4CSSA

Crystal structure of fimh in complex with a sulfonamide biphenyl alpha d-mannoside
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
molecule tags Sugar binding protein
source organism Escherichia coli k-12
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
total genus 38
structure length 155
sequence length 158
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cssA00
5JQIB 2VCOA 1N0LB 3BFWA 1KIUB 5F2FA 5AALA 4AV5A 1TR7A 3SQBB 5LNGA 3ZPDA 5FX3A 4CSSA 5IQMA 1QUNB 4XOAA 4AV0A 4J3OF 5LNEA 4AV4A 4J3OH 3ME0B 4AUYA 1KLFB 1UWFA 2UY7B 3BWUF 4CA4A 2WMPB 4X50A 4J3OG 4LOVA 4XOBA 3ZL1A 5FLUA 1PDKB 3JWNH 4AUJA 5F3FA 4AVJA 3JWNE 3ZL2A 4AVKA 5ABZA 4XO8A 3JWNG 1N12A 2UY6B 4X5PA 5AB1A 5CGBA 2J2ZB 4X5QA 5IQNA 2JTYA 2XG4B 2W07B 4AUUA 4AVHA 4ATTA 4AVIA 4CSTA 5IQOA 2XG5B 4X5RA 1ZE3H 3MCYA 4XOCA 3BFQG 4XOEA 4XODA 5FS5A 5FWRA 5AAPA 2JMRA 3RFZA 4XO9A 4BUQA
chains in the Genus database with same CATH superfamily
1JFQH 2LFEA 2Z8RA 3BZ4A 3FCTA 5KSVA 2WUBL 3P3SA 1T83A 2BPBA 5GGVL 3HG5A 4Z7WF 4OFKA 3STBA 2WXGA 1JZ3A 2Z3FA 3MCLL 4KO6A 4BWTA 3ZYIA 1QZ1A 4JY5H 2IWEA 2HJLB 4KMQA 3SPCA 1YAZA 1DVFD 1EBAA 4YXHH 5A7EA 1CFTB 5FOBB 3UTSE 3EZ8A 2ZX9A 3MV11 1HJBC 4OCWH 4MMXA 3UEQA 1SVZA 3I6KA 3CC1A 1A3RL 1VZGA 4Z7NF 1SEQH 1WA2X 1R1CA 5GGTL 1UB6B 4LVHB 4WV1B 3TBYB 1E5CA 3FH5A 4G6JL 5JW4Q 2Y6SD 3P73A 2C3HA 5HGBB 1N5AA 2PCPB 3SOTA 1ZLDA 3BQUD 2V3DA 4PRHD 4NAQA 3FB5B 1JNHB 2V5YA 1MG3C 2ENPA 3VVVA 3QCVH 1G6RB 2WWMD 5EUOB 2F7PA 5GGRA 2O93L 2VXVL 1HC1A 3HB3D 4N0YH 4YBQC 1WGOA 1BM3L 4IJTA 2R29L 3F8UB 1IV8A 3GS7A 4F9LA 5I0VA 4NHCL 1YNLH 1TSHA 2CRMA 2B5IC 3C5JB 4GAGH 4PSRA 4KWUA 4DP6X 2JLPA 4DVBA 3TESA 3X13A 3MLTB 4MDIB 4HS3B 2GK2A 3MLSH 3WEOA 1I8LA 1F5WA 3PHQA 3DBXB 4R5VA 3WDIA 4RCAA 3GXIA 3WFDL 2MOQA 4JAMB 1QWHA 2Q0ZX 3RWHB 1J5IA 4X99B 4DZBA 3VFPA 3MUUA 4JRYD 3HHSB 4JFYB 1S6NA 2GVYA 1M1XB 2NT0A 3QZLA 4BIKA 1NQBA 1OSPL 5E95B 4TULH 4U1KB 5D96B 3F65A 1RJZA 2FEDD 3TCTA 1NFDB 4AT6B 1QSZA 4IRSC 1S7RA 1KLFB 1YYCA 3O4LA 1HIML 1TPXC 3DC0A 1OP3H 4QRSA 2VN6A 4YWGH 4QRFA 2RFXA 2RCSL 2NY0C 2ZWZA 4GAYA 3GSRA 2OK0L 4W6WB 3D3VA 4AG4H 4DKTA 3CQQA 3WTTA 3LS5L 3IVKB 4PRIB 2EIMB 3Q13A 3VXRB 4HKBB 1OPGH 1OARL 2D9QB 5SWZB 4DT2A 2XWCA 4TQHA 4KTEH 3N41B 4LP4A 2XVLA 5EORL 1QFUL 3N1QC 1XSKA 4ZFZA 3S34L 5A2FA 4JK0D 1YEJH 2BRRH 1QR1A 4X98A 3U7AA 4TVSa 4HOMA 2X1XR 3BPOC 4A6YH 3N55A 4WNQA 1ZV2A 3T2QA 3ZDYF 1FFRA 5I1LB 2JJWA 4OTXH 3ZL4L 4IMKA 4Y1AE 4WY7H 3TYFA 1PZ2A 3MV7E 2VN3A 4GSUA 4M3HA 4ZYKB 1I1FB 3WV0A 5I1HL 1EVUA 3RVWD 1RK0A 1NBZB 3MKKA 3L08A 3NESA 3JT0A 4JY6B 4JY4A 4JFHD 1RZ7L 5DK0B 4GMTH 3V0DA 2UZYB 2VR4A 2EDDA 4N1HB 4PWKA 1CXKA 3TF7C 3IBOA 2ATPB 1OSYA 4JHUA 5EO9B 3TYGH 1CLZL 1JI2A 1QSED 1NCDH 2Y2TA 3PGCB 3WO3B 5JZ7D 1JPTH 3F7RA 2VDRL 1O5DT 3PL6C 5E8EA 1EHXA 4R3SB 1YEDB 4FFZL 5E4EB 5F3HA 4CN6A 4YUEL 1INEL 5KS9E 1NGQH 3D2UD 1MNNA 1OGTB 1CDUA 4WI4A 2XTJB 3Q3GB 2YAPA 4GO9A 2GIMA 2MQ0A 5D2NE 4EN3A 4Z7QB 5JHDA 5LKNA 1GHFH 4MNQA 3TJEL 5DD5L 5KN5B 4P5KA 4KFZC 2X6BA 4AWJC 2ZX8A 1U0QA 4P2QA 2GUOB 1FVEA 2OR7A 5BXFB 3SHSA 4M3JA 1MLBB 4LVEA 4FMVA 4OZIA 5JPMC 4IKNA 1JXGA 3EG9A 3O6FD 4UB0H 5DU7A 1A4AA 4Y9FA 4ZFFB 3DETD 3GZPA 5ESVA 4YSPA 5KYXB 2ZOTA 4TQIA 1WZAA 4JFEE 4A2DA 5D7IF 1X6LA 2AGJL 1GYCA 4HFUH 3QIUD 3Q8BA 3HZ3A 2HB0A 3REVA 5JW3L 5AAMA 4MA3A 35C8H 4K7PX 5FV1L 2EVGA 5EBGA 2DQMA 2QGBA 1T21A 2E9IA 4E41E 4UM9B 3KMDA 3HA0A 1ZT7B 2DQHH 1DO5A 3FSAA 1DDTA 4UIKH 5HHPB 4U6XB 3ZSSA 3FU9A 2DF3A 3OR6B 1UJ3C 1CGUA 4JQIA 4B9FA 4C47A 2EC8A 2VXUL 3C5SA 3MV8B 4AMKH 2AF2A 1ZLUH 1ULVA 3M17A 1G7PB 1XH1A 1RUAH 4TRPH 3HPLB 5EF0A 2DD8L 3K7UA 3GTTA 1WISA 2VLRA 4MMZA 4IHBA 9PCYA 4QXVA 3K6OA 4X6DA 4A2GA 4WTWA 3D51A 3BFWA 5B3SB 3NFPA 5I6MA 4CVXA 5DHYB 3BKMH 2Y06H 2AC0A 2ADYA 2UXFA 5EEXA 4LLMB 4PJFB 2CBQA 2BOBA 4NSKA 3DTUB 3B1UA 3IRPX 3O45B 3LSOA 2N7BA 2Y69B 4HIJA 2VO5A 4YDNA 3VRIA 3REWB 2QSQA 1SUHA 3JWDL 3UEZA 3DMMB 4MAYB 4NGHH 3LDBC 2WCGA 4HXBL 4QTIH 3L9RB 2Y36L 3VD3A 2CUIA 3U46A 2YPKB 5KJ7E 3MRQB 4TL5A 4Q9QL 4CSZA 3MACL 1GA2A 5AW4B 4GQZA 1Y0LA 2WCPA 3CZEA 4K71B 2VAAB 3EOAB 1YRKA 4PCTA 3AGVA 2WAQA 2WK2A 2E76C 3RURA 1XR8A 2ZP8A 5CGMA 4G8GA 4BDVA 4H5SB 5I1LA 3IGKA 3WFEL 1KCRL 3C6LD 4FQHA 3BPLB 4WCYL 3VFSA 4L9DA 2QELA 3UYPB 4B60A 2G4GA 4KK8D 4P5TC 3VXMD 5J3HC 2FJUB 3CLEL 1EAOA 4KNQA 4YDVB 1K5WA 2UY7A 4PJIB 2V2TA 1QFOA 2PP7A 4RWHA 4ZOEA 3NCWA 4ZMLA 2EH7L 5EEVA 3ABZA 4EN3D 1RI8A 3C5XA 2I32A 1MAMH 1KTRL 3ARYA 5CINH 2ZYRA 4IBYA 3UJTH 3PV6A 2E9BA 2BZDA 5ESVB 1HESA 2ARJB 4LSPL 1GOFA 2EDTA 2EIZB 3GWJA 1DBKL 5JOFA 4UT7H 3L4WA 2VL4A 3D69A 3V4LA 3C08L 2NY1C 2F53B 2ZCZA 2IDFA 2WXRA 3OTTA 4U1NA 3R0MA 3OHXA 3NN8A 3CLWA 1BAFH 4UOW1 4WI0A 1NEUA 1F4XH 1MRCL 4NC2B 4DKFH 5JHLA 4F5CE 3P3UA 1PW3A 1XEUA 4X83A 5I1AB 1EUUA 1Q4NX 1UXSB 2FQDA 2Q7YA 3I6LE 1X7TA 5GGQL 2BSED 5GRYA 2QVFB 2H3KA 1IARB 1T0NB 1T04A 2DH2A 2AXGB 2Y5TB 3QVAA 1BVLB 1IZKA 4JHBA 1FNSL 4TNEA 3H2QA 2AANA 4XMVA 3WIFB 3O3EB 3T8VA 3PDDA 4AW4A 2GT9A 1BIIB 4G8IB 3O4LE 5EU7C 5C8JB 2WM0A 25C8L 3TEZA 1B9ZA 3ZKND 3UZQA 1KGYE 1I1YB 5C09A 2VLRD 1EA9C 4JR9H 4HGWB 5EZPA 4CVXB 4K4KA 4OVUA 2WO3B 1ZHKA 4KOBA 2WO4A 5F96H 3BUBA 4W70A 4O58H 5IQMA 2BWDA 4JGNA 3O6FB 1NSNL 4JGMA 1XB3A 4P23A 1NUFA 2BHUA 1KZYA 5D9SB 1U3YA 3HG1B 5ES4B 1DANT 3C8KB 3C5SB 3MV8A 3NZHH 3AU1B 3C5ZB 3OJMB 3HBGA 4EN2A 1AYRA 2AV1B 3RX9A 5KANG 2YC1B 4FZ8H 1UH4A 1PIGA 4DTGL 4Y2OA 3UBXA 3APMA 2Y7NA 1QVOA 3RFZA 1H5BB 2G5BA 1H3UA 5BZDB 4A2FA 4I0PA 4K3GA 3QWRD 3PGDA 2NY4B 2FECI 2X6CA 1A9BB 3GKWL 1GGUA 3T4AA 2ZKHL 3FNKA 2G60L 5E2VL 3CVHB 2ZOLB 4HD9A 4NYLB 4X9IA 1N4XL 4XRCA 1RHHB 3TEYA 1FZKA 3FUHA 5HHME 2IF7A 3TNNB 3KW7A 5IV2A 1E7VA 4Z8FL 2RH0A 2UZIH 3N91A 4LBEA 3IRZA 3QWNA 2VM3A 4LEOB 2WP3O 3TBVB 1HDMA 4FJZA 3D87B 3DTXB 2FX8H 1NCWL 2ROXA 1D5XB 4NOBA 3ZHKA 1FVEB 3QFJE 1A25A 4X8JA 1TTCA 5DMKA 5JR1H 5HI5D 2HP4A 4XP4L 3RWIA 2XQBH 2WZ6A 3EJTA 2W95A 5GRZA 2EH7H 5EOQH 4L0PB 3VFWA 4UOJA 5G55A 1LM8V 3H85A 3BEVA 4Y9CA 2K8MA 1ADQL 1L0PA 1SLUA 2EECA 2ZXQA 3ETSA 1KIRB 5DVNA 4PGBA 4OIIL 2PR4H 3PWLA 4PH8A 3GXNA 3UTOA 4Q2ZA 1BLNB 2EZ0C 2JB6B 4PRID 1BVZA 1IIIA 4RH4A 5CJQH 4X8XA 2ADJA 3OAZH 3RDJA 3ZDZF 3SDCA 5L88H 2OMUA 5FGCE 3WS3B 2IOIA 3LEXB 4XBPB 2X87A 1WAAF 5CIPB 3QJHA 4X7TA 1P5UB 1FE8L 1SBSL 2EP6A 3CFNA 1AGBA 3JV0A 2K4AA 4BK8A 2J55A 1UT2A 3RHWK 4N5EC 4K3HA 5AAWC 1QSFD 3STLA 4XP6L 1IGJB 3WHXA 3AREC 3NABL 4FG4A 1P5VB 1BZ9A 4Y2DD 4S2SA 2ED7A 3GHPA 4LL9A 2F08A 4TUOA 5FM4A 2X2IA 1OE3A 4H1LA 4LKXB 4OY9A 5IB2A 1LO2L 1BEYH 3UTPE 2VC2L 3H8NA 4UUJB 5DVPA 3U0WH 5TE7H 1G7IA 1HXMB 1FPTL 2XBZA 4OJFL 1WC7A 3DMMA 3HNTL 1ZTXH 5FF6A 3J2PA 1CQKA 4AKPA 1ERNA 1TT6A 4LXFA 4XGZA 2B1AH 2IGFL 2VW7A 3KCPA 5C0JB 2QGEA 2OSLB 1C5DB 3QPQC 4G2AA 4XI5D 3CDYA 2VLJB 4QOKB 3U2IA 4V33A 4HXBH 3R06B 4LSVH 1BFOB 4QTIL 2O61A 1ET7A 3MUJA 4WO4D 2DM2A 3ZYOA 1ZXQA 3LY6A 1X6NA 1Z1WA 3LMJH 1ODAA 4I1NB 1L9QA 4HIHB 5TQ0L 4ONHA 3AW5A 1PFOA 1GAFH 3TBVA 4ZJ9A 4KQ0A 5FYJH 2ZYIA 5ISZE 5IWLA 3IBEA 4TL4A 3KJ4B 4MWFB 1F2QA 4HHAB 4QOKE 1XSJA 5F1NB 2Q5BA 1LXMA 4KKBD 2XFXB 5F70A 5JXEC 4XP9L 4Z7VE 5EOCH 3UPCA 1Y6KR 4GYBA 1TQUA 1IBDA 1S7RB 1N26A 1NC4A 3BD5A 2F5BH 4YXLH 4I2XE 4KU1A 5E6SB 4KTGA 3DIFB 4KITB 3JBG7 6PCYA 4HLZG 4HJUA 1IO4C 2GW5A 3IVKA 1HH6B 2VZ3A 3ATEA 3F04A 4P9MH 4PREB 4QHMB 5E99H 3RPIA 3ZE0E 3K81A 3LPGA 4KKCC 3FRPA 3PP3K 4WKZB 1KYAA 3X1GA 1UA6H 3LH2H 5BNXD 5BRPA 1T66C 4YHMH 4JHWL 3UAAA 4WO4A 1JPGA 3I6GB 5C2UB 2P42B 2QEJA 2NMSA 4GQRA 3ZK0A 4KRMB 2O5XH 1I7ZA 4AQ1B 5IW6A 3EYSH 3D9AH 1HXYB 3PUCA 1DVFA 4ZX3A 2D4FA 4RX4A 1BQ5A 2ICWA 3T4YA 3R7RA 4DP4X 4JG0L 4PJDA 4LCCC 3BRFA 2F7QA 2EVJA 1SJVA 3LZPA 1PCXA 2AJYL 3RE0A 2YPLA 4JQXC 3FT2A 4GRLA 3KPLA 2Z0BA 2J12B 1NCUA 4M56A 2XWBA 3H7BB 3RA7H 1BWMA 4JAMA 4BA0A 4RFNB 4X9GA 5H4ZA 4XPGL 2Z8WC 3TA3B 2FGWL 4DPAX 3SGJA 4E9YA 1VSCA 3RY6A 5F7DB 5IK3A 4PJCF 1PLGL 2CK0H 4AEIL 1S3KH 1PNDA 2NSMA 4FYQA 4D0BB 5BRZE 3N2JA 4ZX6A 3WOVA 5D55A 3ZZQA 1U8NB 5D4JA 3KD4A 1PAZA 5I8EB 4YHZH 1F3DH 3A4FA 4FTDA 3QULA 2OJEB 5MERB 1G9NL 3QI9B 1QR4A 5MP6H 4XGZB 2XA3A 4A68A 1BXXA 2OJZH 2IPUK 1IM3D 4ZYKA 1Q9KA 1JZ7A 3VXPA 4GKSA 5IQNA 5T1KB 1S9XA 2ADFH 2LFGA 3QDJB 4GMTL 4AEFA 4U6XA 5IJBC 1F45A 1AHWA 2P47B 5F3BB 1CPUA 4KJPD 1FGNH 3X17A 5A2JH 5IMOB 3U0PB 2IGLA 2XJKA 4KK5C 3MRDA 4WUUA 2CLVB 4QRPB 4KY2A 2Q86A 5EEWA 1S9YA 2YUVA 5F72S 3WS3A 5CR1A 2XVBA 2PPFA 1CGVA 2VLKA 5FYJE 1NAKH 4WNJA 5E4AA 4CGTA 2C7UA 3KJ4C 3UZEA 1ZOXA 4OD3H 3AXIA 5CJOH 2ZCLL 3QXAA 3ZTCC 1Q72H 2OPCA 1E6OH 2QFPA 4YVNA 2KLRA 2X2UA 1OAKL 1EEQA 2P5EB 3BKCL 3BLKA 4E42A 1QRND 4PW9A 1A1OA 1GHFL 1MCPH 1AO7E 3FT4B 1K72A 5CZVL 3RGHA 1L0YA 4P0DA 4ZUSA 4F8NA 3CZKA 4YDKL 4M7LT 2VJ8A 1HOCA 4R0LC 4Y4HB 5IKCB 5ISZA 2YQBA 2VR5A 1UASA 4DF9A 4JO8A 4OZFG 5LNEA 1ZT1A 2HTKD 4IKJA 3BZ4B 3LKQB 4A63A 4GXUN 1TVDA 1IGIL 2NY0D 4Z95L 3K2IA 3ABMB 5T1MA 2C9RA 2CZNA 4FNRA 2DQIL 4HMDA 2F0CA 1EHNA 4Z78A 1NGWA 3QEQB 2NUTB 4R3SA 2P45B 3QORA 3T0ED 2EICA 1JP5A 2WZAA 1DEEB 2VLJD 3CZGA 4M00A 3SGEH 3QJHB 4PG2C 4D3CL 1AAJA 2HLAB 4ENEC 4DWHA 2IXQA 4PJDB 5TPWH 3T6XA 1MHHB 4F7MB 1S7QA 4AE1A 1V5JA 3P4MB 1MFCH 3JTSB 3QJVB 1BXUA 3BAEL 4UT7L 2K6WA 4UQ2B 4DKEL 5CD5D 4B3EA 3RVTD 3MACH 3WNMA 3MXVL 2XTSA 5KOMC 5BZWA 2C1PB 5BW7C 3QZNA 2HLFD 4IEFA 5EUOE 3SO3C 1G7LA 2A1WH 1UGKA 3PIQA 5HVHC 4LOUC 4NIKB 1SMOA 2FJSA 3IN0A 3U6XS 4GQ9H 3ILQD 4UQ9A 3VGFA 2YD5A 3ARFA 3V5DB 3NCJL 4V2CB 1FG9C 1VFUA 3ECVA 3MV7A 4H8VA 3LB6D 1PNCA 4BUHA 1NUGA 1UWEL 1UZ8B 2YPLE 3IPEA 3ZPDA 4HEPA 4PJAB 1WFUA 5KVEE 1FG2A 3K0YA 3BH8A 3IDMA 5M7QA 2A77L 1N0XL 4QUOA 4FQIH 2WZPD 4NPYB 3THML 3V4PA 1EH9A 1G1CA 3RTQA 3ZTNL 1ZSDB 4D0DB 4H8PA 1JZHA 2F7RA 2ZX7A 4YX2L 3N41F 4A1RA 1JHKH 3DYMA 3STZB 2HH0H 2VZTA 4R7DA 1XX9C 2BNQA 3FKUS 4I3GA 5F96L 2XTLA 2BNQD 4LGRB 1QPPA 1T0NA 2Y5TA 2EABA 3DYPA 4X9FA 3ZDYB 4Y2NA 4NFDA 5DJ8A 3W81A 2A6JB 1KNOA 4AK1A 3HFMH 3UZQB 2R7EB 2XT1B 4TVUA 4WDIA 1QI5A 2IANE 1G6RL 1JK9A 2GI7A 1HL8A 3OHXB 4C4BA 4KKBC 3ZO9A 1OEZW 3I3EA 3VXRE 4Q52A 4PG9A 3WKPA 4MNHB 1NAKL 4KXZH 2YFNA 4PRPE 4W9GC 4Y19D 2GJ6D 3SJVD 3T77A 12E8H 2CNYA 3R8QA 3MLTA 1E4WL 5EOCJ 1N8ZA 4ZMTA 4NRZA 1LP9F 4WEMB 5EEYA 2APBA 3MLXH 1K3IA 4UQ3B 5HHNB 1BVNT 3APCA 2MKWA 1I1AC 1S8DA 1SQ2N 4WAFA 1CR9L 2CJUH 2PTTB 1Z2KA 2R0LH 3QJTB 3BKYH 4D0CA 3Q8CA 4WI2A 3FSOA 4LU5H 4JRLA 4DP5X 2DI8A 5I6OA 4Y4FA 1RCYA 4DVRL 3Q5TA 2P48B 1I7ZB 3O2WH 3UBXI 4HKXA 4YSAA 2Q87A 1HFUA 3CFKA 4BCXA 4XNUH 2XWEA 4WFGE 4MA7L 3VFSB 4M48L 3DECA 3BHBA 2MNJB 2FR4B 5DDHB 1U3HC 3IMVA 5SWQA 2ARWA 4QHNA 1RY7B 1SY6L 5T5FH 2VDKH 4NENA 4QLWA 3QORD 2JJUA 3O81A 5I71B 3B7YA 2O6EA 3V4VH 5KBMA 3QWQB 5EOQL 3UPRB 4TSBH 4JY5L 2DQFA 1U36A 1JK8A 2E74C 4I0CC 1X5JA 4AM0A 9CGTA 2JI3A 4XNZC 1Y6NR 4MDRA 2BY0A 4LPVA 3KHQA 2QSCH 5T3ZL 1S46A 1BZOA 2HRLA 1E5UI 1DQJA 3GJFK 2FECL 1J8HA 2FX7L 4H8WC 2HFFB 4JQVC 5IB3B 1IIKA 4OZGF 1JWMB 1KBKA 4WFHD 3V0AC 4AIXA 2XUWA 4IKLA 5E51A 4O58L 4Z7OB 4L9LB 4NFCA 4WDIB 2BSTB 3AQXA 1F13A 3QZPA 2Y7QA 2NQCA 4UT9L 4KUCD 5IQ9B 2NY5L 4ATWA 2H32A 1CMOA 3BAEH 4F58L 2KMWA 2NY1B 2OMBA 4LHQB 1C08B 2WLMA 2XG4A 3BGAA 3CVIH 1TVBA 5E23A 4UTAH 1CI3M 5ADOL 3NRPA 2NCMA 3K3QA 5E7FA 5C6TH 1R3JA 5AOJA 3MROA 3ATBA 4PJFF 2G0LA 3TTYA 1IBGH 2VMJA 4E5XB 4GUCA 1N64H 4MXQC 2GFBA 5KZCB 3I6LD 4XHQA 2J8UF 4RMRA 1KTCA 4U1GB 3E3QC 2NY2D 3T6QC 4XNZB 1Y6MR 3IU3A 1I1FA 2BO0A 3FCGA 1N19A 3QJUB 5PCYA 1PX3A 3ZDXF 4NUGL 5HHOE 3DVGA 4A6YL 5A3IC 2OAAA 5CJOL 2HT4C 3L3JA 5D1ZA 3VXMB 3ZL4H 3FONA 1D2PA 3BKCH 2ZSVA 3CHOA 3G3LA 4RMUA 3OQRA 3FB7B 3QQ9C 1LD9B 1T89C 4NN5B 5DFAA 4CDHA 4JANB 3CDZA 1FFOB 3ZQ9A 5ACZB 2FR4A 1HZLA 5DHVH 4CN4A 1A7NH 3HE7B 3QIWD 4PV8B 4Y5XB 5B3JF 3HUJB 4HF5H 2OK0H 1A14L 4OCXH 3SE8L 2V5MA 2ESVB 4CRPA 1NDMB 1DVZA 2ZT9C 3GKZA 5T1LD 3T2PA 2W1NA 1AFVH 2BW4A 1I7TB 4OIBA 5F9JB 5HHOB 1B2WH 4QF1A 1P9MC 1A4CA 4NXSA 4PJ8A 2YAEA 1XBRA 1VGEH 1IUZA 3FU7B 1VPOL 5AWNH 4NP9A 5LCVA 4RESB 1EHLH 4PJ9C 2Q6WA 4HJGB 1OB1B 3CMGA 3VI4E 4AC2A 1NKOA 4LEBA 4CGUB 2H2PC 5IJCC 3UPRA 1CB4A 4XXCC 5IBTL 1KT2A 5CJ5A 3FS9A 3ARGD 3NG5A 4KJQC 4YO0A 1XGRB 3W56A 2WN2A 2V3EA 4EVNA 3RZCA 3CK0H 1YEDA 3PHSA 5L2KA 1RJLA 2QQLH 4OFYA 3LZLA 2OMWA 4L23A 3SDDD 3L3GB 2RHEA 1EVTC 4MBRA 4PVBA 3QQ4B 4FNTA 1CT8A 2AQ3A 4BV1A 3V6OE 1ND0A 5D7IA 4BFFA 5B38A 1WWBX 4PGDB 3LS4H 5HHNA 4FQ1L 4HULB 3ULVD 1G1KA 1KBPA 3CSYB 4PRPD 3A4EA 4M7KH 3SB3A 2GJ6B 3FUNA 1RZJC 2R2CA 4FQJH 5C08B 4BHUI 2AV7B 4YE4H 4UQEA 4F8OA 3NDZE 3AACA 1JERA 3HW7A 4K07A 4OFYD 3RVVC 1LL1A 4OIFA 5EF3A 2LAGB 1D5ZB 1C7TA 4JFOA 1FZMA 4TSCL 3MRCA 3SE4C 1S3KL 3LV3A 1H9DA 5FWRA 4L4TD 1XR8B 1U8HA 1TQVA 5IVOA 1YNTB 3EO1B 2LR4A 4LNVA 1M05A 3O9WD 4X5WA 4FFWC 1QLEB 3GMMB 3QUMH 1U33A 3DIDA 2D3JA 2PP8A 4G80B 2JH2A 4P49A 4O02H 4JG5A 4NLHA 5IQ7L 2WYIA 5CBAA 1SFDA 1J0JA 4TUJA 3I6GA 3EJZC 5AW8B 5B7MA 3CU1A 5J13C 3ZUCA 3DO7B 1D9KC 2QVTA 2LT9A 4Q4EA 3NCYS 1K2DA 2AFNA 3MNWB 3GHEL 1T1YB 3HI1A 5L9DH 3O3EA 1AIZA 1JGIA 1DQIA 1OCWL 2BVQA 2P5WB 4KO7A 4I77L 4MD0A 5AUMA 3RU8H 1NEPA 1QUNA 4NRYB 1K8DB 4R7NB 5MENA 4JVPA 5GS0L 1JWUB 3QIWA 1QSFA 1NCAL 1IGFH 4J12A 1OSZB 3G5XB 2BHFA 5DVKA 3RZCD 3U6RA 3GMRB 1RU9H 2Z0UA 3N85L 2BFVH 4HUKB 3BP5A 5F6HI 2I60H 3MRRB 1K4CA 4HUVB 4KY1L 2HG5A 2P9RA 1PD1A 1BQHA 3VJ6A 4M43H 3S0PA 2VDMH 2E0PA 5HVHB 4XPTH 2DWYA 4Z7AA 4O2FB 5EZJA 2RJMA 4M48H 5EA0H 3S3BB 3VFMA 4QCIB 5FS5A 2YWZA 3CFCH 4OKVA 3IXTA 4JO1H 3JQOB 5CFHA 4IU3A 1EMTH 3T6VA 4R2GB 1G7QA 2IPTL 1ZHBA 3NVQA 4JPKH 4N0UE 3WIIL 4ZUWA 3RAJL 2NY7H 3KLLA 2FX9L 3P9WB 4WI5A 3APNA 3BXNB 3GK8L 3Q01A 3Q8AA 3FQRA 4MXVF 2H3NB 4RGOH 2ITEA 3IFLH 4Q9BA 4NQCE 1A4KB 1T4KA 3QUXB 1JYVA 4LPXA 5I1DB 4WHCA 3U6XA 1OF2A 4LL1A 1E4KC 2WVVA 4N25A 4MQ7A 1IFRA 2QR0B 4P9ML 4DOHB 5D1XD 3RWFA 1U6AL 2FSEA 3WL9A 3FAWA 5DGQA 4NO2A 5GGRB 3LEYL 2VDLB 3MLRL 4W4OC 4JZOA 1WF5A 1UENA 3HZKB 4IRZH 1W8OA 2UWEA 2HLAA 1ORQB 4PFEA 3DK2A 5DYOA 1KPRA 2Z1KA 4YZWA 1OM3L 5GPRA 1CFSB 4P2AA 3MOAH 1J8SA 1PIFA 5JXED 3KPMA 3US0A 5KVDE 1A5FL 4LOFA 4ZAKD 3PHQB 2PWHA 3JTBA 4LFHD 5IHLB 2HMIC 1EO8L 5INDB 3MYJA 3HJEA 1OPOA 4Y5YB 1MQKL 4HX1B 5LDUA 2EDHA 2GSIA 1BX2A 3EFDH 3VFOA 1FHGA 4G6JH 5AW5B 4L37A 3HNVL 4LKCA 4LSUL 4HALA 4P23D 4FXKB 4JJ5B 3L5IA 4KGJA 3BE1L 4Z77A 1E5BA 2ZXAA 1F4XL 2EDKA 4JX0A 1OP5K 3P69A 1QAWA 4NUGH 3FU3A 4EXPX 5DQJA 4ABVA 1I8MB 4ZPVB 4U3SB 1B4TA 2VRAA 2DEYX 4F57H 1JNLH 2JJSA 4FRWA 1HHHA 3SE3C 2WV3A 3U48A 5BRZD 1VADB 3JTSA 5MP6L 5J1AA 1CGSH 4AYGA 5EIIB 1TJMA 1RUPH 1TR7A 1MREL 3BPCB 3BWAB 4ANKA 3NQKA 2V7HA 4NNXA 4ODBD 1FO0A 4E9WA 3LPPA 4JFDD 1SDDB 1B4JH 3RGVC 1UD6A 2OMVB 4YNYB 1MVFA 1ES0B 1NCAH 4X6EA 3F62A 2CGRL 2OQJA 3TIDA 1NFKA 4AGQA 3S9DB 2R15A 5HGAB 5I26A 4O2EB 3DHMA 5DQ9A 4LP8A 1A6AA 2HA1A 3MUZ1 3BSGA 4HIXL 4HIEB 3HMWL 5FOJA 3CCHB 3VVWA 4AQOA 5LAXA 1J1XH 5C0AA 3FFCD 3UJIH 5LXVA 3MMEA 2KERA 1A9BA 4PJEB 3CLFL 2CBOA 3I9PA 4AQZA 4J2XA 5E00A 3QQ3B 2WXHA 1G9MC 1QQDB 2EDNA 4XMXA 5KN5A 2HPTA 4NQEE 2B4CC 3V5KA 1QBBA 4N86A 2P24B 2XNAB 3VMOA 3WXVH 3ZDYE 2Z31B 4GKZB 5LGKA 2I60L 5E94A 4BKLB 1CGYA 1DBMH 1BQSA 5FA4A 2P7TB 2FH6A 1I1RA 3HG1A 1X5YA 4XC3L 3TH3T 2CRYA 4QXTB 1I3RA 4PUBH 1H8SA 3SE9H 1O9ZA 1X4YA 2FHCA 3FMGL 2JK5B 3SJVA 4JM4L 3TPUB 4ZX4A 3W2DH 3BN3B 4H25B 5C6PB 1AKJA 1JGLH 1YAIA 1YN7B 1G9EA 1HSBA 3ISYA 4RBPH 5TF1H 3SQRA 3ZXAC 1SBBA 4HLZH 3V6OA 4R83A 5TDPB 3P9LA 4K3EL 3TO4B 1XF5A 3OLGA 4X2UA 3VB9A 2Q2LA 5MEOA 4LCWA 3JUYA 1LK3H 1V3LA 3O2WL 5I1HH 5BMFH 5BQDA 5HYSA 1NLDL 4DO4A 3VRJA 1WUZA 2OW6A 5AVWB 1BF8A 4MJ2A 1PY0A 4MCYA 3T65B 4XCNA 1NCCH 1QEXA 3EH2A 4X7TB 1EAJA 2IAMB 3JTTA 2XKSA 1MCBA 1TMQA 1OP5H 3I9GH 5I1IL 1B9KA 2V5RA 1TNNA 4FFYH 1RFDH 3NMEA 2WZPA 3QG6B 4EQ2A 4FXGC 3BAWA 1KOAA 2FATH 3QHFH 1TTUA 3QDAA 5DK2A 3QO0B 3EFOA 1HHJB 2HG0A 5C9JB 5GHWH 4MD5A 3T71A 5CNHA 2R27A 5FB8B 1MRDL 2AXWA 1U95B 1EEYA 1J86A 1CFBA 4Y88A 4UTBL 2B0SL 1CICB 3HG3A 4NJ9H 4PVLA 4NBYB 1T3FB 1P9MA 5ISZD 1BVOA 5AG8A 2BZCA 2IH1B 3A6BL 4PCYA 3U36B 4ISVA 1BP3B 1R75A 3OV6A 1UURA 2GKIA 4MZ3A 3C6SA 4OZIF 3NJIA 4QNPF 5DC2A 3DGGA 4S10A 5IK3B 1E6JL 2IH3A 1KUMA 2CLZA 1QSFE 4UT6L 3LAFA 2Z4TA 2GBAA 5EC1B 5T3XL 1GS6X 1HINH 4ODUA 4LAQL 1BPLB 1K8IA 2W07B 3GMNA 2FYYB 3IE9A 4KUZL 2H0EA 4PV9B 5BS0B 2X0VA 4QHPA 4ZUWB 2X7LA 2JI2A 2B59A 3KLDA 4EI5A 5L0QC 3MUY1 1DQDL 3BC9A 5F1IA 4AJ0A 5L6YL 4KAQH 3K8KA 5FYJD 2YBRB 5KSBF 3EYVA 4JCLA 5GGUA 4FKHA 1OVZA 3ZSTA 2CO6B 3EF7A 3GHBL 4G6ML 2H1PH 3VI3E 2XV0A 3EUDA 2OMTA 4N0UA 3LN5B 4PJDF 4KTYA 1AC0A 3CHXA 3N43B 5J4MA 1H6TA 3OF6A 2XG5B 4UQCA 3ROOA 1J11A 1MFMA 2RBLA 3BI9X 1G9NH 5AEAA 4N2NA 4D8PA 3O6LH 1UGNA 3B2VL 2HVJB 4PUBL 5DZVA 2DN7A 3IDYB 1DSWA 3C09C 5TDNB 4MJ5A 4MJJA 1BWWA 2CM5A 1UVQB 3SD5A 3B8SA 1WK0A 4DIXA 4WWID 1LO4H 3KPNA 4IGBD 4MX7A 3S35X 5D2NB 1PY4A 3SEPA 3Q2NA 1OB0A 1BVNP 1YO4A 2P8PB 3L5JA 4CW1B 3GGWB 3I74A 1ACCA 1KIQA 4AI7A 1S7SA 1NDGB 4NKIL 1DFBL 1W0YT 4UAHA 2A0LD 3CSFA 4JQVA 1A5FH 2Z65C 2F54B 3OZ9H 2X4NA 4OZGA 4A2EA 3LD8B 1MWAA 3GJEA 3ILDA 3SPJA 1MCLA 2A4EA 4LASH 3BSZL 4LB8A 4ZOCA 4NZFA 3H9SE 2Y07H 2I27N 3HI5L 3VQLA 2R1XB 3FN3A 3MV7D 3N5AA 4PJ7A 4CVZA 1IVTA 2KI6A 4L1BA 1F2XK 1SJXA 2VQ1A 5E1GA 4MAZA 3L3JB 1M9WA 3QUHA 2WB7A 4XVJL 4F9PC 1TU2A 4FQQB 5EO1B 2FEJA 4NQEB 4O5LH 1UXLA 1ZIBA 3HB3C 3MUGB 4IBLT 4Y4KB 3AADB 2DWXA 1KCSL 4U1GC 3PV6B 3QBTB 1WFNA 4ZXBA 4JFZL 3UTZB 2IAMC 1SM3H 2OCCB 3QAQA 2PYFA 2HX8A 2GFBB 1KB5A 4JR9L 4Y4FC 3ZTJG 3FOLA 1JPFB 3Q5OA 1I1AA 2A99A 3FQUB 1CUOA 1LP9B 1RQ5A 3L3GA 1I3VA 2NLJA 5KVGE 3TN0A 3O41B 7FABH 1MH5A 4A7GA 5L8JB 4BH8A 3BVVA 1MDTA 1ZANH 4O2CA 1Y18A 3FJTA 3BJ91 4LEOA 2XPGA 2PO6D 3KYAA 3SYPA 3FRPG 5JW4M 2CKBB 3V5KB 2E7LA 1MVUB 4BSWA 3P4LA 4ISVB 1H3XA 5DMKB 3WIHH 3RFRA 4DUVA 4YSTA 4JKPH 4E41B 1H5BA 5IEHB 3QDMA 3R0NA 3VSUA 4UT6H 1C1EH 4A67A 3LPOA 4AJWA 4S1QL 5JDJA 1SF5A 2OTPA 3SBPA 2VGLM 3V4PH 1KJ2L 2W60A 2HN7A 4NNYA 2MCPH 4N0CD 2D7QA 4FQ1H 4BSVB 4CVZB 1HZHL 3K74B 2VH5H 3SBQA 4S1SH 1AD0B 3MBEA 1OGAA 1CK0H 2A9MH 4K8RD 5IF0A 3DURA 4QAWA 1FCGA 4DEPB 3TO2B 2YPVA 5J5EA 3WNIA 5A3ID 3WE6B 4Z7OF 3VD4A 4A6YA 4QIRA 5HPOA 1NDGA 3NSFA 4HPOH 2YARA 3UDWC 2AITA 3RKDC 4DGYL 4CVUA 1DN0A 5L2KD 4HH8A 2KPNA 1XZWA 2CIKB 1MJ8H 1E2WA 3NEOA 3TA3C 4FA8A 1AD9A 4OGYH 3R1GH 4J6RH 3DX6A 4WJ5B 2IBBA 1L9TA 1KPVA 4XC1H 5ICYA 4IRZL 4UM9A 3ARDC 2H4EA 4KKAC 3DMMD 4MCNA 5CP7B 4XNDA 5BO1H 1GZPA 2V2WA 4FFZH 1N8ZB 1IFGA 4XNMB 3OKNA 4LCCB 3PYCA 2XPGB 3MREA 1N0XH 2A77H 4BXVA 4CC0A 4MAYC 5LXGL 1QLRB 3PXHA 2J8UB 2DYPA 2PYEA 3D34A 3IFPB 5AFAA 4H8HA 4M7KL 4NKMA 3RWGA 3VA2C 1DQJB 1MWAH 4Z3EA 1DFBH 4OZIE 3ZE1B 3DGGB 2PXYD 2VLKE 4GRMB 1Z0MA 3QDMB 5IROA 3ZDXB 4S1DC 2NY3C 2Y1ZA 5BRQA 4KJQD 4U3CA 1P4LB 5C3TA 3VAEA 4O00A 1A1NB 2IDCA 3GI9H 2R69H 4Y5VB 3HTLX 5EUKA 3EHBD 3AXHA 4NZ8A 2CXGA 4M7ZC 4WWOA 1WWAX 2R0KH 2YLKA 4TYUA 1IQDB 1BXVA 2CO7A 4RZCA 4D0DA 5T1DL 3HNTH 3RVXC 2AZAA 1F6FB 3K1KC 1HS6A 4Z7VB 1SJEA 2WXLA 4CILA 1GJUA 5DVMA 4LL4A 4KV5F 4HWEH 3UFIA 3C60A 3G7TA 5T3XD 4N2FA 2CXKA 3LKRB 3E1ZA 3W5MA 5LNGA 1UWXH 4BZ2H 3ARFB 3LXBA 2FWOA 4NM8L 2QADB 3QDHA 4AV4A 3MNZA 2J5LB 2W60B 2B2XH 2OI9B 3MRPB 4GY4A 4J8QA 1U8IB 3MXWH 5F71A 3TEXA 1NGXA 2CMRL 1FYTD 1ZSHA 4L1HA 4A7VA 2GI0A 1IM9B 1UVQA 2BIMA 2NRDA 1KJ2H 1WHOA 2NX5D 2CPUA 3CN3A 1N6UA 3H0TB 5FO8A 5K5YA 2BWQA 2J57A 3OGOE 2A9CA 2MNWA 4IOSD 2JJTA 2FD6L 1KGCD 3EO9H 3UP1A 4G59C 4YPGB 5DJCB 3UTSD 1P4BL 5T1JA 3SDAC 3HS8A 3DXAD 4M3KB 2GJZB 1LILA 4FQPA 4JKPL 3OXRA 1AI1H 4J3OG 4BE5A 4BELD 5CD5C 4XMPL 5SV3A 5JA9A 1J8HD 4NZUH 5I30H 3LIUA 5DK3A 3ZYJA 3RAJH 1SYVA 3QCUL 3B9VA 4TLTA 1MFUA 2VSMB 1VDGA 4XH2A 4ZUVA 4LDEB 1IAII 1JF1A 5DJ2A 4BFNA 4JRXA 4ELMA 4Y4HC 1H8LA 5C0RH 2VH5L 5C07B 4DK5A 2Z64C 1KB9J 1KLGB 2Q8BL 1X5LA 1T7WA 4L3FA 4P2QB 4Q9CA 1R3IH 1I9JH 3C60C 5DHVA 4HPHA 2XKNA 1F8TH 4C56B 5BZZA 4JB9H 1SVCP 4JANA 1KTDA 4HJTA 3CH1A 4PYHA 4MNGE 1MCSA 4OFPA 2A6KB 4MHHI 5I1EH 4B97A 3OJDB 4J4PC 5GIRB 3CPLB 2XN9D 1VF5C 2MSPA 3U4AA 4OCLC 1MAML 4G7SB 3BP6B 4UNTA 1QQDA 3UJTL 2X1PA 5DD6B 4PD4J 5SWZD 4FL4B 2E47A 1IFHL 3C2AH 5DO8A 3MBEB 5CP7A 2YMXL 3P77B 4O4YL 4JJHA 5FAAA 4QT5A 1TQCC 2P8LA 2C9QA 3BZDA 4ZW8A 1G0XA 3JV4A 4UILH 3ZX1A 3UCRA 1Q90A 3E8UH 4F2FA 4AE0A 3ILPB 5EWIH 5AB1A 3VYOA 1XR9A 2XG4B 4MYPA 1LO5A 5C0ND 4DN3L 3N3EA 3RVUC 4Q0XH 3A24A 2Y1YA 4RIRB 5DT1H 1L9MA 3TBWB 3OC8A 3IDYC 4F7TB 1T5XA 1I1CA 1MPAL 1VKXB 4UZUA 3QPXH 5C0GA 2EKJA 3VGDA 4Y5VC 3TA3A 1U93B 1XWVA 3BGFC 4LAQH 5TE6L 1LE5B 5ITBL 4MJID 2V17L 1PDKB 1MHCA 3E3QE 4FQIL 1ET5A 5T1MB 4PU2A 1S4IA 4XHJC 1ZY9A 1NFIB 4Z0BH 2K6YA 4OB5H 4EDWL 1WUNT 3TCLB 3QIBA 2PNDA 5DJ6B 1V8HA 3Q1EA 1I8UA 3PUUA 4YOKA 4QPEA 5BZDA 3FU8A 4M8QA 3DJTA 4Y5XA 3ZQWA 1E3FA 2B9AA 4PRHE 5EU5B 5BS0A 5D7JB 5IVXF 2QGDA 4E9QA 2X6AA 2NXYB 1A1MA 4OIAA 2AJSH 1L6XA 2DBLH 2YD2A 1RD6A 5E94B 4BKLA 5FFLA 5HYSB 2C26A 1YECL 1Q9LB 1QEWB 2IVFC 2FTAA 2RALA 3F7YA 3LRHA 2I5YH 4L8DA 2CHXA 1I4FA 3Q1SL 4PGEB 1U8OB 1AZNA 2DEWX 3I9GL 2KUTA 3J07A 2NSXA 5KVFL 3CXHJ 2DY2A 5DHVB 5A6IA 1MHPH 2NY5C 1C5BL 1X7SA 4YHIB 4JFEB 3O2DL 4GG8B 5EIQA 1HHKA 1DBAH 3JYBA 1I1YA 5C08E 4E9VA 1NMCB 2CO4A 4PCKA 4X6CE 3MZTA 1JPSL 1WD9A 4G70B 5FO2A 1WAAA 3ARDD 3IMBA 1U21A 4MTMA 3F58L 5AOZA 4G6MH 3BCFA 3A22A 1PVHA 5TF1L 2EEBA 5E5MA 1ZS8A 1U8JA 2F2HA 2O6PA 1Z9NA 1RIHL 4IOFD 4Q74A 1NBVL 4H8UA 3ULVH 5DVLA 1JGUH 1HE8A 4RRPG 4Y2LA 1HKLH 2CIIA 3RNKB 2ZCKH 4L3EB 3WKNA 3VACA 3JZYA 5EBLB 1HILA 1AGFA 4ZXBC 2QDWA 1EGJA 4PRDB 5ICUA 2BLFA 5JHLH 3LXCA 4YDIH 1MSPA 4LK4A 1OLLA 3HE6C 2IPKA 3IDJA 4XAKD 3RWFB 4D9RD 3MLPA 4Z18A 4N24A 1OAQH 1QRNA 3TCLA 5E9DA 1MFAL 3QXUA 4F9PA 4A7TA 4I18C 4MKTA 3S3SA 4DPBX 2VDRB 2QZQA 3ILQC 1RHHA 3MRJB 3MCYA 4FJ6A 4TNVF 4Y16D 1N6VA 5CSZB 3AG4B 3V8CA 4G8AC 5T3ZE 4HV8B 3MV9D 4YXKH 4RGOL 3LZQA 2XHNA 2GSMB 1KLUA 5KOVC 1EEZB 1KF9B 3T4AC 4MQ7B 2WBJD 5J6SA 1JV5A 4KROD 2D7PA 2J1WA 4HGMA 4PJEF 5ID1B 3AU1A 3C5ZA 4YHYB 8CGTA 1DCEA 5D70L 2J88H 3P0VL 1XR9B 1WBYB 1HH9A 3L13A 4HKJB 4JFXA 4ZQKA 2DTMH 3TBSA 1P5UA 1R6VA 2NTSP 4JPIB 3A6CL 1ECZA 3D3VE 4PJHE 1OLZA 3S7GA 5FKPB 1IGYB 5HYJE 5DD0H 4D9QE 3NZ8A 1YUKB 2VXTH 1JVKA 2VM4A 3EO1A 2UVFA 2VN7A 3HG0A 2X42A 5I75B 3DA0A 1KCKA 3ZL1A 3OKMA 3M8OL 3IJHB 4NQDA 3T3ME 1JPGB 1CYGA 4NOFA 2OQJB 5FGCB 4IRJB 2BVYA 3S8GB 3PNWB 3S8FB 1TXKA 5I6PA 1PKQA 4DOHE 3ZY7A 3FQTB 1D5BA 3EGXA 4UOQA 4XO5A 1H0DB 1HQRA 3NA9L 5DEGB 2YZ1A 3FQNB 2G5RA 2VDKL 5F0PB 2N1TE 4M8QB 4HMEA 3FF7A 5MENB 1DVXA 1EJ8A 3V4VL 4S0TD 3QJFB 4TSBL 3K5RA 2EKSB 2Z92B 4ACTA 4PLNC 1M71B 3ARPA 1J87A 3KLAA 3HBZA 4O51B 4M1CD 1N12A 1C1EL 1U3HD 4R90L 5FFOA 3VXUE 1AXTH 3BP5B 3QUXA 4PLKD 2BP8B 5EC2B 5CHNA 3MJ7B 4JPVH 4L0ZA 3D3VD 4QRQB 1KWKA 1ZV5A 5HTSA 5LN4A 3VQ2C 3TYGL 2WLHA 4XBPA 3PWPA 3WY1A 3BKYL 2BC4B 2J71A 3QEHB 1NC4B 5TTRA 4EPSA 3BLBA 3HNVH 3R06A 3UTTB 2E7LC 2BIPA 4OQ1A 4M8RA 2FWSA 3JWNH 2VLJA 3MRJA 2PLTA 1WSST 5FUCE 1GR7A 3IF1A 5DEFB 1CLVA 2YD6A 1YMMA 5MEOB 2X4UA 3CVIL 3MX0B 4NP4L 4FXGA 3CV5A 4WTZA 5TQ2L 2WNGA 2GTZB 5DZAA 1UM5H 2YRBA 5E4EC 1U93A 2E3VA 3ZKMD 3LZNA 3DK0A 4PP1D 1HU8A 2F7OA 4N4YB 1AJ7L 1Q94B 3GXDA 3QPXL 3V4PL 4LNRB 3RNQB 3ZN6A 1W16A 4HS6B 2HTKC 5ECGA 5ITBH 1BGXL 1SMDA 2GAZB 1O7VA 5J8OA 4YHPA 1G0YR 2E6JA 4U1IA 5FW7A 3AG1B 2F8OA 3R18A 3WKMH 5FWQA 1EZVY 5DUJA 4UCFA 3TT3L 3ZKXB 2R2EB 1A6TB 1N59A 4R96B 3GXPA 2V2WB 3TGXA 4LSTH 3D85B 1E3ZA 5AB9A 2I9LB 3TFKC 2VRQA 1DLHB 4R2GC 4XPBH 3KH3A 2PW1B 3RIAF 1K5NA 2CG9X 4JDZB 4UT9A 4HF5L 4D94A 1WA1X 4XN4A 3V0VB 2FO4A 5F7NC 1DR9A 3D69B 3H9SA 4F7EA 1HH9B 3ABGA 4ZZKA 3T8MA 4FZEH 1I7TA 1MJ7L 2DIJA 2WXPA 4U49A 1QKZL 2LV4A 3D39B 4G42B 5T1DH 1IX2A 3QEHA 4H20H 4LT7A 2UX6A 1Z3GH 2QPUA 2RACA 3KPPA 1QABA 4Z5RB 5I8OL 4WHTA 4P4KD 1CG9A 1YPZE 3IJEA 5E08L 4P46A 3DIFA 1JZEA 1ZJAA 1A6ZB 4V11A 5CBEA 3DHPA 3S36X 3FHQA 5D1XC 3CHPA 3H9ZA 4YHNB 1NCBL 4XCYA 3B5HA 1SJEB 2AV1A 5FLUA 3VXNB 3MJ9L 1D9KB 3INUH 1HCYA 2HFEA 1NGPH 4PJ9D 5EU4B 4X4YA 2YUXA 2AERT 4J3WA 3SN6N 1RMFH 2OZ4H 4FERA 3QFDA 1B3JA 3QWOB 3NZSA 3ZR5A 3UTPD 3NAAL 4FG2A 3WDJA 1XF3B 5I8EA 2PWEA 4MHHG 2BXZA 1SNRA 2IXQB 5FUCC 4V1DE 3GMMA 5B21A 4RGMB 2DQEL 5BPPA 4XNAA 5F8QC 5HP5A 1DSFL 3DLQR 3R1GL 3TPKA 4BH7B 1VA9A 2WQXA 4RDQG 3NN8B 4EN3C 4Y16C 1OAQL 3DTXA 3GIZH 1AI1L 4H88H 5TH2A 5CEZL 1UWYA 1T20A 4M1GL 1QYGL 2P8PA 4JPSA 5AL8A 1F42A 5CS7A 4AXWB 3RUGA 3HAEA 2ZUSA 3INOA 1UXSA 4KXBA 1FVDB 3QXTA 2YA0A 1U30A 4GKOA 2W80C 5I66B 2G3XA 4HK0B 2EDFA 2VLMD 4WFFD 2AHIA 3V7AE 3SKNB 1V3MA 2DWTA 4M61B 4W9KC 2FYYA 4PV9A 3WO4B 2MQ3A 1LLAA 2R56L 3OM3B 3BUQA 2OV0A 1XMEB 1XGUA 3IFNL 4NRXB 4DN3H 1GYUA 2ZAIA 3PWPD 1WTGT 5CLZA 5DMGD 3HIZA 3RWDB 3T8XB 1K4CB 2XX1A 4HUVA 1W0VA 1XCWA 3GSWB 4NQDD 4DN4H 1J88A 1JE6A 2QQQA 4WF7A 3VD9A 3OKLB 3ETTA 3TF4A 3BUYA 3K71A 1P1ZA 3TEWA 4M02A 3QC6X 4K9EC 4C59B 3WUWB 3TT3H 3FPXA 5IY5B 3V5DA 5AUMB 4FXKC 4WGWB 3C2AL 3CUPA 1CFMA 4DEUA 3T0BA 3L16A 3EYQD 3QWOA 1XH3B 3WNOA 2UUDH 2NSQA 2GSGB 3UACA 4F7CB 4KNTA 2IJ0C 5K1VA 4FS0A 1E8WA 4B5EA 4M62L 5IW1A 1ZEAH 2AZUA 3FHAA 1GGIH 3V4PB 3EFOB 1RP8A 3H9SD 2PR9A 3SDCD 2HWZH 3MO1A 2BH0A 5AZ2L 2EDXA 5I71C 5H37A 2C7FA 3TEUA 2VABA 3X3FL 5DURB 5EF1A 4X4KA 4MNQB 1PFCA 3WNJA 1UXWB 3FL7A 4KVCH 2Y22A 3L3IB 3EBHA 1MCCA 1GCFA 4HUMB 1KCLA 3U7YL 4ELKA 4KXAA 3VD5A 3CFDB 3QEQA 4R7VA 5TE6H 4APQD 3DUSB 1K6QH 2OSWA 3C9NA 3IFOB 2V17H 4J5VA 2DLIA 2IALB 3LHPH 3B2UC 4AUUA 4NDMB 1FQ9C 2CDEA 2QSTA 4I3RH 3RTQB 1AXIB 3RDTA 3O2DA 1I9RL 1P4IL 3VGBA 5GS0H 1I8LC 2F18A 1LVEA 2CBMA 1LDPH 1N70A 4JKWA 4UQ3A 2E7HA 2YEVB 2UZIL 3NYKA 2QDVA 3MGTA 4M4RA 4U33A 4Q7DA 2BHYA 3S5ZA 4P59L 5B39G 4IBWA 1EFXB 4R4ND 3MDJA 3BUPA 5EU4A 4X4YB 1Y7VA 2ZZUT 1E43A 2AEPL 3WFCH 4OCMC 4K3JL 3CFCL 1L6ZA 3VE0B 4FABH 5FHBL 1JSYA 5I5RA 4LSSL 3AS2A 2X09A 1NL0L 4BFRA 3ML9A 4E2OA 4LDOB 3CDFA 4KRLB 1JPST 2CAKA 4DUWA 3RGVA 2KZBA 4KVPA 3QQ9D 2GJJA 3WIIH 1NIAA 4ZO8A 1T1ZB 3D39E 5E9DD 1E90A 1H6FA 1GIGL 2Q7AA 1C8QA 4XCCH 2DIAA 1MCOL 5JDSA 4A37A 5BOJA 1DVUA 1NC2B 2WOYA 4R6UA 3WSQH 1A6TA 3KLHD 4AUJA 1KXTB 2A74A 3EG9B 3BVNB 4NQXA 2HJFA 4OLVH 3S35L 1CLYL 1WIUA 2Y07L 3HI5H 1FNFA 3PP3H 1KYUA 4PJEE 1SXZA 2Y2YA 3Q05A 3GMQA 1OZUA 3T3MF 4BA8A 3RZWA 3U4BH 1T5XB 1TQCB 1SZNA 2PTUA 2K9UA 4AH2A 5D5MA 3NP4A 1D5RA 4RGMC 3ZTEA 2Y7QB 2JFCA 2R1YB 1UWFA 1WPCA 3JV6A 3VTTA 4TQEH 4YN3A 4A7UA 3BHBB 2DLFH 4BSVA 3UG3A 4L8CB 3DRTA 1SM3L 3CXDH 1D6EB 2BS71 2JCCF 1IKNC 4DAGH 4GAJL 2VQ4A 4WTZG 1YY9C 4P4KC 5K9KB 2F58L 1X7QA 3MCKB 3VB8A 3S4SA 5CD3A 4BK4A 4GXUM 3WE6A 1DANU 2VCOA 4NKDA 3DSNB 3CZJA 2BSRB 3HN8A 2ZNXA 1WZLA 2MCMA 3HUJA 4YXHL 1NM9A 2Z9TA 1F58L 2DRUA 3EYOB 3TBSB 2Y23A 1R3JB 1GMIA 4L8SB 1DBBL 1TPXB 1N68A 3IPFA 2XWZA 5DC4B 4UM8A 5CF3A 2ZP0T 4AL8H 4M8VA 1CVRA 4HC1H 4ZRGA 4IM8A 4KXCA 3FUMA 3VFNA 1MH5B 3L4XA 3LEVL 4OCSH 2CDGB 1IL1A 2ZXEB 3O3DB 3FU0A 3KVPA 4KK6C 5IQ9A 1S9YB 4XI5C 1KFAH 3P2DA 1SLWA 2XI9A 3SPIA 4LESA 1T89A 1VENA 1B4JL 2NTFB 3DYOA 3MV9A 4OW6A 1TCRA 3FSZA 3PWJB 4P2RE 4L1SA 2P5EA 2V9UA 2ZKMX 4AIEA 4HSCX 4AXWA 4Y16A 1Q9KB 3EBAA 5I1GL 1JZ8A 3NA4A 2LU4A 3QT2A 5C9JA 4KZEH 4U05A 2ORBL 4FEMA 3IK2A 3L3DB 1UD3A 3QAZC 4U7SA 3X2QB 1WRFA 2BZ7A 3PWVA 5C86A 1H8OA 1XVSA 2P24A 2XNAA 5EN2A 3TWCH 3IDIB 4WUUB 3LKQA 3UCQA 1HILB 2AK1H 1E4XI 1LTXA 1KB9K 4N5ED 1XSIA 2NCEA 1UOKA 1IM9A 2BX5A 1D5XA 4ODWB 3KM2A 5DFWH 5AG9A 4WKXA 2IDQA 1HKLL 1PZSA 4H13C 5DUPL 3BO8B 1VFAA 3NIFF 5D7LD 1L7TH 5L4IA 3I84A 4E42B 5J0BA 2Y3NA 4UDTA 1RZKL 4JUTA 5BS0E 5I16A 4KKZA 1X44A 3WTYA 2MQGA 4ODUB 2AXFB 1U9KA 3P9LB 1ZDSA 2MCAA 3TO4A 3L4YA 3GUFA 3QUYB 2GIYA 2ZXDA 4YC2B 1U8NA 3T4AB 3FT1A 2PO6C 5EEZA 1CDBA 2YGNA 4X6FB 1I82A 5C92A 1CD8A 1LEGA 1UD4A 4J8RA 3DOIA 5DD6A 1RZ8B 1JXDA 3G6DH 1F11A 5AKSA 2B1HH 4GUPA 3PCYA 3E6HB 1SN5A 2YOAA 3NJJA 3C12A 1OCOB 3B2UD 5CHNB 4ZPTB 4HU8A 2B2XL 3SE4A 4O2FA 5EZJB 4A7SA 2NNCA 3FTSA 1OGAE 3F7VA 3B56A 1KG0A 2J6WA 3QZBA 3VDAA 3NGBC 4FNSA 5D5ME 2HWZL 2DQ6A 2QKSA 1KEML 2MMXA 4OI8A 4QRRA 3MTRA 3WFHA 1CBVL 3U4EB 4I5BB 2A9AA 3EGSB 4B9CA 4MCZA 3QHTC 4EMZA 3IJSB 1M05B 4LLDA 4GRMA 5JQ6L 1ESOA 1P7QD 1IE4A 2B59B 1JZ5A 4XMLH 2HYMA 4L0YA 4HWEL 5FHAH 1O6SA 4TM9A 1UZ6F 4HWZA 4K94C 2DQCL 1NFDE 1Z3GL 3P2BA 5DGRA 5A40E 2VXTL 2ALWA 2YMXH 3L1GA 4O4YH 1UM6H 3OXSA 4GW4A 4OLUH 2Z93A 3DBXA 1QRNE 5FYLL 4XCEA 1HWWA 2Y2WA 4NQSA 5LCVH 3ULUF 2NZ9C 2EADA 1IKFH 4JHAH 3RZCC 3ARQA 4H4NA 4DP9X 3IM1A 1UOVA 5A6LA 4ZUTA 4DP7X 1R46A 2AABL 5EZIH 1TQBC 3VMNA 3KGTA 2YJQA 4PJBF 5IB1A 1P2CA 3BYTA 3BH4A 4X5WB 4WWPA 5HJ3B 2AXFA 1M42A 4S2SB 2XWTA 5KBLA 1JF5A 4PJ9A 1XBDA 5DA0B 3VFWB 4CNIA 4ODHH 4JPKL 1LMIA 3N42B 2AKRA 2M26A 1CN4A 5DJAB 5I1DA 2AEPH 3WFCL 3MA9L 1U91A 3RLSA 4NQCA 3KW8A 1DQDH 2BSCA 5D2LB 4LVNC 2GSIB 1IEAA 2CH8A 2P80D 5CIPA 2YAQA 4P2OA 5CGYD 5F6IC 3SBRA 1CTOA 2BC4A 3GBMH 3AUVA 5FYJU 4KQ3H 1G7QB 1RLWA 2HRPL 5SWZA 1PJWA 5JHDD 3REVB 5F44A 4GP4B 4XE0A 5HYQB 1C5DA 4QEGA 1T1YA 4OKVB 3FO1A 3CPLA 4HGKC 2BWIA 4LCIH 3KWTA 3MJGX 3O3AB 3P3YA 4JW3A 3WENA 3JYCA 5D1ZC 4L3EE 3OAYH 4PGBB 5IROD 1J05A 1VFMA 5KVGH 3NACH 5LNDA 1TVHA 2OMZB 1INDL 3GD1C 3HZVB 1MJUL 4XPBL 5L88L 3IDXL 3LCYA 2FSDA 4G80A 1K5NB 3ZKNC 4XO3A 1MVUA 1MNUL 4NZDA 4P5KB 3F12A 1T1XB 1ZVSB 1UACL 3II1A 3T0AA 5J12B 3P0YH 2A1WL 4Y1AD 1NCHA 3O8XC 4ZDHB 1YDPB 5FO7B 4XNXL 4ODVH 2EDMA 3STLB 3HI1B 5EHFA 1MI5B 4PR5B 1HWGB 2BNRD 3EAKA 3VWJB 2BIIA 2NLJB 2C9VA 3TN0B 5JXAL 1AJ7H 1UHVA 2I24N 3OZLA 1DBAL 3BIKB 4DQOH 2GBUA 3FU6A 2UWEB 3PFQA 1M1SA 1KGWA 3OX8A 3FOMB 1M9SA 3HE6D 1AVAA 1MCDA 3TBWA 4BFEA 3ZTNH 4B9KC 1CFQB 5F7FA 4OF8A 2DJSA 1C12B 4V2BA 5GGTA 4H1LB 2R59A 3CN4A 1R34A 3CH8A 4JVUA 3EO0B 1YNKH 3P4NA 2YLHA 1FO0L 1UZGA 4AYFB 3NJNA 4ZNCD 1WJ3A 2WVVB 5D93B 3V0FA 2DBLL 4ELME 2WIIB 4XMLL 2XV2A 5LAPA 3BO8A 3UMNA 4Z77B 5DQ9B 5DZLA 3K1DA 4MJ6B 4OQTL 1H3VA 1HSAA 2BOCB 3T08A 1YJDH 4DW2L 3S88L 1H15B 1NCGA 1PEZA 1JZJA 1U2CA 2B9BA 5KYWB 2YZ8A 4NO0D 4R8WL 1KGJA 2DLHA 4JJOA 3M1BA 3ECWA 3QZWA 5KWYC 3BDBA 3O0RH 4Z0BL 5HI5C 3RGBA 2KHAA 3LHPL 3D30A 4HV8A 4NIYE 5F3BA 2IADA 3VU1A 3U9UA 4EDXA 1U3HA 1GVIA 3KPLB 3DVFA 2MTPA 1OF2B 3VDBA 4MWFA 2WLNA 3D25A 3UZEC 2FQFA 2ADIA 3HE6A 3EFFB 2G9HB 4TQ8A 1ZLVK 5HGAA 3PREA 4RVBA 2Y7LA 1XF2A 2DQFB 1B0WA 2D7OA 2ICWB 1IC4L 2FSEB 1JVOA 5B1JA 5AALA 5LBGA 4F8QA 2BNRA 3U4EA 1LQSR 3K2KA 4UDUA 3JWNC 1G6VK 2EZ0D 3CZSA 4YGVA 4AEHH 1G1OA 2CDEB 1IAIL 4YL9A 5DD1H 4ALAH 1OQOA 3A3YB 3LPFA 3QXDA 1W0VB 4J1UB 2Q6WB 5F97E 4G8GB 5E6RB 2YAOA 3QCVL 4BE6A 2DYSB 4MXVE 5DMJB 1D5IH 1T22A 5T5NG 4XVSL 1OHZA 4M6ML 4IOIB 1H3PH 5IM7B 1L9PA 1R47A 1LDSA 3DX8B 3GS0A 3PJSB 3QUMB 5E2UH 4EJ1C 4HOWA 4J3SA 3QDGA 5G2NA 1MCOH 2UUDK 4XPHL 1INQB 4OM1L 4I9WE 4OCWL 1Q1PA 5C09B 1AQDA 4QTFA 3VFRB 3G6DL 2BK8A 3SDAB 1WVZA 4PLKC 1E9PB 4WK0B 2X3CA 2FJFB 2EIZA 2WQWA 4QWWC 3GSWA 1MJ8L 4KZCA 4OU3A 1CD1B 3W3BA 5GS2D 2P80A 3FQXB 4BDVB 2CCWA 4LCCA 4HK3N 2HXAA 1E9OB 2IDTA 4FKEA 4PJHB 4WCYH 1JHLL 4PMFA 4XHJD 4N3UA 1GC1L 4EKXA 5B22A 1EFXD 3ECUA 3IU3B 1TMCB 2IH1A 4KKPA 2DTSA 4N8VB 5GGVH 3LKPA 4M7LL 1NEZA 3EHBC 4XVTL 2C3GA 2VSKB 3C60B 1J5OH 1T5KA 5FYKE 4JM2B 3TOPA 4PJCE 3VXSB 3BVDB 1YEKH 3MRCB 4NDMA 2ADFL 4WWKC 5IHWA 2CRZA 3LOWA 3FT9A 5DJDA 3QP3A 1KCUH 4UZSA 4QRSB 1XL6A 4P9HC 1NPJA 4U1HB 5JXAH 2YEZA 3AZUA 4OLUL 1NFDA 4ORZC 5F21B 5CCGE 4WV1C 3AABA 3NPZB 3SE6A 3NJFA 1JZ4A 2X9ZA 3D0LA 4XNBA 5E9NA 3CMOL 4ZFGL 4LRIC 2WBXA 5IVXE 3F7LA 4OJYA 1U3JA 4DZBB 2EH8L 3ESNA 2JKRM 4L4VB 2CALA 4U4IA 4W9FC 1O6TA 4TQEL 2WLJA 3B9KC 5L6YH 4DP0X 5F88A 3Q5YA 5DLMH 1KY6A 3QORC 3OMAB 4AVHA 5AVTB 1F6AA 3HRPA 3UIZA 2F8XC 3S37L 1IAKB 2L7JA 3CGTA 3UC0L 4P4RB 2VDNL 1I3UA 3G9VA 2ZXCA 4KC3B 2FB4L 1YN7A 3MHZA 5JIIA 3BJLA 2WUCH 4E5XG 4NZRL 3FOMA 5TE4H 3LNHA 4G3YH 1MXGA 2YPVL 1A8ZA 1ZTMA 4IYKA 4J23A 4NQTA 3TIEA 2NY6B 4P46B 3GBML 3MBWB 3QISA 3CFQA 3OKEB 4H2CA 3SKMA 3BX7C 3JVFC 4KTEL 5B8CB 4KZEL 2ZKWA 2WJ7A 4UBDC 4ES9A 2VN4A 1G5GA 4RQQB 4CKVX 2YN5A 3QPQD 1N5AB 2VLRE 5DWUL 1SHSA 4LCUA 1KB5H 4PV1C 5FDWB 4UOW0 1E5YA 2YD7A 3C8KA 3CTTA 5HHQA 4OLWL 3NSXA 4ECNA 1BFVH 4YIQB 4OD1H 4ZFZB 1FIEA 1OSPH 2GJ6A 2NDFA 3KWXA 3F01A 4PJ6A 1ZLSH 3HLAA 2H0FA 1ZMYA 4HCRA 4UV4H 1TTFA 3GSUB 4F7KA 3L9BA 2Z7YA 1NWOA 1WFOA 1OAYH 4YSCA 1JF1B 1E7UA 3VD7A 4YHLL 4F33B 1ZVHA 1N59B 4Q89A 4R96A 5DD1L 3VXSD 4ANWA 4F24A 5JA8B 1I85C 5AAWA 3GLAA 3L5HA 3VA6A 1R3KB 3SGDH 3MJ9A 3PHAA 1SLXA 5KAQG 1EANA 4M5YH 5EU6D 3WKML 2O4EA 2FJGA 3KH4A 5BXFA 5EU6A 2L0DA 1XSOA 3W0WD 2X6MA 3QNYB 1DE4B 5ADPH 1Q94A 3SDCC 3BVTA 1M1XA 4CMHB 3TVMD 4O5LL 3AWGA 4OM1H 5T5FA 5C3IA 3EGDB 1T0MB 4WHYH 3FTXA 1TETL 3CPUA 5HDLA 4Y4KC 1XZ0B 4OUUB 3PWUB 3G04B 2DDQH 2BVOA 2PW2A 4JN2A 4K7PY 4X0KB 5LO7A 2F61A 4KX7A 3HAEG 1X5GA 4G43B 1YQ2A 3B2PA 1DJSA 5C7XL 4JPQA 4JZJA 4OGAD 1ADQH 1X9UA 3ZKXC 2VR3A 3IAGC 2UX7A 4G6AC 1OCCB 3CFEA 3P4OB 5C3LD 1WV7T 5T3ZD 5E08H 4KHXL 5FYLD 2ENJA 2D73A 1WIOA 3UTZA 2W0PA 4QO1B 3VD2A 3UTQA 4I2XB 4G8GD 3HAEB 3MROB 2FIKA 3H2WA 4XN7A 3WU1A 2LLGA 4OLZH 5HHQB 1X5FA 4WEBL 2YK1L 5I8KL 5FYLH 3H1ZA 3D39A 2VDPH 3EBGA 2H2PD 1EIBA 1UZ6E 2WINA 4YSEA 2FJFA 3CFKB 3DRQA 3KXFD 1NIDA 3KPOB 5E8OB 5I17A 4FFZA 1AGCB 2COVD 1P7KB 3GXMA 1AP2A 5BUAA 4FLOA 3S5YA 3PHOB 3FB8A 3RFZC 2VLJE 3N1PC 1T1WB 1NGZB 1XL4A 3EYQC 3QIUC 3FTGA 4JRXD 1KYDA 3QCTL 1TITA 4OCSL 4EOWH 3EJRA 4MYWB 1R5WA 1KTLB 4OD2B 5H2BA 3VW3L 1LD9A 4MAYA 4S1SL 4GI6A 5JXEA 1BG1A 2BS9A 2N7SA 3FO0H 1HXKA 1FNAA 3LD8C 4C56E 4J3TA 4X6BA 2Y6TE 2NR6A 4OV6F 4Z7IA 5IWLC 1A9EB 1MEXL 4HJSA 2ZOKA 3ARDA 3BYYA 4L4JA 2XRAH 5DTFB 4OM0L 4J8RB 4ERSL 2L7QA 1YHPA 3BPCA 3BWAA 1OGPA 1WZ1H 1OTSD 1IBYA 1U41A 2CDFA 1XMWA 4LSVL 1XGTA 5LGHH 4Z5RA 2KZ1B 1MCKA 3D0LB 4QHNB 5K1JA 2YPVH 4H1LG 1CURA 1ET8A 1OANA 4WENB 3EDJA 3MJ8B 4XO4A 3BMWA 4DERA 3T3MB 3H2PA 3GF8A 3MUGA 2ZE0A 3FRPB 4YHOH 2W65A 2OJEA 4NQDE 5MERA 1D6VH 3OB0K 1WQVT 3MPCA 3K4AA 5TFSH 1KCRH 1JHLH 3BISA 2JIXD 4JFVA 3MBEC 5MHSE 3O3BA 5EOCL 2WQSA 2FWOB 2JCCB 2Z35A 3KPQA 1TKWB 1NKGA 3T2NL 3RJQB 2K7PA 1U42A 2B20A 2LTQC 2O30A 4R26L 1WBZB 5E5RB 5SWSB 1E8XA 2ZP9A 4M5ZL 1N8OE 5FA4B 4JRYE 3OKLA 4FHKA 4KTDH 3WJLA 5C6TL 1OK0A 1UH3A 1RIUL 1CDGA 3HR6A 1JV5B 2NY3D 1A22B 1BHGA 3K5SA 3T8XA 1KCUL 8PAZA 4KHTH 3K6SA 5JW5A 1MFDH 2ATKB 2MHAA 4DPRA 2KH2B 4BFGA 1LNUB 1CGWA 2ESVA 2HSIA 3LRSB 4HBCL 1MJJA 5ERWA 3ISRA 3ESMA 5DUBA 1JFHA 5IW6B 4PB9L 3KLHC 1K3ZA 4A7GF 1O75A 2WSKA 3LV3B 3CSTA 4Y1SA 4YDMA 3ZIYA 2AQ1A 1GOGA 4BYHA 1YJDC 3SIKA 5C0AD 4C83A 3IXAA 5CZXD 5DJZB 3QEUA 4FTVB 1S7UA 2Z4QA 3KPOA 4P3WA 3WGUB 4EUPG 5H4YA 1KEGL 5DZJA 3MNVA 1ED3B 1NAMB 4MA8H 4MDJB 5ILTL 2VMCA 3CVHH 1TO4A 1TTRA 5ACMA 5HPMB 1Y1DA 3P4NB 3TBYA 1O7DE 4WQOA 2IAMA 3JTTB 4K5NA 3HC4H 3OLEA 4LPYA 4PGDA 1IC5H 3SY0B 3V4UL 1YEHH 3U0PA 1T6BX 2G3ZA 1CWVA 3PQYA 1GRWA 1REIA 4U6YA 5EN3A 3CBRA 3FBKA 4K3DL 4JKKA 5CMAA 2HKFH 1P7HL 4GG6E 3BMVA 4QRPE 4H0HB 3DJZA 4PRBB 2VZSA 3V52H 3FW6A 3KE0A 3MN8A 4GBXB 2FX8L 4N90D 2DWEB 1MFCL 7CGTA 2J44A 3W39A 3X1EA 4K3JH 4FZEL 1RZJL 4TUKL 5F0LB 4BQ6A 4ONFL 2VWEC 3ALWA 4W9DC 4LOUD 4ZO7A 1L7IH 2JELL 3BN9C 5TK2A 1PKOA 1A4JB 5F7HA 4OJCA 1HOCB 3TZVC 3ULUC 3VSTA 3FRUA 5J1SC 2HT2C 3O0LA 1MFBL 5BV7C 4Q9RH 4JMNA 5AW0B 5I23A 5JNYA 2FJGB 3FQ1A 5DMIL 3ILPA 3MOBH 3PLYA 5IJVA 3KAAA 4GT7A 3WSQL 3RWJB 4TLUA 2X4SA 3FMGH 3B9DA 3CN0A 4HFWB 4P5TD 3H7LA 1UJ3A 3O9WA 1NGPL 4NYLA 2VW6A 1G7HB 4XRCB 4XWOC 3P30H 1OAKH 3WS6C 3ZJAA 3RWEA 5B1CA 4YLBA 2OULB 4P23C 1X5ZA 4W9CC 4IBSA 1AP2B 5EU6E 4PGZA 1IL1B 3GIVA 3ESUF 3JT2A 4OGAC 5FHBH 1CYWA 3H3BC 4UB0L 3GBDA 1U8CA 3A47A 5HI3D 5C0CD 4ALAL 1TZGH 1HSAB 2BOCA 5JW4N 1GC1H 2R51A 2UY6B 5KSBA 4PR5A 1MXDA 3CX2A 3L6FA 4U2ZA 5DRZA 4BM7A 4I2XA 4KPHH 4NI6A 1B0IA 4EI5C 1E3XA 1OIOA 3L1OH 4P5TB 3DX1A 3MNDA 3C6EA 2D2CC 5ANMB 1XGPA 1IU1A 1HI6A 1NDTA 1LO3H 3C8HA 2CGYA 2QQKL 3WO4C 4ENZA 1MI5E 4N2AA 3KPRA 4Q2ZB 3DX0A 4LKXA 3TJHC 5IEKB 3T6ZA 1AR1D 2E27H 4P9HL 5J56B 2X6VA 3GSRB 1XIWD 1YCSA 3QUYC 4YC2C 5IG7B 1A4KA 1VLXA 3IGAA 1AZCA 5I6XB 2KC0A 1RUAL 5DMYA 4OSUL 2AJZA 1F3JA 2J6EL 2VR8A 5B39A 4U6VL 8FABB 1SY6A 2WXFA 1I8IB 2OLDA 4PJBB 4QT5B 4DN4L 1MJ7H 1RH8A 3DOSB 1JZGA 2WLLA 4IS6B 3PQYB 3NK3A 4D9LL 2JE8A 2D03L 4ILDA 4RWYL 4ODTL 3RUGE 5AD0B 3B6SB 3N42F 3VSQA 3CN2A 4PJGB 3EGSA 4R7XA 2YSSA 5DLML 5GS0D 5SV4A 2D7MA 4X4ZA 4IMKC 3AAZA 4AVJA 3ZHFA 3JWOH 1V10A 3TNNA 2AEIT 3PWLB 4ZW3A 3NH7H 4WKZA 1T4KB 1OT4A 3H3PH 2JF1A 3IRCA 5J9PB 4K23H 3V52L 3DETC 5F7YC 2F5AL 1JWSB 2Y4SA 3N6YA 2Y5QA 4AZUA 4XZUB 1RK1A 4YHIA 5LBVA 4I85A 2QR0A 4UI2A 4OH2A 5E99L 5KSAA 1UD5A 3SOBL 2ZCHH 3WGVB 3NFSH 4H8WL 5DJZA 3MODH 4ZPVA 3NCEB 3VWKA 1T7ZA 3FQRB 3V6OC 1K6QL 5FGSA 1UOWA 3NJKA 3WMPA 3RIFK 4IRSA 4U4BA 4BJLA 1EAPB 2C9AA 3NTCL 5EU5A 4M7LH 2Q76B 2BXYA 3J7HA 4JN1L 4DKDC 3QQNA 1YMMD 3F58H 4AQEB 5CSBA 1N0LA 4S11A 3TBTA 4KDVA 1INQA 3LRGA 5ICXA 4H8QA 3SY0A 1BLIA 3PF2A 4QCIA 2OA9A 5AVSB 5I1CL 2VTFA 1SEQL 3MOAL 4H26B 2N4IA 2X4SB 4M7JH 3QJXA 1AOHA 4YQXL 2Q3ZA 5JIPA 2NW2A 3EH5B 3QUKA 1IGJA 3WHXB 4QTHA 2YPLB 2APFA 4Q6IC 4Y4FD 3GQFA 2QLYA 3QA3A 3VXUD 2A0LC 3N44F 2Z7UA 4XBEH 1RUKH 5EULV 5AW2B 1U8PB 4G6KL 5DRXB 1OAUH 3POCA 5K33A 5IR1A 1LEGB 5KS9F 1A3ZA 5IB2B 1RVFL 2YQ3A 4N0YL 4V1DD 1AACA 2ESVE 2VXSH 4H1LH 5CEXB 3ZZLA 3Q43A 1CLOH 2DWDA 3UJJL 2Y25A 5FGBA 1IMHC 1T2QH 2HVBA 4JM2C 5FF6B 4ZMOA 1JRHH 4O2EA 3SODB 3WTSA 1PPIA 1VFAB 4GNKB 4TKWA 1T0MA 1Z0NA 2Z8SA 3BAYA 4FHBD 3SDXA 2BVTA 4P06A 3Q8FA 3DUUB 4JHAL 4LCIL 2IANB 2ERJC 4OLZL 1RZQA 1JGDB 3A5VA 3W0WA 4AC4A 2NXZB 3G6JA 4JFFA 4J3OH 3BUYB 4MQSB 5EIIA 1QFPA 4U0RB 2OP4L 5H8DA 3LXUX 3ZE2E 4EBQL 2NX5B 4PGCB 2I85A 3GSNA 1QLRA 4AQAB 3SPHA 1P84J 2Y5EA 1MCPL 3CFTA 1QOKA 2JKJA 5JQ6H 5KVEL 4PLJC 2FIKB 1F1GA 4WW2A 1T83C 3BPNB 4HW6A 1RJCA 4KK5D 2JMRA 1AGDA 1JRHI 3MNZB 3VXME 4N22A 1AO7B 4ZUTB 3SYAA 5ANMA 3QYNA 1OT1A 3FQWB 1IVLA 2OJ1A 5I17B 2NYYC 5E8PA 1O5PA 2ZWNA 1DBML 4CKQA 1T2JA 5GGTH 5I18L 3VNZA 3WJMA 1UQSA 2K70A 3FT3A 4F1SA 3CG8A 3OG4B 5F1KC 1HZHH 1R5IB 2EDYA 4WEBH 5I8KH 4HLJA 2P7TA 4M7ZB 1F4YH 4YE0A 1NCWH 2HJFB 4RGNE 4AZ8A 5B3JE 1TEYA 4G1EA 1XGZA 2Z31A 5DS2A 1IILE 5DURD 1ZT1B 1N6QL 5AW7B 3T3PF 4JFFD 3LIZL 4IGBA 3UTQB 5JR1L 3CFIC 4FCAA 2G75A 1B88A 3UO1H 4Z7WE 1DJGA 1UT1A 4RRPM 1C16B 4UMSA 4OJEH 1BF2A 1E67A 1KFAL 1R5VB 1U8LA 1E4KA 4DGYH 2E7DA 3ARXA 2JKWA 4WGKA 1JZIA 3ZO0A 2VXQH 3V0HA 5IESL 1TVHB 2FBJH 2OMZA 4Z76B 1HAWA 1ZSDA 1VESA 4NKQB 4PI0A 4FNPA 2JQZA 1MIEL 5HI3C 3FO0L 3QNXB 4LLUB 5FK9A 1VPOH 4NB7A 3BDYH 5AWNL 4JFFB 3RBGA 4F20A 5BO1L 1Z9OA 3K6DA 2JTDA 3VMPA 4LLQA 3RVTC 1EJOL 2Q3AA 2QSVA 3WD5L 2BSRA 3B9KB 1IAMA 5LXGH 3NACL 3VE0A 2ZUWA 5EC2A 3MRFB 3CE1A 3EUUA 1Q72L 3IDXH 3GZKA 1WEJL 1UCTA 2OXGB 3GM0A 1YYMH 1AO7D 3NABH 3E6FA 1GPOL 4G43A 5L8LB 1WTLA 3W9DA 3Q2WA 4JQIH 2XZAL 4GAJH 4KVNH 3RB5A 5L2KB 4XZ4A 3MRRA 1NL0H 1UCBH 1QW9A 4XP1L 4DUXA 1CFQA 1S7QB 5J89A 5F1OB 1J5DA 4HUUA 4KFMA 4XNXH 2I9LA 3D8MA 3LS5H 2DV6A 4LARL 1E6JH 5FYKD 4B7LA 4L9LC 4Z7UA 4Z95H 4HZLA 2EEXA 1BVKA 2ZAHA 5AVYB 2ADGB 3RWHA 2VDOB 4HKBA 4F2EA 4WEUD 5HI4C 2BCKB 4MS6A 3BT2L 5E8EB 4ZQTA 5F9OL 1FGVH 4X8CA 1QFWI 1S7SB 1L6PA 3BP7A 3VH8B 1LEKA 2FLMA 1DEDA 2VXUH 3AJ7A 1LK2A 3KR3H 4LCWE 1ZLUK 4BQ8A 5DJ0A 4X42A 1T80A 1JBJA 2K9FB 1A8JH 3SSGA 3WAJA 4N6QA 4FI6A 3SQBB 4Y7MA 1IEBA 1D7CA 1HWHB 1SUJA 1U92B 2GTZA 3F05A 3EJQA 3S34H 3IE4A 3CQFA 4L48A 4HT1H 5LQBH 4G5ZH 1CTMA 2BY1A 4BRVA 3IF1B 2QVIA 4MMXC 1A3LH 2OR9H 3H42L 2HAZA 5D4HA 5DEFA 3T0XA 4BBWA 3S2AA 5JLZB 2AK4D 1SXSA 1TU2B 3D48R 3KYMB 5HHMB 4UQAA 4QXWA 4IIQA 1GGTA 2F54E 4HKXB 3PGCA 3K2UH 2BNUB 3WEBA 4UDUB 2A6JA 4Y4FB 3GO1L 2EDQA 1SXBA 2QLVB 3KVQA 3FOLB 4QRRE 1RMFL 1UWXK 4GIPD 5F7LB 2H1LM 3SZ6A 4JDEA 3G5ZA 4CVWA 3TJEH 3AY4C 4Q9QH 5D6CB 1TYRA 5ID0A 1DZBA 2XBDA 3ZL2A 4K3DH 2EQDA 2VDRH 4UTBA 5LGHL 1IB5A 1COBA 4Y4KD 2UXVA 4CSTA 5D2NA 3B7SA 2CO6A 5C07E 2NXZD 4A6YB 5DA4A 4P2QE 2PTTA 4M6OH 4LASL 4XXCA 5IFAH 1JGEA 3SQOH 3GI8L 2J72A 3FTYA 4Q6YA 5I66A 2A4CA 1KNOB 5FO9B 3VFVB 5DJXA 1J0ZA 2VAJA 4G6AD 1KEGH 4HSAC 3SYCA 1RIVH 4WHTB 4WHDA 5C0JA 4N8PA 5E5MB 2VDNH 4O2CB 4U1IB 4G42A 3UYPA 4PG9B 3IB4A 2Q2EB 3W9DB 4CC4C 4BZYA 5JUEL 1E4WH 4NSKB 3AY4A 4WW1B 1DJXA 4G7RB 3B34A 1JDCA 4HEMA 4J4PD 4ODXB 2A3TA 1RK7A 1OW0A 3QGVA 1MLBA 4U3XA 1NMBL 2CO3A 4JFEA 3LTVA 1JK8B 4L8BB 2HKFL 4P9HH 4W9EC 4Z0XB 4N8VA 1UEYA 4PV8A 5DS8A 3GPEA 2PUQT 4DKFL 4BWUA 1D7FA 4FEIA 4K7PL 2ZD0A 3BVXA 4UT9H 2OL3A 3ZVVA 3MRLB 3D7PA 3G6JE 1KBGH 2VDQB 3X3GH 1LEKB 3MLYH 4QHKJ 2X38A 3DV6B 1NC4D 2R39A 2V5TA 2VDPB 4K94L 3OMZA 1S7VA 1Y18B 4IOSA 2IQ9H 5CJ8A 4YSQA 4EQ3A 1I31A 4HUWA 5ALBH 3ZRSA 4H5SA 2BSDA 2L7UA 3O41A 1ROWA 4JUSA 4GFXA 4XMZA 4PSPA 1EEZA 3HC3L 3OKNB 3SPGA 4WK4B 1U92A 3Q6FB 1IEAB 1AD0A 1FLRL 4JBSA 1G87A 3ELAT 3BW9B 3JWOL 4OVVA 3EFDL 1PZCA 1RZIA 3F6LA 4OZFH 4E5XA 2AI0L 3MLWH 1DVSA 5E6YA 4RISH 3W2DL 1ZA3B 2X9WA 4AY0A 1CFVL 3VI3F 1GMEA 2XA8L 4KMTH 1Q8MA 2ODIA 1N5YL 3OWEA 2YGVA 1J12A 3FZUD 3L1FA 5D1QD 1KTBA 2YS4A 5H37H 3ET9F 3G04A 1CDJA 3ABLB 2SEBA 3QEGH 43CAB 4YFLF 1WH0A 1N6QH 5ESQA 1ZPUA 3QO1B 4PBXA 5AW3B 4GRWF 1DQVA 4R8WH 1P0SE 3DURB 3IJ7A 3VG0L 1F90H 1DHKA 1E4JA 4K9EL 3L9YA 4RMSA 4AYBA 3G08B 5DVOA 1U8JB 2XXGA 4IW4C 3VFGH 5B39B 5GZOA 1OAYL 3V4VA 3PNRB 1SXAA 4JDVA 2JELH 3B7TA 1Z5LB 4R5TA 1OF0A 1CLCA 3RWCA 2GTQA 3QHFL 3FSVA 4MLIA 5E2TL 2W0FA 5F9JA 5KVGL 2HT4D 3I3DA 2C7UB 2L04A 1BFTA 5LWYL 2YSSB 2NNAB 5C0DA 2MIZA 4WIQA 5KJRH 3MZGB 2XXCB 3L9EA 2AABH 4HSQA 1OXYA 5GS2H 4RX4D 3EOTL 5IIEB 3GBLA 1MUJA 1RERA 1FL6A 1EAPA 1TJXA 4JS7A 4HUWB 1EX0A 1LQBC