3JWNG

Complex of fimc, fimf, fimg and fimh
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
144
Chain Sequence
ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding/cell adhesion
total genus 21
structure length 144
sequence length 144
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnG00
4BUQA 3RFZA 4XOAA 5AAPA 4AUYA 1TR7A 4AVIA 5IQNA 3JWNE 1N0LB 2UY7B 5FWRA 5JQIB 2JMRA 5ABZA 5LNGA 4CSTA 2WMPB 4J3OF 3MCYA 3ZL1A 5F3FA 5F2FA 5LNEA 1PDKB 2W07B 4AV0A 5FS5A 4XO8A 3BFQG 4ATTA 4AVKA 3JWNH 4AVHA 4AV4A 3JWNG 3ZPDA 2J2ZB 4AUJA 4X5QA 2XG4B 1KIUB 3BFWA 3ZL2A 1QUNB 3SQBB 4AV5A 2XG5B 4XOEA 5FLUA 4LOVA 1UWFA 2JTYA 4J3OH 4CA4A 5IQMA 2VCOA 4XO9A 1ZE3H 4J3OG 3ME0B 4CSSA 5FX3A 2UY6B 4XOBA 5AALA 4X5PA 4XOCA 4AVJA 4X5RA 5AB1A 5CGBA 5IQOA 4X50A 4XODA 1N12A 4AUUA 1KLFB 3BWUF
chains in the Genus database with same CATH superfamily
1OGAE 4U3CA 2FHFA 1IB5A 4BK5A 1ILSA 3CN4A 2JQMA 4XT1C 3LDBC 2DQDL 1BD2E 2ZCKH 5I71C 3DK0A 1FNFA 3SBWA 1V5JA 1YYML 2GC7C 5FM5M 4JO3L 5GRWA 4WWNA 4N2MA 4P2OD 1IFHL 1G6RA 4LDOB 1TCRB 5I0XA 3WJJA 2W80C 2UY6A 3H9ZA 4O2EB 4TRPL 1FHGA 3EYFB 3TO4A 1YG9A 4N2EA 3B8YA 2R8SH 3CXDL 3HFFA 4NQDB 4X98A 1NMBL 1XFPA 3ZKXC 2HLEB 4HDIA 3N43F 2NY5L 4MWFB 5GGVH 1EVUA 3FUJA 4FLQA 4NNPH 2EIJB 5FA4A 1DCLA 2BZCA 1DANU 3RPIB 5C2BH 1PKQE 1HEZA 2NY2D 1L9NA 2Q8AL 5CMAB 2YUVA 2ZOKA 1I8LA 1WWAX 3OR6A 2ZKHL 2F8OA 4PJ8B 4RRPM 3W9EA 1DVQA 1ILUA 4FN0A 5DO2C 1TVBB 5CIPH 5E8EA 5KAQF 1UGKA 2EADA 3V52L 1GS8A 3LQZB 2VE6B 3QFDA 3U6RB 2Z1PA 4H1LG 3X3FH 2LAAA 2VLME 4X6CE 4JFDA 2BVPB 3GMLB 1T3FB 1YMMA 1G43A 4M8VA 3ZY7A 2A1WH 3CFDB 2GIMA 4GG6A 4R3SB 3QCVL 2J5LB 4JPIB 4E9QA 1R19A 4YEEA 5K59F 5EBLB 1JNJA 4B0MM 3S96A 5HYJE 1KY7A 3UJTL 4JFQA 4B6ZA 1EFXA 3P4MB 3RFRA 1AHKA 2F5BL 4ZZKA 4L8CA 3O6FB 4DHLA 1B2YA 2CDGB 1HTYA 4JDVA 4R96A 4A7GF 4LHUA 4B53A 4F9PC 5DS8B 5H94B 5GZNC 4MJJA 4ODWB 2OMNA 5E95B 2BSTA 3WEBA 1E30A 5ILTL 4KJYA 2WGNB 2QFPA 4S1RL 3O3EB 3OV6A 4Q7DA 5ICZA 3BOVA 3FCSA 4NOFA 1DDTA 2DQUL 3LIZA 4RZKA 4GI6A 5EF2A 3ZHKA 3PDDA 1I8MA 5A7EA 2ZCHL 5IFHL 3D0AA 2WSKA 1WDAA 5D1ZC 4HEME 3WGVB 4APQB 4DP8X 4ZMYA 5D1ZD 2EIDA 1KYOK 3BKJH 3EYVA 3FTSA 3EO1A 4X4XA 1J05A 4ENZA 3SPVB 4O02L 4DAGL 5GXBB 2YHGA 2C9XA 1YAZA 2DJSA 3L3GB 3KLHC 3LZNA 3CHXA 1CDYA 5EU6E 4NHCH 2WNWA 3ELQA 5GRJH 4A55A 1IQDA 2KDYA 3MNZA 4NO2B 1UH4A 4P59L 1QBLL 3AUWB 1MCQA 4N2FA 1RXLA 1GGTA 1WIUA 4KMLB 2K4AA 4R8WL 5L6YL 3IF1B 2R29A 3CDCA 3M1OA 4XCYB 5HXMA 1A6VH 4U1LA 2G9HA 2QHRH 3D4YA 5AKVA 3VD2A 5F3BA 2XV2A 4HMEA 5SWSA 4LLVA 1WFJA 1HSAB 3RAJL 5CINH 4ELKA 1ZA6B 2DQFA 4UT6L 4XP4L 4FFYA 1KJ2A 1S9XA 4BJLA 3DGCR 1Y18B 1GC1L 1XR8A 2BP8B 3BMVA 2WXNA 4D9QE 1TQVA 2HP4A 2VMEA 4EI6B 1NWPA 2XWXA 3CZGA 4LKCB 4H2CA 3LZOA 3CFJA 3FO2A 2NY1D 3ECBB 4ABUA 5D1XB 1XB8A 1ZEAH 2HUHA 1JD9A 5AVZB 2OJZL 3FQUB 3IGKA 4G1MA 1OSYA 2YWZA 1HEHC 2A2QT 3MMEB 3T9WA 3T1FB 3WEMA 4QF1A 3O2DH 3O6KL 4EVNA 1B0IA 4JM2C 2BP0B 2GCYB 5C07B 3A6CH 4DETA 3WAJA 3P73A 1HH6B 1ZE3C 4RSVA 4UQ9A 5CU9A 3LX9A 5EA0L 1KTBA 1DSYA 1KZYA 3EOBA 4O2CB 4ANVA 1II4E 3A3YB 4WFGD 4G43A 1JF6A 1GPOL 2HKAA 3UP6A 1MVUB 1EPFA 1J12A 5IFJA 3RDTA 3N2JA 3UAEA 2WKGA 5DMIL 5AZEL 3KLKA 3BZFB 3FN9A 3KDMA 3BESR 1AQDB 5DLLA 2OMXA 3BH8A 1IKNA 3CVHL 4JPQA 4GJTB 5KS9E 4M1GH 4PJXB 5K1JA 1MRCL 2HLFC 3MUY1 1BJ8A 3V4PL 2HLFD 2WZ5A 5B1JA 3WYRA 1QLEB 1IGIL 3Q6FB 4OLZL 1L9MA 2W9EL 3D05A 2VNCA 2VW4A 2DLIA 1KC5L 1GC1C 2FLRT 3HI6L 3VGFA 4FL4B 2NDGA 3LV3A 4QAWA 4H0GA 5CGYC 2RR3A 4PJ5A 4JHVA 2C8NA 3H56A 3PXLA 5D6CB 3O2VH 5BRPA 4KITB 4R90L 3FO0H 5JHLH 1G84A 3RURA 3OVUB 5SWZA 2EDQA 4ZBJA 2R56L 3QUYA 4DN4H 3GTVA 3A6OA 1M6OB 1QYGL 1T1WA 1ZHLA 3HC3H 5DD0L 5C97A 3WTYA 2BY3A 1Z5LB 3HG2A 2FH6A 1LWJA 2Z7ZA 3NQKA 3FB5B 4PR5B 5J7CC 1JMXA 2JKTM 4XPTH 5HHOA 1GZPA 1SOQA 1OP5H 3VG9C 2ZXDA 2WCGA 3T3MB 1CR9H 4L3AA 1ESOA 1R5IB 2VJXA 3BP7A 3NIGE 1RZFL 5KVEE 3P69A 2YD2A 5HGBA 4HUXB 5IVZA 1Z3RA 4AZUA 5J6GB 5F44A 3ZMRA 2R0LH 4ZOCA 1UWXK 5GSVA 5E2WL 4PI2A 2WXLA 4P5TA 4XNZB 5ES4B 3AVEA 2NUPA 1URIA 4TQHA 3NIFF 2YGOA 5DT1H 3KPSE 3F6JA 4B9YA 4OZIF 2DBLH 1XT5A 3U46B 2XY1A 3P77A 3FFDB 1XF3A 5I0YA 4NQTA 4FMFA 2X42A 4XNQA 1HNFA 3X2QB 2XG5A 1VCAA 3Q2CA 3G5VA 4LHJB 5AVSB 1NUDA 3EG9A 3KXFD 3CBJB 1ONQB 5DFWH 3F7VA 5BXFA 4FNUA 4FG2A 2ITDA 1H19A 4LLQA 1AO7B 4NUGH 1AGBB 2QVIA 3AREB 1AGEA 3S88H 2CKBB 4NI3A 1T7WA 5IV2B 2W94A 1MAMH 3STLA 1ACXA 3IDNB 3AABA 3UBXA 1XR9A 2V9TA 5JW4Q 1YZZA 1WJ3A 3KCPB 5E9DB 3TIDA 1T1XB 2J43A 2Y2YA 1A6UH 1MIMH 2WZPD 2VN4A 3PGDB 4NRXB 4XAKD 4G7VH 1TZIB 4WHYG 3KWUA 4O2FB 2F5AL 5I8CB 2F1BA 2IV9A 4CVZB 3V0IA 2EO1A 4IMLA 4M1CC 3T0AA 3E2HC 4M1CD 1BQ5A 4P07A 1ID2A 3EDEA 4Z7VB 5L2JB 1AKJD 4NQUA 5B1BB 2UYLA 4JVPA 2ADIB 3N6YA 4X5XB 4BZ2A 2WIIA 3RWIB 3ZDXF 4FYSA 4CKVX 3T6VA 2UZPA 2O72A 1TITA 1U8MA 1OK8A 2J8UB 4Q6IC 4S0HA 4ZX6A 4Y16C 4KTGA 3O2WL 3TESA 3RVUC 4JFFE 2XA8H 3WHXB 3UTSA 2L7JA 1YYCA 5KJ4A 3WUWB 1JXJA 2J5WA 1SYVB 1THAA 1PD6A 4I2XB 5FGBC 4EDWL 3KD4A 4XMZA 1SXAA 1CG9A 1J10A 3RYMA 1EEQA 1ODUA 5C08B 5I6NA 2A6JB 4NM4H 3WXVL 4TUUA 1T5XB 5EZJB 1PY0A 3UYRH 4WZ9A 4OLVL 3QDMB 1DL7L 3NCJL 1AHMA 2IXQA 4JAMB 3HE7B 3LCYA 4Q97A 1FE8L 4PVMA 1TKWB 1NAKL 1WBXB 5M7QA 1A9BB 2IJ0C 3A4FA 4LSTH 2MCG1 4KQ4H 3B6SB 4K3DH 3QO1B 4NFBA 2IV8A 2B1HH 3EOTL 2DKMA 3ASNB 4FI6A 5GZOD 2FJFB 1Q9OA 4IYKA 4IJ3C 1XVSA 1R17A 1X9LA 2F6AA 2NYYD 5FYKD 4BGLA 4LEOB 1HZKA 3P2BA 1U8KB 3Q1SL 1WAAA 4OIIH 2JJTA 5KVGE 3PV7A 1BBJA 4BFRA 1UM6L 2ITEA 3D2TA 3O9WB 5IB3B 2Z6FA 3EBAA 3EZ8A 2EZ0C 4WKZB 1Q9LB 4R5VA 3MXVL 2EZ0D 2OZ4L 2P47B 4OZFG 5E8OB 5EBMB 5CUSL 5AVVB 3S34L 4JY6B 4N2OA 1N3NB 1MAJA 2NZ9C 3PL6C 4HSQA 2DY2A 5INCA 3U0TA 3DOIA 3H9SA 1G7PA 3PE9A 3PL6D 4UTCA 3RY6C 4ZMNA 5DSCB 3K7UA 1U3YA 1FRGL 1PZSA 3O3DA 4OZHB 2QSCH 2P8MA 1O9ZA 4QXUL 2GBAA 4PLJC 1RLBA 4KO7A 1NTDA 4AZ8A 3QUHA 1AJ7L 5J9PB 3FT0A 5L7XL 3U2SB 1GL4B 3GFUA 2WV3A 3N0PB 3FDWA 4U6HB 4G72B 1JSYA 5EZOH 3QEQE 4D3CL 4Y2DB 1T04A 5AW9B 3FUIA 5HI4D 1UJ3B 3RZWA 3FHAA 3U2IA 2NY3B 1YEJH 3MRPB 3TH4T 2YGVA 3RIFK 3VH8A 1IAOB 1KTDB 5EZPA 1A14L 3FBQA 3IFPB 3MV9D 4FQCL 2YBGA 4F92B 3ULVF 2VO8A 1I3GH 2N7AA 5BVPL 1N6QL 2DV6A 3L4WA 3HCVB 1U3HB 3FBKA 1UA3A 4NGHL 1NA8A 3FRPB 1ETZA 5IFAH 5J1SC 1AC6A 3L16A 4P46A 3HHSB 4MSWB 4FKEA 4CSZA 3TBSB 1ZLDA 2D8KA 4XXDA 5K69A 4AJWA 3GJEA 5ESQB 1PLGL 1I1AC 2H6PB 2SODB 2FNBA 2VGLM 5DEZA 1ZXQA 3O8XB 1HCZA 4IJTA 1MFMA 4HIHA 4OTXL 1P4LB 3D18B 2HT2C 2J2ZA 2JJWA 3R4DA 2HT2D 2PTTB 3WAKA 2UZXB 3AXLB 3K72A 2CHZA 2CRZA 3BQUB 1KELL 3QPKA 2X6AA 3L81A 3ILEA 4O58H 3W5MA 1GY1A 1OAQL 1WE5A 4NT6A 2K8QA 4JQIL 4U0QB 1Q72H 1QR4A 1M3IA 2O5ZL 5F3HA 4MS8D 3ARVA 4FULA 3CDYA 4F7EB 4DH2A 1FCGA 3V4UH 2C7UB 1TVHB 4NKOB 5DK3A 3SJVB 1KGUA 4JM0A 1Z9LA 3KVPA 3LN9A 3AITA 5EU5B 4Q4EA 3QDGA 1VENA 1M7DA 4L23A 5EO9B 4Z7WB 3T77B 1E6OL 5I8EA 2MHAB 2AJUL 2RIKA 3MV7D 2OCFD 3SZKC 3ZTCC 1EJ6A 1NCAL 5GGSA 2R1XB 4NIYE 1DBKH 2Z1KA 4FQ2H 2AVFA 1PLBA 4KUCD 1QR1B 4W9LC 1ZCRA 5DVOA 3UERA 1D5IL 5A2LH 5LGJA 1BXXA 1K3ZA 4YE0A 4W9IC 4UOQA 7CGTA 3WNPA 1P4IL 5F7WC 5ALCL 5ISZB 4MDRA 2X3BA 1X7TA 3SQOL 2GJZB 1S7SA 4QOKE 1NDMA 1XD0A 4QYOA 2A74A 5IF0A 5F7MC 4FXLA 1KB5L 2FLBT 3VXMB 3MNWB 4IGBD 4YL4A 1KMGA 5BRQA 1XH2A 2G5RA 4V2BA 4KK8D 4Z78A 3UCRA 5I15L 2YSTA 3IDUA 2HXAA 3ZGHA 1SHXA 1K5NB 3BGFC 5I8KH 4GH7B 1BFTA 3QJFB 2AQNA 4PB9H 4I8DA 1P6AB 4QY8A 4EN3D 1E9QA 1FV1A 2QQLH 4RAVB 4P0DA 4OJEH 2BSDA 1BOYA 3RUGE 2YPLA 4PJHE 4WI9A 3MACH 5JPNA 4XPGL 1WAAF 5C1MB 5D72L 1QHOA 4LOVA 3MRCA 2QQNH 4HW6A 4LCYB 1TTCA 3JWDL 4S2SB 2GW5A 2W9DL 2PO6D 2X89D 3I9AA 5D96C 5TE4H 4IU3A 3TVMB 3EJQA 3U4BL 3VYPA 4G3YH 3NJHA 4E0RA 2DM4A 1V7NH 1QSFE 5LCVH 1CFNA 4TUKH 3PDOA 1HE8A 4LL1A 4XTRC 5D2NC 2NNAB 1QBBA 4Q9RL 2ORBL 4UUJB 1DJXA 1JPFA 4ZNEA 1BVNT 5B4MC 4EBQL 1BAGA 1A8ZA 1B90A 3OZKA 5H2BB 5DHVB 1P1VA 1AE6H 4FKHA 1IEAA 2XX0A 5BO1H 3N1FC 4YK4B 3VGGA 1G5GA 2XJKA 1N0XH 1R3LB 1UYWH 2J6EH 5E94B 3Q06A 1VKXB 4PB0H 1DJWA 4LSPL 4OQTA 1E40A 2I7OA 1SBBA 1SJEB 4CJ0A 3D12B 1I3RB 3MRLB 2VLRE 2X4NB 3PIQA 5B38B 2E8ZA 1YY8B 1U21A 2F74B 2DMCA 2YMTA 5CZKA 2KS0A 4Q6KA 1F86A 4TXVB 5D2LA 4X9BA 4PJFB 1Z9PA 4W9CC 4W9GC 2PYEE 1S7QA 4LEBA 2BSSB 1KIPB 2DRUA 3QJHA 3S5LG 2OMWB 5HHXH 3JWDC 3SDDB 4N5EC 4KUZH 2F8IA 4N5ED 3UBFA 2E5EA 1QO3B 4PSPA 1NLDH 4AEIH 4WWKC 2XWZA 3AG3B 1FFNB 4MMZB 1JCVA 4MXWL 4WWKD 4CGTA 3AZUA 3SYCA 2DYPA 5JIHA 5HHQA 1G9MC 5TJWK 3GMMB 4HT1L 4XO8A 3U7WH 3QHZH 3L4CA 4EIBA 3AMLA 5B39B 1RZ7L 3ZT7A 3OPUA 2CCVA 2CRMA 3SGDH 2ATKB 1BBDH 5IKCA 4OZGA 1LL1A 1UUSA 4OI9A 2DKUA 3G5YB 1IC7H 1MY7A 2IWFA 3HAEA 4UT9L 4P4RA 3GMOA 2OQJB 4O9HH 1Z5HA 1F3JA 4NS0A 1ITCA 3B7YA 1ND0A 4U1MA 3D30A 1OCWH 3EIFA 2OJEA 4F20A 1GZHA 1CLYH 1WPCA 2FJHB 3LZRA 4TS6A 5EPMB 3E9TA 5GGSY 5C0GB 2D9QB 4HUKB 2GK0B 4ANXA 2CBQA 4KPHL 3H1ZA 2PP7A 2WPGA 1TJGH 3DECA 5E4EB 3S3DB 4DK5A 5T3ZE 1WFNA 3FQ1A 2DH2A 3MRRA 3PXHA 3QB7C 4PG2A 1L7TH 3P1VA 1MEXL 4Y1SA 5C07D 5IJCC 1CDHA 4F2FA 3CHSA 2H1PH 1KNOB 1SLXA 3EH3B 1QSEE 2B0SH 5EHFA 2V5RA 4HUWB 3MJ9H 2ERJC 5IBLC 1EV2E 5IBLD 4FX5A 5D71L 3WEAA 1BZ9B 3OXRA 2WWOA 3RZCC 4QXTB 2V3FA 5ACMA 3M17B 3RZCD 1OB0A 3GWJA 4MDIA 2QQKH 4BFOA 2HKHH 1ASPA 5KSBB 4HJIA 2GUOB 4XVJH 4GAGL 2VWEE 4JPVH 1HHHB 1UGNA 2VZSA 5T3ZL 1D5XA 4H8WL 4HLEA 1HOCA 3NJMA 4PRHA 4ZD3L 5D7LB 1XIWB 3VXOB 4O00A 1KYAA 3E6HA 4PRDA 1DJYA 4DTGL 4HGMA 3SY0A 1JPST 3DHUA 4Y7OC 1V3LA 3NN8B 4XOAA 1FFPB 3WIFA 4BH7A 3GKWL 4UU9A 1VA9A 1E5ZA 3CDZA 1KGYE 3OHXC 4N0FA 3O3AB 5DS1A 3BAXA 2A6KB 2V2WB 4KI5E 1LE5A 5IGXH 5F7NC 2A6DB 3N41B 5AOMA 3OJDA 1F6AB 2NR6A 4MASA 3B2MA 4JLRB 4ILDA 3NIDE 3QQDB 2IQAB 4FLRA 2CDEB 2ZX6A 1NGZA 5A1AA 5I0ZA 2CALA 1EAJA 3LDBB 4U6VH 2APVA 2NOYA 2VR8A 4NZJA 1MCOH 2WB7A 3V7MA 5JDSB 1KJVA 3V4VB 3HR5A 1OAZH 5HY9A 4MZ2A 4MS6A 1SGKA 1VFUA 4Y4FC 5DO8A 1U3NA 3V8OA 4XMPH 4E42B 1XH3B 1OANA 1QD0A 4HF5H 4QD2E 3IK2A 5EORH 3O0LA 1X4YA 5D5MA 5TE6H 5FHAL 1IC4L 3VFMA 4E9SA 3KYNA 4H8WC 3Q05A 1KEGL 2EIZA 1X6NA 4ZFFB 3V5HB 4XP6L 2P4AB 3ZE0F 5I1EL 1SEQH 2QGDA 2XYCA 4H5SB 3PJSA 4LRIA 3HR6A 1T89A 5IY5B 1UOKA 4ZRGA 1XSKA 2ATAA 5EU4B 1G7QB 3CN1A 1AD0B 1UC6A 2FDBP 1BQHB 2VR7A 3FO1B 4G82A 1RHHA 3ARGA 3THML 5BZWB 3M45A 1BVLA 2V9UA 2QDVA 3SGJA 4U7MA 1J7VR 4M7LT 1AO7D 3G6DL 1MLBA 4TQEL 6TAAA 3DTDA 3PDGA 5ETUB 3DHJA 4MB4A 2VWEC 4UNUA 4DUVA 3RFZC 5EBWA 4C4KO 3RKPA 5CLYA 1KPVA 4UANA 4TL5A 1FNGA 2OYPA 3T0XA 1FNLA 1QFUH 1UD4A 2RA1A 3QYNA 2ZUTA 3MRBB 1D5ZA 2A9MH 3H42L 3HZMA 2IAMA 5G4MA 4J3WA 2MIZA 5K9OB 3BH4A 4P3DB 5KUKA 4N1HB 4R4BA 3FUDA 3KL3A 2E74C 3LHAA 4IHOB 3UZQA 3RWDB 1RUML 1XGPB 1LK2A 1YYMH 3U1QA 4KX7A 3U7YL 3VFOA 4RGOL 4KI5C 4ZO7A 1BMWA 4KVCH 4X6DA 1N6UA 3QW9A 1IFHH 5DD6A 1ZWIB 3C6LD 3KS0H 3DRTA 3DGDA 4U6YB 1YEDA 3E8VA 2W5PA 3EO9L 3EOYG 5L88L 3FOMB 1HXMA 3DX6A 3HMWL 3Q1EA 3NDYE 1OGAB 1WICA 5BZDA 1NMBH 2VZOA 1KENH 3F2LA 3Q5TA 4X6EA 1NKGA 1TEFA 2IANE 3BZ4A 1BD2B 2ZOTA 1W91A 5HJ3B 3FT3B 1ZT4B 4U3HA 5EB9A 3FQXA 4PRIA 5CSGA 1A1MB 3IPEA 1UZGA 2C3XA 3AS2A 3Q48A 3D85A 5K5YA 5C08D 3WELA 1TZHA 1JDAA 4OFDA 4XO3A 3AU0A 2HLAB 3VACA 1CE6A 2F68X 4OI8A 3C6SB 2HX7A 5HGHA 4IRSA 4XN2A 3V52H 1NC2B 3L13A 1AS8A 1M05B 5CXPA 3MCKB 5CSZB 4NKMB 3JVFC 4LB8A 4XRCA 1IEBA 2W07B 1PKQB 1OY3B 2EVGA 1TJIL 5IWLA 4G6FD 4ATTA 1WWWX 1U8NB 1W0WB 1Z5YD 3QCVH 4JDEB 5FA3A 4Z8FL 3N3EA 3UJTH 4PV9B 4LASL 3G6JE 2F5BH 4XZ4A 4LL4A 3PWUA 1YPZF 5T5FL 5DC9B 5C0CE 4G1EB 4X6CB 3OMIB 5IREA 1CICC 2X0VA 1WZLA 3KGUA 3O9WD 4X5QA 5ILTH 2OX5A 3L3DA 2WYHA 4JMXA 2IH3A 1SN5A 3PHSA 2D7PA 2DQUH 2VDRB 4HCFA 4XBPA 1OTTC 5HYJB 2LAGB 4RA0C 1MHCB 2P42B 4ABQA 3S4SB 4JM2B 2WQXA 4O02B 1P5VA 5MENA 1RUKH 4LF3A 3PQYE 3VO0A 2WXJA 3ZE2E 5DJCA 1NKOA 2IALB 1WP6A 1ZSDB 2DQJL 4O02H 1KPUB 4DAGH 4NNYA 1E7UA 1N19A 3RDJA 1ZE3H 2IH1B 4NZUL 2AF2A 5F9JA 1O6SA 5DK0A 3QPXL 1D2OA 5D93B 3VU1A 2ESVA 2VDLB 1FZOA 1VFOA 2FZ3A 1RZKL 3FTUA 4P59H 1JDCA 5I16B 2VO5A 4UBDC 1GSKA 4R8WH 2O5XL 3RL1B 1CZ8L 2FCBA 2H8PB 3FONA 3LRKA 3MRQA 3WLBA 5IP4A 3L9RB 1HI6B 3IWUA 1DN0A 4ONHA 4YHIA 4GXUN 4U2ZA 3QIBD 4TVPL 4RMTA 4F7KA 4G8GA 3AT8A 3OC5A 5MEOB 5D7SH 2GBUA 1B4JL 3RAJH 1X44A 4UT6H 1E27A 5DRZB 3TNMB 2X4OB 3MOAL 5F89B 3UIZA 1K72A 2HTLD 2HSIA 1GC1H 4N86A 1EHLL 3CFMA 3D39D 1FN4B 1ODAA 4I77H 4XO5A 2G75A 3N91A 4QO1B 4E9WA 1XBRA 4PLOB 3U79A 2BSEA 4YXHL 1W72H 4ZX5A 5C92A 1WS7A 2IQ9H 4GW4A 3QGVA 2I07B 4AEFA 5AB0A 2LU5A 3QWRD 3DPBB 2XTJD 4OCYL 4A68A 2OJZH 3DROA 1DJGA 4FQQB 4G6KH 1ET5A 1NEZA 1HXYB 4M7ZC 4Z0XA 1RSFA 5I1DA 3BQUD 2BIPA 5DJ8A 1WUZA 3O6KH 3ZZ1A 4OLWL 4NN6B 5ACZB 3PWNA 3VG9B 2ZUWA 4MNQE 3NA9L 4PBWD 1J0JA 4KK6C 5EA0H 4P4KA 4Z7AA 2HJKA 2F53D 1K4CB 1GPOH 4Y4HC 5IJVB 1RZKC 4QRUB 4Y4HD 2J1KA 3CVHB 3U0WL 4HKBB 1W0VB 2QELA 4N2HA 3V4PB 2FSEB 4BELD 4E9XA 5JNYB 2J1YA 1WEJL 3HHRB 3CVHH 3KPRB 3I6KB 3RIAK 1F11A 1BYNA 5HVHC 1CXLA 2K78A 3V4PH 3ENEA 3LN5B 4HJJL 4OLZH 1IGIH 4U1SB 3TF7C 2W9EH 2NXYC 3V8CA 5DD5L 2NXYD 1FYHB 1NJ9B 1N4XL 1KC5H 3QQ4A 4QKXB 3HI6H 1JZDC 1YEGL 3CFKB 4R2GD 1FL5A 4GBXD 4PY8I 3ABMB 4ZUSB 2VQUA 5AAMC 2OMYB 4WCYL 3VMNA 2EEDA 2NQDA 2F19L 3HC0B 4OJYA 5KS9B 3OGOE 5KOVC 3BWZA 1GKEA 2EKSB 1C5DA 1S5HA 3QIUD 3RWFB 4XNYL 1LO5B 5DD0H 5ERWB 1W16A 3LRLA 1AGFB 1RURL 4NQCE 1EAOA 1HXKA 2KT6A 1BVZA 1CU4L 4MJ6A 4NYLA 4XHJD 5LGHH 2AQ1A 5BMFL 5ELIA 2FSDA 2ZSVA 4WTXA 1SF3A 3MV01 4QHNB 3OKEA 2PKDA 1S3RA 1KCRL 4YGAB 2VDNL 3APNA 3CVBA 1Y1DA 1UKTA 1A1OA 4JRFA 4PJDA 1B9ZA 2HN7A 1RZFH 5DMKA 4E9VA 1IT9L 3HS8A 2COVD 5E8NA 1I7UA 3RWEB 1NFDE 2ZWNA 2VYRE 2BMKB 3CC1A 4YQXL 5C0JB 5E2WH 1KXTA 4Q6IB 3HMXL 2LOEA 4P23A 5E5UB 4Y16B 1FIEA 2G5BA 1I7ZA 3LIUA 2WWKT 1C5BL 1LDSA 1OZUA 1PZ2A 4KKLC 3T65B 3NZSA 2UWEA 5AOZA 2BNQD 4M5YL 3M6DA 4G9FE 2Y7NA 4NDMA 3V7AE 5J5EA 1I85C 3LZQA 3OKMA 3TEXA 4OD1L 1DUZA 3T6WA 4KKAC 4I0PA 3SPCA 5A16B 2VTFA 3FCBA 2JNZA 4N20A 5E6UB 4WFEE 5I17B 2X4SB 3GRWA 1U2CA 4IU2A 1BPVA 3VDBA 3QFJD 5C3LD 3GDBA 3MR9A 4GRLD 4E41A 2W0FB 3KPSB 5JUEL 4PJXF 4EDXA 3TP4A 3C60D 4H40A 3ILQC 1IGFH 2FBJL 1MFAH 3IAGC 2ED6A 4PJ9A 2CDFB 4HWEL 5ABAA 3GM8A 4XMVA 2C3WA 2VLJB 3BLKA 2F5AH 4IJ3B 3JBG7 3DXAA 3LPGA 1L9OA 4UDTA 1ORSB 1CD1B 1E90A 3SDCA 4KROB 4LSRL 3SN6N 1ZDSA 2GB2A 3N40P 5HYQB 1QVOA 1YEWA 4M02A 1SMOA 4C59B 4YXLL 2ZP9A 4PW4A 4JK0D 5CBEB 3TZVA 1BREA 3MTRA 4R0LC 5I1LA 2APFA 2BVQB 3IXTA 2VDQL 4PJIA 2C26A 3SDDD 5DK2A 5IJKA 4Z3TA 3QULB 3O2WH 3SKOA 4Z7NE 2AABL 2YQ2A 4H8UA 3VVWA 1SYSA 1CL7L 1NCOA 1JWUA 2CK2A 4HKZB 5FW8A 1ETB1 1MUJB 5HHVH 2AZAA 4AQOA 2ALWA 1S9KC 1OD9A 1QFHA 4EDWH 1AOZA 1MHHA 4UQDA 3LEYH 3J8F7 2WLJA 5BRZE 4K7FA 4PRBA 2V5TA 4NP9A 1LD9A 5EOCH 1Q9WB 1EH9A 2ZUUA 4WW2C 3ARUA 3WXVH 4M7KH 1DBML 2EIEA 2W38A 3QNFA 1SBSH 4ALAL 3G6AA 1UOLA 4W9JC 3IB4A 4G5ZL 3SO3C 4ODUB 1LEGB 2VDOL 1DJZA 4LGSB 4JFFB 3V5DA 1P1ZB 5AKTA 3ARDC 3NCJH 2YZ8A 3LEXB 3W0WE 4CW1B 3AB0C 3ARDD 1FE8H 1NAKH 4DZBB 3KH4A 1FFRA 2PCPA 1WAEA 2VC2L 1UCTA 3OGCA 3ETBF 4HIIB 1ITBB 4X8JA 2WXGA 3NCBB 2FWSA 3EOTH 4I9WE 4ATWA 4QRPA 2EKJA 2CLVA 3C8DA 2V2TA 1U2YA 1N59A 2E46A 4MQ7A 1HILB 3Q1SH 3RHWK 4HPHA 1RJLA 3BYYA 4R7NB 1T0MB 5H37G 1JK9A 4UCFA 1KB9J 2ZOLA 2ZPKH 4U7SA 1UM6H 3ARBA 5IVNA 2EYSA 1WFOA 2AEQL 1A4JA 1H9VA 3US9A 1DQJA 4WJ5A 3AY2A 3CH1A 3MXVH 1I1AB 2OZ4H 5CZRA 3S34H 1T66D 5CUSH 1U3JA 3WFEL 4JM4H 3AWFA 5KANI 3GGWB 1T22B 5K39A 3CFCL 5DDHA 2BIIA 3EDFA 5FUZL 1H3VA 3GJFA 3CLFL 1J18A 5IQ9A 3QUMH 1M2OA 5IHZB 5DUJA 1F2QA 3EGXA 4ALAC 4HJSA 4PGDB 1FRGH 3MJ7B 4L0PB 4QXUH 4HWZB 3K91A 5CJXC 4K5MA 3RE0A 5L7XH 2J8UF 1AJ7H 1XF5A 4QXGH 4YBLB 3QRLA 5D7LD 5TF1H 1IM3A 2DN7A 4DP0X 4Y1AD 1SJMA 3SKMA 3QNYA 3QE5A 4XP1H 3TA3A 1WWBX 3U9UA 1ZLUK 4DP1X 1IGML 1BVNP 3QZNA 2Q2LA 2YD4A 2FNWA 2YPVA 3OXSB 3QCTL 4MMXC 4ZTEA 1A14H 1JERA 1OPOA 2VSDA 2X70B 2QZ5A 3MGAA 3B2XA 2E7HA 5E70A 2CIIB 3GZOA 4FQCH 1E9PA 3SPJA 2F8XC 5JYLA 3QC6X 1AFVL 1D5BB 1OHQA 3TC9A 5BVPH 1N6QH 3KWXA 2VLKE 4EEEA 4PS7A 5IHWA 2UWEF 3QIWD 4HZLA 4YHKL 1X5MA 3G5WA 1IM9D 1YA5A 1I31A 1JNLL 3FB7A 3QEQB 4GFTB 4NGHH 5C9JB 1R3HB 4PJBA 4J27A 4WTZG 1AZUA 4IS6A 3VWKA 2WW8A 5F7KC 1JVOA 3D87B 2I85A 2WC7A 4FE9A 1Y07A 4R7DB 4MGXA 1QPXA 3L2LA 1PLGH 3BAWA 4C83B 2EEXA 4GXUM 2Z4QA 3VXSA 2PCFB 4F7CA 2YLHA 4OTXH 4QRSA 2WQSA 1GSMA 3CAFA 3GM0A 4LCUB 1OCZB 3VTTA 3JVGA 3B83A 2QTVA 5T33H 1OAQH 2A6IB 1CQKA 1DE4B 3QUZA 3UTTE 4JQIH 3BGFB 3ZW3A 3Q5OA 1P7QA 3D6GA 4JHZA 4Y19D 1EEZA 3WIHL 2AV7A 2BXZA 5KANG 1JUFA 2F7RA 4DP2X 3BP5B 2WD0A 1I7RA 3DX9A 3FN0H 5KEZA 1V27A 3FRPG 2NTFA 3QORD 4OAWB 2K8MA 4IKNA 4HCRL 4BE5A 1VFAA 1CGYA 5DVPA 4HJGA 2V33A 2Z34A 1NSNH 3EBHA 1VJSA 4DGIL 3NQIA 3R18A 5FOBA 4K7PX 5D96B 1E6OH 3VD0A 3KGSA 2AJUH 1QKZL 2DAVA 2P5EA 3NJGA 4UNIA 4F8NA 4XNMB 2G60H 4I0KA 1SMDA 2MQ0A 4NUJB 3QYMA 1FWXA 1NCAH 4KMQA 3QWOA 4RIRA 4YHNB 5D2NB 3NJFA 3EGSA 1KCSL 1QACA 5D9SA 1UVQB 4CSPA 1C16B 2H47C 3JV4B 1D5IH 1EAPA 5DURD 5FXCH 2NY6D 1W0YT 3D25A 1JGVH 1LNUA 1J8HE 2H3KA 1P4IH 1KTJA 2NY0C 4R7LA 5ALCH 4QJ3B 3ULUD 4ZS6C 1QFOA 1H0DB 4N0UB 3O11B 4RETB 3QHFL 3VFWB 5DZNA 2JB6B 2IEPA 2JKWA 5J11B 1KB5H 3IJHA 3P40A 4ETQA 1RK0B 2IADA 3EF7A 5T1KD 1M2VA 3H3KA 2P80A 2BX5A 1PG7X 2Y25A 5C09E 4F8QA 4JFOB 1D5MA 5D7IE 5FYKU 2R69L 2XKNB 3BEVA 4FP8H 1I8UA 1K3IA 5SV3A 4Y9FA 3MV8D 4E2OA 4NJ9L 2PCXA 3VFNA 3WN5C 2P28B 1JPSL 1CXEA 4QOKB 4RMVA 4QHUB 4DGWC 4JKPH 5AOJA 1DVSA 4QPEA 1GIGH 3MPCA 2V3EA 4XPGH 2CJ3A 1PZUB 1ZGLP 4LLWB 1JWMA 4PJ7A 2QSQA 4JO2L 2BS71 2XN9A 4PY8J 4K7PL 4XBGA 3JWDH 1JWSB 2W9DH 2R0ZH 3U4BH 2KUTA 1HHGA 3QJUB 3IMSA 1KIUB 3L9EA 1DP0A 1I75A 2YMXL 4P2RD 4P2QE 3SYQA 3ZKNC 1K8DB 4NQQA 3ETBJ 4Q9RH 2ORBH 3T5WA 3ZKND 1HYSD 2Q10A 3FCTB 1PQZB 1OAUL 1G9MH 3RUGB 4EBQH 1L0PA 4PJHB 2GJJA 1HQRA 2IGLA 5ABDE 4GMSL 3GKZA 4HWBH 4K3JL 3SGDI 1OTSC 2MRYA 5T1LD 2CM5A 3HE6A 4LCCA 2X05A 3NGBC 3ILPA 2BNRA 4ZUWB 1IGYA 3VI4E 3AXIA 2FLMA 3IDJA 1XB6A 4NKDA 3SD2A 1QSFB 1TJHL 4G8EA 3X13B 3BCFA 1LP9E 3I2CL 1UH3A 4LSPH 3WL9B 3LNGA 3MBEB 5KVDE 1PG7L 2DMBA 2GHWB 1YNKL 3Q9PA 4WWID 3WMSA 3CMOH 1OT2A 3WKNA 4W9DC 4DP5X 5DZVA 2C9QA 3RIKA 5IR1A 1HT6A 5FFGA 1DO5A 3B3BA 4X5LA 2CA4A 4MJIE 5GGRB 3WHE0 2LU7A 5DFAA 1G0YR 3UEQA 2FK9A 3MGTA 4LSVL 5KYYA 4WHTA 4AXWB 2RJMA 3V4LA 5I73C 3BN3B 3DTXA 3NFSL 4M7LL 1PJ9A 3K80A 3B2UC 2XQBH 3QCUL 4DGVL 3B2UD 3QZWB 4NAMA 3BLBA 3D3VA 3I9GL 4ZFZB 3TT1L 3UX9B 5I75B 5DJ0B 4PJBF 4M7JH 3LS5L 2VLRB 1TXKA 3OMNB 2YMOA 3AW5A 1TSHA 3F7YB 1T1YA 1T21B 1SFHA 4GP4B 2JELH 3WKPA 4HT1H 2XIBA 2HJFB 4BWTA 1IGTB 1A7BA 2D7OA 4RLDA 5TDOB 1F02I 1RZ7H 1SZNA 2PYEB 3QJVB 4P3CL 2X1PA 1S9VA 1FZMA 1QRND 2EJ1A 4LARL 4M5TA 3MTXA 3APMA 4KGLA 5B38G 5KSAA 1ZHKB 2DQGL 2HRHA 2UXTA 4FQHA 4P2YA 3VFRA 1WH0A 5D1QA 5C6TH 1EAQA 3D08A 3DMMB 3FK3A 4LO9A 2R1YA 3DK2A 5GRYA 3L5XH 3X1NA 3CX5J 1P5UA 2IPUG 4UT9H 1IE4A 5EU7E 5INDA 3LKQB 2GTZA 4JFEA 3VWJD 4BSVA 5EU6D 3E3QC 3HG1E 3NK4A 4DNLA 3HNSH 4R97B 3OHXB 1JZEA 2AXWA 2GIYA 4V2CB 5DWUL 3ZZQA 2HZHA 4QHLB 5KBNC 2XQYG 4U05A 3LXUX 3RL2A 1J5OL 3MREA 2YA0A 4P2OA 1LDPH 5KYUB 4KPHH 1FDLL 5LG1A 3BRDA 2OXHB 4FFTA 5B39G 2NUTA 4HEPG 1WCBB 1KG0A 3RJDA 4JQXC 3MRFA 4ELMA 1MEXH 3EHBB 1DVTA 2VZ1A 3GIZL 1NANH 2H0PA 2WLLA 3SE6A 4A2LA 1XF2A 4YHZH 4Y4FB 2X0UA 1EA9C 4HHWA 4Y5YB 4DGYL 5ICXA 1HFUA 1U58A 4S0TD 5D71H 2P8PB 5L2KE 4G83A 4Q9QL 5FYJL 2G2RB 3HUJA 5SX5H 3ARSA 4JRLA 4DK6A 3A5VA 1FQ9C 4JGNA 3KR3L 3ZMNA 3K74B 3GQFA 1MFVA 3K4ZA 5K59E 4GAGH 4OZFA 1LJMA 4TM9A 1GOFA 2FGWL 2Z8VC 1C1EL 4H8WH 4IOSD 1QSEB 4Y5XA 4M93B 3GB7B 4ZFQA 3EUDA 3ME0B 5AG8A 3P4OB 3O41A 3U82B 1A66A 3DVGA 1Z0MA 4DTGH 1ZT1A 4MAYD 4IBYA 4ZDHB 1FL3B 1UZ8A 1JZ7A 3GKWH 3DX8B 4Y4KC 2VXQH 5LN8A 3L17A 2XCMC 3FU5A 3R7QA 4A7TA 3RWHA 4NQED 5EOQL 3PUUA 2GI7A 5J13C 4GIPD 4GINA 1WBZA 4AYBA 2GY7B 4YR6A 3OSVA 4PJ7F 3WNMA 2ZOWA 1EHNA 4DQAA 3II2A 4DQOH 1ADWA 1DANT 3E9UA 4TUJB 5C86A 1TO4A 3O4LD 1RULH 2EVFA 2EVHA 5CR8A 2V5YA 1CFQB 4TNGA 3IS0X 5C6PB 4TSBL 3LSOB 2WXIA 4PTTB 1L3WA 4AYSA 1RZ8A 1XL6A 1MFBL 1GZQB 3PREA 1XGRB 2Z93B 3I9IA 3MRMA 4OKVA 1W2KT 2B1OA 4IIQA 4FYQA 3QK0A 3DHPA 4X5WB 5IJBC 5LNGA 1AYOA 1GA2A 4XGZA 3N42B 3B2PA 1U95B 2DKSA 1IC4H 3NIDB 1C12A 1MJJA 3MHZA 1KEGH 1W15A 2CO7B 4H8VA 3T0ED 2AQQA 4XP6H 4A1RA 5I1EH 4YVNA 2P9RA 3VRIA 4EKJA 2CRYA 2PPFA 2QSTA 3DI3B 4FQLH 1MRFL 1F97A 3QAZC 1A2YB 4WI5A 2H32B 4EKXA 4ZFOA 2VZUA 3BFQG 1BZQK 3FYEB 3FQRA 3Q3GA 1QFWM 3FQTA 3V6FA 3TH2T 3PV6A 2H32H 1U8JB 3THMH 2Z91B 1MHEA 3AXHA 5IB5A 1UKQA 4LVOC 5GIRB 2J72A 4TQEH 5KSBF 2NQCA 2X9ZA 1R24B 5D1ZI 2WQAA 4GKNB 1X3DA 3UAJA 4CC1A 4N1CA 4F1SA 4Y2NA 5H35A 5C0AE 2XU9A 3K6SA 2BHYA 4HPOL 4KX9A 2LW3A 4FTVB 1DZBA 2DF3A 5A2JH 4PJEA 4GQQA 4XPFH 2C9UA 4XAWL 3H42H 3C5JB 1OPGL 4J12A 4EI5C 2R2HA 3ZHNA 3CXFA 3AT9A 1SM3L 2EDYA 2UZIH 3IFNL 1AC0A 2GSMB 1RUMH 5CLXA 4F1ZA 4POZC 1XGQA 4I3RL 4POZD 3U7YH 1NFAA 2I5YH 4RGOH 5AENA 2YAHA 5FDYA 1KJMA 3B2VH 2IF7A 2Z7WA 4FQXA 5FYLE 1IJ9A 1AI1L 4NBZB 3WN6A 4HJEA 1CWVA 4E36A 1ZHBB 4PWIA 2JLLA 2GITB 3WNKA 5ECGA 5IW1A 3HMWH 2VM4A 1JNHA 4CILA 3ZU8A 5FC9A 2A4ZA 2LFGA 2Q76B 4N8UA 3VXRD 5KYNA 1OF0A 4QRBA 5LQBH 3Q8FA 3IJ8A 2PW2A 4AM0Q 4M4RB 3K4DA 5FDWB 3CVCA 4OF7A 4XMLL 5FKPA 2MH4A 5DJXA 5GS3A 3CFBB 2O61A 1P7HL 4NENB 4QTIH 3KVQA 1WIPA 2FAUA 1HINL 1X5IA 2IPKA 4L3CA 5FYLL 2QPFA 1F41A 1G6RL 1YCSA 2AK4E 3ZKSD 2IANB 4JFFD 1KLUA 2HT4C 3MRHB 5DUBA 2ZCZA 3DVFA 2X10A 3RGVB 4TQIA 5FWRA 5MEQA 3MBWB 1TJIH 1UOVA 4MKTA 4Y2OA 4JFYA 1IGCL 2JF1A 2YEZA 2ARJB 5DMJB 1TTGA 1J1PL 1T2JA 3VDCA 1BVOA 1AGDA 4LASH 5CWSB 5HVWA 2M2DA 3D0LA 1S7VB 4NNXA 5A2IH 1J8KA 3N44B 1PIGA 3SKJH 3DJRA 1R5WA 3NIFE 1VACB 5C0BE 4Y9BA 4D8OA 4OZIE 1N9PA 4L37A 1OXYA 6PCYA 2R2EB 5ID1A 4LBEA 2BFVL 3SCMC 5EOTA 2P26A 3SCMD 1N7ML 3ULAB 1TU2B 4J3OC 1NDGB 2ZCLL 3S5ZA 4J3OD 1SJHA 2JV6A 4BK5C 5H4ZA 2JI2A 4M7ZB 1FL6B 3G6JB 1PVHA 3KBHE 4L3EE 3SBWC 43C9B 3OLEA 3U83A 4KTEH 1NCUA 3TURA 4UF7C 5C0CB 1J9QA 3FT2A 3ROOB 4K94L 1NOLA 4WI3A 3CPLA 2DQJH 3WJJC 4KXBA 3BFWA 2WWMC 2DM3A 4HUUA 1FI8C 4JFXA 4QTFA 2WWMD 2CIKB 4FFVC 1UQSA 3BEWB 4LPTA 4NZUH 1FZJB 3TO4C 4AW7A 4FFVD 1WA0X 3KXFA 3RRQA 4NFDA 3QPXH 1FF5A 4ZUUB 1AIFB 4JKKA 1RZKH 1A4CA 1BWMA 2O5XH 1CZ8H 2VZVA 4JX0A 4WHDA 1FZKB 3MNVA 1BQSA 2WSDA 2Y7SA 3LQMA 3T2NL 5HVHB 2CRIA 3VYOA 3BUYA 2MCPH 2VZ3A 3LNFA 3PQYB 4U1KA 3B3IB 4JN2A 4TVPH 3T3PB 1FUNA 3EUUA 4AJ0A 5DEFA 1B4JH 4P57A 3V0VA 2VISA 2O6DA 3MOAH 3ZDXE 5CBAA 2HH0L 1EHLH 3T8XA 1B0GB 3GD1C 1BQUA 3UJIH 1NCTA 1BSIA 2XVKA 1E28B 2A5UA 4HLJA 5EO0A 4DWHA 3AGVA 1RIVH 4YXHH 5C0NC 4JFDD 1YMMD 2FVNA 1JV2A 2Y3NA 1AKJA 2CLRA 3KPOA 5C0IB 4PCTA 3L08A 4OCYH 1WISA 3TNNA 1YUKB 1LGVA 2XRAL 1UA7A 1IU1A 1G7JB 3KAAA 3KW8A 2R29L 4YZWA 4K94C 2NLJB 1TNNA 3P3SA 4OLWH 1INDL 2X2JA 1YMHB 1AXTL 2JJUA 2Q6WA 4PJEF 3NA9H 1DZ0A 3IJ7A 3UJJL 5HI5C 5E8PA 1JPGB 2AXGA 4FFYL 2D2OA 1IKFH 2JTDA 4YDLC 3U0WH 3AQZA 1NICA 3B56A 2XZAL 5IOKA 3DOHA 1WEJH 1MFUA 1U3ZA 1RZJL 2B9AA 1JHLL 1ICTA 1KY6A 4HJJH 4MNQB 4JL1A 5DEGA 4FEMA 4G80A 1N4XH 3ISWA 3FTGB 1EERB 1YEGH 2OCCB 3EXJA 3MJ6A 4LOEA 3FFCA 5JO5A 2OA9A 3ZJAA 1XAUA 5EC2A 3D0VB 1NGXB 2BOLA 5FM5O 2E0PA 5GZOA 3X12B 4WCYH 3EOAA 1EK3A 2AEOA 4LLYA 2JE8A 5A6IA 2XWEA 1CD9B 3KWWA 4NN7B 4C56E 3ZT5A 1M9WA 4Z6AT 3AGWA 3BE1H 4F58H 2ZWLT 3KDPB 4XNYH 2V8MA 4GAJL 1EXUB 1RJZA 4HS3B 3ZQXA 2JKJA 4LXFA 2Q3ZA 3OB0K 4ZTPL 3CN0A 2F7QA 5BMFH 2VDNB 3HLKA 3OAYH 2A9DA 4X0KA 3BZ5A 5SWSD 4UB0H 5BCAA 1A22B 1I53A 5HYSB 1G7HA 5I19L 2XTLA 2Z0UA 2NRDA 2PR9A 1UFUA 2VDNH 1NGYA 1NL0L 4N2DA 5G2NA 4BQBA 4RNRB 1SOXA 1OW0A 2P52A 3AS3A 5E6IB 2P5WD 1WZAA 4MNGA 4TTDD 3LB6C 1SVCP 1IT9H 2C9SA 3L3IA 1RZJC 4R0LB 1CGXA 4NQCB 3TWCL 4YQXH 1LWHA 3MJWA 5DCCA 2HX9A 4XCNB 1XQ4A 3KPMB 1CDUA 4P3WA 2X6VA 2B4CL 2N0KA 1S7WA 3ZKQD 2CWRA 4U0RB 3ULVE 1HHJA 2UVFA 2O6CA 3S5YA 4NBYB 4M5YH 4PCKA 5IB4A 5K1NA 2FWOA 1DBAL 4OD1H 5KSAB 1OEZW 2CHXA 1G87A 2AEWA 1TEYA 4NO0D 5ANHA 1T7YA 1CGSL 1Z32X 3RDTC 2XWTA 2VR6A 3F7LA 3RDTD 1JFHA 2X1OA 4TF4A 3WSQH 3OLGA 3QQ9C 4BQ6A 1OLZA 2X5PA 4I5BB 5JUEH 1ZVNA 5EUOF 1IKNC 4KY2A 1ACCA 1Y0LA 4F57L 4ZX3A 1XCQA 4G9FB 3CDGA 3EYOB 2FBJH 5I74B 5B1JC 2JXMA 3V95A 3GINA 3ULVL 3ILDA 1BF5A 2J71A 2PABA 3IDGA 4KZDH 4HWEH 2EYTA 3CZKA 2JI1A 3IU3B 4LIQL 1SXCA 3WJLA 1VSCA 5I1CL 4OH2A 4LP4A 1NCJA 4DP6X 4LSRH 3KS0J 4BZ1L 4RGNC 1KN2H 1TQUA 1TMQA 4RGND 2VDQB 1KEML 4YXLH 1UB5A 2YSSB 1E43A 4KDVA 1P2CB 4W70A 4AGMA 5JW5A 4N0CC 2SEBB 3QUYC 5SWZD 4N0CD 2B4CC 4HUNB 3G04A 1DVYA 2VDQH 4ODTL 3VGHA 4ZXBB 1DQQA 2DOCA 3QR1A 1SXZA 4ORGB 3MYJA 4BH8A 2AABH 2HVJB 5BOJA 3FU3A 4OLYL 4ZUTB 1CL7H 3HRZA 3DV4B 2WWKO 3RNKB 2OZNA 5F1IA 1K4DB 1KSRA 3IXAA 4OR1A 1RSYA 4WV1A 1TETH 2PYED 4Z77A 3RJQB 3WOVA 5GGUA 4FFZL 3C75A 2E3VA 1ZS2A 4V1DE 5EWIL 1PLCA 1DBMH 3KHOA 1OO2A 3H55A 4ALAH 5JW4R 5AUMA 1O5PA 5BNXD 3HZVB 2B1AL 2Q2EB 4G5ZH 3T08A 4P5TC 3REWB 2ICES 4LU5L 5FFOA 4P5TD 4Z7NB 3ESOA 1MJUH 3GLEA 2VDOH 1NMCC 4JQVA 3H3BC 4YGVA 4BZ2L 3WTWA 4NZ8A 4PUBL 2HB0A 4AE1A 1UXLA 3AROA 3QUKB 4QGYA 4QRRE 2VC2H 5BRZB 3K5RA 2O6EA 2CKNA 1MCFA 3LPFA 4LLAA 4P49A 3FJTA 2KPNA 2OW7A 5EN2A 2OR9L 5GGTL 2I24N 4FABL 4IM8A 2XYBA 4PGJA 4IGBA 4IK7A 2OW6A 4DJMA 4YFDB 5F6IC 3RVWC 3K6IA 3EYFA 2WN3A 1WAAE 5BW7A 5KVMC 3W0WB 3MLRL 1CI3M 3OAZK 5AW4B 4NQDA 3I84A 1NQBA 4GB9A 4LPXA 2HFFA 2AMGA 1S9YB 2ZWYA 2AEQH 5CFHA 1PPIA 4MWFA 1UB6B 2NCEA 2QPSA 1E8XA 4JFUA 3UYPA 5JZ7D 4EN3A 3S36L 1E7VA 1HESA 1JTPA 2MPVA 1I9IH 3CFCH 3W9DA 3G7TA 4ANWA 1FGVL 2VDML 3CLFH 3KJ6L 2Z31B 2BWQA 1TVBA 1XTMA 4AJVA 4Y0GA 2NSMA 1A25A 3MRGA 3H9SE 5DVKA 2PO6A 2KZBA 3RKDD 1N2RB 2EC9T 4AQEA 3LQZA 4K3EL 2Y6SD 2FR4B 3WKML 4H25A 5J1AB 4MD4A 2BVPA 2I9TB 3IRCA 2ZWKA 4KKCD 4PJAA 4EE2A 2CGRL 5C70A 1JN6B 3RVXD 2AKRA 4JPIA 3WCYA 3OR7B 5B3SB 4JGJA 2V7NA 1SQ2N 3L3HB 3JUZA 4PTUA 4KTDH 1FFOB 4PYGA 3P4MA 3WIIH 1EHXA 2MFNA 5CS7A 4FLOA 5EEWA 4IBZA 2LE9A 3L54A 3L5IA 3O6FA 4JG0L 5IHBA 1H15A 2BOBA 5FS5A 4LDEB 1JNLH 1HKLH 1MVFA 4OJDH 3C5SB 2Y5EA 4IDJL 2QR0B 1DCEA 3FT9A 3GI8L 5A2FA 1A3QA 3F12A 2NY0B 3LXBA 1CFTB 5IQLA 3T0BA 2QL1A 3TBYB 4L5FE 4Q0XL 2D0HA 4O51B 3ULUH 1MFNA 5F1NA 4APQA 3H7BB 4RFOL 4X6BA 1WYJA 3K71A 2VLKB 1MWAH 3SPVA 1RJYB 1NCIA 1HYRC 3IGAB 4BCZA 3LPPA 3ZQWA 2JJTC 1RK7A 4OW6A 5IMKB 3CU7A 1K2DB 2R51A 5DI8B 2R4RL 3OC8A 4FLSA 4NO2A 4Q89A 4B97A 4JREC 3KEDA 3HB3C 3BSZL 4JCLA 1QWNA 3WXWL 4L5FL 3IF1A 5FKAB 3BUBA 5KBDA 4HCRH 4XCYA 1VRSA 4M43H 4NC1E 4HLZG 2YAFA 1ZLUH 4QLWA 2F54E 3SDYH 2XV6B 1IBDA 3QDGE 4HXAL 1QKZH 1NGWB 3L95A 4UOW0 5KYXB 1LEIB 3V6OA 2DWSA 2NW3B 3UTTB 3ZRSA 4N9GA 3L9YA 3SGKA 1GGCL 4W6WB 5A2KH 2XKSA 1KCSH 2ZP0T 1DFBL 2GVYA 4Z7UA 4MQXD 1CYWA 4EI6A 4LKCA 2KQNA 2GSIB 5E6ZA 2NYZA 4OQ1A 2GKIA 3OKOA 2LQRA 1E4JA 1CLOL 3ECBA 4AYDC 3BKML 4K8RC 1P7KB 4K8RD 1O6TA 3J27A 3NGBB 3BZDA 3FQUA 1WT5A 2X6MA 4CDHA 3QHFH 4NRZB 5GRVL 1JGIA 4ODHL 5AD0A 5ID0B 1L5GB 2GI0A 5B1AB 5F72S 1FC2D 1PL3A 2BP0A 1W80A 2GCYA 4L4VE 2F61A 5C07A 4KUCF 1ZJBA 3GMPA 3P9MB 4AT6B 4J1UB 1CTNA 1XCTB 4F7TB 2D31B 4KKRA 2E7BA 4JJOA 4NCDA 4TULL 2R69H 1E42A 3OAWA 1MVUA 2HRLA 1J8HB 2Y06L 2WINB 1QX1A 4P46C 4AGPA 4JFPB 1JPSH 4P46D 2Z7YA 2BERA 2XXFA 4RWYL 5EO1B 5I73B 1N8ZA 2PPEA 1IVTA 3PWVB 3CVIL 3F3HA 2AQSA 3KLAA 1O7DE 4URTB 3NPSC 1I1YB 2YPLE 3ECWA 4A2DA 1MXDA 3Q6FA 1WFMA 4JO2H 2ZUSA 4R26L 2Q8BL 4K7PH 3RWGA 3MUGA 3TV3H 4HOXA 1AGCB 2YMXH 1ZTXE 1EXHA 1MHPL 1IUZA 1MXGA 4DPAX 1A64A 4QYAA 1OAUH 4M8QB 1JZ8A 2WOBA 3W37A 1ZLVK 3VJ6B 4GMSH 4NC1C 2MOQA 4K3JH 4LCWE 1KTLB 1LVEA 5HD8C 1JGEB 3VB9A 1MKFA 2OTUB 1Z5LA 3F65A 5HD8D 1XGUA 4JG5A 5K9KB 1KGCE 1GTFA 5DVNA 1DLHB 1UD2A 5ANMA 1TJHH 2V8LA 4PR5A 2OULB 5F9OL 4JY4A 3I2CH 3V5KB 3ZUNC 4MMYB 4EUPH 4PJAF 1GH7A 3MA9L 1PG7H 4GUOA 4BFBD 3BQVA 1BV8A 3ZTEA 3ZE0E 1ZTXL 2X4RB 1OSZB 4XI5C 2E8YA 3BKYL 2E7LC 1YQVH 1MFEH 5T8IA 1OOAA 3VFTA 5J6GA 3LRGA 1I1FA 4LSVH 3KL5A 2IOOA 3VI4B 2H26B 2ZNWA 4K2UL 3NFSH 3I75A 3DETC 5IMOA 4IKIA 4M7LH 2A74C 3GTNA 3QCUH 4DGVH 1V3KA 3U46A 3TT1H 3MRJA 3QDAA 3I9GH 3SY6A 5EU3B 3VVVA 1XH1A 5ECJE 1USQA 3MXWL 3CHQA 4KNTA 1TEGA 4WGKA 5FHBL 4B3EA 1NANI 5FUOH 2NNRA 3D9AL 4LP8A 4OJCA 4MJIB 2VXQA 4HFUL 2F1EA 4OQTL 1ONQA 4YLBA 4X83A 2HCZX 5EOCJ 4WNJA 1QHPA 4L8BB 4P3CH 1AO7A 2WWNA 3DIFA 4ISVA 1AGBA 2BCMA 2QEJA 2EUXA 3GMNA 2DQGH 1O7DC 1BAWA 2EDNA 5IV2A 3IDNA 1J1XL 3S3JA 4JE4B 4PP1D 5DTFA 3S37L 1HL4A 3ZKMC 3M8OL 5JPNC 3RFZA 3KCPA 3IGUA 1HHKB 1U8HA 1T1XA 1WAPA 1U91B 2ENPA 2Q7NA 3BZEB 1L9TA 1N8OE 4MA8L 2ZQKA 4NRXA 1HK6A 1MREL 1U2HA 4JB9L 1UG9A 5DQ9B 4FNRA 3QZWG 4CVZA 4XN4A 3L8QA 4B27A 4JZNB 3WNLA 3DSFL 2XWBA 3B9DA 3US1A 3JZ7A 5L2JA 3BUIA 4UQ3A 3ZR5A 1J5OH 2RALA 4JRXE 2ADIA 3WMPA 1DTUA 1FDLH 3C6LA 1SRDA 1H6TA 5IVXF 3RWIA 3GBLA 2BIQA 2WBJD 2QGEA 2UV3A 1AXSB 3ARZA 4IRJB 3HG1B 4HFWB 1J8RA 3QRBA 1AAJA 4Z7UF 4IKKA 3WHXA 3GI9H 4HIJB 4I18B 4OCWL 3WUWA 3P9LA 5DR5H 1SYVA 4I2XA 2VL4A 3N43B 4L1BA 1F42A 4HIEB 4DGYH 5IB2B 2B15A 2IDSA 2C4FT 2D73A 1MJ7L 5FYJH 5C08A 1PKOA 5F9WC 2A6JA 2DYSB 3SKUD 4YHOL 1T5XA 4JGMA 5EZJA 5F93C 4DERA 3OQRA 3BN9C 3FQWB 3QDMA 4J4PA 1FG2B 3BN9D 5I30L 4OIFA 1C1EH 3GIVB 2IPTL 3SDXF 1FJ1B 4JAMA 1A5FL 1VGEL 3HE7A 3QAZB 1TKWA 3B4NA 1EUTA 1DQKA 1ZIBA 4F33A 1A9BA 1YPZE 2P8LA 1EHKB 2A9AA 2I27N 5L2KB 1ZLWH 2KQMA 5J57B 1SUJA 1PCXA 4FYTA 4AH2A 1D6VL 3ELAT 4NRYB 4YAQA 4Q9BA 4HD5A 1AMXA 2DYPD 4DIXA 1T20A 1X5ZA 5EOQH 2HA1A 4LEOA 1J11A 1KCBA 4WI0A 1U8KA 3HC4L 1JYVA 1AVAA 1HSBB 1ERNA 4GQPH 4NC2B 3CIQA 2EILB 4YO0A 5DJYB 4U3SB 3R8BB 3Q44A 2DQIL 1TYJA 4D0DB 3U0PB 1GYUA 2NNFA 3O9WA 3OX8B 4MDJB 4WKZA 5IB3A 2D0FA 2GTQA 1BEYH 4BSWB 5EBMA 4TSBH 5E8OA 3SSGA 1L6XA 1N3NA 1MFBH 1N67A 3E1F1 2BS9A 2HKFL 1E3FA 2WUCL 3LVTA 4J3BA 5HDOA 2GK2A 2M1KA 3CMGA 1KLFB 2KBGA 1GZHC 3KBPA 3IBOA 1PYWA 3V9EA 2H7WA 2ZAHA 5AVWB 2EP6A 3CXHK 2WQRA 1BMZA 4UM8A 1MELA 4FRWA 4YOKA 4H1LB 2F7PA 3U2SA 1XCXA 4X7TB 3OQ3B 5CZXC 3S0PA 3IE9A 2AZUA 5CZXD 5GPRA 1E9OB 4PG2C 1KB9K 2IOMA 3MNMA 2QLVB 3DBSA 4Y2DA 2R8SL 4HETA 1MRFH 1UJ3A 4CJ1A 4LP5A 5CU5A 1U6AL 1IAOA 3VTMA 3PF2A 5GGVL 3KMDA 1KTDA 4YHML 2FIKB 4NPKA 1NCBL 3DBXB 3QH3B 3FO9B 2D0GA 1BEXA 1M71B 1OARH 3CFNA 4N2IA 5AW2B 4LOFA 2ICEB 5T5NG 2EH8H 4OF0A 3QIBA 3NUKA 4C47A 3C09C 4AV0A 1HJCA 2DMKA 1ANUA 2B2XL 4HPOH 1NC4B 1B4TA 5AVRB 3HHSA 1VLXA 4XAWH 3X3FL 2NY4D 4P5MB 1U8QA 4MCNA 4G6AD 2XY2A 5ESAA 1BFVL 2HRPH 2RAMA 4M1DL 3GMQA 3C2SA 1ADQH 5CP3H 3LRSB 3FHEA 2A1WL 1SM3H 1P4LA 5E5RB 3CFEB 3QWRA 2XXCB 3FUNA 3KE0A 2R59A 2PTTA 1KULA 2WVVB 3A22A 4Z5RA 2KHAA 3BQUA 3WHE1 5C0AB 1CBVL 2VN3A 1V7MH 4UDUB 4JO1L 3VFGL 5I6XC 2RB8A 2EUWA 4AMKH 3N1MC 1AI1H 3C8HA 3QR2A 2NR6C 5CJQL 4FFWC 1IBBA 2F53A 4YDVA 4FFWD 2DLEA 3ESNA 3GSUA 1RJCA 2HJLA 1QTYT 1TVHA 4NKOA 3UOAB 5T5NF 1YQ2A 2G4GA 2YC1B 4J3OH 3T6ZA 2UVEA 4XMLH 3W39A 4KI5F 3A47A 4H0HB 4Z7WA 2FD6L 4AKOA 4Y5VB 1X9UA 4WU7B 3N42F 3P0VL 3PGFL 1G6RB 1P0SE 1SDAB 2FWLB 3HVDA 3BKJL 3ZTNH 1KZQA 2H2PD 5FYLH 2R1XA 2UY6B 2QVKA 3OJVC 3TO4B 1G6RH 2HTKC 4R4FH 1QR1A 1TQSA 4GBXA 3RTQB 4XPHL 4HDIB 2XG4A 5I1HL 2F1AA 3WUZA 3QG7L 1E4KA 5BRZD 1YSOA 4LRIC 3DDGA 1T89C 2IC2A 5ISZA 1HEZB 2VDKH 1MY5A 2EDRA 2GJZA 5DC0A 3QIUA 2YKLL 2ZOKB 3ARGC 3OR6B 2KKQA 3ARGD 1J1PH 1QNZL 3SGJC 1A6VL 4YDJB 5KN5A 3U4EB 5D1XE 5FECA 2AK4B 3JTSA 2AK1H 3BD5A 5C0DA 4Z95L 3QFDB 1D7BA 1K5NA 1JV5A 5J12C 1W9XA 3CZFB 3QJFA 1I7TA 2BFVH 3ZRCC 2COQA 3CBRA 4B60A 1BZEA 4BZYA 2IAMC 4RAVA 3SBPA 2W0PA 4MQTB 3OZ9L 1QA9B 1AS6A 2GYSA 4CBZA 2ATPB 1AY1L 1T1ZA 3F04A 1ZEAL 4KRNA 4H0LC 1QBAA 3COOA 1EFXB 2FEEL 1T2QL 2R2BB 4LCYA 2P46B 4YSOA 3CLWA 4L8CB 3TVMA 3UH8A 1LYQA 3NIFB 4AIXA 4K94H 3T4AB 5C0BB 4R96B 1OP5K 4LHUB 4PJXE 4U4BA 5TDPA 1DN2A 4OZIB 4AGNA 1HVXA 3LKRB 2V3DA 4UUJA 4LKXA 5CGTA 3CZEA 4NI6A 3FCSB 3QQ3B 1JZ5A 5H2BA 2AEPH 5DHVA 1TJXA 2DWDB 4OCMC 3QFJA 1MNUL 2QKIB 4L3EB 1THCA 4YIQB 5HHNB 4GRLA 3T2NH 3NZ8A 2XA3A 1PFOA 3LIZH 5E4IA 3M1CA 4KNUA 3C60A 3EO1B 4M1GL 1OB1B 3GC3A 5JPMA 1L9SA 1O0VA 3D85D 5E94A 2DIBA 3B1UA 1VKXA 1PG7W 4ONOA 4MQSB 4NXSA 3MFGB 4FXGB 4IRSC 3RVVD 4AIZA 3RNQB 1I3RA 4APXA 2GJPA 3M46A 2X4NA 1X5KA 2BPBA 5B38A 3HTLX 1YY8A 4FAAB 2F74A 1IQDB 2VOTA 1R4XA 5HP5A 3O2VL 4OFIA 4E9YA 2ENYA 4UIMB 5GS1A 2K70A 4PJFA 1CI5A 3LZFL 3FO0L 2DM2A 3PRZA 4GEIA 4WUKL 5IWLC 5JHLL 1KIPA 4U1LB 2G9HB 1ZAGA 2OMWA 3BPNB 2XRAH 5E5LA 5F3BB 4LVHC 1RPKA 2R29H 3NEEA 2ITCA 3SDDA 4AEHH 5C0FA 3HC3L 4N0YH 4CMHC 4KK9C 4NCC2 3ZDXB 2DQFB 3FS9A 4KK9D 3N5AA 4XOBA 1WQVT 5AALA 1AXTH 1CF8L 4H0IA 1TO5A 3NRPA 4MMZA 1XR8B 3ZSTA 1ZANH 3E1ZA 4YLCA 3UJJH 3T6XA 1Q90A 1QSZA 4JHUA 2X6CA 1RL1A 3IS1X 4FFYH 4XPTL 1S2EA 1KJ2H 5CAYB 3GMMA 2YXFA 4JNXA 2CG9X 2YPKB 1KFAL 1CR9L 2ATKA 5IBUG 3RGBA 1SLWA 1OIOA 2BO0A 2XPGB 3TCLB 2XZAH 3N1GC 4FQIH 1RZJH 4YUEL 3B7SA 3G5YA 2OK0L 2R0LL 3UPAA 4JZJA 1MCJA 4QF1B 4EVNB 3MVSA 1A6PA 4HWUA 4IOIB 2OQJA 3QDJE 2QQQA 2DBLL 3EOBB 1S7UB 4LPCA 1UADC 5FIEA 1DLFH 3WTTA 2FJHA 1YJDC 1E8YA 5IFJB 4I0CC 5CP7A 5AKRA 3NG5A 5EPMA 5FV1L 4DKDC 4YSDA 3PS6A 4S11A 1U93A 5KZCB 2OMXB 2HG5B 3HPJB 4XWGL 3OKDA 3ZO0A 4NUGL 2DICA 3STBA 2PPAA 3T3PF 4RMRA 4GI8A 4H8PA 3FYIB 1CGWA 2EDWA 2YRLA 3DO3A 4G8GD 3CX5K 3LV3B 5MI0C 3TIEB 4MXQC 4WVRA 4ECNA 3NFPA 4JUSA 2J8UE 1NL0H 1JG9A 1X5JA 3FTYA 1FVDB 3JYCA 4GRWF 1CN4A 1BZ9A 3NESA 4M6OH 4QXTA 3WU1A 4C56B 3IE4A 1F13A 2LU3A 3HG0A 4XXWA 4YSTA 1FBIL 5GS0L 4HGKC 1HHHA 3APDA 1ZHLB 2FYVA 4G5AA 4DSYA 2RMNA 3BAJA 2HMIC 2DL9A 4QWWC 5C09D 4GP8B 4JPKH 1JZ3A 1U4FA 2HMID 2B4CH 5D7LA 1XIWA 3VXOA 4YSCA 3WTSA 5FM4A 3MX0A 3TJPA 5HHOB 4YZFF 4ZI8A 3CFUA 4P06A 1DBAH 3NN8A 1FFPA 2UWEE 5I5RA 5AOIA 3HBGA 3TPKA 1CL7I 3LKNB 3FCGA 4P4KC 4XNBA 3VQLA 2IFFH 1K6QL 4P4KD 2FJGA 2E4FA 2FQDA 3CJJA 1NCHA 3O3AA 1SJXA 4JGUA 4MMXA 1LK3H 4LOUC 1CGSH 3F00A 1M9SA 4LOUD 2VCOA 2Y7QA 1ES0A 5F0LB 1F6AA 5GSVB 4BDVA 4YX2L 4JLRA 2FQGA 4F15B 2NUPB 1NMCB 3QIWA 2NXZD 5D6DA 1N10A 1NFIA 2CDEA 4EZLA 2BW4A 5AAWA 1NBVL 2VT0A 3P77B 3QJQB 4P2QD 5AYUH 3EYSL 4CGUB 4XNQB 2KLSA 1NM4A 4K5PA 4KKPA 5JDSA 3V4VA 1ZS8A 4LIQH 2EIBA 3G5VB 2D9CA 3EG9B 4LSTL 3L7FB 4R9HA 3F7VB 4KQ4L 5FAAA 3CCHB 3RX8A 3SQBA 4LLDB 5BXFB 2E27L 3WJMA 15C8L 1RP9A 5IG7A 2B1HL 5GS0C 1P6FA 5F6IB 3DYOA 2VMFA 4HUVA 4ONFL 1KEMH 1I8IA 2IWKA 3STLB 1JHTA 3UBXB 4ZFFA 2QV4A 4OIIL 4ODTH 3INUL 3JV6A 3ZN6A 5FUCE 1Q38A 2ED7A 4OFVA 4PJIE 2QADB 4Y19A 1JI2A 2WLKA 3AC0A 1H8SA 4MYPA 5JW3L 5JHAA 2AV1A 1S8DB 2EECA 4TNEA 5EU4A 1BQHA 3FO1A 3EF4A 3IRZA 3QORA 5JDJA 2Y1AA 3KLSA 1NWOA 4IMLB 1DQIA 2YFOA 4G42A 4G7SB 1VADA 1PDKB 4FNQA 2AS5M 3Q8AA 4JRYE 2UYLB 1RUPH 5EWIH 2BCKA 4MD5A 2K3TA 2AW2A 35C8L 2WIIB 1JCKA 2QSCL 1AZVA 4CMMA 1M42A 2X2HA 3BUQA 2W59A 4K4KA 1CXFA 4P23C 3HN8A 5TK4A 5EIIA 4BZ2H 3MRBA 2LTQC 4W4OA 2EO9A 5JQ6L 4PUBH 3QVAA 3UTSB 5K9OA 4P3DA 4AM0B 1MCNA 5DHXB 3FNKA 1GYCA 4WY7L 1OF2A 3QS3A 4PWKA 3RWDA 4I0PC 1CG9B 2P3YA 3GJFK 3P2DA 4I0PD 4BGDA 2OR9H 4WW2F 1UD6A 4FABH 3UGXA 1M56B 1CS6A 1MCWW 1N5AA 3L3OA 5T1KA 4OD2A 4CNIB 2CJUL 3FOMA 5TE7H 1OGAA 3MLRH 1EO7A 3VXUD 4AV5A 5I8OH 2WNXA 1Z9SA 1IAIM 3OHMB 1D9KB 4QRRB 5F0PB 1QRKA 2W9LA 3DA0A 1UWFA 4G8FB 4PJ9C 4HISA 2VDMB 4PJ9D 3ES6B 1A1MA 1MQ8A 1S78C 4HX1B 3EFDH 1Q9OB 3WY4A 1FGVH 4GT7A 5EMYA 3KJ6H 4WO4B 3SDCC 1C08A 3SJVE 2HLAA 3SDCD 3GO1L 3F05A 4I3GA 3C6SA 5BV7L 2CK0L 2MNWA 4F7MA 3TEUA 1NC2A 2F0CA 1M05A 2AQTA 4OLEA 3K2UL 3MCKA 5CSZA 3TZVC 4NKMA 4L8SB 1CFSA 2OPCA 4JREB 3WKMH 4WTQA 5IJKC 4MHHI 3ABLB 5IQOA 2EDKA 3VFSA 3K2IA 4FNLH 5L2KD 2CGRH 2EDEA 4DGUA 3LNIA 4JDEA 1U8NA 1W0WA 2DTSA 1TIUA 2F7OA 3V4UL 3CQQA 3M88A 4OLUL 2EXYD 2CLZB 1KN4H 2EABA 4NJAH 2C1PA 2B77A 3IN2A 5GS2D 3H9SB 1G7PB 4PV9A 3U0TB 1AH1A 4XX1G 2ENQA 3QA3A 3REVB 3O3DB 2B3IA 1RVFL 3HA0A 2P8MB 3J7HA 5LUMA 4JG0H 3KG5A 4KRPD 4X6CA 4AZ8B 4BHUA 1NBZA 1BF2A 1TYRA 4XC1H 4FQ2L 3GI8H 4P2AA 4N2GA 1T5WA 4PGZA 1R3JB 1H3TA 1T04B 2E75C 4PJBE 4AGLA 5FOJA 2ZG1A 3D4CA 3VH8B 4AC4A 5F2FA 2VQ4A 3FKUS 4K8RH 4L4TE 3IGFA 4BEIA 2Q5BA 4XMKL 1A3LL 3BP6B 2Y23A 4JZOA 4MA1B 2GY5A 2YPVL 4RFOH 3S4SA 3VXSE 1SXSA 3HEIB 5BV7C 1HL5A 2XI9A 3LKOB 1CIDA 5FO2A 3P0YH 3MCLL 1NCDL 1ZSDA 2E9WA 4DO5A 2JIXD 4N8CL 2IH1A 1ETZB 2WUBH 1HAUA 2R4RH 3ARBC 3BH9B 1D6EB 4AVHA 3N85H 4XO4A 3SDAD 5D8JL 1YY9D 5I16A 1GS6X 1C5CL 1JZIA 4PB9L 5JIMA 1CK0H 1QRNA 4TNWF 4HIHB 2AGJL 2WXPA 3UIYA 3NPSB 1UWEL 2J2ZB 3GEWB 2QQLL 1O9VA 4WFHD 3K72B 5MEOA 5I0DA 4HXAH 3NCCB 1QOKA 3R0NA 3VWJA 3MNDA 4ZUVB 3DO4A 2QQNL 2X4OA 4UOJA 5EU6A 4EUPA 5ACLA 1GGCH 1NC4D 1DFBH 4K07A 2DQHH 1H5BA 5LN4A 2LGNA 2N01B 5F3HB 1SY6A 4MHHG 2IDFA 2XQYK 4HUCA 3TLRA 4XWOD 3RILA 4L2LA 4J39A 1MFDL 3KYOA 3BKMH 5LAXA 3TA3C 2F54B 3TA3D 4B9KC 4LSQH 4GMTL 3QDGB 5AVYB 1M7DB 2NSQA 1HXYA 2G4EA 3DUSB 4N5UA 1I8KB 4M61B 5I8EB 5C0AD 3VSUA 4JFVA 5E2JA 2RGSA 3UGEA 4M03A 1A02N 5GGSB 2CXGA 2YBRA 3WENA 2WIMA 1AR1C 1N0XL 1ROWA 5IEKA 4PB0L 4GG8A 1K4CA 4M62L 3CZLA 3FFOA 3FT4A 5F1SA 5LGJB 3EO0B 2YQGA 2Y06H 1YUHA 3OLIA 3ULUF 4IBQA 1E5BA 2XIDA 1TNMA 3L3KA 4HJ1A 3VWKC 4HKBA 4WU5A 1W0VA 4HC1A 2FSEA 4N4YB 4RWYH 1NPNA 2ZUQC 3BGMA 3EJZD 3NSJA 1ZA3A 1S7SB 3CVIH 1NDMB 4QYOB 5M95B 2A74B 5IF0B 5TGBA 4D9RE 1IAKA 3LN5A 1J86A 5HHXL 4IOSA 1J0HA 2VB5A 2Q8BH 1FGNH 4RH4A 4PJ7E 3P4NA 3JVGC 4Z78B 1GAFL 3CSYB 5DA0B 4PH8A 2IDCA 3TBBA 4MAYA 2MQGA 3QUZC 3GSOA 4UQBA 3QUZD 1MHPH 4AEIL 2CH8A 3UTPD 3I3EA 3ZTJH 4QY8B 4LSDA 4RZCA 3G9AB 1EVTC 1FV1B 3ARRA 1L9PA 2EKSA 5IUSA 1WTLA 3QHZL 4IRZH 3QPQD 4P2CG 3HS0A 2YPLB 1J0KA 3RWFA 1LO5A 4QT5B 2YAPA 3TJHC 1AGFA 4ZW3A 1IGJB 2BINA 2QDWA 2YKKA 2H2SC 1BYPA 5LDUA 1MG2C 2AK4D 3QEUA 3RX5A 4IU3B 5F9OH 4QHNA 2P5ED 4V33A 3MA9H 3QBTB 2HVKA 4ICWA 3ZHLA 3QRGL 1JZJA 3GS4A 4EPSA 1JPFB 1FVCA 3KNBB 3BKYH 4OM0L 2OYLA 3IDXL 4LCWB 5JA9A 2RFXA 2FQFA 4PFEA 3NJJA 3US0A 2IVFC 4BYHA 2BMKA 3NJXA 5I1AB 5FO9A 3QUXD 3UL4A 2PMZA 2GJ6E 4LQFH 3ZIMA 1TJGL 5BUPA 3T0EA 5HHME 1ZVSA 3KLLA 3T65A 3G5ZA 1MI5D 4WK4B 5C0BD 1L7TL 1CE1H 3UG4A 3MXWH 2X1QA 5FHBH 3B7TA 5A16A 1H6FA 1XSJA 3L7EA 3D9AH 4L9LB 3PIQB 2B0SL 4HFUH 4OQTH 5F9WB 1E4WL 2WP3T 5D55A 3Q8EA 3SYAA 2VL5A 2YJLA 3EJPA 4L3ED 2X2IA 1CYGA 1WC7A 2AJXL 4AK2A 1XHHA 2W0FA 3KPSA 3A0OA 1S7QB 4L8DA 3UZVA 3QJHB 1FO0A 1JMZA 5EUKA 2Y7OA 1GRWA 3M8OH 4GKLA 3APCA 3ZHFA 4JPVL 4RAUB 1CLZL 4X5RA 4MAZA 5D1QE 5CCKH 3DIDA 4QJ5B 3PXJA 2CDFA 2I60L 3H2QA 4YHLL 1MREH 4JFEE 1VZGA 4JB9H 2WM0A 2ICWA 3QNZB 4JKLA 1ORSA 4MRBA 1BIIB 2UX7A 3DSFH 5DVMA 4YBQD 5HYQA 3NH7L 1FORL 2GBTA 3Q0HA 3HZKB 3BO8A 5J3HC 1RMFL 1KDIA 2XETA 2BVQA 4QXVA 2QJDA 2WYZA 3HE6C 3CZJA 1U8LA 2F9BT 3C5XA 3JWNC 3HAEB 2EYRA 2BNRD 3GMOB 1OAYH 3VXRA 3PJNA 3UFIA 1BQRA 1F3JB 3HAEH 4OCWH 4AYGA 1DSFH 1ND0B 1J5IA 5F1OB 3MJ8B 3DX1A 3DWTA 1A6ZA 3NP4A 1MJ7H 1X7QB 3CPUA 4J8RA 2XWJB 1X6LA 1BIHA 3AG2B 4HF5L 4ENEC 5EORL 1V55B 4ODUA 4NAQA 4ENED 5I30H 5KSVA 4JJ5A 5I6OA 4JFFA 2IPTH 4WEBH 5C3IA 3LEXA 1VGEH 4B9GA 1YNTA 1KPRA 2RCSH 4UOW1 4S1DD 1SEQL 3D3VD 1IC5H 3FZUD 4HIIA 2Y07L 1GMEA 3MA7B 1D6VH 1ZLSL 2VQ1A 4G11A 1WGVA 3OXRB 3CFIC 4L0ZA 1HILA 1MZYA 2G0KA 2LR4A 4OZ4A 4AEEA 1Q0YL 3DGGB 1IIIA 2BZDA 2ENSA 1CGUA 4R7NA 2J6WA 3BAYA 5KSAC 4GUCA 1QFWL 1IILE 2MEJB 3VXQA 2X7LB 5KSAD 1D5XB 5CEZD 2PW1B 5D1QC 2DQIH 2VR4A 1HOCB 2WK2A 4PRHB 3X11A 1YPZB 3BVNA 3LH9A 3E6HB 1NDTA 1P5UC 4W6YB 3GGWA 1T22A 2A9ML 2FBOJ 2HKFH 1SFDA 2WUCH 4UU9B 3EFFA 5IMLA 3CDZB 2X53A 4JEGB 2FO8A 3BHBA 2H3NA 1WK0A 4HWZA 4GSQA 2N56A 4HBQA 4P2OC 4KVCL 3VD3A 3ALWA 3EH2A 3QT2A 4ZQKB 3WMQA 3ARFB 1NM9A 1AHWB 4LMQI 1NGZB 1XGYH 2ZONA 1F4WH 1IBGL 2WAQA 3S2CA 1O6VA 1RZGB 3VQMA 1KENL 2A9BA 2GSGA 1KJVB 1U6AH 2FRGP 3N1PC 3OXSA 1FC1A 2XZCH 3HR5B 4TSCL 4PW9A 2K6WA 4UINL 5HY9B 4YHMH 3WGUB 1NCBH 2NY2C 3MDJA 5D7JD 5MERA 1KFGA 5ADPH 2MQ3A 1TR7A 4N8VA 5CIPB 3VFMB 3KZ8A 1D5BA 2O6PA 3KWVA 4RQQA 4EZJA 2R1WB 5HI3C 2RH0A 3KYNB 1UM5L 4OY9A 5AVXB 2DL2A 3QDHA 5HI3D 2EIZB 5C9JA 1JE6A 2B2XH 1R3HA 1M57B 1TTRA 4ZMVA 1EO5A 4GYBA 1NGQL 3PJSB 3VSQA 1OCCB 2HFEA 3GSNA 4Y5XC 3IAQA 3ABKB 2H3XC 4R7DA 4PJEE 4C83A 1BFVH 3G5XA 3AADB 4M1DH 5IOPA 4OF8A 1RHHB 3LOWA 4TVUA 4ZFOL 2NCMA 2FT8A 1W8NA 1UXSB 1IBFA 2P5PA 2Y2WA 4LCUA 3WFDH 2D3VA 1MLBB 3H9HB 1L3NA 5LHDA 3B9KB 4A39A 1JF5A 4U1JA 1CBVH 2EACA 3HW7A 1BX2B 4QAMB 3VFGH 4JO1H 1BVKB 1DBBL 2A6IA 2A7BA 2GG1A 1YAIA 4RGMC 1DE4A 2XOTA 1KPVB 5CJQH 4BM7A 4FG6D 3IDIA 1NCCL 2QADD 2MMXA 3UBGA 4W9FC 5BOPA 1ORQB 1UFGA 1TSRA 3HZMB 2IAMB 3BP5A 2EXTA 5HBBA 3C5ZD 3X1FA 4S0SD 3IEAA 4RRPG 4R4BB 2XFXB 3IJEA 1LK2B 2DIEA 2LVEA 4N28A 5JXED 2FD6H 1KCVH 3VFOB 4BWUA 4L9DA 4IIQC 2X4UA 2JH2A 4L1LA 1UZ6F 3BPCA 4NUQA 3P0VH 3PGFH 2B39A 4NUJA 3V0AC 1ZSHA 3DRTB 3JV5A 4X6FA 1RUKL 3UZEA 4NC0B 2RBLA 3RPKA 3DX6B 1UVQA 2Q86A 1C16A 2N59A 3PPSA 3JV4A 1QATA 5BZDB 3E7JA 1DQVA 3KM1A 3FXIC 4X6EB 3MLWL 4G6JL 4UAOC 3L5HA 4XPHH 3K4AA 2G2NA 3FAXA 1HOEA 4AENB 4AKQA 5I1HH 1DVXA 1V8HA 3QG7H 1D7CA 3HG4A 3FQXB 4PRIB 3MKKA 2FYYB 3TXAA 5LWYH 2OYKA 3HNTL 4J3OG 4V1DD 2YKLH 3VFWA 5E99H 2AEIT 1HZHL 1JL8A 4A2MA 2O93L 1QNZH 1RK0A 3F83A 5E23A 3D2UB 4IRSB 3UAJC 4JFOA 5D7SL 1YNTF 4Z95H 3UAJD 2XKNA 2F18A 1R46A 2AMUA 4XRCB 1D9KD 3BLPX 1IEBB 3L9BA 3X14B 1KCLA 3OKYA 1XSIA 4NXKA 1FYTE 2P5WA 3DNKA 3S35X 4I77L 4QOKA 5DRWA 3V2AR 2ZYHA 3BKCL 3UXFA 3UCQA 5FA3B 4QHUA 3OZ9H 4PRPD 2NY1C 1W72L 4LVHB 3AG1B 1BAFH 1MFCL 1AY1H 2IQ9L 2XSKA 3VA2C 4LLWA 1ZV5A 4P5KB 2YAMA 1EBPA 1T2QH 4OGQC 4ZMOA 1J9RA 4G6KL 2VLLB 3HPLA 2D7TL 1HE7A 2E6JA 3BISA 3KPRE 3PWUB 4GW1A 4FQXC 1RU9H 3VDAA 5EUOE 4FQXD 1UEMA 2I32A 1F90L 1K8DA 3C2AL 1FCCA 2OMZB 2OX5B 4NO0A 4J3OF 1PQZA 4D0BB 3NSXA 3RUGA 2IH3B 1CJYA 3QZMA 4RX4D 2IDQA 4ZFGL 3TN0D 5D7KD 1MNUH 1GHFL 5L9DL