3JWNG

Complex of fimc, fimf, fimg and fimh
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
144
Chain Sequence
ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chaperone protein fimC
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein binding/cell adhesion
total genus 21
structure length 144
sequence length 144
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnG00
4AVHA 4AVIA 4AV4A 3ZL1A 1PDKB 5AAPA 4X5RA 2UY7B 5FWRA 1QUNB 4XOAA 5AB1A 4AUYA 2JMRA 4AUJA 5JQIB 5LNGA 2WMPB 3JWNE 5AALA 5CGBA 3JWNH 4J3OG 4X50A 5F2FA 1ZE3H 4CA4A 2XG5B 5FS5A 5LNEA 4BUQA 1N12A 4XO8A 5F3FA 2W07B 5IQNA 4X5PA 3JWNG 4CSTA 4AVJA 4XODA 1UWFA 3ZPDA 4AVKA 3BFWA 4XO9A 3MCYA 4CSSA 4AUUA 5FLUA 1TR7A 5IQOA 4LOVA 4XOBA 2VCOA 2XG4B 3SQBB 4AV0A 2UY6B 3BFQG 3ME0B 4XOCA 5IQMA 5ABZA 3BWUF 5FX3A 3ZL2A 4J3OF 4XOEA 1N0LB 2JTYA 1KLFB 4AV5A 2J2ZB 3RFZA 4J3OH 4ATTA 1KIUB 4X5QA
chains in the Genus database with same CATH superfamily
1K6QL 3A67L 1ZK9A 4PJBE 3QUHA 2ICES 2J5LC 2HX9A 3ZYOA 3O2VL 2ZXDA 2XY2A 3MV8E 2L3BA 4DZBA 2H3XC 1F58L 3B2VH 4V1DE 1U58B 1RZ8A 1PDKA 3SBWC 3UTSA 2GJ6E 3ZDYB 2GKIA 3FT0A 4NKMA 3S36H 3RVUD 5C8JB 1H3WM 2HT4C 4G5ZH 3FMGL 3JWDC 3GSOB 2Y0SA 5D1XE 1QRKA 2DDQH 3BWSA 2IANB 4NZJA 5HHPB 4P2YA 4I8DA 1TFHA 3TESA 4YJZL 4L18A 2I60H 4GW1A 3EHBC 1K6QH 3EJSA 3PF2A 4G71B 1R24B 4JQVC 1M7IA 2EDQA 1L7IL 4XI5D 3O2VH 3MZGB 3TP4A 5CLWA 4MNGB 4R9HA 3AS3A 4AQ8C 4RWYL 5HXMA 5CLYA 2VE6B 3QR1A 1FHNA 2HTKD 3FT3B 3QPQC 1L3WA 1MJ8H 2DQMA 1JD7A 4AEHL 3QUYC 5HD8D 4WHCA 2BVPA 2MKLC 1XX9C 4HIHB 5DD1H 2WZPD 5F7HA 5C6TH 2YUVA 3ZMNA 4NS0A 4GUQA 1PFOA 2O30A 2AQ3A 3PJLA 1JNLH 4PHZA 2NXZB 2CUMA 5DHVH 5F9OH 2NPLX 4A7UA 2AK4A 2WCSA 3IDYC 2OXGB 4IBYA 3HCVB 1MCLA 2W91A 3VGGA 4EN3B 1V5JA 3IJ7A 4OFYA 1EAPA 1BSIA 3V0IA 3WAKA 1OARL 4U7SA 2VUYA 3HG5A 4NBZB 4CVXA 3K6SA 2VXUL 4CL7A 1N70A 1DR9A 2A0LD 5D7JA 5CS7A 2VLME 4X9GA 5IB4A 2DJ4A 5FYLH 5GGSA 2Q76A 1CXIA 2H7WA 2EYRA 1E90A 4LOEA 3FCSB 1ZA3B 3JV4B 3GZOA 2A9NL 2FBJL 2GBTA 3BFQG 4NXSA 5IB5A 1TFPA 1EWHA 2JQAA 2EDHA 2FWLB 4OZ4B 2X1XR 5AW1B 2VLLA 3WIHH 5B4MC 1KJVB 1MW3A 3NJGA 3SDDD 4WGVB 5F93C 1BPLB 2VQ1B 2ZCZA 1KLFB 2N0KA 1N4XH 2ADJB 1WFJA 4K94L 5DURD 1IM3B 3TT3H 2OSLA 2OQJB 3EFOB 3GBNH 3DKHA 1NIAA 4HWBL 4K3GA 3CH1B 3IT8D 4OSUH 4RZKA 1YMMA 3MRDB 4NX0A 2XZQL 5IMLA 1ZHKA 3BO8A 5AW7B 4XHJC 1CFNA 5HPMA 1B4JL 1N5AB 3QFJA 43CAA 3P9MB 4APXA 1TZGL 4JPIB 5KW9H 4WSJA 1DDTA 4YDMA 2A9NH 1LE9B 1UOVA 2QVMA 1EZLA 4LPWA 4GINA 3PHSA 4PRHA 2VDRH 4Y0GA 5T3ZL 1NC2A 2C9QA 4UT9L 4YXKL 1P4LA 4WEMB 4XE5B 1H8NA 4ZSOE 1U8MB 4N26A 1E9OB 2AXFA 4AMKH 1S5IH 4N8VG 3MVSA 4F3FA 1C7SA 1O6TA 3PAYA 2HT2D 3L9RA 2R7EA 3GS7A 4NJAL 3K71B 4WO4D 1TMQA 3G5VB 3H8NA 3KYNA 2Q10A 1A7PH 1T1YA 3REWA 4YDIH 3T0DA 1NGPL 2GAZA 4FL4B 4XNYL 4K71C 5FM4A 5HHMB 1T6WA 2IDSA 3O6ML 3LJ3A 2VLJE 3QCVL 4LSQH 3P4OB 2ORBH 3JWOC 3GK8H 2A4CA 1HKFA 5CGYC 3GIVB 3LD8C 5E8PA 3AMKA 2P8PB 3LEVH 1CU4H 5IR1B 1DN0B 5KS9F 4P07A 1DSFH 1JAEA 5EA0L 4TTGA 4PVNA 2WINA 2EJ1A 1L9SA 1EEQA 2CRZA 3HNSH 2QADC 1LWRA 1CE6A 3ILQC 4QYAA 4CN4A 1KB5L 3T6ZA 1SLWA 5JPNB 4PREA 5HI3C 1AC0A 3I6GA 3THMH 2W9DL 2GK2A 1WT5C 1RUAH 1S3KL 4F15C 2D7OA 2NXZD 2PETA 3HRPA 5I6PA 5JQHC 3BXNB 4Y5YA 1R75A 1U8OA 5FGRA 4KK9C 4K3DH 4EN3D 4P4KA 2ITEA 1SJXA 1XR8B 4FQHA 3ZW3A 2OMVB 4FX5A 3T0EA 5AOZA 3T6XA 1RZQA 3N04A 1ZRUA 1P1ZA 5HJBA 1H9DA 4NRXA 2X6BA 1DUZB 1GOFA 5TFSL 4G9DA 4LIQE 1BVLA 2YSSB 3ISRA 4POZC 5ALBH 1C12B 4EUPA 2CR6A 3RTQB 1KB5H 5I18H 3QQXA 5D7KD 3DVFA 2DEYX 3HZYB 4LRNL 1FCGA 2BIPA 4J39A 1S3KH 4HMEA 4IOFC 5DMGD 1S5HA 2HVKA 2EDRA 4LPCA 3VB9A 1J0HA 2B08A 1N19A 2P1YA 4TNWK 2WQUA 3FQRA 1BWMA 1WBYA 1AYRA 2B5IB 4FQCL 3LHPL 2W0LA 4L4VD 1IZJA 1R9FA 2CJSA 2OMXA 1IM3D 5T3XD 1MCWM 2XTJC 3WTUA 5GRUL 1FORL 2E4TA 2PLTA 4YC2B 1BMZA 2WQWA 1RK0B 2QV4A 3CZUB 1FWXA 3SGKC 2ROYA 4LLQA 5AAMC 1U8KB 4BGDA 4O51A 4HWZB 2HFEA 4CRPA 2KC0A 4FFZL 5TGBA 4RQQB 4JKPL 4ZOAA 1DVFA 1RIVL 5J3HD 2ID5A 4KGJA 4LRNH 1HSBB 4M1CC 1CYGA 3FU0A 4N22A 3PJSB 5E6UB 1CICB 1SFDA 2AEIT 2BW4A 4HA1A 2GJZA 3EDEA 2GVYA 1X6LA 3MOAH 1X4XA 5JR1L 2WP3O 1IAIL 3NFNA 2OM5A 3EH5B 3TCLB 3CFEA 2E4FA 3WFHA 5D5MF 3JTTA 3RU8L 2JI3A 3DBXA 3KJ4B 3PWUB 1MLCA 4N2MA 4QXWA 1FGNL 4PJ8C 1F3JB 4Y2DB 5D1ZA 5HY9A 3SOTA 3A6CH 3NCMA 3VWJA 4FTDA 5KBKA 4TLSA 4OZIA 4PJBB 3GXIA 1A7QH 3K5RA 2G60L 5E24E 1G1CA 2DQ6A 5J1AA 1H15B 3GHEH 3MV8B 5DO8A 4G70B 3D2TA 3BWUC 5K59F 1AE6L 3MRJB 4FXGC 4V1DB 1Y1DA 2HRPH 1KTLA 2VGLM 2GJ6B 4FXTA 2OMYB 2A6JB 3JWNG 3IETB 4AVJA 3UZQA 2PYFA 3PNWB 1UH3A 1MDTA 4LPVA 2WYIA 1DQDL 5D1XB 4JUTA 1BQKA 3MCLL 2DWSA 3RU8H 2W9LA 4MRBA 4N5EC 2OTUA 3FTGB 5I5JA 1KTDB 1A64A 1JCVA 4ACPA 4BKLA 3O41A 1GGCH 1XGPA 3LV3A 3MACL 1NCBL 4UQCA 4WEEA 5C7XL 1NFIA 2VMCA 1JYWA 4AMWA 4KNQA 4XZUA 3AC0A 4EI5B 1CXKA 5HJ3B 2BIIA 4OJCA 5HDBF 1E4WL 5IG7A 3MO1B 4NBXB 1C5DB 3LZRA 3AMLA 5I5IA 4JBSA 4JFXA 1SXAA 3EGDB 4J6IA 2YC1B 2FLMA 3FCTB 3FB5B 1X5MA 3QPKA 4MB1A 2YWZA 5EG6C 3TBYB 5ID0A 3QR2A 4YLBA 4LASL 4DEPB 5IFAL 2C26A 3UO1L 1QMUA 2LU7A 4NT6B 4ZMYA 4RA0C 2AW2A 4BINA 4M3JA 4CU8A 2VZUA 2NTFB 4LBAA 3EF4A 4J28A 3IMWA 4KJYB 4PJAE 3WL9B 3VXMB 1KEGL 4J5VA 2O5YL 2G0KA 2J20A 4X6DE 4GAYB 1YUHB 1ZV9A 3NJVA 4I18B 4NQCE 3ZU8A 4K5OA 4AL8L 4NQTA 5DO2C 3GMPA 2P28B 5I1LB 2IJ0C 5DA4A 5J5EA 3FQXB 3UMNA 4P9HH 4XB7A 2WNGA 5DHYA 3VW3H 3MRQA 3GQFA 3K6IA 4RBPH 1EXUA 4N8VA 5I1EL 3TNMB 1R5WB 3KJ6L 5SWSE 5BVJB 1X9QA 1MG3C 5IROD 5IFAH 4J3BA 3UG5A 4G6JL 2APXA 3KE0A 4QHLA 1JK9A 4LXFA 4MX7A 2PCXA 4CADB 1JD9A 3O9WB 4PAZA 4JFYB 4IRJA 2EC9U 2X4RB 1BGXH 3E1F1 2X7LA 1TYJA 2O61A 1CICD 3HAEH 2O5YH 2H0JA 2O5NA 4JO8A 2Y6SC 3GUTA 4FFVD 1YC8A 3NPSC 4RAUB 3M7OA 3ECWA 4AL8H 2EAEA 4MXQC 1QLEB 1P1VA 1GYAA 3TO4C 1WRFA 3S88H 3QUMB 4PG2C 2C3VB 4JG0L 4FCAA 3WLWD 2A3TA 2VZ1A 1EA9C 2FL5A 4Y4HA 3BD4A 3L9YA 3S98A 5AOMA 4KKCD 5EO9A 3FQTA 2G3NA 2ODIA 2H3NB 2YD6A 1BAGA 1SHSA 1Z9SB 3SDDA 2R0KL 3HBPA 3HG2A 4FI8A 2Q20A 4ZSOB 4U1MB 1J87A 1QFUL 4K0OA 4FMKA 4V1DD 4PB0H 4FEIA 4HC1H 1W0WB 2JK5A 2GJ6D 4UQ2B 5EWIH 5LDUA 1HZKA 3KLDA 4BQ6A 5DD5L 1U21A 3K7UA 5HP5A 4J12A 5GRJH 1ICTA 2V2WA 5FM5M 4CKQA 4WHYH 3SE3C 4D2NA 4JDVA 4HS3A 3R1GH 4IKIA 4ESKA 4XMTA 2Q7YA 1FC2D 4ALAL 2DMGA 2VLJB 2J5LB 3UTPE 1EUUA 4B9YA 1NJ9B 1TEFA 4B3EA 2W94A 1REIA 1VERA 2Q6WB 2WXRA 5CXPA 2IQ9L 1KF9B 1FAIL 3D3VE 3KBEA 4LHUA 3I3BA 1BBJA 5EBWB 4EI5D 1OGAE 1QFUH 2HKFL 1IFGA 5C8JA 2CBQA 1HK6A 2AI0L 2K4WA 4WO4A 1P5UB 3D2UB 2IMNA 5H37G 4EIUA 4JO3L 4YX2H 3DIDA 5IKCA 3RWGB 2XN2A 1DDHB 4LKXB 4Z77B 3ZL1A 1XB3A 3EHBB 1QFWH 4AQ1A 5EU4B 1QG3A 3CFTA 2XKUA 2Z8VC 2FUQA 4NM4L 1MVYA 5EOQL 1QVOA 2APSA 1DVSA 3I6LE 2VXTL 4MQXD 2V17L 2KERA 1T7VA 3NH7H 4NP9A 3Q5YA 4YUEL 1DVZA 1FAIH 2GT9B 2ROXA 3JT0A 4AE0A 4CVWA 5FWQA 4OIAA 3H4FA 1AS8A 2HKFH 4WCYH 3L16A 2VLMD 4LL1A 3R8QA 2ATPB 3K4AA 4HIHA 3U30C 2DEWX 3NZHH 3HN3A 5T5NF 5JW4N 4RAHA 4IKJA 2D7NA 4JO3H 4X4ME 1U30A 3WFCL 4XVOA 3GSUA 5DQDL 4LGSB 5C07A 1ET8A 5CJBA 2AEPL 1AZZC 1QFOA 3PP4L 4G43B 4TSAH 1WUNT 1OTTD 4HWEH 4H0IA 1LMIA 2OXGA 3A6BH 2AMUA 3HCVA 4LCCC 4PGEB 3WFDH 4C56B 4EN3A 1NANI 4OAWB 2WTPA 4FHJA 2GSMB 5LWYL 3HHSA 2X9WA 3HI6H 1CN4A 4Z7QE 1WGOA 5DWUL 2VXTH 4NI6A 4BM7A 4H44C 4LEBA 1AXSB 5E0FA 1YEFL 4GKNB 3C60C 3TBSA 2ZWKA 5BNXD 4BH8B 4QTIL 2V8MA 2BCKB 4UU9B 3QEGH 1MRCL 2YEQA 4C55A 1MFDL 4BQ9A 5I0WA 2CKBH 3MCKB 4ZD3L 5C9KA 3FSWA 3QHFL 2D4FA 3CVIL 4UTAA 4WJKB 5DQDH 2CJ3A 1ZA3A 1E5ZA 3JV4A 3SBRA 1PZ2A 1A66A 5IQ7H 2OMTB 2WQXA 1MHEB 3BVVA 3H7BB 1I7TB 4JPVL 5E2TL 4FE9A 3N5AA 3D50A 4RH4A 2B14A 1UH2A 3SYCA 1ZVHA 2X5PA 1VFBA 4AM0A 3L3OA 2VQ1A 4L4VA 4O2FB 3LPOA 4YDZA 1D9KC 1OB1B 1UCBH 1OZUA 4LCWE 1I3GL 2DQTL 1CS6A 2VERA 3EFOA 4G7RB 3P2TA 1Z0MA 1PSKH 2WCGA 4Y1SA 4I1RA 1LEIA 2RA1A 3I75A 4AY0A 3N3EA 1AANA 3P4NA 1M4KA 4ADJA 3C12A 2A99A 4WI9A 2H47C 2YS4A 3HUJE 4JPIA 4NNXA 3W57A 5A6IA 4PR5B 1IAII 2VLJD 2WUCL 1N0LB 4M8VA 2E7MA 1UM5L 1UWGH 4L1BA 2CMRL 4WI0B 3SCMC 4GG6F 3QJOA 1RURH 2N7SA 3DXAE 3F84A 3TASA 2P5PA 5A43C 1NAKH 4E2OA 3IPFA 2I69A 4HOXA 3G6JF 3O3EB 1U8MA 5EEYA 3SY0A 1KGYE 4K7FB 5H35A 3H54A 3KS0J 1HTYA 4IJ3C 3ATBA 2HT4D 1AMYA 2WD0A 4FZEH 3UG3A 4J2XA 5GRVK 3D2UD 5JW4M 1U8HA 3ZTNH 4K71B 4PS7A 1OL0A 4O4YH 4ZTEA 5KSBE 3II2A 1NCJA 4YE0A 1F4XH 1BZ9A 3AZUA 3ML9A 5INCA 2WLIB 1NGYA 3BUBA 3DIFB 3FRPB 3V4PB 3N41B 1A0QL 1CGVA 2VERN 4PVMA 3UYOD 4OUUA 4YBLC 1UM5H 3DRTB 2GSGA 2ZP0T 1NBVH 3EYSL 2ICWI 3KPMA 4J4PC 4P0DA 2NW3A 4DGVL 1QLFA 5I1HH 3B56A 4GSDL 2QADB 4ZK8A 1O5PA 3GI9L 4DKEL 1NCTA 5B8CB 3HIZA 3P40A 5I15H 3TS8A 5C0AD 3T2QA 2XFGB 3I6KB 4HALA 2FATL 1A8ZA 3KWWA 4G80A 4KHXL 4F15B 4KC3B 4PJAB 4BHUI 2EUVA 2EXWD 5KVDE 4R8WL 5JPMC 2JWYA 4AZUA 3N2JA 4E42A 3QHTC 2NY4B 4PRAA 1LO3L 2YRLA 4LBEB 4X6DB 3QDJD 5F96L 3EYSH 1F4WH 3NIDF 1ZT7B 3BISA 4L8SA 4NQCB 1XR8A 5GRWA 1E5CA 5CWSB 3DA0A 2EO7A 3QAQA 4FQQB 4KFMA 1XH1A 3SDCC 4DF9A 1GGUA 2EO9A 3VA6A 1KOAA 1QFPA 3BLPX 4BZ2L 4GSDH 3WS3A 1F6AB 1A7NL 2VDLB 1BA9A 4DKEH 4TUKL 5SWSB 3O4LE 4AUUA 1C12A 5BW7C 2P43B 1KCWA 2G5BB 4HCGA 4AYFB 2X2JA 2EEAA 3S37H 3BN9C 4FFTA 4ETQA 4N25A 1I4FB 1CVSC 2X28A 4HSAC 5F88A 1V7NL 1ASPA 3LXCA 3W2DL 4Z7UF 3ECBB 5A2KH 4X5XB 1U8PB 1J8KA 4XNXL 1RZPA 1HYSD 2XWEA 1DZ0A 4E9RA 2DKUA 2SEBB 2IGTA 5D55A 4K9EL 1XEDA 2NCMA 4KXZH 5SV4A 4E5XB 4N0CC 3GLEA 3NFSL 3OLIA 5IROA 4HWZA 4DAGH 1JPFA 5L8KB 5DJ8B 3BOVA 4YSSA 1KJMB 3GMLB 4GRMB 3X13B 5H37A 3QRFM 4IBVA 3QFDB 4P5MB 2CUAA 1ZGLB 1G7MB 3B6SB 2BNRE 3BSGA 2UXFA 3CX5J 3H6AA 5C0FB 1DQQB 2YRZA 1FJ1A 4FG0A 2J73A 2BSTA 4MVBD 1YYLL 4MA3A 4P23A 2LLNA 3GO1H 3W2DH 2N59A 5AW3B 1T0MB 5I8CB 3WG7B 2EE6A 2FEEI 3M46A 3F3HA 5CINL 3SY6A 1FO0L 4HKJB 2CO7A 3QZWG 2G2RB 1G0XA 2ZKMX 3BC9A 4PJ8B 1XGUB 1MFBL 3ZT7A 2I25N 3UTTE 1GW6A 3C8DA 1MCNA 3NFSH 3K3QA 4Z76B 4OJFL 4FQIL 2N01B 4R7LA 1J8HA 5SX4H 2Q9OA 3CXHJ 2UZYB 1EDYA 1SY6L 3O6FD 4U1NB 4FXGB 1PFCA 4JY5L 3D3VB 3MLYH 4RGOH 4PBDA 3MRJA 4UUJA 1OGAB 5I30H 4MSWB 3H3PL 1UUSA 1HE8A 2OMYA 2A6JA 3IETA 1QFWI 4N20A 1VZGA 3WUWG 3PNWA 1V3JA 3L81A 1IBYA 1LM8V 2QADD 4HWNA 4PV8B 4BFKA 5AVXB 2X42A 2J1KA 3ILQD 3UBFA 3BP6B 3OHXA 3BKJL 3QB7C 1HXKA 2R2BA 5HI3D 5T1KB 1MCSA 4AZ8A 1JPSL 5I6OA 3MNWB 5DMIL 3UX9B 2B2XL 1OSPH 3F64A 3QJFA 4Z7VE 3V9EA 3WN5C 4FQIH 4AXWB 4ZYKB 2VWEC 4AIOA 2C9VA 4R7DB 1TEYA 4CC4A 3DYOA 4ELMF 2NY4D 3M17B 2XOTA 3PU7A 4ZBJA 1ORSB 3R8BB 2YXVA 1A6WH 1CFQB 2ILLA 1I31A 4NQCD 2WYHA 4B9FA 1MFAL 1Q94B 3BH8B 3MO1A 5SX5K 1R3JA 3QRBA 1S2EA 1XZ0B 3SGDH 1URIA 4Y19D 3L7FB 4WGWB 3UH8A 5KTEL 1B6UA 1DTUA 1SEBA 3FB5A 3M1CA 1X5XA 4IMLB 4UQ3B 5IY5B 1NLBL 2A9AA 2ZAHA 4WW2C 4C57C 3D25A 4YN3A 5SWSD 3FQ4A 2CH8A 1ZHLA 4JFZL 1L5GA 5HJGA 1FZOB 3I2CH 4R6UA 5K39A 3CE1A 3D0VB 2Q8AH 3GSWB 3AB0C 4MD5B 4Z7QB 5FGCE 4M8QA 3TF4A 4QRTA 1J05B 2BNQD 4K2UL 1TTAA 3QNYA 3ALPA 3PLYA 4GAYA 1N5YH 1LO0L 2Z0BA 1VSCA 4Z6AT 3WV0A 4OR1A 4LOUD 2Y3AA 1IQDB 4HGWA 3F12A 4QMEA 5KOVC 3K81A 5DEZA 1CGXA 5DHVA 2VZOA 1WSST 3TNMA 1R5WA 3LCYA 2LVCA 5JIMA 1EANA 3P3SA 5GJTH 3K4ZA 1KPRB 4HHGA 2VMDA 5AZUA 1E8XA 2P8LA 2CO1A 2APTA 5D8JH 2JKJA 4ZFOB 5MERB 5B3SB 5EBLB 3EF7A 4HLZH 4KJQC 4HIIA 4LRIA 1FL6B 2VN3A 5E1AA 2XU9A 1A6ZA 5DYOA 2AFNA 4PI0A 4YAQB 4LCWB 5FKPB 5FCUH 2ADIB 5FYKE 2AGJL 4RAUA 3MRIB 2WXOA 3SODB 3VRIA 5JXAL 5IB3B 1UQSB 3QUMA 3SDAD 4BRVA 2VRQA 1NCAH 1SOQA 5F0LB 1CG9B 3LPWA 4PJ8D 5A3ID 5CLTA 3QULB 3HUJB 4XX1E 1EVUA 1JYNA 1G7IB 5TF1L 3WIHA 3EUDA 2NLJA 4CVZB 4WK4B 4LL9A 4L23A 3UTPD 5LGYA 2KZWA 1I1RA 4OFIA 1R3KB 2KH2B 4DP1X 2H3NA 1T5XB 3NESA 3WGVB 1W16A 3DXAB 1BD2E 3WMPA 5HGGS 2V7NB 1ETZB 4ZSOA 3LQAH 5TK2A 4WNQB 3L13A 2PYEE 4XT1C 1OGAD 2VM3A 2XPGA 3PAZA 1W0WA 5DUML 4F37K 4DO4A 3OAYH 3OXSA 4XCFH 3VSTA 4JL2A 2V5YA 4HPYH 1NSNH 4PJ6A 1K4CB 4FULA 1IQWL 3H42H 5KSBB 5FF6B 1AGCA 3DURA 2JCCE 1HX0A 1MKFA 4N5ED 1FIGL 1XEUA 4PBXA 4OM0H 1ZEAL 4NCC2 5TF1H 2MFNA 3APCA 2UUDH 1IGML 4HP5A 1FL5B 4WWPA 4N0UE 5D7IE 1D5RA 3SPIA 4JQIL 4BJLA 3I6LD 4TSBH 3LIUA 3S48A 3WFBL 5EBWA 3OKEB 4XTRC 3F6JA 3MHZA 1NGXB 2N1TE 2OJZH 4AX3A 2VC2B 2BOLA 3MJ6A 3O11A 4ICWA 1P5UA 1XGYL 3CHOA 3D2UA 1VDGA 3LRGA 3HAEG 1IQWH 3E1ZA 2IH8A 3NCWA 5GS1C 2EIMB 2W81C 3VNZA 4DNLA 2BRRH 2FVNA 2FDBP 4H8WC 2ZKHL 3HPLB 2F2HA 2EEBA 3T6WA 2VWEE 4W9HC 4Z7OF 3TJHC 1AG6A 2I24N 1A9VA 2BSSA 3QWRD 1KYUA 5DHEA 3P11H 4QHPA 2CWRA 2X1WL 4Z95L 5ESVB 5EEVA 1N64H 1HZLA 5M95B 5KS9A 4UZSA 1MAML 1ERNA 2LLLA 2Z64C 2DQDL 3CN2A 3DUUA 5AOIA 3X12B 4KJWC 4DO6A 3U30B 2R0ZL 3MBEB 1NC4B 1WZLA 5C0AA 3O4LB 4L8DA 4KO7A 4FTVE 2YBGA 5IHZA 3QG6B 4X99B 1PY0A 2MRYA 1IGCL 5JMRA 2GBAA 2FGWH 4NN6C 3QZWA 1MRDH 3FONB 5DVNA 4G43A 3DK0A 2YD5A 4LCCB 5F72S 4XPGH 3PL6C 5L0QC 4UM9B 1EEZA 1A4KA 4WI5A 3V6FB 4WHYG 1OM3L 4KXZI 2DQFB 5H2BB 2QSCH 3QDJA 1JXDA 5AVRB 5B1CA 1U8QB 3ZHNA 3C60B 3IDXH 4LCWD 1AGEA 1CXHA 4UOZA 4JEGB 3W0WE 2X3CA 4JGUA 2YUXA 4HWUA 1IVLA 4LLMB 4X7TB 1DLFH 2BCKA 4NBYB 4NQVB 5C0JB 4YIQB 2FX7H 2YN3A 4HQQH 3UJTH 3WUWA 3MCKA 1QNIA 1KG0B 4PJ5A 1FE8L 3QUZA 5E0QA 2OLDA 3X3FH 2BNRB 1OAQL 3KPOB 2F19H 4AC2A 2OMTA 1INQB 3KVDD 2NY1B 3DRQA 4MRCA 2AJSL 3DXAD 5BRZE 5CKAA 5EZJB 1D9KB 3UBXB 4PD4J 1D7DA 4O2FA 3E9TA 4OCWL 5DJ6A 5EO1A 2X05A 5IBLC 5T3XL 5SX4I 3L3HA 5C0EB 2F53E 3HZKB 2VL5B 3ARED 4GO8A 5JMOC 1AO7A 1YEDB 3JZYA 3WTVA 3C5XA 2LAAA 4XO3A 1UKSA 4ZUTB 3UTTB 1IBBA 4IBQA 2Z93B 4NZFA 5G4OA 3RIAK 1MW2A 3GSXB 5KANG 3K6OA 2LW3A 4POYA 4PR5A 4WU7A 1Z9PA 3CFDA 2FEDD 3BE1L 4XCYB 1L7TH 3F2LA 3BP4B 4AJVA 4L2LA 5E94A 4LOVA 3SCMB 4O2EA 1B3IA 4V2BA 3TYFA 2R0WL 3VFSB 5FYJU 2AABL 4ZUUA 4JFFA 2W80C 4MA8H 5EZLB 1SXCA 2XVBA 4IJ3B 3BQVA 1JUFA 1SDDA 2Y1VA 1NICA 5CCHE 3UTZB 5IOKA 1BAFL 5D5MA 3NRQA 4NZ8A 4BK5A 5CNHA 1KCSH 3OC8A 2FT6A 1UJ3C 4G6FB 4AT6A 2ZNWA 2BY2A 3FQWA 4HAKA 4DP7X 3BEWB 4Z7VB 5EOCH 1Y18A 1UOWA 1KTCA 2DLTA 2WVUA 3L5XH 4H88L 4QRPE 3M88A 1JMZA 1ZS8B 3O6FA 4K23L 1UH4A 4YBLB 3DX6B 2C3XA 4ZT1A 2WLNA 3DRTA 2RALA 4O02L 2R0WH 32C2B 2FJGB 4PGJA 3ZRFC 2Y22A 5KVEH 5B7FA 4JCMA 1CYXA 5TQ0L 5AW6B 3WD5H 3T0VA 1BZ8A 5B8CA 3MBED 1NC4D 4FFYL 4F9LA 3UYPA 3O4LD 3I6KA 1KPVA 2G30A 1IV8A 1JZHA 1E6OH 1EDHA 4OLYL 3EOTH 5JPMB 1OGTA 5C0DB 5LBSL 3UGXA 4LDEB 1OE1A 5FGCB 3RZCA 3GI8L 5E4AA 4PJEE 4TVPE 3US1A 4LBEA 1OD9A 4O02H 4X6DA 4NQCA 2XKNB 1P7KB 1D5IH 4KQ4L 1A4BA 4M43L 3SDCB 1JGUL 3MRRA 2CLRB 2ICWA 2LU5A 4RWHA 4Y19A 5TQ0H 12E8H 5TE6L 4KKRA 3VG9C 3QQ9D 2F9BT 5HHVH 2Y36L 5C0NC 4G1EB 4FFYH 4JR9L 4L0YA 3PUCA 3K8MA 2AJVL 4N3TA 2DM2A 2G5BA 5DJCB 3S3JA 4BRJA 5HVFB 3P73B 2BNRD 1T7WA 2I07A 1N6QL 4L37B 4YEFA 3BP5B 4JO1H 3FKUS 4KY1L 3A4FA 2BNQA 3U1QA 3NCXA 4BHUA 5ACZB 2NY1D 5EC2B 5F9WC 3SZKC 1UVQB 4HZLB 1LDPH 4PU2A 1D9KD 3ECBA 4X5XA 3FHEA 4MJ5B 4YHNB 3GMRB 4A37A 4YR6A 3E0GA 1YEWA 3NQKA 3SGKA 1I8UA 3QXDB 3ABMB 2ZUYA 4ZW3A 1FFTB 3IRPX 3D30A 3CU7A 1KJMA 5ICYB 1TIUA 3QFDA 3HAEA 5DJ2B 3B6SA 4QNPE 2NOYA 2IAMA 1BD2B 2RJMA 5C0FA 4OM1L 3SCMD 2YD9A 3TBBA 3EBGA 2PYEB 2ARWA 2VXQH 3BT2H 4M93C 1BZQK 4Z7WE 3LNFA 4J3OF 4P05A 3V9FA 1WICA 1AIZA 4K7PH 4D7BA 4UZGA 1MVUA 4UILH 4MJIE 3SDAA 4J3OH 3K0WA 3DTUB 2FGZA 3WE6B 2JCCB 4XBMA 5CN2A 4G6FD 4M7JH 1XAUA 1RHHB 1KFAL 5I6LA 3TVMB 4GMSL 3GS0A 3TOPA 4JVUA 1RZGB 3QNFA 4DN4L 5H4ZA 4PJCF 4N0UB 2UZYA 5D7IB 4B7IA 4O9HH 4PBVC 3B7RL 4HC1A 2A1WH 2ZUSA 4U1NA 4HK0B 2H41A 2N56A 5FWRA 4HKBA 4BYHA 4MSWA 4F20A 1R3IH 1SJHA 2NNAA 2B1AL 1CTOA 5EB9A 1XF2B 4V2CB 5AZEL 3P2BA 1B90A 1DQJA 1XL6A 1YEHH 5IVXF 4NZDA 3BP6A 3MFFA 4MCYB 4ZAKC 2VLKE 2GEQA 3CBKB 4JFOA 3LEYH 2VR5A 5DI8B 4K8RH 4RESB 3ENEA 2TAAA 1YN6B 4R7DA 1GPOL 2ITDB 1SMDA 4YHOH 3I50H 4UQBA 2QT6A 5JA8B 1MNUL 1CFQA 2E27L 1RULL 3PWLB 2EE9A 4Z78B 2X10A 1NMAH 1H5BB 3CSGA 1KBBA 2X6AA 2VJXA 2P46B 2VL4A 3OKMB 3B43A 4QXGL 1ODAA 1UM4L 3G9VA 4GAAA 1G7JB 3VQLA 1H9VA 1UWEL 2WKOF 4IMLA 4L5FH 4WO0A 3I9IA 4WW2B 3KGTA 4FTVB 4NQDE 4R0LC 5IQNA 4YHZL 1G5AA 3EUUA 2D2OA 1QEWA 3ZTJH 4BSVB 4XAWH 2BP3A 3A23A 3DJZA 3WY4A 3AB0B 3QWRA 1JV5B 1Z7JA 4W6WB 5F6IC 3P0VL 4MD5A 1GPOH 4ZOEA 3HZMA 3ARGA 3OWEA 3FBKA 2EH7L 2WVTA 5EZIL 4RAVB 1T1ZB 1UZ6F 4LLWB 3W0WB 4LPXA 4B53A 1NCOA 4WGKA 5DTFA 4AQAB 4HUUA 5E99H 5I6XC 4BEIA 4QXGH 2AKRA 3KGSA 3FO0L 4OQTH 1UM4H 1IC7L 4G82A 4NCC1 1K4DB 1GZPB 3S35H 2H32H 1T04B 5LQBL 3MJ9L 4BXVA 2A4ZA 3P1VA 4NQQA 1XF4B 1JRHH 1M56B 1Y1UA 4UZUA 3ILPA 2XXGA 4P9MH 4YHZH 1MF2L 3G5YB 1H3TA 2HYMA 1ZLWK 4UV4H 4GY4A 5DRZB 1YNLL 5BRZB 2NY5C 4XWGH 1FL6A 1TJGH 1UYWL 1WAPA 3NIGF 1U8NA 3U0TB 1Q0EA 2VQ4A 2Y9RT 2ADIA 2EH7H 2F53B 2WXKA 3OGOE 2OMUA 4LSVL 3IBOA 1S7SB 4H8VA 4S1RL 1IRAY 1YN7B 2CKBA 4QT5A 4XB3A 1X3DA 4FDWA 5C6PB 3MRHA 5GZOC 1QI4A 4AC4A 5GRVL 2WLYA 3FO0H 4HJ0C 3MYJB 3LS4H 4N28A 4IK7A 4JZJA 3KPQB 4PM1A 5DJYB 5HHXL 4IRZL 1G7IA 4JVWA 4JHUA 3TVMD 3NIFF 3STLA 4JG9A 3X1GA 1R3KA 2UXTA 2G3ZA 4PGCB 5KG9A 2P8MA 4YL9A 3C9NB 4YBQC 2I9TB 3DXAA 1SZNA 4WSKA 4MA7H 3GGWA 5DRWA 2V7NA 3ULVE 2QELA 5HGDB 3DNKA 2ZYRA 3KW7A 4B41A 2PTTB 4M62L 3FU5A 4I9XA 3DX7A 3GBMH 4R97C 5I23A 3IF1B 5JOFA 3AREA 2O72A 4LSVH 5INDB 4KNSA 3BDYL 4GAGH 1UD2A 1YEGH 4KV5F 4NP4H 4NPKA 4Z3EA 4H5SA 1BFSA 4XPFL 1MRFH 1TQSA 3FO1A 3WDIA 1KCKA 4G7YL 2CCLA 3LKRB 4QRPB 4S10A 4NRYB 4WEBL 3ROOB 3V10A 5CEZH 3II3A 4UI2A 1DJYA 2OFQA 4YE4H 4U1KB 3QG7L 2XN9E 4UDTA 1OT4A 2EYSB 4OJDH 4P5SA 5PCYA 3QQ3B 4HK3N 4XNQA 1FNLA 4M02A 5IVOA 2ZPKH 1C5CH 3V4VH 1A3LL 3G6JA 3EYFA 1HQ4A 4LAJH 3TBTB 4MA1B 4KPHL 2OL3B 4UIMA 2DLFL 4JPQA 2WZ0A 4TLKA 1EJ6A 4HLZG 4Y4FD 3QQ4B 3JWDL 2OK0L 4AYMC 4AVKA 4XPFH 5GS1B 2Q87A 4FTVD 2FYVA 3VFUB 3WS6A 1SYSA 1CK0H 3RWCB 1HQRB 3EH4B 2GHZA 3JSSA 5C92A 3CSTA 4XN1A 5GHWH 5C1MB 1TR7A 2Y25A 3QG7H 3SE4A 4PJEB 3CSYB 3IFOB 2VM4A 5MEPB 4PJDA 3FO2B 4XC1L 1CL7L 1R0AH 1S9KC 1S7XB 4KAQL 1QFWM 4J27A 4KNUA 1S9VA 4HW6A 2ZF8A 1AACA 4QTFA 1DSWA 2JJTA 1ZWIB 1HEZB 5F1IB 3X12A 5IMOB 5EIQA 1GGTA 3MBEA 4LIQL 1BVZA 1QW8A 4Q6KA 4N8CH 5AUMB 1KELL 4JL1A 1A9BA 3O4LA 4MJ6B 4DPBX 1B0GB 3U7YL 5DQ9A 4NN6B 3KPLA 4LVOC 1AR1B 1DEEA 1SDYA 2HG0A 2YAMA 1KIQB 4N2FA 5EMYA 4YPGB 3BPNC 1UEYA 2NCEA 1I1FB 2R1YA 4KJQD 1BVKB 2EDYA 4P5TC 2PR4L 4PLKC 5KSAB 1WV7T 5BRZD 3HHMA 5H2BA 1HSAB 4H8HA 2Z7UA 3MODH 3WEMA 4DK3A 4WTXA 4GXFA 2F53D 1IGTA 3R19A 3FOMB 3WNNA 1TLMA 3N9GH 5IMMA 1X5HA 1HFUA 5EFIA 3GTNA 4JZNB 4EIBA 4NQVA 1I9JL 4ONHA 2DQHL 5C0JA 5AENA 3TPUB 3GKZA 1A6TB 4KKQA 1IMHC 3L2NA 3FL7A 3D18B 3KCPA 1WA2X 1XTLA 2ZWLT 4OCSH 1N0XL 2R0LL 5L6YH 3MRGA 3ZXAC 2ZWYA 1INQA 3TA4D 3U82B 3VFMA 5IW6A 1MFEH 2JCWA 5J6HA 1AQDA 1NAMH 1Z9NA 2PR4H 4Z7WB 1CFVL 1R33A 4XVJL 3INUH 4XO5A 4MJIB 3DUSA 5C0EA 3OKDA 4C47A 2VL5A 4XP5L 5E08H 4UOW1 4CMMA 1YEDA 4KXAA 2CRIA 3NVQA 3V0HA 4XPAL 5BRPA 4ZUTA 4HUVA 3DOHA 2E59A 4OFKA 3JV0A 3KLAB 1AOZA 4P06A 4F7MA 4HHWA 3ZZQA 3K6NA 1OD7A 1ADQH 2CXKA 4QRPD 5G5DB 5HGHA 2EACA 1GTFA 3LH8A 4XCYA 1IEBB 2ENSA 4G7SB 1JDAA 4P5KB 5F7FA 3TH3T 2VISB 2WXIA 4NZTH 3MOBL 4GP4B 4K5PA 1EJFA 4M48H 3VM5A 3ULUF 3MRKB 2MPVA 1CFVH 3ZPDA 5EZLA 2WW8A 1XGRA 1XH3B 3OZKA 3Q43A 3L4WA 3ARXA 4ZQKA 3ULUH 3UTZA 4D3CL 1U92B 3FUIA 3IJHB 1UJ3B 3JQOB 2J1ZA 3LRSA 1RUPH 2VLKB 4F7TB 5CSBA 5AOJA 1HILB 2XZAH 2VCOA 4J3WA 2WXFA 4PJ9C 3VJ6B 2VZTA 1VGKA 4ZTOH 1GY2A 1ZS8A 3JWOL 2Z8SA 3DMMC 4OJYA 3V4PL 1XO8A 4ETYA 3T8MA 1R3LA 3BZ4B 4W4OC 4TVPD 3SGJA 2EDTA 32C2A 3EJQA 5C0RL 2DD8H 4HKXA 3RNQB 4C54A 5D93C 1MCCA 1E28A 3C8KB 2GSIB 4GUOA 1VIWA 4URTB 3UJIH 4IK6A 5AYUH 2GBUA 3AXLB 3HBGA 1KSRA 4NQDB 4YSDA 3KWTA 3IWUA 3ZKNC 2IPKB 4M56A 1IE5A 5F7EL 2GHWB 3RIFF 1AR1D 5F7KC 1FFNB 1TTCA 3CUPA 4J8RA 4P59H 4B60A 1BQSA 4N86A 1WA0X 5I8OL 4MAYC 4D0BA 1HCFX 1Q72L 2H9GB 2NW2B 4ZDHA 3UEZA 4NKQB 2YGVA 4ELMA 5JXED 1TQWA 3E38A 1P5VB 4FLQA 5DHXB 1YHPA 5DF0A 5KSAD 1F8TL 2XKNA 5ABAA 3RWEB 1IIKA 1JRHI 4Y5VB 2G9HB 4R2GC 4PY8I 3SDCA 2PCPB 4JY4B 4NUQA 2CLRA 4JDTL 4OIIH 3ORJA 4X5WB 3ZO0A 4DERA 5AD0A 3DDGA 3VG9B 1I8LC 4GRWE 3A22A 4B96A 2ZAIA 3A4DA 2GPZA 3QBTB 1IKOP 1INEL 4X8JA 2HCZX 3O3UN 5D2NC 1SLUA 2ZUWA 4MQ7A 1X9LA 3NJLA 4BWUA 5CD5C 5F21B 5KVGH 5CP7B 2VDNB 1E2VA 3NQIA 5DJCA 3KL0A 4R7VA 2BFVH 2ZJSL 2HLFC 1MCFA 5TE7H 4LVHC 5PAZA 5I8OH 5ACZA 5HGAA 5EC2A 3QS3A 3L9EA 1XH0A 4HZLA 1I8MB 5CCKL 3NP4A 3IXAA 4MJ5A 5J1SC 4AGOA 1BF8A 1FG2B 4JDTH 4R84A 2OJEB 5GGRB 3VFRA 3L48A 5T1JA 3I3EA 1AFVL 1UA3A 1INEH 2CALA 2D0FA 2XXCB 2WXNA 1BP3B 2VDPH 1ZIBA 1IEHA 1BIHA 4PLJC 2PO6A 3CHXA 1XR9A 3WXVH 4G7VH 2Z92B 3CC5B 3TT1H 5DD0H 4MAUL 2ZUXA 4I77H 4M93B 3BIKB 2CLVB 1HHJA 1TKWA 2NYYC 1SM3L 1IO4C 2R1XA 2J3SA 4HULB 2X2UA 4RZCB 5DEJA 3QJUB 5CCKH 1TQUA 1WGVA 4YXHL 4RX4D 1T80A 4GQ9L 1DBKH 1TJMA 4H1LB 2VQTA 2IFFH 1NEZB 3WE6A 4Q74A 1KCUL 3OZ9L 1DANT 3GIZH 4M6NL 3C6EA 3C5ZB 1IE4A 4M7LL 2VLKD 1UB5B 2FQFA 3TVMA 4S1QH 4WENB 1I9IH 2J4WL 1TZHA 2XN9B 2ETWA 3KYAA 2E7DA 3ZDZF 4N0UA 4PB9L 4PWKA 3HPJB 1HWGB 1ECYA 4R26H 4U1JB 1YPZE 4PIBA 1A6AB 4PSPA 1WFOA 4ZX6A 3UYRL 3LKSB 2ZCLH 2ATAA 1CI5A 1MWAL 1JZEA 3L8QA 1XF2A 4BWWA 1E0OB 1P4IH 2HFFA 2VAAB 4TQEL 4Z23A 2WXPA 4GQ9H 4ZAKB 3TEWA 4NQDD 3UC2A 1AKPA 1HE7A 4M6NH 5CO1A 1B4RA 4JDEA 4M6MH 4MB4A 1ZJBA 2ARJQ 3HE7B 3RX7A 5DI8A 3V4VB 2IVFC 4WW1B 5DZPA 1T2QL 1BOYA 1YN6A 2G9KA 3UACA 2P7TB 3PREA 2BNUB 1QI5A 3BAWA 4XHQA 3LAFA 2CM5A 1WBXB 5E03A 4R5VA 1L0XA 1AKJB 1L0QA 1TQVA 4X0KB 3ZRCC 5MEQB 1H5BA 4Y4FA 3OKMA 1OK0A 3UJJL 3GXUB 4MGXA 4QHMB 4JDZB 4LVNC 4R0LB 1J9SA 2LFEA 4TQEH 3ZYIA 4FTVA 4NAQA 3T0AA 4HIJA 1ZY9A 5D96C 3DVNA 1ZTXE 4O2CA 4U1SA 4FLHA 5E8OB 3V4LA 1CI3M 3VFTA 4PWHA 3AQZA 3B1UA 4MWFA 3VXQB 4KXCA 4J3OG 3U4BL 3N40F 4X7DC 1LL1A 1QI3A 2CO3A 1T2QH 1KXTA 5D6CB 4KX9A 3W3BA 3NA4A 2JXMA 2ZUVA 1TO5A 3P9WB 1YC7A 3NZUA 1TU2B 2HJLB 2PWEA 4NNYB 4DQAA 1U93B 3TO2B 5D7HA 4JO4H 4FLSA 4J7RA 4Y4KC 3VWKC 5I6XB 5GS0H 1MFCL 4ODVH 3MQIA 4XP9L 1J5CA 1OAYH 1VADB 5A2IH 1VCAA 1D5MB 5HVWA 3UCRA 1K4DA 1GZPA 4TLUA 5D2NE 1T04A 1FZJA 1OCOB 3QJHA 2IH3B 1W72L 1XF4A 3SQOH 4Z7NF 1ZLUH 2PW2B 1HH6B 4F7PB 2YD7A 1K3ZA 2NZ1A 3EOYG 1RUQH 3G5YA 2ZOWA 3H56A 2QGEA 3P30H 3QDMD 1PZ3A 4ZFOL 4UT7L 4YHPB 4ZMTA 2YR3A 2VSCA 5CD3A 5DRZA 3US9A 4EQ2A 3U0TA 1S6NA 2MSPA 3NACH 5JNYB 3ULVD 3EKCA 3C09C 3T0WA 3JYCA 3WCYA 2KQMA 1BQLL 3RWDB 2MMXA 3RGHA 4M03A 1S7SA 2Y5TB 4D8PA 1FP5A 4HXBH 2ZT9C 3PABB 4XCEB 5C2UB 1BEYL 4RNRA 4JW3A 3ME0B 2VIRA 3JV6B 1HHIB 1JPGB 4FQ2H 4HSCX 2X12A 3ZL2A 5EPMB 3C5ZD 4N2AA 1YNKL 5GS2D 1W72H 3CDZB 1NAMB 2FHBA 2XN9D 3FH5A 3KS0H 5DS8B 5MENE 3MLPA 3LNDA 2PP8A 3A47A 3NCBB 4H7VA 3DPBB 3X3GH 5IEKA 2I9TA 2XBDA 3VD9A 4OF5A 2F58H 3ZTJG 2OMWB 3ZGHA 2PTTA 4R97B 5EO0B 1G9NC 4F8TA 3KLSA 1SGKA 2ATKA 2EDFA 5INDA 1JCKA 2A9BA 1GH7A 1JFHA 4YDJB 3EJTA 4TLTA 3STZB 43C9B 3K4DA 3BYTA 4ZAKD 5HHQB 5GGVH 3HTLX 1BX2A 2HAZA 3H9ZA 1JZ7A 3LKRA 4QRPA 4HJJL 3ROOA 5F7DB 4P2OC 1YNKH 3KG5A 3K0YA 1E6JL 3LB6C 3WJJC 3BVXA 4IIQC 1WFNA 3HE7D 3RPBA 1QPPA 3MRLB 3ZSTA 4G6KH 5FUZH 7FABH 3QQ3A 3GPSA 1MNNA 4IRSC 1G87A 5DVKA 1JGDB 2K78A 3AY2A 5ERWA 2MIZA 3AITA 3BQUC 1BWWA 2Z1PA 1GZQB 4B9JA 5F9JA 3TBTA 5HDLA 1AKJD 1IGFH 2Y06L 5CIPB 2VC2L 4WSGA 1H0DB 1TNNA 3ZZ1A 1CO1A 4HETA 4M00A 2GTWA 3CXFA 3TZVA 1Q9LA 3IDIB 1NDTA 2X88A 2E46A 5KVDL 3RVTC 5HI5C 2FIKA 4S1SH 5J6SA 3DO3A 3P3TA 5CEXB 3AGVA 3ZX1A 4I13B 4KROB 1JGEA 1M05A 3IFOA 2X2IA 4JHVA 4WU5B 2PPEA 4JM2B 5K9KB 1KBGL 5D9SB 1LEKB 4UQAA 4AG4L 4A63A 2QMKA 2XN0A 3POHA 4AGMA 1E42A 1HHGA 5DD6B 3REVB 3CFCL 3CK0L 5C08A 4NUJB 4GRWB 4ANKA 5K9OA 1ZWIA 1HEZA 2J8UF 5IMOA 1U8LA 4L0PB 5IWLA 2YZ8A 3Q8AA 3IGLA 5K33A 3MCYA 4LKCB 5I1KL 5DFWH 3U9PH 2FLRT 5LXVA 4LVOB 5BJTA 2ZSVA 4P5RA 4WFFE 1DYZA 1SJEB 1I85A 2YGOA 2E6QA 3BPNB 1KIQA 1LEGA 4QXTB 1N59B 1E2WA 4MNQE 3EO1B 1WJ3A 4FADA 2A74A 1T7YA 3H3BC 2A77H 3MNZA 2Y7QA 1BVKA 2RH0A 4XXCA 5JXEA 1WIOA 5KSAA 4Y8DC 2Q86B 1OCZB 5JDJA 5JIIA 3WY2A 5JIPA 5JHLL 1KBGH 1G7HB 4OF3A 3D69B 3JT2A 1M6OA 3TV3L 2HRGA 3FOMA 4FFYA 5CZXD 4ZS7H 3UDWA 4EI0A 3UPAA 2EVJA 1PU0A 2H0FA 4K15A 4N2BA 1GSKA 4ENEC 1DBJH 2OP4H 4P46C 2G75B 5I1KH 3TA3C 3RWFB 3TPUA 2BVQB 2VDQL 2Y1AA 1SJMA 2VUOA 3D18A 2ED6A 1ES0B 2RR3A 1OPGL 1AI1L 3CN4A 2Z65C 1JZGA 3CHSA 1AJ7L 2J12B 2H2PD 3OSKA 4RMUA 2R56L 1WK0A 3AM8A 4ANVA 2XWTB 4BCZA 3CVDA 1CFSB 1R34A 4IKLA 2QZ5A 3NOIA 2VDPB 5H8DA 4XCNA 3CQQA 4EMZA 2JNZA 1F11B 3FFCE 5JUEL 3VFOB 4D94A 2XPZA 2B0SH 2CUIA 4DGIL 1L9NA 3CHPA 3PGFH 1A4JA 1OAUL 2JF1A 2VDQH 1OQOA 2VXQA 3MR9B 1UA7A 1IEBA 1CFBA 1CLOH 2YJQA 1YPZB 1T7ZA 3HBQA 2VISA 2GCYA 1FRGL 1T6BX 1YSOA 2WCPA 1CDYA 2Z6FA 3D39A 3MDJA 3ULUD 4JE4B 1AH1A 5ITBL 2B15A 3SGEH 5C0IB 3DOIA 4RX4A 5I1AA 1CVRA 2P24B 4QYOA 4H4NA 2IBZY 1V54B 4GW4B 2VN7A 2JVUA 4O58H 1WWAX 3FU9A 5FFOA 3RWJA 1JWSB 2VLKA 4F7TA 1WE5A 3CLFL 3HG3A 4PJ9B 1HILA 3IE4A 5E2VH 3ET9F 4X6CF 2XTSA 3QC6X 2RAMA 1ORQB 2K6WA 2C1OB 4DGIH 4AGLA 3DMMB 5D2LE 5FIEA 3VMNA 2BDNH 1S8DA 2FTAA 2Q3ZA 3FU7B 3NT0A 2YLHA 3MCG1 3DX0A 4KROD 4LMQI 4RGNC 3U7WL 1BFVL 1EVTC 4FABL 2Z9TA 2DYSB 4N0FA 4A66A 2WLZA 4JM2D 5D93B 2EADA 3GTTA 4KQ3L 3U2SA 1JJUA 4YFDB 2XA8L 4U6XA 2ENJA 2FYYB 5IFJB 3ARYA 1CXLA 1TJIL 3OZLA 3L4TA 1U8IA 2CIKB 3OAZH 4HKZA 1P7QB 5C7ZA 3T1WA 2YGPA 4QXUH 4FF9A 1XB6A 1ASOA 3GFUA 2F8VA 4H20L 5FYJH 2CZNA 1FFNA 2CJUL 4I0CC 4MAYB 2BERA 4DGUA 3MYZA 3OAUL 3VTAA 1BFVH 1MWOA 4FABH 5J6GB 3B34A 1HXMA 4R2GB 2AJXL 3WIIL 5T33L 3RFZA 4Y5VA 2G9HA 1WAAF 3BKCL 2FBOJ 4WV1C 1U0QA 2PCPA 4JY4A 2CNYA 2X6CA 4W9KC 5E51A 2XA8H 1GC1C 1T89C 4NOBA 1KLGB 2WKOA 3GSRA 5D2NB 1NIBA 1TJIH 4NENA 1PF3A 4FNPA 2BVOA 2D0HA 2ED9A 5IB2B 3QUKA 4KZDH 2VH5L 3N06B 2JQMA 3MTXA 4G1MB 1RFDL 3TBWA 3H9SD 4DKDC 3PFUA 2WPGA 3MLZL 4UWQB 4XB8A 3WXWL 1AS7A 4F7CB 1YQ2A 1MHCB 3BZFB 3IGKA 4PV1C 3L3GA 3SEPA 2X3AA 2IPUK 3ZE2E 4FA8A 3OPUA 3SBPA 4QRRE 5FYKL 4JPSA 4LCIL 4JB9L 1I8MA 4OQTA 2GUYA 4FKHA 4YQXH 1NGZB 1ZSHA 2MKWA 3WE1A 5BOZG 1MREL 3BKCH 3QXAA 1M9WA 1S9XA 2JI2A 1N8ZB 3DX9B 4XC3L 2AQQA 5CJOL 2IMMA 4HHAA 5DK0B 4ERSH 3D08A 4LO9A 3AFLA 3BHBA 1AGFA 3QSKB 5MENB 2QGDA 2BH0A 3OPZL 4LNVA 1OAJA 2XV3A 3LQZA 5E7FA 3QDMA 3IMSA 4TXVB 3NTCH 4YDLC 2J44A 3AY4A 2BY0A 4JFDE 2Z92A 1WITA 1ZE3H 3L54A 1EO8L 3H2QA 2CLVA 3FQUB 1PKQE 3SPCA 1IAOB 5I1DB 3LNIA 2CRYA 3QIWD 3TH2T 4UF7C 4HOMA 4G6ML 2AK1L 1EJOL 1MI5D 3NN8B 4RFOL 1VEOA 3L5WB 4PFEA 5E6YA 1XIWC 1EO5A 2NY3C 4KKAC 5DEFB 5KYUB 3ESMA 2V5MA 2VN6A 3C5ZA 5I0ZA 4J6RH 2VDMH 1DQLH 1A1NB 4Z8FL 4AKQA 1AC6A 2DQEL 2R59A 2DBJA 2DMBA 1ONQA 2XN9A 4ODSL 2DQIL 3ARRA 3OPZH 1RH8A 4OGAD 3DMMD 4ZTPL 4HG4J 3H3KA 1QBLL 3KNBB 4BA0A 2WXMA 4WUKL 4U1JA 1LDSA 3MLUL 1CGSL 5LCVH 4ZNEA 3EXJA 5I9QC 2WZ6A 1V55B 3VA2C 4EDXA 1QYGH 3T3MF 5LGKA 1PYWA 3ARBC 3RJQB 1QA9B 3DYMA 2AK1H 3P4MA 1OCWL 2W0FB 2BSBA 3EYOB 1EJOH 1BZOA 3OC5A 4RFOH 2Z91A 5DJXA 2IEPA 5FPIA 5I8KH 1M2OA 3CDGB 4OUOA 1SJVA 1F4YL 3TURA 3J8F7 3HE7A 1XGTB 4G5AA 4Q9BA 3DVGB 3V4VA 4I4WB 2VDOH 5GGRY 1U3HB 5CN1A 4ZTPH 4RGNE 4DPAX 2FX9L 3MRFB 1QBLH 2BSCA 1ZKAA 4HISA 2P7TA 3FTZA 2BNUA 4MMXA 3D09A 3DTXB 3WTSA 1WBXA 1RUKH 3IGAB 4U4BA 4R2GD 1TENA 2UZPA 3OGCA 4GKSA 3T77A 1HNGA 2HJKA 1XGZA 3I9GL 4LVNB 4FI7A 2X4PA 2OSWA 1WG3A 2R8SH 4JDZA 1KENH 2CD0A 2M1KA 4DQOL 3PHQB 2FD6H 5D96B 1HZHL 1OCWH 2C7UB 4KNTA 4XN7A 5CD5D 4ZXBD 5F3BA 4F33A 4PRPE 3IVKB 4MNQB 3RNKB 1K85A 4Y9CA 2E6PA 2DI9A 1E9PB 3PAVA 5KYXB 3OKOB 1KZQA 3T2PA 1BMWA 3M07A 1YUKB 2EEXA 1QTYT 3IB4A 1CQYA 3U0PA 4W9EC 2PWHA 4Q7DA 4Y9EA 5T1DL 2HJLA 2CU9A 3SKNB 3MBXL 1U93A 1J0IA 3LH2L 3VWKB 3L1OH 1XFPA 2DQUH 3SDXE 1IBGL 4ONFL 1ETA1 4S2SB 4PTUB 1D5MA 2UVEA 2K7PA 1NGQL 1OK8A 2AXJA 4DQOH 1RXLA 1PG7H 2E3VA 2IH3A 3PS6A 4L8BA 2PW2A 1HH6A 4LAQL 3MLTB 2EINB 2GTQA 3WMSA 3QJXA 5ADOH 3QO0B 4QRUA 2EDEA 4BFNA 4HVBA 4YHPA 3T3PF 3ZTEA 3CPUA 2DTSA 1MQ8A 3C09B 3B9VA 4Y7OC 2NYYD 2RCSL 4I0PD 3BZ5A 1CFMA 3B2XA 2Y5TA 3LH2H 3VRLF 1X7TA 4KTGA 3GM0A 3ZE0E 1ECZA 5F9DC 1SBSL 2I5YH 5F89B 3JZ7A 3DJTA 4ONFH 1IL1A 4XO9A 3FFCB 3JV6A 5B39A 3VAEA 3DO7A 1HHIA 3VD0A 2AS5M 1W80A 2WUBH 5EZPA 1TVBA 1T83A 3CMOL 3EYUH 3QW9A 2VYRE 3BUYB 3SGEI 3X1FA 1CLVA 3CDZA 1NAMA 4JHAH 1T21B 5DS8A 5EU5A 3CWGA 2VLRE 4M1DH 1D2OA 1RJLA 3I9AA 1KXVA 1M7UA 4LU5L 3DPBA 2A4EA 1CGYA 4NO0A 4WY7L 2OR7A 2NUPA 3T3PE 4DVBA 1HCVA 1P6FA 4F2ME 3TNNB 4M61B 5J89A 1IGYA 1MCKA 5DUBA 3GJFH 4PJFF 4ZO8A 5B38G 5I71C 2QVIA 1JZDC 3OB0H 4JFSA 2HPTA 4YDJA 3RHWK 1ADQA 4ZFFA 2NTSP 5E6IC 4AEIL 5HHQA 3PIQB 1ZVSA 4N1HB 5D2LB 2YBRB 4IIQB 5T5FL 5EF0A 1TTRA 4JO2L 1TF4A 4MCNA 2C3HA 4PVBA 1VZIA 3IBEA 2QVFB 4IRSB 4B27A 1U3HD 4TOYL 2WWMC 1FVEB 1JGDA 4WY7H 5DQJB 3I74A 3AWGA 1E7VA 1HXYA 1GZQA 2HVJB 4LSRL 2OL3L 3BDBA 2BP0B 2WOBA 3B2PA 3KYMB 3WNKA 3PP3K 3E8VA 1RZFH 1NKOA 2WTOA 4XXWC 4P4RB 4XVSL 1ZSDB 3HC0B 4F7KA 1KV3A 2WOYA 3K2KA 4PJ7F 3E2HB 4WFFD 2G4GA 4IU2B 5LB1A 2CDGB 2X4UA 2R39A 1LD9A 4H8WL 4RVBA 1DJXA 2UWEF 3LYRA 4D7PA 2BLFA 4YXLH 5D6DA 3EDKA 5CEXA 4JO2H 1R4XA 3PDGA 4CU7A 3CZFA 4TVPL 4DW2L 2CIIA 2YPVL 4F27A 3OXRB 3GKWL 4JM2A 4TOYH 4PMFA 2D3LA 4B9KC 5DD6A 3BW9A 4GQQA 2MCG1 3VDAA 3ZHDA 3P77A 4U1GC 1HIMH 3IDJB 1I7ZB 1QKZL 2DJUA 4LKCA 2WBJD 3KXFE 4KTEL 4MXVF 5FS5A 4Y16A 1HL9A 1KUMA 2AJZB 4U6TA 5B22A 3AJ7A 5IK3B 5K1JA 1XF5B 2GITA 1SJEA 2EIZB 3AW5A 1M6UA 1IBHA 1IEAA 4OIBA 2NZIA 2WB7A 3VTTA 1N59A 1K8DB 3KBHE 3EO1A 4R3SA 4S0HA 1TG8A 1LK2A 4LLDB 3RUGE 3ZE2B 1P6WA 2CGZA 2OYMA 3P0YL 4QRRB 3GSVA 4WFHE 3ABLB 2WAHA 1FDLL 1T1WA 5CFHA 4J3UA 3RL1B 5AW9B 3H53A 4KZEL 2ESVE 2AHIA 2F5AH 3OKLB 3RKDC 4PVLA 3RGVD 1JWUA 2LGNA 1RJYA 3U9UB 1NBYB 2E9JA 1FH5H 1JF1B 1B3JA 1NA8A 2FEJA 2YSTA 2KPWA 4MZ2A 1AQ8A 3ZKMC 1QKZH 1RZKH 2G75A 3CLEH 3UP6A 1SVCP 4BCYA 5TF0A 1DBBH 1MCIA 3H9SA 5CEYB 4YH6A 1NMBL 1ES0A 1W9XA 4JFDB 3WIFA 4AIEA 1MIEL 4GW5B 5E8DL 2OXHB 2FJHB 2Q7NA 1R46A 4NO2A 5D7JC 1KJ2L 1YEJL 2YFOA 1E4JA 1MQKL 2B1HL 1PKQB 3ELQA 5K93A 2XCMC 3QEHB 5HPOA 2DBLL 3FT2B 3W82A 4DGYH 4KZEH 6TAAA 1CFSA 5J0BA 1JDCA 2VB5A 3RDTD 5M94B 3W37A 3FUHA 4G8EB 5HHNB 1IB5A 4FNUA 1AD9B 2MPAH 3MA7A 4R96A 2NY6C 3QORA 3OX8A 1Z5LA 3UIZA 3MAWA 3N42F 3MR9A 3LS5H 4JANA 3CFNA 1Q1JH 4HPHA 4ZMNA 3HC4L 1I3UA 2AITA 1ID5I 1OSYA 1PBYA 4IRSD 4BSWB 1FV1B 2Z4QB 1KJ2H 1LO2L 3GNMH 3GB7B 2TSBA 3N1MC 1MQKH 2B1HH 4GXUM 2DBLH 3QIWA 2IH9A 1QSZA 4HJIA 3F58H 3ARDA 2VDMB 3IKCA 3EYQC 2P24A 1MI5A 2XZZA 4NWTL 1AAJA 4UNUA 3ILEA 3PWNB 3HR5B 4FNLL 4D0DB 5LVEA 1FPTH 4YO0A 3D52A 5L2JA 3NZ8B 2PW1B 4CW1A 2H8PB 3FRUA 2LE9A 3RVTD 5HI5D 2DPKA 3DMMA 2V2TB 2EDDA 2P4AB 3CZGA 1O0VA 3FHQA 4RGNB 4PJHE 4RSYA 2UZXB 3HC4H 3CXHK 5D72L 2BWIA 4NPJA 2DWEB 4U3SB 5FKAB 5LN4A 3KPRA 2XX1A 3BESR 3KLKA 5G2NA 4JFPA 4TV3A 3CIAA 2XG5A 5IFJA 3RL2B 3CU1A 3SPJA 3MXVH 2CIKA 4TF4A 4NWTH 2ZG2A 3KH4A 2VDOB 5FYJD 4PRPB 2WKGA 4WK2B 3S8WA 5EULV 2HKHH 4YGAB 1MCOH 4RDQG 1AIFA 1YJDC 2NSMA 2EXSA 4TL5A 4PPTA 3OB8A 3TBVA 3GJEA 2A38A 3UZVA 3UTSE 1QBBA 5JW4R 4OLUH 3IPEA 1B9KA 2XBZA 4WV1B 3CFBB 2YIHA 3SDXB 3GBDA 2GJPA 4N0YL 3RPIB 1F6FB 1KTBA 2UY6B 2AVGA 3LKPB 3UGUA 2YKKA 3MROB 4G6AD 3MN8A 3MXWH 1W0VA 5I17A 3P3YA 1TMCB 4X4XB 5BO0D 4IU3B 4ZXBA 5KVFE 2ODHA 5B38A 1G6RH 5E2UH 3VFVB 3M1BA 5HBBA 5IB2A 1J8RA 5ABZA 4A7VA 5ANME 2M8XA 5DJDB 2VDNL 3MJ7B 4DSYA 5I2IB 5KBLA 3FFOA 4Y7MA 3PPEA 2LT9A 1INDH 3FT1A 4U6YB 4C58B 3T0EC 4CBPA 2FJFA 1EGJL 1MHCA 4JFDD 1OY3B 5DJAA 3HI5H 1BBDL 2XTLA 4ATTA 2BCMA 2WQSA 3MUGB 2WAQA 4XVTH 2X4OB 3L45A 2JB6A 3NK3A 1QBMH 5I1CL 3ZE0B 1Z9LA 1NGZA 3UL4A 4E9XA 2X0VA 2D2CC 3O3AB 3VXSE 3R18A 2WV3A 5AAWA 4GP5B 3NEXA 4YHMH 3SO5A 2Z34A 5IM7B 2W95A 2X0WA 3LIZH 1U2YA 1QTPA 3DX9A 3EDJA 2GY7B 1CBJA 2H45A 1ZT4A 5E4OA 5HJDA 4QWWD 1S7TA 1U4FA 4TYUA 2B20A 4PCYA 5AZ2H 1A6PA 2VLRB 4JVPA 4D9LH 2D7PA 1MY5A 3VG0H 2JJWA 4ZX4A 4F2MB 2O6CA 3AS2A 4N24A 4I0PA 3VXOA 1QD0A 3EJRA 4FQLH 1IAOA 5CGTA 2B3RA 4GQRA 1FZMB 3IM1A 1U8CB 3ZHFA 5FAAA 3VCLB 3DGGB 3EFFB 1ACYH 1DVFC 1LP9E 3NN8A 4OZFB 3L5WA 4XNUL 1M57B 3VU1A 5DEFA 2W9EL 5KYUA 3MV9A 4GS7B 1TZOA 2OZ4L 3WKNA 1J0KA 1GTNA 1IBZA 1MXDA 2CO6A 5AWNH 4FI6A 4XCCH 3GMNA 2CGYA 2LR4A 5LJYH 4CA4A 2Y23A 1ZDSA 1YEIL 1TJHL 2Y07L 4RGND 3MLRH 2P80D 1ILSA 4JHWL 3VQMA 3VDBA 5I9QB 1DLHB 1DQIA 3T65B 2IBGA 4DUWA 4OW6A 4XP6L 2GJJA 3G04B 5LXGL 1WZKA 4FNRA 5D1ZC 2D31B 1CD1B 3TLRA 5L9DH 3VWJC 3FUEA 2D7QA 3W1ZA 5KZCD 2V8LA 3U9WA 1QA9A 1SHXA 3EYOA 3SYOA 4CSSA 2K45A 4PRHE 3Q44A 1XD1A 4JHZA 4JJ5A 1K2DB 4PRPD 2CGRL 4JX0A 1XGTA 2PWFA 4NZRL 3DVGA 4R5XA 3HB3C 5CHNB 1U3HA 1NEPA 4HBCH 4YS4A 2CK0H 3N6YA 1YEIH 2NY2C 2Y07H 4IEFA 3ZMEA 3B5HA 4EKXA 2VM9A 4JHWH 3DTXA 1E67A 2IPTL 5H94B 1JERA 5TDNB 4WJ5B 1V8HA 4Z0BL 4H13C 3C5JA 1A22B 2WWKT 4QKTA 3WI9A 3KXFB 2H1PL 4B9IA 3IRZA 1Z3RA 4OZHF 5JW3H 4JAMB 4X6BB 1ZA6A 4YNYA 5KSUA 2NNRA 1H3UA 4R4FL 3B3IB 3V6ZA 3FSOA 1KIUB 1VEPA 5IHUL 3IVKA 3RNKA 1SF5A 2GFBA 4XMUA 4UMGA 3RUGB 1I1YA 1RP8A 1OSZA 3CXDH 1JWMB 1LWJA 3OLDA 4P2RD 3RVUC 2GK0A 3LZLA 1ACXA 3MGAA 4AQEB 4GO9A 4AV4A 2ESVB 3WEOA 1J5IA 2LVEA 1FL3A 1V27A 4WWKA 3IS0X 2NY7H 4OB5L 2J8UA 1GRWA 2VR9A 4AOFA 1MCPL 3ZQXA 5DJZB 3GC3A 4TULH 2WBJA 1ZHNA 4S2SA 4HAGA 2WNWA 2ZKYA 3EOAA 3X11B 4OGXL 3WKQA 1BIIA 1SXNA 3P69A 1Z3GL 3DBSA 3BGMB 4XXDB 1OTSC 2J71A 1CT8B 1U8JA 5GGVY 3VB8A 3VD1A 5IHUH 1BYOA 4HMDA 4PJDF 3T0EE 1CLYL 2BIHA 2VO5A 2NY5L 3HE6D 1A47A 4DPRA 3IJSA 5HD8C 4YPJA 1N2RB 4KKZA 3RFRA 1LLAA 3DROA 4QOKE 2IC2A 5EC1A 5GRYA 3BH9A 3QZNA 3D85B 1ZXQA 2IXQA 1F3RB 2QLYA 4PRNA 4WTZG 4XBEH 3RGVA 4PQXA 2JB5L 5CUSL 5IVZA 4XBGA 4ODUB 3DVIA 3RG1C 4XX5A 3CDCA 3DJRA 4LEOA 3RB7A 4QRSB 3SKOB 1EHLH 1IFHH 4KKAD 1B4TA 4L48A 2B4CC 1G1KA 4IRJC 3Q6GH 1JMXA 1QWHA 2EE0A 4RMQA 3CVCA 4JFVA 3OKKA 15C8L 1DJWA 1JGIA 3AQYA 4CKVX 1OALA 1PCXA 3BVNB 4PG9A 3OMZA 5KOMC 3HNVH 4X6EB 3TBCA 2H26B 3IKKA 3DSFH 3BFOA 1GKOA 1IKNA 5T1LB 4NCDA 5I71B 3SE9H 4Y4HC 5K9QG 3RDTA 4ZFZB 1QUPA 1X5GA 4PD4K 1NFDF 3L7EB 1UT2A 1EEUA 5E6IB 1RZIB 3S4SB 2X6MA 3IJEA 3PV6B 4ADGA 5GGUB 4FYQA 4I3GA 3UTQB 1NMCC 4IOIB 1CF1A 3SDDC 4YSEA 4L8CB 1PIGA 1KCRH 5AOLA 3S5LB 2IIJA 1D6VL 5D2LA 2GB2A 1IGJA 1E2ZA 1VCBC 4MJ4A 2XG4A 3RYMA 3D6GA 2VXVL 5FW6A 5C3LD 3G3LA 4PJHB 4IRSA 4V11A 3C08L 1P6AB 3SYQA 1G9MC 3NA9L 4PY7B 4H25B 3WTWA 1NFKA 5FHAL 3DX4A 2CLZB 2YOCA 5DQJA 1RJZB 4QGYA 4ODHH 2D7MA 2HVJA 3D4CA 2HLEB 3NJIA 5DZJA 3AUWB 3BAKA 1BXVA 1ZSDA 2FT7A 3HC0A 3MC0A 1K5WA 3PE9A 3KXFD 2JLPA 3ESNA 3V0EA 4N1CA 4X6CA 3ZSSA 4DZBB 3RVWC 3GZKA 4OCMC 4R7NA 1PLGL 1RZ8B 1PDKB 4IOSD 4TPRH 3UTSB 3UC0L 4TM9A 2E7BA 2AF2A 2VXVH 1YNTF 2ZCHL 4E9LA 4WFHD 3OXRA 1IUZA 2BWQA 3FTYA 4WO4C 4ZQTA 4JM4H 2L7EA 4UNTA 2KHAA 5E6SB 5FHAH 4MASA 2ESVD 3X14A 1RK7A 2CNZA 4F8OA 5DMKA 2C5DC 4GW1B 4AQ1C 3IDJA 3IDGA 1M7IB 3DX1A 3QWOA 5B3NA 1XDTT 5ANMB 3GRWL 3HMXL 1XF5A 3QT2A 2NY0C 1G4RA 4BQBA 1K8DA 4WNJA 1C8PA 3U1PA 2VN4A 4XRCA 4LLDA 4NERA 2UXGA 2O93L 5ES4B 3II1A 2BVPB 2X38A 3UAEA 1OAKL 3QC5X 3D4YA 1HWHB 2AJ3A 3MRNB 5BXFB 4H8PA 1WAAA 3MV7D 3VXSB 1BQRA 4WJG3 4HDIA 3MLXL 3MLSH 2XT1B 1YEKH 2EH8L 2NXZC 5MP6H 3E7JA 1IKFL 4WFED 3TJPA 3PWPA 2B59A 5LGJB 5I1IL 5DFTA 2NX5A 4EN3C 3NSYA 5CEYA 1PX3A 4XWOC 3GRWH 4CVXB 2WLLA 4JPWL 3L08A 3FO9B 4JFDA 4X7CC 4A6YB 1RPUA 4LSPL 5D7JB 2FJHA 4NM8H 3V8CA 4AITA 5IB4B 5GGSB 2Q76B 3HA0A 4LARH 2EYRB 3V5KA 5E2JA 1OPOA 3N0PB 4LB8A 1OP5K 1RU9L 5T1LD 4OGZA 2XPYA 1LP9B 2YN5A 3D07A 4OLVH 3C2SA 3WNJA 1EHXA 2VLLB 5E6ID 5DMGC 2WNXA 5CU9A 3VFGL 4G8EA 2PPFA 5DT1H 5HHNA 1NTDA 3ZR5A 4ZO6A 3L3OC 2OSLB 2X9ZA 3BWZA 4E9QA 3I02A 4PJGE 1ODUA 5D7SL 1FV1A 5IMLB 5ACLA 5FLVA 3GB7A 1ZHKB 1JZ3A 1CFNB 3WHXA 3GLZA 43CAB 2R69L 2MTAA 4UAOB 4A2DA 3AXHA 7PAZA 4Z0XA 4TVUA 1UB6A 2NR6A 5HVGB 3T4YB 5J3HC 3PWNA 1BZ7A 3G5ZA 2A6DA 4PRHB 3KM2A 3R7RA 1ZGLP 5DLMH 5IV2A 2M26A 1NC2B 2H8PA 4KK8C 5E5MA 3QYNA 1HDMA 3HZVA 5F3HB 2AXFB 3DX8B 4MBOA 5LCVA 4ODTL 1NCHA 1BDYA 3UTSD 3MLVL 2P80A 3GHBH 3L9RB 3MX0A 3U1SL 1J5DA 2QR0A 2DYRB 3KYNB 1QNZL 1T1YB 2MCPH 2DWEA 2ZAGA 2GAZB 4Q9RL 5BV7H 3K80A 2R69H 4N5UA 4RMVA 3IFNL 3N43B 4JN2A 3QRGH 4WTZA 7TAAA 1ZTXL 5E8PB 3TU6A 1PEWA 3U7AA 2N0MA 1FN4B 4MB5A 4DP6X 4TNGA 4OCYL 2WINB 3V4UH 4YGVA 4OCXL 1QHPA 3WY1A 4M29A 4LESA 2JELL 4CC1A 3P0GB 4J3XA 1H6FA 2UZIL 1GMEA 1EQWA 4HFUH 4I3SH 4K4KA 1OT2A 5I26A 3RKDD 3H85A 3I6GB 3CFBA 4JG1H 2P44B 3VXSD 3RPIA 1NIEA 4BZ1A 1XBRA 1BJ1H 1ZLVK 1TZIA 4Z18A 1UWFA 3OD3A 1Q0YL 1OWWA 2WIIA 1AZNA 3S37L 2I26N 1DL7L 5E1HB 3ZKMD 2HFGH 5ALCH 5BMFH 4E41A 2C9AA 4NXKA 4X4XA 1U8OB 4IU3A 1FBIL 2J88H 4YWGL 2BP8B 2R29H 4Q0XL 3VFVA 3SDYH 4H8UA 1DFBL 4CGTA 2XVKA 3J27A 4L8SC 3T0EB 4MZIA 2PPDA 1P1ZB 4NRXB 4P2RA 3V0DA 3GSNL 2WLJA 5D7JD 1BM3L 2V2XA 3QAZB 5DVLA 3LX9A 4QOKB 5GGQL 1H3XA 1QEXA 3MUGA 3DX2A 4G9DB 5BZWA 5B3JE 5J56B 1YG9A 4EUPB 2A73B 2CA3A 4FJYA 4MS6A 4UQDA 5C07E 2AQTA 2JKWA 4GO6B 1WBZB 3O2DH 1WZ1H 1HEJC 1DBAL 4OY9A 4AYID 1XCTB 2HVKB 4O5LL 3HVNA 3S3DB 1DL7H 5LHDA 2FO1A 4DWHA 4ZS6C 3NABL 1MZYA 3RWIA 3EOBA 1FBIH 3VYOA 2OKMA 2V5RA 1NUFA 2B5IC 4QRFA 1DFBH 1JE6A 2ZXWB 2OMXB 1UD8A 3HE6A 3FHAA 4L3EA 2BXYA 1HI6A 1AHWA 3CG8A 3GSNH 2YKLH 3FUNA 1UZ8A 1SYVA 4LLQB 4DTGL 4O51B 2HFEB 3LVEA 1NCUA 1FZMA 2DEXX 2KLRA 2IOMA 4K3EH 4MJHA 4ILDA 1U8CA 4NHCL 2XX0A 3BUPA 3V52H 3VCLA 1A6UL 3UMTA 3CFMA 3FQNB 3G6DH 2WN3A 5IFHL 1IM9B 1K9TA 3FQ1A 4KI5C 2UY7A 1IGIL 4O5LH 4ZFGH 4IKKA 3LQMA 5HDQL 1DUYA 4UINL 4P23C 3N55A 2QKSA 1OW0A 4FFVC 3NFNB 1E5UI 1TETL 3WFHB 2BHUA 3GJFA 1KXHA 1MSPA 3QCTL 3LY6A 3JTTB 4P3CH 3TIDA 3DBXB 2A7BA 1MLCB 1WZMA 3KVPA 4RA3A 2V9RA 4PJFA 2QQQA 3JVGA 5D1ZB 5HY9B 2QPUA 3VWJB 2VW4A 4LPUA 2ARJA 1P69B 2D31A 3J7HA 3LMJL 4KKCC 2P47B 5JDSA 4PLNC 1GGBL 2UYLA 5J1AB 1NUNB 5E4IA 2O6PA 3RI5K 3L3IB 3N85L 1J1PL 4A2MA 5J7CC 3AROA 2LLGA 2BX5A 4BUQA 4X98B 4Z3JA 1KTLB 3ZO9A 4XH2A 4EJ1C 1A3RL 3UZQB 2GI7A 2PYFB 3M86A 4BK8A 3VX0A 3FUMA 2NY2B 3W81A 3L4CA 2W0PA 4NKIL 4U1HB 4XMLL 4F57H 3OMAB 4GKOA 3OHXC 4I3RL 1BXXA 2OTUB 5MI0C 5DHMC 3D0LA 1CDCA 1Z6JT 3O41B 3U2JA 4YBHA 3DJSA 4OT1L 1QTSA 3KXFA 3JTBA 3LMJH 1JGLL 4PJ7A 3HBZA 3LV3B 3X17A 3MREA 1OP3H 4JAMA 4X6BA 4IHOB 4XOBA 4CC4C 3B3IA 4XZUB 3IMVA 1J1PH 5EOCJ 4PJXF 4NEHB 5IG7B 3CVHL 3IE9A 3RUGA 4IBWA 3T0ED 1JWMA 4JFXB 5I6MA 3GLDA 1NUGA 4I9WE 4F7EA 4HX1B 4HGMA 2CPUA 4QOKD 1GJUA 5ID0B 3BH4A 4XMLH 4P57A 4YZFF 3SKJH 5GSRA 3HR6A 4DEPC 3BKYL 2ZYIA 4FHBD 3Q5OA 1IT9H 3B5GA 3GXDA 4UANA 5E9DA 4DP2X 1W8OA 5GQBA 3GMQA 3DOSA 2X6VA 3RDJA 2QHRH 2CQVA 2OJ1A 3NRFA 1UD4A 5F7LB 3F05A 3G5XA 1TZAA 4MQXC 1YY8A 5ESQA 3T2LA 1NPNA 3FQYA 4TTDD 3GMPB 2WGXA 4TNVK 3FYEB 3L2LA 1MJ7L 3CVHH 1J86A 2HSIA 2IO5A 5AKSA 4Z3FA 4PJIF 5DHYB 1IC5H 3NCJH 3EAKA 4JFTA 3MRQB 1NUDA 5FK9A 1EXUB 4N8VB 3MV7A 1B6DA 1P9MA 4UTCA 5DR5H 2JJUA 5KN5B 4QHLB 1JK9B 4MX7B 4QRSA 3F7PC 3SKOA 4IRJB 1UGNA 1IM9D 1JZJA 4LRIC 2F54E 2ED8A 1JFQH 3QEQA 5DXWA 4AH2B 4LNRA 1XXDC 1S4IA 4PJGB 1T0PB 2DM7A 1T22A 3S96A 2A6KA 5HDRA 4HXAH 3T2NL 3ARQA 4JM0A 3PAUA 4N3UA 4X6EA 5IF0A 4NN7B 1G9NL 3NJHA 1XWVA 4MS8C 4ZODA 2FL5B 3K6FA 4Y4HB 5T1LA 2IDFA 4Q14A 5IBTL 4J3TA 3LN5B 2X4SA 3SHSA 3VWJD 4IBLT 4ZFZA 4GXVH 3VQ1C 3QJTB 5EO9B 1F97A 3FQTB 3QNZA 4Y2OA 1Q0XH 3QIUC 1NMCB 2H5UA 4AK2A 4KI5E 4JLRB 2MQ0A 1CUOA 3ESOA 4HCRH 1S9YA 2MEJB 3RA7L 3T6VA 4E9TA 4CSTA 5K9JL 2YK1L 4U3XA 5EZOH 2JK5B 1V3KA 3EBIA 4KI1A 1NFAA 4GRLB 4GMTH 5FUOL 5F8RC 4E0RB 3IRCA 1O7VA 2NY2D 4PY7A 4H25A 3S5YA 5ID1A 2V2WB 1EIBA 4PS3A 1E4XL 4HS3B 3DTDA 2Q7YB 5SWQB 2BJMH 4XXWA 1QZNA 5CKGA 3HJ0A 1RZJH 1OAXL 1J8HE 3SPGA 1B88A 5I5MA 3OSVA 5SWZA 4X80H 1DBML 2J6EL 4NB7A 3UJIL 4LHUB 1BBJB 3LKNB 3EH3B 5ILTL 3IU3A 4BSJA 1B0WA 1CR9L 4ZUWB 4XP4H 3F85A 3N1PC 5DUPH 3RLSA 4WO4B 1X5AA 4BV1A 2FB4L 5FUOH 3VXRE 1Q4NX 2P26A 3VGBA 1P5UC 4WLCA 5E1GA 5IKCB 4LPTA 2J1XA 4OIFA 1LE5A 4JN1L 2CBMA 2IFGA 1EFXA 1OTUD 2XJKA 4AQ1B 1UGKA 1LXMA 3A67H 3OQRA 5H4YA 3VGEA 4CSZA 3ULSA 2RB8A 1I3RA 1QVOB 2BHZA 1X9UA 1HH9A 5ANMA 2WZ5A 5HYEA 2D0GA 1OTSD 2NY0B 5IVNA 1ZPUA 2X09A 2WJ5A 2APBA 1F58H 3M6DA 4NPYA 4DP9X 1NZRA 2DYPB 2QQKL 4DUVA 2DW5A 2KDGA 1JBJA 3FMGH 2KZKA 3MRNA 3T04D 3GSUB 5BXFA 4ZO9A 3VXSA 8FABA 1HOCB 5C07B 5J9PB 1G6RA 2EXWC 4N6QA 4JKNA 2ISDA 2DTML 5LGJA 3ZTCC 1T1XB 3HHSB 1L7IH 4IRJD 1CD8A 1VA9A 3OKYA 2FSEA 1T20A 1THAA 1IFRA 4RWYH 3AWFA 2XI9A 3BP7A 3FO9A 4H8QA 2XZCL 3TBSB 5CSGA 4U0RB 3C6LD 4X7FC 4AIZA 2HUEA 2ALWA 5DU7A 4AEHH 3VI4F 3E8UL 1QLRA 3MJGX 4C8XA 1A14L 4BUHA 3LIZA 5EEUA 2P5WA 4Y4HD 3WUZA 3X1BA 3QUZC 5ICZB 1LP9A 2V9UA 3H9YA 3BZEB 4QHKJ 1RKRA 4Q58C 3HN5A 5I1JL 3EJCA 3H2PA 1VF5C 4FXLA 4AM0B 1VFBB 5GGTA 3L3OB 1OARH 4L4VB 5IW1A 1T6VN 1M53A 4PY8J 4S1DD 1BVNP 5I8EB 3S3SA 4KUZL 5FYLE 2VXUH 1HYSC 2VN5A 3PPSA 4GRLD 3D9AL 1QATA 2IBZX 5D4QA 2J1YA 3S7GA 4CDHA 3V0VB 2VR8A 1LEIB 3I75B 4BFFA 5AVTB 2LU3A 3FB6A 2XQYG 3P4NB 3SKMB 4PYHA 5DMYA 4NNXB 3BVDB 4OKVA 2F7PA 1JHLL 2FBJH 3T4YA 4EIGB 1JXKA 3DPDA 2LV4A 1P53A 3DJ9A 1YECL 4W9FC 2L7UA 1KEML 2E9GA 3ALWA 3ASNB 4MVBC 3RVWD 5F3HA 1KC5L 3SY0B 4LHUD 5H35B 3DX8A 4K94H 1O9WA 4XPTL 4CN1A 1JNJA 5EUKA 3TFKD 3SPVB 3V0JA 3Q8FA 4HWBH 4BK5C 1AZCA 4KKBC 5T1MA 1U8HB 2OMZA 3KGRA 2XZQH 2RQEA 3QIBA 2B77A 1JF6A 1B4JH 3JV5A 4AIXA 1BZ9B 2C9SA 3FFDA 5L2KD 1TZGH 1NBQA 3FK3A 5INCB 1NGYB 1AXTL 1JHLH 3O6FC 2EIKB 1ETB1 4PLOB 5GGSY 1FFOA 3X1NA 3R0MA 4OUUB 4U7MA 3S3PA 3LZPA 3S5ZA 2GSGB 4AW4A 3KPMB 4KQ0A 1KEMH 1FN4A 2KKQA 5T3ZH 4UT9H 2NY0D 5IQLA 2NW3B 4YXKH 4BD4A 1QLFB 5F1SA 3SO3B 3PDOB 2IGFL 3PFQA 2QGCA 5CCGE 2DYPD 3BSZL 3K8KA 1H8OA 4NJAH 4I88A 3D8MA 5B8CC 4KO5A 1SEQL 4F9LC 4TQ8A 4L4TA 2XV0A 3B83A 1NGPH 1O5DT 4XNYH 4G80B 1QFHA 1GC1L 3KWWB 5C07D 1O75A 2V3FA 1NCCL 2I7OA 1M1SA 3O81A 4JG5A 4P2QE 5FA3B 5IJVA 3QA3B 3BGAA 4KRMB 2CPCA 3O6MH 4E42B 3QCVH 2ZSWA 4K5NA 4NNPL 4ODWA 1T2XA 3ASOB 3A5VA 4PRAB 4LSSL 2BP8A 2MCMA 2NY4C 3RZCC 3TYGL 5IZ7A 4XWOD 3TWCL 4L8SB 5KUKA 1KB9K 4EZJA 5DCCA 5KS9E 1UM6L 2A2QT