4CSSA

Crystal structure of fimh in complex with a sulfonamide biphenyl alpha d-mannoside
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords PROTEIN FIMH
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 38
structure length 155
sequence length 158
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cssA00
3ZL1A 4CA4A 1PDKB 5IQNA 4XO9A 5AB1A 2XG5B 5FLUA 5FS5A 3JWNE 2JMRA 4XOBA 2UY7B 2JTYA 3JWNH 5CGBA 1TR7A 1N12A 5LNEA 4ATTA 2UY6B 4CSTA 1ZE3H 4J3OH 2WMPB 1KIUB 3MCYA 4AUUA 3JWNG 1UWFA 3ME0B 5AAPA 5IQMA 3BWUF 2W07B 3RFZA 4J3OG 4XOEA 2VCOA 4AV4A 4X5PA 1QUNB 4CSSA 5LNGA 4X5QA 1N0LB 5F2FA 4AV5A 5JQIB 3BFWA 1KLFB 4AVKA 4XODA 4AUJA 4AUYA 4X50A 4XOCA 3ZPDA 4J3OF 2J2ZB 3ZL2A 4AVIA 5F3FA 4AV0A 5FWRA 4XOAA 5IQOA 3BFQG 4XO8A 4AVHA 3SQBB 4X5RA 4LOVA 5ABZA 2XG4B 4AVJA 5AALA 4BUQA 5FX3A
chains in the Genus database with same CATH superfamily
4PJ9A 3BQVA 3LX9A 2IF7A 3QS3A 5ALBL 3U9UA 4JHBA 4LEOA 5L7XH 1KMGA 3HTLX 1F4XH 1KCVH 4HCFA 1Z9SA 2QFPA 1NZRA 3O6KL 2ZCKL 4GP5B 5DQJB 5FW8A 2NY5L 2H26B 3GMRA 3CPLA 1ZHNA 2G5UA 4PG9A 4X6BA 4YDJB 1NBZA 4Z8FL 3HR5B 4OZHB 2Z0UA 4JE4B 1IKNA 4L1HA 5F71A 5AOMA 1WPCA 1F2XK 1OM9A 4EOWL 1BFVL 5EH1A 2ZQKA 4HHAB 5D71L 1CDHA 1V05A 1J0KA 4XB8A 4J3OH 1Q8MA 3CLWA 4ZPVA 4DK3A 4QJ3B 5F8QC 4O2FA 5FYKH 3MRQA 2BY1A 4J5VA 3W0WE 1FL6A 4OJFL 1VF5C 3DI2B 4PY8I 4YMPA 4QXUL 1YEFH 3EGDB 4RAHA 5DFAA 3SN6N 3VD7A 1FSKC 4XPTL 5SV4A 2Q86B 5EOCH 2NTFB 4YX2L 1BGXL 2RJMA 3QG7L 2WVVB 1BVLA 4AYFB 2G5BA 2B15A 4KI5F 2AITA 4PRID 4MYWB 4JFDD 2GEEA 2BY2A 1PZCA 2PWFA 4LCUB 3TJHC 4MJ6B 4ODVL 2WQRA 3UABA 3PNWB 4B9KC 5BV7C 4PBVC 1QFWI 3LVTA 2CKBA 1H3WM 2NQDA 4FYRA 3QJHA 1EJFA 3BPLC 1AJ7L 1DFXA 3FU7B 1I8AA 1GAFH 3NCYS 4LKXA 2DH2A 4P2RD 1YCSA 2B2XL 3ZZSA 4BQBA 3VWKA 7PCYA 2PWGA 1SEQL 1NEUA 2EVHA 1FLRL 1Q9KA 3HI1A 4FG6D 1T5WB 3F7RA 1NFIB 3Q8FA 4KU1A 4XMXA 5E70A 3QUYC 3UZEA 1G9EA 2J2ZB 3ZL2A 1IFHL 2HTKD 3LQAL 3ABLB 2PPCA 1DQDH 4DKEH 3VI4F 1QEWA 2I5YH 3IWVA 3QC5X 4JL1A 2ADGB 3U36A 1ORSA 1T7XA 3FO2B 3HJ0A 4GRLB 1N6QH 2ZX9A 2Z31A 4HUWA 4HIPA 4NFBA 4NWTH 4ONHA 4UTBH 4NX0A 2QZQA 3LY6A 4HLZG 4XH2B 3STZB 4APQC 2A74A 5CILL 3U4BH 2BOBB 1XEDA 4X83A 5D70H 5I0XA 2GAZB 1A6AA 4R8WH 4Y4FD 3NCJL 1PU0A 1XGQB 3MRMB 4OD1H 1LWHA 3BZFA 3Q1SH 3TBVA 5J7CC 1U3HB 4LAQH 4Z7WE 1PDKB 3ZYIA 1BX2A 1M4KA 4HIEB 1Q38A 1P6FA 4E9WA 4WFHE 4FNTA 2AEOA 2FNBA 3VXUD 5DT1L 3PG2A 3L3HB 3TTSA 1XGRB 4HGKC 4H0LC 1JMZA 3LRGA 3P30L 2J1WA 4GUOA 3FB5A 4W9DC 1M7IB 1JHKL 1O9VA 5F44A 2QLVB 3L5WA 7FABH 3LXAA 8FABA 4JREB 1BAWA 4AQ1C 5MEOA 1NGXA 1PAMA 1ZS2A 5L88H 3NJGA 4EMZA 4J3SA 3CFMA 1G6RB 2H0JA 1T5XA 4PJBF 1J8KA 3VRLF 4OU3A 3TVMB 5J11B 3MOBL 4KRNA 1I3VA 2EDJA 2AJUH 3ZT6A 1VSCA 2WWNA 4FHJA 1H3PL 3ULUD 3D25A 4GAJL 4XNQB 1A6UL 3G08B 3QPQD 3VG0L 5IFAH 4KI1A 1ZA3B 3RKDD 3M45A 2GBUA 3BISA 4Y5VC 3LKNA 3MJ8A 3K6IA 2F58L 2BFGA 3HE7B 2QVIA 3OR6A 1E6JH 4JKPH 1NKGA 3ES6B 4UI2A 4Q6YA 4XWOC 1L6ZA 2QPSA 3L7EA 1DSFL 3QWRD 1P7QB 2Y07L 4HULB 4M00A 3QIWC 2NXYC 1OAZH 4R96A 5CGYD 5GJTL 3WHXB 1OAYH 2J8OA 1HNYA 3E2HC 2EE6A 2BSTB 5EUOB 4ODUB 2OYLA 3HFMH 4EVNA 5E5UB 2WZ6A 2XQYA 3MGOA 4FKEA 2CNZA 4RZCA 4CGUB 3H9YA 1L3WA 2DQHL 3PABA 1U91B 3FOLA 3M88A 4ZYKB 5ICUA 4AIOA 2D7TL 3WXVL 2R1WB 4OB5H 3QS2A 1A47A 2FQEA 2GT9A 4WKZA 5JO5B 1EO7A 4JL2A 3HG3A 5HYEA 4LASH 4AQ8A 3VO0A 2WQXA 5T3XE 3U46A 1MIEL 2CG9X 2Z4QA 4OI7A 3ARWA 1A3ZA 4PB9L 1YJDH 5SV3A 4KAQH 4I9WE 3HKZA 4NUGH 4UT6A 4FEIA 4BSWB 3K2UH 3MYJB 2BCKA 3F00A 4Y1SA 1I1YB 2WOYA 2YZ8A 5BS0B 3MFFA 4LEEA 3BVDB 1HL9A 2NNFA 4O9HH 1X4XA 4RESB 4CN1A 3BZEA 1A4CA 2I69A 1OWRM 4Z7AA 2PNDA 3KLHD 1G1OA 3KYKL 4IGBD 3O45A 1QR4A 1QRKA 5I1GH 2EXTA 2XBTA 4CA4A 3DRQB 1ZVNA 4NQEA 3ZO9A 1X6LA 3L4UA 3CSYB 4S0HA 3MV01 1QATA 2BSRB 1T21B 4YC2C 1E5AA 4UBDD 5D7IF 5HHOA 3D48R 4LRIC 2DQJH 2VJ8A 3MFGB 3NGBC 4LVNC 1FC1A 4ELMB 3AUWB 4IYKA 2ATPB 3MGTB 4OJAA 4HEPG 1XT5A 5C0DB 3B6SA 4BZ1H 5EIIA 3JV4B 1Z9MA 4O4YL 2W5PA 3M7FB 2FQFA 1DQQB 4PV1C 4XXDA 4F9PA 3TU6A 4F8TA 4E9QA 4P2OB 3R1GH 4JHWH 5DJ0B 2JB5H 2VDQB 4OD3H 4M61A 2CGRH 3QNFA 2XVGA 2KLSA 3PDOB 4HIIB 4DO5A 3IU3B 4IHOB 5I1AA 1H0DB 4WGKA 1TZ8A 3S6CA 4JQIA 3EG9A 2VIRA 3OZ9L 1MW0A 4NHUB 2ZUSA 2OW6A 3FCSB 1NCCH 4AJWA 1ZMYA 3CZKA 2BW4A 3FNKA 5D7JA 4GAFB 3QIUC 1SYVB 1URLA 2X1PA 2JCCA 3LEVH 2PXYC 1JRHH 3V6FB 1UD8A 2K45A 4HH8A 3E38A 4NHCH 1HZLA 3W3BA 4V33A 5CD5D 2MPAH 3IPBA 2YRZA 5GS2H 2GIYA 3OMZA 3GT6A 3B7TA 1XGZA 2HG0A 4QRQA 2CHZA 2R51A 1KLGB 3GGWB 2ZSVA 2AV7B 3BAYA 4JMXA 4L8DB 4KDTC 5F97E 1QFWM 3ZJAA 5LHDA 4NI3A 3WCYA 1WWCA 5EA0H 5JQIB 3ECBA 4NFCA 3WD5L 4QOKA 4XODA 5E2JA 3RGHA 1TITA 4YNYB 5KSUB 4HC1A 4QKXB 5D7LA 5DD5L 5CJQL 3OG4B 3MLPA 4FJ6A 1JZIA 4G7VL 3AQDA 1NAKL 1FNHA 3U82B 1FO0A 1IEAB 2BZCA 1ULVA 2PTTB 5B8CA 3HNSL 4AM0Q 1YPZA 1GC1H 4PUBL 4WO4B 1I7TA 4PRBB 5CFAA 3EYQD 2EEFA 4JB9H 2X4QB 3EJTA 4D0DA 1NMBH 2IPTH 4PCKA 3A23A 3WKPA 4Z76A 4FF9A 3IJSA 5E1HB 1HH9A 4MHHI 1ZRUA 4WY7L 4UM9A 3BKJL 4G8EA 1F13A 1EHLL 2FEDC 2PYFA 4PJFB 2YAMA 2I26N 3B9KD 4U7MA 3LNEA 3GSUA 1QSEB 3HEIB 3LQZB 1KENH 2CJ3A 1XZWA 2GJ6B 3BVTA 2VM3A 4JY4A 3QEUB 4H8VA 2ENJA 5KVEE 1DDHB 3IJ7A 4FG6C 5D7SH 5ESQB 1KTLA 4FQ2H 3GMQA 3VWJA 5CZXD 3QJSB 1P4IH 2V9UA 4U3XA 3FJTA 5HYSB 1RZJH 3UC0H 1IBZA 5T1KB 3PRZA 3VWKD 1KBWA 4NQEE 1PIGA 3W9EA 3OAZH 1ZVSA 2VDOH 5HHOE 3VSQA 4XXCC 1WGVA 5T3XD 3SYCA 2YFOA 5JQ6L 5LGJA 3H9SA 5DMGD 5AVVB 4ODSL 1AIZA 4I9WD 3L5IA 2KH2B 4IQHA 3GHEH 2V17H 1BJ1J 3U6RB 3IAGC 2DD8H 2V8MA 2J5LB 4MNGA 4P9HC 3K46A 1TUPA 2RCSH 3I75B 1XL6A 2Z31D 4HV8A 5HYQA 2OMWA 1JPEA 2QKIB 1JRHI 3CAFA 1XBRA 3R0NA 5A2AA 4HXAH 1LILA 3L4YA 3P77B 4PRHB 1AGEA 1IU1A 1AS8A 3D0VA 1AHWB 2F7IA 4HJSA 4JKLA 2ZYRA 2BW5A 1NC4A 5GRJH 3SOTA 3GSRB 2ITCB 2DQMA 2YO3A 4EDWH 4EI5A 1JV5A 3A67H 3C2SA 1T20A 3NCCB 4M7LH 1MDTA 1XF4A 5D7EA 1EO8H 1MAJA 1IMHC 3RNQA 1YN6B 1K9TA 4Z7NF 2JCCE 3KM1A 2OAAA 3MQIA 4NO2A 1LDPH 1YECH 3S4SA 3HBQA 2B39A 3DTXA 1ZSDB 1Y6KR 2E9IA 2XZZA 2CO1A 4NIKB 5LNDA 2FBJH 2W07A 4MD4B 2ICEB 4N0UB 2JK5A 4LLVA 4YDVA 4XO4A 3IMBA 3FC8A 3ULUC 4PI2A 3UYPB 3NIDE 4LESA 5E23A 2IDQA 1UXWA 1IGML 1CWVA 4QOKE 4XVSL 3RKDC 4PJFF 5FUOL 2O4EA 5D7LE 2Y7OA 3CU1A 2WBJB 1QPKA 2EILB 4P2QE 2DIEA 3IDGA 3VD1A 2IXQA 3EFFA 1IZJA 1YPZE 1LLAA 3SQBB 2AJYH 1I85A 2WWMD 2O5YH 2CO6B 2NUPA 1M71B 3MACL 4WWKA 2WLMA 3IYLW 4WQOA 1U3YA 3SB3A 4EF3A 3O8XA 2X70A 3SD5A 1NUDA 4MBOA 1ZA6A 4ETQB 3UFIA 4JDVA 4PJAE 4JLRB 5FKAA 1IIKA 4JFHD 5CEYB 3MRHA 3M1BA 2Q8AH 3HS0C 4APXB 4NUPA 4AQEA 2AEWA 1ZEAH 1A14L 4R4FL 3IJYA 3G9VA 3KHOA 2JNZA 2YRLA 2XN9D 3OKMA 4X5LA 5JW3L 3QNXB 4H8PA 1TQCC 3LN9A 5ESAB 5AAWA 4U1HA 3WENA 2D0GA 2X9YA 3TT3H 3U7AA 1AMXA 2FJGB 2PCFA 3PDDA 1CO1A 43CAB 1KB3A 3RY6C 4X6CF 4G9FE 5E6UB 2YRPA 1S5IL 1IRAY 5C9KA 3L95A 4LMQE 2Q3ZA 4OH2A 1A65A 1QG3A 5I5JA 1I1RA 4GUPB 3WS3A 4HUVB 3O3EB 2H5UA 4CSTA 2EYTB 4G8GA 3RWJA 1OK8A 4KDVA 3AG3B 2QVMA 3FN3A 5E8PA 1JGLL 2GY7B 2HKFL 3P40A 2Y7LA 2KHAA 3H42H 4MAUH 3GRWL 3RLSA 3BSZH 4IGBC 3H9SE 4YLBA 3JVGA 2R27A 2WTPA 4TMPA 5AFAA 2NLJA 2X4NB 2ZKHH 4TVPE 4X9BA 1TTRA 5HGDB 4U0RB 1RIHH 4UZSA 5IHHA 1WAEA 4PJ8B 1NBQA 4PJXB 1Q1PA 4UBDC 4V1DB 3RHWF 3TWYA 5FHBL 2ZKYA 4ATWA 4B9PA 3TV3L 5IJKC 3QZMA 3CMGA 3FTZA 3HOGA 3O0LA 4Z7UA 2A0LD 3MLYH 3V4VA 2OMVA 1AQ8A 2DI8A 2X4PA 3P4OB 3C6EA 4F33B 4NQED 1WCBA 3GK8L 1BZ7B 3EO0B 3WUWA 1MZZA 4G42A 4MA1B 4UINH 5DHYB 5HHOD 1R9FA 1MRDL 2R23B 4RMSA 3X17A 1FE8H 4ZS6D 3ZL4L 2F5BL 2FJHB 5CUSH 5EZIL 1ET8A 4I3SH 1R3KA 5E24E 3VSVA 1WC7B 4XMLL 2EAEA 1HIML 5DZVA 3HI6H 4G70B 4P3WA 1N9PA 3CVHH 5AW9B 5F7UA 1MWAL 2KYIA 3O9WD 5IVXB 2A5UA 5FO7B 4HS8H 4PVNA 4IBZA 1KB5H 1N4XH 1U8MA 3IPFA 1FIEA 5I66A 5DZ9A 4HJ0C 4N2HA 4QRRA 5J13B 2K78A 3AG1B 2JJTC 3K5RA 1EXHA 5DUBA 5CD5C 1D5BB 1KOAA 2FT6A 2AV1A 1P0SE 4PJ9C 3O6LL 5CZRA 3SDCA 3VX1A 4MWFB 3KLAA 4RGNE 1FGNL 5DD1L 3U4AA 1NPNA 3MDJA 5D7JD 2YD9A 3MMEA 2H9GA 2UYLB 4FQJH 2XN0A 5HPOA 4AC2A 1G9ML 2ATKB 3G04B 3MJ7A 2D3VA 1MUJA 4P5KB 1CI3M 2V7NB 2VDOB 1AZCA 1EXUB 1D5IL 1X5FA 2ZUXA 4KX7A 5TF0A 2A9NL 5CCKL 1IKNC 4XT1C 2ADJA 1TIUA 4NUJB 2E59A 4O5LL 1JDAA 4YXKH 4G3YL 2XWTB 1MHEB 3VJ6A 4JJ5B 4KJWC 5B3SB 2YD7A 4BZ2A 3WGVB 2YGPA 3R8QA 3FTYA 2Z92A 3D8MA 1VFUA 1OB1B 2XZAL 3WI9A 2QGBA 5CJXC 1ORQB 3C2AH 1RZFL 3QEGL 1XF2A 3PU7A 3LN4A 3A0OA 3T0AA 5JUEH 3GMPB 3SBWA 3WO3B 2GTZB 2WYHA 4P2QD 4HA1A 3VXNB 5D2NC 1YYLH 5D96C 3MOQA 4F92B 4P4KB 2NY4D 4A1RA 1FNSH 2AZUA 3CDGA 4PJXF 4QT5B 4P4RB 1P4LA 1RZQA 1YEKL 1JUFA 1H15A 2V2XA 2AQQA 3C87A 3DVIA 1BEXA 1RV6X 3AJ7A 1PY4A 3QG6B 2YN5A 4MD0B 4X7TA 4F7EB 3JWDC 3MI6A 3O0RH 1YO4A 4G8GE 1XH2A 4U2YA 5CBAA 1UM5H 4QHLA 2YQ3A 4UM9D 2ALAA 4QNPF 1MAKA 3BVXA 1W0WA 35C8L 2LQRA 5JW5A 4IKLA 5FECB 1MHPL 5JYMA 3N40P 4H13C 5DURD 2CHDA 1ONQB 1AGDA 4N3TA 5GHWH 3POHA 5IB3B 2ESVD 3NCYP 2LU7A 1YY9D 3MJ9L 4QHNB 3H9HB 3PWUB 2CUIA 5F7LB 3UZEC 3O2DH 4HUKB 4HXBH 4G9FD 4N2AA 3VWJD 4NT6A 5CLTA 4Z7UE 5HI5D 3P02A 3D9AH 3VFOA 5FA4B 5E08L 1LEIB 4KTEL 4PJ7B 1ZANH 4YHIA 1NAML 4QRTA 4TUOA 3S3DB 3F85A 5BZXA 4MMZA 5JW4M 3F7PC 1OW0C 3B2UC 2K7QA 3D33A 4ZUTA 3ZIYA 3HW7A 4MB3A 5IFJA 1G7LA 1J1PH 2JKWA 4GRMA 2A1WL 4JFFD 4G6JH 5CHNB 3KXFA 2A74C 3FQ1A 5F93C 1P7HL 1JXKA 3H9SD 3OSKA 4KO9A 3Q5OA 2WLIB 3ZLQC 1PJWA 1A6ZB 5BUPA 4QJ5B 1MVYA 2BOCB 3WYRA 5JHDA 5E94A 3SE9H 4BZYA 5KYUB 2MOGA 3KBHE 4N90E 1JF6A 3K4ZA 2GJPA 2BH0A 3LRKA 3SDYH 5EU4B 4QRRE 5KVDH 1A1NB 3L2LA 4UU9A 1NCAL 1KPRA 1M3JA 4A39A 4OGZA 3M07A 4YBQD 1VFMA 1NC4D 5JHLH 3WUZA 4NRXB 2RGSA 2CMRH 3PWNB 4EN3C 5DQJA 1A7BA 1Z5HA 4ERSH 2H26A 3S34H 3ZDYE 4Z5RB 2E7LC 1PS3A 4YDJA 3HR5A 4OZHA 4PCYA 4WU7B 1MN4A 4GXUN 3APFA 4OR1A 5MI0C 3IT8D 2Y3AA 2DY2A 4X6DB 5TF1L 1QSVA 1Q0YL 2AFNA 4EAEA 3AT8A 2WHVA 1DQJA 3EHBC 4HHAA 2GCYA 4JEGB 5I5MA 4LSQH 3FN0H 2W1NA 3A21A 3T0EB 2ZZUT 1KGCE 2UUDK 1KJ2H 4DZBA 3GBNH 1AY1L 3S3SA 3L6FB 4YPGB 3C12A 5F6HJ 3BP5A 3EGDA 32C2B 4L4VD 4NO0D 2VISB 4YXLH 4K55A 4C58B 5GQBA 1NEZA 4RGND 4DAGL 2P44B 2NTFA 5T3ZD 1MFEH 5CF3A 2OR9L 4AYFA 4Q6IC 3TJEL 4HQQL 4WWKD 3MNZB 4LCUA 1DJZA 4AG4L 3QCVH 3F7VB 4MJ6A 1IC1A 3L08A 3QZWB 3O8XD 3H6AA 3PNWA 3VW3H 2ZCZA 4CW1B 1CJYA 1T0NA 5CP3H 4PJ7F 2DMBA 3TBBA 1XDTT 2BIHA 2WNXA 4JFXB 1E0OB 4KK6D 3CX5J 4F8NA 3FU7A 4XZUB 2ZCHL 4OLWH 4FXTA 1CL7I 1GH7A 1FNFA 3CVHB 4POZD 1NIBA 3ZHDA 3O3DB 2X4TB 5I15H 1YNKL 5LAPA 3AQZA 1T5WA 3LPWA 4LLMA 1OOWA 1SN5A 5KVFE 2J2ZA 4XO3A 4AQ8C 1ADQH 1HSBB 1LVEA 4M62H 5L4JA 2HT4D 2MWCA 1L6PA 5AWNH 3HMXL 1I1AB 3NPZB 4GSRA 3FO2A 4JFEB 3RI5F 1S9VB 3ZDXF 3BQUB 3CZEA 1AG6A 1SEBB 2ITFA 1MLBB 4LLAA 5C7XH 2MQ0A 2WXRA 2E7BA 1CCZA 4G8GD 1JPST 2ZOTA 4IM8A 4UNUA 3WE6B 5EF3A 1GGCL 4XH2A 3STZA 3UGEA 4OZFG 3RIKA 4YS4A 3D39B 3L3KB 5BXFB 4FCAA 1X7QB 1Z66A 3G6DL 3KXFE 1LO3L 2GAZA 4R3SB 1ZAGA 4WWPA 4DGIL 1G7JB 1G7PB 1PZ2A 2PP8A 2LR4A 2WBWB 3GXUB 4LSTH 3ZE0B 1XGQA 3MRMA 3EYVB 5GS0H 1XF5B 5JHDE 4S2SA 3EYSL 1ZJBA 4PYHA 1AAJA 4KX9A 4P3DB 4PIBA 4XMTA 5DO2D 1PDKA 2V33A 4HIEA 4WI5A 1OP9A 4H8WC 4YDNA 2KLRA 1CFNB 3VFRB 4NKIH 3V6ZB 3L3HA 1KCRL 1E5YA 4BFFA 1XGRA 4ZW6A 5C0ND 4JRYD 3CX2A 1RZKL 2XVLA 3IAPA 3LS4H 4PGDA 2FSDA 4XN7A 5FO2A 3SO5A 3WTWA 1M7IA 4YAQB 4RGOL 3RWEA 4F9PC 3NSYA 1G6VK 1L4IA 2VC2L 2H45A 5I8OL 3VQ2C 5CKGA 4FA8A 1G6RA 4BA0A 2NCEA 2MNJB 4TUKL 4EI0A 3CC5B 2R29L 2JFCA 2VLRB 4OZHE 1PSKH 2X1WL 2WV3A 1FH5L 1JFQL 3OJDB 43C9B 4FQQA 3ZKND 3OAUH 3WTTA 2MJWA 4N90D 4JQVA 3KW7A 4XNQA 3G08A 1RU9H 2VB5A 3GBLA 4K5MA 4DOHB 1T03H 4MQSB 4QRRD 2PO6C 3P3SA 4XPFH 1ZA3A 5BPPA 1HHJB 5I1KH 2BP8A 2NZ9D 4R7XA 3HE7A 5F9WB 4UAHA 1ZHBB 3CN0A 4TKWA 4YVUA 3SYAA 1BA9A 1DJIA 2Q1EA 3ES6A 5DJ8B 3SDCD 4OCWH 2OSXA 1KACB 2E6QA 2A83B 4X80H 1P7QA 1DJWA 4B9FA 4W4OC 2EDRA 2TRYA 2XV2A 3WHXA 4J4PA 4KKLD 4PWEA 2VXVH 2J72A 2WAHA 1Z0NA 1FBIL 1DVQA 1AC6A 5EUOA 4OY9A 3BKML 4YSUA 4DP1X 1SQ2N 5LGHH 4MS6A 1D6VL 3AVEA 4XC1H 4HUXB 4XBMA 5E99H 2HJLB 3QQ9D 1U91A 3IM1A 3NJIA 1KGCD 4QD2E 4ZYKA 3ILEA 5C6WH 2R1WA 3BAWA 1Z9PA 3BAIA 4ZXBB 4KO7A 4MCNA 3WY4A 4OKDA 2VH5H 3OVUB 5C0AD 5JO5A 3K6SB 2Q8BL 4WI3A 1QHOA 2X6AA 4XP1L 2XIIA 4M6NH 2YPVH 3RVVC 1ROWA 2DM2A 4N1CA 4IMLB 3WTSA 3FH8A 3ETBF 1AOZA 2DTMH 4U7KA 1AQHA 2ORBH 4BSWA 4H8QA 4ZFOL 1AS7A 3MYJA 4PJHA 2NY0D 3WNIA 4NN7B 4UT9H 1I1YA 3AUVA 2O5XH 1SHMA 4AGQA 4R7VA 5J4MA 3FMGH 5BS0A 1CF1A 5BRQA 1DQML 1LNUA 4YHZH 3TBSB 2P5ED 4K8RL 2EO7A 1CR9H 1CT8B 5ACZB 4K94C 2IPKB 4HSAC 5HI5C 3HRPA 3DRQA 2WJ7A 3IMUA 3DA0A 3K4DA 1ROCA 3CLFH 3CSYA 3DMMC 4PVLA 1WSST 1G0XA 4PJEB 5D1ZI 4ZODA 3NG5A 2OJZL 5EC2B 4KI5D 4ELMA 3B1TA 1J9SA 5BJTB 1GSKA 1RPQA 5HHXH 1KJ2B 2ATPA 3MGTA 4QWWD 3W11C 4BM7A 2YPLB 4MB4A 5L4MA 1NGPH 3JV4A 1KFGA 3UP6A 3IDXH 1KELH 1S7VB 2QQKL 3CBRA 4K23H 2VLJB 3DSFL 1DQQA 1PY0A 3ZUCA 1GMEA 2OP4L 2VXUH 4GKSA 4TV3A 3TO4D 1OE1A 4P2OA 3QZPA 1AKJD 5DJ0A 1I9JL 2PPFA 4A6YL 1A8ZA 1IC5H 4KHXH 4FN0A 4HIIA 3IN2A 3IU3A 3KXFD 1H0DA 4IJ3C 4MDJB 3IS1X 3ULSB 4PWKA 3UJTH 4B9GA 1UD6A 4N0YH 1OTSD 5EC1A 4LLYB 3TA3B 2F53B 2H0PA 1P6AB 4HUCA 4XNYH 1D6EB 4NHUA 5JHDD 1OAQL 3FCSA 4EI5C 1LK2B 3N40F 1WE5A 4MDIB 3FCGA 4F58L 3ZYZA 4N8PA 3CFBA 2IC2A 4KROB 1IVLA 1SYVA 4WEBH 4UM8B 5IQMA 5IV2B 3V6FA 3BWUF 4Q4IA 3X1NA 3D4YA 4HVBA 3CG8A 4NNPH 1RUKL 1OAKH 2VCOA 4WCYL 5I6KA 1Y1DA 2WM0A 4PR5B 4YVNA 2AV7A 4L8DA 4BQCA 4ACTA 3BT2H 1PPIA 3NJMA 4Y9CA 3VUAA 1KB9J 2G75A 1JZJA 4YNYA 5KSUA 3UOAB 5ELIA 5C0IB 5J3HD 1U8CB 4UTBA 1YNTF 3NVQA 1U8LB 1INDH 2ZUVA 2AANA 4P2CG 3HR6A 4AUJA 4B3EA 5E1AB 1R3IH 2MPVA 2PTTA 2G2RB 3Q6GL 4FQ1L 4HIHB 4YHPB 5EUOE 2ZCLL 2WWKT 4PRBA 1KCKA 4WO4A 3FSOA 1F18A 2X4QA 4B9YA 4ZFQA 3NJJA 5JNYB 1U21A 3FB8B 5EHFA 1ILSA 4LPUA 1BQLL 1RULL 5C70A 3DYPA 4WWKC 3AXHA 1L9PA 1W0YT 1C5BL 5TJWK 2D3NA 4R97B 2DB8A 5B4MD 4JKKA 5C3LD 4KK6C 2NCMA 1ZDSA 4L3EB 4X5RA 3PS6A 4IBQA 1YLBB 1QSEA 2R1YB 4G11A 4PJEF 4YXHH 2BP5M 3LQZA 1DFBH 2R0ZL 3ERXA 2GJ6A 4BKTC 3GRBA 2BJMH 5E2WL 3CSGA 4M93B 2X87A 4YSTA 4E36A 3TEYA 1DDHA 5AAWC 4KKPA 5ESQA 5BS0E 2CJUH 3VE0A 3GBEA 3FU9A 4OUUA 4BE6A 5E51A 4TNWK 3GJFB 5HYSA 3CFJB 3BP4B 5T1KA 3CIQA 3REVB 2GJZB 1PG7X 4UQBA 1BVZA 5AB0A 3AWGA 1SY6L 4NXKA 4XX1E 4HD5A 2R15A 5GGSB 4XC3H 1JP5A 3UBXG 7PAZA 2MNWA 4ELME 4XP9L 2VR7A 1JPTL 5FYKE 1S2EA 4ZFGH 3BRDA 3ASWA 1JJUA 3ZQWA 3JVGC 1A1MA 3U6RA 3WJJA 4GRLD 4PGBB 1OTUC 2F19L 1QZ1A 4JRFA 5DHVH 5BRZB 4N0CD 3I75A 3BEWA 3FZUC 3VH8B 3ZTNL 1KIUB 5DR5H 1NBYB 5F96L 1U8OB 4OBSA 4I18A 2FEEL 9CGTA 5DHMC 1A3QA 4JN1H 3P77A 4PRHA 4KDWA 3B2VL 1AHWA 4FQIH 1LJMA 1WRFA 4HMEA 5I71C 2J6EL 2K1MA 2HWZH 3FTWA 1CTOA 3WNOA 3GSRA 2ITCA 4N5UA 1FL5B 2YXMA 5DJ6B 4FS0A 2QEJA 3BYTA 1U3HD 2FEJA 2HRGA 1UD2A 3MXVL 4QGYA 2DQCH 4AGLA 1YN6A 2X9XA 3CFCL 3CV5A 4MAZA 4DH2A 2FL5B 4NNYB 4NZ8A 4XCCH 4XBEL 3TEXA 1G9NL 4JG1L 2Z7WA 2CRZA 2OR7A 1C1EH 1ZSDA 3TBYB 3GTVA 5AYUL 2ETWA 1KLFB 3FT4B 4N0UA 3FT2B 5M94B 5FYJL 3UYPA 3RTLA 3T6VA 1JZ8A 2VMDA 3GRGA 1FNGB 1OE2A 4PJ5B 4PSRA 2V3DA 5BW7A 3OB0K 1KSRA 1MREH 2R1XB 3V4PL 1N18A 5J12B 5HGGS 4NJAH 1M2VB 1HINL 3BE1L 3TVMD 1PLAA 3EFDH 1UUNA 3P1VA 2WBJA 4IIQB 5TE6L 2EXWC 3P0VH 2KL6A 4U6VL 1XH1A 1R6VA 1K8DB 2CIKB 3SQBA 5DZJA 2CO6A 3L4VA 1M71A 4MJIB 2GHWB 3DX2A 3OAYH 3I6KB 2B5IB 1CLOL 2OA9A 4X8JB 1U8IB 3QBTB 4KKLC 3G7TA 3DVNB 2C7UB 2IH1B 3HI5L 3FUEA 2DKUA 3MRGB 1UD4A 4MS8D 5C7ZA 5CEYA 4RZKA 5C6PB 4CAGA 3WY1A 5D2LF 4APXA 1GOFA 2R0WL 3L5XH 4PJFE 3E80A 5L0QB 2OKMA 1P7QD 1QSEE 3D5OF 2EDTA 2GJ6E 4J4PD 5ESAA 2WD0A 5I18L 4CDGC 5DEFB 4OGQC 3O6KH 1KLUB 2FJGA 2ZCKH 5KANG 2NY5H 3TF7C 5KBDA 3SBWC 3H54A 3GXTA 43CAA 2X10A 3MNMA 5L9DL 4Z8FH 1F86A 4I87A 4MDRA 4RISL 1NCHA 5HJDA 4GUPA 1TFPA 4HUVA 5EG6C 3O3EA 2EYTA 4CKVX 1CVRA 2K4AA 1N5AA 1UQSB 4DN3H 1O7SA 1BFVH 4EOWH 5D71H 1BLNA 3PWLB 2WMPB 3RIAK 4Q14A 1SUHA 2CXKA 4OF8A 4N6RB 2X4NA 4OJFH 5SWZB 3FYIB 3ZO0A 5BXFA 1MCJA 3BUBA 4QO1B 4K71C 4J3VA 4QXUH 5CN2A 2HXAA 5EDXA 2N7BA 4PJ8A 4XPTH 4GSUA 4PJXA 4ZO6A 4V1DA 2QDWA 5HI3D 1BGXH 3FSZA 3QG7H 4YX2H 3BPOC 4ZX6A 1BMGA 3P2TA 4U1MB 3X12B 1QBLL 5CINL 4PRHE 5ID0B 3B9VA 1QI4A 4ODVH 4HUNB 2ATAA 4JJOA 2NZIA 4F33A 5AD0B 1P7KB 4UNTA 1RPKA 3FRUA 4BHUA 5I26A 3GMOB 1BZ7A 2QQNL 3O2VL 3EO0A 4F37K 4MMZC 4Q74A 1AJ7H 2MQCA 2EEXA 5DHYA 4NBYB 2B2XH 2R23A 2BHUA 5FO8B 3ESNA 3OZKA 1SEQH 1FLRH 2I27N 4M7ZB 1INEL 2JE8A 1A6WL 1EMTL 1CDUA 3RB7A 3OKEB 1TSRA 5IVXA 4LGPB 3QWOB 1BXAA 1IFHH 3NCEB 1ZVYA 5FO7A 4GT0A 3V52H 4P2OD 4BDVB 4PBWD 4N0UE 2YXVA 2AEIT 3NTCH 4Y2NA 4F20A 3BFQG 3PIQB 3RVUD 5FEBA 1D5BA 4KVNL 4JE0A 4FI7A 4G7SB 2IGFL 5CILH 2VGLM 5I75B 2CQVA 1U8KB 4MWFA 3T77B 4M7LT 3SCMB 4FCHA 2HLAB 2MRYA 5DUML 3NCJH 4WHCA 1F6AB 4J39A 2EDKA 1M57B 4BFJA 4GB9A 2ATKA 5JXED 3G04A 2QMKA 4P5KA 1D3CA 1EXUA 4K3GA 3CDZB 5I9QB 3ZL1A 4HDIB 5HHPA 4G9DB 2AJSL 5CFHA 4EZLA 4FHBD 2XWTA 1MHEA 4JJ5A 5DT1H 3ORJA 3ZIMA 5I0DA 5E9AA 3S35X 1T0PB 5C97A 3P30H 1MCQA 4WLCA 5DHVB 1OB1A 1JHKH 1GS6X 1ORQA 2RD0A 3IXTB 2FYVA 3GMPA 2N59A 4PIRF 3WHE1 1ZGLP 2GTZA 1U8QA 2LVEA 3VXNA 4J6RH 5AVTB 2MCMA 1FNAA 4AWJC 1FL3B 1SDDB 4QT5A 4P4RA 2DF3A 2EIMB 3MOBH 4HS6B 1B4LA 4XPAL 1SHSA 5CP7B 3VXMA 1E4XL 4LSUL 4D9RE 2JELL 4MD0A 4F7EA 4X9FA 1H3PH 4NZTL 4GAJH 1A6UH 2P24B 4HBCL 2GG1A 2BRRL 1XMEB 3I3EA 3VG0H 3HC2A 2IALA 5FECA 1JVKA 3F6LA 2ZONA 3GXNA 4GG6F 5BVJB 3ARDD 1QSED 3WV0A 1G0YR 1ONQA 4WUUD 3VVWA 5IK3A 4GI9A 4P06A 4QTFA 4BGLA 2F08A 2GJ6D 4HMDA 5I0WA 3OXSB 3JYCA 3JV6B 3KGRA 4X5PA 4PJXE 4P2AA 1KYOJ 3H9HA 2Y07H 3KL5A 4QHNA 3PWUA 4V1DE 2BP0B 4ZUUB 4MYPA 3S0PA 3P3RA 5L8KB 4KRPB 2XRAL 5FA4A 1LEIA 2QVKA 3SKUD 2JXMA 5CSGA 5T1KD 5CR8A 1BPLB 4QNPE 5IJCC 2J43A 1KPUB 2V3EA 3OLDA 4UCFA 2Z1PA 2AK4B 4YSOA 1RZ7L 1BVKB 4X50A 5C3TA 2DQHH 4OFIA 5CHNA 2NTSP 2A3TA 2D7TH 3WXVH 4CU6A 5AVZB 3DGCR 4YHML 1QP1A 2JKJA 1A6ZA 1QMUA 4LLWB 2BOCA 2GK0B 5AVUB 3DOSA 3D08A 4MFHA 1L6XA 1VACB 5IVXE 1IBGL 3NABH 1NJ9A 5KYUA 1MIEH 4PB0H 2ENSA 2N56A 4KXDA 4PB9H 5EEUA 1EJOL 4HWZB 1EPFA 2OTUB 3ARGA 1A1NA 4YO0B 1SBSL 1E2ZA 5EU4A 2VXTL 4PRHD 2FO8A 2R4SL 3BW9B 1I8UA 5CIPH 5L2KB 3S88L 1C5DA 1DVUA 1YQVL 4KKNA 4IRJD 1IBHA 2XQYK 2C3GA 3BH4A 4NRXA 3BMVA 3KYKH 4W9JC 4LPYA 1N10A 4WI7A 4JREC 2WQWA 4FFWC 3DRTB 4XO9A 1TTFA 2HKHL 4Z5RA 3KH3A 3NSJA 4BFOA 5D1XB 2O93L 3II1A 4WU7A 5CEZL 4JRXB 1RVFL 5HDBF 3NSXA 1S3KL 4PMFA 5J11C 4X6DA 2HFEB 4NCDA 5A6MA 3ZR5A 4B3VA 4AJYV 4OF6A 4NZUL 5FFGA 3DKHA 4JQVC 4JKWA 3T0EA 4O4YH 5ETUB 1DBBL 4MA8L 3MOAL 3QHFL 1E7UA 4M5ZL 2ZUTA 5B7MA 3L6FA 3AS2A 3SO3B 5B1AB 3HE7C 4BKLB 4B60A 2WBJD 32C2A 2VISA 6CGTA 4ZAKC 4ES9A 1E8ZA 1JZGA 5DEGB 1NICA 1Q0EA 1T1YB 5EBMB 1KN4L 2CCVA 1Z3GH 3OZ9H 1XSJA 2LAGB 3ETBJ 3MNZA 4OCMC 3T3MF 3F7VA 2BVUA 3QZWA 4ZJ9A 5KTEL 4F80A 1HNFA 4J4PC 4N8UA 4CW1A 1CD9B 4JFYB 4X5WB 4JFXA 5AW0B 1QWHA 2BOLA 3GUFA 4XZUA 3MUZ1 4JZJB 4XOEA 2IMMA 4Z7VA 3L9RB 2PETA 2DI7A 3MHZA 5GSRA 1TZHB 3CVHA 1PYWB 5JPNC 1XAKA 2NY3B 3SY6A 2D7NA 5C09B 3O3DA 2D8KA 1KB5A 2X4TA 2D31B 4PGJA 3DIVA 4RAUB 2BWQA 2NNRA 1AG0A 3K0WA 3CHQA 2WIIB 5CEXB 4GUQA 2UX7A 4A04A 5JYLA 3M86A 2JF1A 3NCXA 5DD5H 3DIFB 5CJQH 3N1QC 4GMSL 1AD0B 1I1AA 1YDPB 1EERB 4G7VH 2EIZB 1J9RA 1NAKH 2F7RA 1II4E 3CC1A 1ICTA 4JFEA 4PJ7E 4B9ZA 3BQUA 2NXZC 3HNSH 3TNMB 1MLBA 3EXLA 1JTPA 4PUBH 5IJVB 2YQ2A 1DJGA 3RU8L 2ZKWA 1AD9B 4I4WB 1SDAB 2XETA 2AF2A 2I24N 3D39A 3L3KA 1JXJA 1ECYA 1WWWX 2XLLA 4K9JA 1X7QA 3QJTB 4P49A 5KUMA 3WFDL 3L3IB 4IKIA 3QA3B 4MSWB 1OALA 4OW6A 1G7JA 1B0WA 1NFAA 1G7PA 5GS2D 1FC2D 2HFGL 1R47A 3EYVA 3L3JB 3BKJH 3NCWA 4Q56A 4WY7H 1EHLH 2EUXA 2NY7H 3MROB 4NO5B 1WFUA 3FUFA 5JDJA 1IAOB 4P3DA 4S1DD 5AALA 4V1DD 2W92A 3PJSB 4TSBL 2IEPA 3KWWA 3D12B 3KDPB 3P73B 4J3OC 5F7YC 5IMKB 4RMUA 1FLTX 1NCUA 3PGDA 4B5ZA 1NA8A 5L8LB 2Z7ZA 1M2OA 4YAQA 1TCMA 3NQKA 2VDML 5C86A 1P4UA 4OFDA 1ETJA 4G43B 5F70A 3C5JB 2R56L 2I9LB 4GEIA 5I76B 4I0PC 4RDQG 4N6QA 3CC5A 4GMTL 2VLRA 2YD0A 4HJ1A 3F8UB 4KXAA 2Y06L 3HHSB 4RMVA 3V5DB 2SODB 3LNIA 5EO1B 1OGPA 2ARWA 4OLXL 4V2BA 3S36L 5JQ6H 4X6DE 3K2KA 4L4JA 5F7MC 4ODSH 2AEPL 4RMWA 3T0EE 1HHJA 3IETA 3D07A 1AO7B 4OFQA 3TT1H 5CJ5A 5I24A 1EVUA 4Z3TA 1ZHBA 4ZDHB 4FLRA 2EKSB 1UA7A 3T9WA 3O2DA 4IKKA 3WL9B 5DJ8A 3ARBB 5EZJB 5K1NA 3VU2A 4FQHB 4MTMA 5DQDL 2Z34A 4CDHA 2A83A 4TM9A 3X1FA 3GPEA 1XQ4A 2F0CA 3UTOA 1AXSB 4H8HA 4NLHA 4P5TB 2CK2A 5CCJA 5CR1A 4OT1L 4AYGA 3MRFB 2W91A 1U8HB 3IDMB 3PV6B 3EJJX 1B3JA 3S2CA 4OI9A 1CLYL 4ZUVB 4XPGL 4NCC1 4HUXA 3KGTA 4WO4C 3BX7C 3SPGA 1DO6A 2HJLA 1AVAA 2OW7A 3NA4A 4HK3J 1RP8A 1OXYA 3MRCB 3HB3B 4ADJA 1PD1A 3O6FB 4JM2F 4BWWA 2OCFD 4ZXBA 1F4AA 2WQVA 3X11A 1M6UA 1EAPB 3GPSA 3S3BB 5HJGA 3KCWA 4K07A 3IJ8A 1L9TA 3OPZL 1CXEA 1OIOA 1VEOA 3GMLA 1IGMH 4P4KD 4N22A 4P57B 3O4OC 5FUOH 4DKDC 1JSYA 1UURA 3TJPA 3U1PA 5CIPB 3T8VA 1F6LL 4NRYB 1J0JA 2CPUA 2YRBA 3ZVVA 4JFEE 2K4WA 5DRZB 5JHLA 2BZ7A 2DJMA 2BS8A 4LNVA 1PMYA 5HJ3B 4OLVL 3QUMB 1G5AA 4S11A 3TBSA 3KPNB 2ARJQ 3MACH 3D39E 1CT8A 5T1JA 5HHNB 3J07A 4PU2A 4AVJA 1UKTA 2IPKA 3ILDA 3RX8A 3PXHA 5EIQA 3BAXA 4DKTA 5C8JA 3ZE0E 3WDJA 2VXQL 1W9XA 4PJEA 3T0VA 5EC2A 5I6MA 1A14H 4R4FH 3L9BA 5BJTA 5EPMB 1KJ2A 3ULVL 4FQXC 1WZMA 1JXGA 5FLUA 3KAAA 5JW3H 3H7BB 1SLVA 2Y5TB 1S7VA 2VLJA 4Z7IA 3FQ2A 4OCRL 2FH6A 3T1FB 1K4DA 2WNGA 4K3DL 4QHUB 5JDSB 3KLKA 2W0FB 5KYWB 4KTDL 1S5IH 4F15B 2FNWA 3WLWD 5G4MA 4IHBA 3MLUL 4I18C 4GH7B 4RVBA 2YD2A 4MDJA 2P8PB 3ULSA 2OZ4A 4G8FB 3L1EA 3PAVA 4RFEB 4LLYA 2VLRE 2F53A 1Z7JA 2VZOA 5CP3A 3TA3A 4DERA 1DN0A 4YDKL 1JGLH 4O00A 2HKFH 4PG2C 3PFUA 4TSAL 3GRWH 1F02I 4MDIA 4OV5B 4XMUA 2XY2A 3CN1A 4UM8A 4DOHE 4HT1L 5I5RA 5IV2A 4F2FA 4AT6B 2WXQA 4I9XA 4N8CL 4LSSL 4X8XA 3OHXA 5FHBH 1YEIL 1OTTD 2WGNB 3TV3H 5C0RL 4PR5A 5GIRB 1ADQA 4TQEL 5LDSA 4OJEH 3RZWA 4BSVB 2DMCA 2VXSL 1UWEL 1YJDC 3T6XA 3GLEA 5BV7H 5E4EB 5C0IA 1DYZA 3GK8H 1U8CA 1U8LA 5AZEL 1B0GA 4IKJA 4QGTA 5E1AA 1O75A 1MRDH 2G2RA 4HIHA 1J48A 3ZL4H 4DFHA 2F5BH 3FFOA 5EZIH 3SDDC 4CADB 2XPGB 5JNYA 1OSYA 1GR7A 1U4EA 1HIMH 1KTJA 3V9FA 1MPAL 1NDTA 4JG5A 4ZO7A 1MWAH 5DK0A 3F05A 4C4KT 3O3AA 4L1BA 5HDOA 4I85A 4G72B 3TIDB 5TQ2L 2XUWA 4DPCX 4KRLB 4M03A 4CVZB 4X7FC 5KVDE 1ZLVK 5FAAA 4H0IA 2B14A 4L3EA 4A2DA 4YGVB 3MA7A 2R1YA 5ILTL 4NJ9L 1RUPL 4Y5XB 4EKJA 4G1EB 4YZWA 1JYVA 2HMIC 1PD6A 1PEWA 2JLLA 2E76C 5DUPL 3GSNL 3IDJB 2WYIA 1FGNH 4MJ5B 5DD1H 4I89A 1WITA 4RRPG 4JPKL 1WWBX 1A6TB 5EU6A 4D3CH 3QUZB 1G9MH 1PVHA 2R0LL 4X4KA 2GBAA 2F7QA 2XQYG 3BHBB 3U1QA 1D5IH 3CFJA 1R24B 3BP4A 5CCKH 3TPUB 3REVA 2E7HA 2ZXCA 4FQCL 4O5LH 3TBTA 4NPYB 2ENQA 1QPPA 4G3YH 4PJEE 5GGSA 4JMNA 1U0QA 4L1LA 3BJ91 2ZXAA 2XZAH 3GWJA 1RZFH 3QEGH 3ZGHA 3BPCB 1MCOL 1I1AD 1TENA 4PGBA 2CK0L 4ATTA 2VLJE 4Q6KA 1AS6A 4YHNB 2IFGA 3BQUD 3CFEB 4C8XA 3L3DB 2YK1L 4U1IB 4U6YB 5GPRA 3VH8A 1ZHLA 2UXTA 4PJ8C 1KIUA 3U7WL 1NBYA 4E42B 1O9WA 1U8OA 1K6QL 15C8L 1V7NL 1YEKH 4NUMA 5GZND 3D39D 1C7SA 1M7DB 3UBHA 3QEHB 4DFIA 1MFMA 4HD9A 2F53E 4WWNA 1FL5A 4TF4A 35C8H 1YC7A 1GC1C 1MHPH 2C3VB 1NCDL 3PCYA 3RZCB 2FX8H 4U1JA 3BAEH 1RXLA 4IKNA 4N9OB 5EMYA 2FL5A 4NNYA 1BMWA 2YMXL 2K7PA 1I7UA 3MJ9H 4UQAA 1NQBA 3TBYA 1TYRA 1VGKB 2FCBA 5EIIG 1KLFA 3FT4A 4PLJC 1E4JA 3RL2A 4X4ZA 4ICWA 3KBPA 5E08H 4KTEH 4CL7A 4LZKA 1FNGA 1NAMH 1PKOA 3P11L 1CXIA 5J13C 4UT9A 2R1XA 3TCTA 2HN7B 3QDMA 3NRPA 1XF3B 2LU4A 3ARFB 1M2VA 4GO8A 1R5WB 4F7MA 2O6DA 1T6WA 2A1WH 3FTGB 1K8DA 3H4FA 4Z3EA 3FQNB 2LLNA 2B9BA 2DEXX 4QHMA 5FUCC 4MJIA 1RZJC 2JV6A 5DVMA 2WO4A 3SDAB 1ZXKA 1U3NA 4FABL 4KOBA 3HS8A 4WEEA 4X8JA 2A6KB 1U8IA 4PJIF 2C7UA 2IH1A 3MRGA 4KUCD 1BD2B 3BOVA 5JLZA 1NCAH 4L3EE 4XRCB 4F93B 1XX9C 5ES4B 4KV5E 1VFOA 1O6TA 4M1DL 3U0PB 2BVEA 1TVBB 1QO3B 1A7NL 3WY3A 1CUOA 4FNLL 3UTQB 2GUOB 3QJXA 5DEFA 5AB1A 3DDGA 4S1RL 1T1WB 3G3LA 4QRSB 4IBUA 5E6ZA 4ZTEA 2RALA 3KEHA 4RWHA 1TSHA 2Y25A 3OSVA 3KZ8A 3KL0A 2UY7B 1ZLUK 3CDFA 4IOFD 1I8LA 4TLSA 2WNWA 2X12A 2HRPL 1Q0YH 2AEQH 4M8VA 4ZXBD 1UQSA 1QOKA 3HN8A 2EACA 4MNHA 1WCQA 4WNQB 2XIBA 3P69A 3GS0A 3OGOE 1AY1H 1FSKB 3VRJB 1JGDB 4BUHA 4N6RA 3H2QA 5SWZA 5IHBA 2DH3A 4U0QB 4RFOL 5KBMA 4QO1A 3DETD 5D7KE 2BIMA 3LIZL 1NCGA 1PBYA 1OPOA 5BRZE 4DNLA 3ZKQD 3F83A 3KVQA 4QHKJ 4DAGH 4YHYC 5F0LB 2BIIA 3APCA 3BP6A 2OR9H 5BV7B 1ZT7B 4UIKL 3TJEH 4HQQH 1RIVL 2OCCB 3UL4A 4AG4H 3X12A 5IW3A 5ID0A 5DVPA 3Q43A 3IJEB 3L3OC 5PAZA 2Z7UA 3VD4A 3DX1A 3ZTEA 1OK0A 1P7KA 5AD0A 3GMOA 2ZCHH 3TEZA 4R26L 5LBSL 3LKSB 1FORL 5KN5B 5FO8A 4TYUA 3E6FB 3QDGA 4KH2A 3K72B 2YPLD 3VFWB 3K5SA 1YNKH 3OKEA 3DWTA 4QY8A 3BDYL 2VLJD 4L0YA 4OGAC 4GINA 4GKZB 1ZCRA 3ALXA 3RAJL 1KGXA 4BDVA 4P3CL 5GRYA 4G8AC 1FDLL 2FSEB 5HVWA 4N0RA 3HMXH 4JFOB 5DMYA 4OTXL 4APQB 5IJDC 3PL6C 3ARGC 4PJ5E 3PIQA 3QDME 3EJYC 5D4QA 1UFUA 5C1MB 3TA3D 2F53D 2YA0A 2H1PL 2P5WB 4HK0B 2FGWH 4WW2C 1PAZA 3OX8B 1ZLWK 4UF7C 3G6DH 1KJVA 4JO2L 1U8KA 1FUNA 3T77A 1LO3H 3SCMA 4KGJA 4DGIH 2ISDA 4KROD 4PW9A 4AEHL 4F8OA 3GFUA 1F6AA 4MJIE 2LVCA 2AK1L 5J1AB 1S7QB 5KBNC 1CGWA 3CDZA 3QR1A 3HZVB 2DLFL 4LCYB 4HDIA 4TTDD 4ANUA 4G9DA 3S4SG 1ACCA 2AXHA 1KCRH 2F15A 4AQ1B 3O81A 5K9QG 1RZKH 4ZUSB 4FA6A 3T0EC 5DHVA 1CGTA 2JKLA 3FH5A 4RGOH 4DPRA 4GG8B 2VC2H 2RBLA 1FAKT 1R75A 3IXTA 1ZWIA 2MCPL 2CDGB 2AGJL 1DEEB 2VITA 3ARUA 4MXWL 5E1QA 3D3VB 3ZOAA 2DL2A 4QTHB 4RMRA 4TUKH 1SDDA 1FH5H 1X44A 5LBGA 4HS6A 5H94B 5CP7A 3MYZA 3NIFB 4QAMB 1XCQB 2D2CC 2PYEA 2WSDA 4LSRL 2XA8L 4ORZC 4Y5VB 1CDGA 2P24A 2P52A 4OCXL 4FLQA 2ZWLT 1JERA 3U2JA 2Y1AA 3NH7L 3OKOB 3BCDA 4L3ED 3HG0A 4M1CD 3MUY1 5E6IC 5BVJA 3ZE1B 3SGKA 1F1AA 5A40E 3CX5K 5SWZE 2VRQA 2R39A 1WAAF 2NXYB 2IDSA 3OXSA 1FZOB 1FIGL 3LHPL 4N87A 4QRUA 3X1GA 3ZMRA 2V2TB 1JI2A 1ZT1B 3E2HB 3QB7C 4ZUUA 4U31A 5C6TL 4WTQA 1ZDQA 2BXZA 2VO5A 4QXTB 5KSBB 1FBIH 1KZYA 1CURA 1E4HA 1JHTB 4A7QA 5DS2A 3BKMH 5DJ2B 4DGVL 1KPUA 1P4BL 3BQUC 2AK4A 1D6VH 1BVKA 1JZ3A 5IHLB 1FP5A 4E9SA 4CN6A 3N3EA 2BNQB 1F56A 3U6XA 1WHPA 1XZ0B 2VZTA 4LCCC 4IU3A 4XNMA 3ZZLA 3QDGE 1BECA 3EOBA 2HH0H 2Q8BH 3LV3A 4H44C 3ABMB 4WHYG 1VACA 3LZQA 4XP1H 3UAFA 5BRZD 2OXGB 3NJLA 1MLCA 1DBKL 4JQXA 5IT2L 2NR6C 5TK4A 1KPVB 4ONFL 2OTUA 4NZFA 2AJXL 4XHJC 1KCUL 1X5ZA 2AQRA 3EDFA 1NMCB 4WAFA 3BW9A 3MBEA 5ABZA 1DQMH 3N1PC 5L2KA 1AXTL 3C6SB 2Z4TA 4K8RH 2X6BA 2MFNA 3ECWA 4IJTA 5EBWA 2F1BA 5CZKA 5JOPE 2BY3A 4YC2B 3GIVA 2MTAA 5CCHE 3DRTA 3WUWG 3ESMA 5AUMB 4UAOC 3NRFA 4GKLA 1YZZA 4LVNB 5D1XA 5IHZB 3UAAA 2CBTA 3BVWA 4HH9A 4JRXA 1IUZA 4XMKL 1PFOA 2PR4L 1IJNA 4LL1A 1KIRB 2HFEA 2I7OA 3BVVA 1UJ3C 3RNKB 3ZYJA 1KJMB 5GJSL 5ETUA 1LO5B 3CZFB 4PJ5D 3S2AA 4IMKA 2OP4H 3TO2B 3TL5A 1S7TB 3L1OL 2LGNA 1XSOA 4A37A 1YY8B 5IQ7L 4I2XB 4AK1A 1NPJA 1I9JH 1UACL 4A6YH 1QQDA 4JO5A 1BBDL 3X13B 1UB5B 4L0ZA 2UVEA 3KPQB 2NNAB 5D72L 4DP6X 2NRDA 2VN4A 2J25A 1QBBA 1T1YA 2CM6A 3AQYA 1WDAA 1FFPB 5EBMA 3L4ZA 5JIMA 3QIUB 4MJID 4NKMB 4GUCA 2MMXA 3Q13A 4FI6A 2GC7C 2PXYB 4W9FC 1EZLA 3ABGA 3OKNB 4UV4L 4F58H 1UWFA 4LIQL 1V55B 3W56A 4JFYA 2BHZA 4M8RA 2K3HA 4JZJA 1NGWB 5HVGB 1E27B 2A7BA 4PWJA 4L05A 3L9RA 5E8EB 5EOTB 4J3WA 1OZUA 1RUKH 1TZHA 3HPLB 4Y19B 3FTXA 5H8DA 4WCYH 2D31A 5LCVH 3EJZC 5IMMB 2N0KA 5L2JA 2WIIA 4F2MB 4IU2B 5CEXA 1MH5B 2N1TE 2QL1A 4JZOB 3V0JA 2P8LB 2HUEA 4YDMA 5A2BA 4Z9KB 1OAUL 1YDPA 3B5HA 2EABA 2XV6B 4NO3B 4ZPTB 3VFVA 4LSPL 5JQHC 3FH7A 1Z5LB 3Q6GH 4FQ1H 1N2RB 2ZCLH 3ZPDA 3NA9L 5IJVA 2AK4E 2J7LA 5DU7A 1AD9A 3R4RA 4I4WA 1BQLH 3I02B 2XU9A 3OF6A 1AKPA 5EO0B 4OF7A 3QA3A 4MSWA 4NQSB 3S5LA 2JJUA 3BC9A 2VSMB 3MRRB 2KMWA 4GQRA 1CBVH 3ML8A 2APSA 4TXVB 1TJHL 5SWZD 1LO2H 1YMMB 3ROLB 3L3JA 1BYPA 4F27A 3MROA 4NO5A 1IAOA 4LOEA 2TAAA 4XVTL 1LL1A 2Z8RA 1HL8A 1Q90A 3PJSA 2AW2A 2R0ZH 3P73A 4U05A 5IMKA 2ZP9A 3C8HA 5E9DB 4A68A 2V37A 5E2WH 3VGEA 5SWQB 1JZHA 3FOMB 1AI1L 2BY0A 1J0ZA 1U92A 1A7RL 5L2KE 2J5WA 3F2LA 4FTDA 1EFXB 5FDYA 1VFAB 2ZP0T 4G43A 2Y9RT 4JDZB 4RLDA 5F9OH 2I9LA 4NKOA 5I76A 1XB8A 1PKQB 5HYFA 5D1XE 1SY6H 4JRXE 3HHSA 1W6LA 3V5DA 5EO1A 5T1DL 2QPEB 4XP9H 1JPTH 2BVPB 3D85B 3TBCA 4ZW7A 3C5ZB 2WKLA 4MJ4A 4M29A 1BMZA 3ZX1A 4AQOA 1AO7A 2F19H 4AZ8B 5K9JL 1RD6A 3I6LE 1HHGA 4ZDHA 2E6JA 3ZTNH 5F96H 4HCRA 1JF1B 2AZAA 3OHXC 3NUKA 5I30L 3WL9A 1JGIA 1T1XB 4FQHA 2J44A 4FDWA 3D0LB 4K3JL 1FNLA 2BVTA 3B2VH 3SCMD 5JOPD 1OSZB 1QI5A 3UTTB 1AXSA 5E2VH 3MLSL 2FT7A 2WO3B 1ZLDA 4PW3A 1R4XA 4K9EL 1FYTB 3MRFA 2WW8A 2EADA 3GXMA 3IDMA 1U8HA 3PV6A 2EC9U 3MXVH 2WJ5A 3CFCH 4PHXA 2KDGA 1H3VA 3MLRL 3NDYE 2EDHA 4XBEH 1G9NH 4JG1H 5FM8A 2VRAA 4S1QL 1G84A 3CUPB 3RVXD 4ZTOL 4L3CB 5GS0C 3O6FA 3TLRA 4AE1A 5AYUH 2DQGL 1EZVX 4RBPH 3PUUA 5C09E 3BN9D 1HKFA 1YA5A 2PWDA 4PJDB 1LM8V 5FYJH 5JOFB 2D73A 3LEYL 4R97C 2V2WB 2YWZA 4ZFOB 3GKWL 2E3VA 4PP2A 4D9QE 3V4PH 4M1CC 4IOIB 4P57A 4HOWA 2ROYA 2OYPA 4OFKA 2KZBA 1HINH 3KYMB 3BE1H 5CIPA 1NEZG 3L8QA 1MRFL 4NRYA 5TE6H 4U6VH 5DRZA 3TXAA 2WAQA 5C07B 4BH7B 1YUHB 1LE9B 1UTDA 5F7WC 3RVWD 3QO1B 1SOSA 5HJ3A 1WS7A 3T08A 1IL1B 2EYSB 3IBOA 4FZEL 4WGVB 4J8RB 3KPNA 1T0OA 2BHFA 3LVEA 3SEPA 3TFBA 4AVHA 3NN8B 3WTVA 5HHNA 1TO5A 4JCWA 1MW1A 1CLOH 3FU8A 3HS0B 4XP4L 1BM3L 1RQ5A 4NWUH 4PCSA 1IAIL 1MFBL 3V0VB 3C8KB 3NJHA 2EC9T 3ARPA 5EF2A 2R0WH 4AK2A 4LL4A 1LD9A 3BZ4B 1VHPA 3VDAA 2CKBL 4K15A 1CGVA 5HY9B 2XA3A 5SX4I 3QI9B 2KPNA 5EPMA 1SOQA 1TJIL 4E41B 1A0QL 4MQTB 1G7QB 3H7BA 2Y5TA 4KRPD 1FA4A 3GEFA 4DGUA 5I18H 1N67A 5FS5A 1GYWA 3QXDB 5D5MF 1ACYL 3ZYOA 1FVCB 1O7DE 3INUL 3T1FA 4PGEB 3CXDL 5JDSA 3WS6A 2W0FA 5KYWA 5L9DH 4DSYA 2OTWB 5I8EB 1XH3B 3VTAA 4RISH 1HE8A 3UZVA 3I9GL 5CGBA 4PJCA 2P8PA 2D7OA 2F5AL 2Y2YA 4G8FA 4RFEA 3TYGL 2FEEI 1AH1A 1SN2A 4LCIH 1XCXA 1K4CB 2O72A 2FTAA 1KUMA 2ZNWA 4ANXA 2RQ8A 5TFSL 4L4TB 2OI9B 1UOWA 3V0WH 4OV5A 2OBGA 1MVFA 1URZA 4H5SB 4X42A 1RL1A 2ID5A 5JORB 5B7EA 4TNWF 4P99A 2L0DA 5CD3B 4AT6A 1L0PA 3F62A 1W6WA 1AO7E 1OCRB 1BBJB 2QVTA 1CE6A 5EN2B 4UYQA 4I77L 4JHUA 5GIRA 1A21A 3ULUF 3PV7A 1KYAA 4KXZI 4NDMA 2E75C 3MODL 1WP6A 1EFQA 4BSVA 3TX4A 4DP2X 1QBLH 3B2XA 5CINH 4F8PA 4A2MA 4HPHA 4Q7DA 4NBZB 3MA9L 4AMKL 1F0LA 3TASA 2VR3A 4HKZB 1SZNA 3JTBA 4TNEA 3EJUA 3ESVF 3O2VH 2QQNH 1UHVA 4POUB 2X4SB 5D1XD 2DDQH 1KT2B 2X6CA 4JRXD 1TZGL 2BPBA 2ODHA 3UO1L 4CU7A 1SJHA 3BLBA 2XPGA 4Y2DC 4LOUD 2HKAA 1A6WH 4P2YA 1EMTH 2WK2A 4O2EB 2AABL 2WVSA 2OYKA 3SGJA 1CK0L 3L7FB 1EAQA 3MSPA 2JWYA 3IPEA 2KS0A 1P7BA 3I6LD 3TIDA 4CVZA 1I8MB 4QLWA 2LLGA 5AOZA 4Z23A 4D8OA 4RNRB 4PJ9B 4WFEE 3VAEA 4YGVA 3MJWA 4WW1B 4JFVA 4KHTH 3IFOB 4TRPL 4E68A 5L0QC 4Y5XA 4KVNH 4PN6A 1MF2L 2DM3A 1CXKA 1KF9B 1MJJB 3FB7B 3C60C 4G1EA 5TDPB 2IGFH 2H2PC 4ODWB 1JNHA 2NSQA 3IDJA 5EF1A 1ZHNB 4MJ5A 2WXOA 2YN3A 1YHPA 3BP7B 5DUMH 2V9TA 4XPHL 1Q4NX 3FSAA 2X88A 1VFBB 3P4LA 4I3GA 3DX6B 4BFRA 1J1OL 4Y8DC 1VADB 1OLZA 3H1ZA 2X0VA 3V6OC 4R2GD 3TPUA 4FJZA 3W81A 5EULV 5AB9A 4TVUA 2AJSH 1I8LC 5C09D 4NPYA 5JIDA 4LHJB 4BFIB 3VU1A 1F90L 3MRQB 3QULB 5ANHA 4WIQA 4HPOL 5LXVA 5D2NB 1J8HB 5D96B 4F57L 4OFYA 3EH2A 1D5MB 3BPCA 4KO6A 4DPAX 5GISL 4YHNA 5LN8A 1LWRA 3CFEA 3GZPA 4ENZA 3L3DA 2X4UB 4U1IA 4U6YA 2ODIA 3HG1B 1EHNA 1KWKA 3V55A 2OMTB 4JPVL 3PP4L 4XPAH 2WXPA 3OF6D 5I1EL 1FFQA 1E4XH 4LSUH 1E3ZA 2JELH 4NBXB 4PJCE 1M7DA 2G30A 3OAZK 5B39B 4NZTH 1RK7A 1IARB 2BVOB 3K8KA 4LKXB 2BRRH 1QFOA 2XWJB 1SGKA 2YC1B 5KVEL 3VA2C 4RDQF 4MQXD 3QHZL 4K5OA 4UV7L 5F88A 3RZCA 4I5BB 2XZQL 4XX1G 4KVCL 1OLLA 3P2BA 2UXFA 4J3OG 1F2QA 4RX4A 4GIPD 5J6GA 4AV4A 1FFRA 2GK2A 4FLHA 4MKTA 2X3BA 3HZYB 1QRNB 4TLTA 1ZY9A 1J05B 3IRZA 2XRAH 4X7SL 2GJRA 1H9VA 3EYFB 4JR9L 1A4AA 3BFWA 4BD4A 4M8QA 4OCYH 5LDUA 1XF3A 4F7TB 3NIGB 1RZ7H 4M3HA 1JF5A 1BP3B 2YZ1A 3GS4A 3GTTA 5IVOA 3NDZE 1J5CA 1TVDA 4BQ8A 2YMOA 3FQNA 5FC9A 4YHMH 3QJFB 3SCMC 1AMYA 2R9HC 4AYID 2B4CL 3TBVB 2H3NA 1Z1WA 4W9IC 3SDAA 1AO7D 1IBGH 1WO2A 1Y0LB 3F7YA 2A6KA 2KLTA 4M3JA 5EF0A 4JQIL 4F37F 3DI3B 1GKEA 3HMWL 4AE0A 2H4EA 1EJOH 2O5ZL 5DC0A 4ABWA 1BD2A 2JJVA 2F8XC 1SBSH 2BERA 3ARBD 2VXTH 2EDFA 3FB5B 2EZ0D 4XRCA 3SQRA 2GW5A 1BG9A 3G5XB 1AACA 2R4SH 3IGFA 1G87A 4GPVA 4D94A 4EN3B 3S88H 4XNDA 1NGXB 1KDJA 1YQVH 4H1LH 1QUPA 1QO3A 4P5TD 3U0PA 1NGQL 3UTQA 2GUOA 1FWXA 4P04A 3W39A 1T1WA 1HHIB 1G1KA 4XVJL 2KERA 3FW6A 4QRSA 2BCMA 4MRBA 5MI0B 2HKHH 4L1SA 3GJEB 5JPMA 2F8OA 5CEZH 4B9JA 4Y9GA 2UY7A 3EHBB 2JMRA 1HTYA 1S3KH 3NACL 2EDLA 3HB3D 3O6FD 3UG3A 3V4UL 1LP9B 2GKIA 3BFOA 3NK4A 1GW6A 1FO0L 2VYRE 4NZUH 4WNQA 3LKNB 4GQZA 3OR6B 4WFED 1VAHA 2ADIA 4MA8H 5DQ9B 3MOAH 2Y7NA 2AQPA 3QHFH 4G7RB 3A22A 4M5ZH 1JGDA 4HW6A 1E3XA 1S78C 5LAXB 3HN3A 3SGKC 3NAAL 5LUMA 5BVPH 1ZT4B 4Q6IB 2VDPL 1HQ4B 4AM0B 2D0HA 5KSAB 2X5PA 1QBAA 1ZT7A 1KN4H 1WYJA 3CFIC 3IKCA 5TDOB 3N42B 1CZ8L 1KYOK 3K3QA 4HIQA 1ZKAA 5KTEH 5LXGL 3IJEA 4KRPC 2N7SA 1ZPUA 4PGCB 2F54B 3PABB 4JHVA 1IJ9A 5HYSG 4M02A 3CN2A 4GXFA 1SNRA 1VLXA 3LKSA 4KMTL 2G9KA 4JANB 1R3HB 2DTSA 4WKZB 5KN5A 1F58L 4TUUA 2IV9A 1TEYA 5BUAA 2JKTM 5C0CB 3VFWA 4EE2A 4GKNB 5D6CB 2GEQA 4GKZA 1B6DA 3CLEL 2AC0A 5DC4B 1XGUB 4JQXC 2FSEA 4ZMYA 4GMSH 2VR8A 1Y18B 4JFOA 1V3JA 4APQA 5JXAL 3KWXA 4I48B 1W8EA 5F3FA 1QX1A 5BZZA 2WGXA 3O45B 3MBEC 1W2KT 2P5WA 4HK0A 3EF7A 2NY5C 4B7IA 3OX8A 3WFDH 3UBGA 4FL4B 5ABAA 4AW4A 1TOXA 1WZ1L 3SGEI 1YEEL 5AW5B 2IBZY 1Q94B 5J1AA 1LTXA 1XBDA 3J2PA 2EC8A 3HZVA 4LCYA 4G6KL 2VR4A 1CI5A 1FV1B 4TSBH 4EEEA 4CUCA 1BD2E 3KGUA 1MJ7L 3EGXB 4ZUSA 1JBJA 5DHXB 1NM9A 1RUML 3D6GA 2Y6TE 4Q9CA 1N59B 4IMKC 4GG8A 5FCSH 2VDMH 2YSTA 5D4HA 2CDGA 3LZRA 1CLCA 3ZRFC 3SO3C 1DEEA 4HJEA 1UUSA 1QTSA 3D3VA 1AZRA 2VDRH 3EG9B 4GMTH 1BZOA 1DBJL 5AG9A 1X5IA 1MHHB 4MHHG 3K7UA 3W5MA 1F1DA 2Y06H 4L18A 1XGPA 1WD9A 1XCQA 2PO6B 2WVTA 3MRLB 4OLEA 4OLXH 1D5ZB 3N42F 4YFLF 4Y5VA 2AEPH 1M9WA 4M4PA 1IBDA 3TV8A 2X53A 3OKOA 5BQ7B 5T3ZL 4QRQB 1QHPA 2HVBA 1U8PB 3MJ9A 5C0GB 1NMAL 3K6FA 3NIDB 2ICES 1CICB 3CDCA 2NY3C 3RTQB 3LQAC 4YGAB 4TVSa 5DVLA 2V2TA 3IMTA 1D9KB 1ZT1A 1NAMA 3H3BC 3JWOL 1OQOA 1MQKL 3QUZD 4HETA 4OT1H 4QXTA 3D2UB 5KSBA 4CSSA 1JHTA 3S5YA 5GGQL 3B3IB 5DJ2A 1CN4A 2FLBT 4MVBC 1AQKL 4OVVA 1CB4A 6PCYA 3A6CL 3AGWA 1RK0B 1ERNA 3CFDB 4GSDL 3HLAA 2VUKA 2BNQA 2VABB 3OL2A 2Q7AA 3ROOB 3IJSB 2ZIDA 4ZNCD 4W70A 2B20A 1XZ0A 5I1LA 2VDNL 1MFUA 1EIBA 2ZF8A 3UJJL 2QTVA 4YFEA 4ALAL 2UZIL 2IBGA 4N2NA 1TTBA 2OXGA 3HPJB 2G3NA 2A2QT 4JY4B 1KPVA 5EZPA 1FH2A 5DA4A 1SM3L 2W0LA 4H1LB 2GTWB 2Y2TA 1LEKB 1WFNA 4NN6C 1TQBB 1MCNA 1HN1A 3DX0A 4OGXL 1AYOA 4IRSC 1HE7A 2AERT 4GO6B 2YA1A 1BVNT 4OLVH 5FKPB 1VCAA 3C6SA 4RSVA 4WJKB 2XPZA 4KPHL 2P5WE 1XD1A 3EF4A 2LU3A 4PHZA 4XVUD 3FO9B 2XICA 3CBJB 3DMMB 4GW4B 2F2HA 1RKRA 3IWUA 2B8OT 3RZCD 4LRIA 5AVWB 1ZVSB 4JDEB 1VCBC 3HCVB 2VXQH 5DFVC 4FFVC 3FQRB 4PP1D 1WA0X 1FHGA 1TTAA 1GS7A 1J0HA 4RX4D 1P1ZA 1CD8A 1KIRA 3ULVH 3H0TB 2Z93B 3RNKA 4MNGB 3IMSA 1E8WA 5KS9B 1LO5A 4HV8B 3QVAA 5FW6A 3CZFA 2MSPA 3WIFB 1NFDB 4OCRH 1S7TA 5B1BB 3CHPA 4WSKA 4K3DH 1YY8A 4GBXA 4F8LA 3ARFD 4I2XA 4KTDH 4LK4A 4TULL 1UB5A 4B9CA 1I7ZA 3MLUH 3NIDF 1MRCL 3D3VE 3KPQA 1FGVH 1HESA 5FM4A 3HIZA 1FFPA 4W9GC 1KWGA 4NKMA 2YBGA 1XF4B 3LJ3A 3VYNA 4YDKH 3SDAD 5H4ZA 3FULA 3NIFE 1V54B 3OKNA 1TQSA 2BO0A 3UGXA 1YPZF 4DZ8B 1BD2D 2WLJA 1E27A 1Y6NR 2DJ4A 4YPJA 5E8EA 4KDTA 5EOTA 4LSSH 3ZE1E 2W07B 3HPLA 4Y19A 4P8QA 1YEIH 5C0RH 1BEYL 5A2CA 1QASA 1HQRB 2ZWSA 3HB3C 2IADB 3L13A 4TQEH 4YUEL 2VXSH 5DK2B 3CZNA 4UUJB 1UWEH 1GIGL 4WI9A 3HMXA 1UG9A 4F2MA 4IU2A 1E5ZA 3UERA 3HUJB 4JZOA 3SKJL 4RAVB 3G6JB 2HA1A 2P8LA 5DJZB 2ZD0A 4Y4HC 4NUQA 3LRSB 5AZEH 3IDGB 2X2YA 4NO3A 3BD5A 5KSBE 1VRSA 4A7VA 4RMBA 1Z5LA 4W4NA 1AHMA 5DJYB 1RH8A 1UENA 4GRWB 3CFKA 4XP5L 5KSVB 3HVNA 3US9A 2X70B 4A66A 3ZN6A 1ZA6B 2BNQE 1MPAH 2J88H 3LN5B 5EO0A 3FUDA 2BIQA 4XBGB 3SPCA 5FWRA 4OJYA 3QUGA 5KVGL 3MRHB 1XO8A 2AQ3A 3QCUL 5JIHA 4FC3E 1CGXA 5TQ2H 1PIFA 3QXWA 1YMMA 3PPSA 3ROLA 3MV8B 5FOJA 1PX3A 3VXTB 3SPJA 4CJ0A 3HHRB 4IRZL 1E8XA 1SFHA 3MKKA 3CVBA 2A77L 3TJHD 3BUTA 3OKMB 5ILTH 3CFQA 4NJ9H 1RUPH 4U1HB 2IG2H 5E9DA 5DUPH 5TDNA 3MGAA 5SWQA 3GSNH 2YXFA 1ANUA 1S6NA 3FOMA 4E0RB 4PBXA 3PHOB 1E67A 1HWHB 3K80A 1B0RB 3GKZA 1DVFC 1EFXA 3L95B 1NFDF 2VDRB 1VFAA 3QJZA 4JPKH 4WNJA 3DO7A 2BDNL 5KVFL 2R0LH 2FX7L 1NDMB 3WS6C 3VTMA 4JDZA 3RX9A 5E2UL 3FQYA 4UDUB 4ZOBA 3QUYD 4J6IA 1PKQA 1IGJB 4FQCH 4BUGA 2BSEA 1ML0A 2WY3B 1A7QL 1NH6A 5F21B 1ZLSL 4HWUA 1VGEH 2BVPA 1BZDA 3D85A 4MMXC 4L2YA 3C5ZA 1DCLA 3DTUB 1MCOH 4EIUA 5A16B 2CK0H 4APQD 3HNTL 3WDHA 2UY6B 4ZMWA 1TPXC 2YK1H 4YHOL 5I1CL 3U7WH 4A2EA 2CCLA 1UM6L 2DBJA 2IGLA 4HIJA 1JF1A 1K6QH 3FFCB 3QXTA 4I2XE 4N28A 15C8H 4NIYE 3V4VB 2JKRM 5I71B 1IV8A 3S3CB 1DE4A 3NJNA 1V8HA 4XNUL 3D0LA 2C1OA 2ZYHA 1BZEA 5DMJB 1OSZA 1C9SA 1BSIA 1SJVA 4WO0A 3QQ3B 5J9PB 1PQZB 2WBKA 1DQIA 2EINB 3E1F1 1FYTA 5E4EC 2OJEB 3B9EA 1IEBB 4BE5A 1NCDH 2AXGB 3VNZA 4Q9RL 3JZ7A 3Q01A 1USQA 2W94A 5JTWA 1IX2A 3QEQB 3S3JA 2AJZA 4GRWF 4EUPH 2YMXH 4MXVE 4NI6A 4YIQB 1Q9LA 3ZRCC 4DEPB 4OGYL 4Y19E 4L3CA 1A3LL 3SGJC 1HX0A 3EBHA 4J2XA 2W38A 4PJDA 1A9EB 2ICCA 2J73A 5JOFA 2KI6A 4URTB 1LDSA 5HD8C 2V2WA 3FAXA 1DN2A 2XX0A 5DUBB 4ZFOA 4F2ME 2NYYC 3P11H 2O26U 3ELQA 3LRMA 4HSCX 3D3VD 4X98B 2AV1B 1GJIA 4IOIA 3QQ4B 1ODUA 3EKCA 2WSKA 4P5SA 2OL3B 5J06A 1R0AL 1PD0A 1YRKA 3H3PH 2W9EL 3ZY7A 1W0VB 1HOCB 1JCKA 2H9GB 3BGFC 5C07A 4WI4A 4BH7A 4HWBL 1LE9A 3QO1A 1CPUA 3KLLA 4EPSA 2EYSA 1T6BX 2L3BA 3QZWG 3LMJL 3N41F 4J8RA 3NZSA 4XWOD 3B7SA 3OWRA 3HS0A 5CMAA 3T6ZA 5DD3L 1A7PL 1F4WL 2JQAA 4NQXB 3BT0A 3V0VA 1YMME 3LH2L 3C8KA 1JE6A 4NOFA 3AB0B 5J56B 1KXHA 2NXYD 1PZAA 2X3AA 3EOAB 5I0VA 3F12A 3GF8A 3LEXB 5C0EA 1LMIA 2AJVL 4W68A 2XOTA 5HY9A 3QI9A 2OSWA 4E41A 1UATA 4M1DH 2WCSA 3QRLA 4G6ML 5E9DE 1A7NH 1G7QA 3Q1EA 4FNLH 3ZDWA 4A6YA 3QXDA 4S1RH 3V0IA 1KN2L 1FVCA 3K6NA 4ZD3L 1UEMA 4PGEA 5I8EA 2FIRT 3UBXI 4OIIL 6FABH 1MQ8A 2ZG2A 3H53A 4Z7UF 3G5YB 3UX9B 2MCG1 5BO1L 4UMSA 4QHLB 4QI3A 2HRPH 1EDYA 1SOKA 1PKQE 1W0WB 1PW3A 3JWNH 3RWHB 3NBNA 4YLQT 1K4CA 4FNSA 1FN4B 1OF0A 4BSJA 4RSYA 3QQXA 1BXVA 4L4TA 4K71B 3LPOA 1E2VA 2M8XA 4U3SB 5F72S 5AW3B 5KOVC 3V0FA 2EH7L 4JO1L 2DMHA 4LKCA 4H5SA 5JORA 1EUUA 1U95B 4RFOH 3R7QA 5IJKA 1UH2A 1B9ZA 3BPOB 3LIZH 1QLEB 4U6HA 2NUTB 5LCVA 2APVA 4UOQA 3CXHK 3MJGX 5EN2A 5IW6B 4KJQC 2VZSA 4YZFF 2XTJC 3WSQL 4UIKH 5IEHA 3DJZA 1RIVH 2V6HA 2Q3XA 1UWGH 3FTVA 4FYQA 4QRTB 1KV7A 5EEXA 5E0FA 2CU9A 3N1GC 5G55A 1E3FA 4XCEB 1RUQL 3UTTE 2H3KA 2LW3A 4HKZA 5D9SB 4GRMB 4P23B 2X4SA 4JCLA 1KT2A 1EDHA 1FYTE 1Q9WB 3L4XA 4OQTL 3ARQA 4R26H 3QE5A 3GYRA 5LBSH 1FORH 1SF3A 4I8DA 4KKQA 3ESPA 5AKTA 5HGHB 4Y9BA 4AV5A 3ZDYF 5E5MA 2L8AA 2YKLL 4O2EA 3U2SA 5D1QC 1HU8A 1I31A 3TBWB 4XN5A 1HHHB 1JPSL 5B38B 3QRFM 3RAJH 3SDAC 4L23A 3SQOL 1FDLH 4PJDE 1I8MA 4D9LL 4MAYC 3HBZA 1XB6A 4IIZA 4RNRA 2R8SL 4OTXH 1A22B 2R2HA 2YBRB 3DGDA 2QR0B 5TPWL 3GSNB 4WW1A 1PZUB 1A1OB 1WICA 1DVSA 3IFOA 3F6IA 2P43B 5FDWB 2QJDA 3FB7A 1MJJA 2H1PH 3QIUD 5TDPA 4ZX3A 4AENA 4H2AA 4CJ1A 4ODWA 2OXHA 1HYSC 1V7MH 4JO2H 3ULAB 2PXYD 1C8PA 5C07E 3BP7A 2HRHA 2YUXA 2OMYB 4AEHH 1NM4A 1J5OL 4HAGA 1VFBA 3DX6A 1SY6A 2AK1H 3AU0A 3T8XB 1VADA 1X5JA 1CQKA 5JPMC 1T2XA 4Y19D 4L3FA 1K3IA 1DQJB 2GCYB 2P49B 3IBEA 4UQ3B 4LLUB 2VJXA 2IIJA 4BFIA 5FCUL 5J89A 5CJXA 4DZBB 5KANI 2B1AL 3QULA 2KBGA 4DK6A 1AR1C 2DW5A 4E41E 3PYCA 5D2NA 1J8HA 3GEWB 1C5CL 3BP5B 2FD6L 1D5MA 3KD4A 4DO4A 1AZVA 4E5XA 1NEZB 2MCPH 1UXMA 3QFJB 4OLZL 2AGJH 3N44F 3MBWA 1U58B 1K5WA 4MXWH 2FWOB 3WEXA 2X4UA 4C4UA 1MCWM 3HG1A 1W16A 5C0BB 3MXWL 3PGCB 2OMTA 2H6PB 3E9UA 2J8UA 2XQBL 1T0NB 3GHBL 3W2DL 2YD8A 5I28A 5K5YA 4LSRH 4U1SB 2FEDD 5B39A 1I4FA 4JFPB 3IJ9A 5E6SB 1KBGL 1XHHA 2BVOA 2DL9A 4OCXH 1YMMD 4X7DC 2E9JA 2XWJA 1KCVL 1RCYA 2YC1A 4YR6B 2IDFA 3NH7H 4MMYB 4L4TE 1N8ZB 3QGVA 4X0NA 2LHAA 4EUPB 2EEBA 1N70A 3F64A 4L1TA 2A73B 4I5BA 3KS0H 4AXWB 4BRJA 1HT6A 4KK8C 2HRLA 3WO4C 4ANKA 4LLMB 5E9DD 1FIGH 1MIML 3LHPH 3T5WA 1RPUA 4PLKC 5IBLC 2GUYA 3HZYA 1QRNA 2DJSA 5C6TH 1EFXD 1IM3D 2EH8L 1J05A 2M83A 2WUBL 1OW0A 2WIMA 5TK2A 4HBQA 1U30A 3EBAA 3MLTB 3ML9A 4D0BB 1TKWB 3EYFA 2AS5M 3K74B 4GI8A 3CVIL 1J5IA 4DGVH 1BG1A 2VQ4A 4F7TA 1P4BH 2C9XA 4LO9A 2DWTA 2BSED 4WHTB 3VFMB 2NY2C 1TTUA 2Q76A 2O61B 2RAMA 4FMVA 4QJ4B 2VDQL 3D85D 1IAKB 1G9MC 3C5ZD 3QJFA 4S2SB 4WHDA 3FSVA 5FFLA 3AWEA 1MG2C 1TJGL 4OZHF 2HG5B 2ICWI 1BOGB 1Y0LA 1DBKH 1DQLH 3FFDB 5IT2H 1QSFB 4XOAA 1OP5K 4ONFH 3WHE0 2H2SC 4PGDB 1B0IA 1KCUH 1TEGA 3HRZA 3PF2A 2ZPKL 5T1MB 3ZTCC 3G5XA 3NQIA 1HOEA 2PTUA 2BNRB 2EDMA 3RWEB 3UTTD 3US0A 4EN3A 4DUWA 2Q2EB 1AXTH 2QLYA 4TS6A 3HC4L 3HC3L 3CH1B 2BIOA 4XMVA 2E7LA 1FYTD 4PJGB 1GJUA 3BKYL 5FX3A 5DRXB 4AGOA 1HHIA 4FGMA 4EO5A 4MD5B 2X0WA 2ZE0A 3OAYK 4KNUA 3NSCA 3GJEA 4FQQB 1H6UA 1QEXA 2F7OA 4K3EH 2YGNA 2XG5B 2JQZA 4DP0X 4XMKH 3WDIA 3I74A 2PR4H 4NWTL 4YK4C 1LP9A 3RA7L 5E6RB 1MCHA 4LXFA 3APDA 3PAUA 3CGTA 4WJ5B 2BP8B 2ZT9C 4YN3A 5DQ9A 4A2LA 2C34A 3N43B 5JZ7D 5D2NE 1J8HE 4ZAKB 5IQ7H 5LAXA 4K3HA 1UACH 2IJ0C 1ZT4A 4Q6IA 4WZ9A 1HQ4A 2Q87A 1BBDH 4AM0A 1I1FB 4OIBA 3FHQA 5C07D 5D72H 1M9SA 2C8NA 5KSAA 3HG1E 2ZUWA 4RRPA 1L0QA 3VGGA 2CHWA 3MCYA 5TDOA 1LK3L 3OC5A 4X8CA 2XTLA 3ILQC 2E86A 4W6YB 1X5MA 4UV4H 5IQLA 4LIQH 5I1HL 4PGCA 1P53A 2F54A 5JPNB 3PHSA 5H37H 2ZX7A 5I1DB 5F7EL 2IWGA 3W0WD 3C08H 4FNPA 3VM5A 4X4YA 4JM0A 5ITFB 5JW4R 4JANA 1R3HA 2XWRA 3QI9D 4LRNL 1T3FB 4E41D 5IUSA 3SD2A 1D2PA 1SVZA 1WK0A 5C0CA 4I1RA 4BINA 3R7RA 1V3MA 4KK5C 2VSCA 4KZDL 1RZIB 3WFZA 5FYJE 2AJUL 4GKNA 5D6CA 2H1XA 2H32B 4XB3A 4LPTA 3D69A 1DDTA 1QRNE 2OMBA 3D05A 2NXZB 1M1SA 1XGUA 4PJHB 1Q9OB 3B7RL 1OAUH 1Y18A 1EUTA 1X5HA 4YE4H 4LSPH 3B9AA 3VH8G 5INDB 1H6EA 1CYXA 2NYKA 1LNUB 2RIKA 3Q44A 4I48A 1E6JL 4JS7A 3CJJA 1AFVL 3MRPB 3NIGE 1NMCC 3NOIA 3H56A 1ZIBA 5DEJA 3FN9A 5B3JE 1XIWC 4XNBA 1EQWA