3JWNG

Complex of fimc, fimf, fimg and fimh
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
144
structure length
144
Chain Sequence
ADVTITVNGKVVAKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding/cell adhesion
molecule keywords Chaperone protein fimC
publication title Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 144
sequence length 144
chains with identical sequence M
ec nomenclature
pdb deposition date 2009-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3jwnG00
3MCYA 2W07B 2XG4B 5FWRA 4AVJA 5IQOA 3BFQG 2WMPB 3JWNH 5FLUA 3JWNG 1N12A 2JMRA 2UY6B 4X5QA 1KIUB 3BWUF 4XO9A 2JTYA 4X50A 5FX3A 4AV0A 5LNGA 5IQNA 1TR7A 4XOCA 4AVIA 4AUUA 4J3OF 3RFZA 4CA4A 1PDKB 2VCOA 4X5RA 3ZL1A 4XOEA 1QUNB 5JQIB 2XG5B 3ME0B 4XO8A 4CSTA 4AUYA 5F2FA 4J3OH 4AUJA 4J3OG 4ATTA 4AV4A 4CSSA 4AVKA 4XOBA 1KLFB 3JWNE 4XOAA 4AVHA 5CGBA 5AALA 4BUQA 4AV5A 5IQMA 2UY7B 5ABZA 4XODA 1UWFA 3BFWA 5FS5A 5LNEA 3ZPDA 1N0LB 4X5PA 4LOVA 3ZL2A 5F3FA 5AAPA 3SQBB 1ZE3H 2J2ZB 5AB1A
chains in the Genus database with same CATH superfamily
3MBEA 3MRRA 3W38A 1MNUH 4NQDE 4F7CB 5HDBB 2ZXAA 4FHKA 2AEQL 4BQ6A 5I75C 1CURA 3FC8A 3GSXB 4TL5A 4Y19D 4ZUWB 2TRYA 1S8DA 1JWSB 3M07A 3P9MB 4U1NB 3NJXA 3WFHB 5SWZB 4LOUD 1SJEB 4PJDE 1S7SB 4MAYB 1M7IB 3CFIC 4F57L 1D7FA 2OTUA 1JTOA 5F96H 1OGTA 2NY5L 5LBGA 3D69A 4B95C 3O8XA 4QJ3B 4CU7A 1OHZA 3KPNB 1LVEA 3Q5TA 3QO0A 4QXUL 4LPCA 3C60C 3KGUA 2Z31A 1NAKL 5C0DB 4GAGH 3LN5B 4FLSA 4AUUA 1H15B 2XZAL 5JHBA 2AW2A 4R97C 2ESVD 2Q0ZX 2LU4A 2X2HA 4JDVA 5EU6B 5F9WC 2H0PA 4QF1B 5BQDA 3RI5F 3L45A 4W9LC 2O6DA 2Q8BH 4RLDA 1OLZA 3LSOA 4IRSA 3L4XA 4NQTA 1QRNA 3MREB 1BM7A 1D9KA 3LZOA 3DURB 3U6RB 3UJJH 1DBBH 1FE8L 1BQUA 4Z0XB 3VH8B 4QWWD 2YBGA 5BS0E 5AG8A 3DX9B 2FIRT 2EICA 2ZYSA 2YN3A 2W59A 1SLUA 2YGVA 1UM5L 3GKZA 1HI6B 3T3PB 3HI5H 1NC2B 4G6AD 5SWSE 1AJ7H 2J21A 4P3WA 4X83A 3I50H 5CCKL 5JIKA 1T1XB 2D3VA 3ULVF 2Y1VA 3X3FL 4ZQKB 2OSXA 2C9QA 1PZDA 2MTPA 1RV6X 4XNYH 3SDCD 3AS3A 4QOKD 5DUPL 3DHMA 4BFEA 4CMHC 1CBVH 4HKZB 1UA6H 1T0NB 4LARH 2BNQB 1NOLA 1ZTXH 1IQDA 1UACL 2DBLH 3E3QE 3MLRH 1TQUA 1VESA 2PW2A 1T0MB 3BZDA 3BFOA 4L3EA 4AIXA 1J0IA 4LCWD 1OSPL 3QDGD 2BNUB 2FGZA 3VXSE 2F18A 1W72L 2O6PA 3CFCH 3JTSA 5E6YA 4RGNB 5F96L 1G84A 1O7DE 4PJFA 2F15A 3NAAH 3VSUA 1B0GB 4QRPA 3FT4A 4H8UA 4NC1C 5F3FA 1IIKA 1DVUA 2JWYA 1XF4B 4GRWE 4NHUA 3PDGA 2AJSL 4S0TD 4U1MA 3VGGA 4RNRA 3KCWA 4PN6A 3WUZA 1MFUA 4M43H 3FOMB 1MHHA 2FWOA 2VWEC 2A74A 3JZYA 2NNFA 2XKUA 1A6WH 5C08D 4YQXL 1W0VA 1U92A 5GJTL 1JGUL 5J1SC 2Q8BL 4FFWC 3FU6A 4GSRA 5LAPA 1MPAH 2WXKA 4CVWA 1Y7VA 4PLOB 5IKCA 2UVEA 4GG8B 2Z8WC 5AW3B 1RPKA 5IOPB 2VR5A 2FWUA 3BDYL 1NUFA 2DB8A 2BMKA 3GD1C 5EZPA 4ZW7A 4URKA 1Z0NA 3MACL 3EYVA 4KK6D 5KSBE 2FATL 2GQHA 3I6KA 5B3NA 1ICTA 4GXUN 3L3KB 5HHMB 5J89A 3GKWL 3QAZB 4EZMA 5BRZE 3U0WH 2DLEA 3AS2A 1JZ6A 3P77B 5F1KC 2WYIA 4PIRF 3PV6B 3MV8A 3NIFE 1R24A 3TV8A 2O5XL 1VPOH 3V6FB 1GZPA 4L1BA 3MUJA 1NEZA 1BBJB 2NXYD 3ARFA 3DOSB 4JFXA 2BFGA 1I7ZB 1XD0A 4NI6A 2VDOH 1KCLA 4MDIB 3V0VB 1GKOA 3ZXAC 4NQXA 4ORGA 5I73C 3UTOA 3VXMA 3IRCA 2HKHL 5C0EB 3RYMA 1UQSA 2XV6B 4J8QA 1CDBA 5TDPB 1Z0MA 4XMXA 2YD1A 4M93B 1FZKB 3ULUF 1KJ3H 5K1NA 3FRPG 1ITBB 5FXCH 3EJJX 4I7ZC 3MLRL 4HIJA 4NS0A 4F15C 1TSRA 3SJVA 4NDMA 2EXTA 1D7DA 2OS7A 3LPOA 5TF1L 4LSSH 4D94A 4Q4IA 5E9DB 4K8RC 4PLKC 1PG7L 4AXWB 1YMHA 3Q6FB 4BRVA 1F3JA 3NAAL 1T0OA 5A16B 3OX8A 2HX7A 2W81C 5SX5H 4J4PD 3SDXA 2PETA 2AK4D 4JHAH 4P4KC 3OLEA 2R4RH 5E00A 4N28A 5AYTA 3PGFL 2WXRA 3RY6A 4PREA 5IEHB 1H6FA 4R2GD 4BK8A 3OGCA 5FO8B 2I85A 4HFWB 3P3RA 1FGVL 1R34A 3ZQWA 4L4TA 4TSAH 3L81A 7FABL 4EPSA 4HCRA 3TEYA 5MERA 2GK0B 2EIZA 1RHHB 1JWUB 3F58H 2P5ED 2VDLB 3QNYA 4HZ1A 4APQB 1OGPA 3CN1A 5I1EH 2J25A 2A6DA 2XTJC 2X42A 3GRGA 1P2CA 5E6IA 2CGRL 4AI7A 1EJ8A 4XHJD 3F05A 1IJ9A 2HYMA 3B56A 2H3KA 3C5ZD 3QDMB 4G11A 4QT5B 3VGHA 1P7QA 4UIMA 2BIPA 4PSPA 1EAPA 4OCWL 5IK3B 4XVSH 4CW1A 4YDLB 5IMLB 3ZL4H 3A22A 4NJ9H 5DEGB 5LO7A 4Y2DD 5J9PA 2DEYX 2QDWA 1QSEE 1EANA 1JPFA 3RU8L 1Z9SB 4HD9A 1E8YA 1BG1A 3VSQA 4M5YH 3T5WA 3I9PA 3BMWA 5I2IB 2VLJD 2JNZA 4XN7A 1XXDC 3ML8A 4OV5B 3GMMA 1KB5A 1SXNA 2KDYA 3HA0A 4YR6A 5C0AD 1CICD 3IJ7A 4K0OA 4HLEA 2EYTA 3NACH 4KZCA 4WUUD 4LLAA 3SYOA 2KS0A 1XGQA 1YA5A 1WT5C 3CQPA 2WUBH 4I77H 4PJCB 3E6FB 4WKZB 4LSSL 5F7DA 1A0QH 1E5YA 4UNVA 3UO8B 4N6RB 3IF1A 5D7LD 1QVOB 2A9DA 1NGQH 4B3VA 2VL5B 4WHYG 2AZUA 3SDYH 3GBEA 2IG2L 4G3YL 2J5WA 2YUVA 5KYYB 4IGBB 5IB1B 4HWZB 1UOWA 1FPTH 1UA7A 2IAND 4QLWA 5I1LB 4YDJB 4QWWC 4NRYB 1KDJA 5AUMA 4MD5A 4UWQB 3EO9L 3Q9QA 5C0ND 5JQIB 2R29A 1XR8A 2F54B 5IFHH 3PQYA 3OAWA 4GW5B 1OP4A 4LEOA 3TGXA 1L3WA 5JORA 4LVHC 3UPCA 4Q9RH 2W9EL 1NCBH 2IH9A 2R1XB 2BX5A 5ITBL 2FD6H 1X3DA 5MEOA 1ML0A 3SDCC 3ESPA 2FO4A 2R39A 3IS0X 3FFDA 2GC7C 2CJUH 5DYOA 2XWZA 4D0BB 2CHWA 2HN7A 4D0CB 3UAJD 1Q94A 4B7IA 4NJ9L 1YQVH 2OJ1A 1YEFL 3B2VH 5AOMA 1L6XA 2HWZL 3ILQD 4ONHB 3S36L 4N0FA 4IM8A 4HCRL 5KVFH 3PXHA 3IE9A 4X4KA 4EOWL 2TSAA 3LKNA 1QBMH 3MOBL 4DUWA 4YHPB 1XZ0B 3EYSH 4DZBA 3QZPA 4JGUA 3QORD 4KUZL 3PWPA 1DEEA 1ECYA 4IQHA 4UTAA 3BH8A 4ELDA 1VIWA 4D8PA 4DEWA 4Y4HB 1F3DJ 1CLZL 2EABA 2ZQKA 4JEGB 4XBPA 4DTGL 2FUQA 2XWTA 5FUCE 2EDRA 1XF1A 3CFJB 4W68A 1GC1L 1ZE3H 1NGQL 1S9XA 2CJSA 3SZKC 2APXA 1VKXA 2WSDA 5KWYC 1JF1A 2W07B 2ADFH 3OKOB 1FPTL 2MCAA 4AL8C 4R90L 3BUIA 3OKMA 5IIEB 1KGXA 2YPLB 3QZNA 5ECJE 2V33A 2RIKA 1MLBB 5IFHL 1OPOA 4L8SA 4ALAH 4XI5D 5GQBA 1T1ZA 2YS4A 3MLTA 4UDTA 1JXJA 2BSSA 4GUQA 5FYJL 1DL7L 1A3LH 2H5UA 4NO0B 1XIWC 2Q76A 3FU5A 3G5VA 4D7PA 2FD6L 5D1ZA 2MTAA 2PF6A 2Y9RT 3C5SB 3KDPB 4L3CA 3RRQA 4GG6A 3H53A 4M7JH 4NWTL 4UOJA 3N85L 2CJUL 1R5WB 3VCLA 1SZNA 1U8PA 1XR9A 2V7HA 4LL9A 2E27L 3WJLC 4U05A 2YD0A 2Z64C 1QUNA 4NQVB 3CPUA 2R29L 4TVUA 4PCYA 4YN3A 4WHDA 1TQWA 5CEYA 1DQIA 2BW4A 3C2AH 3CDCA 3IFPA 4HBCL 4ODTH 1WTLA 4EDWL 3GC3A 4ZDHB 5KVFL 2X4UB 4N2GA 5BRQA 1HQ4B 1QBML 2YIHA 1ESOA 1B0RB 4HZAA 4JN2B 3WLWC 4J4PC 2OTPA 3WS3B 1DQMH 2BSBA 1ZANH 5L0QB 4LCIH 1NBYB 3D39E 3T3ME 3UROR 5I66B 3HS0A 1H0DA 3LIZH 2CGZA 3PFQA 4R2GC 5DTFB 5FOBA 4F2FA 1I8LC 3BAKA 4H88H 5DF0A 1IBGL 5DRZA 1IGTB 2IPUG 1UD5A 2MJWA 4B3EA 1KBBA 4E5XB 4MSWA 4CBZA 4OD2A 4KITB 2YLHA 4MXWL 3WY3A 1A3RH 5D7SH 4BUGA 4OTXL 5HVFB 3SBQA 1DR9A 4JG5A 2VZ1A 2ADFL 3KLAB 2J6EA 1X5LA 4E42B 2PO6B 3K4DA 3MTXA 4I3RH 5EOCL 4N22A 5E2JA 3KM2A 3K72A 4WNQB 4XPFL 5LUMA 2KMWA 1QEXA 4BXVA 4E9YA 3RPIB 3RBSA 3I85A 4ALAL 3BD5A 3MGTB 2NT0A 1XB8A 1G9MC 3CXHJ 4WI5A 3FCUB 5F6IB 1A3LL 4Z7VF 5CN1A 5B7EA 3CSYB 2QTEA 3BP5B 2J6WA 3KBPA 3QIBB 1YMMB 1JTPA 2KC0A 3SE6A 5F0PB 1AGFA 1KOAA 4ABWA 1D2OA 5I6MA 4BH8B 2Q8AL 2HFFA 1MCDA 4X6EA 4HIHA 1EO5A 4QYOA 1LP9B 2ZSVB 3H9HB 4JRLA 4MJ2A 2BS71 3RJDA 4TQEH 1TMQA 1UZ6E 3VDAA 3IJ9A 3ZE2F 4M1CD 5D7JD 3BSZH 1AKJD 5D1XB 3ERXA 5CZXC 3ECVA 1JDCA 5I23A 3UDWA 4G6MH 4Z7UE 3QUXB 2XX0A 5DMKB 2G30A 4I8DA 4X50A 4AH2A 5D93B 5HYJD 1M2VB 4LCIL 4X5XB 2W95A 3E0GA 2PUQT 3VGAB 1DBML 5HYSA 4WFFD 1ZHNA 5FFLA 4HYTB 4YSQA 1HXYA 4LSVL 4X7SL 1FVCB 2CPCA 2XYCA 4P2QA 4JPQA 4WWOA 3UO1H 5CHNB 1XGPB 3IU4H 2VITB 4PJ7E 3M45A 2DQTH 3GF8A 3H3KA 5IVZB 1D5XA 5CN2A 1T5WA 1PFOA 1G7QA 2BNRA 2HLFD 4FN0A 2E4TA 4Y1AA 3PWUB 4W6WB 2W88A 4WTXA 1R3LB 3GI9H 5J1TC 2UWEB 1DVFD 5GS2H 1HOCB 1F3DH 4XBGB 3QVAA 4JNXA 1OCZB 3B9AA 1AS6A 1V55B 1QSZA 2AAAA 2YQ2A 4LLDB 3MA7B 3ZDYB 4PJIB 4IS6A 3ILQC 5B1JC 5FUZL 2JCCA 3D2UD 1QSFD 1YECL 1TLMA 3LV3B 1WBXA 3DUSB 4WCYH 2MMXA 2CRIA 3W39A 3J27A 1XO8A 3MLSL 5DZPA 1GW0A 4D8OA 3V79C 4RBPK 3VGEA 1AGBB 3GGWA 1ZVSA 3ZTJH 3BT2L 3QJTB 4Z77B 1FQ9C 4HJUA 3JT2A 1UM6H 1G7IA 2EEDA 4JR9L 2G2RB 3GSNA 4OCLC 3EIFA 4JN1L 4C56E 5CZKA 3R0NA 3MJ8B 1A4BA 3FQTA 3O3DB 1RHFA 4P99A 1QOKA 3H4HA 4J27A 3VWKB 1S5HB 5IW6B 2EO7A 2JKLA 1KV3A 1TMCB 5D2NA 3OTTA 2VDMH 2LR4A 4JJOA 2CLVA 3KEDA 3BP7A 1HCZA 1JHTB 5HDOA 3TT3H 1W9XA 4P2OB 3QUMB 2BP8A 1BEYH 3QXAA 4UAOB 1OHQA 3H3PH 3F7VB 4PJHA 1FYTB 1I7TB 3A21A 5F3BB 2ZX6A 1X5MA 1GXEA 3KLQA 2ARJB 1DLHA 3U30B 1I9IL 4MNQA 2LLLA 4YPGB 2GSIB 1YNTB 3B6SB 4AJWA 3FN0L 4R96B 5C2BL 4PJ5A 3DOHA 3CDGB 3ZSSA 4MMXB 1KIUB 2XN0A 3GI9L 2C8NA 2TSBA 4DW2L 1F56A 2RH0A 4X0NA 3GBDA 5EUOF 2Q10A 4RFOH 4M9OA 1J86A 5JIMA 4XRCA 1LO5B 1BAWA 2D0HA 2UYLA 3ZU8A 1I1AB 5EIVA 1WAEA 3FT3A 4WGWB 3IXAB 4KROD 4GEIA 4NT6A 4P2RA 2BSTA 4IIQB 5JO5B 2PCPB 3HAEH 3QZWB 2PPAA 4H8WH 3DVIA 3LS4H 2ODHA 4WCYL 2VT0A 2NTFB 2AQNA 1JI1A 1HE8A 1F3RB 1S7RB 4JM2A 3TEXA 3UTSB 3MR9B 2IPKA 2ICWI 3QWRA 5HDWA 4G7RB 1LE9B 2R51A 3ZBMA 2FO1A 3BDBA 1TSHA 1EQWA 1KENH 1OF2B 1OKEA 1U8QA 4P3DB 5D71H 4Y19E 3V5KA 4NRXA 3KJ4B 3WSQL 5TH2A 1UM6L 3S8GB 3T0WA 4OGYL 2XQYA 3JV5A 3H9SA 4LB8A 3DBXA 1R5IA 1BXAA 4RA0C 1G6VK 2P80D 1YLBB 1FBIL 3G04B 4TVPH 4LCCC 5HYEA 4PGZA 2XJKA 4XOBA 1T3FA 3LNHA 3UZVA 4L9LC 4OI8A 3QI9B 2YKLH 2VDML 3QJOA 5T8IA 3D09A 4WEEA 4L0ZA 4XOAA 2WSKA 2DLFL 2GI0A 4AVHA 2ESVE 3O6LL 3PUCA 3HPJA 3K8MA 4ZMNA 5CGBA 1E3ZA 5DYFA 4QRQB 3NJGA 3SDAA 1BEYL 2FO8A 3WKPA 1ZOXA 3DIFA 2DIJA 4ZXBC 3UZEA 43C9A 3FQRB 1IC0A 3NP3A 3VMNA 2XPZA 2YHGA 5J7CC 4F20A 1QHQA 2I7OA 1KYUA 4WVRA 1M4KA 2IMNA 3MCKB 4QO1A 3WTUA 3CMGA 3SKOB 3DGDA 3SKNB 3VGFA 4ZO8A 1WJ3A 3K2KA 3CNKA 4DEUA 1KBWA 2J55A 2LTQC 2J5LC 5JW5B 1NFDF 2BS9A 2H2PD 1N18A 5GS2D 4UINL 4TKWA 4HKXA 3OKEB 2R8SH 3GBLA 2WWOA 3POHA 2UXVA 1ROCA 4WWPA 1ORSB 4KH9A 3H2WA 4BCYA 1X7SA 4OLWL 4M1CC 2ZWKA 1WHOA 2YPVA 5EA0H 1KYOK 1DN2A 1NGWA 1P69B 2BVEA 3D18B 3QS3A 4H8WL 4QOKE 3LS4L 4KKAC 4GXVH 4U3SB 1WUZA 2X2YA 2ARWA 3VRIA 1I75A 4KRNA 1FNHA 2W60B 2WKOA 3QUKA 1OB0A 4JG9A 4KVNL 4KX9A 4PTTB 4UOW1 4U31A 3RZCC 4CGUB 3SE3C 2D3JA 4XNXH 1HCFX 2W65B 2WWKO 4L37B 4LCWE 3QDGE 1OIOA 1V3MA 3HRZB 4IRZA 1P6AB 4FCHA 3MUUA 3DX8A 3NTCH 2JELL 4RMBA 4X5WB 3VX0A 4I48A 4HKBB 1HESA 4WV1A 1KPRA 3VH8G 5C07B 3JVGA 4CKQA 3CFNA 2N1KA 2GFBA 4KWUA 2CBTA 1ZE3C 5GZND 4YDVA 4Y8DC 5TTRA 4UOW0 2HVBA 3HBGA 1IGML 2KYIA 3L9YA 2HRLA 3EXLA 3B3IA 2ALWA 2N56A 3SKUD 1KGJA 3CFBB 3A6CH 1DVFC 3FSOA 5C08E 2Y5TA 2F5BH 5L88L 2DM2A 4L23A 1VLXA 1AO7D 3JQOB 5ADOH 1AQMA 3NIDE 3QJHB 1T1WB 4JKMA 2KPWA 3MLYL 2FNWA 3BVVA 3UP1A 1U3JA 1R47A 1AMXA 4AW4A 4Z7QE 1YO4A 5J8OA 5BOZG 1A1NA 4OJFH 5D9SB 1PSKL 2OXGA 4JFYB 2EXYD 1OAUH 1UA3A 2BRRH 3RTQC 2OXHB 3TWYA 3L1EA 1HSBB 5HHOD 4MNGA 1YJDH 2R8SL 1ACYH 1MW0A 3AJ7A 3IB4A 4B5ZA 2ZSWA 3IJYB 1QNIA 4YHMH 2Y07H 2P7TA 5EA0L 4QR7A 5IG7A 3NUKA 4HGWB 4E41D 2ZJSH 2YFNA 5HHNA 3NEOA 1ADQA 1RSFA 3PWJB 2BSCA 2VDRH 3TFKD 1EFXD 3MZTA 2BOBA 4XNXL 3TYFA 1HTYA 1ZLDA 5ALBL 1QATA 2F8OA 2Q9OA 2WZ5A 4DJMA 4K9EL 4QRRA 4G1EB 4MA8L 2JB5H 1U3HA 1RZKH 3OR6A 4OAWB 3TZVD 5KS9F 1S9VA 3GHBL 5E94B 1KCUH 5DVLA 3QIUA 2CIIA 1OAKH 3UCRA 4AYDC 2W0FA 1X5IA 2YPVL 3FU9A 5C7XL 2AK4E 3HZVB 4TVPD 2KKQA 3C08L 4NNYA 4WGVB 1JPEA 2BVPB 2NY3C 2K6ZA 4TNWF 3IXTB 3GSXA 2ENYA 5T1DH 3T1FA 3WKNA 1DQVA 4P23D 4FCAA 4XX5A 4Y2LA 2DWSA 4P2YA 1EUUA 2P24B 4PRHD 1DJGA 2E6QA 2XWBA 4FXGC 4PY8I 3QQ3B 3G6JF 4UB0L 5BV7H 2P5EE 4KROC 4IRZL 2CM5A 5C2UB 1RIUL 2KZKA 4BELD 2Y2WA 5JMOC 4F8NA 3F3HA 3GNMH 3UL4A 5I1IH 4FEMA 3WDJA 2YEQA 4NQCD 2APVA 3MLVH 2N0MA 4TSBH 1HWWA 3J07A 5A3ID 5EZIH 4JPVL 4DK6A 4O2EB 1CLYL 1DBAL 2BRRL 5E1QA 3Q05A 4F9PA 4BWUA 1AI1H 1UOLA 4NO5B 3HE7D 1DSYA 3IDJA 3D05A 3BPOB 4QF1A 1AE6H 5ANHA 4K3DH 1X5YA 5E6UB 1MHEB 1WE5A 1IAIL 3EFDH 5GJSH 5KYXA 3NJMA 1YY8A 3VW3H 3IDIA 3DURA 4F2MB 1KPVB 1AMYA 3E2HC 4Y16C 3NCJL 4WIQA 4X6CA 1R9FA 2VLJE 2ZJSL 4Z0XA 5GISH 4I3SL 4KK5D 1JNLL 2FECI 4N2FA 3KYKH 3DX9A 4FQ1H 2VDRL 1PZ2A 4LAQH 1P7HL 4Q8BA 1X6LA 1NDTA 2R69H 4C47A 4CILA 4WUUE 2ZXQA 3SDDD 3LKPB 1ZTXE 1GGCH 1HI6A 3K5SA 4B0MB 5IB3B 1NC2A 5C92A 4Z3TA 1AQDB 3GMPA 3MRBB 2JB5L 3POCA 3NFPB 1CFSA 5D7LE 1KCUL 2X4TB 4ZQKA 4BQ9A 1PAMA 5E2VL 1Z5YD 3U9UA 5LQBL 4HKZA 1HC1A 3SGDI 3M1OA 1JNNH 1EFQA 2OYLA 4N20A 1QPPA 2IANE 3L17A 3BN9C 1ADQL 1INDL 3GO1H 1T0MA 3FB5B 4WFED 1BZOA 2BNUA 3HEIB 3V6OA 5DD0H 5HPMA 3HVNA 3GMOB 1WA0X 5HJDA 1BSIA 1PLBA 3QCTH 2H2PC 3U0PB 2O5ZH 2JIXD 3M1CA 5BV7L 1UC6A 4M62L 1I8KB 3GMQA 4WWKB 3AACA 1B0GA 3DHUA 1IFHL 5LHDA 2Y7MA 2F0CA 3H85A 3TX4A 1A6VH 2CRMA 3UTTB 1OPGH 4B7LA 2X44D 3HHMA 5JQHC 4TSBL 4QRPE 5EZIL 1MCFA 1ZLSL 1KCKA 3WY1A 2PWDA 3LEXB 4FFZA 3P69A 1AI1L 1E5AA 1MHPH 3B9VA 3EOYG 3AQDA 4K3DL 3FN3A 2XG4B 3IS1X 3EOAA 1F86A 5GJSL 1KJVA 2R9HD 2WINB 3CVCA 4ELMB 4OLUL 3BYYA 4AQZA 2FX8L 2E7HA 5F6HI 3VFSA 2VO8A 3GSUB 4QHKJ 1C7SA 3RA7H 4XP6H 3DHPA 3AAZB 3PHSA 4C59B 4D0DB 2WBJB 1U8CB 1P1ZA 2N7BA 1G4RA 3ARUA 4X4ME 1MQKL 3BWUF 5GISL 5KTEL 5SX4H 3L3KA 3KYKL 4MFHA 4FQ1L 3C5JB 1XMWA 2P8LA 1BAFL 5DJXB 2L7UA 2Q6WA 5TJWK 3PV6A 4JFQA 3V52H 5KG9B 3KHOA 4ZFZA 2OBGA 3HKFA 4K3EL 3V6FA 4AGQA 1HEJC 1MCPH 1BBJA 2X53A 1TITA 4OGZA 4CVZB 2G60L 1I7ZA 4PJBE 2C1OB 2OL3H 4OBRA 2CG9X 1UEMA 2L0DA 2YD4A 3V0VA 2EEFA 3K1DA 1ZT4A 1OTTD 2C26A 2RHEA 4G8IB 4HVBA 2AJYH 3MRPB 5I1GH 1YVLA 5BQ7B 1JNNL 5HJ3B 5TDPA 1P1VA 5DCCA 1FZKA 2H8PA 1NFKA 4HK3N 2QR0B 3G5YB 4GBXD 1VFAB 1CLVA 3QUYC 2AXFB 5CMAA 1YHPA 1KG0B 3R0MA 3D3VB 4M5TA 1Y6MR 4ZPVB 4NNPL 2CSPA 4PV9B 3RVXC 2HKFL 4X4YA 4P04A 4AXWA 3VRLF 3Q6FA 4GRLD 3SJVE 2X1OA 1HNYA 1T5XB 3K5RA 4R84A 1FDLL 3HN3A 4GAJH 1Z3GH 4HF5H 1AFVH 2IPTH 4OCRL 4FNRA 4XMPH 3UG3A 3D52A 4HWNA 3LQZB 2W94A 3KGSA 4OZHA 5BO1H 3T1WA 2CHZA 4KY1H 1QYGL 4P9HH 4F2EA 4FL4C 2XKNB 5E2UH 3ISYA 3HUJF 2VXVH 2WC7A 2ZXBA 4WI3A 1GW6A 2GK0A 1RHHA 5DMIH 2H3NB 4RCAA 1PG7X 1JWUA 3QS2A 1F8TL 3I3BA 5DA4A 5B21A 1R5VA 4APQA 4EDXB 4L4TE 3TZVC 2APTA 1UGKA 2DTSA 2OMZB 5EFIB 4Z7OF 3T0ED 3U7AA 2KZBA 4QRUB 4AC4A 4QT5A 3ZPDA 1B4LA 1PZSA 1OO2A 1KBGL 1Q90A 2X4PB 4PD4K 2AQRA 2PKDA 5GZOA 3VG9C 4TNGA 4HWEH 4TXVB 4RFNC 1BG9A 2X09A 4P23C 1IM9B 1Z9SA 1P6WA 5IVXB 3P0GB 2OL3L 1Q72H 3H54A 3CU1A 5I2IA 1RL1A 1KY7A 1X44A 2ATKB 2EDLA 4LHUD 4OV5A 1GHFL 2JVUA 5H37G 1NEUA 4OZ4B 3W5NA 5DHVH 1N12A 5I8KH 1BZEA 3CCHB 2X10A 4XPGL 3HFMH 1FCCA 4JPKH 4JO2H 3TF7C 5A3IC 2ZYRA 5LBSH 2HX9A 2XVLA 4PJCA 1B0IA 3E6FA 4N8PA 3KL3A 4WKZA 3T2OA 4JQXA 5I1HH 2V2TB 1U8HB 1NBCA 5LWYH 3MNWB 5EOTB 1Z5HA 4KFZC 1A1MB 3MLXH 1K4CB 2DF3A 2VL5A 2AS5M 1QBAA 4XCCH 4ZMPA 3PHQB 3BIAX 4XC1H 3GS4A 3PPEA 5KYYA 4GAJL 3G6AA 3MXWL 3CXHK 4HF5L 1AFVL 4HWZA 2H32A 4TLUA 5ALCL 5IB1A 3RL2A 4HT1H 5I0YA 5BO1L 1BLNA 3O2WH 5DJ6A 3L16A 1QTSA 3WEXA 4GQZA 4WK4B 4QIRA 3GBNL 2J8UB 3BQUD 1GGBH 3TN0A 1ZVYA 2PXYC 1E9OB 4QTHB 4Z95H 5DMIL 4E5XG 4NUPA 2X9ZA 1JUFB 3OB0K 4J6RL 4Y5VC 1FFQA 3O6KH 1L9OA 2GB2A 1A6UH 5TFSL 2R1XA 5GS1C 4YHNA 1TJGH 5KVFE 5TE7L 3TBWA 2DTMH 2XQYK 3O4OB 4Y5XA 3MTRA 4JFHD 4DVBB 4D0BA 3U7YH 5KBLA 3P9WB 4ONOA 5E6ZA 5HYJE 2DAVA 2EDKA 5HI5C 1KXVA 3DX3A 4PB9H 2Z8VC 3F00A 4BFIA 2F58H 3MUY1 3IMTA 2JH2A 4ZW5A 4K7PL 5DJYB 3DK2A 3SPCA 1MUJA 1TTAA 2MNUA 1OAXL 2WJ7A 5T1KB 3DX2A 1CE6B 2EDBA 1BHGA 2EE0A 2V8MA 2YUZA 3L2LA 2QGCA 3SE8H 4XO4A 1J8HD 1DQKA 1L9SA 1XZ0A 4JRXB 4YHPA 4Z23A 4HS8H 12E8H 3N9GH 3HC4H 2M1KA 4Z7AA 3SBWC 4BHUI 1JIBA 4NQEA 4IRJC 4O02B 4JPKL 4JO2L 3SE4A 4GSDH 3TLRA 4Y4HA 1AZZC 1UZ8B 2WBWB 4WTZA 4XR8C 1FWXA 3G9VA 2CHDA 3U82B 4DF9A 3ZKMD 3LRLA 2WLZA 4OY9A 3UBXB 1LMKA 2V9QA 3B9KD 3S36X 4BWWA 4O51B 1EHNA 2JJVA 4ZAKA 4BM7A 5LWYL 3ARDB 3CFJA 2YWYA 3O6FD 5DK0B 1S7UB 2R9HC 3KR3H 1YJDC 1RIVH 3S8WA 3ZZ1A 1GYAA 1QSFE 3VJ6B 2IH3B 2DQMA 3U9PL 2W07A 4RMQA 3OKOA 3NPSC 5AG9A 3JT0A 4OZIE 1MF2H 4G8EB 3MZGB 5IIEA 3ARVA 5EOQH 2XZCL 3NMEA 5F0JB 4EN3B 4X6FB 5F44A 4HDIB 1KPUB 4J3OC 2XI9A 3ZZSA 1IX2A 3QNXB 3D0VB 3DMMA 2EILB 3KXFB 5DDHB 1IUZA 3DC0A 3ATAA 5EBGA 2B3IA 3AWGA 2ZXWB 4JPWH 2FJGB 1E30A 4NO0A 3TH4T 2Y7OA 4O9HL 4K3JL 3C5SA 3LJ3A 3VI3E 3Q1SH 5J06A 4KUCD 1BQRA 1OTTC 1RZJC 3ARQA 3CWGA 3WFZA 5DWPA 1R5WA 1BZ9B 1VZHA 4OGQC 2NR6C 5IESH 3ULVL 3QK0A 5I5IA 3TWCL 4MKMA 3ZT6A 4LLWA 4PB9L 2CLZB 5D96B 4ANVA 5DXWA 2AXGA 3LNFA 5FGRA 2M2DA 3L1OH 3MCLH 1T7XA 2IWEA 1I1YB 2DWDA 3ULUH 1CZ8L 3V4UH 25C8L 5CIPH 4KQ4L 4A55A 3RWEA 2X4UA 1DEDA 1HQ4A 1IKOP 1WAAF 2B2XH 3AVEA 4XMKH 5CAYB 1HIML 1B0RA 3NJLA 4JN2A 5F3HA 3OQRA 5MI0C 5J56B 3ZDZE 4OUUB 4KBPA 4KKRA 2ZCHH 3HCVB 3V6ZB 4Z7OB 1KTRL 2WXMA 4XP5L 4JRYD 5DTFA 4P9MH 3O11A 4XBEL 4TN9A 3KCPB 5CXPA 4LSTH 4PS4H 4OJDH 1FO0B 2XRAH 5LB1A 4NO3B 2C7UB 5E4EC 1AH1A 4DIXA 3BAEL 1XCQB 4FFYA 2PCXA 4ZOBA 2Z65C 5FW8A 2GEQA 3PAYA 5I5RA 1C8QA 1U2HA 5HTSA 3PL6D 4E42A 5BZWB 1JFHA 4YSTA 1JYNA 5BNXD 4WNQA 1QO3B 2XX1A 4WTWA 2LW3A 4GLRH 1IKNC 3CUPA 3RPIA 4M4PA 3L8QA 1JN6B 3MGTA 2W1NA 4L3FA 4P46B 3C6LD 4U1GC 1ND0B 1JHKH 4JPWL 5GGQL 1NIBA 3BP5A 1IC1A 3QIBA 2ENPA 2V17L 4JFVA 2E59A 2QPFA 4UM9B 4MB1A 4BH8A 3F7YB 3RVTD 1ECZA 1KJ2H 3QGVA 4LXFA 3N41F 2P43B 3M1BB 4K7FA 1LP9A 3H9HA 5FEBA 3IGLA 1Q9KB 4YNYA 3MCLL 4FX5A 1BJ1J 4IOSA 4P2AA 3ULUL 1MCEA 2G4GA 5D1XA 5JDSA 5EULV 4LFHG 4AYFA 2YAOA 3AXHA 3BLBA 3DPBA 3N0AA 3QUXA 3ZIYA 1CCZA 4HH9B 1TTFA 4HKJB 4N8CH 1A4JB 2EADA 1A8ZA 2WCSA 1WDAA 1M2VA 2BHFA 2C9XA 2RR3A 2OMVB 4Y4KD 2BVUA 1ZDQA 5FYLH 2MOGA 4YSRA 3ALPA 3RVUD 2XXMB 4A67A 4DGIL 2EIKB 2KLSA 4YX2H 4P59H 4MQ7B 1KCWA 3BQUC 2WIMA 4X7CC 5CHNA 1XGPA 1VAHA 1L0QA 1SLXA 2ITDA 4ACPA 2ISDA 3EBGA 1Q9LA 2VN4A 4JKLA 4NN5B 5A7BA 4P2QE 1H5BB 3VFWA 2CUHA 3PWUA 3HBZA 5LGHH 2UWEA 4PJ8D 4PLNC 1RU9H 3HTLX 4I0PD 2P9RA 4XBGA 3E8UH 2PYFB 1BM3H 2PMZA 4M1GL 4X42A 4BQ8A 3VXRD 1S9KC 1IBDA 4H13C 2QLYA 2CKBA 3OL2A 4PJIA 1K85A 4Q0XH 1KIRB 4JE0A 1HWHB 4EQ2A 1ET7A 5ESVB 2JKJA 3LV3A 1EEZA 4FFYL 3Q01A 3WKYA 4A7SA 2Y0SA 1KCSH 5IR1B 4Z7NB 3DO7B 2V5MA 4YHLL 4WSGA 5CP3H 1AHWC 1KN4H 4HUMB 1Q1JL 2ADGB 4Q52A 4LDLB 4WO4B 4MB4A 5CBAB 4UNIA 4Z77A 1XWVA 4LLUB 1KIQB 4JW3A 3S5LB 3DXAD 5MEPB 4PP1D 1EH9A 1RUPL 1WD8A 3ZKMC 4ABQA 3DJZA 1S7QB 2G2RA 1KMGA 2WLKA 3F64A 1C5DA 4KRPB 1PL3A 3CMOH 4HSCX 2X6MA 2F2HA 5KJ7E 3ULUD 2HVKA 3MJ8A 5DHYB 4OI7A 1AVAA 5D5ME 2FJSA 3PGCB 4PJXB 4A6YB 3VWKA 1S5HA 2XV3A 4N8CL 2OMNA 5IW6A 1ZS8A 2B14A 3FBKA 3WJJC 3VSVA 5AVUB 5FYLL 3WKMH 1E4KA 1JHTA 1AGCB 3ARBB 4R7NB 2P3YA 5DJ8B 3W1ZA 1R3JB 4P59L 4YHKH 3QUMA 1KN2H 5HHOE 2BVOB 3NEEA 3F7VA 1FYTA 1I7TA 4E9XA 1YRKA 5E8OB 1HWGB 3WCYA 3PJSB 2ARJA 1FJ1A 2XYBA 3EYUH 4YPGA 2GSIA 4QHMB 2XWCA 1YNTA 3B6SA 4FP8H 3GEWB 2FL5B 4PJHE 3JTTB 5E56A 3TO4D 4E41E 3CDGA 2G5BA 2JJWA 2WGNB 4MMXA 1KIUA 1QLRA 3TO2A 5DR5H 1TEFA 1N5YH 4MNQE 5A2CA 1S5IH 4JZNB 4BSJA 4FA8A 4I89A 1BM3L 3VRJB 1I1AA 2KI6A 4XGZA 4BRJA 4C54A 2RB8A 2PPEA 1WUNT 4HEMA 5JXAL 2X3BA 1C5BH 3QZWA 1WWCA 3PHOB 4DOHB 4FNUA 1YEIH 4PHZA 1RK0B 3F6JA 3NDZE 2NTFA 2VXTH 2NY4B 4B9IA 2VDKB 3G5ZB 2B5IB 2GTWA 3BI9X 3MU3A 4AJVA 4B6ZA 4P3DA 5DLMH 2GAZA 4ZFQA 3GJFH 5D55A 1KZQA 2B8OT 5ESQB 2F1BA 2NSQA 2OR8A 1OCWH 1PX4A 3OMIB 4PRHE 1E4XH 2CKBL 4Q9CA 1BMZA 4A37A 3MRKA 4FQ2H 3CFKB 3RNQB 3TVMD 3WD5H 4DO4A 3TJEL 4NP4L 2A1WL 1CGSL 4G7VH 1CF8L 1JD7A 2C3GA 2QADB 4HMEA 4YFDB 5D1QA 4IU3A 1WHPA 2ICEB 3P3TA 4TULH 4N26A 5CGMA 3EJZD 4Z7VA 4FNLL 3PL6C 1W15A 3HW7A 3PP4H 4JO8A 4OR1A 43CAA 1J11A 2V3EA 4KNQA 3CVHB 4PJ9B 4LDOB 1PFCA 3BEVB 2Q86B 2VN5A 2VLKD 4HPYL 5FYLD 1KN2L 3AQZA 4ZUVB 3V7AG 1WFJA 3KMDA 1BXVA 4PJGF 2SODB 1V05A 4YWGH 3RVWD 4PRAB 3HLAB 3QG7H 1DJIA 2WIIA 2Q5BA 5DR5L 4PJDB 3LAFA 4U4BA 1S5IL 4TSCH 5JW5A 4EBQH 4YZFF 3D07A 1L4IA 1P5UC 1IFRA 1F4YL 2QFRA 4OD1L 4UQ2A 4FA6A 1ORSA 3UTQA 4XE0A 5ISZA 4J8RA 4X80L 1C5BL 2NXZD 4YK4B 3IDXL 5PCYA 4NFCA 4EI5D 3D18A 1Q1PA 2A3TA 4P3CL 4Z0BH 4L29B 1MEXH 1OSEA 4JFDD 4U3SA 1QZNA 4AYMC 4CJ1A 3BZ4B 5L6YL 2NOYA 1MREH 2W60A 2B9AA 4EZJA 1F11B 1M1SA 3QT2A 3UBGA 5DLML 2G5RA 4WFHE 1N10A 1SHSA 3OAYK 4HXAL 5LGYA 2YEVB 2BERA 2W65A 4K2UL 4OM1L 4WFEE 5LKNA 2P8MB 3HRZA 2VH5L 1MN4A 2BWQA 1N8ZA 1CG9A 1CT8A 1FN4B 2V5SA 3EH3B 4ZUSB 4HKBA 4KZEH 5BS0B 2B7DT 4MKTA 3ESNA 2DMCA 3LN4B 3ULSA 3FTSA 1PBYA 3RGVD 4LP8A 2C1PB 2FAUA 4LNVA 2IQ9H 4PYHA 3FHAA 5SWSB 4YE4L 1YPZE 4P8QA 3RFZB 4OLYH 2NY5C 1PD1A 2X88A 4N8VG 4HZLA 1X9QA 2BK8A 4I0PC 5B8CC 5BUAA 1XGTA 4JHWL 3EG9A 4YDIH 3MO1A 3QEQA 3UGXA 4KHXH 3NCFB 3W11C 1ET8A 1ID2A 3WN6A 2NW3B 4PQXA 3KPPB 1LL1A 2A73B 2A9BA 3DPDA 2GIYA 4YWGL 4KOBA 4NQSB 5FOJA 5E7FA 3VB8A 1IM3B 1CXHA 2Y3NA 3ESOA 2NPLX 5IREA 5D9SA 3BHBB 2XXGA 3KWWB 3VXSB 4JFYA 3W2DL 2XVKA 2MQCA 5G4OA 4HS3B 5AAMA 5K9KB 1AD0A 1D6EB 2R56L 1JD9A 2OXHA 4QDGA 4F7EB 4EBQL 1HSBA 1OB1B 1SMDA 4MTMA 3FAXA 1CDJA 3VFGH 1KFAL 1KTKE 4PP1C 5EWIH 3EGSA 2ZZUT 3AB0B 3BKYH 3IJYA 4GRWB 2XV0A 1T4KA 3AGWA 1F42A 1JTTA 4M6NH 1JFQH 1A7OL 1EZUA 1MEXL 4KMTH 2DMBA 1NGZB 1WPCA 1UTDA 1RY7B 4F7TA 5E8DH 1PEZA 1DJXA 2F53D 2QZQA 2VC2B 4OF0A 4YXLL 4X9IA 2GCYA 2XZQH 4OAWA 2WZPA 2WVSA 4OZFG 2PYED 5LAXB 5E94A 5EUOA 5J13B 5KSBB 1BMGA 4KJPC 1T22B 4LOVA 4WI0B 4KZEL 2A9MH 2IOIA 3RX9A 4N0YH 5BRZB 4D9RE 5EEWA 1R3IL 1JZ7A 3HZVA 4B9JA 3NIFB 3TO4C 2BVPA 3NIGF 1TG8A 4P4RB 3WTTA 5C0JB 5CZRA 3UXFA 3IXTA 2Z93A 3LQAH 3QIWD 5AVVB 1I3UA 1VACB 3AS1A 3P4MB 4WW1B 3I6GB 1Q0XH 4FYQA 4KXZH 3ZGIA 2ERJB 4A2FA 3RBGA 2P24A 1IILE 1X7QA 4NBXB 2YJLA 5I71B 4QGTA 4QHNA 2VAJA 4N2KA 5DJDA 2NY0D 1DSFH 3MBEC 4I13B 2EUXA 2G3MA 2E9BA 3US9A 3T0EE 1NGYB 1P4LB 4DEPC 3O2VL 4QAWA 4I3GA 1J0KA 3JWOC 4Z78B 1Q9WA 4WHYH 3WFCH 5AB2A 2X2JA 3O8XC 3GB7A 4P5TD 1PKOA 3S3CB 5EWIL 4E9WA 2FBRA 2ZOKA 4MAUL 5FGSA 3BKYL 1JGDB 4IJ3C 3SQOL 2QQLH 2CKNA 2F61A 1DSWA 1FNGB 1NAMA 2VQTA 2Z31C 1FSKB 1JFQL 3GTTA 4FFVD 1PPIA 4M6NL 5TQ2L 1RZIB 2B1HH 5LDUA 3ME0B 5B3JF 5CEZH 4CSTA 3MRIA 3ETSA 5AZ2H 1MIML 1YN6A 2EH8L 3HMXA 2J71A 3EJZC 1U8OB 1JE6A 4X6CE 5CJOL 3OJ2C 5IB3A 1LO2L 1SHWA 1AC0A 3ECWA 1KTLA 2HB0A 2IDUA 1DZ0A 3F6LA 4IRSC 5DS2A 3U4EB 1AQDA 1SMAA 4KZDH 4NZTH 3MRBA 4H1LB 5LGJB 3T3MF 1PZBA 2OLDA 1SXBA 2V7NA 4QNPE 4UAHA 2X4TA 2OW7A 2OR7A 4W9CC 2YD5A 1I3RB 1NFDA 3T77B 1F41A 5IFJB 4FZEH 2EEXA 5KYUB 3S5ZA 1SHXA 3RVWC 1U8NB 1ZWIA 1E8WA 4FMKA 4JKPH 4JBSA 3OLDA 3HC0B 4PV1C 3OF6A 4LPTA 4POZC 3FB5A 1MNNA 4BIKA 1SRDA 1B9ZA 2QVFB 5ENWA 1BFSA 3GMOA 3KBEA 3ZOAA 2F7IA 3PPSA 3WTWA 5KYWB 5C86A 5ES4B 4F7EA 3MV11 4PS8A 4A04A 2ZG1A 1QUPA 5LG1A 3V6OE 3Q43A 5CJQL 4ZSOB 3RTLA 1MWAB 3NPZB 4HUUB 1AYOA 4KDTA 4C83B 2HJLA 4JFHE 3SCMB 3B34A 3UYRH 2OX5B 3T65A 4QRTB 4UQIM 5F0LB 5IQ9B 3LEXA 4F91B 1URLA 3S37L 1T6VN 2A6IB 4JG0L 3HJEA 1NCTA 2FE0A 4Q58C 3WIHA 1WBYB 1H3XA 2WINA 3KW8A 4PJEF 4Y5YB 4MDJB 1VZGA 1IEAB 1OTSC 1JGEA 3LY6A 3TA3B 1UZ6F 3GSUA 3OKLA 2WNKA 3AAZA 1J8HE 3HRPA 2WBJA 3N44B 3WXVH 1DVSA 5B38B 5CEZL 3NN8B 5AZ2L 2ZP9A 4WI2A 4CL7A 1XBDA 5AKVA 3M17B 4NYLA 4ZS7L 3C5JA 3UGEA 2CDFB 1NKGA 5C0GB 1T4WA 1GSKA 3WHE0 5KG9A 1SMOA 1E8ZA 2E9IA 1G43A 2MKLC 2YJQA 3G5WA 1RUKL 5IOKA 1XVSA 4CVZA 4Y9FA 3W0WD 2C1OA 4N9GA 1MCWW 4CRPA 2M83A 1CU4H 3BZEB 1O7VA 1WFUA 1Q9OA 1TZGL 3EBHA 3OC5A 1EMTL 4G8IA 1NAML 1WBZB 4JHZA 1AGEA 3MRPA 2Z6FA 5BQ7A 4XMTA 2W8CA 5HJ3A 1OARH 1Q0YL 4HUXA 1MIEH 4HC1H 2B1AH 2QR0A 3FTUA 3G5YA 4QKXB 4UV7L 1VFAA 2XACC 3CTTA 4XB3A 2AXFA 4XO8A 4PSRA 4DN3H 1KG0A 4ZPVA 3D3VA 3HMXL 1GAFH 2WVTA 2HJFB 1IKFH 1BOGA 2Q7YB 1I53A 1NGXB 1BJ8A 3O9WD 5BJTA 4M5ZH 5B39G 4AMKL 3FB6B 3F12B 2OCCB 4PCSA 5IHUL 4OD3H 3SY6A 1MHCA 5J3HD 1T5XA 4NOFA 1MI5D 4Y1TA 1ZT7B 1BLIA 2OSLA 3WAJA 3DO3A 5KS9A 5EN3A 3V9CA 2H1PL 2DQIL 4DGVH 2CA4A 3P73B 3MSPA 4DGUA 2ZG2A 3UYRL 2VO5A 2P47B 1T0PB 1DBKH 3UBXG 3TASA 2IGFL 3FULA 1KLGB 5JPMA 5I16B 1TCRB 3Q6GL 3WLBA 3S5YA 1QWNA 2H3NA 4TPRH 2CR6A 3U36B 4LPXA 4S1SH 5HDLA 4UOQA 4EDXA 2VN7A 4XC3L 5AW5B 4BFOA 2OK0H 1CD0A 2EYRB 4XN9A 5EC2B 3WY4A 3RY6C 4DGYH 4BGDA 4O00A 4PGCB 2YPKB 2VE6B 3CFUA 4YC2B 3SO3C 2COQA 4JL2A 1YEJL 3TYGL 1VCBC 1UJ3C 2LE9A 3BUPA 5GGSY 5CEZD 5I30L 4XNMB 3RDTD 2FEJA 4LESA 2WTOA 1TZHB 4K71C 3WOVA 4AJYV 2I60L 4NPJA 1K8IB 1JVOA 1NIAA 1AHMA 5IVXA 3APCA 1A2YB 1AR1C 4TTDC 4DO6A 2BH0A 3WIHL 3R7QA 3UTZB 4Y88A 1M3IA 1P0SE 1WFNA 4J1UB 1FVEB 3EJUA 2H0FA 4ZFOB 2ZXEB 4OZ4A 4MA3B 5CGYD 3BO8A 1F6AA 2CXGA 3ZT5A 4DKEH 5SX4I 1ZTMA 3SQRA 5HHVL 5DD5H 2I07B 1NMBH 4DN3L 4DP8X 5IF0A 1SYSA 2HMID 3MRNA 4BZ2A 2OP4H 4ERSH 1NL0L 2X2UA 1BQHB 5DHXB 1D5BB 2XQBL 3CVIL 4KPHL 4JO1H 4M61B 4S1DC 3MNWA 4M5ZL 6PCYA 4P5TC 2XWXA 3TNMA 4MJID 3HI1B 3PHQA 1N7ML 1OAZL 1BVLB 3HIZA 4PGDB 1F5WA 3D39B 3L7FB 4FFVC 3WE6B 3E38A 2OKMA 1E8XA 1U8KB 4LP4A 5DD3L 3OPZH 3FQXB 4ETQB 2BP0B 4PR5B 4NUQA 3J8F7 1DBKL 2MSPA 4FQJH 2CO6B 3DKHA 2V3FA 3ULVE 3OHXB 1JK9A 9PCYA 3INOA 2OZ4H 1E9OA 3RX5A 4TPRL 2XIBA 3K2MC 1PYWA 4UQAA 5JYLA 3QEGH 1G7LB 1F2QA 4HCIA 2ZOLA 1OQOA 1UD4A 4MASA 5DHMC 3UC0L 4DGYL 3VFOA 2FWSA 2XIIA 5GRVL 1A14H 4YDMA 2IAMB 2DWXA 3P4NB 4P57B 2A9NH 2E7MA 4N86A 1VFMA 5DD1L 4IBSA 5J6SA 2P5WD 2I26N 4P5SA 2ZXCA 2UZIH 2DYPD 1HHGB 3NA9L 3N43F 1PMYA 1N3NB 4H20H 3Q8CA 4JFFD 2H47C 5ECGA 4JRXA 3ESMA 4FABH 1GGTA 4G80A 3FF8A 4BH7A 2ZPKH 5FV2A 2YSSA 3MLPA 5KANG 3GXIA 2Z0UA 4G43A 5L2KB 2UY7B 5E4AA 2EECA 3DYMA 2VW7A 4O02A 2NX5D 2MCG1 1UZ8A 1RUQL 1NMBL 4JB9H 3S35X 1GY1A 4ERSL 4K7PX 3F5WA 3FQUA 3VXRE 1JGVL 4Z7UB 4JO1L 2YXFA 3TM6A 1NANH 2B39A 4MCZA 4OSUH 5IM7B 3UBHA 2BIMA 1BIIB 5DJ0B 2YD8A 4GJTB 3HC3H 3VJ6A 4TLKA 1IGJA 4NXKA 3X12B 2LAAA 3OPZL 3AXIA 1OAQL 5K39A 4BDVB 2X4OB 5CEXB 5I9QC 2Y2YA 2H7WA 1TJHH 4EN3A 1E4HA 2X4RB 1R75A 5IBLD 3K0YA 2ZF8A 5DWUH 2OZ4L 1YNLL 2QV4A 4PJ7B 1QR4A 4EXKA 3EYQC 3EYFA 5DURB 3F6IA 4I87A 3MOAH 4BZ2L 5DO2C 2ZF9A 5JXED 2FJGA 1NCDL 1LNUB 4ONGH 4G9FB 1ASOA 2J8HA 3ULUE 3D33A 3WNLA 1A14L 2ROXA 2C9PA 3H7LA 1BZ9A 4U7MA 4AEHH 4ZMLA 2A9NL 4L8SC 2AXHA 2FX7H 2CLZA 4XP4H 4FQQB 3KVDD 2R7EB 3MFFA 2X70A 5J11C 2EUWA 2UZIL 4GQ9H 4O2FB 4HUWB 3SPVA 1I1YA 3FF7A 3LQAC 3K2IA 5D1ZC 4R7DB 1B3JA 1RURH 3HUJA 2O5YL 1F4WL 3O9WC 5DQ9B 1HL4A 1PIFA 4U1LB 1N0XH 3A67H 4LNRA 3K46A 2FNBA 3TBYA 5I1JH 2NTSP 4Y2NA 3KWXA 4PV8A 1FZMB 2CXKA 2I5YL 5HHXH 1NJ9B 1IL1B 3SGKC 4OUUA 4QJ5B 2J8OA 3HCVA 3V6ZA 3EDFA 3L3GB 4JQIH 4Z7QF 3GSQB 3S5LG 5DK3A 1MH5B 1N2RB 2V2WB 4DNLA 2XV2A 5C0RH 5K9QI 3KCPA 3HE6D 1BFOA 5T5NG 5AB9A 1ACCA 4C56B 1Y6KR 3PNRB 2C3VB 4PRDA 3L48A 3P0YH 4ZYKB 2C7UA 5E1AA 3LKOB 3NK3A 2DQDL 3BUTA 5K9OA 3L4WA 3IU3A 3QYNA 4AIZB 2WP3O 4OLVH 3D85D 4JO3L 3A6BL 1XTLA 5DQDH 5BZWA 5ETUB 1R3HB 1YYML 3VA6A 1SLWA 1DUYA 3IEAA 3WENA 3IYLW 4O02L 1HZHH 4YS4A 1D5MB 3LH8A 3RDTC 2LHAA 2P28B 3RWHB 1K2DB 4P46A 3MOAL 3X3GL 3B2DC 1KLFA 1RD6A 4WUKH 4NUJB 4R7XA 4FNSA 4XVTH 4DPCX 3LXAA 5C0CA 6CGTA 2YZ1A 5F1SA 3DTDA 1AS7A 1G6RA 5CWSB 1ZIAA 2CMRL 1TZIA 5AKRA 5DEFB 4AEHL 1MCRA 3AM8A 3G6DH 2AK1H 2X28A 5CGYC 3NSXA 4HISA 3M1BA 2VUYA 5C9JA 3F8UB 2HMIC 3VGDA 2VLKE 4KRLB 3PS6A 4HHGA 5FYLE 2GPZA 3NJVA 5HVHC 5C6TH 1OCCB 1FL5B 4K5OA 4GS7C 1K6QH 4XN4A 2VXQA 2ITCB 3ARGA 3VFMB 1N0XL 2Z34A 4TUKL 1PW3A 2G9HA 5I1JL 4KAQH 3WE1A 4HH9A 3KGTA 3VFRB 3FSZA 4ADGA 1QLEB 1A4JA 2Z7WA 4YBQD 4Y19B 3U1PA 5HHXL 4WU5A 4WDIA 5C0BB 2OMVA 4JQIL 1EGJH 4YBLC 3MODL 3LTVA 4R4BB 1XEUA 1BP3B 4YIQA 3MRMB 4C55A 5JIIA 1SN2A 4JCWA 3BPLB 3MUGB 1PKQB 3GM8A 2QKIA 5TDNB 4B9FA 4BFKA 1YEHH 3N1GC 3T2PA 3P0YL 4L4JA 1MJ8L 3QXWA 1II4E 3RWGB 1OAYH 4XN8A 2LVEA 1H5BA 1EEUA 4OT1L 5DSCB 4JFDE 2K9FB 2BFVL 2HAZA 5EG6C 2E86A 5EU5A 3ES6B 3WS6A 4DO5A 1SOSA 2FH6A 3N06B 3PWLB 1OF0A 3F7RA 1M71A 2WXFA 3AG4B 2PYFA 5JHDD 3GLAA 2X1QA 3T09A 3OWEA 1KIRA 3KYNB 3BWAA 4PG9B 2C34A 5ESVA 1BZDA 1KNOB 3JYBA 5B4MC 3HG3A 5IR1A 1I8UA 4MVBC 4UZUA 5MENB 4FE9A 4EEEA 2NNAB 3WDIA 4HOXA 4BEIA 3G6DL 2AK1L 2ADGA 4M4RB 2DM4A 4U6HB 2YD7A 5EIIA 2ZE0A 4LLUA 1KIQA 2CO3A 1OGAA 5FYKU 1T7VA 1S7WA 4GLRI 1YZZA 3CSBA 1S7QA 5E8NA 4E68A 4JY6A 1THAA 3TBSA 4P5MA 4QOKB 5C6TL 4M00A 4TRPL 3C6SB 4JRWA 4ZX6A 2ZYHA 5IQMA 4C4KT 1S46A 4FI7A 2ZWLT 2CCLA 5TGBB 4UU9A 4I5BA 1TNNA 4A6YA 1P4IL 1JZHA 3MFGB 3FFCA 2AKRB 3X2QB 2HG5B 1Q8MA 2AEOA 4NKDB 1G6RL 2DKSA 4FQLL 4IJTA 2X12A 4I0CC 1EGJL 1AGCA 3ARBA 4R7NA 5DJ8A 5BPPA 1MCHA 1PD0A 1R3JA 5I15L 2WN2A 3ZYOA 1W6WA 3GHEH 1QG3A 4R3SA 2BVOA 3WUWG 4I1NB 3MJWA 3OVUB 4PGEB 1MJ7H 4MHHI 5E8OA 2BJML 2MHAB 1RJCA 3QUZA 4OH2A 1ZVHA 5JXEC 5MP6L 1YY9C 4LVNB 5D2NC 1TQCC 2FH8A 2VXQL 5DJ2A 3W9DA 2FL5A 1MFDH 2W9DH 3EXJA 5GRZA 4PI0A 3SZ6A 5C3IA 1WQVT 2ZG3A 3F7PC 5C08B 5CD3B 2JXMB 5FIEA 3IJSB 4IMKA 3PU7A 3NIDB 4XP9H 3ARED 2F53E 2CO7B 4GSUA 1OVZA 1FFRA 5J4MA 1EXHA 3WEMA 2IH1B 1BD2D 2VSKB 5CILH 2PYEE 5FX3A 4DPRA 5F7NC 1QBBA 1YSOA 2HT2D 3PHOA 1UCBH 4KRMB 3L1GA 4EKJA 1RK0A 2ZKYA 4G6KL 3S34H 4PJBF 1GYVA 4XXWC 1VRSA 1KWGA 4LKCB 4RETB 4N68A 2X9XA 5SWZD 2PR4H 3G5ZA 1UENA 3KYOB 1N19A 3WMPA 3D25B 1KTJA 4GKOA 4MAYD 4JY4B 2NXYB 5DJZB 1J5CA 2OMWB 3QR2A 2I9TB 2CHXA 2GHWB 3EADA 5ESQA 1KGCD 4EI0A 4H26A 2VM3A 4F8PA 5E70A 2NY1C 2YAEA 3ROOA 2Y72A 2WSPA 4NB7A 2VMDA 3FZUD 1F4AA 1RVFH 2WLYA 4P5RA 5F7WC 5DD6B 3CFKA 3VXUB 4JM2C 3RNQA 4HK3J 4FTVD 2ZX8A 4XZUA 3UPAA 4F93B 4LSPH 2F8VA 3BWZA 1YYLH 3ZE0E 5EU6D 2ICEA 3WO4B 4O2CB 3KH4A 2ZONA 4PRIB 4OLXH 1PDKA 2YK1L 3UEQA 1G94A 4Z3FA 5GRVK 4POYA 3FCBA 5L7XH 3BEVA 2Q86A 5D1QE 2DEXX 4FI8A 1W72B 3GHEL 3VXTA 4JZOB 1NC4D 1YC7A 5B7FA 1S7XA 4Z7VE 5I8OL 1MFBH 2WOBA 2YC1B 1GTNA 1MJ7L 1A9BB 3PXLA 2F74B 1LWHA 1R33A 2AK4B 4AKQA 4XE5B 4NQDA 4A2DA 4GI6A 2OJEB 3BAWA 3NA4A 1L0YA 1JK8B 2DJSA 1V27A 4J2QA 4PRAA 2VOTA 4FDWA 4GP4B 4OIIH 4HXBH 2EDYA 3B4NA 4B9GA 4A6YL 2E7LA 3EHBC 2AI0H 3MBEB 3N1MC 3BSGA 5FGCE 4PJDA 3SDAC 3VWJA 5IJKA 3S3SA 4RRPG 4HULB 2E56A 4WRLA 2P5EB 4LLYB 4JPSA 3QDHA 4RX4A 3UJIH 2XLLA 1AC6A 4MS8D 1EZVX 3GXPA 4AQ1B 2AJZA 1J5OL 4APXB 2JCWA 3L4TA 1J10A 2BNQD 1HZLA 1UB5B 3C8DA 4MA7H 2OTUB 1A5FL 1U58B 3GUFA 2J43A 3C5ZB 3D69B 3RWFB 3VQ1C 4L29A 4NZRH 4QXWA 5I0ZA 1KACB 3ABMB 4HPOH 4ZD3L 3QO0B 3BZ4A 1CC3A 4CDGC 5IQ7H 4TQ8A 3V5HA 4Y2DB 1F11A 1HYRC 5GSVB 3REWB 4RGND 4X7EC 1AIFA 4X4XB 1MRFL 5JOPD 4F7KA 2RJMA 2P8MA 2CDGA 5DRNA 3NCEB 1JRHH 1KBKA 3TCLB 3ZZQA 3OAUL 4OB5L 4XVJH 3TOPA 3X11A 2X0VA 1RZ7L 3LSOB 4JREC 5DS1A 5BS0A 1A3QA 1CICB 1TXKA 4NHCH 1D9KB 5TE6H 4GI9A 4LO9A 4WUUB 5KSAA 1YYLL 1GS6X 1MKFA 3O2DA 1B3IA 4UIKH 4DFIA 5IEKA 5JPNC 2V3DA 4NM8H 2IADA 4LRNL 4N2HA 3RFZA 5L7XL 1H9DA 3O3EA 3ZKSD 5D7LB 2CGYA 3VQMA 3WXWH 7TAAA 4NM4L 4WV1C 1MFBL 2CRYA 2VLMD 3D0LA 1RP8A 4Q2ZA 3K6DA 1E4XI 1GPOL 1YEGH 4R4ND 3V4LA 2WLNA 4DN4H 4CVUA 1Z5LB 2W5PA 2ZD0A 3V0HA 1L9NA 1UM4H 3QEQE 4W9HC 2R2HA 3DI2B 1GS8A 3O3BA 3IBOA 3KWWA 3VXSA 3QH3A 1DDHA 4ANUA 3LX9A 5F1IA 5K9KA 4HS3A 3FJTA 3RFRA 4BK5C 1XAUA 2BVTA 1OB1A 4XCFL 2VZOA 3GZOA 4P07A 4AVKA 3W9EA 5T5NF 3AU0A 1CGTA 4OFPA 2DYSB 4Z3IA 4AM0A 3W0WE 1M3JA 4K07A 3JTSB 3QPXH 2CUAA 1X5XA 4DP1X 1TO4A 4QRPB 1ZS2A 2UZXB 3FT4B 3O0LA 2DMHA 4NN6C 6TAAA 4LCUA 3LH2L 4NHUB 3EFOB 4RNRB 3F84A 5E9DD 3H9ZA 5FWQA 4U6XA 2FWOB 3L9RB 2K1MA 4HHWA 2A74B 4AYBA 2OMYB 3J2PA 1W0YT 2DWYA 3CH1A 4KFMA 4ZMVA 3V5DA 1U92B 1MG3C 5LAXA 4XVJL 5BOPA 5KSBA 1T22A 4DZ8B 3QORB 5IKCB 4NHCL 4UF7C 5LXGL 5BRZA 1HE7A 2N7SA 4YGVB 2Y2TA 4LQFH 3BGFC 2AF2A 2CO4A 3GRBA 3EYVB 4Y2OA 1P84J 1FNSL 4TV3A 2Q3XA 3S0PA 2A9AA 3VE0B 1TKWA 1VACA 4OZIF 1JDAA 1IARB 1G9NL 4PB0L 1BWWA 1U3HC 2YXMA 1FZOB 4AQOA 3FS9A 4M7KH 3T71A 3QIUC 4ILDA 4JFXB 3ARFB 1J1XH 5H37H 1NM9A 1A02N 1MAJA 2O6FA 3QDMD 3WNIA 5CUSL 1N26A 2AJXH 3LKRA 4ZG1A 4X9HA 1P7KB 3QXVA 2CU9A 4NQXB 4LEXL 1CF1A 1N64H 4LGPB 3KGRA 4FQXA 3VXQA 3T6VA 3LZRA 5AZEH 2LFGA 3W3BA 2JTYA 2F5AL 4QPEA 2WD0A 5AKSA 3S2CA 4BFRA 5CEZE 3EFFB 3ZR6A 1RZFH 3M8OH 1TJIL 4MAYC 3SJVB 2GTQA 2N59A 3S3DB 5F7UA 4UNTA 1H3TA 4EQ3A 1RUML 3NH7H 4ZJ9A 3N1PC 1YMHB 3FZUC 1F3JB 1JNHB 3LRSA 5A2LH 3BSHA 1B4RA 3GRWH 3VUAA 2BO0A 4LCYA 1SF5A 4F9PC 1CFNA 3OJDA 3Q13A 3ZE1F 3WTXA 4RDQF 4F5CA 4ZMWA 1QPKA 3WI9A 5IY5B 3OGCB 4UV4H 5B22A 4JPIB 4MD0A 3ZDZF 3U4EA 4L4TB 4J3OG 2RACA 4H1LA 4IGBD 4ATTA 2ED8A 4ZRGA 4JFSA 3EDJA 1J87A 3VYOA 1LJMA 1O75A 2G3ZA 4MJIE 3MRHA 5FA4B 2A6DB 3BW9B 3QXDB 5E6IB 1P2CB 5KYUA 1U8NA 4LQFL 4Y4FD 2F54D 2Y36H 4MLSA 3IDNA 3QCVL 1LK3L 4X6DF 1AZRA 2E4FA 1ZV2A 4G9DA 1JYWA 1QSEA 2W0KA 2LU5A 1EAPB 1ZY9A 2YR3A 1R0AH 4CW1B 2EQDA 4U1SB 4Q9QH 3LPFA 3TIEB 1UH2A 3IGUA 4M7KL 5J9PB 3JV6A 4MS8C 1MW3A 2EDMA 5GGVL 2DQUH 1JPFB 1J7VR 3DJRA 1ZXQA 1J0HA 1CGYA 2QSCH 4IK6A 2X4NB 3O6MH 1MWAA 4HUUA 4WWNA 3DLQR 1BFVL 2F6AA 4C83A 5HHQB 5IHWA 3SCMA 3HNTL 1CLCA 5C70A 3VD4A 4L4VD 5IQ9A 2EYTB 4TVSa 1BQHG 2VSMB 4RGNC 5D2LE 2P5WE 3LZPA 1E3FA 2VABB 1H9VA 2A6IA 2PP7A 4KXZI 4NKQB 1WBYA 4PWKA 4MDJA 1IEAA 2BVQA 1BQSA 3C8KB 2GITB 2IAAC 3TA3A 3NJKA 3DIDA 4AM0Q 4AYSA 3TPKA 5K9JH 5B38A 4NIKB 3NN8A 3PXJA 2M26A 3IVKB 4AYID 3GM0A 5I26A 4ZTOH 3RZWA 3N5AA 2AJVH 4AW7A 4Z1PA 2NX5E 3MA9H 1TETL 3ECQA 5AUMB 4MD5B 5D7JB 3S37X 3ZTEA 2AHIA 2VSCA 4W9DC 1FH5H 1XR8B 2N3JA 1MJJB 5TE4H 4YDKH 3BZEA 4CN4A 1JPST 4UQ3B 3VVWA 2L04A 1BV8A 3SY0B 1AQKH 4GUPA 2AEPH 2YPLD 1JHLH 1RJZA 1WBZA 5HYJB 5FO7A 3FCSB 4AENB 1C16B 3QAZC 5LBVA 5BVJB 2Y36L 4Q6IA 3AWFA 1OP5H 2D2CC 3FCTA 4ENZA 5DYOB 1CXKA 4F1SA 4HEPA 3TS8A 1Z2KA 4KKBD 4NO2B 4XXCA 4PVNA 2E9JA 2HJFA 2Q7YA 4PRNA 3G5XB 1ILSA 1NGXA 3LPWA 3JUZA 4KX7A 5FKAA 5KBMA 3GMLA 4ODSH 4F92B 3FB6A 3HHSB 3F12A 2K3TA 3KLSA 3V2AR 3V7MA 4LF3A 4W93A 4Y9CA 3T2NH 3U6XS 4M93C 3V0DA 2ZT9C 3V55A 4N87A 5CBEB 3Q2NA 4DZBB 3P73A 2ICWJ 1KT2B 2H2SC 4RZKA 3FH5A 1XT5A 4Y8AA 5AL0A 4JKWA 3ZUCA 2WXJA 2IDFA 4D8PB 5KS9E 1C1EH 1HNGA 2DL2A 3GSOA 5DHEA 1PTZA 2GUYA 5I16A 1IT9H 1A9VA 1LYQA 2E5EA 4XBPB 3U36A 2UUDH 4TOYH 2XWTB 3RY4A 3NABL 5EORH 1IBBA 4ELKB 5IB2B 4NWUH 2EYRA 1RMFH 2YAFA 3HI6L 3LEYL 4W6XB 2D03H 5EC2A 3SB3A 1FUNA 5K9JL 4NQUA 4PGCA 4XODA 2VE6A 3B1TA 5LGKA 2VR7A 5E2WL 4ZW6A 3ILDA 5E7BA 2G5UA 5HI3D 4XNMA 1UWXH 2CK2A 4UT6H 3OKMB 1E65A 1GMIA 2H6OA 4PEEA 5D5MF 3VFTB 3QNZA 3MNZA 3MRFB 3G6JE 2UVFA 3RDJA 4APQC 5I76B 1K8IA 1FH5L 1Y0LB 4U1KB 3ZL2A 4AE0A 4PJ6A 4XMLL 2QMKA 2L8AA 3LB6D 3MLTB 4HUNB 2CCVA 4UDTB 3SEPA 1N70A 2PO6D 4MQTB 4V1DD 4KTGA 1T66D 2B4CH 2J2ZB 3FFOA 4X7FC 4E9RA 4J1UA 1JHLL 4AOFA 1YQ2A 2NYYC 3OZ9H 3G5VB 5T33H 1BQLL 2UXTA 3ZJAA 4ZFOA 4WNSA 2ZUSA 4GG6B 4YDLC 5GZOC 4R26L 1P53A 5J12B 4PW3A 5CFAA 2HUHA 3AUWB 3OKKA 1BGXL 1LDPL 4LEBA 1U8PB 1MQ8A 5DS8B 2I07A 4NKMA 3TEWA 3JYCA 1HOEA 5BMFL 4GPVA 4YOKA 3FDWA 1YMMD 1HDMB 5GGTA 5C0IA 1C8PA 4UCFA 1HU8A 3QP3A 3BGAA 5CEYB 2E3VA 3ZDZB 4YDZA 5D4JA 2YRZA 1BVLA 5G5DB 4PGDA 1CMOA 3U4KA 3APFA 3L7FA 3WE6A 1MCIA 5B1CA 3H42H 3GSRB 1NUGA 1NWPA 4ZUUB 3FQXA 3D34A 3CFTA 3MOQA 4ETQA 4PR5A 2BCKB 2CD0A 4S11A 3SN6N 4JQXC 2CO6A 4FXKB 5A1AA 5BOJA 4LEEA 1MAMH 3LS5L 3HS0B 2AC0A 5HI4C 3M46A 2FYYA 3EJCA 2HFEB 3EGXA 3C60A 4WZ9A 1G7LA 2EDOA 4IGBC 4RMUA 2GY7B 4MSWB 4OD2B 2PPDA 3CZUB 4N9OB 1WZLA 4ES8A 2YGNA 1S9WB 4HG4K 2IAMA 3AT8A 5C09D 4XB7A 3P4NA 3GS7A 4LDCA 4P57A 3D6GA 3U7WH 4FNTA 2P8PB 1NFIA 5F7HA 5IVNA 2AQQA 2ZYIA 4MZIA 5HD8C 1MRDH 3KPRD 3EO0B 2DI9A 2OYMA 2BM3A 4PHXA 3D51A 4XNZB 4OGAD 5E5MB 2MKWA 3IK2A 3NYKA 4WSJA 6FABH 5I1KL 2FIKB 5D70H 2DD8H 1RH8A 4DT2A 2Y7SA 4YUEL 1TZOA 1PEWA 5FM8A 4XPAL 3X1FA 1KTCA 3HG1A 4TS6A 1TUPA 3OZ9L 4RESB 5GRUL 1HHHA 4X9BA 2WN3A 2WKLA 5F7MC 1KXVC 2UY7A 3ABLB 3PIQB 4QTIH 3BVDB 1UWFA 2IOMA 3BFWA 4YSDA 1KDIA 4DETA 2HFFB 4X6EB 4JY5H 5JHDE 3WN5B 4PBXA 2R1YA 4MXQD 2BSRB 4J3TA 4HIXL 4OVVA 1OP3H 5IM7A 4LLMB 2IOOA 4H7VA 2NCMA 3AWEA 3CFMA 3MV7D 4JMNA 5EDSA 2ICWA 3X12A 2QDVA 3SE4C 4BDVA 3PJNA 4Y4HC 2X4OA 3ABGA 4ZFOL 3JV0A 4NIYE 4AH2B 5EF1A 5DVKA 3B9DA 2GJ6D 1S3KH 1NCAL 2X4RA 5IW1B 4NEHB 1Z9PA 2WLIA 5EH1A 2FBOJ 4GP8B 1U8JA 3L5XH 4PJ7A 3MRQB 3I74A 1ZHNB 2EDDA 1HXYB 1E6JH 4P2QB 4BJLA 2JF1A 3L4YA 3FSAA 3QRGH 1EHLH 4OFYD 2VJ0A 2DLIA 1JP5A 2X89D 2EIMB 4P2OD 1G7QB 1PGRB 3WO3B 3V0EA 3U7WL 1U8IB 1WA1X 1NCWL 1E7VA 4FQQA 1MRDL 3AMKA 4EUPG 2YOAA 5KVMC 3WKQA 3VRLE 4ODHL 4Z7WF 1NSNL 4KKBC 4O2FA 2YFOA 1AXSA 4HUWA 6FABL 5D70L 2YA0A 3B83A 4YLQT 4R7DA 1TVHA 4KKCD 2YWZA 3OAZK 5DQ9A 4U1LA 1B2WL 3QJRB 3Q9PA 1I4FA 1UOVA 3NJJA 4XB8A 1WBXB 1NJ9A 1IL1A 3D9AH 3HUJE 2Y7QB 2VDMB 3W39B 2L7EA 2N7AA 3SSGA 4IDJH 4CN1A 3GSQA 2V2WA 3GGWB 1ZVSB 2WBKA 4HLZG 4C56A 5AVRB 2DM3A 2LU3A 4LFHD 1RZ8A 2AAVA 2C3VA 3BEWA 4BXSV 5D5MB 1G7IB 1XEDA 4ZYKA 1BD2E 1EXUB 3ZUNC 3LKOA 3PHAA 3SPJA 3UTSD 1L3NA 2MH4A 3LRHA 2DIBA 2Y06H 4GW4A 5L0QC 3QZOA 1KB9K 3FQTB 3MJ7B 1KEGH 1IC7H 2DLHA 3C8HA 2C4FU 4KQ3L 3DUUB 4W9JC 1R3HA 2QQQA 5AW2B 5D4QA 5HHOB 1LM8V 5DC0A 4UYPA 4OVUA 3QRBA 3BP7B 4FNQA 1D5MA 1HL8A 1UT2A 4J3UA 4WWID 3T08A 1W0WB 2UZYA 3L5XL 1K2DA 1S7VB 4HOMA 4JCMA 2GBTA 5J5EA 1DFBH 4PJHB 3S4SB 4S1QH 1P4BL 3HAEB 4NUJA 4E41B 3QI9D 1NANI 2GJJA 2Y3AA 2PO6C 4G8FA 1EHLL 1E0OB 1T66C 4FTVE 5EHFA 4MNQB 1DP0A 5CFHA 1AZVA 1F4XH 1XGZA 1EXGA 5EU6E 1CE1H 2VDNH 4PJ5B 3L3DA 4ACTA 3BRGC 8FABA 2Q7AA 1GYUA 5A7EA 3OPUA 1D5IH 5F6IC 4XRCB 4YSEA 1E4WH 3VM7A 2R23B 3QIBC 4NT6B 3BCDA 3LPGA 1BBDH 4JLRB 3V9EA 2IFFH 4DKAA 1WFTA 1A47A 5ACMA 2NY1B 4PFEA 2AQPA 2EDTA 3AABA 4Y19A 3KPLA 1VGEH 2IWFA 2PABA 1UKTA 4NPYA 1I7RB 4UQ9A 4IDJL 4MRCA 4X8CA 1RUAL 3ZTCC 4LKXB 2WKGA 4DPAX 4HWUA 1KYDA 1NBQA 2N01B 4F1ZA 4X9GA 2IBBA 3Q5OA 5D1XC 5F1NA 2GUOB 5EC1B 5TH2B 3PDOB 2YGOA 1HQRA 4C58B 3QUXC 3RL1A 4G7YH 1T1YB 1NZRA 2O72A 5FUOL 1ZXKA 3RWGA 1GTFA 1FORH 2WV3A 5D93C 1SXAA 2AANA 3DROA 1FC1A 1WT5A 2LOEA 3WDHA 2ESVA 1KEGL 1HCYA 1T3FB 3ZK0A 3V0GA 3VGAC 3HE7B 2J72A 1ANUA 3FUFA 1CR9H 4M8UA 5T3ZH 3IMVA 4JHUA 3N42F 3T6ZA 2ZICA 2D7MA 5JOPE 3HPJB 4HWBH 3VD3A 5C07D 3TCTA 1NBVH 2XWJB 5HDQL 1DFBL 2V37A 4FKKA 1E6OH 3R4RA 3BH9A 1K72A 3H1ZA 3IRZA 43C9B 4TNEA 2Y1AA 5D8JH 2G3XA 1ONQB 2E6JA 1U4FA 3IFLL 4MMZB 4N2BA 4QNPF 2ADJB 2YMXL 4K55A 3BCFA 4LGSB 4RISH 2NNAA 4AQAB 3X14B 1CE1L 1FNEA 2VDNL 1P5VB 5GGSA 3JWNE 3SDDB 5F9DC 2J1XA 1ZRUA 4GOSA 4M4RA 4KHTH 3J7HA 4U6HA 3TTSA 2VERN 2KDGA 4K8RL 2GBAA 1ZCRA 2BOLA 1ASQA 2DH3A 1TYEB 1KXQE 4K7PY 2X4QA 1E4WL 5DJCB 4HKXB 2ZKHH 3OM3B 3SDCA 4QOKA 3PJLA 2VLME 4Y0GA 3UADA 3VNZA 5BUGA 1OM3L 3DYOA 4FG4A 4AQ8C 3OG6B 5TGBA 1OGAE 1VHPA 3FT1A 4JS7A 1AS8A 3C12A 1X5HA 4RGOL 4IU2B 5AB0A 4XPBL 1DLFL 3EF4A 4NKDA 3PE9A 3MJ9H 2G2PA 2NMSA 4LCWA 3QDGA 4OZFH 3NSCA 5I0DA 4NLHA 3QUKB 2VNCA 4Y1SA 2JIXB 4OQTA 1AOHA 3SPHA 3O0RL 4KC3B 4PGEA 1XAKA 3KG5A 3V0IA 3WGUB 1LO0H 2IXQB 4G7YL 3U79A 1AQHA 3VWKC 3DX8B 1T2XA 5FYJU 2FT6A 5EEUA 4I48B 1FORL 4W4NA 5IVOA 1U41A 1YPZB 2GFBB 1E4KC 4YDVB 3KS0H 1CDGA 1SJHB 4P2OC 5C08A 3V4PH 2WTRB 4UAOC 4KVPA 3H4FA 2ITEA 4PS3A 3IJSA 3GT6A 5E9DE 5I8EA 1AAJA 3VD7A 4RZCB 1YAZA 3S48A 1WAAE 5AWNH 2Y5TB 4QCIB 3FYEB 3FXIC 1MY5A 3DYPA 1SFHA 4MMXC 5D8JL 3X13B 1PNCA 4WEUD 1AZCA 1N6QH 2KHAA 1DYZA 4B9ZA 5A2BA 4IHBA 3DV6A 2DQHH 3RGHA 3NCYS 2VDRB 1UXMA 4ZODA 1I1AC 4KHTL 2OXGB 4DSYA 1AKPA 4G5ZL 4UILH 5DJZA 3VD1A 1V7NL 3TJPA 4JM0A 4OM0L 4IIQC 5I17A 1FL6B 2OCJA 2Q7NA 5D7KD 3QDME 2YQGA 2Y23A 5EZJA 4PY7B 2R0ZH 1F18A 1XSIA 3B2PA 4N2OA 4GBXB 4P4KD 4ZT1A 4HFUH 5DUMH 1NCGA 1Z32X 3MJ9L 3KJ4C 2WO3B 3P30H 2NNXA 5GSRB 1SY6L 1ZA3B 5E8PA 1I9JH 1A7BA 4UUJB 2BOBB 1OTUC 3TYFB 4GRLB 4WW2F 3FT9A 2YC1A 5BV7B 4J4PA 2XNAB 1NGPL 1A9BA 1GYWA 3F83A 5JOEA 1N4XL 2AK4A 5LCVH 2XTJD 2HP4A 4XT1C 4KKPA 4KO9A 2GYSA 3AXLA 3QI9C 2CIIB 1KF9B 2HT3D 3NJIA 35C8H 1L0PA 2W0FB 5ICUA 1I8LA 4NNYB 1Y1UA 4EMZA 3CZGA 3F7KA 2P5EA 4LLYA 1BYPA 1D5ZB 3T1FB 1NEZG 1NQBA 1RCYA 5T3ZD 1GIGH 1X5AA 3BUYB 5HGDB 3ZMRA 1RFDL 4AQ1A 2GI7A 4OQTL 4APXA 5C7ZA 4V2BA 3T0EB 4ONFL 1UB5A 2XWBB 3TJHC 5FV1L 1U58A 1CFVL 3C5ZA 1MLCB 3RWFA 3UBFA 2M8XA 2XETA 2FECL 2EDWA 3B1UA 2E47A 5AB1A 4AK2A 4V33A 4Y2DA 5GSVA 4LZKA 3I3EA 3REWA 1UURA 1J5HA 3CD4A 4X4XA 2OFQA 3CXFA 4WWKD 3QYMA 3AY4C 3EO1B 3IDJB 3HG5A 5AVZB 5T3XH 3TCLA 2FLMA 4URTB 3UTTD 3EJYD 2VLJA 4F24A 5KYXB 3ECBB 1EJOH 5C0AA 1E2ZA 1MJUL 4AL8L 1CICA 1YY8B 2XJLA 2R0ZL 3IDIB 3OLIA 1OT2A 1JPTL 3QHZH 4WUUA 1JZ2A 4XAWL 1NKOA 1TFHA 4X6CB 2H0JA 3ORJA 1NDMB 5KJRH 1DQLH 1EEYA 4FADA 3R19A 5E8DL 4JKNA 4ODXB 1FFTB 3ZTDC 3MV9D 3HRZC 4L4VE 1OCOB 5D7LA 1G9MH 1FLTX 1UWEL 1F6LL 4JFZH 4ZX5A 1UFUA 4F3FA 1FAIH 1VZIA 4OLEA 1QHPA 2EEBA 3LNGA 1UHVA 3GMPB 3WL9A 4X6BB 5LCVL 5F7EL 1CFSB 1R46A 2QPUA 4MBRA 2IANA 3APNA 1KGYE 4B60A 3MVSA 4U2YA 5D4HA 1Z5LA 1U3ZA 4GKSB 3I2CL 3VXOB 35C8L 3ZDXE 4UQEA 8CGTA 3O41A 3U9UB 2EIDA 4CBPA 5FCSH 1MNUL 3ARXA 1VFBA 3FO9A 1ETZB 4XVUC 4FG0A 4GKNA 5JUEH 1B90A 3GSVB 4LL1A 1RZQA 5AVQB 2FJUB 1CK0H 3DETC 4MD4B 2Q20A 5HPMB 4N5UA 5KBNC 3V9FA 4BBWA 1T83A 3MUZ1 4PJAE 5DC4B 4S1RH 2ZKMX 3GMQB 2H3XC 2UZXA 2XG5A 5GS0C 2YPLE 1UEYA 5HP5A 3O4LD 5AAMC 4RAVB 4YLBA 2QTVA 3EFOA 3UAJA 3GINA 2ZIDA 1L9QA 1HN1A 4GAGL 2NZ9D 1JWMB 2VM4A 3L9RA 3KM1A 4YBHA 1MCOH 1KB3A 5B1JA 3QCUH 3T6XA 5HXMA 3PUUA 1CFBA 2OMYA 4NAQA 2X1PA 1BZ8A 3LVEA 2CLRB 4KJQC 2OL3B 3EOAB 3QAQA 4X4MA 2X7LA 3FMGH 1KJVB 4DZ8A 1TT6A 3QORA 5GGUA 1PLCA 1YEEH 3UYOD 2WWKT 3VFSB 4YGVA 1VJSA 3UJJL 3NBNA 1DBBL 5EB9A 1P1ZB 1X5JA 4L5FH 1DQLL 5IWLA 4QHPA 3A0OA 3B9KB 4H0IA 4XNAA 3VE0A 2ENSA 1ZEAH 4PJBA 2P8LB 5JIDA 2Q6WB 5M94B 1FZOA 2JI2A 4JFZL 3O6FB 4HHAB 4JFQB 3HI5L 4ZFZB 3DRTA 1SFDA 5IHBA 1AJ7L 1TQBB 1JRHI 3I50L 4L48A 8PAZA 2CK0H 4RMRA 4FLRA 2W9LA 3WNMA 1QNZH 5HGBA 1SLVA 1XIWD 1P7KA 4A2HA 4JGMA 3VFPB 1ZT4B 4XNYL 1MFCH 3WFDH 4HIIA 1U3NA 1CBVL 1B4JH 1EV2E 1UA6L 3MLWH 4LARL 3NJFA 1IM9D 3LXUX 1ZTXL 2H8PB 4E9VA 3IMSA 3P0VH 1DE4A 3EFFA 2DBLL 3GXTA 1Y6NR 4XWOC 1IAKA 5CMAB 4FKEA 3US1A 4D9LH 4XMUA 1EZLA 3T9WA 4FAAB 1Z9LA 3CFCL 4X4YB 5IT2H 3MRLB 1DDTA 3GDCA 4S1RL 3DK0A 4V1DE 4EZLA 3BE1H 1JNHA 4RGMB 1NCOA 4QRFA 3WLWD 2LVCA 4BHUA 3P4OB 4IHOA 1FO0H 1WEJH 5HPOA 1FLRH 1WCQA 5CNHA 1WZMA 4MYPA 3BPOC 1HS6A 4M43L 4OZHB 4BKSC 1BX2A 1I85C 4IBTA 3QCUL 4TL4A 1MFVA 3NCCB 4JPIA 5D7IE 3KDMA 4CSPA 3E6HA 4PJGE 1A6WL 2OMBA 4M3KB 4F5CE 4KI5C 1MPAL 2ZUYA 1R5VB 3CZFB 4M6OH 5T3XD 2XBZA 2COVD 1YEEL 3IBEA 5FA4A 3BW9A 3QXDA 3BRFA 5BVPH 5DHVB 2HT3C 4ZFGH 5I6XB 3MNVA 3CU7A 3OKYA 2K9UA 4YZFE 1G0XA 3GXFA 1ZEAL 1EO8H 3HC2A 3U0WL 1FHGA 2CM6A 4U1SA 3TIEA 4ECNA 1VPOL 5EEXA 4WHCA 1MDAA 4J3WA 1UUNA 1EZVY 3L3OB 4LSDA 2VDOL 1WG3A 3NZUA 4UDUA 2J88H 2X4NA 2DICA 2H6PB 2PWHA 4R5VA 5F7YC 1WVZA 4IBVA 1QKZH 1B4JL