ1A 3ZTDC 1MAKA 1CIUA 4IOSA 2DLHA 4LE8A 3S96B 3QDGB 4R4FH 4JQIA 3KNBB 5E1QA 1WFJA 2RALA 4JHVA 2J44A 2XXGA 1A6ZB 3HZ3A 3S4SA 3MPCA 3X3FH 2VW7A 3QI9C 1G7HA 3FQTB 4X4KA 5ACMA 3U0TA 4BD4A 3QJRB 4ZYKB 4Z78A 2A6IB 4XN7A 5FGBC 3T0EA 1IL1B 2ZNWA 3MJ9H 3LKQB 2I60H 3BRDA 1JNHB 2F7OA 2P24B 5I0DA 3QZMA 1O7DC 2AF2A 3S37X 4I4WA 4MAYD 5K1NA 4PG2C 4ZPVA 4MKTA 1OWRM 4GKSB 3QFGA 2NLJA 1H0DB 5CP7A 4YVUA 3MNMA 1DBJL 2VITB 3K8MA 2OYLA 3E9TA 1NDMA 3NEOA 4WWKA 3TM6A 5CR1A 2WTOA 1DE4A 4CSPA 5SX5H 1Q9KB 2EVGA 3FO0L 2LU5A 4XNZB 1GTNA 1Q9WB 4Y2OA 3K6DA 4JFHD 3MROB 4JO2H 3VCLA 1T6WA 3EZJB 1RPQA 3L5IA 3BWAB 3LN5A 1GYVA 4ZAKB 3BCFA 1FRGH 5KBPA 3CSPA 5C08E 1W0VA 3BT0A 4BRVA 5D55A 2EP6A 4LPXA 1EBAA 4HLJA 3TNNA 2VMEA 1JXJA 3ABZA 1HKLL 3HZKA 2Y07L 3W39B 3BPCB 1PNCA 3QDGD 4ERSH 3WE1A 2JFCA 4P2OA 3IAPA 4M62L 3NJHA 5I8KH 1OGTB 3D50A 2W38A 3G9AB 4NEHB 1DVFD 4KJYA 5AKTA 4CU7A 1JSYA 3V4PH 1U8HA 2PTTA 3I3EA 1NOLA 5K33A 1UXMA 3CCHB 4ADGA 2MQ0A 4TNFA 4IJ3C 2WXFA 4AEIL 3NJMA 1UCBL 1Q1JH 3MU3A 2XA8L 3VD0A 3FH7A 3T3MF 4M1CD 2NR6A 4TM9A 1BDYA 4XMUA 3TO4C 4JM2B 5EOQL 1U30A 5F89B 1TZGH 4ZFFB 2X0WA 3QULA 3GI9L 2CLVA 2IANA 4WCYH 3S5LG 1OSPH 2L4OA 3AXHA 2CKNA 1NCDH 1TYEB 4KVCL 1XH3A 3W0WA 4Q6IB 1TSRA 3NN8A 4EI5A 1DJGA 3L81A 1EA9C 2JQAA 3WHXB 2YD5A 5D7SL 4ONGL 1OAZL 5JR1H 3CFJA 1ANUA 1QOKA 4G7VH 4GAYA 1CB4A 1JNNL 4XAKD 5CBEB 3WNMA 2EUVA 3KLDA 1TO4A 1RZIA 2ICWA 1RUML 3LXAA 1X9QA 4QHLA 2NXZD 3KYMB 2IOIA 4WW2B 3HB3B 5C3LD 1Y6NR 2Z64C 4X5XB 4FL4B 3HI1B 4YDMA 5ACZB 3PXLA 2R56H 3MRGB 1UD5A 1CTNA 2PW2A 3EGDB 1O75A 3LB6C 4HU2A 1HXYB 1JHLL 3EGSA 4XMPH 5K9OB 4FLOA 3KBFA 3WIIL 3KHQA 2XV2A 1XR9A 3NYKA 4NKIH 1B4TA 4HS3B 4QRRD 4E41D 3N55A 5IQ9A 4EOWL 4OCWL 3HE6B 3QZLA 3UDWC 4ONFH 3FQNA 4CU6A 4G71B 3L8QA 4FFYH 3D3VD 3Q13A 4NQXA 4U4IA 4WI3A 4DAGL 1T0NB 4DZ8A 2KPNA 4WKZA 4GRLA 3ZBMA 4KZEL 2FJFA 4P2RE 2HAZA 2JTDA 4X6FB 4B9GA 1JPTL 1T03H 2P7TA 1DVSA 4FFWD 2V3FA 3MNVA 1HILA 4HJIA 3HHSB 1ZT7A 1LVEA 4FQXC 3N1QC 3RL2B 3G6JF 1BJ1J 4I89A 5DFWH 5C08A 3EJJX 3RGVA 3ARDA 4LKCB 3LIUA 4JFDD 4RGOH 5ISZB 3L3JB 1C08A 4ZSOA 3JSSA 3HFFA 3GK8L 4PTTA 1AS7A 2IBBA 1L9TA 4PRHB 2EDJA 1ZHNA 2DQMA 3VA6A 3ULUH 1BWWA 1MXDA 4Z7WE 1RK0A 2X6BA 3IPFA 3M1CA 3V10A 1KCBA 1XT5A 3WEBA 3H9SD 5D1QC 3LJ3A 5IROC 1I7UB 5JHLA 3W38A 5AD0B 4NKDB 1Z3GH 3T08A 2CDEB 2Z8RA 3G5YA 3QJSB 4U2ZA 2D03H 4RX4D 4ODSL 4P2CG 4KTYA 3SIKA 5L8JB 1ETZB 1UWFA 5DK2A 1MY5A 3PGDB 1AOZA 1EEYB 2VDPH 3IPBA 2ITFA 4K73A 5TJWK 2VC2H 1Q0EA 4FXLA 3HE6D 4LGSB 3JT2A 1A9BB 4HCRL 4FMVA 4NENB 3P69A 2V9TA 4XMLH 3G6JA 4Q52A 1IBGL 1KJ3H 5TPWH 3P4OB 3GBML 1T04B 1FA4A 1Q94B 1MH5A 3INOA 1ASQA 1ZLDA 4PS3A 1UXWA 5ADOL 1AD9B 2YPLE 4EXPX 2XN1A 1COBA 5F3FA 3V4PA 1I8MB 2FL5B 4MJIB 4NKOA 2F1EA 1OAQH 5AVUB 1MFNA 5MP6L 3B9DA 3P4NB 4UNVA 2HXAA 3NIFF 3TBCA 3LN4B 5ITBH 1HNYA 3ZZSA 4NPJA 4NPKA 4RETB 4C56A 3O6KH 2VDLH 3MTXA 1FZKA 1N12A 3V7MA 3VFPA 4UM9D 5AVYB 3DROA 2CHXA 4TVUA 4KQ4L 4FG2A 3B7RL 1ZRUA 1Z5YD 3LNHA 1H3WM 4GW1A 3O6MH 1FVCA 1A6VL 1ZXQA 4B5EA 2QSTA 1I7TB 15C8H 3T8XA 4AEFA 1M7DB 1HAWA 4NB7A 5I23A 1WE5A 5ERWB 1QAWA 2DH2A 3E1F1 4I9WD 2ZUWA 4L3EB 2E7LA 2DMKA 1N7ML 1HHKA 2CO6A 2XDHA 3F7VA 2YSSA 5IT2L 2OL3H 2CUHA 4FC3E 5LG1A 3F05A 3DK2A 4MWFB 3DV4B 3W0WE 4PWIA 1N70A 3QQDB 4NAMA 2OTWB 1MW0A 3BH9B 3DSNB 1D6VL 3HE7C 3WNIA 2OMUA 3OQRA 4ZXBB 2WQWA 3D05A 5EORL 4BK4A 3OQ3B 2CUIA 4BSWA 4AI7A 1CGVA 3ZVVA 2G2RB 1RURH 3DIDA 5FO2A 3RPBA 4RX4A 3X13B 2H0JA 1L9SA 3V8OA 4H40A 4S10A 3W81A 1CG9A 4Y19A 5FYLH 5INDB 1S3KL 2GBVA 5CEZL 3L1OH 3UYPB 2D2OA 5D9SB 4YHLH 2NPLX 2QSCL 4RRPG 5JQ6L 1FNSL 2FWLB 3U48A 2ORBH 2P5EB 1WIPA 1F8TL 3N1MC 4KROC 1YZZA 5AYTA 3OF6D 2N56A 4GMSL 1DR9A 4ONFL 1JYXA 3IGFA 5FDWB 1YO4A 3WFDH 3FO9B 1S7SB 2YIHA 4FOMA 4XCYA 2MRYA 4GUPB 1JF1B 4PJ7A 5PCYA 3GFUA 5F9WB 3QDJA 4HH8A 5EU6B 3VQLA 4CDHA 2PR4L 1AD0B 3D51A 3FS9A 5FV1L 4M1DL 4P2QE 2R0LL 1B0IA 1PKQB 1D7CA 2XICA 4LDEB 2XQYA 1TZIA 5F9WC 1E9PA 4I1NB 3C6LD 4ODBD 4ZPVB 4K5NA 3TC9A 5LLIC 1QO3B 3CHRA 3ECVA 3K4AA 2QLYA 2XTJB 1MCEA 5F71A 1GY2A 2NY4C 1DLFH 3K6OA 4C4KO 3U0PB 3FFCD 4FTVD 4WU7A 4X99A 3GTTA 1MF2L 4ZUUA 3VFSB 4AY0A 1OE3A 4K3JL 3KL5A 1F3DH 1KGIA 3OXRA 2YD1A 3P4MB 1U92A 3QFJE 4PD4J 1JYVA 1I8AA 3U4AA 3QDHA 5DA0B 4KDVA 5IVXE 2FHFA 3DTXB 4LEXH 3AG2B 2ZUXA 4XBGB 1W0WA 1A7OL 3DX6A 3BOVA 2YD4A 2BY1A 1WZLA 2ZCLH 1LO0L 1FL5A 1A14H 2KL6A 3QNXB 1JVOA 3CX2A 4UT6L 4O2CA 1EHKB 1K5WA 5AUMA 4JRYE 3Q01A 2HT4D 3C5JB 5IW6B 5K1VA 5EZOH 1QSFE 4P5MA 5I16A 3SY0A 3A3YB 4P9HH 2P28B 4G8GE 4Z7NB 5E4OA 1GJIA 4D2NA 4JREB 5GSVB 4Y2DD 2OL3L 4G8GB 4Z7NE 2LLLA 2L04A 3IDYB 4HX1B 2QR0B 3OGCA 3L4YA 4M29A 5DUMH 4YBQD 1REIA 3EFFA 2H7WA 3U0TB 3WDHA 1ZK5A 1TVDA 3BH4A 4NC1C 1MFBL 3R7QA 4KI5C 5B38A 2HFEA 4X0KA 4TVPE 1FE8L 2I9TA 3ARBC 1QI5A 2EEFA 1T7WA 2OMZB 1CF8H 4JVWA 1NCWL 5FEBA 2AZAA 3MRBA 4ZFOA 2PTUA 4GRLD 4QRQB 1W0WB 4K3GA 1QQDB 4GKSA 2EEDA 4FTVB 3T6XA 4HIPA 4ZO6A 4ZTEA 2BIMA 1SEQL 5BNXD 1CXLA 4LARL 5E6ZA 4UT9L 2IWGA 1NCBH 5DRXA 1YMMB 3VXOA 3QUZB 4F7TA 4NLHA 4Q9RL 4NC1E 1FV1B 3GS7A 5KSUA 1H19A 1H3TA 2EINB 5JHDB 3SDCB 3D39A 4J7RA 4ETQA 2PCFA 4WJ5B 5AAWC 1YECL 4MMZB 5CJQL 1EAPB 4XZUB 2NNRA 4P23B 5HYSG 1OSYA 2K70A 1WZMA 4LIQE 3Q7JA 4MJ6A 4G1EB 4FTVA 4WFFE 4IK7A 2HVJB 1UXSB 1Q0YH 1H5BA 2ZX5A 3WKMH 1K5NA 4E0RA 3BEVB 4A68A 5I6XB 3KPRE 5J8OA 5MEQB 4ZMQA 3QWOA 3QUZD 2CO2A 1H3GA 4Q2ZA 5C0BA 5FHAL 2PP8A 4XNQA 4ZNCD 2FNBA 4HBCL 1C16B 2P49B 3CZUB 2J73A 5L7XL 1AZZC 3ARRA 4ODXB 4R4ND 4C55A 5JPNC 2CO3A 2DWYA 1JPFB 3FRPB 4M6OH 1AQDB 2DQ6A 5HJDA 4ORZC 1SF5A 3MFFB 8PAZA 1R34A 3VWJD 1X3DA 5KSBF 2WTRA 1JTTA 5B7FA 5BVPL 4UTAH 1AQHA 5KW9L 4ZX3A 2E7LC 3MBXH 1A9EA 3ARGD 1N4XH 4LF3A 1CFBA 3ME0A 4V33A 4M1DH 1RPUA 1D5ZA 1AGFA 4PJXA 4B9IA 2G4EA 3UJTL 3MUJA 3WFZA 5ESVB 1ADWA 1L0YA 3NSDA 4TLTA 4Q6IA 3TH4T 1XH3B 3UTQB 2VDML 2EXYD 4R7NB 5HJ3B 3B43A 4QRRE 4E41E 1SHMA 1XF3B 3UJJH 2VSCA 4YPGA 3OZ9H 5CIPA 3O6LH 1EUTA 6PAZA 4PHZA 1KELH 2PKDA 2WQ8A 3O3EB 3IBEA 4CADB 3P30H 4ELMF 1LDSA 4BZ1H 4GG6E 2C9PA 5EOCJ 1C5BL 2IGFL 5H37G 1T83C 3S34L 2A74C 5E2TH 4M00A 1J5HA 5ACZA 4A2GA 4NJAL 5GGVL 1NUNB 4KRNA 5BRZE 3VB9A 4JFDE 5C71A 3D25A 4HS8H 1XGQB 5CHNA 4BFRA 4E9WA 4Y5YB 2X89A 1KY6A 2NY5L 1OCWL 3CDYA 4Z7UE 2DQDH 4Z0XA 2WBKA 1TVBB 2P8PB 4QJ5B 2ZOLA 1XR9B 2UY7B 1AZCA 4K2UH 3VXQA 5AAPA 4JR9L 5ICYB 2XBZA 5JXED 2IPTL 3IJ8A 1JXFA 1SXZA 3H9HA 3X11B 2W91A 1VAHA 1U8QA 3HMWH 2WVTA 4UU9A 1KPUB 1XTMA 4GJTB 4N2FA 1ZLUH 5JOFB 3S36H 5CGBA 4YVNA 4HH9A 4GRMA 3DARA 3FQWB 2JJWA 3BW9A 2YEZB 5E0QA 3L5WB 4MNHA 4R97C 4NHUA 1A9VA 1QVOB 1GJUA 3OG6B 3A22A 1U3NA 4QKXB 3TV3L 1QBAA 2WXQA 2ZCZA 5FGCB 3P3RA 2LV4A 1HH6A 4ZMZA 5MHSD 4FS0A 1RULL 1E28B 4XRCA 3ZT7A 2GEEA 3GO1L 5J9PB 5CEXB 3UPAA 3VGAC 5JW4M 1AYRA 5A43C 4XP1H 1HIML 3DX8A 1I9IL 3RWGB 2OK0H 3CQQA 2OKMA 4APQB 4ZQTA 1JE6A 4HXAH 1GGIL 3D18B 3IVKB 2CJUL 2OMYB 5E8OA 4XMTA 3GHBL 1C5CH 3KPSA 3MJ9A 3DHMA 2MQCA 3W39A 5MERA 4LGPB 4PJDF 1AZNA 4N0UE 4QF1B 3GI9H 3NGBC 2ISDA 2WQUA 4P06A 2VC2B 4FHKA 3LN9A 1CK0H 2BC4A 2NY4B 4R7DB 4XMWA 5FO8B 4BEIA 5ENWA 2BSEA 3QDMD 1CFVH 3ZDZF 4FFYL 4KKLD 3WNOA 1WTLA 3GZOA 2BVPA 4HQQH 4S1RL 1LDPH 1FYHB 1BQ5A 1IAOA 4P2OD 3QHTC 3L5XL 3SYCA 3U6XS 2DIBA 4B7LA 3IMSA 4XCFL 3P4MA 3DUUA 2VSKB 5B1AB 2DJUA 1BVLA 2E8YA 4ZFGH 1FYTB 4RMBA 3DX4A 4HKBB 4YXLH 1HYSD 2HCZX 4QYOB 5AVWB 3Q1SH 3FHQA 5HDQL 4H25B 3W1ZA 2X38A 4PP1C 3KXFE 2QL1A 3V9EA 2YR3A 1YUHA 5ICXA 1RLWA 2KT6A 2Y7QA 3ZQXA 1CBJA 1IEAA 2FE0A 3WIHH 4P57A 2J8UF 4XMKH 3FF7A 1C12A 2IPKB 5J7CC 1DSYA 1RD6A 3GPSA 3GXTA 4NCDA 4XBMA 3RUGF 4MS8C 2MEJB 1AE6L 2DMHA 2ED7A 4RFEA 1VA9A 5G55A 2K78A 3EYSL 3BKMH 3QUYA 5EU3B 1IKFL 4WHCA 2C4FT 2R2EA 2MNJB 3BAEH 2F53D 4KTDH 1A4KA 4EVNA 3EXJA 3SCMB 5I28A 4NWUL 3W9DA 1L6XA 3PJSB 3NJLA 3EYVA 4LCUB 3S88L 1MPAL 5IREA 3T0ED 3BX7C 4GBXD 1CICC 1BQKA 3PQYB 3RILA 3H6AA 1RVFH 3FFCA 1SQ2N 2A6KB 5D1XD 4N0CD 2NY5H 4L1SA 1P2CA 2YPVA 3PAYA 3BIBX 1YY9C 4ENED 1UD4A 2ERJC 3NCMA 3CFCH 1WFNA 3SPVB 1QEXA 4PWEA 5I1GH 4YWGL 3U25A 3POCA 4L48A 1AS6A 1OF0A 4OIFA 3QZNA 2JB5L 5GSRA 4L29A 5DQJB 2HMID 5L2JA 5CKGA 2Z6FA 2IAMA 1AZUA 5I8CB 2Y36H 3DJZA 2P44B 1S7SA 1T6BX 2YXMA 3G08A 1SNRA 5GGRA 2PR4H 2D7OA 6TAAA 2WO4A 4F37F 3UMNA 2Z4QA 3BVTA 1DUZB 4X98B 5EU4A 1OB1B 5L0QC 1R5WB 2DTSA 3GMLA 1NC2B 2X4RA 3Q5TA 4D94A 3PNRB 3C5ZA 4J12A 3TVMD 2CDGA 2VDKL 1VCBC 1WUNT 3RE0A 4G80B 3TA3B 3L9RA 1ES0A 4YEEA 3VGEA 2CBQA 5KVFL 4LL1A 1KCVH 4GAFB 3T4YB 1E40A 2RCSH 3NTCL 2XZQH 3FK3A 4URKA 4AVJA 3N43F 2Y2TA 3LKNB 2YMOA 2Q8BH 3T2NL 5LBGA 3B2VL 3MLWH 3NEXA 5MENB 3GSRB 2ZYIA 1VSCA 3L45A 2YBRA 5C0EA 4YX2H 4ZUSA 1PVHA 1XVSA 3KPLA 2IDTA 2ZOKB 5G4MA 5E7FA 2BVTA 3BKYH 4K55A 3SQOL 3EHBD 4JFYA 1FCCA 2J1YA 4K5PA 1P4BH 4QWWC 4YK4B 3T4AC 4F1SA 4GIPD 4X42A 3N1FC 3RJOA 5M7QA 3PJNA 4KK9D 1R9FA 4LOFA 4DN4H 4IYKA 4FLRA 2VLKB 1I8IB 4G9FB 3IRPX 4G1MB 4GRWE 3QUZC 4HJ0C 5DTFA 5C2BH 1ONQB 2IF7A 2ZKXA 5FYLE 5IVNA 4ZUVA 1MAMH 1CGTA 4OZHA 2IADB 5AZ2H 2OYPA 4ZMNA 5KVDH 1IV8A 3HE7B 4F80A 3WLBA 1TU2A 3L5XH 2XJLA 5JMOC 3HBZA 1SHSA 2WQSA 4MSWB 3QEHB 4MMXC 3FUHA 4HETA 3WO4B 3WELA 1MHPL 4DVBA 2VN7A 3MOBL 4DUVA 1OARL 1B0RA 1QUNB 4XNXL 1INQB 1XHHA 1GGUA 5LG6A 2IMMA 4Z77B 5D70L 2V5MA 3WUZA 4PRID 5EBGA 2XG5A 3VACA 2A9ML 1BPVA 3G04B 5ESQA 4BDVA 4YXHL 1O6SB 3O6KL 3NRPA 1ZT4A 5ALBL 4KDWA 4X7DC 4WIQA 3QUXA 2CJTA 2XLLA 5DMGD 2VLMD 1NANH 4JREC 5J6GB 2WVSA 5JIHA 4PJIB 3RB5A 3DV6B 2FT8A 3LHPH 4EI6A 1N0LA 5AG8A 4UTBA 4LO9A 1BMWA 1M7IA 4JPWL 1AGCA 3NCBB 4QYAA 3UTTE 4P5TD 2RTTA 4MB4A 3MV7E 4XCEB 2P5WD 1J5CA 4NCC2 4L0ZA 1WBXA 2AC0A 2ZWYA 3BAEL 4PRIB 4DTGL 1S9XB 4Z3EA 1E4XL 2ICEC 5BOZG 2HLFD 1R24A 4J6RH 4YSRA 3SKOB 2Y6TE 4DN3L 3ZQ9A 2R69H 4FG0A 1BGXL 2KUTA 3MJ7B 4PBVC 2H8PA 4U3SA 1CD8A 2B1HL 4QY8A 4XP4L 4IIQC 4I0PC 2Y22A 2NLJB 3MA9H 1A3LL 2V3EA 1ZIBA 1FZJB 2WIIA 3AJ7A 3DMMB 3LY6A 1YMHA 5E4AA 1KN2H 1WZ1L 4L8BB 1BFSA 1GPOH 3DKHA 2YLKA 1PCSA 2GAZA 3DV6A 3T6VA 4JBSA 1TJIL 5F0MB 4NFCA 3CSYA 3AG1B 4NOFA 1HKLH 1RZGB 1J0JA 2BCMA 4X6CE 2VZ3A 5ELIA 2B8OT 3NPZB 1YEIL 2VN4A 1CF1A 2YXVA 1QWUA 2EIMB 1S7WB 4YZWA 3G6AB 3L1EA 5TK4A 2AGJH 4AJYV 2AVFA 3WHXA 1MJ8L 1ZJBA 3TNMA 1MCFA 3NAAL 4E5XB 1J8KA 4PJEA 3UZEA 3SE4A 4GAAA 5I5JA 3FQWA 4HWBA 2PXYA 1YN6A 2WPGA 4HJUA 1AZBA 4NI3A 3LVTA 3LKRB 4EPSA 2GEQA 4H8VA 1LMKA 4XN1A 4NAJA 4PJDE 3RNKB 1JPSH 4RFNC 4YHOH 3ULVH 4MCYB 1GJWA 4UBDD 1IBHA 3MV01 1TEGA 5T1MA 3WTXA 4HWNA 1EEYA 3HG1D 5IB3B 3VD4A 4L23A 1ZT1A 2CMRH 2PYED 1FORH 3MYJA 3TEYA 5CEZE 1NCGA 3FL7A 4XN9A 2OZ4H 5EU7C 2ITDA 3EH2A 5DYOA 4L4JA 5AZUA 3V4VH 4DGYH 3GMMA 3C5SB 4S1QH 4Y9CA 1CMOA 3ZGIA 3MBED 2HVJA 4KX8A 3G6AA 4LRNH 5CD3B 5TE7H 4Z7WB 3MCG1 3STZB 1KTRL 4I9WE 3A4FA 1P1VA 5F7NC 2B2XL 5IJVA 2GJRA 3BLKA 3MGOB 4XXWA 4FFWC 3L3JA 4ETYA 3IMUA 3KD4A 3W2DL 3LKRA 4WAFA 1DQDH 4J4PC 1HILB 1NICA 3HI6L 2YPLB 4LHUA 1I9JL 2VR8A 3VXRD 5MP6H 2FJGA 4DQOH 3RKDC 1AKJB 1J0HA 3D4YA 1PGRB 2H2PC 4Z7WA 2BVUA 2VDLB 1ET5A 3JV5A 2EO7A 2MCPH 3RWCB 4PW4A 1JVLA 2VJ0A 4NFBA 3QJFB 4PY8I 3HLAA 3QFDA 4FLQA 1OLZA 3QR0A 2DM2A 5EEXA 4G82A 3RI5F 1HHGB 3LAFA 1LM8V 5DXWA 4R8WH 4MNQB 5ERWA 3ZZ1A 5T5FH 2VGLM 1DEEA 3MRHB 5ICXB 3V0AC 4JMXA 5KBLA 3G5XA 2XN2A 4TQ8A 4ODUB 4PLKC 3HMXA 2KLRA 4JG5A 1MNUL 3SDXB 2JKXA 2JQZA 4BZ1L 1B6DA 1IZKA 1PAMA 3OKEB 4QOKA 4AGPA 5L2KD 4IJTA 1WAPA 4P49A 4JDEA 1RIVL 4ZAKD 5I1KL 2PO6A 2DPKA 5E00B 1S7UB 1JERA 2FB4H 4NHCL 4CC4C 1ZTXL 1L9QA 3IU4L 3V7AG 1JL8A 2BDNH 2R2EB 2PCXA 4G5AA 2X4UB 3BDYL 3LCYA 1SFHA 2AANA 3DIFA 5D2NB 4LSTL 2R69A 5CSGA 3PDOB 4MJIA 1A5FL 4JL1A 4NKOB 4HUCA 2VXQH 5J4MA 1IAIL 5J5EA 1I8MA 3DYPA 5I5MA 4U31A 5T1LD 4FXKB 4KGLA 5I66B 4M7LL 4Y16C 1T2QH 4WO4C 5HHVH 1OT1A 3Q3GA 3HPLA 4GAGL 4OZGF 3BAWA 2ESVB 2DLFH 4RVBA 2ESVE 1KCSH 3MBWB 3GSOB 1A2YB 5EEZA 1QA9B 1BAWA 3WLWD 3IAQA 4H8HA 2B1AL 3KGRA 4P2OC 5JIQA 3PGDA 5JIDA 3R4DA 2F5AH 4QHNB 2ZJSH 2WWKT 1U6AH 4MQ7A 1FAIH 1UZ6F 4JY5H 2H9GB 5IEHB 3SKNB 1S9KC 5TQ0H 4Y8DC 3ARGB 1RZKC 1WZKA 2W88A 3ET9F 1J9SA 5A3ID 5T33H 2V17L 3KEHA 4M93C 2VT0A 4AZUA 3MBWA 1UEMA 3VFMA 4JGUA 1UEYA 1J1XH 5DUML 1EO5A 1ES0B 1OPGH 4JFEA 4J3UA 3TVMA 4PW3A 4I7ZC 3W57A 1HU8A 5C97A 5FCUH 1RCYA 2HH0H 3FRUA 5EU4B 1MCKA 4Z95L 1FORL 1BYNA 2X05A 4ZXBC 2ZF8A 5C0EB 2Y5QA 3DWTA 4GKZA 4MAZA 1MFCL 4AQAA 2XFXA 3K2MC 2E9BA 2OQJB 4JUTA 2OZ4A 5BV7B 3GF8A 4XNYL 2X40A 5JMRA 1JK8A 1SEQH 5CSZB 3GZQA 1WD9A 5LN4A 1EH9A 1INEH 1VACB 1F8TH 4X8XA 1BF5A 1EEZA 1FFRA 1DANT 4M02A 5EEVA 4YC2C 4GUPA 4U1NA 4JPVH 2DYRB 5C9KA 3NZ8A 3TBWA 1H9VA 4GKNB 4IHOA 2IADA 3HRPA 5IV2B 8CGTA 2JB5H 1QFWI 2C9SA 3BVDB 2ENYA 1HHHB 1ECYA 2VW4A 3K1KC 3N85H 2W9DL 3CPLB 1JZ8A 1E4HA 4OZIA 4GRMB 3NFNA 1K2DB 1ERNA 4U6XA 5KAQG 3HG1E 5K59F 3FT3A 4HFWA 2J3SA 4HULB 2IH1A 2YOCA 3AY2A 2EVHA 2VDOH 4R84A 3BDXA 4BGLA 3D2TA 4EN2A 4QHUB 2ICCA 3PV6A 3CHQA 2CK0H 5F7EH 1ZPUA 3ILQC 4LRIC 1P7QA 1MJJB 2JJSC 5E9DD 1QPPA 1B4JL 4B0MB 2JB6A 2P5EA 4AYDC 1IJNA 1S78D 3MUY1 4U1HB 5J13B 1KEGH 5HY9B 2AEOA 2DOCA 4PJBB 4JGJA 1BYOA 2UZYB 2E46A 1IC5H 3KG5A 3SCMA 2XWBB 3D85A 4JO5A 2FK9A 3ZZQA 2ZP0T 2J8HA 4UDTA 4KY2A 4X9HA 2R1XA 2H1PL 4OKDA 4KJWD 3BDYH 1FNGA 2OMTB 2Q7AA 2Y1YA 3MLTA 2FLBT 2VOTA 3KPRB 1RJZB 4M4PA 3TO4D 4YBHA 4LU5L 3DRQA 4M5ZH 3FTUA 1JF1A 3HCVA 1KJ2A 3BZFB 4PJ7B 4IK6A 1IAOB 4BUGA 1KBVA 4L3EA 3MJGX 5D1ZB 5IW1A 4TSCH 5DWPA 1I1YA 2ZUQB 2ICES 1M42A 2YGVA 3K6SA 3OXSB 4DKFL 3FTWA 4HCFA 4M9PA 3WE6B 1U8IB 1FL3B 1BMGA 5J89A 5FHBH 1X5AA 2B0SL 1W0YT 5D70H 1ET7A 3QYMA 5I1DA 2UXGA 4GMTH 3T77A 3TNNB 1CIDA 1DVTA 1M4KA 4L1HA 1PFCA 3AQDA 5ID1B 3UO1H 4XPAH 3STLA 5I18L 3CUPB 3DO7A 4B95C 5HHNB 5ESQB 4QO1B 4BDVB 4ZX6A 3WS6A 1OGPA 4LLAA 1J10A 4M7LH 3F3HA 3WEOA 4K0OA 3TBTA 2YHGA 4RQQA 3QHZL 1YEHH 3DX8B 3OM3B 4WW1A 5TF1H 2AQNA 1D5XB 3BPNC 5DSCA 1XB3A 4UBDC 4FQ2H 4Y1TA 4U4BA 3D69A 1H5BB 1E5YA 2Z65C 4M7ZB 4MJID 1NCIA 4M4RA 5SWQA 3ULVD 2FTAA 1F6FB 4NO3A 1L7IH 4GUOA 4C58B 3SE3C 5SWSA 1JV5B 3K4ZA 3EH1A 4XOCA 4FL4C 3IT8D 4HALA 3KWXA 4ZQKB 2UZXB 4N9GA 4LSSL 4EZKA 4U3SB 5D7LD 4KDTC 5I1AB 5HGAB 4OUUB 4KPHH 4FG4A 2Z35B 3ETSA 3JXAA 3O3AB 1E5BA 5KVFH 1KACB 5HDRA 5T1KA 5GGVY 4AIEA 1YYCA 3EJSA 2COQA 1T2JA 4ODWB 4XVTL 3UYOD 1AGBB 4G7YL 4PRHA 5ITBL 1WA1X 2WLMA 3BWUC 1BZDA 4YHIA 4DVBB 5IBLC 4H26B 2IWEA 5EIIG 4ZOBA 1L0XA 2ZUQC 1TZGL 1KLFA 4XO9A 3RWEA 4XNYH 3OSVA 4ODTH 4UV7H 3WSQL 3WMQA 1XGZA 2NY7L 5KVFE 3STBA 3VXOB 1AJ7L 3E6HA 2ZYSA 5C0CA 1OB1A 5E1GA 3ULVC 3VXRA 4OF6A 4M7KH 5F21B 3MBEB 5IG7B 3GMOA 4L4TE 1A6PA 4POZC 4XBEH 2QQNH 3I50L 5EFIB 5F9JB 1JIBA 4PREB 1JNNH 2Q76A 4PLJC 3CXFA 3US0A 5FUOL 4U1KA 3BO8A 4F15C 5B1JC 4CILA 4I48A 3LRKA 3MACL 1RZFH 4LLWA 4WGKA 1FNAA 5IFAH 5BVJA 2JKLA 1CXFA 5D4HA 5FGCE 2LFGA 4YUEL 1QWHA 4K8RL 3ZDWA 2QVMA 1EAJA 5KANI 1AQKH 2P42B 1J9CT 3V6OC 2H1PH 5CGYC 5GZNA 4Z5RB 4UQDA 2JK5A 2VISB 1UB5A 1XIWD 2A83B 1RZ7H 4BRJA 1A1NB 4QXGH 5CF3A 4JO4L 3OMAB 1EGJL 2E7MA 3VFMB 4HJSA 4JZNB 5BO1H 3GIVA 1E2VA 4FQHB 4HQQL 1D7FA 4UWQB 3BESR 3HN8A 4IBYA 5K5YA 1EFXA 1N9PA 4ZS6D 1I1RA 3ESNA 5C07B 1ZSDB 2XZAL 2V7HB 4NWUH 1ADQL 4Y4FD 3ZDZB 7FABH 1WBYB 3BIKA 3UYRH 3ARUA 2VL5A 1HXKA 3V95A 1BXXA 2QV4A 1UH2A 4BWWA 1GL4B 1V3JA 3QXDB 3S5ZA 4YPJA 3IDIA 4F92B 1QA9A 4PWHA 2RIKA 1YEJL 1CFQB 2W59A 4OV6F 2ITEA 2B20A 2ADGB 2WXNA 2WLLB 3GQFA 4LSPL 1QEWA 1VPOL 4OLVH 4MMXB 1ZS8B 5JHBA 1AZRA 1QR1B 5D8JH 1FP5A 1VEPA 1HOCA 5ID0B 1K6QH 5KSBE 1PY0A 5HYQA 4IEFA 3QJOA 3CZEA 1MNUH 3EG9A 1DANU 2VDNH 1KBWA 5DJ0A 5IP4A 5DO2C 3KPLB 1XF5A 3IYLW 5JHLH 3WS6C 3MR9A 3NJKA 4HIIA 4ANVA 5LGJB 4Q6KA 4TL5A 4OV5A 1DFBH 3QIWD 5EUKB 4TSBH 2ESVD 4IRSA 5I6OA 4XPFH 4QPEA 2Q8AL 1P2CB 1KBBA 3PY9A 4HMDA 1IGML 2A9NL 4QRBA 2OXGB 5IBTH 3ZMEA 4XP1L 1F4XL 3QCUL 4PB0H 1NUFA 2GSGB 5MEPB 1BLNB 1NSNL 1QI3A 3ERXA 3N50A 3OZLA 4QRAA 2F61A 3S97C 5IQ7L 1KTBA 2A6DB 3WI9A 5CD5D 3BJ91 1I7TA 3T8XB 4N8PA 3QPXH 2BHFA 1HTYA 3AUVA 1M1SA 5JDJA 3VX1A 1SMDA 1JGEB 3CFEA 1MF2H 4NCC1 1J87A 2F08A 1P5UA 1KJMA 1R0AH 1PG7L 4PRAA 1G7IB 2WM0A 2N7BA 4PRPD 1RPKA 5T5NG 4PCSA 5FYJE 4AGOA 4WO4D 1IEAB 4FGMA 5H37H 2QVTA 4OV5B 4QGTA 4JK0D 2LVEA 3P0VL 4M6MH 5FW8A 3ZT5A 4WK4B 1TTCA 1DJSA 1F18A 4UIMA 1A7RL 1AG6A 3QIWC 1IT9L 3MOAH 3KPPB 4R9HA 2WO2B 3L08A 5CJXC 4ES8A 5T33L 2OXGA 2WWNA 3BDBA 3QUXC 4F7KA 3H53A 4QRUB 4LRIA 1D5MA 1EK3A 1NCAH 4IRZH 4TNWF 3QA3A 3B2MA 3EYVB 1PL3A 4YHYC 4AV0A 2KLSA 1YNKL 1GGBH 3T2LA 5EG6C 1UVQB 2YQ3A 2FAUA 3L4XA 5EC2A 1M3JA 1JXGA 2CLZB 2H3NA 3L13A 4JW3A 4BZ2H 3VXUB 3IMWA 1M56B 3VFTA 4HOXA 3RTQA 1VFOA 2GIMA 1GY1A 5I6PA 2GTZB 1RURL 2CHWA 2HFEB 4ZPTB 3QO1A 4ZUUB 3HE7A 4B41A 2FZ3B 1FFOA 3CC5A 1OSZB 3DO3A 4JPWH 1ND0B 1U93A 2H0PA 4MCZA 3WFBH 1RFDH 4AK2A 3WCYA 3QI9D 4DFHA 4KHTH 3T9WA 1ED3B 3SDDC 3VQ2C 3U4KA 3IF1B 3Q3GB 2J1ZA 3ARVA 3RG1C 4YUEH 2YMTA 4HJ0D 1CG9B 4Y19B 2VC2L 5BZDB 3ZDYE 4IRJA 1FNEA 3FTZA 4O2CB 5KW9H 2X70B 2FB4L 4MNGA 5JYMA 2IOOA 4LFHG 5B1CA 4FZEH 1VERA 2Y7NA 3CVDA 3A5VA 2CKBH 1X5JA 1PD6A 3DBXB 5JUEL 4JN2A 2CUAA 3ULVF 4BUQA 4M7KL 5ID1A 3PLYA 1H9DA 2D73A 2C3HA 1YYML 4NSKB 4O51B 4LOUD 4TVPH 2Z34A 2A77H 1NAMB 1NTDA 1PZBA 4X4ME 5CGTA 4KJPD 4LLUB 4WSJA 5DK0A 4FI8A 1HSAB 4FQPA 2RMNA 4AE1A 3U4EA 1MREH 2IAMB 2R2HB 5I8CA 4H2CA 3EXLA 2J8UE 4LAQL 5A16B 3FT4B 5IHUL 1AD0A 2XQYG 4LL9A 3SKUD 3N2JA 15C8L 1BAFL 4I77L 3B5GA 4M43L 2BS9A 4DO5A 1N4XL 5D7EA 1M9SA 3AGVA 3KLLA 2XZQL 3O41B 4RNRB 3SEPA 2QADB 4APQC 1R3LA 3KH4A 4GAJL 4PJ9C 3O8XC 3FUMA 2V2TA 3LQMA 1UOKA 2DM7A 1VIWA 4MYWB 2WP3O 3PNWB 3RP1A 4YSQA 2J43A 4BFGA 1MLBA 1R5VA 3T0BA 1UM6H 3UTPE 1JG9A 1M7IB 3GRGA 4ANUA 4YDNA 1EZVX 1WO2A 1BBJA 2BNRA 1I3GL 3HZYA 3FCSA 1FWXA 1USZA 2IFFH 3F5WA 5BRZD 3VTAA 3QWRD 1LO0H 2AJ3A 1AY1L 1HJCA 1HINL 4PTUA 1FGNH 3PJSA 3V4VL 3CBKB 3FQ1A 5EMYA 2VWEE 4DGYL 3RLSA 3GM0A 2K6ZA 1ZOXA 2OMXA 2VDRH 3DHJA 4K9EC 4Z7OF 2NY3B 3KYOA 4OM0L 5KYWA 4X5WA 4GP8B 3QIUB 3VXSA 3HC3L 2Q20A 4Y1AA 1KJ2H 2XKUA 3BKCH 3MJ7A 1PQZB 3QG7H 5GGRY 2Z7ZA 4PUBH 4CC1A 4WNQA 4U0QB 5MEQA 2C9QA 3GMNB 1PZ3A 1L4IA 4W81A 4HD9A 3UOAB 3W0WB 5HBBA 1WWBX 1S9XA 5BS0E 1E8XA 2YKLL 3QZPA 5IB3A 1DL7L 4LDOB 5CM1A 1KEGL 4RQQB 3T2NH 3TBTB 1XCTB 2AXFA 1OAUL 1BFVL 4CSTA 3MBEA 5IMOA 3B2DC 1ML0A 1R5IB 1NCAL 4LDLB 4PRPE 5F8RC 2B59A 3J2PA 1NGYA 1HQRB 3Q8CA 5I6XC 2R0LH 3V6OA 4XP9L 3AMLA 3NA9H 3W5MA 1MHHB 1WICA 1QSFB 2XI9A 3GJEB 2BSDA 2HRPL 3C8HA 3NRFA 4Z95H 3UTQA 1NH6A 1MN4A 2VUOA 3A67H 3QEQE 4NS0A 3TNMB 4JPKL 5CILH 4E5XA 2L8AA 1KB9K 1U2YA 4O9HL 5DJXA 2EILB 1C1EL 4KJYB 4OZFB 1DVFB 1AGFB 1S9YA 2GBUA 3BE1H 2Y69B 3PWVB 3K91A 3T2PA 3VI4F 4NGHL 4OI8A 3BZ4A 3J7HA 4OQTL 5D7JD 5DHVH 5E8NA 5L4JA 4Z7OE 2EAEA 2UVEA 3MLYH 4OGYL 3OJMB 5E5MA 5J1AA 2WP3T 4ZUTA 2VLLB 2NY6D 2EYSA 3QJHA 5IB4A 4XVUD 3WJMB 4E41A 2GC7C 4QRRA 2GIYA 4ZZKA 2IV9A 3MREA 3B2UD 4J28A 3DURA 4MRBA 3WE6A 2B59B 4RZKA 1NGYB 3ATFA 3RWFB 3S3PA 4FKEA 2XTJE 1GZQA 3ZGHA 1HCVA 4X8GA 1UD6A 5JA8B 2AMUA 6PCYA 3RKDD 5IFHL 2XVGA 1NC2D 4FE9A 4AYGA 1N8OE 4H20H 1U4FA 1TU2B 2X4NB 1DVXA 4GAGH 1JZIA 1WAAA 1XIWB 4ADJA 4BBWA 1G87A 2AEPH 3LNEA 2MOGA 1ZHNB 1JNLH 4PGDB 3TBVA 4MA8H 3RNQA 3BHBB 5K69A 1CPUA 2QJDA 4XNUL 5T3XD 4GG6B 4LFHD 4QNPE 1HYRC 5EORH 1CN4A 3V0FA 3HI1A 3RVXC 2YZ8A 2KPWA 4HIHB 1X5KA 3CU7A 2XPGB 4JFUA 2LOEA 3GDCA 1QEWB 2EKSB 3QUXB 4JDVB 2HVKB 4PJXF 1T7XA 4DT2A 2AI0H 1XIWC 2DZEA 3B9AA 2NR6D 3AG3B 3ESUF 3LQZA 5E8PA 1UZ8A 4ACPA 4JFHE 4FTVE 2WJ7A 4OJAA 3TA4D 1PEZA 2NY6B 4D0CA 2WD0A 4PJCA 4Y88A 1KJ2B 4F7EA 2B1OA 1GGCH 1FRGL 3UC0H 3BLPX 4Z3JA 2VZ1A 4GFTB 1FLRL 2Q7YA 3RX9A 1HSBA 1UA6L 5HHVL 4W9FC 1Z5LB 1ILUA 5DZ9A 2XN9A 3IJSB 4ZMTA 2HH0L 4UQ3B 3VNZA 4JM2A 3PL6D 4E9TA 7FABL 4MLSA 1OIOA 3SGJC 2QZQA 1UM4H 4PMEA 1F3JB 5T1KD 5TK2A 4IOIA 5TE4H 3MRHA 3ZKQD 3EOBA 1T89C 3HS0B 1UACL 1DBJH 1ZHBB 4GXUN 4MS6A 4OJEH 5LNGA 3X14B 1U2CA 3ARFD 5I71C 2DQFB 1SXAA 1CCZA 3L16A 1E7UA 1IGJA 1NFAA 2ZX8A 1HOEA 3GIZH 2Y4SA 1T2XA 2BNQD 1KCVL 5IROA 5IJVB 3V6BR 2IH3B 4IS6A 4JDTL 3U9PH 3UEZA 1B0GA 1ZS2A 2R23B 2XETA 4P04A 5BQDA 1RUQH 1SHWA 4EN3B 1EWHA 1NGPH 4YWGH 3ZMNA 2NYYC 4QTFA 4NUMA 4A04A 3BKYL 3O6FC 3WU1A 3GB7B 3LYRA 3S0PA 2AQQA 4NO2A 3QT2A 1XGRA 3GSUB 3TYFB 1GXEA 2PN5A 2IJ0C 4Q0XH 4LCWD 2GABA 2F58L 3MLRH 3PE9A 3UACA 4IMKA 4Q9RH 4IU2A 1JZGA 2F54B 3UP1A 2WB7A 4JQIL 5I1JL 1LXMA 1QFUH 2V4LA 4XBEL 4Z78B 3ARGA 4ZPTA 1C9SA 5AEAA 2J25A 4WK2B 4XB8A 2ZCHH 5E1HB 4XGZB 1Q72H 5DUPH 5FO9A 3HI6H 5DZAA 3UDWA 3VWKD 1XBRA 2EE9A 4GQRA 4H44C 1MAJA 4NHCH 2CLZA 4LVNB 3OJDB 1A66A 4PPTA 5TDNA 1JXKA 2CIIB 2M26A 4TQEH 2C1PB 1G0DA 1UM5H 3BPLB 3KPRD 5IMLB 5IMMB 5A40E 3DGCR 3O0LA 3EFOB 4X6BA 3L6FB 4NKQB 3FRUB 3VDAA 1EHLL 2OR7A 3BP6A 4W9IC 5DJ2B 1BHGA 4QXGL 4DCQA 2QGEA 3FH8A 5CZXC 3RTLA 3RIFF 1BEXA 4ZAKA 5DK3A 3AMKA 3LZNA 4YDKL 1S4IA 5SWSD 4Z76B 3WIHA 1MCHA 4OAWA 5J3HC 3CLFH 5E8DL 4NYLB 1SUHA 1ZKAA 5EV7A 5SWQB 2FX8L 4N2HA 1FDLH 3BO8B 3KXFD 4KZ0A 5FO7A 3UTZB 4JRFA 1KYUA 2CQVA 5B1KA 2ENSA 3VVVA 3SDYL 3RWCA 1MIEL 4YGAB 2B9AA 2YA2A 4XCNB 4QRPA 3VI4B 4L1DA 1PTZA 1E9QB 1SM3H 2FYVA 4J3OC 5E8EB 1ZLVH 1IVTA 2CJSA 3OPZH 1F11B 3WGUB 5GGSB 5TTRA 2OM5A 2V9UA 3IWVA 2EXWC 4LQFL 1KGYE 4UM8A 2YPVH 1CL7L 4F2FA 4R83A 4WKXA 2V7NA 4K71C 4P9HC 4MZ2A 1U8IA 2QQLH 2GTWB 2VDNL 3TN0D 1WIOA 3H7BA 3S88H 1KN4L 2V2TB 2OAAA 5CZXD 1NGXB 2FDBP 1MCWW 2AQSA 5MENA 4HWZA 1BZ9B 3M7OA 2ADFH 4YIQA 3QEQA 3TFKC 4O00A 1XB8A 2IV8A 4M6ML 1FNLA 3T6QC 5HHNA 4BH7A 4EI5B 2QT6A 3O11B 4O02L 1A6TB 4IRJB 1KZYA 2AK1H 1RXLA 2D9QB 4Y5VA 2AJ3B 1OAJA 4K7FB 1VFBB 4YHNA 3TT3L 2QVIA 4UQ2A 4PS4L 3BFOA 4FDWA 3VI3A 5INCB 1IC1A 3KGSA 3LMJH 3M1OA 2IOMA 3MRLB 3NIGB 5FF6A 1RZ8A 1QO3A 4QWWD 4MBOA 1EJFA 1I8IA 2IQAA 1NMBL 3B7TA 3QPXL 1S7XB 1GA2A 4QKTA 4WEBL 3FONA 2R4SH 4PYGA 3MQIA 3T3MB 1PG7X 4NSKA 4KJWC 3GSXA 5DUBA 4ZZFA 1MVUB 1FO0L 1WWWX 4YL4A 4ENEC 1F4AA 3WTVA 1CBVH 3H2WA 2XWEA 3VFOB 4V2CB 5GRVL 2R0ZH 4G8FB 5ETUB 2OMTA 4P0DA 2H1XA 1ACXA 2VDNB 4HWZB 4LXFA 3MODH 1AHKA 1DZ0A 2IQAB 3I2CH 5EU5A 4G9FE 5IJDC 1JRHH 1JZ4A 1WFOA 5HHOD 5B39A 5C09D 4ETQB 3BAJA 4ODVL 2PWFA 3CSTA 2IDQA 3P11H 1IM9B 2WGNB 3FU7B 3QUGA 2PXYB 5E2JA 1QPXA 4LCVA 5GJSL 1WHPA 2PPFA 2K0RA 4ZFFA 1LK2A 5CJBA 4WFGE 4XO8A 1QLEL 2P7TB 1OO2A 3W0WD 3PNWA 4IMKC 4DP6X 2BP3A 5F3BA 2C3VA 3QZWG 4K4KA 2ZAHA 5EO1A 4LLDB 4S1DC 5HI3D 4F33B 2ED8A 1V8HA 2GITA 1JWMB 4Q2ZB 8FABB 4MB3A 1IIIA 3FKUS 3ZYOA 2YWYA 4AH2B 3MLSL 3R8BB 2YGQA 1A6AB 4M5ZL 3P3UA 1P1ZB 1BVNT 2Y7LA 1QRNA 1TYJA 4R6UA 3CVHB 3HLKA 3HW7A 1V7NH 3DYOA 1FNSH 4PJFE 3LH2L 5HYSA 4B97A 5IR1B 2VTFA 1CL7H 3RWHA 3QDME 2BK8A 1TOXA 5T8IA 2DWDA 5GIRA 3ZDZE 5B38G 2XC8A 3PGFL 5D93B 3NZ8B 2HRLA 2JNZA 3QQ3A 3TBWB 4G42A 4UIKL 5JHDA 4KKQA 3CLFL 1XF3A 4NNXA 5I0VA 5C0JA 4MLIA 5I0YA 2CRIA 3JV4A 4NFDA 3DRTA 3V0WL 1JFQH 5HJBA 5CCKL 1TCRB 2EVJA 2DB8A 2ZUUA 1EIBA 4PJ8A 3BZEA 1E6OL 4J5VA 2XTJC 3BD5A 1ECZA 4HC1L 3EJCA 2GY7B 2CBMA 2WWMD 4TULH 2K7PA 4UAOB 2DI8A 2Z31A 4G7RB 3GUTA 1NKRA 1GVIA 2I7SA 4EI6B 1C5DA 4U1MA 1IAKB 5JPMB 4I3SL 1XGTB 3GHEL 4OFQA 3MJ9L 1ORQA 1RZKL 1ED3A 4QLRA 2GJ6A 4Z3HA 1JNJA 3AWGA 3I6GB 4K3EH 2P5WE 1XF4A 4ZD3L 1T4KB 3K46A 2FRGP 4CMHB 1U3YA 2MNUA 3MC0A 1OSEA 1IGFH 1IBZA 1QNZH 1SXBA 2H5UA 4ZUTB 1I8KB 1KV3A 5SX4I 3Q6FB 4TQEL 2X1QA 2DKUA 3VXPA 1DVFC 4BFKA 3TCLA 4DF9A 5DDHB 3UBGA 4GG8B 3E7JA 1JUFA 4NZTH 3BD4A 3DOIA 1GIGH 4Z3TA 1GZQB 3BZ5A 4JRXB 4Y4FC 3FB8B 3CNKA 3I6GA 4G7YH 4MJ5A 4IIQA 3AQZA 4XXCA 2X0UA 4WF7A 4QRPD 3VYNA 3WIAA 3LEXA 1JZHA 3BYYA 4GT7A 4O4YH 5JPMA 1HXMA 3AREC 1E50A 1SY6H 4ABWA 2ZPKL 3CXDL 2WYZA 3GBNH 1FL3A 4R2GB 2OA9A 4GI8A 2YD0A 2CG9X 4EN3C 3PXJA 5AB2A 1VFUA 5H94A 3VX0A 4WWID 3ZDXE 3V4VA 4OKVA 4GO8A 3BKCL 1KJ2L 4NQXB 4OLXH 1FIGH 1F3DJ 5A2FA 1P4UA 1XGQA 5C3IA 4OD2A 1RJLA 5HHMB 1SN0A 3F7QA 1IMHC 2XYBA 1U3HD 2VDRB 2YXWA 5HHME 1J1PH 4QOKB 2HKHH 3B7YA 4JFVA 5E8PB 4F8OA 1W15A 1ZWIA 3HFML 1HNFA 1Z32X 1HHIA 3GSNL 1JZDC 1BJ1H 1BMZA 2GBAA 4KH9A 1BX2A 1SVCP 1UWEH 2BIOA 3IDIB 2WXRA 3S4SG 1NWPA 5JOFA 1A7OH 3GWJA 3LRGA 1T80A 5C0NC 1ZEAL 3REVB 4DKTA 3DI2B 3PABA 4FXKA 4FQXB 3R19A 1RZIB 5FOJA 1MCOL 2ICWB 2VSDA 3O9WC 5D1ZC 5IVXB 4O2EA 1CXEA 4K9JA 3QWRA 4PS4H 5E2WL 3MXWL 1XEUA 1I9RH 3MUGA 1G5AA 4I48B 3ZDXF 5I30H 4PUBL 4Y19D 2XTSA 2ZUVA 3AW5A 3DOSA 5FA4A 5I8OH 4WTZA 4ZS6C 5LO7A 2X53A 1G7LA 4XPTH 2NR6C 3HAEA 1OGAB 5SWZB 4DUXA 3MACH 3LV3A 4IDLA 3RVWD 5F89A 2Z4QB 4BFOA 5FLVA 4MA3B 2HFFA 2HTKD 2AAVA 1Y18B 3L3KB 4MD0B 5DD5L 4NO0D 3V4UH 2O5XH 2VLRD 3C8KA 4IKKA 5E5RB 1YPZE 5JUEH 4FD0A 5DD0H 5EZJB 2EO9A 3ZSTA 3PL6C 3U9UA 2B4CC 3IKCB 4XVOA 3H9ZA 1F86A 4P46D 3QCVL 1ZGLA 3K72B 1T5XB 5KBDA 5D7SH 1NBQA 1MG2C 3I9IA 3UTOA 4NUJA 3JV6A 4KK8C 1OPGL 1IFRA 5AW7B 1T20A 4JZJA 1MCCA 3KCPA 3TJEL 5D2NE 4CRPA 4F7CA 4FXTA 4JFOB 1UC6A 3EO1B 1SJMA 4MNGB 4E9SA 3FN0L 3C08H 1X44A 1WLHA 5LDUA 3RUGE 2M83A 1E3FA 2V7NB 4P05A 5JHMA 4Z7IA 3EADA 2NX5E 4BA0A 4ZNEE 2CA4A 3D30A 3PWNB 5BJTA 3B9EA 5D4IA 4JN2B 1MY7A 2PTVA 1PJ9A 3H1ZA 1TLMA 2WKGA 1JMXA 2DWEA 3ECWA 2LW3A 1JVKA 3VRJB 3ZTCC 1MWOA 5DEGB 1O6VA 3VI3E 1HCZA 4EXKA 4ZFOL 3KPSD 1DJYA 3BKJH 1NUGA 3BH9A 4KUCF 1M71B 3V0JA 4DH2A 2CO7B 3OB0H 3GSNH 25C8H 2R0KH 1MELA 3MRFB 3U7AA 4OFYA 4KBPA 3OZ9L 1UWEL 1IGTA 1WG3A 2DEWX 4Y2NA 1G7PA 1MW3A 3O2DH 3KYNB 1OALA 3IDMA 3TH3T 2J6EA 4J39A 2WSDA 3GSOA 1FAIL 4V1DB 2EDFA 2AEQL 3LS4L 1YEEL 4QRSB 4XAWH 1LEIA 4LPWA 3ML9A 4NM4H 1P5VA 3SPGA 1XO8A 3KWTA 4BQ8A 3DX7B 2GUOB 2UZIH 4BJLA 2VQ4A 1MUJA 5KWYC 2CDFA 3VA2C 4JMNA 2LFEA 4PP1D 4OW6A 3PUUA 1VFAB 3GSVA 3RPKA 5L4IA 3OAUL 3BP4B 3UBXB 4A2DA 5JZ7C 4N85A 1YPZA 1A7QL 2OV0A 3CFTA 4PMFA 4QT5A 3ARDD 2R2CA 3S35H 2LLGA 5DEGA 1HH9B 5L9DH 4K7PL 1J1PL 3GRWA 1PSKL 2FECI 2ZPKH 4L5FL 3VD1A 4WLCA 5DJ0B 1WFMA 2BS71 3OXRB 4XN5A 5IJKA 3D39D 2BFVL 3H2QA 3LHAA 2AJXH 3AABA 4TNVK 5I1HL 3WJJA 2DI9A 1ROCA 2EDXA 3HZVA 2DQGL 4LZKA 3AROA 3CBRA 4OZHB 1H6TA 1P6FA 4NENA 4RLDA 5IMMA 1WZAA 2IDFA 1YYLL 3IU3A 2DL2A 5D71H 5DJZA 4GKNA 4XXWC 4PGCB 2IGLA 3SPIA 3VSUA 1IT9H 1E4WH 4KZDH 3C5JA 3HI5L 3QNZB 2PMZA 5LGHL 1CTMA 1A6AA 4N0FA 3MXWH 4QMEA 1NFDF 5B8CB 3QHFH 1FL5B 3JQOB 4XCYB 3LEVH 3GSRA 4WGWB 3F7YA 3JYCA 4WW2C 3T1FB 5KOVC 1WBXB 4H8WH 2LQRA 4F9PC 3HAEH 5EZPA 2RHEA 4HKZA 2X70A 5EDXA 4Y4FB 3LPWA 4PTUB 2BDNL 1RI8A 3GSUA 3TYFA 4AQOA 1CUOA 4HFWB 4N6RA 2AQ3A 5TE7L 5I1IL 4RMTA 1JGUL 7TAAA 3BEWA 4JM0A 5HVFB 1X4ZA 4FFZL 4FMFA 3FRPA 5EOTB 3TEWA 3P40A 5KYYB 4M3KB 5D93C 5EU5B 3WXWH 2CD0A 1GYCA 5DEFB 4MDJA 5DD6B 2H1LM 2J1KA 5C86A 1BZ7A 3FMGL 1UOLA 3WUWA 3T0EE 4DNLA 5HYJD 1Z5LA 3B1TA 4KKZA 2VJ8A 1KXTA 3QQDA 4R26H 5DS1A 4H1LA 5GSRB 2ITDB 1CDJA 4D0BA 1MRCL 5AAMA 1OP9A 4DW2H 3UZVA 1CQYA 4PN6A 5GS0C 2H3NB 4KX7A 4D9QE 3K81A 4RMSA 2CR0A 2BVOA 1AGEA 3QEGL 5GZOC 4HJGB 3QWQB 4ZO9A 4X98A 1OTUD 1EO8L 1HL8A 1INEL 3EJTA 5HI4D 3MOQA 4OFKA 4WJ5A 1OSZA 1N59B 2G75A 2OFQA 3RA7H 4XNQB 4M6NL 5DR5H 1A4CA 3CPUA 4WI0B 3PJLA 5D5MB 3F58H 1LE5B 3DJTA 3PWVA 4OLYH 1K5NB 3S35X 4I87A 3O45B 4G6FD 1K85A 4ZW7A 3GSNA 1A7PL 5HGHA 1DBKH 3AU1A 3UO1L 5HI5D 1IE5A 4NQEE 2OMZA 1VGEL 4FZ8L 4NX0A 3AY4A 3EYOB 1B4LA 5FGBA 4N2KA 2ZKHL 4RWYH 4PBWD 4WVRA 2IANB 2R1WB 1MEXH 3FT0A 3FULA 1ZHLA 3MYZA 4QAWA 5EZOL 1YEJH 4X4XB 5GGSA 3RFZA 4XVJH 2Y9RT 3LRSB 4K3HA 3G6DL 3BGFC 4NRYA 3AG4B 2HFGH 5HDOA 3IFLH 3VCLB 3WY1A 3ZMRA 4N0UB 4WWKC 1IAKA 1C5DB 2D0FA 3PWJA 4U1MB 4V11A 4CNIB 4AM0A 5F1NB 3WL9B 5DSCB 4Z7UF 2X1WL 2AV7A 3F6IA 4HPOL 4X6DF 3QUMA 1KV7A 2GI0A 3II1A 4Q9BA 3RVVC 3B9KB 1XL4A 3BN9C 3F6LA 4PJBE 1LO3L 1KDJA 1QYGL 1T4KA 2MKLC 3CHSA 5KBKA 2VLRE 3L7EA 5T3ZH 2ERJB 5JORB 1P69B 1U8MB 5GGUA 4AIOA 1EAPA 2EE0A 3VG9C 5CU9A 3ARQA 4DKEL 4MMYB 2M2DA 1BD2E 2EQDA 4I3RL 5HGAA 2P26A 1GAFH 5E1AA 1CR9L 1I31A 1ZVSA 1LNUB 3AY4C 4IRZL 1LJMA 1NSNH 1GR7A 3F12A 1CICB 2QHLA 1D9KA 1OARH 4K94H 3K8KA 3BZ4B 5DRZA 2F7IA 4IIQB 3B9KD 4LCWA 1DO6A 1CDCA 2FQEA 2WKOA 3L7EB 1O9ZA 2R4SL 3WFCL 5GJTL 4U6HB 4Q8BA 1KPVB 3PWPE 1HDMA 2KKQA 4G8FA 4Y9FA 4J3XA 3SKNA 4LASL 4KOCA 5C0IB 4OIAA 1B0WA 3OKNB 5I24A 1BVNP 2KQNA 2MQGA 4QHMA 1JHTB 1DQKA 1I85C 2NZ9C 4MD0A 5GGSY 4AE0A 5KS9B 2XOTA 2JIXA 3GMPA 2HJLB 4FQXD 4RBPK 5F88A 3MLZH 1WGOA 4AGNA 5FUOH 5DJCA 5E94B 4AENB 3EFDH 3BW9B 2OJZH 1AC6A 1Y6MR 1XGTA 4WWOA 4JPIB 3LZRA 4KHXH 4MB5A 2DQJL 2D7MA 2WKOF 4BQ6A 2FH8A 4I1PA 3O0RL 3UYRL 1QBBA 5AW9B 5C0ND 5DRNA 4Z7NF 1OAKH 2A9MH 3HNTL 2RAMA 2ZOTA 4YDIL 1ID2A 2IH3A 4KPHL 2QEJA 1S7VB 1T5XA 4WDIB 4Y5XA 5DCCA 2NYYD 3EBIA 4Y5YA 4N25A 3NJIA 5CLTA 3SE4C 3FXIC 1FH5H 3MA7A 4I3SH 5EC1B 4X80H 4IOSD 3L3HB 3HC2A 3KLKA 4E9QA 4URTB 1M05B 1HHHA 3RTQD 3H9HB 3X11A 5HSFA 5G4NA 4YO0B 5IB1A 4GRWF 3FUIA 1Y6KR 2SEBA 5B4MD 3NMEA 1DYZA 1TVBA 2P8PA 2UUDH 3HAEB 3HVDA 4DWHA 4FQCH 3TX4A 2DWTA 5BRZB 1WBYA 2ADJA 2XV6B 1K3IA 3VGAB 4XN4A 2ZSWA 3GO1H 4F7EB 1OCWH 5C7XL 3SPVA 4JDTH 1E4XI 3LXCA 1YLBB 4W9HC 5F97E 4AQAB 4UM9A 4MJ4A 4HC1H 1N5YH 2OJEB 3T0EC 3I9GH 1CT8A 2G60H 2VR4A 3C87A 1Q72L 5GS2D 4ALAH 2WAQA 4PY7B 4KRPC 5JQIB 3C8DA 2V9RA 3KHOA 2G5BA 3H9SE 2XIDA 2NZ9D 3GSWB 1OE1A 3G6JB 4LKXA 4X6BB 1LD9B 4PB9H 4KMTL 2GYSA 1YSOA 4GG6A 3H3PL 4ICWA 2UY6A 4NQQA 3U82B 1RJCA 4AEHL 5ECJE 2JF1A 5F0JB 1R3JB 3C60A 5AKRA 1J88A 2C9RA 3AAZB 2HN7B 1G43A 4NNPH 5F1SA 1FVDA 4NQUA 1G0XA 3DSFL 3MV9B 5FM5O 4FNLH 4RGMC 2P1YA 4OIBA 3RTQB 2PW1A 1OAYH 1QFWH 1CI3M 2ZXBA 4G9DB 4XWOD 5A16A 5BV7H 1MH5B 2ICEB 3IFLL 1V55B 4XPHH 4A67A 1UGKA 1RK7A 4MXWH 5A2AA 5A2IH 2EZ0D 3CMGA 4GW5A 1QFHA 3CZNA 1ACZA 4HIXL 4I4WB 2DQCH 1MHEA 3WV0A 3TBYB 2WLIB 5IHHA 3C2AH 3QORC 4TUJA 2X10A 4EDXB 1B9KA 2W9EL 4UB0L 1NM4A 1I7ZA 2PYFB 3HN3A 4QRPB 4CVWA 4NUGH 4M3HA 4HKBA 4QYOA 1RUAH 4JFEB 3O0RH 1U8KA 3IXAA 4Y1SA 2CPUA 5T3ZL 1JGLH 3JV0A 3KPPA 5EBWB 5I6KA 2MCPL 1CFSA 1CVRA 4KKLC 4LSVL 2OULB 5F0LB 2HZHA 1VGKA 3QH3B 4P4KA 1L7TH 4YFLF 4H88L 2E6QA 5EZIH 4KC3B 5MENE 1GAFL 3D0LB 4Y5XC 1MZZA 3SSGA 4QRQA 4GQPH 1X5LA 3QZOA 1AIFA 2IXQA 2WJ5A 3EIFA 1EZSA 5EHFA 3TCXA 4HUXA 3KPRA 1T0MB 3FCTB 3TO4A 5DD1L 5I2IA 4QRUA 4OD3L 4WU7B 4X99B 5DJAB 1PZ5B 3UTSE 4CA4A 2R29L 3MJ8A 3EDEA 4B9PA 1RUKL 3EJYC 2HG5B 4UDTB 4X9GA 3TJHD 3ZRSA 4X9BA 4FNUA 2CNYA 1QR4A 1P0SE 4PRHD 4L1TA 2VZUA 1JWSA 1XGRB 3CVHA 3O2WL 4S0HA 3D09A 2R1WA 3KJ4B 5ABZA 1A5FH 3AM8A 1JYNA 3EO9H 4OJDH 3HCVB 4YK4C 2VERA 3TEXA 1OTUC 4BH8B 1MCQA 5E08H 1TVHB 5B7MA 3MMEB 5FHAH 5CILL 1S7QB 2R83A 4BE5A 6FABH 1J0IA 1BXUA 1NGZA 4Q14A 2R8SL 3ESOA 3PV6B 4ZX4A 1Z9LA 3VXSE 1A6UH 1S78C 1KXHA 1KG0A 4YFLI 5IQMA 5F70A 1MFBH 2HT4C 3ZTNH 4YE4H 3GRWL 3BQUB 5HVHC 4A55A 4HG4J 3O4LA 3VMOA 3KR3H 3C08L 3IFNL 4GKLA 2DQEH 3IBOA 4P2QD 5IUSA 3UG4A 1M3IA 1CDGA 3O8XD 4LLMB 2BNRB 1EFQA 4S2SB 2GQHA 4AXWA 2XXFA 2BNRE 4WI4A 5B39B 3GEWB 2NXYC 2EDRA 4FLSA 3AC0A 5GGUB 3OKYA 4FQ1L 2EH8L 1NCBL 3AU1B 4GEIA 5CBEA 1F58H 4OLEA 1AR1B 2EYRB 2IQ9H 4J3OH 3VSTA 2WKLA 4AKOA 3TONA 1X9UA 1INQA 5LN8A 4U2YA 2BXZA 4R2GD 3IM1A 2Q2LA 3CBJB 1NFDB 4QRTB 1ICTA 1OTSD 1UOWA 2GITB 1NCNA 5IK3A 2Y36L 3FONB 5E2VL 2DLGA 2IDSA 4HMCA 1BZ7B 4HEME 4JG0H 4LEEA 4OZHE 2EEAA 3V52L 2CR3A 4HWBH 2AS5M 2IFFL 4UNUA 5EIQA 2H26B 3D9AH 4AM0Q 2H3KA 1NAKH 1DZBA 3SQBB 5HYSB 5TE4L 3Q9QA 5AVZB 4F3FA 2F8XC 5F7YC 2HRGA 2CLRA 4G70B 1I85A 3DNKA 4IDJL 2C3GA 4GXUM 1K4CB 3BQVA 4OLUH 1UASA 2ZOKA 4HIQA 4HHWA 4P8QA 5KSAB 1F90L 3I74A 4KO7A 3U0WL 4L3FA 5DJXB 3ROOA 7PCYA 3EZ8A 3O8XB 2IPTH 2NXZC 1AY1H 1QRKA 1XGYL 1HQ4B 3S9DB 3OMIB 2BSSB 5C8JB 1NIFA 4OBRA 1LK2B 3Q2VA 4KY1L 2Q76B 5TQ2H 4RESB 4JN1H 2XNAA 2VSMB 1IC0A 5TGBB 4PVNA 3FRPG 3HUJE 1L9NA 3OKLB 2VMCA 3UCQA 3ZT6A 3T3PE 1B3IA 1GOFA 3ZDYB 1XF4B 4FQCL 5FV2A 3KS0H 2KC0A 4JDZB 5CZVH 4ZMOA 4JL2A 4D8PB 1R3IL 2R4RL 2DTML 2WCSA 4UNIA 3L3OB 3CK0L 1ORQB 5C6TL 4HAKA 4X7EC 1YEKH 5F3HB 1E4WL 1A4JB 3K4DA 4IKJA 4EAEA 4WFED 3ALXA 1VZIA 2FBOJ 1BZOA 1JNLL 5D96C 4FNRA 2F15A 2UYLB 4AIZA 1WQVT 2EO1A 2H41A 3BEVA 2WVUA 4RRPA 2HKHL 2R29H 3MKGA 4ODWA 4NM8L 4FERA 1I8UA 4FYSA 5FYJU 4U49A 3LZLA 3MV8E 3EH5B 3LH9A 3WKQA 3WXVL 2GSIB 1FVEA 1U3HA 2VO8A 2AXGA 2J6WA 3P3SA 4LMQI 3UZQA 4DP9X 1EZLA 3RHWK 1AGCB 3DRTB 1IAIH 1G7QB 1VENA 1YMME 4I3GA 4BWUA 3IETB 4ZMXA 4DEWA 2WN3A 3VD5A 3EOAA 3HMXH 5DMIL 4HP5A 2X6MA 4HUMB 4C47A 2NRDA 3FT2B 1CT8B 3HRZB 2D9CA 3M1BA 4QDGA 5JORA 1U8MA 2FJFB 3L2LA 2OTUA 1S9YB 4PLJD 1X5ZA 2NYZA 4Y1AE 4XN2A 4A7TA 1P84K 1TTAA 2WGXA 3V5HB 3KBEA 1B0RB 2AK4B 1MJ8H 1CGYA 1OTTC 3D4ZA 3CFBA 4UYQA 3U2SA 5LVEA 1SBSL 1SN2A 4CN1A 1QKZL 3X2QB 4LPUA 4PRHE 1GHFH 1OWWA 4PLNC 2BOLA 2GUOA 3LZFH 4XNDA 3BSZL 5AB1A 5DUJA 1KXVA 3ES6B 4U0RC 2WSPA 4Z7VB 5DJ8A 1RHHB 2GJ6B 2F1BA 5GS0L 1BV8A 4APQA 5EC1A 2AI0L 3GXIA 5CZKA 3ISWA 5IVOA 2KMWA 5IB2A 3OR7A 1WEJH 3B34A 3ULUL 2YWZA 5ABDE 3VFUB 3QRGH 4KZEH 3A6OA 1ITBB 3I9PA 4XTRD 4JRYA 4HUUB 4KHTL 2AJUH 4YGVA 43C9B 2CK2A 1A3RH 3H3KA 2IDCA 3ZHNA 1G7JA 1JZ3A 3ETTA 2VDLL 4ODSH 2XHNA 4WKZB 4G8IB 5CWSB 1G9MC 1NDGA 4I1RA 1R46A 2YAHA 4BKSC 3RWDA 4Z0XB 2QBWA 4OLZL 1E4XH 3LS4H 1NL0H 5K9KA 4MQXD 2DM4A 3FUKA 5DYOB 1IGIH 5E00A 3F85A 1CLYL 4U7SA 2CCLA 4I2XE 1R3IH 1EJOH 1BM3L 2ZSVB 3BGFB 3RL2A 3SDCD 1HWGB 2DYSB 3LEYH 3RAJH 4K71B 3RY6C 3ZQWA 3VH8G 3JWDH 5TE6H 43CAB 4MBRA 5AYUL 3QJQB 1XCQB 4GOSA 1T1XB 3B83A 4J4PD 4M7JH 4N8VA 4LGRB 1DQVA 3VXQB 1UB6A 5LXGL 3LV3B 4XO4A 3OX8B 4J27A 1T89A 3ILDA 4NZ8A 3ZKXB 5BS0A 3SE9L 3Q2CA 1JGVH 2J8OA 2ICEA 3ZJAA 3KYMA 4F8QA 3FU0A 2PXYD 2P3YA 4N90E 3D9AL 3FBQA 1UWYA 4F5CE 2W80C 3V0IA 2BP5M 3UBFA 4JO3L 2WNKA 4U6HA 1TENA 3SDXF 1NDGB 5HPOA 2E5EA 4PJHA 3QIWB 4L3EE 2DWSA 2EH7H 2GVYA 1JK9B 2NUPB 3BVUA 3NT0A 4ALAC 5IHLB 2OP4H 1JRHL 4DP0X 1XAUA 2F54E 3QA3B 1KULA 2YEVB 3A4AA 4MA1B 3FFDA 3V6ZA 2E47A 4WUKH 4J1UA 3MKKA 2IAND 4PJGB 4AZ8A 2QFPA 3C5ZB 4ZTOH 1AXTL 4ZK8A 1DQDL 2WBJD 3GB7A 4EDWH 2O61A 3CAFA 3MRIA 1F6AB 2BPBA 3BQUA 1AHWA 3CSFA 3HPJB 3MRRA 4B0MM 5DEJA 1A0QH 3B2PA 4PI2A 4EN3A 4XCNA 2VH5L 4EUPG 1HZKA 1TTRA 5DQDH 3N40P 3IJEA 3FSWA 1ZV5A 2DEXX 2OW7A 5I8KL 5EF3A 2B15A 5C6TH 1K4DA 3HMXL 2J56A 4IU3B 4JQVA 1IBDA 1QYGH 1A47A 1KPRB 4HBQA 3LKSA 1DUYB 3L3DA 3F01A 5A2KH 4OCRH 4HUNB 2C4XA 1BIHA 3PGCB 5EU6E 1LMIA 3SKJH 1PFOA 3ARPA 3SDXE 2VRKA 3MJ8B 3MDJA 4GMSH 1SLXA 3NCJH 4PJBA 5F6IC 5F96H 3U2IA 5IK3B 3OHXB 4U1NB 1HEZA 1WFTA 1IKFH 3QUZA 4WI5A 4ZTPL 4F7TB 1XGYH 4WU5A 3IKKA 4G11A 5EOQH 1BXAA 5M95B 4KQ3H 4Z0BH 1QKZH 1BQHB 1KDIA 4OZ4A 5FYLL 3RVUC 1KC5L 1XBDA 1IGIL 2E7HA 3KGUA 1MVYA 5BMFL 1CLZH 5TDNB 3OLEA 1E5AA 4F7PB 1YJDL 2R1YB 3ZR6A 4ZO8A 4JO4H 5BRQA 3QUMH 4LSPH 3JVGC 4KAQL 1CFSB 1OAZH 3TV8A 3UTTD 2YUVA 3NP3A 3SE3A 2VR5A 5DI8B 3N5AA<