4CSSA

Crystal structure of fimh in complex with a sulfonamide biphenyl alpha d-mannoside
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords PROTEIN FIMH
total genus 38
structure length 155
sequence length 158
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cssA00
1UWFA 4AVHA 3BWUF 1PDKB 3JWNE 1N12A 4J3OF 4XOAA 5F3FA 5AALA 4BUQA 1N0LB 2J2ZB 2WMPB 4X5RA 4XO8A 4XOBA 4AVIA 1TR7A 5F2FA 5AAPA 2W07B 3BFQG 5IQMA 4AV5A 4XO9A 2UY6B 1QUNB 3ZL1A 4J3OG 4AVJA 4CSSA 4XOCA 2VCOA 2JTYA 5LNGA 3ME0B 3JWNH 2JMRA 3ZL2A 5AB1A 3SQBB 4X5PA 4AVKA 5FS5A 5FWRA 4AV0A 3JWNG 4XOEA 1KIUB 2XG5B 5LNEA 3ZPDA 4AV4A 1KLFB 4X50A 2XG4B 2UY7B 3MCYA 3BFWA 5FLUA 5IQNA 4CA4A 3RFZA 4LOVA 5FX3A 4X5QA 4ATTA 5CGBA 5ABZA 4AUYA 4AUJA 5IQOA 5JQIB 4AUUA 4XODA 4CSTA 1ZE3H 4J3OH
chains in the Genus database with same CATH superfamily
5EU3A 4XH2B 2BRRH 2NZ9D 4FHJA 4LVOB 4D8PA 2AHIA 2EVFA 1JOIA 3GSWB 2GFBA 1TQWA 2LU5A 1PZBA 4P2OD 2P45B 4ONGH 3DX9B 5IGXH 3L2LA 1IGFH 3ATEA 5J9PA 4HIJA 1T5KA 3DIFA 4MKTA 4DN4H 4AOFA 3U2IA 3PWVB 3MRIA 4ODUA 1KJ3H 2J8UE 1IC7L 5AOJA 4X80L 1DVQA 3ZO9A 5A40E 1FAIH 1V7NL 1BQHB 3ABLB 3QDGA 4HOMA 1WTLA 2DI9A 4N0UA 2NQ3A 4L3AA 1NJ9A 5EA0H 1T5XB 1KBGL 3DUHA 4NN5C 3EHBB 4KJWD 5KS9B 3MNMA 5F9WC 3ZHDA 1AFVL 4BA0A 1OAZL 2JCWA 3W3BA 3AWGA 3L3GB 3QJHA 4XMKL 2VR8A 4K94C 4MD0A 2C9QA 3QIBA 4AENA 1J18A 1CXKA 2PN5A 3EGDB 3GLEA 5T5FH 3WE6B 5ID0B 2H0EA 1HI6A 4FYRA 3MLSH 3ATFA 4RMTA 1EHXA 4HC1L 5DA4A 1BZEA 2OMTB 4ZUUA 2YJLA 3H4HA 2J6WA 3BVNA 1OGTA 3A6OA 3QS3A 5D2LE 1RUPL 2WQSA 5A1AA 2PW2A 1AXSB 3Q8AA 3UABA 2M8XA 5TK4A 4QAWA 5CN2A 4RQQB 3BCFA 4XXDA 4U0RB 1AXIB 4JZJA 5EH1A 1YY8B 3I2CH 4RNRA 3MRKB 2X0UA 5GIRB 1T3FB 4LLYA 3E8UL 5B7MA 1VEPA 2VC2L 2FL5B 1AQKL 3B5HA 1TVBB 1CD9B 1MH5B 1KPUA 3L3KB 3ZXAC 4NNPL 3RY4A 1H3UA 1SPDA 1YEHL 2BVOA 2NNFA 5HPMB 3LXCA 3DO3A 4U6YA 3QAZB 1DL7L 4P46C 5KZCB 1XGQA 1FV1A 1ZAGA 3KR3L 1U3HB 3EYSH 4JRWA 5EOCH 5EC1A 3GSRB 3PHSA 5D7EA 2FEDD 3LEXB 2P3YA 4DF9A 5CLYA 1IC4L 1R24A 5JPNB 4GKSB 5IQNA 3C5JA 4RWYL 4ZUSA 4OAWA 5BVJA 3MRRA 4LO9A 4OF0A 5I76A 4TOYL 3KEHA 1KJ2A 2VISB 1UCTA 1NLBL 4OZFA 2NUTA 3ZIYA 4YHKL 3T0BA 1EXUA 1PDKA 2H6PA 4GRWB 4M6ML 4M62L 5DK3A 4G6AC 5C86A 3IRPX 4QXUL 1MJ7H 5EOTA 2FT7A 3B7UX 4NKDA 4PCYA 4QMEA 5E0QA 5C07D 5E08H 5FYJE 1RJYA 1MVUB 1R5VB 2DQUL 4Z3JA 3QZWG 4PLKD 1IEBB 2R4RL 1F3JA 4ZX5A 2FUTA 3BN9C 4HCRH 3U0TA 5I6OA 5EZJA 5H94B 2BDNL 2EIDA 1DQIA 4XVUC 5TE7L 1VCAA 2AEPL 2QV2A 1N0LB 1T0NB 4F24A 5GRZA 1WFUA 2ADIA 3GEFA 3IBEA 2OCJA 2R1XA 3F05A 2EO9A 4ELMB 5BW7C 4V1DE 4H8WH 3LRGA 4FYSA 2WN2A 4TV3A 3CVHA 3MV7B 4BYHA 1EHLL 1EFQA 1U8JB 1RUAL 3BKJH 3MCYA 1X7QA 3FTVA 4FLHA 1M42A 3PGCA 3P0VH 4CMHC 2DWDA 1KJ2H 1MFAL 4OZFH 4DESA 5HI5C 1N4XL 1UZ8B 4QD2E 1G7PA 2Y9RT 1YHPA 5E2VH 4F15C 4HT1H 3RZCC 5TDNB 3EH1A 1R3JB 4KKPA 4NJAL 4IRZA 1EAPB 1MCWM 4HCFA 2ENJA 2FJFA 2XWEA 3ZYZA 1M2OA 2WWMD 1BGXL 3O6KH 3AWEA 3RDJA 4C47A 2Q8BH 1E9QA 5HYQA 4UZGA 4JRXA 3ZO0A 2EDJA 1BA9A 3S37L 2FX9H 3NJKA 2OJ1A 4S2SB 3S48A 3IN0A 2OXHA 1NCNA 5IF0B 4OCXH 1J05B 1AJ7L 3DROA 1Q8MA 2GEQA 3ZDXE 1WCQA 3MJ7B 5I24A 3HBQA 3KVDD 1RUAH 3CDFA 1VFBB 3VSVA 2XSKA 3MGTA 1LO0H 3EJSA 4RVBA 1DO6A 5A2LH 5E94B 1MWAB 4JO1L 5KSAA 1S5IL 3NVQA 2DLFL 3L16A 1XV8A 1HZHL 4NUPA 3BDYH 4A63A 3D25B 5DRNA 5A2IH 5DYOB 5FWRA 3CVHB 1MRFH 1SN0A 3HB3C 3U6RB 3L9RA 4UIMA 2XNAB 3LKNB 2J1WA 3G04B 1MG3C 3ZSTA 4OQ1A 2WK2A 2F19L 1H6TA 3THMH 4HS8H 3B34A 1DUYA 4OV5A 1GGBL 2A73B 1UM5H 4HCRL 3GZKA 4AIZB 2FYYA 3TLRA 3STLB 1KG0A 2R4RH 2YMTA 4IU3A 5D7SH 3N50A 5LG6A 3P3RA 4GQZA 2KUTA 2WY3B 1M2VA 4HQQH 4N2HA 2WAHA 1S7UB 1CFBA 4X6CF 3B43A 5GHWL 3JWOL 4BIKA 1V3JA 1IBYA 5KVFH 2JV6A 4XN4A 3O8XA 3TJHD 4HLEA 1QVOA 1A7PH 2QPUA 4UTBA 2YXWA 4Q6IC 3IM1A 5FCUH 3MV01 1UOVA 4LQ1A 3QNFA 3WJMB 2EEXA 4YR6B 5D71H 3KLKA 5DRZB 1E4XL 3GS7A 1F00I 3HG4A 1F3DH 1GW6A 5C9KA 1QBLL 1FRGH 5CIPB 1I3GH 1U8IB 3CSTA 4JO3H 3GBNH 1IAOA 4GG8B 3MRBA 4TQEH 4U49A 2Q3ZA 2PTTA 2HJLA 2VJ8A 3DURB 2J2ZB 4GKLA 4IHOB 4LP5A 1MWOA 3EYSL 3IGAA 5F2FA 1NH6A 4MQ7A 1M7IA 4OLVL 5ILTH 3CHSA 4DK3A 2JLLA 3GBNL 1FP5A 1PX4A 2XWJA 3SPHA 4BZ2H 1FVCA 3VH8G 3PGDA 4NX0A 4Q6IA 4EZKA 2Y5TA 4CU6A 1AQKH 5D7JD 3GXNA 3VFRA 3FSOA 3SKMB 1DE4B 4QT5B 4OJFL 3ESOA 3FOLB 1BMZA 4R7NB 3SQBA 5DU7A 1FGVH 3UADA 2O6PA 3RWIB 4PD4K 2BY2A 4Q9QH 3FKUS 4FZ8L 1PAMA 4A7SA 2WBWB 4F57L 3C6SA 3FTWA 3ZMEA 4FFWD 4ZFZB 3HMWH 1V8HA 1WWAX 2VXSH 4NZUL 4NYLA 3ZYOA 1KJMB 4PS7A 4X4XA 4FOMA 1QSFD 1NMBH 4YX2L 3K0YA 2WQUA 4WI2A 1JS4A 2AK4D 3MTRA 4M7LT 5ESVB 4HUVB 4GI9A 5IOPA 3CFEB 3PL6A 4HC1H 1NM4A 1SUJA 4MNQA 3BDBA 4QNPE 4QY8B 2VQ4A 5T5FL 3CPUA 1LO0L 2XN1A 4DH2A 2F54D 5JIHA 1RHHB 4RA0C 5E5MA 1N70A 3PXHA 4LEXL 4ZJ9A 5C0JA 3TN0D 2AAAA 3VWJB 1XR9A 3K8LA 3QJSB 3D30A 2VB5A 2VZVA 2YRPA 3RBSA 2ZP8A 4A6YL 4RNRB 1EAPA 1D2PA 1A0QH 1A9EB 2YRLA 3F7VB 1FVEA 1TMQA 2GJZA 3RGVA 3NP4A 3IJSA 3OKKB 3DX0A 1M71B 2BIQA 4N1EA 1IC7H 3VI4A 4ZO6A 4D0DA 1BQHA 1SHSA 4GXUN 2R0ZL 4ISVA 4ZAKA 4DKEH 3EDDA 3C5ZC 3T2QA 5BQDA 1QHPA 4UILL 5EU5B 2BZCA 1NTDA 2JKSA 4N5UA 2CGZA 3G6JE 5HVHB 3ETBJ 4J5VA 4K7PY 4ZDHB 1TZHB 4APXB 2NY0B 3MRMB 4RBPH 4ELKB 3KPQA 2QQLL 2VITA 3E6FA 4GSRA 3VXPB 5I30H 3FO2B 1IE5A 2J8OA 1ORSB 2B1AH 4QRSB 3RWHB 3HE7D 4R8WL 5I6PA 2ICEA 1E4KC 4YBQD 1OY3B 3TNNA 4QY8A 4WHTA 5JW4N 4KQ3H 2E5EA 1NL0L 3F7RA 3CC5A 4B9CA 4CILA 5FF6B 2YPKB 3QIUA 2PR4H 4I3RH 4L4TB 4WI4A 1LO2L 2E3VA 2Y7QB 4KKLC 1NC2D 4HETA 5AZ2H 4QR7A 5C0GA 3I6GA 4GT0A 1M2VB 1LL1A 3RPBA 4KJQC 4NQDE 5LAXB 4Y4KD 5CBEB 2V3FA 3X12B 4B3EA 5KBKA 5JW5A 3MODH 2O6CA 4P99A 1EAJA 3OSKA 2JQZA 1MFDH 4NWUH 2MCAA 1RSYA 1S8DB 2R4SL 3TV3H 3V0AC 2WVUA 5DRZA 3UTPE 3GTTA 2Q7AA 3IJEA 3MUJA 1XF3A 3VYOA 5BJTB 2EDKA 3MLUH 2EP6A 3IXTB 5AYQA 4M4PA 4GH7B 1SXAA 5JDJA 1HAWA 4WI0A 1KIPB 2KLTA 4PRPD 1J8KA 2XUWA 5E9DB 1CLOL 1KACB 1BBDL 4PGDA 1UB5A 3U4BL 4NHCH 5D55A 2G4EA 2PW1A 3ULVH 2WUCH 4WWOA 1I31A 2WLJA 1Q9OA 4TVPE 3ATDA 4ZTOH 1D5MB 2YPLA 1FHNA 3CU1A 1UWFA 1HL8A 3PXLA 4ATWA 1FYTD 2JQAA 4LLQA 4GRLC 4FL4C 4I48A 4NNPH 4JG1H 3V9EA 2DL2A 2FSDA 1QI4A 1G9MH 4NHUB 4BFOA 5DSCA 2ALAA 1F6AA 4N0CC 5HGHB 4HKBA 4TSAH 3CSGA 3KLLA 2PETA 5CGYC 5GRUL 1CJYA 3S0PA 5DA0B 3H85A 3L2NA 1I82A 4IOFD 3WO4B 2EXYC 3MBXH 3I3DA 5CEZH 2IBGA 3GHBH 4I2XB 1B2YA 2ZKXA 2LE9A 4IRJC 4JQVA 2OMUB 2O4EA 2CSPA 3L45A 5JXEC 3K46A 1EERB 2N7AA 5ICZA 2EH7H 4YBLB 3BAWA 3I6KA 1NFDF 2DBLL 2PO6A 2W60B 1MHCB 2FQGA 3IS0X 4W4OC 4GLRH 1BIIA 4LCYB 3TTYA 3CBRA 1SYVA 1U8PB 2CLVB 3RGBA 3OHXA 1MZYA 2HRLA 5DS8B 4BZ2A 3AM8A 4XC3H 2IAMD 4J6IA 1O6TA 2JFCA 2XPGB 4X9HA 4B96A 4KRMB 4JDVB 4O00A 4W9ZA 1YN6B 4HKXB 2CIIA 4RGOH 3HC3L 5DYOA 4BGDA 2VZSA 3L9RB 4XWGL 4UT9L 1UG9A 4KU1A 4TQPA 4JFFA 3RTQD 3WY1A 3LRHA 2CUMA 4DP1X 5EZOL 1BW8A 5EZPA 2ESVD 3NJFA 2CCLA 3VI3B 4ZMQA 1YMMD 2ZCKL 2DWXA 3U0WL 4XP1H 5EBWA 3D39D 2PF6A 1S9WA 1SGKA 3GMRA 2FX8L 3IU3A 1GJUA 4XPBL 4FXGB 5EA0L 4ENEC 1AKJD 3JWNH 1W8OA 4XPGL 4YAQB 1MFNA 1S2EA 2C5DC 1UZGA 1NC2B 1URZA 1ZA6A 4QO1B 1S7QA 1R0AH 1NBVL 1J86A 3EADA 3V4UL 4PI0A 2NXZC 1EJFA 5I8OL 3L6FB 1BHGA 2VR7A 3QR1A 4JL2A 2VMJA 1OCCB 2HT3C 1K8DA 1W2KT 4LNRA 1CF1A 4PB0H 4BH7A 1EEUA 4JO8A 1MI5D 1MJJB 1ZA3B 1MFVA 3KYNB 3U9UA 1HHKA 3O6FB 4NKMA 4PW9A 2AJVH 4KHXH 2NCMA 3MRHB 3FT9A 3UTTD 3CD4A 4ZX6A 1QFWH 4N8UA 1B2WL 3QHFH 5F7NC 3HI6L 2DQTL 5AFAA 3ECWA 3HLAB 2UZPA 3DV6B 3NTCH 2WXOA 2X4UA 4G1EB 4LSTH 4NT6A 3BIAX 2PPEA 4B9ZA 2F54B 4L9LB 4YZFE 5I8OH 3ULUF 3QUGA 4MGXA 4W81A 3MXWL 1OO2A 5HHNA 3K81A 5AKTA 3V4UH 3BH9A 3TBSA 2OYPA 3W1ZA 4R83A 2Y0SA 3D5OF 2C1PA 2P4AB 1L9NA 4FFYH 4TLKA 4YQXH 4J2QA 4H8VA 1SQ2N 2CDFB 2EO1A 2PABA 2BX5A 4ALAL 4P9MH 4KITB 1BVOA 3CFQA 4XNZB 3LCYA 5ICXB 2FWLB 4WTXA 3CZFB 1ET5A 4JPKH 2WXFA 5M94B 3PQYE 4WNJA 1HQ4A 3BPLB 5C97A 4GEIA 2VW6A 4JHUA 4LXFA 4EOWH 4R7VA 4OW6A 4HW6A 5HHMB 3MV11 1UOLA 3QE5A 4NOFA 4PAZA 5DC0A 5B3JE 1W6WA 5F89B 3TIDA 4YHLH 1RXLA 2PWEA 2MNJB 2V5SA 2HAZA 4FYQA 3K72A 5E8DL 1MW3A 2DLEA 5IB4B 1UEMA 2JK5B 3F58H 1QSED 1INDH 2YN5A 4OT1L 1YECH 2BERA 3Q5OA 1HHKB 3O6FA 4MB3A 4G8FA 2QZQA 4PS4H 2DM2A 4KHTH 3RE0A 3K71A 3MA9H 3FU6A 4Y2OB 1GHFL 2AQ3A 3UJTH 2W38A 1T1ZB 5KZCD 2WO3B 2K9UA 5DS2A 1RIVH 4NUMA 4X0KB 4TNFA 3RDTD 2XQBH 1YYML 1GOFA 3QR2A 2E9BA 1WFTA 4YXHL 5C0FB 4JDZA 1HU8A 1OTSC 3TBSB 5CEZL 2XN9A 1UH4A 3HEIB 3JV6B 4HIPA 4PJGF 5FA3B 4LLYB 3BSZA 5LQBH 4YDKH 1ANUA 5C0AB 3WNPA 4HK3J 4J12A 2XV2A 4R26H 1RZKL 2VDMH 5IW1B 2YS4A 3KLAB 1DJXA 4HK3N 3C2SA 4KHTL 1V55B 1S3KL 3PWPA 4YN3A 5KSBB 2O5YL 4EIBA 4PP1D 3MJ6A 3VXRE 4PV8A 3F00A 3EO9H 2P8LB 1SVBA 5AWNL 1AXTL 4KMLB 5IQLA 1AGDB 1IC5H 1DLHA 2XA8H 3NT0A 3V55A 1HN1A 1O7DE 2OI9C 3CXDH 5JW3H 5MEQB 2GBVA 1A3LL 3RA7H 1MFBH 1YRKA 5FB8B 4PJFF 2OMVA 1P4IH 1I3VA 4PRHB 2NR6A 1D6EB 4XP5L 3PFQA 5IT2L 1TITA 3NFPA 4H8HA 4OV6F 3SE9H 1OK0A 4JRFA 1T5WA 4KO5A 3PJLA 5C0CE 1CZ8H 4HGWA 4HC1A 5H35B 1WWWX 2QVFB 3PGFH 5FW8A 1SOXA 3UDWA 5CBAB 2VXUH 4G9FD 2HPOA 5CP3A 4ES8A 4G6KL 3O8XB 1HCFX 1ES0B 4N0YL 3O3BB 4LSRL 5IBTH 3QDGE 3DMMA 5BZDB 4RA3A 3WHXB 2VWEC 4XC1L 4GW5B 5CP3H 3KPTA 3VU1A 2EH8H 1AQHA 1CE6A 4KTEH 3RTQC 1YUKB 4JG9A 5EDSA 1N18A 4P0DA 4DETA 3OR7B 1LQBC 4C4BA 1FAKT 2YKKA 1W0YT 5KSBE 3HPLB 1N5AA 3UDWC 3VXSD 5B1BB 1IM3A 2IOIA 4JKNA 2VQ1A 5ESAA 5C7ZA 3V0HA 4YEFA 1RH8A 2MH4A 4TM9A 1IAIL 4Y16B 3RUGF 2DH2A 3FYEB 3R4DA 1KCVH 3V0JA 2L7UA 5JOFB 1JNNH 3N44B 3K2MC 8CGTA 3DMMC 1QWHA 4XOEA 1UH2A 1R5WA 4E41D 2YR3A 2GAZB 3NFPB 4OJAA 4TN9A 1MWAH 4YBHA 3WTXA 2A9CA 2FB4L 2X6CA 2CR6A 1AZVA 5DHEA 1LO5A 2FX8H 3MJGX 2X2UA 3DHUA 3WTWA 1BF2A 1BQUA 2Q1EA 4WGVB 2J8HA 5FUZH 5K33A 5DI8B 1ED3B 4AKPA 3ETSA 4KROD 1ZHKB 1AIZA 1WC7B 2PYEB 4LPYA 3T4AB 1JXJA 4OLZL 2ATPB 2VOTA 2J56A 1WVZA 2NQDA 4KXAA 4XP4H 2KERA 2PO6D 5AVRB 2NW3A 4NZRH 5EBMB 5IB3B 2E59A 3REVB 5HGGS 2I25N 3PXJA 4RFEB 4XZ4A 4IRSA 3PWPE 5BJTA 2XV3A 4TMPA 1QZ1A 3CFBA 1NMCC 4NO3A 1GGTA 1R46A 4MA3A 4MJJA 1QEXA 3KBHE 4L0PB 1LEKA 5ANHA 3GGWB 3N9GH 5KYYB 3L7FB 5FUOH 1J1XH 5DQ9B 4OLYH 5JYLA 3HZMA 3NA9L 1S9XB 2OMXB 4PWGA 1ZT4B 3EOBA 1OP9A 4BDVA 1Q0YH 3HNSH 3GSVB 4HDIA 2B59A 3UAJA 4PJDF 1JPGB 2VAAB 5DEZA 4PRHD 3LN5A 4XO3A 3BISA 5I71B 4FLQA 1QMUA 3FU7A 3CLEH 4PEEA 1SEBA 1VLXA 3Q9QA 2EVGA 4C58B 1YYLH 2R83A 3QI9B 5GRUH 3JWDC 1IKOP 1DVTA 4UUJA 1WD8A 2X4OA 5SWQB 3BP4B 5L6YH 1QRND 2XX1A 2X12A 3EUDA 4FP8H 4NKDB 4DO4A 3POCA 5LLIC 3APFA 5D7KD 4DGVL 3C2AH 3MBED 3DYMA 4W9HC 1JF6A 1CQKA 1RJLA 5D2NC 3X3GL 1NLDH 4Y4FB 2WUCL 4LCWD 4N8VB 3WIHH 4WUUE 4IEFA 1U41A 4NBXB 1F4HA 1YSOA 2B7DT 5HHMD 1DLFH 4EVNA 3HMXL 5LBSH 1T0NA 2QR0B 3RX9A 2EO7A 1TYJA 1Q72H 4DP9X 3GYRA 1J8SA 1IQWL 3LEVL 3CFBB 4KI5D 3PDOB 1MFUA 4WUKH 3VFNB 2DJUA 2Y5TB 3WAKA 1AH1A 2R9HD 1VGEL 2B0SL 1LILA 2NNAB 3L5WB 2VDNL 1AIFA 1IFHH 4BCYA 1L0YA 1CGUA 1BMWA 2DKSA 1BQLH 1P4BL 4BDVB 4F7CA 1LDPL 32C2B 2DD8H 3IJHA 1I1CA 3AU1A 5C0RL 3RURA 3FUKA 4Z77B 2J5LB 2Z31B 1AY1H 1CIUA 1AACA 1D5IL 4FMVA 4PCSA 1C16A 3AXLB 4YAQA 3ARXA 4TULL 4X8XA 4E9SA 2C9VA 1S3RA 1E27B 4PJ8D 5D7IA 1UXSA 2JKTM 2ZUXA 4YDZA 4F37K 5DRXB 4XP6L 4ZD3H 2DEYX 1ASPA 5IEKA 1ETZB 4QNPF 4R8WH 3B9KC 5MI0B 4TVPH 2EKJA 3ZDZB 2E9GA 4M00A 3HBZA 2BM3A 5C7XL 4LNRB 4ADIA 1XZWA 1PFOA 2YBGA 5IK3A 3BZ4B 3QDJE 3QEHA 5E8NB 2HMID 4WI3A 5A7EA 2WKOA 43CAA 2I60H 2XKNB 4Y4KA 3UTZA 3DYPA 5JXAL 4AUJA 3FQWB 5LHDA 3IXAB 5J13B 3L48A 2SODB 5JORA 1KJ2B 1LK3L 2VISA 4OZFB 5CS7A 2XU9A 2FX9L 3A4EA 3U6RA 1M7DA 3ZE2B 2FX7H 4OSUH 4L5FE 2UX7A 3LQMA 1CL7L 3MJWA 3BRGC 3O6KL 2CR0A 2VR4A 4P5RA 4XXCC 3I9AA 3G9AB 4XBPB 3DRQB 2IH1A 2BVPB 3CZSA 2AQTA 3B9KA 3NIDB 4A6YH 5C71A 4WU5A 5DJ2A 2IDUA 2IADA 4LKCB 1S7UA 4QAMB 5E9DE 5JIKA 4R90H 3BP5B 4JY4B 4QHNA 3SPVA 4AC4A 1QYGH 4P2OB 1FC2D 5JOPD 3P0VL 3OXSA 3RWJB 3V0DA 4OFDA 1J8HE 4PTUB 5FYKD 4AVHA 4HUMB 2JCCB 2AP2A 5GXBB 3QC5X 4DVBA 4O51A 1SYVB 2CLVA 1KCUH 5CU9A 3GPEA 4M6NH 1CT8A 7FABL 1JNHB 2VJ0A 4TVPL 5CIPA 4W68A 3SPIA 4D8OA 1MCEA 2X4RB 3ME0B 4MQXD 4E5XG 1WWCA 1YMHB 4WWKA 1AO7B 4XMUA 3IPEA 3WV0A 5IK3B 3TJHC 2ICWB 1QBBA 4IMLA 3C75A 4OQTH 2EE9A 2OXGA 3ROOB 3VGEA 1JVLA 2P42B 1ECZA 1VB9A 1W91A 1PZSA 3RWEB 4POZD 5GSVA 4EO5A 1IARB 2XJKA 3FQYA 3HMWL 3L5HA 3PGCB 3MCG1 4HGWB 1GY2A 2KYIA 4OFPA 3OWRA 1X3DA 4K3GA 2I9LA 1B0GA 3G6DL 3VD0A 4WAFA 2HFEB 3LB6C 1CICD 2CCWA 1M7DB 4PJDE 5J6SA 5TPWL 3RY6A 2J6EH 4LSUH 4A6YA 4PGJA 3OJ2C 3Q6FB 1H3VA 3B3IA 1ZPLA 1QKZH 3G5XA 4JANB 4K3JL 1U8HB 1M3IA 5BRZE 3KHQA 3SY0B 4CAGA 2VJXA 5EEZA 1RP9A 1M53A 2NY6D 3RIKA 3RWIA 4ZUWA 4FNRA 2OJEA 4C54A 2Q0ZX 3VXRD 3RJQB 1ROCA 1QHOA 1DJSA 1G9NH 5J7CC 4HX1A 4WDIB 4WI0B 3ZDZE 4IRJA 4K07A 1E90A 4OLVH 3FOMB 4TYUA 1AHKA 1Z32X 4IRZL 4YIQA 1RHFA 3H9SA 5T3ZL 2K7PA 4ERSH 5CLZA 4HWEL 4LPUA 1DQLL 4M8UA 4NJ9H 3IETB 4M61B 4XNAA 2BNQB 4FQJL 5DMGC 4A38A 4ZUVB 1FRGL 2A6IB 2EINB 3L1FA 3BPOC 1GSKA 4K4KA 3QEQA 2DH3A 1J88A 3W57A 1HI6B 5DSCB 1E4XH 3F01A 1A4JA 4KFMA 1D7BA 1Q9KB 1RZJH 1Q0XH 4NQDA 4YZFF 3ULUE 3ULVF 1LEIB 4GXUM 3U4EA 5FB8A 4BQ6A 2G2PA 4YDVB 4Z7QF 3KJ4B 4Y5XC 4RSYA 3DSFL 3FT4A 4NRZB 1P7BA 3N1MC 4MAYA 1OD9A 1T2QH 2CDEB 2D7MA 4X9GA 1UJ3B 5AW8B 1T21B 2ICES 4YHPA 4Y1AE 2PUQT 2V8LA 2NYYD 4UWQB 2G2NA 2QVMA 1KLUB 3G6JB 4ZMOA 1PJ9A 3O4LE 4NO5A 5F9OH 2DIJA 3IFLL 1AGBB 5FUOL 1NGQL 2JCCE 3PHOB 5B3JF 3BZEA 1TXKA 2A83A 5LGHL 4IJTA 3FT2A 2C34A 3L1OH 4OM0H 2B20A 3FONA 5IBLC 5I23A 4HPOH 1A6TB 3TO4A 5KYYA 3NSDA 4J1UA 4P9HL 1CD1B 4Y4FD 1XCQB 3KYMA 5IB2B 3H9SB 1ZDSA 1JD9A 1DZBA 2JNZA 1J9CT 5D7IF 2CZNA 3ZTDC 2WXPA 1XGQB 2K6ZA 3Q0HA 4GAAA 3CFCH 1J1OL 3D3VD 4L4TE 1AFVH 4BKSC 4DP8X 1WFNA 2L8AA 4ZOCA 2W5PA 2ZYSA 5I74C 1A4KB 3FU7B 2KZWA 4DGIH 1RZ7L 3U4EB 4HG4K 3OMNB 4TSBL 3BUBA 3FSVA 4YDVA 2PCXA 3NH7L 5BO1L 5IM7A 2JELL 1FAIL 1EXUB 3TBTA 1E3XA 1S7QB 4FG4A 3ARSA 5E6SB 3BFOA 3BMWA 4GQPH 1P7HL 2BNRD 4M5TA 4NJAH 1MUJA 3TA3D 4ORGB 4Q9CA 1E50A 3HB3B 5CN1A 4HMEA 3RVVD 1NZRA 3FTZA 4YHIB 1X5IA 5LXGH 4YHPB 2H1LM 5CAYB 3NZHL 3QQ9C 1QWNA 2HUEA 2YN3A 3FPXA 3QCTH 5FS5A 3S2AA 3SDXA 2DLHA 1UWGL 5D2LF 1DJGA 3UGEA 2HKAA 4I4WB 4JKPH 5CO1A 3NFNA 5K9OB 2K3HA 1NCBL 4BQCA 2NX5E 5CHNA 5DK0B 1E8WA 3TEXA 4BM7A 5IWLA 2B2XL 3NJNA 2WXJA 5I1IH 1CDGA 1CFNA 1XCWA 5TDPA 4XC1H 3ZJAA 3FW6A 4G1EA 3INUL 1H5BB 3I6LD 3IDXH 3ABMB 2GUOB 3ARDC 2ZUVA 1C12B 1NGWA 3A24A 4I18C 2Q6WB 1XH0A 4MJIE 2DWYA 3QCVH 3UO1H 5GS0D 4LSRH 5E1AA 4PJXB 2QQQA 1IILE 2ZOTA 3FB8A 5C2UB 2I9LB 1IGMH 3LV3B 2DQGL 2AV7A 4JBSA 5DVOA 3T2LA 3VXRA 2N7SA 4ANVA 1MJ8L 3OKNA 4QI3A 4HXBH 1BJ1J 2OV0A 3FCTA 2X28A 2BXYA 4U1NB 2D3LA 3F7YB 1CTNA 1SJHB 5DRXA 1SN5A 3EGSB 4F9LC 4K94L 4ODXB 4N20A 3VG0L 5INCB 2VXVH 3TFBA 4K3DH 2X2IA 4AXWA 4N85A 5H8DA 2QGBA 4B6ZA 1HL4A 2BP0B 4N1CA 1IC4H 1W0WB 4I18A 5KVEE 3ZTCC 4ALAC 4MXVF 1OB1B 3NJVA 5DT1H 4K73A 1DL7H 3CV5A 5DJZA 3T0AA 4AUUA 5C2BH 5JW4R 5IIEA 3ULAB 3H3KA 4NP4H 3VE0B 4DHLA 2MCG1 3BJLA 3ULSA 1MWAA 5KSAB 4DTGH 1NM9A 1BM7A 5ESAB 4WV1A 2VLJE 2NX5B 1NPUA 3BZDA 4OI9A 2Z4TA 4JFDA 1IGCH 4WK0B 4WFED 5IKCA 1FJ1A 1GCFA 2LU7A 2P43B 2QMJA 4YXHH 1DUYB 1QI5A 3QUXA 4K0OA 2A73A 4AIZA 2PYFB 2DIBA 3TYFB 3OSVA 4FA6A 4GINA 1BFTA 4DW2L 4PV1C 3B9VA 1GPOL 4O02L 1SOQA 2AQNA 1K3ZA 3MUGA 4OLUH 5DGQA 4TS6A 1AGEB 4KKAC 4MXWL 5GRJL 5JHDE 4QIRA 2N1KA 2PCPB 3VNYA 1IEBA 1SJHA 2EUWA 1SY6L 3WLWC 2E74C 3MXVH 3WFZA 3KWTA 3MV8D 4AVJA 1E9PA 3EHBC 3N44F 3N55A 4LEOA 2Z6FA 1PG7X 3UZVB 4WV1C 3FTUA 2AQ1A 2AJSL 4WWKB 5DHVH 3EO1A 1WAEA 2L7JA 3ZZQA 5KOMC 3VXUE 4GRLD 1OB1A 2XBTA 1M4KA 1OD7A 1YUHA 2R15A 3FTGA 2EIJB 3WNLA 3QUXC 5GGVH 1MHPL 2OTUB 4ONHB 5HI3D 3O6LH 4XNDA 4J4PC 4NQVA 5DMYA 2D7QA 1JWUB 1PJWA 1UACH 3WKYA 4DQOL 1A4KA 2ZWNA 1XZ0B 2BFVH 4YWGH 1MCDA 2DKMA 2W92A 2CALA 5DJ8B 4MMXA 4JHAL 4TNGA 4KI5C 3BUDA 1FGNL 4DKFL 5GGUA 4ZMPA 4X6EA 1HNYA 3ABZA 3RVXC 1ICTA 3SBQA 3WLBB 1JDDA 1SEBB 1G5GA 2XG5A 1M7UA 1GCYA 1NA8A 2HVBA 3MXWH 5T3XL 1C08A 3DIVA 3LKPA 5FYKU 1I7RA 3BWUF 4GW4B 4JRLA 2R8SL 3TVMB 2ZXBA 5I1JH 1WIOA 2K3TA 1RJLB 4JREB 3NJMA 4FQPA 2YEZA 3U83A 4NNXA 3OKOB 5E2JA 1V3LA 2BNRA 1B4JH 2MQ0A 4HS3A 3TA3A 5GS2H 3MNZB 3TPUA 3C08L 1L9RA 2LAAA 1VADB 3AITA 4OZHA 5AW7B 2WLNA 5B38G 2XZQH 4TLTA 4LCUB 3NIFB 4OU3A 4JFZH 2COQA 1PKOA 4R4ND 2NYKA 1F86A 2WBKA 4LPCA 4JS7A 1BREA 5EBGA 3CFTA 4L4VB 2GEEA 3X11B 1FBIH 1M6OB 4G8FB 4G1MB 1R0AL 2DYSB 4F3FA 4FCHA 4XRCB 1P5UB 3RWGB 2GY5A 4YGVA 1NCWH 4LASL 1MN4A 1I1AC 5AOKA 3AGWA 1TZOA 5IVXF 2NY4D 4X7SL 4X0NA 1GKOA 4NQSB 5F70A 2V9RA 3B9EA 5JUEL 1NGPH 1NUNB 3TJPA 2OCCB 5DEFA 1U4FA 4B5ZA 4XP1L 3VXNA 1SOKA 1A14H 4M8VA 2EDDA 2O30A 4HPYH 4EUPG 4M9PA 5H2BA 1B88A 2KPWA 2RB8A 3KJ6L 1RZKC 5EZOH 5F6IB 3ZR6A 1JV2B 1KXQE 1SBSH 2C8NA 4LAQL 3CVDA 4HD5A 3WI9A 2WZ6A 1F41A 1KYFA 4CN1A 1RVFL 3QIUC 3X2QB 1BPVA 3RAJH 4JX0A 5IB2A 1Q9LA 3BVWA 4Y89A 4ZMZA 1ZLDA 4XC3L 2WQ8A 3AWFA 1N3NA 3MOBL 4NNXB 1QLEH 4ZTEA 2EDMA 1CN4A 1CWVA 3DGDA 3K2IA 3OKYA 5IUCA 2V3DA 3QJUB 2ENQA 4DJMA 3T2NL 2AJYL 1YLBB 2AXFB 2H32A 3FQWA 3II3A 3CAFA 2A6IA 4K9JA 5INDB 1KWGA 2ZONA 2F9BT 3H7BB 1F02I 4LLVA 3NCMA 3X11A 1P7KA 3O4LA 1ZEAL 2Z0UA 3WFCH 2EUXA 5CCJA 5KOVC 2Z64C 5FM5M 1VFAA 2R69A 2D0GA 3GSOB 5FF6A 1GL4B 3QI9A 4GAGH 4YBQC 1LMKA 1P1VA 2WBXA 3T9WA 3P1VA 1A64A 3VX0A 4P23A 2AEWA 1ZGLA 4M3JA 5CCKL 3QXDB 1Y6MR 4TQ8A 4P4KA 5EU7C 1JE6A 2EDLA 2D9CA 1BD2A 4AYID 4N6RA 4NO2B 1JJUA 3GXMA 1D7FA 4BD4A 1I7TB 2H2PC 4PGEB 5LUMA 1CU4H 5B38B 3PWUB 4WTZG 2XN9E 4ODBD 5DEGA 1DTUA 3CZJA 3Q1SL 4G6JH 1VERA 5DVMA 1AGCB 1Q9LB 1FO0B 5JMRA 4DZBA 1KIPA 3JT0A 3SKJL 2QL1A 3VI4E 2WZPA 1EGJL 3BEVA 3V7AE 5K1NA 3GSQA 5KWYC 4JM4L 2DYRB 5CLTA 2YGOA 1S7SB 5C09D 4TNEA 3ZDWA 2G75B 1NCCL 4EKXA 5FFLA 2PWDA 4J3TA 5HHQB 1VHPA 3QULB 2GTZB 2CHWA 4FLRA 4W9LC 2W81C 4NGHH 3S35H 4BSVB 2ITEA 5CFHA 4L3CB 3EBGA 2VKXA 4BWTA 5SX4I 3QJFB 2GAZA 4CC4C 5CEZD 5ADOH 3H0TB 2PYEE 3B1TA 2QGDA 5CJQH 4G9FA 3ESMA 4M8RA 2GIMA 3WD5H 4CU8A 3ZPDA 3WHE1 5A2CA 4HIEA 1J7VR 4K7PL 4XB3A 3RL2A 5KS9A 2E4TA 2FO4B 3OTTA 4OCSH 4TNVF 1BZ9A 3WIHA 5EOCJ 4POUB 1JF1B 5KTEL 3B9KD 4PJAF 4EBQH 3MNZA 4U1IB 5BMFH 2H2SD 2DLGA 3SPGA 1XF1A 1XL4A 4H0GA 4L37B 4X5LA 3WDJA 2GT9B 1DBJH 2ZOWA 3WHE0 4BA8A 1EAOA 1AZCA 4CL7A 4E41E 5GZNA 2XPGA 4C8XA 2EXSA 2JMRA 1FL6A 4OM1H 1LEKB 3MNWB 3GHEH 2EIKB 5IQ7H 5D1XD 3TH2T 1AVAA 1G4MA 1NSNL 4FNTA 2GHWB 4Z7VA 2CO3A 1S7SA 4YXLL 4AYFA 2E56A 2Y7QA 2DWDB 2XWDA 5IESH 5TDOB 3MA7B 3B9KB 5MI0C 4ANKA 4XMPL 3UBHA 2EEFA 5E99H 5C1MB 2VDOL 3WTUA 1K8IB 1EZLA 2KT6A 3D87B 2MQ3A 3E8VA 2ZE0A 4H4NA 3OQ3B 5I75C 4XPTL 3WIIL 1N68A 2WTRB 3DKHA 4TNWK 4EI5B 1QA9A 5MHSE 1AD9B 3DX8B 1S7XA 2A1WH 4W9CC 4NXSA 1TVHA 2WD0A 3KBEA 3E0GA 5GZNC 2CO7B 4JRXB 3PHOA 2VDLH 3P4MB 1BOYA 1NAKL 2AERT 5HHXH 4LOUC 4B53A 2BW4A 2WIIB 2I27N 1ZLWH 5K59F 4KKCC 4PLJD 3V4PH 4JFTA 5EU6A 5GGTA 4N87A 5IB5B 2Q7YB 1U95B 3CQPA 4ACTA 4YHZH 2N3JA 4ABUA 4W4NA 1EPFA 1GJWA 3QT2A 5TTRA 5HTSA 4CVWA 4APQD 3D2UB 1N5AB 1U2CA 1QSEA 1KIRA 3EDJA 2QVTA 4NKQB 1B0RB 2QVIA 4GYBA 3UJIH 1NINA 1JYVA 2H9GB 4KQ4L 4PJ5B 5FOJA 2H6PB 3TM6A 1DHKA 3NBNA 4NCDA 3GSNB 1D2OA 2X4UB 3HCVA 3QGVA 4MB1A 2Y4SA 3WFBL 1H6UA 1JPSH 1OPGH 3HFML 4PG2A 2YD2A 3P3UA 1AZRA 1IVLA 1KC5L 2N0KA 1IKNA 3AREC 4DP2X 5I16A 3AS2A 1IV8A 4JPVH 3ELAT 4RFNC 5T5NF 2FATH 1F3JB 4HSQA 3V0VA 3BKCH 1IBGH 5CJ5A 2M1KA 1DVYA 1PYWB 4PMEA 2ADGB 4HHWA 2VR6A 4U1SA 2JJSA 2WMPA 1KEMH 5I71C 1RAMA 1Z3GL 2QSVA 2WIIA 3TFKD 4X4ZA 1CGWA 4WO4A 1P53A 1KGCD 3DO4A 4JRXE 4WFFD 1XCXA 1DFXA 3SN6N 5GQBA 1O7VA 3X3FH 1UJTA 2R59A 3OAZH 4F9PC 5ALBL 5FCUL 3RVWC 4NKIL 2ZCLL 2XTJE 4PVLA 3GJFH 4AQAB 1AQ8A 3FRPG 4QKXB 2NQCA 5CD5D 1QBML 1E2VA 1BZ8A 2M26A 2WOBA 3GT6A 2V5MA 3QJOA 4TL4A 1BAGA 2FJGA 1L9QA 5A2JH 3TX4A 7TAAA 2GQHA 3I9IA 4X98B 4CGTA 1GGBH 35C8L 4J3BA 3CFMA 2VH5H 2H45A 2O5ZL 5F1NB 4ABVA 2F19H 4XVTH 3QS2A 1D7CA 3RVUC 1PAZA 1U92B 5B1JC 5JO5A 1L7TL 1CYGA 1TETH 1AKJA 4FQHA 4Y4FC 3NSCA 3QG6A 4PB9L 5LBGA 1HL9A 3FT2B 1RQ5A 8FABA 4UIKH 2X4TB 5L2KE 4Q52A 2Z91A 3GUTA 4GW4A 5EFIB 5I18H 4KAQL 3ZN6A 5F1SA 2LT9A 1P6FA 2R69L 1UH3A 4PJAE 4LU5L 3RHWF 1D6VL 5E94A 1RULH 5MP6H 4RSVA 4H0HB 1IQDB 4WI9A 4AQ1A 1SVZA 2MHAB 4NZDA 4Q6KA 2JB6A 2OMYB 2QSCL 2CBQA 4Q4EA 3CK0H 4MXQD 2EEAA 4D7PA 4F37F 2HH0L 2FGWH 1WEJH 2IQAA 2JB5L 3CSBA 4V1DA 3VXSA 5J11B 1YEIL 2VCOA 2WGXA 2NCEA 3GMPB 3ESUF 5C0JB 4GS7C 2X6AA 1T1WA 4GO6B 3QUXB 4YGVB 2X6BA 4HT1L 3JTTB 1HILA 1FNGA 3D8MA 5G4NA 3SKOB 3PWLA 2NXYD 1L3NA 4JFQB 4HIHB 1FNHA 3J7HA 4NZTH 3LPFA 3FQUA 2AEQL 4LARL 3ZDXB 2OZ4H 3U1SL 1I9IL 4Q6YA 4W93A 3WJMA 2Q3AA 2X10A 1E67A 1XGZA 3D85B 4XO8A 4Y4HD 3LXUX 3CSFA 3ZQ9A 4B0MM 3VI3F 3QQ3A 2HTKC 2UYLA 4XBGB 5E2WH 3P73A 3RGHA 4FMFA 5C6WH 2DQDL 2BNQE 3DVGA 4MB5A 5LB1A 2LTQB 3BQVA 3SGKA 4BSWA 3CN2A 1MH5A 5I1DA 4E9QA 3FUFA 2HKHH 1FYTA 3QBTB 1BEYH 3SKNB 3HTLX 3S4SG 2IVFC 4HJGA 2EYRB 1RMFH 3HZ3A 2XXFA 1O6SB 1CXIA 4PWIA 1A25A 5IB1A 2PCYA 1FIGL 4RAUA 2R2HA 2OI9B 1YMME 4PJAB 1CR9H 1OT1A 2E7DA 2QPEB 3BUYA 2FJSA 3ZTJH 4G6MH 1VFMA 1IBHA 4KX9A 4PRDB 25C8L 2DMGA 4EZMA 5EBLA 5KSAC 2VLRA 3TBYB 1WTGT 5C07B 5DQJA 2XDHA 1OTTD 3VSUA 4G9FB 4XCYB 2ZSWB 2R56H 3DUSA 3QHZL 3W9EA 1HILB 5B1KA 3UP1A 1TTGA 4E0RA 1IGTB 5FM5O 3P3SA 1SDDB 3LMJL 4GRWF 5I1EH 4HF5H 4PBVC 3RTQB 3T5WA 1N2RA 3HAEA 4KDVA 3A6BH 4MDIB 5F7EH 3B56A 7CGTA 1C5BL 2EYSA 3QJHB 4JLRA 4HK0A 4ZS6D 2CM6A 4XN1A 5IFJA 2JKNA 4ACPA 5AB1A 3O8XC 4ETQA 1XBDA 4G3YL 4LCVA 1YEEL 5A2FA 4HJIA 3HVNA 2IMNA 5F7BA 3MBEB 5IBLD 2DQMA 4XX5A 3MOAL 2WPGA 1XXDC 1BG1A 3HKFA 1O6SA 3L4YA 4EN3B 2X6VA 1TNNA 1F8TH 3SYCA 5IJBC 1S9XA 2OMXA 4U05A 3DNKA 4TVSa 3B83A 4M4RB 4G82A 1A66A 4OD2A 1KPRA 4DKDC 4YDLC 3D33A 3EFOA 1Z2KA 3Q6FA 1WBYB 4AGLA 3HJ0A 1CD0A 2F5AL 4JZJB 4WIQA 3T3PE 3O0RH 2E76C 2UZYB 1CF8L 3D34A 4OZFG 4X50A 1CVRA 1GOGA 3RUGB 1MHEA 3EOTH 4UAOC 1WFOA 2DQEL 1FFOA 1IGIH 4YPGB 4R5TA 2K1MA 5C09A 1BZ7B 3ESVF 5DLLA 1ZS8B 4NENA 1JZEA 2IEPA 4UQDA 3VNZA 4F7TB 4GG6F 1KCKA 3BGMB 1DBAH 3BGFC 4S2SA 3C5ZA 3W0WD 5HPOA 5EO9B 2UZIH 1LP9F 4MHHG 5EMYA 4L29B 2ENYA 2EVIA 3US9A 2F58H 3FO2A 3EYQC 2JKRM 2QSTA 2QHRL 3FUDA 5FO7B 2XQ0A 1CFSB 4GQQA 1UWEL 1W72A 1WRFA 2G3MA 3GXPA 5DD3H 3GTNA 1F58H 1SLWA 3HW7A 3C5JB 4ZUSB 3QZNA 4PJ5A 2EE0A 3KPNB 1JZHA 4X7CC 2YARA 4FMKA 4DP7X 4QXWA 2CA3A 4JCWA 2FT8A 3DI3B 2F5BL 2WNKA 4FFVD 1JWSB 1F4XL 3EOAA 4FAAB 2AXJA 2UVEA 1IGFL 3MLRH 1OE3A 1KGUA 4JFQA 3QFGA 4KDTC 4MWFB 3CMOL 3SQRA 1I1AA 3OR6A 3DIFB 2FD6L 4Y4KC 5DVPA 2P47B 1U8OA 3L3IB 4PJFB 5EEXA 2GSIB 4TSCH 1SN2A 3VGBA 4ETYA 3GQFA 2A9ML 4NO2A 1BD2E 2P44B 3S8FB 5CILL 3MLYH 5D7JA 2X1OA 4LIQE 1U42A 1I7UA 1O7SA 4NO0B 4X5XA 1RUKH 1MCPL 2V17H 2DQJL 5B1AB 4QOKE 5I0YA 3MLVH 4QJ4B 1YO4A 2JF1A 4X2UA 4Z7NF 3TPKA 1JZ4A 5EO0A 5F9DC 4LB8A 4YFDB 2E7CA 2GIXA 4U1GB 3GRWL 1GZHC 3VWKD 4DIXA 4ZO7A 1ECYA 1OAXH 1NPNA 4OFIA 3UL4A 4KUZH 3S96B 3PQYB 5ISZD 1YMMA 3DGCR 4FI7A 2XWZA 5TE4H 3B2DC 1JGLL 3PRZA 1QFOA 5EN3A 5FC9A 2K78A 1ZT4A 4FTVB 3U82B 3WN5B 5CD3A 1CGTA 5HGHA 3L3OA 3MO1B 5K5YA 1QPPA 2VUOA 5IM7B 3FRPB 3PU7A 5E03A 3MU3A 1MKFA 2ENSA 2YKLH 3ARGD 4FQ1H 1IFRA 1T0MA 1W8EA 2B4CH 3MKKA 4JMXA 2QLYA 4LGRB 5ALCL 5EV7A 3D3VE 2ZQKA 3JWNC 1F2QA 4KI1A 4P49A 3DK0A 4QHUB 2CXGA 4LNVA 3K7UA 4YBLC 3WMSA 4L8DA 1G6RH 4XPAL 3O4LD 2BVPA 4LIQH 4P5TD 3OAZK 4JFHE 3KZ8A 2JIXA 3MRQB 1U93A 2UZXA 3L3JA 4UQBA 3VFTA 5I16B 4Y5VC 4CJ0A 3K1KC 4HUWB 5IFAH 4B97A 4H20L 3U7WL 3QWNA 4BZ1H 5DUBA 2X5PA 2N59A 5I5MA 2F6AA 1YPZA 2NXZB 4X6CB 1KTDB 1BYNA 2ITCA 4XOAA 2PXYD 3FDWA 3S37X 1RZ8A 3QYCA 3AM8C 4KTGA 2X4PB 2BVUA 1FLRL 3K72B 2GT9A 2HTLD 3TT1L 4GG6B 2W0PA 1A7NH 1UURA 3GB7B 1PF3A 2H3KA 5JHMA 2D03H 2MOQA 4G5AA 5L9DH 1MF2H 2P80A 4R7DB 2DQHH 4JFEA 1N64L 2X09A 4E2OA 3W9DB 2AS5M 4ZMNA 1WPCA 3GXTA 4JM2B 5CINL 5GSVB 2OPCA 3OAYH 15C8L 3FBQA 3RJOA 1KBVA 3WNNA 1R3IH 4HIHA 4AKQA 5J06A 3LVEA 2B77A 2JXMB 4U6HB 5GS3A 3VXQB 3TH4T 5IUSA 3CLFL 4JRXD 2IPKA 2F68X 1G1YA 3VJ6B 3QP3A 4HFUH 3L5JA 3FS9A 4MD5A 4UT6A 1E4HA 1TQBB 4OFKA 1X6NA 4KZDH 1HL5A 2JI3A 4PUBH 1Z9SA 1U92A 4CC4A 1FH5L 3QIWD 2Y36L 3N42F 4XR8C 3NIFE 2I7SA 2HLFC 4L4VD 2AV1A 4Y5XA 4JO2L 4PI2A 4I3SL 4IRJB 5DUML 4LDEB 5AKVA 3WGUB 1ZLVK 4P2RD 3WXWH 3REWB 5JXEA 1TQCB 3MV8B 4LMQE 4QTHB 3WO4C 4PU2A 1QEWB 3L08A 3PJSA 1XD1A 4AG4H 4Z7NB 5CKAA 4J3OD 2QDVA 4OUOA 4K7FB 3VFSA 3KPNA 2JKJA 3KHOA 3RWFB 2KMWA 2NY3B 2X9XA 2OMTA 1UYWL 3ZZLA 5F0MB 4PLOB 3OHXC 1A3RL 1PTZA 3FB6A 4L3CA 1RCYA 2DYPB 4FNSA 5D96B 4PGBA 4V1DB 5J12B 5I1HL 4NQQA 2GJJA 1MXDA 4DQAA 5B1CA 5BOJA 1OQOA 4F20A 4N2OA 4JN1L 4P2RB 1A47A 3CZFA 3P9MA 1AQDA 2YXVA 2Y6SD 2YAEA 3BGAA 4E42B 2EUZA 4IDJH 4MZ2A 1WICA 3FHQA 3WKMH 3KW7A 3BE1L 1U21A 4KKNA 1N59B 4ODVL 2HVJA 4QHLB 3AAZB 4GQRA 3QDMD 1FE8L 1OHZA 1I7UB 4QHPA 3KPLA 1UD3A 1TTCA 2Y1ZA 4YVUA 2VDQH 1TVBA 4G43B 1T1XA 2KQMA 2NTSP 3CH1B 1KPUB 1P6WA 3L3KA 4XCNA 3TWCL 2V4LA 1PZ5A 3ESPA 4DVRH 2A6JB 3SPJA 3OX8A 4JJ5B 3GNMH 3E3QE 3LRMA 3P4OA 1QWUA 4UM9D 1OP5K 3WKPA 3BYYA 4C56E 1FYTB 3OBAA 5L88H 3AS0A 5TK2A 3VFPB 1I8KA 1RHHA 3GSRA 3MV8A 1NAMA 1EBPA 1QRNB 2WO4A 3ILPA 2IAND 4FGMA 3D9AL 4M43H 2HX9A 5ECJE 2BSTA 2CGRH 4G70B 2X3BA 1TQCC 5TDOA 1TG8A 3V4VH 4R0LA 5CN3A 1NOLA 3M46A 3BUPA 4Z0BL 3VM7A 3ZDZF 4MNHA 2OQJB 2WQRA 3HNTH 3K8KA 3BIKA 2AXGA 1XH1A 3Q8BA 4PJCA 1NEZA 3NRFA 4AUYA 2BOCA 2O6EA 3QRGL 3P77B 1DSFH 5AVVB 2NY0C 1OOWA 1J5OH 5IVXA 1TJGL 3RIAF 1YNKH 3FCSB 3GI8L 4KRPD 5JW4M 3CN0A 3I9GL 2B3IA 4AX3A 4XB8A 2J55A 4E0RB 4PVMA 4LHJB 3N2JA 3ARVA 1FL5A 1OT4A 2X4SB 4NQEA 5D9SA 1RZFL 5FDYA 5HI5D 3SDDC 5KVGH 4YIQB 2A9AA 2P8LA 2WKGA 4LSVL 4OIAA 5JR1L 3VDCA 1MFMA 2C7UB 4J6RH 2FBRA 2XTJC 4JY5L 3IFPB 4YHNA 3BWZA 3REVA 2AW2A 1K85A 1KGXA 3D12B 1FNEB 4N0UE 4QF1A 1E6JL 3WENA 2VSMB 1BLNA 4U3XA 5BUGA 1H3TA 3P0YH 1UM6H 5G4MA 4XTRD 1EJ8A 1GIGH 3EJJX 4X6BB 2BSSA 2YGNA 5ID1A 1K4DB 4MHHI 1H5BA 1T83A 3HZMB 5C8JB 1NAML 1NGYB 2OMBA 1SXNA 3IDMA 3TO2A 4JQIL 4ZMVA 5D70H 1E5CA 3LZQA 1YPZE 3HG3A 4YH6A 4XNQB 4PY8I 1DQQB 4LCWE 4WFFE 3PUUA 4MYPA 3P11H 3ZT5A 4HWUA 2ED7A 4P2YA 5D1QA 2MRYA 2H7WA 3BVDB 1ES0A 1I8AA 2ADJA 1GXEA 2VDNB 3EJQA 2D7PA 1A02N 1F4WL 4UUJB 5CGTA 3GZOA 5D2LA 1A1OA 5DMKB 3APMA 4IBZA 5BXFA 3RUGA 4FC3E 3D3VA 3RVTD 5FFGA 2PPDA 2VLME 3C09C 3H9YA 3RG1C 5GGTH 5DCCA 1INQA 4XAWH 2VQTA 4F58H 1KZQA 3B2UD 1A7QL 1GC1C 3OR7A 4Y4FA 4ECNA 3MCLL 5ES4B 5FA4A 1Q90A 2FCBA 4YOKA 2X38A 2HYMA 4YSPA 4XZUA 5DMJB 2MCMA 1K4CB 2X4NB 3MACH 4HJGB 4DT2A 5D1ZD 1MW2A 2UY7B 1DDHB 4D0BB 3WAJA 3U7YL 1AD0A 2AJUH 4U1HA 1BG9A 1JGVL 1KCWA 1A7RL 2BK8A 3MRRB 1H15B 1YEFH 3NPZB 1U0QA 1VSCA 2IQ9H 2D7OA 2JSFA 3KGSA 4UOQA 5LKNA 2IDTA 3K2UL 1JGUH 4MQTB 4OGXH 3BAYA 3RI5K 3WEXA 4ZQTA 3ZYIA 1EWHA 4G7VL 3G5ZA 3JV4A 3N85H 1YQ2A 5E0FA 4KPHL 5IJKC 3BH9B 3ILEA 4IU3B 2ICWI 3T8MA 4AMKH 1KFGA 3Q2LA 5FGBC 1R3HA 2HN7A 1RUML 3F12B 4LPWA 4GRWE 2WV3A 1EJOL 1WLHA 1S7WA 3VG9C 2X9WA 4B9PA 3WNJA 2GTQA 3SD5A 5I66B 1NCAH 3MRGA 1YEGL 3HR5A 3QEQD 4YXKH 2P8MA 1F13A 2K0RA 4KZ0A 1YAZA 4V2CB 3AG2B 4XNYL 1RPKA 4U31A 1K2DA 3UTSA 5GZOA 5IMOA 3RZCB 1ETZA 1MOEA 1FO0A 3K6SA 3SGJC 2ENPA 1U91A 2E8ZA 3QZOA 4LRIA 4C83B 1LD9A 5EHFA 1A1NA 4JFEB 4S1QL 5IJCC 1WIUA 4LKXA 4PJ5E 4R4BB 2JK5A 3SGKC 2VDPH 3WUZA 1MY7A 3PF2A 4D9RD 1MFEH 2YGVA 4K55A 4NAQA 5D1QD 1MZZA 1FDLH 3S3SA 5D6DA 1VEOA 1JDCA 4P8QA 4ZT1A 3M17B 4EI6B 3MTXA 2C3WA 4FQ2H 1E28A 5I9QC 1KENL 4N0CD 1UWYA 3EBHA 3JYBA 2NY7H 4OZHF 1OAJA 3GINA 2OQJA 5F44A 4E9LA 2X40A 4K15A 1KN2H 3LQAC 5HGDB 1AE6H 3QW9A 2YXFA 3QIUB 1R4XA 3QB7C 4G9DA 1TJHL 3R18A 1W16A 1A8JH 1Q94B 4U1NA 1X5MA 5AVWB 4DGYL 3O11A 4HWBH 2XG5B 4GO8A 4W9GC 1MHEB 1W8NA 1ZT1A 4W9JC 3ZK0A 3FTSA 4DOHB 3S97C 5T1MB 2AV1B 4G8GD 1IVTA 3H9HB 4DAGH 4HH9B 4DO5A 1HDMA 1UQSA 5EEWA 3RLSA 1Z9NA 1JWMB 1WWBX 1WG3A 3FH7A 2Z8VC 4KKLD 2Q86A 5HDQL 2ZOKA 2YC1B 2NLJB 3PPSA 3VFMB 4AM0A 1A9BA 5DR5H 3HPJA 1BLNB 1XGPB 3DRTB 1P4LA 4HIXL 1QQDB 1OCWL 4OTXH 3K4DA 4CA4A 4ATTA 2R0LL 3RWCA 1FZKB 4MQXC 3OAUH 3EYFA 4GKOA 4U1KB 2D9QB 2ZUQB 3V4PA 2YHGA 2F8VA 1YPZF 2H0JA 4OI7A 1I8IA 5AL8A 2EC9U 3DWTA 1QR4A 4P5MA 2B4CC 1SNRA 5AYTA 1DUZA 1Q1JH 2CK0H 1ZS2A 4K5LA 3W39B 1S7XB 5E6ZA 5GJTL 3QORC 3S36L 1U8OB 4N5ED 1CMOA 4EI5D 3BO8B 1R3KB 4H88H 1JVOA 4PBXA 3MC0A 5HDWA 2KH2B 3IS1X 4R2GD 4ZAKB 5T33H 4D3CL 4DP6X 1VA9A 3PNWA 5FOBA 2OMWB 4XN2A 2AQSA 1GC1H 4KTYA 3GZPA 5G5DB 5MEPB 4E9XA 2R7EB 1T1YB 1J10A 4XNZC 1M05A 2EE3A 1N7ML 4EUPB 1U58A 3MKGA 4NZ8A 1NMAH 2NSQA 2YUWA 4H2CA 3ZRCC 2J8UF 2XPYA 1XSKA 1OWRM 1FZOB 2GC7C 3UJJH 2OFQA 5MERA 5GGRY 1QR1B 4ZSOE 5JYMA 1UD6A 2BINA 1PLBA 3KYOA 4FG6D 3OMAB 4JDVA 3WXVL 1T4KB 4XAKE 2YEQA 5AW0B 5KG9B 1I8MA 1ILSA 4L9LC 1A4JB 5A3IC 1FO0H 3L3OB 3RU8L 1TZIB 4EN3C 3WO3B 2NUTB 1A6ZB 2WNGA 3MRJB 2W0KA 1QW9A 2AJ3A 3D0LB 4HV8B 3RGVC 1F2XK 2IALA 3ISWA 5KJRH 4K8RH 5C0AD 4YDMA 5DD0L 3OG4B 4WW2F 5C09B 4CKVX 1HHHA 3S34L 3J8F7 1LHZA 2R27A 3EIFA 5A16B 1SOSA 2ZX6A 4P2RA 4H7VA 5AVUB 5T3ZE 2F8OA 2P8MB 2RCSL 4S10A 5JA9A 4A2MA 1EV2E 2YD3A 3FU5A 1CT8B 2IJ0C 3IGKA 5L0QC 3FUHA 2CG9X 3Q6GL 4JO4H 2ITCB 3NCCB 5JHAA 3HNVH 3OPUA 3QYMA 3ULUL 1A1NB 1MRDH 2ICEC 4XPFH 5FV2A 2QJDA 4ZOBA 3HOGA 3TESA 3LD8C 3AT0A 3B6SB 5AAWA 1SVCP 4JY6B 1OCOB 3BEVB 2VR5A 1RZJC 3DX7B 4WEBL 3LVTA 5ISZE 2EUVA 1S9VA 3OF6A 2MWCA 3OZKA 4YHMH 1QRNA 2DAVA 4PJAA 4YL9A 3VD1A 5CEYA 2DM3A 4OGYL 4L18A 5LGKA 4NOBA 3SY0A 5B8CA 4EZLA 3GI9H 2DICA 3ARFB 2VUYA 2VWEE 2YPVL 3QNXB 5E7FA 4GAJL 2BOCB 4F93B 2DB8A 4X7TB 4N0FB 5F7DA 4AVKA 5A16A 4P57A 4B0MB 3ARTA 1KLFB 2YA1A 5F7MC 3FO1B 3MLZL 1G7JB 5I1CL 2QDWA 4S1QH 3TCLA 4C57C 2FYVA 3K0WA 2X4SA 4NQEB 4OGQC 4ZFGL 5E5LA 3GSXB 2JIXD 3LPPA 3NCWA 4FKKA 4PJCF 1JSYA 1MJUL 3HPJB 3G9VA 3ZHLA 1TSRA 2BS71 3N04A 3S5ZA 5B8CC 5BRZB 3O2VH 1ORQA 2LGNA 4UIMB 1PZDA 2AK1L 3TBCA 2D4FA 4X6BA 2YRBA 4YC2C 3NCJL 3GSWA 1S9WB 3CN3A 3BVTA 2GVYA 1VZHA 4N2AA 3HC0A 1FPTL 1KBKA 3QWRA 4HZLA 1AR1D 2WW8A 4QUOA 4JQVC 3SZKC 3F2LA 1BXXA 2FK9A 3BRDA 1A1MA 3VFGL 4PRID 2DQCL 1ED3A 1TZGH 4QDGA 1I9JH 1U33A 4X9YA 2PO6C 1UM4L 3CDYA 4NLAA 2P5EA 2FJHA 5ERWB 2NY0D 1VENA 5AAMC 3KYKH 3K5RA 4X7TA 2R0WH 5B38A 3ZE0B 1P5VA 3BAEL 3JTSA 2Z8SA 5FEBA 5DD5H 3S5LG 5DD1H 3N40P 3JZYA 3HHMA 5DLML 5HHVL 1BVLB 3ETTA 3NAAL 1INQB 4HVBA 4U0QB 3JWOC 3FCGA 2BIOA 4NKMB 5D5MA 5FGSA 1U2HA 5MERB 3BZ4A 5TQ0H 1OAUL 1NDMB 1BXAA 1Y18B 3FUJA 3ZVVA 4LP8A 3W5MA 3VQ2C 2E6JA 4NI3A 4N3TA 3V2AR 4DERA 1OTTC 5I1GH 3DETC 1ADQH 4K5PA 4NC1E 1XGRB 2G5BB 4WNSA 1JPGA 3U4AA 2HLAA 4PRPE 2AEOA 3MRJA 3GF8A 1XCTA 1QTPA 4KO6A 2VDKH 4TLUA 5I1AB 1OGAB 4RMQA 1YEKH 2MPVA 1G84A 4E41A 5T1LA 1WBXB 2OR9H 3TYFA 4PRAB 1IM9B 4CSTA 1YQVH 4K3EH 4NNYB 3V9FA 1TENA 3LIUA 4WI5A 3DETD 5AZEL 1H0DB 1SJVA 4ZNEA 3ZE1E 7PCYA 4N28A 5DGRA 1HQ4B 1SXBA 3QO0B 4B9YA 1TTFA 4H2AA 3O3BA 2X9ZA 3C5ZD 3NFNB 4KVNH 3NSXA 5FDWB 2NW2B 2W1NA 1D5RA 3CBJB 4M1CD 1KXVC 3ZGHA 3DVIA 3PHQA 4F27A 1E3ZA 2H3NA 1QFHA 3QUMH 1BIHA 1KF9B 4H5SB 4YE4H 3WUWB 5CZKA 4L8CA 2FR4A 3CU7A 3MGAA 1CE1H 1OAKH 1RZFH 3HKZA 5DZPA 2H0PA 5I8KL 3BQUB 2APXA 3OWEA 2DM4A 4CW1B 4XP9H 5KYXB 5IG7B 2ZOUA 3TO4C 2FIKA 5EZIH 1JZIA 1UASA 3V0IA 1TSHA 1DSFL 5AW4B 3RIFK 1SDYA 3FFOA 3FCTB 1WFMA 2NYZA 5KYNA 1KULA 2FWOB 5FHBL 2GITB 3HC4L 2BSCA 1NQBA 4ICWA 3TTSA 4KKAD 2F8IA 1QVOB 2ADJB 5I19H 3KW8A 2D7TL 2C4FT 2VM4A 2MOVA 3QDGB 4U3SB 4CBPA 4O4YL 3TNMB 3RX7A 1N6QL 2HRHA 1FSKB 1HAUA 4X99B 2XWBB 4ZUWB 3ZE0E 3P4MA 2J43A 1NBCA 3F7PC 5IVZB 4OZGE 4H0IA 3I6SA 4HGMA 3B7YA 1ERNA 1UCBH 3S5YA 2FWUA 4Z3IA 1A5FL 4YNYA 2OR8A 5DFWH 1E9OA 2OCFD 4XMLH 3TEYA 4G83A 1MREL 3U2JA 1H8SA 2NTFB 3HE7B 3SDDA 5FR3A 5GGRA 1DQDL 1QSEB 4RFEA 4KV5F 4QLRA 4GUOA 3NPSC 4CADB 3J27A 4LVEA 2Z1KA 1KB3A 2YOAA 1ND0B 3BJ91 1FVCB 3IWVA 4F2MB 2K6YA 2FSEA 4R7DA 1RIHH 5EPMA 4AGNA 3DO7B 5KVEL 1W9XA 2IAMB 3D0VA 4HOWA 3HC4H 1OGAE 2WCPA 1WIPA 2XWTB 3U9PL 3VGFA 1W72L 1JNLH 4IGBB 4XVSL 3NABH 3ABKB 4NM4L 3LQAH 1FLTX 1SM3L 1NFAA 3VW3L 4FULA 4R7LA 5AL0A 3RZCD 3VTMA 5T1LD 5HYSB 4HSAC 5I8KH 3DX1A 4G59C 3SCMC 2E6PA 3MYJA 3O6FD 3JVGC 2HT2D 5IQMA 1T03L 2W0FB 4OIIH 5SV4A 3D2TA 1IL1B 3II2A 4LLWB 4N2MA 1OK8A 1AG0A 3U2SA 5IMMA 1A6TA 3TO4B 3NUKA 3ZYJA 5D7IE 5D6CA 1R75A 2EYRA 3BLBA 2QELA 5C8JA 4LSQL 4URKA 2W59A 4F33A 1A6VL 2Y36H 2CNZA 1AYRA 1NGZB 1WAAA 1HINL 3VWJA 3DX9A 4YLQT 4Y5YC 3TIEA 1MI5B 3GMMA 1IEAB 5L2JB 2WLIB 1CDBA 2HLAB 3LNGA 6FABL 2HJFA 3QDJA 4NRYA 1A7OL 4ZBJA 3DO7A 4YO0A 2FJGB 2VLMD 2R2BB 5AW2B 4NS0A 1RSFA 4PHZA 1PNDA 4KXCA 4PGCB 3LS5L 4GBXC 3S4SB 4JPQA 1JZ8A 2H3XC 5I1GL 2L7EA 4FQQA 4AV4A 4M7JL 1NUGA 3FH8A 3KLAA 4N25A 5DJAB 4YC2B 4JB9H 2YD5A 5E6YA 5TQ2L 2ZUWA 3MR9B 4OFVA 2WXRA 3RTQA 4ENED 4PRHE 3RVVC 1CFTA 1ZKAA 4ZDHA 3T77B 2GYSA 5FPIA 1JWMA 5EULV 2NXZD 4OCWL 4P3DB 3CDZA 5IQ9A 3T04D 4ZOAA 4NUQA 1SEQH 3VFVB 1P0SE 4RFOL 5E6IA 4Q0XL 2J72A 1XWVA 2G0KA 1N0XL 1P5UC 4MQSB 1CXFA 2VZ1A 4OLWL 2IBZX 4UBDD 3BP7B 4LLWA 3KYKL 1MCQA 4KNUA 3KWWA 1JXKA 5G2NA 5JA8B 1IAII 3WEXB 2VL5A 4LGPB 4XO5A 4QXTB 1EJ6A 1NAMB 2A9NL 2WYZA 1X7QB 5FX3A 3UOAB 1X5LA 2Y3NA 2X7LA 1LE9A 4LLMA 4KRPB 4PJEF 3TIEB 4ZTPH 43C9B 3JXAA 2D3NA 4UB0L 1FFTB 3KPOB 1DQJB 1FFQA 5D2NB 1MLCB 1TPXC 2NSXA 1DUZB 4FLOA 1MEXL 1ZHBA 3TVMC 2EEDA 1EDHA 3KWVA 2A9BA 3O2VL 5C0DA 2Y1YA 1BOGB 3EGSA 4AWJC 4BH8A 2XT1B 1WQVT 1HCYA 5M7QA 2VKWA 1HIMH 4U1JA 5KJ4A 1J0KA 1MJUH 1BZ7A 1A4CA 1QW8A 4F80A 3K6SB 3SBPA 3IJYB 1A5FH 4NUGH 5E8OB 2OBGA 4IRSC 3BSZH 1EMTL 1F42A 1FL5B 5F6IC 5D5MB 4P57B 1ZSDA 5CEXA 3I3BA 1JPEA 1C8QA 2NUPA 2XTLA 1FNFA 3IAQA 5GS0L 5I1CH 4P3DA 4JUSA 2EDQA 1IMHC 2VAJA 1X5KA 2W94A 3D69A 4O2CA 1JNHA 3CMGA 5IB1B 2H32B 3H53A 4OZIF 1RFDH 3QIBB 4AENB 2X41A 4G6AD 4LLQB 3EGDA 5CF3A 1KCBA 1I8MB 1QLFB 2XNAA 3LKNA 1HJBC 2E7LA 3SDAA 2AJZA 2E46A 5KVGE 1P84K 3GO1L 1I85A 2PXYC 4JCMA 3VWKB 3DX4A 2HG0A 5DMGD 5I6LA 4ZG1A 3MA7A 2Q7NA 3MLPA 1BAFH 1GZHA 1XGYH 5F96L 3T4AC 2A77L 4EI0A 1GAFL 1PKQB 1AXSA 3F6IA 5MENA 4E42A 3KPRD 3LYRA 2HFFB 1AOZA 1FL3A 3SGEI 4PCKA 1A9EA 3F7VA 3RGVB 1ZHKA 3IJ7A 4JHWL 5GGVY 4YSAA 5LN4A 3T08A 4BFEA 2Z34A 5EEVA 3OZLA 5HI4D 2ZSVA 5BO0D 4JREC 3QNZA 4BFBD 3L3OC 1HKLH 2R1YA 1UXLA 3OPZH 3VMNA 5C0CD 2QMKA 1J9SA 4DGWC 3QUML 4M7ZB 2NY6C 5I1LB 5IOKA 1KELH 1TCMA 4JHBA 3T09A 4KX8A 4R4FH 4A37A 1ADWA 5DD6A 2FHCA 1DVSA 4AYBA 3EO1B 5TFSL 1ZSDB 3SEPA 1BLIA 3V0EA 3K74B 2J88L 4LMQI 4J39A 5CMAB 3GUFA 5C09E 4RMUA 3VQLA 1FNSH 1H15A 4DFHA 3GMNA 5JNYA 4LBAA 4GNKB 3LN5B 4O5LL 1CBVH 4LFHG 1DBBL 1S7VB 3PV6B 3UBXB 3FC8A 3UZEA 3SODB 2IH9A 3BPCB 4TRPL 2BP8B 4AKOA 1ZRUA 1LNUB 3A47A 1UXWA 4OR1A 1NC2A 1ZA6B 3HZYB 4YFLI 4HGKC 5KYUB 3H2WA 2XN9B 5GZND 3MLWL 3G3LA 4Q4IA 3SPVB 1F4AA 4AE0A 1QTYT 5L8KB 5F71A 5BS0A 5CCGE 3SE8L 5TQ0L 4MJ2A 1N26A 3X1GA 1A6UL 1MPAH 1LO3L 3T65B 1T1YA 2Z35A 2FWSA 3OG6B 4JM2F 4WW1B 3P2BA 4TPRH 4FA7B 3CVIL 3FO1A 3QO0A 4EQ2A 1USQA 5T1DL 3C6LD 4Y1AB 4TUKL 5C6TH 3C5XA 4G3YH 3BOVA 5DMIH 2X4RA 3CFNA 4Z76B 4XXWA 4D3CH 5T33L 2YEVB 3S3JA 3L3DA 3U36B 1OAYL 1DBMH 4BGLA 2HMIC 5GRYA 3L95B 3BAJA 4P2QD 3A6BL 2CMRH 3QZWA 1XL6A 4FYTA 4G7QB 5HYEA 3BC9A 1SF3A 5EOQH 1HEZB 4Z7AA 1YNLH 3EUUA 1PQZA 4XT1C 3UAFA 4R5XA 1U9KA 4NWTL 1CI5A 4NFDA 4KVCH 1PLCA 2BXZA 1N67A 1XF4A 2Z9TA 1NEUA 1TTBA 2PR9A 5LXVA 2XPZA 4L2LA 1GGCH 3STZA 4AJ0A 3EJCA 2XZAL 4ZFFB 1MUJB 3E80A 4CC1A 1BJMA 2ZF9A 2D7NA 1ET8A 3BYTA 3GSUA 3EH2A 3QG6B 3VVWA 1PY9A 2CJUL 3W5NA 3BKML 2WLMA 1HZKA 2W9DH 5EU5A 2V7HA 1L7IH 3V7MA 4M6OH 3EF7A 3IDNA 1RUQH 2X88A 3DARA 4WF7A 4IIQC 3MHZA 4XWOC 5M95B 3EFFB 1HQRA 4I4WA 2CHZA 1I3RB 2HKHL 4P4KD 5HDQH 5HY9A 4YPJA 3RIFF 5LGYA 4NEHB 3QYNA 4JY6A 3DOHA 1OKEA 4NM8H 2H6UA 2Y24A 1BQSA 1JGEB 4GAJH 4AT6B 4M29A 4AGPA 4HXAL 2C9PA 4XHJD 1ZY9A 5DJXB 1W6LA 4ZPVB 3RVXD 3S3PA 4HWBL 3O8XD 5INDA 1ZTXH 1C12A 1NGWB 3B2UC 4XVJH 2A7BA 3ARDB 3ZDYE 3SY6A 4RDQG 4AV0A 3ZIMA 4WLCA 4ZODA 1DVFC 5DJ6B 5GGQH 1T1WB 3ARFA 1D3CA 1VCBC 5D1ZC 2QTVA 1KCLA 4RGMC 3JQOB 3BKYL 1X4XA 3P3YA 3DDGA 1UENA 3V4VB 3E6HA 4P23B 4Z5RB 1RPQA 1IJNA 2H0FA 4RZCA 3IMUA 1JFQL 4L1LA 3T6WA 2ISDA 3OB0H 2HT4C 1HFUA 1WEJL 2OULB 4P05A 6CGTA 4JG0H 3ULUH 4PV8B 1RZQA 1K2DB 4BQ8A 4FQXC 5E23A 1HX0A 2Y07H 3ME0A 5E5UB 3Q6GH 2PP8A 3QEUA 4N26A 3OKEB 1KDJA 1AYOA 1ITBB 5JHDA 4G8GB 4HKZA 4I3GA 3MNVB 3MLXL 5HD8D 3D7PA 5TF0A 4LZKA 2XVGA 3C60D 3EF4A 1PSKH 2VDRL 3FSWA 3O41B 5D1ZA 3WJJC 3GGWA 4P07A 1Q9OB 3UTOA 4P06A 4F9PA 1J8HA 2MCPH 1VZGA 1S7RA 2ED8A 5C08E 2I9TA 1JZ7A 2EADA 3DTXB 3LIZL 4GOSA 3ZKQD 5DZOA 3GMOA 4LVNB 4RQQA 1WZ1L 1GGYA 3SJVA 2J4WL 3NIFF 4MAYC 4XX1E 4KPHH 2QTEA 4M03A 3S5LA 5A2BA 3IJSB 1N6VA 3MJ9H 4N8VG 4LSSL 2YQBA 2GITA 1Q94A 2CO1A 4AQZA 2GG1A 2OTPA 2NZ1A 4I2XA 3IAPA 5L2KD 4O2EA 4NN6B 1CI3M 1QLEB 4PJDB 2HKFH 4BFIA 4JG5A 1ACYH 5JQIB 3QJTB 2DWEB 3WIFB 3EJZC 5JHDD 1EVTC 3W56A 4OF5A 5DJYB 4M93C 4NUJB 3AADB 4OCLC 5T1DH 3ASOB 5ALBH 2ZCHH 4G8AC 3FF8A 2E8YA 2QKIB 2WLHA 2ZCHL 1DSYA 3LZPA 4JKMA 4PG2C 1A6UH 1MPAL 3IETA 1OALA 1J9RA 2VLRE 2NDGA 2RAMA 1IQDA 5KW9H 4KV5E 4JPIA 2MHAA 1ACYL 2ZJSH 3D4ZA 3PP4L 2IGLA 2XIIA 2AKRA 4PWKA 1IM3B 1WHOA 1R3LA 4AQ1C 5JQ6H 4CADA 1ZVSB 4A67A 3KVPA 4LSSH 1CGSH 1F4WH 1B0IA 1KGCE 1QBAA 3ARFD 3INOA 5BOZG 1IBGL 5E1AB 4MZIA 3WELA 1Q1JL 2CK0L 2DYPA 1OIOA 1Q9WB 2E75C 3RVUD 4NQVB 5T1LB 3QUMB 4OD2B 4PW3A 4LLAA 5KSUA 5DRWA 2UWEF 3X12A 4CDGC 4YS4A 3A67H 1RU9L 1JPSL 3C09B 1L0QA 1ZJAA 1T80A 4KJYB 1HC1A 1PU0A 2J88H 3MLXH 1PZ3A 2C9AA 2QSQA 1YJDL 4OTXL 1ZGLP 1KSRA 3QQ3B 2CO6B 1OARH 2HVJB 4FQLH 4QHLA 4UQCA 2HJKA 3UJIL 1IEHA 4KRLB 4NQEE 2WVVB 1MDAA 2DPKA 3PAUA 3S8WA 3DJRA 1NKGA 1G7LA 5CJ8A 4HU2A 4ZS7H 4S0HA 4KXZI 3AABA 3BLKA 1A3QA 4FNQA 5H37G 5EU6B 1J5CA 4UBDC 4E9YA 1JZ5A 1A22B 2V8MA 1LO4H 3OKOA 5FA4B 5DUJA 3KLSA 1A6AA 1DSWA 4OBRA 4IQHA 1PW3A 2EKSA 1WF5A 3FUEA 3GS0A 5EIVA 4I48B 3T6ZA 3LPGA 5HHXL 3FU0A 5EIIB 1KGYE 3UXFA 5MEQA 4QRFA 2QQKH 3ARBC 4QRRD 2X2HA 2CLZA 5TDNA 5D8JL 5K9QI 5EBLB 4MVBD 4WW2B 5C0BA 1ZTXL 1A6WH 5C07A 1KN2L 4OD3H 2VDPB 3O6MH 3GXUB 1BJ1H 1RPUA 4JQXA 1GGIH 3B7RL 2C1PB 4HMDA 2CBMA 4M5YH 1KBBA 1UT1A 1IU1A 4F9LA 3V4VL 2QVKA 2X70B 4P46D 1ACZA 5C0BD 4M48H 3VH8A 3VD5A 1QLRB 1OP3K 2BS8A 1TKWB 1G7MA 2J8UA 3D9AH 1MFEL 3P9WB 1N2RB 3HAEB 2PWFA 5JIMA 4KXZH 4RESB 3PG2A 1U8PA 4KY1L 3P30H 4OZGA 1BQHG 1T3FA 4L0ZA 3UMTA 2O61A 4ZFOB 1JHKL 3LEYL 4LVHB 4MCZA 1DDTA 1H9VA 3QEUB 2J71A 3DLQR 5HJGA 1CL7I 3OJMB 3TWCH 1CLZH 4KK9D 3N1FC 3IXTA 5KYWA 1ND0A 2H1PL 2WOYA 1INEH 3CSPA 3CXFA 3FRUB 4NCC2 1NCAL 4QRUA 3CDCA 4L4TD 5A43C 4GP4B 1EJOH 2EEBA 4PJ7F 3IKCB 5JHLH 2AJXH 5FK9A 3EJTA 4X6CE 4AMKL 1WBYA 5F7KC 2C3VA 1UD2A 2F54E 3Q43A 2YMXH 2CJTA 2L04A 4NAJA 3X1FA 4PJXE 2VRQA 2YGQA 4HS6B 2ZX9A 1NFDE 4FI8A 1DBML 5T1KA 3NG5A 4GXVH 3FT1A 1UYWH 2OKMA 3ZTNH 5DMKA 3QQDA 4IBWA 2RMNA 3IFOB 1ACXA 4WFHD 5C6TL 3X1NA 4BH8B 1ZCRA 2R1WB 4JFFE 5ENWB 2VLJB 4GKNA 4WSJA 3UTSE 2AABH 2G60H 2PKDA 3FO0H 4FNPA 3A6CH 5I5RA 3FUIA 1A8ZA 4P5TC 1BBJB 5EFIA 5DJZB 2O61B 1XHHA 4XN7A 4NAMA 1WDAA 5CNHA 1SYSA 3GK8L 3IGAB 2UY7A 2P80D 3IYLW 4GLRI 3UX9B 2E27L 4PYGA 3OHXB 2ADIB 1TT6A 2ZXQA 3SSGA 3WFEL 4GMSL 2R29H 3CC1A 4UMGA 1CICB 1IBFA 1YZZA 3FU3A 4TUOB 2Q76A 4EF3A 2NX5A 2GI0A 5E6IC 4WJKB 3WIAA 5CM1A 1M6OA 4BFRA 4NRXA 1NMCB 3F6LA 3OB0K 4G1MA 5FM8A 2F74A 5DZ9A 1DJIA 2H2SC 2VYRE 2PW2B 4JM2A 5GJSL 1CBVL 5DFAA 1AQMA 3HS8A 4HKJB 3SBWA 3VFWA 1BWWA 1KEGH 1MCCA 4MA7H 1HEZA 1JPTH 3FT4B 2C3HA 4LVNC 4UQ3A 5D70L 3QEGL 2VAAA 3L2MA 5C08A 1BYPA 2UWEE 3QG7H 4P5TA 3TJEL 1NAMH 1OE1A 1DR9A 4ENZA 4UNVA 2IDSA 4ZX4A 4N90E 2DRUA 4ODHH 5I8CB 1A4BA 4I1NB 5BZZA 5SX4H 1BVNT 4NQXB 5E1IA 3UERA 1EXHA 2XFXB 3V52H 3TA3C 5D7JC 5AYUL 5JHDB 1EFXB 4PLNC 1E4KA 4UINH 3LRSB 3ZHFA 1I9RL 4PJGB 1CIDA 4JJOA 3NACL 4KQ0A 4QHMB 1M1XB 2R7EA 2VLKA 4JM2C 5IREA 2VL5B 1UA6L 1O9VA 2KPNA 1FN4A 3DTXA 3CPLB 3EFFA 4JVWA 5CWSA 2J5WA 3O3DA 5KSBF 3BH4A 3NABL 1BAFL 3K80A 3UAEA 4G5ZL 4XPAH 2FECI 4LAQH 3MV9D 1U8MA 2XCMC 1E28B 4G8EB 3FRPA 2EDTA 1HOCB 3KPOA 2I24N 1PLAA 2Z92B 3G04A 5I1AA 1OSYA 2L0DA 1ROWA 4YHYB 1NFDB 2DTMH 5EWIL 1F1GA 3WGVB 1RIUL 3DA0A 4G80B 1KPVA 1LP9B 3N40F 3SDYL 1O75A 4JGUA 2JVUA 4XBMA 1NIFA 1MVUA 3VYNA 5JOPE 5DWPA 1CLVA 2BCKB 1EH9A 4K5OA 5E6ID 1F18A 3H9SD 4PPTA 3U7AA 3LKRA 1TQTA 4IIQB 1Z7JA 4MLSA 5HYIA 5D7IB 2OS7A 1VADA 4OZHB 1F11B 1X5JA 3N41F 3QDME 1FG2B 3VXMA 2OL3H 4M3HA 2HFGL 4XPHH 5CUSL 2O93L 5F89A 3TIDB 3EW3B 2Q2LA 3L3DB 3KDMA 2VW7A 1ETJA 3IF1A 2P7TA 5KN5A 4HD9A 1TEFA 3OKDA 2J6EA 5J6HB 3FN0L 1SY6A 2KDGA 3D50A 2SEBB 5F6HJ 5I1JL 4OH2A 4H0LC 4UT6H 2PLTA 5CWSB 2X0WA 4BHUI 1HEHC 3EJPA 4MAUH 5EBWB 4MJ6B 1JRHH 1K3IA 4AI7A 4HWZA 4Y2OA 4Y7MA 2FWOA 4QRRE 1IUZA 4M1DH 4P23C 3QORD 2F5BH 3T3PF 4PJXF 4OQTA 5D7LA 2R51A 4FNUA 2ADFH 3G5VB 1U8LB 3IT8D 2YMOA 3X13B 4WHYG 2F08A 3MRIB 2JCCF 2P9RA 4ODUB 1EZUA 2DLIA 1R5IB 4KK5C 1I9RH 3QHTC 4WKZA 5ITBH 1MVFA 1BVNP 4Q0XH 3V0WH 5DC2A 4LF3B 4Z3HA 3GSUB 2K4AA 4BRVA 4P2QA 4YSEA 3DMMD 3Q48A 3HIZA 3KD4A 3E9UA 5EC2A 4A7GA 3KGRA 1G94A 5DUMH 5D72L 4L5FH 3ZLQC 4KVPA 1WFJA 1NBZB 2ALWA 3M7OA 2UZIL 1MJJA 1YYCA 2ADGA 2XQYK 3IB4A 3MGTB 3F04A 4X7DC 2KZKA 1BF8A 1OP5H 1JV5B 1S7TB 3QO1B 4R6UA 2XZCH 4K2UH 3EJUA 3RP1A 3G5YA 3LKQB 1YMHA 1ETB1 4OZHE 1OSPH 1WA0X 4LBEA 4J8RB 1JK8A 1F6AB 2AMGA 1E5UI 2BSED 4AYGA 3WFHA 1GA2A 1RURH 1TZIA 4OGZA 1NGYA 4MXWH 2OMVB 4AMWA 3VACA 1UXWB 3FH5A 4K2UL 1ADQL 2RTTA 1Q9WA 4GMSH 4HUKB 5HDRA 1QLRA 1TZAA 1ZHNA 2LU3A 1Q0EA 1X4YA 3VUAA 4AYSA 3HG5A 5IHLB 3PJNA 3FQ2A 4M5ZL 4RGNB 2VGLM 2R2EA 1YVLA 1MIMH 5ICZB 1C7TA 5D72H 4FJYA 4JHVA 1WS8A 1IGCL 5D7KE 4ZMYA 4WW1A 1NANI 3SDXB 1USZA 2FAUA 3T3ME 2NY4B 4OZ4B 5DLMH