4CSSA

Crystal structure of fimh in complex with a sulfonamide biphenyl alpha d-mannoside
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords PROTEIN FIMH
total genus 38
structure length 155
sequence length 158
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cssA00
5F2FA 5F3FA 5AAPA 4LOVA 1KIUB 4XOAA 4X5RA 3SQBB 2UY7B 4CA4A 3BFQG 3JWNH 4J3OF 4AVKA 1UWFA 4AUYA 1QUNB 3ME0B 4X5PA 4CSSA 4XODA 3JWNE 4AUUA 5IQMA 5AALA 5LNGA 3RFZA 4AVJA 2W07B 4AVIA 2J2ZB 2JTYA 1KLFB 1N0LB 4XO9A 3ZL1A 2VCOA 2UY6B 5JQIB 4XO8A 4ATTA 1TR7A 2XG5B 4J3OH 2XG4B 2WMPB 4CSTA 4XOCA 3MCYA 4J3OG 4AUJA 4AVHA 4AV0A 5ABZA 4X5QA 4AV5A 4AV4A 4XOEA 5LNEA 5IQOA 3BWUF 5FS5A 5FX3A 3ZL2A 2JMRA 4X50A 4XOBA 5IQNA 1ZE3H 5AB1A 3ZPDA 5CGBA 5FLUA 1PDKB 4BUQA 1N12A 3BFWA 5FWRA 3JWNG
chains in the Genus database with same CATH superfamily
2FZ3B 4CU7A 5ESQB 1SY6L 2VL5A 1JIBA 4TQPA 5DJYA 1VZIA 2X6CA 4PSRA 2PR9A 1RLWA 5TDOB 3QEQB 4GUQA 1K3ZA 1MFUA 2FX8H 1ACZA 3B3IA 1Z9MA 4JO3H 1XF3B 4PGDB 2NLJB 1JYVA 1MRDH 1ZTMA 3GMLB 3NGBB 2PO6A 5ICXB 1UZ6E 1MG3C 3QQXA 1OP4A 3ASNB 4D0DA 3PABB 1EZLA 3DIDA 1Z9SB 5AD0A 4GUPB 4RGMC 5DEFB 1SRDA 3QDMA 4ZS7H 2WP3T 1PLCA 1A8ZA 1WLHA 5KSVA 5F3FA 3FHAA 3WDIA 3DJSA 5I0ZA 2D7NA 5BRZE 2X2YA 3WTSA 3ECBB 5CR1A 3B3BA 1WZAA 3SKMA 3IMBA 4WWPA 5E8OB 3ROOA 1KDIA 2FT6A 1ZA3A 4JO1H 4OF3A 1CT8B 1R3JA 1AO7E 5MEPB 5GZNA 5CJ8A 4DO5A 5CMAB 5T1MA 3IFNH 3ILQC 1KTKE 1R4XA 1U8OB 3BW9A 3EIFA 3FS9A 2X05A 1VEMA 3MLYH 4O02L 5F44A 3OKNB 4H2CA 1JGDB 4JPWH 4RMUA 5HGDA 5C09A 3NTCL 1DO5A 3GPEA 1DVUA 4QXGH 1AOHA 3VI4F 2A1WL 1XB3A 4Y19A 3VXRB 2A99A 4HLEA 3IRCA 2ZKMX 3PG2A 5E1AB 4DP4X 3GJFK 4PJBE 2OMUB 1Q1JL 2WYIA 1XIWA 4IRSB 2BDNH 3ARTA 3CHSA 3BKML 2C5DC 5I1HH 5FO7A 4LSPH 2WLHA 1NLDH 4ZUSA 4P59H 1GYAA 15C8L 5BCAA 5FLUA 3B2MA 1JMZA 2YKKA 6PAZA 4ZMVA 1EJ6A 4ODHH 2X88A 2WBWB 4BHUI 1JI1A 3A24A 4Q6KA 1RK0B 4G7YL 5KAQF 3O11A 3QDJD 4XI5D 3SDCB 4HGKC 2Z35B 1HL8A 1A6WL 3HG1A 1RJZA 3IJSA 4ODWA 4LOEA 1S9XB 4OGQC 3ZU8A 2V8MA 3AY4A 3OR7B 1LO4H 1C16A 1I3GH 4FZEH 1XFPA 5H37G 5BOZG 1MREH 4XBPB 3NZ8A 4IHBA 1PNCA 4BA8A 4OF6A 4PWEA 3D25B 5DD1H 3U48A 3UTSD 5FOBB 5E8NB 4PLKC 4D2NA 4L1LA 2KQMA 4LAJH 1IL1B 3SDDC 4JDVA 4Z3TA 3DRQB 2N0KA 3ZY7A 4FC3E 2AAVA 5C0JA 1N6UA 2OP4H 1SFHA 1HXKA 2H26A 3B9KD 1AS7A 5ADOH 2H45A 1KGYE 2YGQA 3CXDH 1D7DA 1CDHA 2NY0B 4HP5A 3OKEA 4PJXE 4JY6B 4D0BB 1YMMB 1SF5A 4Y4FD 4WEUD 4YL9A 4P57A 5DD0L 2EXWC 2XKSA 5DQJB 5DO2C 5FC9A 4CC1A 2AEWA 4DKEH 2YXWA 1ZA6A 3GBLA 4M7ZB 3ILPA 2ZXEB 3KBFA 4PW4A 4WWOA 5CJ5A 5DS8A 2UXFA 4ZXBB 4ANWA 1T21A 4LDCA 1F56A 4WNJA 2WN3A 2OL3H 4FQCH 2ARJA 2YUXA 3CFBA 3LH2L 4FFZA 1LQSR 1MCQA 1CXKA 1TJXA 2YA2A 3NOIA 1RZFH 4DOHE 1P84J 3B9DA 1NWPA 4LRNL 4YSDA 3V8OA 4MA7H 2TRHA 4LP5A 2OR7A 1R3LA 4ERSL 4UV7L 5KS9F 2CH8A 4HIEA 4DP5X 4DPAX 1DQJB 1DDHB 1KF9B 4NZFA 3OLEA 1VGKA 4OD1L 1A4KB 3R0NA 5IW3A 3VFSB 4YSCA 3K2MC 4JVUA 2P80A 1VF5C 5TGBB 2J4WH 1FIGH 4KJPD 3QXAB 5HJDA 2NY2B 2WSPA 4ZO7A 2I9TB 3CVHL 2CLRB 4FL4B 1EFXD 3ESPA 4QO1B 5JQIB 2YZ8A 1SMDA 4X5XB 4GG6B 4ABQA 5EN2A 4L05A 3WFZA 2CO2A 3BN9D 3CVHB 5EU7E 2IALA 1BVZA 4LSDA 4BXVA 5HHXH 4D8OA 4NZRH 1LDPH 1PMYA 2FB4L 2EXTA 3E6FA 1V3KA 2BP0B 3NYKA 1FG2B 1OY3B 1AGDA 1QFUL 5D7SL 4AQAB 2A5UA 5DO8A 2FO1A 4BFOA 4KK9C 3MV8D 5C0AA 1AACA 2AJVL 2H2PC 5DMKB 4YSQA 5DWUL 3DOSA 4OGZA 4PRHB 4FXKB 4I0CC 1SXCA 4G7VH 4YK4B 5AQ0A 2ZCZA 1MNUL 4DZ8B 3WFEH 1Z9PA 4G9FE 5EWIH 2VL5B 4PB9H 2V2WA 4HKBB 2C3HA 5L2KE 1SUHA 4JANB 5FW7A 4RNRB 2WQVA 5JOFA 1QBLH 4PGDA 5DFWH 1I1AC 1T6VN 4ZO9A 1T89C 4X7FC 1SNRA 1D5IH 2X44D 3PWUB 3JV4B 3T3PE 4YO0B 3WHE0 4LEOB 1TYRA 2XHNA 2DEWX 1HCYA 3TA3B 4ZMWA 3KYOA 5CFAA 1JF6A 2DL9A 2VLJD 3BEWB 3RPIA 5BV7H 2YXMA 3QDMB 2Q86A 4HU2A 3ETTA 4K94H 2WQWA 4Q89A 5J8OA 2NY4B 1MNUH 4KO7A 4NNYA 2EDJA 3K91A 4BM7A 1FUNA 3WS6C 1YPZB 5AYUL 5IB2B 3WDHA 5GS0D 1H3UA 1ZCRA 1O0VA 2RFXB 2R0WH 3JWNC 1GYCA 3QIWB 3AS1A 4IBVA 2O4EA 3PREA 4HT1H 3JWOH 3QJZA 2C34A 1IKFH 4DKFH 4C54A 4PVMA 3ZBMA 5HHVL 1MCOL 1SBSL 4N5ED 3S36L 4WO4A 2NZ1A 3ZDXB 5LAXA 4GBXB 4Z5RB 4JFHE 1B4JH 3IPFA 5F6HI 5J6GB 4KJPC 5CMAA 2MTAA 4M43L 2APBA 4OQTL 2MH4A 1RUQL 1U95A 2F61A 3DO3A 5DEGB 3F83A 3RDTD 5IJDC 3TA3D 1ACXA 5CD3A 2C9PA 1A6ZA 1UD8A 4Q9BA 3OKNA 3RWEB 1U2HA 3QEGH 4OTXL 4BQ8A 4P9HH 4UQAA 4FNTA 4GH7B 4F3FB 4NC1C 4OZFH 2X4QA 1PZUB 1EO5A 2DQJH 1R5IB 2XACC 4FXLA 4OKVA 1K8IA 1BAWA 3EDDA 3NJIA 3QPKA 3BLPX 1BFOA 1RQ5A 4PGZA 4CN6A 2IWFA 2J8UF 2V5SA 4W9GC 3FT0A 1E6OH 2NDFA 1ZPUA 3II2A 3WY1A 3UTZA 2QVTA 3IE9A 4Z0BH 2VM9A 4N2HA 2YSSB 3GI8H 1RP8A 2X4PB 3AS0A 4P46C 4ZMAT 5C8JB 1L7TH 3EGXA 3OVUB 5DYOA 3EO9H 3KJ6L 4YUEL 1ETA1 2BY0A 3PWPD 3V4VH 5HYJA 3D4YA 2HX9A 3AUVA 3CC5A 3FT4A 4WI7A 2HVKB 1S9XA 4PREB 2QHLA 3GXTA 5IG7B 1F42A 1FH5L 4MNGA 2D03L 1EWHA 1QRKA 3MUJA 3ZRCC 4OJFH 5FKAB 2NR6C 4WTXA 2OR9H 2VC2B 3DHUA 4YOKA 2N1TE 5ERWB 5F7YC 2WWKT 3PUUA 5E8NA 4PY7B 1FGVH 3NPZB 2EXYC 2HJFB 5I1DB 3WIFB 3WLWD 5C0FA 5L4IA 1A3LL 3NJMA 4Y9FA 5GHWH 2C1PB 5B3NA 4EKXA 2EDTA 1MRFH 1RZGB 2FNBA 2OTUB 2X0UA 4K5PA 4TL5A 5TFSH 2GFBB 5JPMA 4Z18A 2CA4A 3F7PC 4X0KB 2HT3C 3RLSA 2BVOB 2P24A 3RGHA 5DJ0A 1AZRA 3TO4C 3C2AL 3BFWA 2XI9A 1JWUA 3JTSA 2A9CA 4NKDB 1EMTH 1E28B 4H20H 3S8FB 1I8KA 3LEXB 1JNNH 4OZHB 1AZBA 3QZNA 4LOUC 5DVPA 2ZWLT 4Z3GA 1O6TA 4HDIB 4JG0H 2E74C 2XBTA 1G9HA 3W0WD 3GUTA 2BDNL 4A2FA 1CQYA 5C0GA 3TCLB 4EDWL 4FLQA 3SPGA 2ERJB 3STZB 1DJZA 2DPKA 2RA1A 1QLEH 3NJJA 3QJHA 2GJ6D 1A5FH 3HC0A 4C4UA 5J57B 1FYTA 4NO0A 3BP7B 2WXKA 1ND0A 1O7VA 3D5OF 4JBSA 1AI1L 1IV8A 3C5XA 3HMXH 3UDWA 4XVJH 4XVJL 2N01B 2PF6A 3QWRD 3ARBB 4F33B 4F15B 3KPSE 5I6KA 4C4KO 4WHTA 1KEMH 4IIQC 1WO2A 3O4LE 1PCXA 3HLKA 4KDVA 3JWNE 1DDHA 3GZOA 3O6LH 4R2GC 3UYRH 2RCSL 3O45B 4J23A 2QVMA 4GP8B 4JFWA 2HA1A 2DLFL 4JY4A 3HPLA 4TSAL 2D7MA 1FVDB 3QAZB 2ZOLA 4Z7UF 5I1HL 1V7ML 4MA8L 5DUBA 1JBJA 1C08A 3P54A 4OVVA 1HH6A 4LK4A 1IGTA 5DUMH 3IRZA 1YC8A 4JREC 3IMWA 4HKJA 1HJCA 4GG6A 1O75A 5D93C 3FFCE 5C0BA 3QIUA 3V0IA 2DJSA 4ZG1A 3JTBA 4ELMF 4DFHA 4HF5H 3N42B 3VRLF 2OQJB 4ZPVB 2DYPD 3S4SA 1OAUL 3M17B 3KPQB 4RDQG 1BXUA 2EDQA 2NR6A 3RL2B 5K9JH 2BZDA 2WTRA 3B2VH 2AKRB 2ZKXA 4TUKL 2GBTA 2BNQA 1UWXK 4B9ZA 1A1OA 1ZSDA 4YXKL 1G7IA 5EU6D 3T4AC 4MMZC 4KUCD 3QEQE 3ROLB 1IT9L 4B3EA 4HMDA 3BAEL 3LRSA 1LEKA 4NNPH 1S7RB 3G9VA 4A63A 2IF7A 3TWCL 1Q9OA 4N2NA 1S5IH 2XFXB 1PY9A 2WXJA 4Y9GA 4Q58C 5LNGA 1BBDL 4MNQE 1C7TA 2L7EA 4DQOH 1JSYA 4GW5A 3WL9B 3CXFA 1H9VA 4DVBB 5T33L 1ZIBA 4R4ND 3ALXA 3H3KA 2Q86B 1EV2E 4MS8C 2DWDA 1NEZB 1PZDA 2GJ6A 1A3RL 4ADIA 5FYLD 3F2LA 4PWGA 1VESA 5K9QG 1MCCA 4M4RB 2ISDA 4I3RL 2HJKA 4FHKA 3VRJA 5KUKA 2YOAA 4W70A 1TQCB 3W1ZA 4HJJH 4JHAL 4PAZA 2DQIH 5DGQA 3PQYB 5F1NA 4ZDHA 4HXBL 4ZNEA 1NFDF 3H9YA 4MJIB 5EIIG 1NDGB 1HXMB 3HE6A 1MCWM 2KI6A 3W9EB 1CLYL 3T1WA 4RA0C 1KCUH 1M7DB 4PY8I 3RWFB 4N25A 3MBEB 3IKCA 4Y5YA 2WCPA 5I0WA 1JVLA 4MGXA 1KEGH 1TFPA 2A73B 1W72A 5B3SB 3UOAB 4KITB 3NIFB 3TA4D 1DANT 4X9HA 3KBHE 4AIXA 5I9QC 1CD9B 3HMWL 4WJ5A 1T2XA 2O72A 3FB8B 3K8LA 3IVKB 3ULVD 4QHUB 2DWYA 1T2QH 4LASL 5I5IA 2CO3A 3GIVB 4U1SB 5HTSA 5BW7C 5HHNB 2B20A 1JXGA 4G1MB 3BT2H 3C8DA 3QIUC 3R0MA 2F7PA 4OCYL 1QFPA 4LKXA 3S48A 1JGEA 3OGCB 1PTZA 3D4CA 3JUYA 4WI0B 3SPCA 1ASQA 2YSSA 2MRYA 2XPGA 5BOJA 1BJ1J 2BNRE 5BS0E 4M43H 5CLWA 3PWPA 3D06A 1IFGA 3DWTA 4YDZA 4LSSH 2OV0A 2A3TA 3WFDL 1X7QA 3MRNA 4M3KB 3FPYA 4MTMA 4X5RA 2BP3A 1AGEB 3K71A 4CMMA 4KPHL 1MHCA 4HW6A 2HWZH 3SB3A 4AVKA 3TTYA 3U1SL 4AUUA 3PV7A 1ONQA 3MV11 4WSKA 3OF6D 3PJLA 5AYUH 3QH3B 4WHDA 4BFIB 1NAML 3PWJA 1ZHKA 5LWYL 1GS7A 1JP5A 2EDEA 4QGTA 5KW9H 1NJ9A 4TSCH 1XB8A 4M6NH 4E41D 1IAKA 2DZEA 2FTAA 4JCMA 3RJOA 4Q9RH 4Y4KB 2Q2EB 5FB8B 3SDDA 1EBAA 1FRGL 5E99L 2C8NA 3MLTB 4X7TA 1CFVH 2GFBA 4H1LB 4U4BA 1C5BL 3Q9QA 5CEXA 3RTQA 1J7VR 1VENA 4NNXA 2ADFH 2JTYA 4JN2A 1AP2A 3G5VA 2NY1C 3FT3B 3K6SB 3ZL4L 1AGFA 4C57C 4N3UA 5DWPA 3WFEL 4I3GA 4CC0A 1JZ4A 1CTOA 5E2VH 3U46B 1DCLA 3BHBA 1JXDA 3QZPA 4LL9A 4N2FA 3WDJA 2WANA 4FI7A 1RVFL 4BK8A 3L5XH 2ODHA 5A2AA 2CRZA 3KNBB 4XPTL 1VFMA 3UAJD 4JFOA 5D7KD 2GTZB 4JO5A 3STZA 2FJHA 1GGTA 5IVOA 3H1ZA 5GGRB 4K55A 3BZ4B 3D51A 4HIXL 5E9DB 1I1YB 4R7VA 1FN4A 2HLFD 3ML9A 4TL4A 2Q20A 2WXMA 3RAJL 3TP4A 5D93B 3SPVA 5B1JC 1CYWA 1EUUA 1T3FA 1WAAE 5DJDA 1FO0H 1RMFL 2NNAB 4RGOH 4EXPX 1JPSH 5FECA 1IEAA 3AROA 1MUJB 1O6SA 5TK2A 2J88L 1RUKL 2Z7WA 4KK8D 4PU2A 3SGEI 4RIRB 4LL1A 1TTRA 4RFOH 3L5JA 4AMKL 5I1AA 4W6YB 5I9QB 5T1DL 4HIJA 1J8HA 1E6OL 4S0HA 3WJMB 1IC1A 2ZUQB 1C08B 5T3XE 1J1PL 3HBPA 3PJNA 5DJAA 3QR0A 5E8DH 4M7LL 1GGBH 2QPFA 4GMTL 4TNGA 2FX9L 2EUZA 3UPAA 3UZVA 2YEZA 2XTLA 4QJ4B 5AKVA 2H32H 5F96L 1EEUA 2WBJC 4JFDD 3CQQA 3SKUD 3ARFA 1F90H 4WGVB 2VSCA 3C5ZB 4JPKL 4ZBJA 1Y0LA 1PIGA 3EF7A 2MIZA 1M9SA 2WTRB 1RPKA 1OPOA 2ATKA 2OXHA 3OQ3B 5K9OB 1OF0A 5FV2A 1CGWA 1KBGL 1ORQA 4UMGA 1DQIA 4LP4A 4G9FB 4AM0Q 2EZ0C 1ZPLA 5A1AA 2JFCA 1U9KA 4PP1C 3CV5A 4DGVH 2WW8A 3WSQL 1M05B 5T1LD 4DJMA 3ECWA 3QJSB 5CUSH 1XSIA 3MCYA 4NFBA 3TS8A 1TZHA 5EUOA 4N2DA 4DPRA 1I75A 5B4MC 3WAJA 4KXZH 4UOQA 4LLWB 1HI6B 1GMIA 5SV4A 3BE1L 4MJ2A 3P9LB 4KXDA 5IEHA 2X6UA 4EO5A 4H0IA 5AKSA 1AQKL 4HH9A 2ZXAA 5EEVA 2XCMC 2FBOJ 3H3PH 2XN9A 2VKWA 3LKQB 1B0GB 2NNRA 4NN5B 4QLWA 4EPSA 3SCMB 2VL4A 2CBQA 4G7RB 4QRPB 4YZFF 3FULA 2GW5A 2Z0BA 5EFIB 3K2KA 1CD1B 3T0VA 2AMUA 3N1QC 4RFNC 4J39A 1BVOA 3L13A 5B38G 1KLFA 4HWBA 4GXVL 1WCBB 2PCFB 4LCWA 2VAAA 1HILB 3DHMA 2EDMA 4ODTL 4MAUL 1MHEB 1NC4A 1CIUA 3HFML 4FMKA 2CJTA 1OVZA 5DLML 4BINA 4OLUL 3BLKA 4CW1A 1MHHB 2BOCB 2CWRA 5IIEB 3VXTA 5HVHC 1R24B 4R4FH 4YIQA 4FQXA 4QY8A 1F45A 5CEYA 4KI5F 2JXMB 5E1HB 1P4IL 2TSAA 3LSOB 3LH9A 3DRTB 1EO7A 4JCLA 4MNHA 5C0NC 5HDBE 3ZO0A 3FZUD 1QBMH 4RH4A 4YX2H 3I84A 3T2NH 3AGWA 4YXHL 2A77L 2BJMH 2A77H 3MBWB 1NMCB 3KVPA 5FWRA 2VLJA 4K5LA 4O58H 5D71L 4IGBC 3ZHKA 3SPHA 4LEEA 1U3HA 4PRDB 1JAEA 1S5HA 4X4KA 4AG4L 4M9OA 4XRCA 3BP4A 2D0FA 5HHOB 5BXFA 2O5YH 2ZOUA 3DIFB 3UAAA 2WN2A 5KSBE 2NT1A 4NRXA 4P46A 3N91A 3GMRB 3NK3A 1BVKB 3BVTA 1VIWA 4X8JA 1FNGA 2YC1B 3EH2A 4QXUH 4L4TE 2GTWA 3EHBC 4TUKH 1XH2A 4JVPA 4O4YH 1E9QB 5EBLA 5HDRA 4ZYKA 1OCCB 3O4OB 4XXWA 4GRWE 3LXUX 2PABA 1SLWA 4LLVB 4O58L 2VZTA 3CH8A 4KHTH 1J86A 2EE3A 1OQOA 4YBQD 4F92B 4H8QA 3DX4A 2BHYA 2Y7QA 4KDWA 4MJIA 4UIKL 4PJGF 3G6JA 5E51A 1MRFL 1KIPB 4DKAA 4ELKB 3LDBC 1IAKB 1G7PB 4YVUA 5EPMA 1FP5A 4KTGA 3VFMB 2O5YL 4Q2ZB 4U3HA 1CCZA 4P3CH 4ENED 1IC5L 4QRTA 3NIFE 4UYQA 3LN9A 4QHNA 4AV0A 5DJ2B 3SE4A 1BD2B 2AZUA 2GI0A 5IMKA 1FFNA 3QWOA 3U6XA 5BRZD 4UZGA 2IXQB 3CFCH 3VXMD 2P80D 1DL7L 1KC5L 1BXAA 5ETUB 1N4XL 3TIDA 3UCQA 4OF0A 5ESQA 3CZJA 3NESA 4P2QD 2VDPH 3HG3A 5BUGA 43C9B 5LGKA 4NJAH 1AO7D 4E68A 3APMA 1GYUA 1LHZA 1XF3A 2F6AA 1MIML 1V10A 5D1ZD 4P2CG 2HG0A 2EYSA 3M86A 4TSCL 1M3IA 2BCMA 2IBGA 4ODUA 4GRLA 5ITFB 3GEWB 5BMFH 3GXMA 4LSUL 4A04A 5KSAB 2G2RA 4PR5A 3ZE0E 3MV7B 4FQXC 3MUUA 1MCRA 1T80A 1HAUA 2O5XL 2GEEA 3O9WD 3T1FA 3TNMA 3B34A 4JB9H 4NZUL 5TDPB 1MFAL 3P3TA 4W9EC 1F4XH 2HRLA 4HXAH 4NLHA 2ETWA 3BXNB 1D9KD 4Q97A 2PTUA 5AAWA 1KXTB 3FO1B 4N85A 2P48B 5FYJD 2JNZA 3MV9B 5TDNA 1U3HC 4Y2OA 1XMWA 3DTXA 2PCXA 1CK0H 3D1MC 1Z32X 3SGKA 4M6ML 4N3TA 1R3JB 1GIGL 3VFNB 1JJUA 2A83A 3IU3A 3OZLA 4IEFA 4NUGH 4KKLD 4IBYA 4LCWE 1G9MH 1U8OA 2F7QA 1NSNH 4F9PC 3I9PA 5HPMA 3MOAH 2O5XH 5JW5B 1T7VA 1HSBA 2B1HH 2Y5TB 4C58B 3CXDL 3QO0A 3J7HA 3VX1A 4EN3C 4XN9A 2VLRE 1XF5B 2OMVA 4NO2B 3U1SH 1CDBA 5E1QA 4YWGL 5L6YH 1XAUA 1WWCA 4A7SA 3BVDB 1WFUA 2VLKB 5HDQH 3UTSA 2VDKL 2EUVA 3QFJE 5K9OA 4J3OG 1GIGH 4M7ZC 4XOBA 1CK0L 4EIUA 2X38A 1KCRL 2EDDA 4ZW6A 1KBKA 4MAUH 5FXCH 4RGND 2XJLA 2WOYA 5EBGA 1G5AA 3NIGF 1M1XB 3NACL 4UZSA 1N0XL 2XWBB 1EDHA 1K4CB 4EN2A 3KBPA 1H8LA 1XZ0A 3ESOA 1PLGL 3IJSB 3SGEH 1IGJA 3L5IA 1EHXA 3C2SA 4HEPG 1S8DB 1VZHA 1SMOA 1DO6A 4HH9B 3MJGX 3MXVH 4LPVA 4Q0XL 1AHWA 3MLZL 3MGOA 3P9WB 1INQA 1CBVH 4PGEB 2V17L 3BKMH 3BWZA 2LTQC 4RFOL 5FOBA 1AJ7L 3WXVH 2NSXA 5DD6B 4N2BA 4Y2NA 3WO3B 2J88H 2VR3A 1MN4A 5ID1B 2CHNA 4XN4A 2IIJA 3OWEA 4LGPB 1M71B 2FX8L 5C0JB 2XN9E 2JJVA 2W91A 1U91A 3LTVA 4OQTH 3ZZQA 1AD0A 2DMBA 4QRSB 3AWEA 4JRYA 3CVBA 4CADA 5BZWB 4AXWB 3OLDA 3LB6D 1Q0YH 4NXSA 2VZUA 4BFBD 4JY6A 1JF5A 4L1BA 5SWQA 1QP1A 1EGJL 3BP5A 3QQ4A 4OCNC 5DJXA 3T8XB 1MW1A 2WGNB 2CSPA 2X1QA 3IDNA 1ETB1 1ZA6B 4H8WH 1O7SA 1F8TL 1ZSHA 4WI2A 3UX9B 2EUXA 2Z7ZA 3LS4L 5ELIA 3KM1A 4A6YH 3L3IB 5CJOH 2V37A 5EU3B 4IU3B 4KVNH 3SKJL 5FUZL 4I5BB 1VFAB 4APQC 3NQIA 4PB9L 1ZK9A 3FB6B 2DICA 1YY9D 3L9YA 2UX7A 5MP6H 2UXGA 4LRNH 3ZKMC 1XF2B 3CMGA 2QQLL 4ZAKA 3ET9F 1SDYA 4FLRA 2W0KA 1AI1H 1YYLH 3K1DA 3LDBB 5CCHE 4FLOA 4JHVA 5CP7B 3VNZA 1CMOA 1XWVA 4GQQA 2BSDA 4QXVA 2HT3D 2YMXH 1LGVA 1WUNT 4Q14A 1GXEA 4NZ8A 3KXFB 4RAUB 3GHPA 2CXKA 3KPNA 3U4EA 1CN4A 1E9OA 4G8GB 3QRGL 3R06A 5EO9B 2APTA 4ZYKB 1IZKA 2XWXA 4XNZB 2J2ZB 1UKTA 4FG6C 5TGBA 3QXAA 3HW7A 5KSBA 4N2EA 4DHLA 3QI9D 3MCKA 2HTLC 3RRQA 4LQFH 1Y1DA 2NXZD 4EZLA 1E27A 3S34H 2LFEA 2WYZA 3VU2A 1MVUB 5INCB 3IGUA 4P23C 4IBWA 5IGXH 5FYKU 5AYTA 1UXMA 5FCUL 3JBG7 5CCKH 3NP4A 4O9HH 4UM8B 3LMJL 5AVYB 5IVZB 5EEWA 5MENB 3EJSA 2JI1A 4Q2ZA 4XOAA 4UT6H 5AB0A 3T77A 3FKUS 5SWSA 4PJIF 4RWHA 3G6JE 3QFDB 1UD5A 2P5EA 2YA0A 2DQHL 3QSKB 2BMKB 4KXCA 1BJMA 4KK5C 5LXVA 3MA9H 1M7UA 2CA3A 4LLUB 4Y5VB 3VGFA 1LE5A 3I6SA 2OCCB 4ZTOH 1E4HA 5CD5D 4NO3B 3H9SB 5KS9B 1PCSA 2KZWA 5DS1A 1Q9LA 2FLRT 2ATAA 1AGBA 2IDQA 3L81A 4U05A 4E9XA 4K0OA 4NM8L 1G0DA 2QHRH 4JJOA 4YDKH 4ZTPH 3FSOA 2HLAA 3MO1A 5E2JA 1ZHBB 5IGXL 4MVBD 4POZC 3VMPA 4GRLB 5DS2A 3D48R 2ZCLL 4IOSA 1WIPA 3MLUH 3HG1E 1NDMA 4L9DA 5GS1C 2FWSA 5KVMC 2ZKHL 2YN5A 1ACCA 3ULUH 3O0LA 4KNTA 4WF7A 2XRAH 3FT2B 4TUOB 3I75B 4MDIA 4HHAA 1RZPA 5B1JA 1MAML 3T0AA 4XN2A 1BAFL 4DKEL 3QA3A 4A7GF 4G70B 5GS0L 1DHKA 4HPYL 4X6FA 1I85C 1TZGH 1V7MH 2OXGA 4MA8H 5F7NC 1E3FA 4F20A 3L3GB 3RIKA 1RL1A 1AD9A 5A2KH 4PBDA 5J6GA 5INDA 4EUPH 3MRJA 2W92A 4LBEB 1H3XA 5CD3B 1QFWH 4WEMB 4KZDL 1A7NL 2GG1A 4NFDA 3BGMB 1HSBB 5D1QD 1R3IL 4J27A 3RIAK 4CSTA 4NWTL 2J8HA 4PIRF 2Y36H 3DROB 2HSIA 1J0ZA 1P5VA 2J6EH 2BVYA 2E7LA 3BPOC 1MREL 2I07B 5A3IC 3FN9A 4PP2A 5J6HA 2QZQA 1L9PA 3FQUA 3PAVA 4AQEB 4P23A 3UGUA 2MOVA 3CVCA 4OJEH 4OY9A 2P4AB 1ILUA 1JPGA 4AK2A 2K6WA 4DO4A 4CRPA 5DHEA 1XGQA 4GAYB 2EE9A 3T3PB 2Z31A 5DI8A 3FRPG 5DZLA 1WE5A 3MLRL 1HWGB 2Y3AA 2NY4C 4FTVA 4I4WA 5F1KC 4ZXBC 2B16A 3NG5A 3MJWA 2P52A 2DQJL 3ILEA 5FDYA 3KPRD 2HVKA 1FVCB 3GSOB 3N44F 4LPCA 2OMBA 5EEZA 2JKWA 1KIUB 4UAOB 3WENA 2YKLH 1AHWB 4U6VH 5DJ6B 5CSBA 3TFKD 5FO2A 5K1JA 4GAGH 3O41A 5LG6A 2BERA 2UZYA 4HWEL 4HC1H 1CLOL 1FBIL 2DKMA 3PWNB 4HC1L 4HUWB 4XMUA 5DTFB 2EH8L 4ZOEA 3ESMA 1QRNE 3OAZK 1NFDB 4IBZA 3C08H 2V6HA 3MJ7A 3CE1A 4WI5A 5LHDA 3VXMB 4GSXA 1MIMH 3Q1SL 3TBWB 3VB9A 5JLZB 1NUNB 1BD2D 4JMNA 2DIJA 4G71B 2G9HA 4PJXB 4QTFA 2BVOA 2P24B 5TH2A 4HS3A 3EG9B 3OAUL 2E9JA 4JRFA 3O4LD 1ZJBA 2C4FT 2P49B 3FBKA 3WKML 1NBCA 2JH2A 1BMWA 3Q5YA 1QQDA 3NCXA 4AMWA 3FYIB 3HHMA 5E5UB 3S35H 4KX7A 5E5RB 1J5IA 4HJSA 5IFHL 3VFUB 1QTPA 1JZEA 4P2QA 1V55B 3QULA 2V17H 3EF4A 4IU3A 4JO3L 1ZVNA 3DHPA 5C0GB 3RPKA 1R6VA 4UU9B 1RVFH 5CJXC 1E4KA 1CFMA 3KPOA 4WK4B 3SKNA 5FX3A 1S7UA 5A2BA 3TOPA 3VD2A 1ROCA 3OZ9H 4HALA 3FT9A 4R3SB 4G43B 4G83A 1HQ4B 5ACLA 2LR4A 3HE7B 4B97A 3BAWA 2I32A 4LDOB 2CHDA 1NIFA 5HHOD 1NCBL 4JHUA 2UYLB 2IGFL 1YEFH 4G7QB 4U1KB 1ZLWH 4OTXH 3MJ8B 3UBXI 4DUXA 3DURA 4Y2LA 1V7NH 2PW2B 5FUCC 4CC4A 4ZFGL 4UCFA 4ES8A 3LRLA 2AQNA 4QHPA 4K9EC 1WYJA 5EU6E 2AITA 1CR9H 4ADJA 4G82A 3PHQB 4BSVB 1XD0A 3WE6B 4X99A 4YHOL 4Z7NE 2J2ZA 3K46A 4M61A 1YEEH 2CKNA 2PW1A 1PJWA 3TCTA 1HHHA 4N9OB 2XICA 1J9TA 4HKJB 1BFVL 4ZUWA 3FU7B 1B4LA 2VWEE 3LRKA 4OZIA 2ZKHH 4N6RA 1QA9A 2Y0SA 1HDMA 4G9DB 2EH7L 4EBQH 1OPGL 1BEXA 1L7TL 5GGQH 2WBXA 4G8IA 4AYFA 3VB8A 1XCTA 4Z7UB 5F96H 2YAQA 2V3EA 2R0ZH 3KLAB 4H0LC 4YDIH 5DD1L 3NRFA 3VFWA 4DVRL 2DLTA 5C6TL 1N4XH 4DP1X 1X9QA 1G9MC 1KLUA 1A1OB 1ZSDB 2UX6A 4G6KH 1DEEB 3P9MB 4WNQB 3QRGH 3QR1A 4N8VG 4X6BB 3PHAA 1DFXA 3B7YA 3OXRB 4P59L 4CN4A 5LQBH 4PRAB 4UAOC 4GG8A 3DI3B 1SLVA 3SO3C 5I1CH 3A4FA 2H8PB 3CZNA 5DU7A 4W6XB 1MWAL 2EDWA 5DT1L 1ITBB 4BHUA 4UINH 4YSRA 4GLRI 2LABA 5CCKL 1LTXA 5E4EC 2CO6B 5B21A 4DUWA 4J6RH 3CZFA 4AYDC 3II3A 3TVMD 1KOAA 3K74B 5FYJU 2HG5A 4LNRB 5M94B 1JFQH 3BVUA 3PCYA 2QTEA 4JM2C 4HUUB 4NWUL 2OZNA 4UIMB 5KG9B 4PTUA 1I1FA 1P7BA 1P7QD 3EOTH 4S10A 3HN3A 1GSMA 3MACL 3MRDA 2MHAA 2OP4L 1F6LL 1USZA 5DQ9A 3MYJB 5IT2H 1JGUL 3SGKC 1UJ3B 4X5QA 2AEQH 4DP7X 2RGSA 4HZ1A 1TQBB 2IGTA 4FNLL 3ZYIA 2ZUQC 1LP9F 2QLYA 3RGVC 4OD1H 1AKJA 1I8IA 2COVD 2J57A 1ULVA 3ARDC 1NOAA 3AABA 2Z92A 1MRCH 4NFCA 5CP3A 5LGYA 1AVAA 2X1PA 4PIBA 5EULV 2IPTH 3W5MA 2OJEA 3ISWA 4WJG3 1KB3A 1YN6A 5F7MC 3F04A 4QRPD 3QRLA 1O5DT 4PJFE 3V10A 2IADA 3Q06A 2K4AA 3HHSA 4K07A 5JMOC 5LNDA 1SEQH 2NCEA 4QTHA 1M2OA 1GW0A 3BN3B 2Q8BH 1TJGH 1QMUA 2VM3A 4I87A 3U1QA 1YNTB 4QYAA 3OJMB 2XPGB 4LL4A 5C0RL 3TPKA 2NY3D 3VWKD 4X9GA 3IDGB 2Z31B 2FD6H 5JR1H 2ICES 1SM3H 2CDGB 3GZQA 3Q3GA 4PCKA 4PJAF 2W07B 3DX6A 2PXYB 3JVGC 5F1IB 1PIFA 4XT1C 5IB3B 1QLFA 3QUYD 4KKAD 4F8NA 5DJZB 3RVWD 2VDMH 4WEBH 1AJ7H 2FGWL 3TVMC 4M00A 4AK1A 3SDXB 4KHXL 3KJ4C 2VWEC 1UXWA 3C5SB 1MHPH 4HMCA 1U8CB 4PJDE 3DLQR 3VVWA 4XMLL 4RFEB 3KPRB 5ILTL 4JPVL 1PZ5A 2GY7B 4HJGB 2VQUA 3RGBA 1PKOA 4R5XA 2H0FA 3ATFA 5AZEH 1KY7A 1OGPA 4OZIE 4WFGE 2B39A 3BIBX 3J27A 2OMTB 3EO9L 3MLWH 5TH2B 1H6FA 1R3IH 3MV8B 4Z7QB 5CEXB 3QI9B 5GXBB 2XA3A 3EJJX 4ICXA 4OZGA 3IBOA 2R9HD 3BKCH 3ZUCA 1ZT1B 3IDMA 3LNDA 2GSGA 2GEQA 2JWYA 4RWYH 3DARA 4IIQA 4J6IA 2V9RA 3GI9H 4GAJH 5I23A 2PYFA 5CILL 3C5ZC 4IKIA 3VFUA 2JKLA 1DLHB 2QQNH 3S3DB 3CDGB 1G7HA 5F89B 3QEQA 3ZDZE 1FDLL 4G6MH 1OGAD 4XMXA 2J8UA 4EUPA 2FJFA 3LZRA 2ADYA 3OJDB 3RGVA 3DMMA 2H6PB 4GMTH 1TFHA 3TBTA 2WO4A 1OSPL 3GXDA 4FQLL 4TULL 5JW3H 1AKPA 3F64A 1PQZA 4KX9A 3JZYA 2ZQKA 2ZX6A 3SPVB 1BBJA 4PJIB 4U7MA 2QPEB 3AXIA 2EDBA 4PWIA 1P1ZA 3STLA 3T4AB 4ISVB 5F93C 5FO8B 4UQDA 3BKCL 3PQYE 4DP2X 1HZLA 4PH8A 4RAVA 5FECB 5I75B 1E65A 4AKOA 4KNSA 1B0RB 1WA1X 4A7UA 2VDQB 5CSZB 3DXAA 1VSCA 4G8GD 2CGRH 4WFFE 3OPUA 3B2XA 4U1GC 5IW1A 4LLYA 1A1MB 3O8XB 4L23A 1I9RL 4JO1L 2IOIA 1YA5A 1INDL 1KTCA 3OKDA 4HA1A 4OV5B 2VNCA 4ZUWB 3OZ9L 4JFXA 5J13B 1Z66A 1CI3M 3VTTA 1YNLH 2VABA 3BJLA 4JFQA 2GSMB 4F7MA 4UT6L 3VXSB 4HULB 1KXHA 3F05A 1DZ0A 1YMMD 2B1HL 4U6XB 4Y19B 3FN3A 3OG6B 4MJID 3BGAA 1KJ3L 2FEEL 2FO8A 3L3KA 2O1AA 3EFFA 2N7BA 2W8CA 3WEOA 3WHE1 5I17B 4JJHA 5EOCH 1D9KC 1XZWA 5TE7L 5CWSA 1SDAB 4IRJD 4JHWL 3RKDC 1NMBH 1RJYB 3HAEH 4R96A 4ZMOA 4JFYA 5KWYC 2FR4B 5DJCB 3HZKA 1M56B 5DK2B 3PHOB 1KTJA 1OGTB 1BGXH 1DSYA 1ADQA 2EEAA 3L3OB 4JAMB 4F7KA 5IW6B 1IE5A 4FL4C 5KYUB 1EH9A 3SQOL 2BP8A 4MKMA 2G30A 4LLWA 5CEZD 4ONFH 4J2QA 4P0DA 2CIIB 4QMEA 2ZP9A 3QHFH 4N20A 1R0AL 4ZS7L 3RE0A 3DVIA 4K8RH 2QQKH 4H44C 2PO6D 3RY4A 1RD6A 3JWDC 3FB7B 4IBTA 3KGSA 4Z3HA 1QHPA 3HCVA 1T5XA 3LKQA 1LO0H 1JHTB 5BRPA 1PLBA 4JPQA 1OE1A 4RMTA 1HHIA 2GT9A 2GITA 2HP4A 5D7IB 5EU6B 3UG5A 1O7DE 1QBML 1ZTXH 3MCG1 3ARUA 3DMMC 1OD9A 5E2VL 1A5FL 3AZUA 2L7JA 3GSNH 5HJ3B 2ORBL 3MRDB 3MXWL 3POCA 1WITA 3BQUD 4FQHA 3HUJA 5D7JA 2HTKD 4HCRL 1UQSB 2A6JA 4ODHL 1XAKA 4MWFB 1U2YA 1IC7L 3CPUA 4MD4B 2WKOA 2EDXA 2QEJA 4KK5D 3L95B 1A6TA 4G6JL 4P3CL 2IQAB 3TV3L 4AW7A 1KJMA 3O6KL 1CGVA 4WHYG 4JGNA 1RY7B 3D39D 5DVNA 4UUJA 4U33A 3AU1B 4Y7OC 5C9KA 1MI5E 1YN6B 4XC3H 1T6WA 2ZJSL 2ZXGA 3KR3L 1J5OH 3FRPA 5JPNB 2KL6A 1VRSA 4BBWA 4JDEA 1GY1A 3HS8A 1JTTA 4D8PA 4OLUH 3SZKC 1CLYH 2YD5A 4ZFOB 5BXFB 1CLCA 1D6VL 1NCWL 4GKNA 4KKZA 1LD9B 1DQJA 3GSXA 1FZKA 1XGUB 3VXPB 2GIMA 2CRIA 1AQDA 3VI4B 3GMRA 2PTVA 4MMXA 5I1IH 4PJCB 4Q52A 3S3BB 2A6IA 3VXME 3M6DA 3SDDD 3IXAB 3DETD 3SOTA 2PXYA 3UPCA 1KZYA 3RTQC 3SN6N 1TSHA 1E9QA 5EBLB 2VZOA 1L6ZA 4XWGL 1F2QA 3S96B 4K15A 4MHHG 3MLSH 2CLRA 2D8KA 2OL3L 4FQCL 4LPWA 2HUHA 2Y1AA 5ADOL 4KI1A 2JK5A 5HDLA 1G7JB 4Y4FC 4XZ4A 3QUXB 2IALB 4ONHA 2BW5A 5DHXB 4ELKA 3T0EA 4K7FB 4PJ5B 3UTTE 4FTDA 1OPGH 5CS7A 4WWID 3CBKB 3PLYA 4PFEA 3ZKMD 3MV7D 5I1IL 3BWUF 1Z2KA 3OMIB 3A21A 4JKKA 5IB5B 4RBPK 5G5DA 4NQDD 3DVGA 4PJAA 5IV2A 1DUYA 1KBPA 2VR5A 1QTYT 5D55A 1A6PA 3T65A 3D33A 1U93B 5GGSA 4E5XG 5D7JC 4N8UA 2OMYB 5E00A 1U30A 3IMRA 43C9A 1KZQA 4RZKA 3N40P 5C3IA 3VFVA 1FNAA 2RACA 4OI9A 3JWOC 1MHPL 3OAYK 2ZOKB 4J3BA 4QHLA 3ULUE 2OYLA 1KEGL 2CCWA 3CCHB 4JO2H 4PLNC 4QHMB 1IILE 4HG4K 3BEWA 3ARBD 1XGPB 5T5FH 1OB1B 5D7LE 4FFYH 5T3ZL 3LOWA 3PDDA 3MKKA 2FX7H 4GAFB 2WWOA 3FMGH 2HT2C 1SM3L 1YSOA 5GGTH 1L5GA 3QFJD 4Y2DC 1BECA 1FPTH 4F58L 1UXSB 4FOMA 2UZXA 4PRNA 3RA7L 5AZ2H 5BQ7A 3FT1A 3NCJL 3UCRA 5AOJA 1SY6A 4Z5RA 2OMXB 5DVMA 4CMHC 1PX3A 2I27N 1P4LA 4XCFH 5DEGA 5JHDB 1RHHB 2DQDL 4NGHH 3OAUH 3JVFC 4AYID 1C5BH 2ZPKH 2A1WH 2Y5TA 2QQKL 3D4GA 3EOAA 4NLAA 5BV7L 2DJMA 2VLMD 1HINH 1YRKA 2OMWB 4NO2A 2DIBA 1JUFB 3II1A 3KYNB 3NSFA 5T5NF 4BFKA 1QLRA 4MFHA 1SGKA 4ZX4A 2WLLB 1HSAA 2WP3O 1EHAA 4NC1E 4H8WL 2CU9A 2E6JA 1GY2A 3AXLA 2ZUSA 1BQHA 4LVOC 4M6AA 3BKYH 3LV3B 3V6OA 1O9VA 2XETA 1VFUA 3HAEA 5C8JA 4P2OC 4ZUUA 4IK7A 4OFQA 1QI4A 2DM3A 4MCNA 2NUPA 3O6FD 2WINB 4FLSA 2E47A 3CC5B 5HYIA 2AV1A 2AZAA 4HIHB 2AFNA 3BSZA 3ZIYA 43CAB 5F88A 5I0XA 4N8VA 3BDYH 1ZWIB 3NABL 5D1QC 5GRJH 1F13A 4AT6A 3HCVB 3BO8B 4UV4H 1FVEA 1UH4A 4L2LA 5BO1L 1SVCP 1FZMB 2OYPA 2HT2D 3SGJA 5ICZB 1IEBB 4WO4D 3E38A 4HS8H 1N7ML 3D9AH 5FM5O 5IEKB 2CGRL 4YLCA 4M5SA 1D5XA 5D7JB 1KENL 4TVPL 1OAYH 2I9LA 2JB6B 2Y7SA 4S11A 4N0UB 1QFWL 3UBXG 1IC4H 2AEPL 3WOVA 4EI5A 3TV8A 1JRHL 1Q1PA 3GYRA 4DOHB 1KYDA 1KJVB 5CJQH 3B9KA 1OTUD 4W9KC 1KIQA 1WS8A 1CDUA 3ZE2F 3BRGC 2W9DL 3BUPA 4E42B 3WXVL 3L3IA 2EYTA 1F3JA 1VPOH 1CLZH 1EIBA 3TCLA 2Y2TA 2QFRA 1I7UA 1A65A 1J11A 3NUKA 5HD8D 3SZ6A 5BPPA 2R0KL 1FFPB 3JV6A 1NCHA 3WHXA 4MCZA 3NP3A 4UTBH 1ND0B 5D5MF 2VO5A 1J1PH 1U0QA 3BPCA 2CALA 4OCWH 1OSPH 3O2WH 5D6DC 4AMXA 2IOMA 4F37F 3V9FA 2CUAA 4FE9A 4AW4A 2ZCHL 2AEPH 3QCTL 3KE0A 4Z78B 3KJ6H 4YUEH 2IH3A 3ZOAA 3MVSA 3SOBH 4L3FA 3QIWC 4MA3B 1AQDB 1MJ7H 5DZNA 5KOVC 3G5XB 3U2JA 2NY5C 3FCBA 3ZE1E 3CK0L 2P7TA 5JZ7D 1AZVA 4X4XA 3U4EB 4FCAA 3R06B 4LGSB 5B38A 1FVDA 2VDKH 1OAXL 2ZOLB 1PG7H 4XBGB 1N5YL 2FATH 4IRZA 4CL7A 3NJFA 4XVSH 4NPKA 4EQ2A 3LKSB 1TYEB 3KWXA 5EC2A 2EDHA 1KTDA 2F5AL 1M7IA 2X6VA 1RIHH 3FO9B 4ZO8A 2YAEA 4WO4C 4LT7A 1HC1A 3LHPH 1NCCH 2XA8L 3HMXA 2F15A 5KVFL 5EZJA 3R8BB 3TYFA 3X3FH 3KPQA 3Q2WA 3V52L 1A6WH 3C8KA 2OYMA 3GMOB 4JM0A 3FFOA 1JYXA 2BNQB 2X6MA 4LU5H 2BS8A 1WZ1H 3QFJA 1YAIA 1ZV2A 3P4OB 3QGVA 5L2JB 5G4NA 3T65B 1OAKL 2FZ3A 4QF1A 3BD3A 5MI0B 3OAZH 5DR5H 1SEQL 4WV1A 3V5KB 2YPKA 3BPOB 3NH7L 4C59B 4A7TA 3T4YB 2CM6A 3L3JB 4K5MA 1HOEA 4PWKA 4G6FB 1K5NB 3US9A 4ZFFB 4IRSC 5C0RH 4JN1H 5EO1B 4KC3B 3LXCA 4Z7WE 1EXHA 3MUGB 1CL7I 3U7AA 3RHWK 4P2RD 3NCYP 3QDJB 1TIUA 4I18A 3W9DA 3NCWA 1YY8A 4JZOB 1BBDH 4AVIA 2EC8A 4OM1H 4OM1L 3KEDA 4N2IA 4FG6D 3QB7C 1MCJA 2VW7A 1I4FB 2DLGA 1A6UH 2KZBA 2Q0ZX 1RUPL 3RDJA 2F08A 4M4RA 2IAND 3JWOL 3P69A 1HIML 2UUDH 1S3RA 1QRNB 4FA6A 4HWZB 4GIOA 1IQWH 4LPXA 3DUSA 4OUUA 2CKBA 3GMQB 4QRBA 3WEAA 2QGCA 4PUBL 3HE6B 3HG4A 2VDLL 4X6DF 4UI2A 1ZS8A 1NZRA 1P4LB 2VRQA 3E1ZA 1QI3A 5I6OA 3HJEA 3AITA 2EE6A 4LBEA 5IT2L 3IDIB 1I8MB 1YCSA 4NP4L 2HKFL 2WPGA 3RY5A 1OAUH 3RVXC 3FCTB 1S7XB 5C09B 4WJKB 2FLBT 4JRXB 1I7TA 4UBDC 3RG1C 1KJ3H 2OMWA 1RERA 1JUFA 5ECJE 1TQCC 1CGXA 1HSAB 1UB6B 3IB4A 1GCFA 4G3YH 3FQUB 1JV2B 1TENA 4XPAL 3HNSH 5DDHA 5AUMB 5LQBL 2ZYIA 5TF0A 3GJFA 1ILSA 3QS2A 4ZMXA 1BD2E 5ID0B 4ZUSB 5I71C 4XMKL 1Y6MR 4FXTA 4H13C 5JIKA 4BZ1H 1J18A 4S1QH 5ITBH 3HAEB 3MODH 3DV6B 2XZZA 1IGMH 5JLZA 4AOFA 1X7QB 3D52A 4NZRL 3F3HA 3L1FA 5KVDL 1E4WH 2YPVA 1MCHA 1VAHA 4NJ9L 4PS8A 2CBPA 3LEVL 5AVQB 1CGSH 4PGCA 3TO4D 2IPUG 4IMLB 5DK0A 3QCUH 4N8VB 4NN6B 1PBYA 4BFIA 1RK1B 4XAWH 4XP5H 4ELMB 12E8L 1P0SE 3PWNA 5DTFA 4GS7B 4ZX3A 5J4MA 3HZVB 4J4PD 3OHMB 4KNUA 3DRQA 4I18C 4GQZA 4XB3A 2GBVA 4Z77A 2XZCH 3IE4A 2HFFA 3VWJB 4TOYH 3L17A 2BVUA 1CVSC 2KKQA 2YAFA 2WIMA 1CU4L 5ENWA 1D5ZA 4YHNA 2VDRB 2Y23A 1DBKH 5A3ID 1OD7A 4ORGA 1BOGA 4DW2L 1RKRA 1MJUH 3VA2C 4KXAA 2R2EB 3QIUD 3MRFB 1Q1JH 3BHBB 3LD8C 3K72A 4HUNB 1MIEH 3DBSA 3I85A 3UO1H 5D1XB 4OI7A 3ZMEA 4PJCF 4C56A 3QDAA 5FYJL 4FFWC 2R1YA 3ECVA 3JV6B 2NPLX 3RX7A 3BZ4A 3NFSH 5AVUB 3L4ZA 4Y4HC 5IOPB 3DSFL 4U7KA 1R3LB 1KXVA 2IG2H 5CEZL 2IH3B 2MKLC 3Q2VA 5I8CB 1XR9B 2G3MA 1LK2A 2PWHA 2L7QA 4LVHC 1G94A 3GBML 4RMWA 4M7JL 2VITA 1A4KA 2IOOA 3NIDE 2LT9A 3CIQA 4MMXC 5JHBA 4JFEE 5ALBH 2WSDA 1MXDA 4X99B 1I9IH 3I2CL 4GW1B 4HIJB 1KFAH 1G9NH 3WJMA 5JW4N 2AW2A 3RIAF 5SX4H 1G6VK 1LEGA 4YHKH 1DP0A 2AXJA 4H26B 3WLBA 4QO1A 2VO8A 2O5ZL 2NYKA 4WGKA 2OSLA 1K5WA 3VDCA 1P84K 2XYCA 5F6HJ 1DBMH 2JELH 2QFPA 3MA7A 3MBXH 2XC8A 4K3DH 3EJZD 4IBSA 3VXSD 1U3JA 4NQED 4G8IB 5J6SA 3MRQA 5AYQA 1BIIB 1Y0LB 1XCTB 4AUJA 2R29H 3MNVB 3QXDA 4PW9A 3QIBA 2C3GA 3VFWB 4YSAA 3F7QA 5HYSG 1GOGA 4A2EA 3HI6H 5L2JA 1TKWA 3BVXA 4CSZA 5JIHA 4YPJA 1QO3A 2HRPL 3MR9B 4RAHA 3TZVD 2GUOA 4PJEA 1TYJA 3L3JA 2CCVA 2ENJA 3M8OH 2A4ZA 3SDCA 4HLJA 1OGSA 3X1NA 2Y72A 3MLYL 3MNZA 4O02H 5IEHB 3M1BB 1J05B 4XPFH 1W6WA 5KVGL 4RQQB 2DQEL 3BGFC 3CZFB 3RZCD 3FW6A 1UWEH 4L4TD 2WWKO 1SOSA 2XN9B 3HHRB 3TPUA 1UZGA 3BP6A 3NZ8B 2XSKA 1CFQA 1P2CA 3BOVA 3GJEB 3L1GA 1G7QB 2ID5A 3L3DB 4LDEB 5DRZA 2J4WL 4KRPC 2DB8A 1QRNA 3FHEA 1H8OA 4HWZA 3QJRB 4X7SH 1QG3A 4OLEA 3B7UX 3ZDXF 3GMQA 5H35B 4GXVH 2ZG3A 3WMPA 4BWTA 3MZGB 1NPUA 4OB5H 4PJHE 4E9YA 1L0XA 3CSTA 5EA0L 2CBTA 2WNGA 1YEHH 4ZPTB 4R6UA 5F9WB 1MHHA 3B43A 4P57B 1LLAA 35C8L 1NM9A 1A6VH 1P4UA 3BH8B 5LO7A 3ARGA 1U8KB 3HBQA 3FCTA 5C9JA 2Z92B 1OT2A 1ZDQA 3FH8A 4XHJD 1T66C 3F62A 5JXEC 5DS8B 3K4DA 3RP1A 2OJEB 5EZOL 1N64L 1X9UA 4P2QE 2XQYG 4M48L 3F65A 2ARJB 4N6QA 2J73A 5B4MD 1TCRB 4GFXA 1BP3B 1YMHA 3FU3A 4ZOAA 3RNKA 2FWOB 2B5IB 4ETQA 5DZPA 4LCVA 2QV2A 1VDGA 1S7SB 2PP8A 4LCCB 5IROD 3ETSA 2AERT 4LFHG 3ZHFA 3E2HC 2DQTL 4P46B 1HAWA 2HFEA 4X8XA 1MCPH 4MX7B 3FT4B 4UILL 1BF5A 1C5DA 5KTEH 3H2PA 4Q4IA 1R3KA 1DQTA 3AW5A 3DPBA 4L18A 3IJHB 3D30A 3BUYB 1RUPH 2VUKA 4JFEA 3WTYA 4U6YB 5LBSA 3ARSA 5E2UH 5A2JH 2F54E 4QNPE 4DEPB 3GBNL 2RB8A 1TOXA 2ZWNA 5DURD 2VGLM 4B7LA 3LZLA 4HEME 2DLIA 2DWXA 1IFRA 2YARA 2DQCH 1E9PA 2DQGH 3G3LA 1W8NA 2VLRD 3CQPA 1V05A 3WNJA 4QRFA 4YLBA 1MFDH 1O7DC 4PCTA 2IXQA 1ZT1A 3IDMB 3QPXL 4FULA 3QPXH 4QXUL 4DZ8A 5GZOC 2X3AA 4WU7B 1KWGA 4UQEA 3ARFC 1T0NB 5J11B 3MRFA 3QUMA 1VEPA 1YNTF 3X13B 3ZE0F 1MJJA 4Y5XA 1FNEB 2ICCA 2ZIDA 4RNRA 3HZYA 5EOCL 3I3BA 3QDHA 5D1XA 3RVTD 3AACA 3F5WB 2IBZY 4RGNE 1FJ1B 4UIKH 4PJ7B 1QATA 3WD5L 1S78D 4NO0B 1HJBC 1NTDA 4IMKA 3LQAL 1NGWB 3MV7A 4K3DL 2YPVH 3FRUA 4NP4H 4F2FA 1TTGA 1KB9K 2XTJE 3U30B 3T1FB 1MY5A 3DNKA 3TNMB 2KZKA 4OM0L 5F9OL 2F5BL 2QKIA 1D6EA 1DTUA 2BSSB 2W5PA 4RFNB 4B9KC 4UM9D 4Z7OE 3QIWA 1S9YB 3JTTA 4Y16C 1QKZH 3QNZB 1B0RA 1V8HA 4L29A 1NC2B 2R2HA 1MXGA 5C6PB 3ARED 3UBHA 5I5MA 4PRPB 3IU3B 2XN9D 4JM4H 4ENEC 5LGHH 1H15A 4RX4D 1QSFA 4M6NL 2BXYA 2YUZA 4JRYD 1S7QA 3WLBB 3IWVA 3LZFH 2X3CA 4M7KH 2VQTA 4MZRA 4W4NA 1W0WB 2A9DA 4LSVH 4OV5A 2XWZA 2YBRA 1NBZA 4YLQT 1K72A 3NJKA 1U3YA 2X89D 1I53A 1CU4H 2B8OT 2IV9A 1XT5A 4MVBC 4POZD 1FLTX 2F53A 3NZHL 1T04A 3OKLB 1ETZA 1K2DB 1T7WA 5EU5B 4C4BA 3MRQB 3BYYA 4ZQKB 2VLKA 3UTSB 4WVRA 1A9EB 4RMQA 4LHUA 3QDGD 3LQZB 2EEDA 2JKJA 1MIEL 1E8YA 4PJFA 1J8SA 2GIXA 1BVLA 2YPLA 3QXUA 2VMJA 4BUHA 2WVTA 1URLA 1MKFA 3EJRA 5DJCA 5JDSA 3OKKB 4I85A 1F1DA 1YEKL 5GSRB 2XV3A 3HG5A 3W3BA 2X12A 2ZYHA 1FC2D 2FO4A 5KYUA 3ZO9A 5DJ8B 5T1KB 1MOEA 3EZ8A 3SOBL 4YQXL 1BVNT 1ASPA 1LNUA 2QL1A 3K2IA 3EADA 2RH0A 2CIIA 3UEZA 1HHJA 4XGZA 4BIKA 1KWKA 6CGTA 1NIBA 2YGPA 4PJEE 2A4CA 2GAZB 2B7DT 4Y4KC 5D1XD 3VFTA 5I15H 3KHQA 3D39E 4GXFA 5E5MA 1MCEA 4F8QA 4DVBA 1K9TA 2CNZA 5HDQL 3WE1A 1T20B 1MI5D 3ORJA 4PP1D 1GZHC 4X6CB 1HEZA 4XP6H 5HYJE 3WIFA 2F8IA 2AK4B 4HJ0D 5E6ZA 2M83A 2Q76A 1I82A 2X4TA 1WEJL 1THCA 4N2AA 1AGCA 2VDLB 5I8KL 1U91B 2DDQH 2XQYK 4LHUD 1UJTA 1G9ML 3OF6A 3WAKA 3AQDA 4GP4B 3W9EA 2OK0L 3VW3H 3VW3L 3MRLB 4W1TA 1ZD6A 3ZTNH 5EEUA 3FAWA 3FUEA 3UAEA 2PPFA 1I8KB 3T3ME 3SBWC 4Z1PA 3W11C 3VYPA 2R29L 1JRHI 3GINA 5E23A 3TBSB 1U36A 1ZE3H 1P5UB 4IRSD 3GB7B 4G3YL 4QHUA 1FH5H 3ZMNA 4LMQE 4PJ8C 4U1SA 3QJHB 3FHQA 4KAQH 1YMHB 4PMFA 5EZIL 5HHME 2GJJA 1K6QH 1AZNA 1KCSL 3GSRA 1N2RA 1U21A 2L3BA 5ITBL 5KANI 1B6UA 1F4AA 1MSPA 1S7SA 3FUHA 4OLZH 5GPRA 3ALWA 4P04A 1F6FB 2B1AH 3MV7E 5BZXA 2VCOA 2R23B 2EVHA 1PX8A 2ICEC 2WWNA 3T0WA 5ACZA 3VDBA 4A7VA 3N42F 5ESAA 4NQDE 4PWJA 1T7XA 2K4WA 3JYBA 4LVNC 3JYCA 2QR0A 5D8JH 5C0ND 1DVFB 3FZUC 5MERA 3ETBJ 1XGRA 1IGYA 2FUQA 3DPBB 5DRNB 3GBEA 3MCKB 1PFCA 4KMQA 1VKXB 1EZUA 2PWGA 2C7UB 3QJVB 1MVUA 3AG1B 4CVWA 2YPVL 4BFRA 2IH8A 5J12C 3F6LA 4YDVA 2ZX9A 3FUKA 4Y4KA 3SDCD 3S4SB 4GYBA 5D1QE 1E9PB 5D7LD 4XNYL 1T1YB 1WQVT 3TONA 1S6NA 2AKRA 2BOLA 5KJRL 3T2QA 3N41F 4ZMLA 2VRAA 2Z91A 4GG6E 3FT3A 4CVXB 3REVA 1JHKL 1G7IB 3LKRB 4MLIA 3WIIH 3N43B 4MDRA 4AVJA 2OMYA 2X09A 3ABMB 4CU6A 4RMVA 5C92A 3IJ9A 3QUMH 2OS7A 4MA1B 4NZJA 1LEKB 3KPMA 2FQEA 3HZYB 3LRSB 3VGHA 4YXHH 5L7XH 3IK2A 3VFRB 1AZUA 1TNNA 2ORBH 3FONA 4KKNA 5ICXA 2HLAB 4PJ8D 4RSYA 2EDFA 5IQLA 4MSWA 2ADIA 2BFGA 2VDPB 3CCHA 4GW5B 4TVPE 5EBWB 4HK3J 4KI5C 1KJ2L 1UA6L 2YUWA 4R8WH 3FT2A 2B4CH 4K3HA 4PWFA 5CCJA 2R8SH 1P1VA 5AVRB 1MFEH 1BMGA 3VWJD 5KSVB 1BMZA 2CLZB 5FO9A 4G1EA 5C0BD 5ANHA 1E4XL 1M53A 5EZOH 4GKLA 1ZVSB 1BZ9A 1X7TA 3QNZA 1XDTT 4PHXA 4KQ3H 2HPTA 1Z0MA 2OXGB 5ISZE 3LKOB 4S1SL 2BWIA 4S1DD 5F71A 3LIUA 5AFAA 3GBNH 1D9KA 1J8HB 3IDJB 5J7CC 4HZLB 4QYOB 3MBEA 5FIEA 1PNDA 3FN0H 4F8OA 1S7QB 5DCCA 2G2PA 3O9WC 5G2NA 3MLUL 4HPOH 3D05A 3PJSB 2NTFB 1PZ3A 2QADD 2V7HB 4NKIL 4F7PA 2AJXL 4LEXH 4KXBA 1P5VB 3UROR 3W2DL 4KROC 3V5DB 4DF9A 5HI3C 2WLLA 3X14A 5I2IB 2UXVA 5B39G 4DAGH 3AQXA 1Y1UA 5K59E 3LQZA 3PV6B 5HXMA 4X0NA 5IM7B 4NI3A 5DO2D 4UDTB 5CBAA 2XBDA 3QEUB 3LRMA 5FO7B 4YDKL 4NRZB 4MCYB 2PPCA 4TSBH 3QG6A 4HXBH 1NCOA 3OX8B 3KXFD 5B22A 3O2WL 2V7NB 1XF4A 4WTZG 2X4RB 1Q8MA 3ZTEA 2W65B 3V6ZA 3ME0A 4IHOB 4QCIB 1QR1A 3CFIC 3EYUL 1HHJB 4PRPD 2OR8A 4J3UA 4ZFOL 2HX7A 5HJGA 2OTWB 2XQYA 5C0CE 2OPCA 1MLCA 5BS0A 1MH5B 3OZKA 5IOKA 4DGYH 2AI0L 5F6IB 3S7GA 1EX0A 1B90A 2ZUVA 2EH8H 3RNQA 1UZ8B 1UWFA 3GC3A 5T1DH 1G6RA 2NNFA 1BHGA 4OQ1A 5CR8A 1CFBA 2LVCA 3Q2NA 3PNWB 1KLFB 1QNIA 4L1TA 4YSEA 1J87A 4AEHL 3KL3A 4P5MA 5JTWA 1D7FA 2ZXWB 5KVFE 4MA1C 5AW9B 2X0VA 5FWQA 4BK4A 5J1SC 3KHOA 4ENZA 4LAQL 1DBAH 3CSPA 2NSMA 2FT8A 3BN9C 2BOCA 5IMOA 4ZZKA 4PRBA 5D2LE 4G6FD 3V9CA 4Q56A 2DEXX 3TJHC 4JFFA 1T6BX 4NZUH 1RUKH 4GKSB 3V6OE 1L0YA 2A38A 5CEYB 5A43C 4E42A 3VGAC 2Y06L 1CFSA 3IMVA 1PZCA 2DYRB 6FABL 4JFOB 2J8OA 4N86A 4HS8L 4OR1A 2OZ4A 5C07A 5D96C 5JXEA 1G5GA 2DN7A 3NEOA 3P0GB 3TIEB 4TVUA 3BZFB 3CFBB 4NCC1 1PW3A 3LKNA 2Q6WB 1FZOA 2NW2A 3BPCB 3B5TA 4D9RE 1AQMA 4FQJH 4AV5A 3LZFL 4M7KL 1KDJA 4DQAA 2YUVA 4YDJA 2BOBB 5DURB 4O2CA 2Z31D 2A74B 4Z78A 3V9EA 5B8CB 2D7TL 3QDJE 2NY3B 4HIEB 4MBOA 3T0EC 4Z23A 4K7PH 2Z93A 4WLCA 2EIJB 1X5FA 5IHWA 4A67A 4Z7VB 4RETB 1LWJA 3KGTA 5D1ZA 4IBUA 2Y06H 1BYOA 3J8F7 1DVFA 2FDBP 4JHWH 4M7JH 4DZBA 2K7PA 2B08A 1TEGA 5EZLB 2VQ1A 4B96A 4XBGA 4NC0B 4LO9A 4NQDA 4JGJA 4N87A 3L4WA 4LLVA 4WUKH 3IAGC 2A6KA 2F1EA 5DJAB 4GI6A 2DDQL 3A4EA 3L2NA 1KTDB 3F7LA 2R15A 5E6IC 3G6JB 3U4KA 2FSEB 4MXVE 4MRCA 5KYXB 3P0YH 1QFWM 5LN4A 4NS0A 4V11A 4E9WA 3NACH 2UY6A 1FG2A 4AQAA 4B9FA 4QLRA 2R0LL 2AQ3A 3VCLB 5CIPA 2V5MA 3G5WA 4KDTA 4QHNB 3KLAA 3SYPA 5DJ2A 3TA3C 4FLHA 1JZ2A 3I9GL 3P4OA 5ADPL 4HZAA 3WKPA 4PCSA 1IBHA 1DVSA 4N1CA 5AKRA 5I1EH 1JZ8A 2YPKB 4QOKE 1SJMA 3NCJH 3U0TA 4JKPL 5JOFB 4HYTB 4Y5XC 2ADGA 5I8KH 3H42H 3H8NA 3A4DA 3EJTA 2KH2B 4JPIB 5EO1A 1FV1A 2PMZA 4I13B 2DQTH 4S1QL 5TE4H 4L4VD 4DP6X 4S0TD 4HLZG 1OE2A 3AQZA 3KYOB 3GSWA 5GISH 3SCMC 4NIKB 3NQKA 4J6RL 4LVOB 4TNEA 4BSWB 4CJ1A 3FF8A 3PAYA 5E2WH 3UZQB 2NZ9C 3EO0A 3HLAB 3OHXC 3U9WA 3LIZA 4ANVA 1E5ZA 4X9YA 2J25A 4HGWB 4ELME 1CD1A 2VR4A 1OTSD 1F00I 3LN4A 5EOTA 4HJJL 1AO7B 4OUUB 5DZOA 4NC2B 4NN7B 3M7FB 5LAXB 5EBMA 1S7TA 2I85A 3H4FA 5I73B 4MJJA 2IPKA 3MRHB 3GEFA 4HBCL 2FVNA 3TZVC 1GSKA 4LESA 4LSRH 4OCRL 4R4NC 4YC2B 2FWUA 3V6OC 1ZLVK 1Q72L 3QUZA 4HSQA 2E59A 2LQRA 1YYLL 4DQOL 2VXQA 1I7TB 2ARWA 2F58H 3ARYA 3NPSC 1MCLA 1MFNA 3FQRB 1UFUA 1S2EA 1BFSA 3V5DA 3BEVA 3KW8A 4X7EC 5AW7B 4WWKC 1LDSA 5FUZH 2WV3A 4LIQH 3LX9A 3I6LE 3PV6A 3MLSL 4L3EE 5AUMA 4UDTA 1E30A 1RZKL 2IBZX 1TVBA 2AJSL 4P9MH 4MCYA 3CSGA 2FJSA 2ICEB 3G5YB 3QO1A 2K70A 3SGJC 1KENH 4TVPH 2W38A 4X83A 3LZOA 3TF7C 1XEUA 2V7NA 2VXSH 2WWMC 3H55A 5E4IA 4DGWC 2XWBA 5F9JB 2UZIL 5JNYA 2ZF9A 5HYJB 2VLJE 2YC1A 1K3IA 1Z1WA 3CFCL 3MRPA 2AXHA 1OP5H 4JPKH 3KDMA 4GAGL 5IB3A 2OJZH 4MB1A 4XP1L 1UASA 4DO6A 1MH5A 3DXAD 2FGWH 4LP8A 4R26H 2CAKA 4R84A 1WHPA 5FKAA 4X6CE 3QORC 5C6WH 3CDFA 3MOBH 3ULSB 3MFFB 3KLDA 1M4KA 2ZUUA 4LCIH 3VH8B 2NZ9D 1OHZA 3ABLB 1CI5A 5DVKA 1BFTA 4RFEA 4GKOA 2ED9A 2ZKWA 4L4TA 1K8DB 4LSVL 5L0QC 5HVHB 4OB5L 4H8UA 4AQ1A 4XXDA 4IJ3B 2CM5A 1WBXB 3C09C 3TN0B 4P5MB 4QRTB 3VFGL 5LKNA 1JZ7A 1AZCA 1U4FA 4YHNB 3CX5K 3CSYB 4QPEA 1DVYA 2FIRT 3EYOA 3FCSB 3LPWA 4FQQA 4MJIE 3ZL4H 4XTRC 2DLEA 2R4SH 4IIQB 3T8XA 3V0GA 4AZUA 4M7LT 3WV0A 3HRPA 3VD4A 1RZQA 5FKPA 3KPLB 4HFUH 1G9EA 4YGAB 3MRCA 4AH2A 3QNXA 5C07B 3EGSB 5IFJA 1SQ2N 1VFAA 2WUBL 3VQLA 3DMMB 1GA2A 4JO2L 1FZOB 5B1BB 4Z7WA 2MNWA 3MI6A 2NY7L 3KPSB 4AUYA 3ARBA 1SUJA 3TT3H 5C07E 2AXFB 3ZR5A 1CXFA 1EXGA 4HGMA 4ISVA 5BVPL 4LZKA 5FYKE 3PGDB 3ZVVA 4BQ6A 4B9YA 2YHGA 3EYSH 2ESVE 2AJZB 1MAMH 5TDNB 3BGFB 4HUKB 3H9SD 2UXTA 1SJEB 5L8LB 4MLSA 3U7WH 3LAFA 1U8PB 3W37A 1EAOA 2ICWA 2ZOTA 4EIBA 5CF3A 4DGYL 1SZNA 4N9GB 4UAHA 3ARFD 4I0PA 1YEIL 2UWEA 3A0OA 3CFDA 3OC8A 4HUVA 5BV7C 1NCUA 1KTBA 5FYKH 1AXTH 3OKDB 5DRXB 2X2JA 4NQSB 4K9EL 4NSKB 3VACA 1DBBH 1REIA 2RBLA 3FXIC 5IY5B 3QUYA 2K9FB 1FSKC 4M03A 2G75B 5INCA 4OIFA 5GS3A 2N1KA 3AMKA 3ARWA 3N5AA 1QPXA 2B1OA 4WDIB 2ITCB 2BY2A 2DYPA 3PL6B 5JOPD 1ADQL 3O8XD 4ZS6D 2QSQA 4W9ZA 1IM9D 2WXRA 1N18A 3GO1L 2H6UA 4RLDA 3QFDA 4XPGL 3P3RA 4RMBA 3TO2B 2OZ4H 1DUZB 4JFPB 1FDLH 5DC2A 2DJUA 2D2CC 3R4RA 1AR1D 1P6AB 1RJYA 4R96B 2WHVA 4XNUL 1MDTA 1YEIH 4HSAC 3FAXA 2GUOB 4PJEB 4GQ9L 5JW4M 1U92B 4LF3A 4Y19D 4UT6A 4U4IA 4HU8A 1QHQA 1OAYL 1DVTA 3V4VB 4TOYL 4MD0B 3FO0H 3MO1B 3FFDB 4AV4A 1Q9OB 4ANXA 1L6XA 4OT1H 2OMNA 5ESVA 4K7PX 4A7QA 3KWVA 1A6VL 3NSJA 1UA6H 2A0LC 1ADQH 4E9SA 1C12B 5I1JH 4X2UA 2OTPA 3P77B 1VB9A 3H6JA 4R4BA 4U3SA 3VO0A 1KIRB 1ML0A 5E6UB 4QI3A 3I75A 1HX0A 3BSZL 4OJYA 2IANB 1QI5A 2GITB 3QT2A 4ODVH 4YFEA 3EO0B 3HLAA 2BNUA 1NGQH 1P7KA 2RD0A 2X4NA 4XCNA 3VRLE 1P4BH 4JQIH 4YZWA 3VRJB 5CO1A 3BZEA 5I1EL 3SJVE 5EOTB 4U1LA 3HBZA 1X5ZA 1UQSA 3TEWA 2R4RH 3SYAA 1FGNH 1TQVA 3MRBB 1SJVA 1KJ2A 3ESNA 3ZPDA 1WBZB 1JK8A 5F7AA 2PWEA 1UD6A 5C0AE 1N19A 3QUZB 1NAMA 4PVLA 3BIKA 4IU2B 4YR6B 2XQ0A 3EH3B 4DWHA 1A7QH 5E94A 4Y4KD 5I74B 3AU1A 3BEVB 3B7RL 3I6KB 3AS3A 1BQRA 4C56E 4BUGA 5L2KA 3F7KA 5GGUA 3ZHLA 3MJ9A 4XOEA 1E8XA 2F54D 3GSVA 2MCAA 4PJBB 1DE4A 3NCFB 4LKXB 1JPTH 3QXTA 1NCDH 3QWNA 2Z1PA 3X3GH 1AR1C 2FGZA 2XG5A 4KJWC 3QO1B 4JNXA 1CICC 3FOLB 3O3UN 2PLTA 2E27H 1WFIA 3GSXB 3KMDA 2WY3B 5DLMH 1MJ7L 4OIAA 4XAKD 2HFEB 5IBLD 5JNYB 3DTUB 1FYTD 1MHCB 3DMMD 4LOUD 3P73A 3KPPA 3UBXB 3M07A 2EE0A 1GS8A 3KLLA 3Q8BA 2QT6A 4DN3H 3VD5A 1BAFH 4WGWB 5C0EB 2BW4A 3LS5L 3LS5H 5JHAA 1OAKH 3QG7H 4JFEB 4I89A 2UZYB 2Q10A 4UQIM 2D9CA 2E75C 4YBLC 1WGOA 3IJYB 1XH1A 4OF8A 3WY4A 1E27B 2VH5H 2RR3A 4TS6A 4PRHE 5DUML 3TT1H 3HIZA 3KLSA 3CZEA 3LNEA 4K7FA 3L2LA 4R97B 5F9WC 4KQ4L 5FB8A 4OCLC 1URZA 3GHBL 3Q6GL 3U2IA 2IAMA 3VWKB 3U4BH 5HBBA 4HH8A 4R4FL 4LAQH 3SJVB 2MMXA 4QNPF 1DUYB 1AP2B 1UM6H 4FYQA 3DX8A 4KKAC 1IRAY 3K6SA 4HX1B 2IVFC 2OULB 4WU7A 2Y6TE 5E6YA 2YJLA 4KKCC 4NBZB 3L3OC 3U46A 1Q9LB 1QYGL 1TQWA 3IAQA 4B7IA 5FKPB 3U83A 2EEXA 4B41A 2BJML 5I16B 3KPLA 2JI2A 1FL3A 3LH2H 1MCNA 4KGJA 5IROC 5SWSE 4B5ZA 5I1LA 4LIQL 1CG9B 4YEEA 4KKBC 4AH2B 3EGSA 5IFJB 1U6AH 2ADJA 4FA8A 1JN6B 1S7UB 2R51A 2DBJA 4QHLB 4UWQB 1ZT7A 2MSPA 1XGZA 3D0AA 1Y07A 4PBXA 3P02A 3T2LA 3IS0X 3CFKA 1AKJD 2WNWA 5DEZA 5H94A 2DMKA 4NCC2 4DFIA 4IGBB 4BKSC 4HOXA 5EIIA 2JCWA 5CZXD 1F6AB 3VXUB 5HP5A 3RFZC 1XH0A 4I9WE 4K3EH 1TTBA 2QKIB 2QLVB 2YS4A 4XP9H 5L8JB 4PGBA 3BPLC 1ZJAA 2YD6A 2WVSA 1S9YA 3JTTB 4HBQA 4HEMA 3TJEL 3L45A 3WGVB 3D85D 1EXUB 3I74A 5D1ZC 1PAMA 2HLEB 1U8PA 2OMXA 3KVQA 1EZVY 2WO2B 4PPTA 1L7IH 4DH2A 3EH1A 1A2YB 1DQLL 5T1MB 4D94A 1SXZA 2QPUA 1ICTA 2XWTB 3FQ2A 1RHHA 3FF7A 3TBBA 4HKXB 5F3BB 5BVJB 3S3JA 1UATA 2A7BA 3CX2A 1U8HA 4R7DA 2BVPB 2DYPB 2JSFA 3DROA 5D1XE 2F58L 1T04B 1FC1A 3RIFK 4YHZL 1JPFA 1KPRB 1ZV5A 2HYMA 4ODXB 3WXWH 3QJQB 1S3KH 4JZJB 1A9VA 4LHUB 3VXQA 4XN7A 3TESA 4AQEA 1WFNA 1YEEL 2YPLB 5KAQG 1KBWA 4ZX5A 1JPGB 4NT6B 1M05A 2VERN 2Z9TA 1MCKA 2GJRA 1SYSB 4QAWA 4Z3EA 5LLIC 4GT0A 4BZ2H 1F41A 1TETH 3ZRSA 3FSZA 5HDBB 4UQ3A 2DYSB 3BQUC 3K7UA 3V4VA 3SQBB 4JGMA 4KUCF 3IFPA 3UPRB 3UBFA 1YEFL 4ZW8A 3CLEH 1ZT4A 1FVCA 2WJ5A 3NSDA 4YFDB 4ZW7A 5GISL 4W9HC 1ZWIA 5E5MB 2Q3XA 4OZGF 4ZW3A 2XN0A 2ZP8A 2VN3A 3ESUF 2DAVA 4XBPA 1MFMA 5FV1L 2H2SC 3W82A 1OIOA 1IC0A 2WSKA 2HG5B 3NABH 1T20A 4LNRA 3U7WL 1C5CL 1VCBC 3IDYC 3MDJA 1SXBA 4K2UH 3SY0A 3KLHC 3SCMA 1BZOA 2BVEA 1G43A 1JDDA 1FORL 1TJIH 4Q8BA 1G9NL 4DP8X 3FCGA 1LP9A 3E2HB 3BT0A 3BWUC 4M1DL 3VFOB 3TVMB 3QDGB 4XXCA 4GI9A 2BSRA 4OLXH 2NY7H 3OKEB 1JK8B 1QSEA 1PDKA 4ZW5A 4JFVA 2E5EA 4QRRA 4CW1B 1W0VB 1RUAL 4K3JH 4AIZA 5IVXB 3KZ8A 3A6OA 5ACMA 1VACB 1WPCA 4P5TB 4YDIL 3BVVA 2IQ9L 3IN2A 5DA0B 4J3WA 1NA8A 4Y1AA 5GRJL 4HISA 1OV8A 1SHXA 3SPIA 4BUQA 4KVNL 3OKMB 5LBSL 3TX4A 2EAEA 2VSKB 4PV8B 5HDBF 4J8RB 1GVIA 4XPTH 3N1GC 5E2UL 3V4PH 1XB6A 1RZIB 2R56H 2AJYH 4O2EB 1JHLL 3GJFH 1KCSH 4DKTA 4OCWL 1T7YA 4PJBA 2X70A 4UTAL 1JGUH 4UTBL 1MWAH 1KELH 2Y5EA 3KL0A 4B0MB 3I6GB 1FE8L 3GMMB 4OT1L 4KZDH 2ADFL 4MNQA 3FO0L 1RP9A 3D69B 4MA3A 2IAAC 5LNEA 3B8SA 3G08A 2CGZA 2PW2A 2ZUYA 5DMJB 1EJOH 4M5YH 2VXQH 1ORSA 4P3DB 5IB4A 5T1LB 3T2PA 5DD5H 3CDCA 4O2FB 4EUPG 2VXVL 4R26L 2BY3A 1IBYA 2IWGA 1QLFB 2G9KA 2OR9L 1WA0X 2O6EA 4ODVL 1BZ7A 5JPMC 1YJDH 1Q9WB 3FUNA 4RCAA 1ERNA 1PG7L 2Y2YA 2NRDA 1A3LH 3EJYC 2Y7QB 2WAQA 4F8PA 4JFSA 4KUZL 5FYLH 3WD5H 1UCBL 3VUAA 4YDVB 4ZSOB 1PZ5B 1AANA 1Q72H 3M88A 4HJGA 1J8KA 1V54B 4BGDA 3HS9A 2G5RA 4YQXH 5EZJB 4PV1C 5HI4C 5CU5A 1JNLL 3TYFB 4IMKC 1E5UI 4KV5F 4PRHA 3BUBA 4FXKA 4G6JH 2P8LB 1IAIH 4BRVA 2XY1A 2WD0A 2WQUA 3VGBA 5I15L 1UD4A 1HOCA 4N0FA 2F1BA 4WSGA 2QKIC 1GYWA 3LKRA 4PBVC 4ZTOL 2Y07L 1U58A 4PRAA 4JQIL 4HKBA 5DK3A 2VYRE 4Y16A 3KPMB 2VXUH 1K5NA 3QIWD 4HUMB 2ADJB 5CN3A 3VA6A 4KZEL 3N55A 2AJ3B 2JKIS 4I18B 5FK9A 4PR5B 3TT3L 3LMJH 4XCEA 4FYSA 1UA7A 3CFKB 3Q8EA 4XNXL 1JNJA 5JHMA 1KJ2H 4OBSA 5TD4A 1NANI 5EUKA 2CLZA 4O5LL 1OANA 5FO9B 5MI0C 1J9QA 3FU8A 1T0OA 5FFLA 1KXTA 1UOWA 3FO1A 1U4EA 2LU7A 3VI3A 5HGGS 2YEVB 1ZVSA 3TBCA 2NY5L 4OUOA 4G9FD 3ZSTA 3DUSB 3U0PA 5D1QA 1FSKB 1T03L 5L7XL 4UOW0 1NLBH 2JMRA 5DQ9B 5EDSA 4NO5B 1F2XK 3QNFA 4L37A 1CGUA 1A4JA 1MELA 3VXRE 3G6JF 4M3JA 3BAIA 3VFNA 4AI7A 4XO4A 4IEFB 5FCUH 4IDJL 4P05A 2M1KA 3DDGA 3G5ZA 1N9PA 3V4PB 1BZ8A 2AP2A 5KVDE 4KK6C 1L9RA 4BCYA 4NUPA 4DN4H 3BVWA 3RWEA 1WH0A 4NUJA 4HUXB 2B4CL 2ENQA 3QEHB 1U8NA 2VUYA 3BPNB 3PJSA 3WFCL 1UH2A 4JFQB 1PSKH 2Y7LA 1DN2A 4POUB 5AOZA 2DD8H 4LEXL 4Q4EA 2NYZA 5ICYA 3QQ3B 4X6EB 5FHBH 1C5CH 5I5JA 4BK5C 9PCYA 3RZCC 3LB6C 5IUCA 5IHUH 1N5AB 4TNVF 1YPZF 5D72H 2XVGA 2PUQT 3JQOB 3SE8H 3BKYL 2J1XA 5AKTA 2YAPA 4YVNA 3FQWA 2XV6B 2V33A 3V7AG 4NRZA 4A38A 1X6LA 2VDLH 4J3SA 4O00A 1VERA 2FIKB 5KJ4A 4QRQA 3DTDA 4H7VA 4YHPA 5I1KH 5IW6A 1S7VA 4ACTA 7PAZA 3MV01 3QYCA 4ESKA 1EBPA 4EZJA 2X9XA 2VZ1A 5D6DA 4JM2B 3SQBA 3ZT5A 3CFEB 4JJ5A 1DBAL 1QR1B 1TQTA 4JR9H 1O5PA 2WB1A 4ILDA 2A74C 2ZF8A 2DWEA 1ES0A 5HDWA 1UHVA 2FX7L 1OM3H 2OL3B 4R0LC 1T1ZA 4NB7A 1S3KL 1I8LC 2UVEA 3ENEA 4FABH 3NJNA 2O6PA 4LLQA 5D7IA 4U0QB 3FQ4A 3C5SA 4G59C 5IQ9B 2HJFA 3UJTL 1U8CA 2E7DA 5CM1A 5C0FB 4BJLA 1U3NA 3OHXB 2KMWA 2XPZA 2HFFB 1EEZB 2H1PL 4F7EA 2XZQH 1L0QA 3L4TA 2DI8A 1Z5HA 4Y1TA 3QDGA 1WV7T 2ZG1A 4HS6A 1I9JL 2F5BH 5BZWA 3O2DL 5B7EA 1OGAB 4KJYB 1J0JA 3B2UD 1BOGB 3L95A 3LEVH 4M1CC 5SWQB 1A6TB 3QK0A 2NNCA 5LBGA 3ZDYF 3BP5B 1ODAA 3IAPA 2Y7NA 4OSUL 1G0XA 4M6OH 4P5TA 4B9IA 4FFVC 1NBYB 1C8PA 1OAJA 2WQSA 1A02N 1U8IA 4P8QA 3KH4A 3ILDA 3LIZL 3S2CA 3QRFM 2Q7AA 3MRRA 3ULVL 2JKRM 1E6JL 2CMRL 3FRPB 4DUVA 2Q6WA 3AY2A 2FJGB 5JPNA 1B9KA 2H3NB 4WV1C 5GJSH 1BFVH 2CNYA 1L9OA 1JVOA 2H9GA 4D8PB 4P2YA 1BBJB 2WQAA 1QEXA 1TETL 4R5TA 2VJ0A 1EHNA 1JNHB 4G42B 1L0PA 1INEH 1WC7B 3PWLB 3F7VA 2J8UE 1FZKB 4NJ9H 3ZTNL 5H2BB 4M6OL 4Z76A 3PRZA 4RAVB 3O45A 3TJEH 1AHKA 2CDEA 3GKZA 3P3SA 4MCMA 5A2LH 1LYQA 3CMOH 3KPNB 2B59A 2VW4A 3P3UA 5EO0A 3NCEB 3VI3E 1CC3A 3F84A 2VQ1B 4FQIH 5KSBB 4BWUA 2NT0A 4YHML 1A6AB 1JF1A 2A6KB 1XCWA 4GMSH 4WSJA 4HJUA 3UERA 2MQ0A 1M42A 4YFLF 5C0BB 4ZTEA 1ID2A 1F0LA 1UM5H 4HIXH 3NZUA 4L4VE 5E4AA 1U8MB 3QWRA 3C6LB 4LVHB 4UM8A 2DTSA 3V5HB 4D0CA 1AQ8A 1KG0B 4ZJ9A 3EOYG 2F68X 4LHUG 3VCLA 3IFOB 3MNVA 5FDWB 3L3KB 2P47B 4P2OB 1E7UA 1A4AA 2P8LA 4L1HA 4Z0XA 1AXSA 4RESB 2K9UA 3VX0A 2ERJC 5C71A 2BH0A 3U79A 3UFIA 3PGCA 2BM3A 1F11B 4WTQA 4MJ5B 2VXVH 1MI5B 1SYVA 2EXWD 1TU2B 1F3RB 3HRZA 2ZG2A 3IPEA