4CSSA

Crystal structure of fimh in complex with a sulfonamide biphenyl alpha d-mannoside
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
158
structure length
155
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN FIMH
publication title Fimh Antagonists: Bioisosteres to Improve the in Vitro and in Vivo Pk/Pd Profile.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 38
structure length 155
sequence length 158
ec nomenclature
pdb deposition date 2014-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 4cssA00
4LOVA 4AVIA 5IQNA 5LNGA 3ZPDA 3BFQG 4XOCA 4X5PA 1KIUB 4XOBA 5AAPA 3BWUF 5ABZA 1TR7A 5F3FA 4AUYA 2VCOA 4X50A 3ZL1A 2J2ZB 3ME0B 5IQOA 5JQIB 4CA4A 5F2FA 4AV0A 5LNEA 5FS5A 4AUJA 4AVJA 4AV5A 1N12A 5IQMA 4XO8A 4XODA 4AV4A 1PDKB 5FWRA 2XG5B 4J3OH 4AVHA 4XOAA 2W07B 3BFWA 1ZE3H 4XOEA 5AALA 2WMPB 2JTYA 3JWNG 4J3OF 2UY7B 2XG4B 4AVKA 1UWFA 4AUUA 4BUQA 2UY6B 1N0LB 5CGBA 4XO9A 5FLUA 3ZL2A 2JMRA 4ATTA 1QUNB 1KLFB 3SQBB 3JWNE 3MCYA 4X5QA 5AB1A 3JWNH 4CSTA 4CSSA 4X5RA 3RFZA 4J3OG 5FX3A
chains in the Genus database with same CATH superfamily
4IDJL 3ZE0E 3CFJA 3MLXL 4GXUM 3A6BH 1SXSA 3NA4A 4PJHB 5FO8B 5A1AA 1A6TA 2GTQA 3GMRB 4G8GB 3FN3A 1DBJH 1TXKA 1RZKH 3ECUA 3WAJA 4JGMA 1BQRA 2YGPA 1ACYL 1LO0L 1WZMA 1UT1A 2I07A 4LU5H 4JFDB 2F68X 2G75B 4MDJB 2UZYA 4B96A 5CBAA 3SSGA 3H9YA 5HD8D 3WTVA 1LEIA 3V6OA 5T3XH 2BOCB 4WSGA 4TL4A 3PJLA 5KBPA 5EBWB 4OZFG 1HI6A 4HUVA 4P49A 3MR9B 3NSYA 3ARBA 4DAGH 3QPKA 1IC5H 3WNIA 5EO1B 3PL6A 3U7YH 5FKAA 3X3FH 1MF2L 2JFCA 1QKZL 4AYEC 1IVTA 4ODHL 2ZUUA 2CJUL 3EOAA 1MELA 2AJZB 2PWDA 3GSXB 4Z7NF 1CLYH 1HT6A 1IGYA 2IH3A 3ESNA 3TF4A 1FCCA 2WW8A 5ADOH 4P8QA 5EBLA 2OV0A 2QGCA 3FOMA 4HH9B 3OAZH 3T9WA 2O6FA 1RZGA 4Q89A 1I7RA 5LBSL 2ZYHA 5D1QC 5E4AA 3A23A 3ARUA 3REWA 3FB5B 1T7ZA 1EO8H 4P5SA 3DETC 1OCWH 2C3WA 4HUXA 4L8BB 4PB9H 2VZ1A 4Y4HD 1KN4H 4MLSA 2VQ1B 4GXUN 2CAKA 3SPVB 1YY9C 3KPRA 1DFXA 4POYA 1ERNA 5LXGH 3EYUL 4R97B 3C60C 2E4FA 3VTTA 3VXPA 2DJ4A 1FFPA 2KUTA 4JCLA 4U3SA 1ECYA 2NQCA 1BM3L 1KT2B 3HI1B 4PGBB 2R0LL 2WTOA 3LIZL 1AIFB 3T0EA 2FBRA 4JO8A 1SHMA 3B43A 2A9DA 4ZPVB 3RG1C 2O5YL 5D9SB 1I9IL 1ZLWH 4JO3L 2ZCZA 2QV4A 5DYOB 5HVWA 1BSIA 1BX2A 2CLRA 2A9CA 2G2NA 1IEBB 1PZCA 3IRCA 4MCYA 2R1WB 3MJ7B 3NIGE 4DFHA 3IWVA 2EEXA 4JO4L 2EYTB 3EH4B 7CGTA 4NQCE 5I1LA 4KZEH 2FO4B 1Q0XH 1T7WA 3ZZSA 5FECA 3PWUA 5LHDA 3TS8A 4HK0B 4P9HH 4OV5B 2BS9A 1KTJA 1Q94B 2JCCB 3AUWB 5SWZD 3VA6A 3FS9A 4DETA 5C3LD 1T66C 5H37G 3QXDB 4E9WA 1QSEA 1GZQA 2CMRH 4MA8L 4KITB 4DKFH 2ZOLA 1NOLA 5IREA 3H54A 3H9ZA 5E9NA 5GS0D 1GVIA 1SEQH 2QKIB 5C0BE 1CFSB 3NIGF 5DLML 2Z7YA 3Q5TA 2CBTA 1WTLA 2OR8A 5F44A 3HS0A 4EDXB 43CAA 1BM7A 4OZIE 1FLRL 3CPLB 3L1GA 1PKQE 3A4DA 4UTAH 2YAFA 1TT6A 1S7XA 3KPSB 4M6OL 4EN3D 1OLLA 5JXED 1L0XA 2B2XH 2EQDA 4ELDA 2XWXA 2FECL 4BBWA 3HFML 3RZCD 5AW7B 2ZNXA 1CE6A 5GGUB 2X09A 1YYLH 3CLEL 2NY4C 1B4TA 4IK6A 4G8AC 3QJFB 2WKOF 3PPEA 1H5BC 1EHKB 3V4UL 1HAUA 5HYQB 4KVNL 4QHLA 4UIKL 1X5HA 2LFGA 2RIKA 5CEYA 3CMGA 4HSCX 4XPBH 3T4YA 4LPVA 1IL1B 2X40A 1ZT4A 3BMVA 5DUPH 1BOGA 1CE1L 3T2OA 5I9QB 1JNNH 3QEHA 4ZTPL 3V4VH 3CSFA 4JQVC 4YEEA 1VFUA 1OAUH 2KHAA 1J88A 5FAAA 4AE1A 5DZOA 3FUMA 1RZQA 1WA0X 3GJFB 2FIRT 3GXDA 1PIFA 2GEEA 4YQXL 1DLFL 5SX5H 5D2NC 3RVTD 3QIBC 4GBXB 3S5LG 4IU3A 2QPSA 3RGHA 4LSTH 4PWJA 5I18H 4GXVL 3ZU8A 3TWCH 4PRPD 3QEGH 1KXVC 5JQHC 3K74B 2FUQA 5JHAA 5MEND 3QG6A 3AY2A 1Z9SB 1AZBA 2ED7A 2XZCH 3L2LA 3F84A 4LL1A 4D3CH 3DO3A 5I1IH 4Y19E 1NGQL 1ZVYA 1Q1PA 2K1MA 5AOLA 4ZAKA 4MMXC 3DO7B 4RFNB 2X9YA 4LCIH 4LIQL 4MCMA 3RFZB 5K39A 1E7UA 4ELKA 4AQ8C 4P5MA 4X6DA 3VXNA 3HG2A 3NCJL 5EIIB 3CX5J 5HHMB 1RK1A 3B37A 3S88H 3ULVF 4JM4L 3FQNB 3I84A 1KBBA 4A2LA 5JQ6H 1U9KA 3QS2A 5DJCB 2I7OA 5AKVA 4DO6A 4L8CB 5IVZA 2F8VA 1TYRA 3P9WB 3LZNA 1DDTA 3B2UD 2H6OA 1CLZL 3TBYB 5F1SA 3EF7A 3MRQA 3ZKND 4R2GD 5ERWB 3CTTA 3P0YL 4X4KA 2JI2A 4H1LG 4XBGA 5FHAH 4F80A 1I9JH 3GUTB 4M7JH 1WBZB 3D18B 3GXPA 4XNUH 2Y7QB 2ZXQA 2JB5H 3UZVB 4XGZB 2NXZC 3BP6A 1UH2A 2FB4H 4K8RD 1M1XB 1JMZA 2WO2B 3CXDH 4PVLA 5F3FA 4I4WA 3S7GA 4JM0A 1JZFA 2C9VA 1BFOB 4B97A 3II3A 1QO3A 3GI9L 1U8IB 1WGVA 2VR8A 4UOJA 4PP2B 3N85L 5IJVA 5KSVA 4RMBA 1A1MA 2MPAH 1HYRC 2WINB 2N7BA 4DTGH 1N5AB 5KSBB 2AXGB 3L5IA 3PUCA 4L1LA 1HHHA 3X12B 3U0PB 4FG4A 4C59B 4XZUA 2GSMB 1O7DE 2DM3A 1A5FH 4KVCH 1YEHL 1PSKH 3LRSA 4BKLB 4DP7X 5C0AA 5T5FA 4UB0H 1WIUA 3PGFL 1JYVA 4D0BA 4ABUA 3QCUH 4LQFH 4MS8D 1FRGH 3FTXA 3QH3A 1JHKH 2YOAA 4JFEE 4L05A 1WZ1H 1HHGB 1OTUC 3K2KA 1PX4A 2GUYA 3GLAA 3M1CA 4YIQA 3CFKA 4Z7QE 5LDUA 1KCLA 2X6CA 3BUIA 5BRZE 1WCBA 3B8SA 3KXFD 1NIAA 3EH5B 5IWLA 3NAAL 4DHLA 1VGKB 2CO6A 1BF2A 4G8GD 3VB9A 3HC3H 2D2CC 3DGGA 3NRFA 3X1NA 1JWSB 3ULUF 1LP9F 1SLWA 2K4AA 3MCKB 3QUYD 1JK8B 1KCKA 1UXMA 3ARGC 4KMQA 4JFDD 5CZKA 1W8NA 3IKKA 4GYBA 5ID0A 3KPOA 5EUOF 5K59E 4X6BA 5D6CB 1RZIB 2PXYD 4GSXA 4JGJA 3ABMB 4GLRH 4Z7QF 1G5GA 1OAJA 2W59A 4IU2B 4JW3A 1X4ZA 4OD3H 1BIHA 5F7LB 3SE9H 3SKMA 3ESMA 2IGLA 5J9PA 2MTPA 5DZVA 1T1YB 1FO0A 3GEWB 3BZEA 2UYLB 3DIFA 3D52A 3EDJA 3FBQA 1KV7A 2QELA 3W37A 4MNGE 1OAYH 2VR6A 4PRAB 2AK1H 2W9EL 3JWOH 4EI5B 1JUFA 2VLRB 1G9MC 3GSQA 5GJTH 2GJJA 4G80B 2CKNA 4PJHE 2FR4B 3E6HA 1IGIH 1DCEA 3BUDA 1JTOA 4P2RE 2O5XH 1UA7A 4ZZKA 5E94A 4N2DA 4BK5C 5DEZA 1Z9NA 1BVZA 1S5HA 4O4YH 3OF6D 1WT5C 2V3FA 3CQPA 3FSAA 2Z8SA 4JREB 1GGTA 4WY7H 3ULAB 2WWMC 1A1OA 2Y23A 3MJ9H 4WV1B 4NUQA 4KMTH 4PRHA 1CF8H 1NCDL 3EOTH 1XH0A 5J4MA 1QNIA 3EYVB 3DX2A 3F65A 5F3HB 4DKDC 4U1JA 4XXCC 5I1EL 5CILL 4X5XA 2ZQKA 4JKWA 5DEGB 2EIJB 3LHAA 1DVXA 4KRPD 4LOEA 1LEKB 4KV5E 4P5TB 1FGVH 5B1AB 5E24E 2G60L 2VDMH 4P05A 4OB5H 5JOPD 1EZLA 1JGDB 4XP6L 4FL4C 4LIQE 1F4YL 4RAUB 5C08B 2VITA 3LZFL 2ZKHH 1AD9B 1ZSDA 3GXIA 4AIXA 3N41F 1J1PL 3IDJB 3FBKA 1FORH 3V4PH 1SXCA 2EE2A 2CK2A 4I77L 2Y1VA 4G7YH 1FN4B 5ENWA 3TGXA 1TO4A 2X9XA 5HHOE 3HC0B 4G70B 4H0IA 3WXVH 1OY3B 4KKBC 1GIGH 3P1VA 2VJXA 3DMMA 5F1IA 3BHBB 2DKSA 3GRWL 3RBGA 2P8LA 2FEEI 1HKLH 5ISZB 3QQ3B 1NJ9A 2CO7B 3S5ZA 4ZUVB 1NDGB 4YE0A 2R29L 1JWMB 4NM4L 3NK4A 5BUAA 2VRAA 4A7SA 3UZEA 5T5FH 3JTSA 4N8VB 5EDSA 4NKIH 3MZTA 3PIQA 3OKLB 3UTSB 2VDPH 1N64H 3BGMB 4ZG1A 4FI6A 4M8QB 1N8OE 4MA3A 1XH3A 4KJQD 4EZKA 1JG9A 2DYSB 3L4ZA 4JVUA 3UMNA 3HW7A 5AAMC 8PAZA 4GG6A 4GW5A 1GOHA 3HI5L 4NNYA 4MXQD 3C5ZC 3FCTA 4PJ8B 1JGIA 2VQ4A 4TTDC 2KYIA 1PZAA 2QKSA 3JTBA 1UD4A 1K8DB 4B9GA 5LGHL 4QRRA 1I1YB 3MRHB 4IRZH 3F58L 1ONQA 3GMOA 5EU6A 3WIHL 4AIZB 2EDBA 1S9VA 4BD4A 3TURA 1KGUA 3SDAC 2VKXA 3NABH 5D7LE 1K4CB 2CA4A 4NHCH 5F6IC 1T89A 5EF3A 1V05A 3DTXB 5HHPA 4H8HA 5KSAB 3V8CA 3M45A 1J7VR 1I8KA 1N7MH 1NCWH 1R3IH 2IDCA 2Y3NA 3IRZA 4JN1L 4PHZA 4LARH 3B9KD 1U8CA 2CKBL 1NMCC 1DQLL 1L7IL 3C6SB 4PJ7E 4PS4L 5EZOH 3WKPA 4KKZA 3RP1A 1A65A 4ZMXA 3KYKL 4FABL 1GL4B 3FQ2A 3QQ9C 4ZOBA 4K9EL 1JV5B 2YA1A 4IRSB 4N0RA 4P3WA 2IAMA 2BW5A 2VW6A 3B4NA 3NZSA 4PJ9A 4G8FA 4XN9A 2OLDA 2IQ9H 3RGVC 4UQBA 2V9QA 1GTNA 4MJ5B 3DX3A 3IN2A 4QHMA 3W11D 1N70A 3FT2A 3GZOA 5DC2A 3JZ7A 1KBKA 1I8MA 1YEDB 1HQ4A 4PJ7F 2UXGA 4RSVA 4GBXD 3G6AA 2KQNA 2Z91A 2YN3A 2NNXA 4I13B 4NRZB 2Q1EA 3MACL 3QZWB 4XE0A 1Q9WB 4YFDB 1W6WA 1QR1A 3OQ3B 3UGEA 3BVNB 1XSJA 4OCLC 2NX5D 4KK8D 1KB5H 4PBWD 5IB5A 1TETL 3KGUA 1INQB 5EU4A 4N0YL 3UC0H 1ILUA 5J06A 1NEPA 3NEOA 2MCMA 3V7AE 1NPJA 1EGJH 1QEWB 5I8CB 1W9XA 2CGZA 1Q0YL 4NDMB 3V5KA 4XMZA 2JWYA 5JDSB 1A3RL 1N3NB 1JRHH 2YO3A 1VFBA 3SE8H 1E4WL 3OWEA 3GHBL 2ZOUA 4TSAH 4MASA 2P28B 4U0QB 3TA3C 1ACXA 1R3LA 3U83A 3OLIA 3FQUA 3TEWA 4YBHA 4PRNB 1AZVA 3MYJA 3ILEA 4J4PC 5DWUH 4YX2H 2VLKE 2DQEL 1RPKA 1GGIH 1UADC 4LCYB 3RUGA 3MLZL 3I6SA 4A7QA 2IANE 3IYLW 4CW1B 1K8IB 4ECNA 1J8HB 4F7KA 1PAZA 3NA9L 4CBZA 2K6YA 1EDQA 2NCEA 5DHXB 1BGXH 1KY6A 3KM1A 5CJXC 2BOLA 3K71A 3INOA 3P9MA 1C5BH 3LNDA 2WVSA 2Q6WB 2E74C 2J2ZA 1NIEA 4AXWA 4AYMC 3L5XL 3E2HB 2B15A 1I8AA 1MREL 3BUQA 4LDEB 1MIEL 3F83A 2BC4A 3BAXA 3KJ6L 4X7DC 5CLZA 1AXSB 4XPFH 1XCXA 3MLVL 2UY6B 5E2TH 5F7KC 1IQWL 3KM2A 2X4UA 2UZPA 1TG8A 3HPLA 4EZMA 4P0DA 3BEVA 2G4EA 4PJFF 4TPRL 3RDTB 3V52H 2BY0A 3ZSTA 1DVQA 4AKOA 4PI2A 1FG2B 3M6DA 1O7DC 4BGDA 5HHME 1BZ9A 5D1ZA 5AVWB 5D8JL 4U1SB 2BY1A 3BXNA 1V3LA 2GK0B 1ODAA 4HC1L 4NWTH 4OFKA 5J1AB 2EUWA 5F21B 4QO1A 3WY4A 1ZA6B 2WMPA 1GH7A 5C9JB 1GKEA 2BSCA 3SOBH 1Z1WA 1K2DA 1IBFA 4ZMYA 2XIBA 1OD7A 3EJPA 3T3MB 4Z8FH 2PO6A 2FEEL 2FAUA 5K9QI 3G5YA 2X4SB 3D05A 2FO8A 3BPCA 1UD8A 1VB9A 4UQ9A 1A6TB 4HDIA 4C55A 4OCYL 4AY0A 1KPRB 3RHWF 5E2JA 4LLYA 4A66A 3QJQB 4NN5C 4N0UA 4XVTL 4DEPC 3NDZE 4S1DC 4PJDA 4PR5A 4CGUB 2C4FT 2HWZH 5KYWB 1LEIB 1ZHKB 2L7EA 3WIIL 2PW1A 5KSBE 2R51A 4LSQH 4JKNA 4ERSL 1MDAA 4ODXA 5JHLL 1HI6B 4HUVB 5BZDA 3F7LA 4Z7UA 1CQYA 3GMLA 5ELIA 2EVGA 1LM8V 2BINA 1B0WA 1Y1DA 3APDA 5FKAB 3VVWA 4L29B 3MRLB 5DD5H 1WJ3A 2PCPB 3V4VB 2B8OT 4PV1C 1NH6A 1RZJL 3EOAB 1HYSD 3ZTNL 5D1XB 5DO2D 4B60A 5J13C 4HKXA 2XKUA 3VX1A 4EI5D 4JY4B 1F86A 3BQUA 2W95A 1O6SB 4AJ0A 1RZGB 4HS3A 4QF1A 2R2EA 4OZGE 1SQ2N 1KB9K 5DZAA 4YZWA 2ZCKH 3U6XS 4S2SA 3IJ9A 3RIKA 2ZTBA 4WW1A 4OTXL 3P30L 1WYJA 4K23L 3TH4T 2OW6A 3CZUB 2EE0A 1YMMA 2C3VA 4ZYKA 3DSFL 1JPGA 2CUIA 1FFPB 4JPIA 1AD0B 1Y07A 3JV5A 4P5TD 1DZ0A 1MWAL 3LS5L 4O9HL 4M8UA 3T0EB 4Z7WE 2VGLM 3X3FL 3S4SA 1UFGA 2VLRE 4HZLA 4TTGA 3AREC 5C08D 2EKJA 2Y72A 5EC1A 5C7XH 2AJUL 3HRZA 5D93C 4NOBA 2WLMA 1BX2B 5C0IB 1A22B 1MI5E 1T83C 1T2QH 2FEJA 4J1UB 1I7TB 5I24A 2F5BH 5IOPA 5EN3A 2ICWB 4YSCA 3P3TA 3FB6B 1XMWA 2BNQA 3MRGA 4QD2E 3C8KB 5I1LB 1RPUA 4GXFA 5GZND 4NQXA 5FECB 4TM9A 3VDAA 3W38A 2MKWA 2QZQA 4JCMA 4LVOC 4YL9A 3FCUB 1EO8L 4YH6A 2CZNA 4PBVC 4GKLA 2BSSA 3TFKD 3GF8A 4YDKL 5F9WC 5ISZD 3NCEB 5ES4B 2RCSH 3HUJE 6CGTA 2QR0B 2V3EA 5E0QA 3MNVA 5I8EB 1Z9PA 2B0SL 3QUZA 1UASA 1E4KA 2IAAC 2BIMA 3F6IA 2G3MA 5CM1A 5J6HA 3VFWB 1CICA 5BS0B 4Q2ZA 43CAB 4YE4L 2X4QA 3RPKA 2VB5A 1UEYA 1Z7JA 3UPRA 2DIEA 2RMNA 4TULL 5DD0L 4ZNEE 5G4MA 2X89D 3BP5A 1DL7H 5DI8B 2ATKA 2TSAA 3HUJF 2G3XA 5IVNA 1C7TA 3ZTJG 5GRVK 1T21A 4PJ8D 5F3BA 2Z93A 4Y2DC 4C83A 1EV2E 1WHPA 1D5ZA 2OMZA 4ANVA 1B3IA 4QHLB 2QKIC 4ELMB 4LO9A 3VXMA 5JA9A 4GT0A 3Q5YA 5KSAD 4TUJB 4TOYL 2IOOA 4EBQL 2BSEA 2CMRL 1F3JA 1N12A 1P7KB 2EH7L 1VFAA 3FFCE 4LGSB 1NCCH 4RX4D 5D7IF 5HGDA 4OUUB 4AH2A 3AITA 4KOBA 2R8SL 5CJOH 4XODA 3CGTA 3QEHB 3UTSE 5EUKB 1ZV5A 1D3CA 3LDBC 3MRNA 1YN6A 3WS6C 2JJSC 3DNKA 4IRSD 4TVPD 5DJ0A 3MODH 3MLWH 4FE9A 1AS8A 4FTVA 4BE5A 4MQXD 3LQAL 4B53A 1KACB 1I9RH 3BD3A 5KG9B 4KKCC 4QLRA 3OJDA 5T3XD 2ESVE 4XCCL 3CZSA 4GLRI 4EAEA 5FOBA 4IU3B 5DURB 1KFAL 4IJ3B 2J6EA 2EDWA 3CK0H 2YGOA 3LHPH 3P02A 1G7LA 5CIPA 3VU1A 3OG4B 2YR3A 3HTLX 1FC2D 1ITBB 2YD8A 1K6QH 3KLLA 3NFPB 4HX1A 3ABKB 1TJGL 1YEJH 5L4IA 3P4OA 8CGTA 4HWUA 3CZNA 1SRDA 1ZAGA 2D7TL 4BH7A 1BYOA 1S7QA 3EHBB 4M02A 2H2PC 4W93A 1U3HC 1RLBA 2BNRA 3NFSH 4E36A 1YEKL 2FX8L 4ZAKB 3MRKB 2PPAA 3CU1A 3HCVA 3UAJD 2OJ1A 1WEJH 3ASWA 1JXDA 5K39B 1D5IL 4ELKB 1AI1L 4P5MB 1I1CA 2IDTA 2VAJA 3VXNB 1J0KA 4A2DA 2CDEA 1Y6MR 3G5XA 4K7FA 1HJBC 1BV8A 3UADA 2ICWJ 2BVQA 3O6FA 3NCBB 5C0RL 5IVZB 1S6NA 4MJIE 2VDMB 1VERA 3NJVA 4X4YA 2WXMA 1WITA 1HHJA 3NPSC 4YJZL 5E6SB 5KS9E 2H32H 4XBGB 3MOQA 4NZTH 4ZMZA 4XPTH 5AL8A 5LNGA 3SQRA 3LEXB 2LW3A 3UBXB 3V4PB 3D4CA 1ZHBA 5IROC 3OKOA 4BRJA 3T4AA 4XOBA 3UBXI 3V0FA 5AAPA 1KBVA 1EZUA 3ARRA 4ZUUA 2C9QA 7FABL 2VW4A 4QT5B 5E7FA 3PAVA 3BKYH 4HJEA 1RY7B 2DZEA 2XFGB 5KSVB 3QDJB 5KS9F 4J23A 2QHLA 1A1MB 3WD5L 4AEIL 1KJ2H 2CK0H 1J8HE 1S46A 5K9OA 3ZTCC 3TN0B 5JO5A 3T0DA 3FRPA 5KANI 2VJ8A 2XWDA 4NN6C 2BZ7A 5I1AA 4TLSA 4FKEA 4NZRH 3LH2H 1RJLA 5IQMA 4U1NA 5C0AB 4D0BB 3MREB 1IGCH 2C7UA 1IEAA 3WNNA 3U9WA 3NEXA 3QH3B 1KCUH 3PWLA 4PWEA 4HPOL 3H4FA 3LEVH 1SJMA 4J5VA 4NO5B 4LRIC 2CHXA 2DYPA 2ITDA 3KPQA 4B9FA 4A55A 1Y0LA 5KYNA 4B0MB 3AWEA 4L37A 2ZT9C 1ZV9A 2EEFA 4M5ZL 3OAUH 2XQBL 3DGGB 4RGNB 4GQ9L 1H6EA 1BXUA 4H8QA 3T65A 2ADGA 3JVGC 2DTSA 2XOTA 3T3PF 3KPOB 4Z7VA 4P57B 1IQDA 2JKRM 3L3HA 5CP3H 2OMNA 4JPQA 3HAEG 4AUUA 4IBVA 2NSQA 1P7QA 2DW5A 4K9EC 3DBXA 1UWYA 2C9PA 2XN2A 3QJSB 3BVXA 5J9PB 4NM8L 2APWA 5IVXA 2BIOA 2VDRH 3BZEB 2CHWA 4QAMB 4FXKB 2P43B 5C0EB 2ZOKA 1JUFB 3OLEA 1FRGL 3HBGA 4FYSA 4XPGH 4FQHB 5D1XD 5TK4A 1EIBA 1N59B 3EGSB 4O51A 4U6TA 1HHIA 1X44A 4ESKA 4N28A 4RIRA 1FNEA 4IGBC 1RZFL 3FU5A 5E94B 2GSGA 3FO2B 1X5MA 5LCVH 1S5HB 4J3UA 4V11A 4U1HA 3OMNB 4QWWC 5HGAA 4Q97A 1A1OB 3IS0X 3N06B 2VM3A 3ET9F 2I32A 1RJCA 3V6OE 3V8OA 1U8PB 2EEBA 4HALA 3GGWB 3HRPA 4K3GA 4PRHB 1MW1A 2BY2A 3TZVC 4CVXA 5DK0B 2W0FB 1KB5B 1BFVL 1RERA 3VW3L 3SKJH 1EAJA 4NQTA 3S34L 4X5XB 5EFIB 1F41A 1KF9B 4HBCL 4EVNA 4GINA 1BQLH 4APQC 3D07A 2OR9H 4TXVB 4XP1L 3E8VA 1T1ZA 3V95A 2JKXA 3CUPA 4M61A 1R5VA 4G82A 4AGQA 3T0ED 2WZ5A 2VITB 1A25A 4NRYA 1L9SA 5HBBA 4TQEH 5CZXD 1RAMA 4XP5H 1O9WA 2JKNA 4KY1L 3GM0A 1INDH 3HC2A 2O5XL 2C4FU 3DV6A 3HKZA 3WFCH 5ANMA 1O5PA 4AIOA 4DVBB 1LEGB 3Q3GA 2HLEB 5MERB 1RVFL 3UC2A 3KPRE 5D5MF 5H94B 3KYMB 1MWOA 5DD1H 2PCFA 1SOKA 1E8YA 1U91B 5DHDA 4OR1A 2DDQL 1FJ1A 4X83A 2CPUA 4X5WB 4YXHH 4QRPA 2BIIA 4M4RB 4F7TB 2NZ9D 3LY6A 4FG0A 3PIQB 4TLTA 4WI5A 3PE9A 5IBTL 5GRJH 4QRAA 2DRUA 1TPXB 5CUSL 1I4FA 4MA3B 1XH3B 2DI8A 5BS0D 3HMWH 1TZ8A 3MV01 2ZYSA 2Q3AA 2VTFA 5C0JA 2E6JA 4HD5A 3J07A 4Y16A 4ZNCD 1QSFD 1GYVA 3QO1A 3X14A 3QEQA 4I48A 4LLQA 3FCTB 4EUPG 1IE5A 1M7IA 4G7YL 4YSQA 5GJSH 1HIML 4QRRB 5FR3A 3CNKA 1ONQB 1QASA 4KK5C 4KU1A 5EU6B 5TF1L 1E7VA 5IB2A 5JMRA 2EUZA 4K2UH 3S8GB 4LOFA 1FVCA 5JXAL 1QSEE 2JNZA 4R7VA 1MH5B 2RTTA 3KGSA 3M88A 1L9NA 1YYML 3GB7B 4JM2C 1KCSH 1PY0A 1DQDL 2G9HA 3BVWA 5BUGA 1GGCH 3BGAA 5A16A 4CSZA 3C5SA 1BQHG 2FD6L 1HFUA 4Y2NA 2BVPA 4BRVA 25C8L 1NFAA 3BDXA 1XR8A 5D4IA 5KVGH 4ZSOA 3TBWB 3U1SL 1A6UL 3VE0A 4CSPA 1JZ6A 1N64L 1E6JH 1DN2A 4B3VA 5CCKH 2OX5A 4KKRA 2R1YA 4LNRA 5FYJU 2DOCA 5ILTH 4I1PA 2Q7NA 4MZ2A 2OKMA 3IWUA 2AKRA 2XWJA 1RZJC 4LCUB 4M7LH 5B3SB 3G6AB 1E5UI 2Y7OA 5DURD 3QA3A 3GPEA 4M7ZB 1OGSA 2IEPA 2BP8A 1MJ8H 5E8OA 3EF4A 3N43F 3IJYA 3RU8H 1AGBA 5F7EH 4CC0A 2DB8A 3AMLA 4WFEE 5ANHA 4GAYA 3O41A 2J56A 1W72A 4Q4EA 3OXRB 3QRGH 4WFHD 4KNTA 1C5CL 3BJLA 4Z23A 1A6VL 1A4CA 2OSLA 4NQUA 3Q13A 1FO0L 1FL3B 4MCZB 2BCMA 3FB7A 5HPMB 3MV11 1H3VA 3GEFA 2ZP9A 1I1AA 4P4KC 4CU6A 1SMOA 2OL3H 4O00A 5FS5A 4FA7B 2HJLA 1IAMA 1A8ZA 4NXKA 3GI8L 4TMPA 2MCG1 3RUGB 2IQ9L 3TV8A 2NCMA 2N7SA 5I1GL 4J39A 4GP8B 5E1GA 2VDQL 4QHNA 1NAKH 4HPYH 4B9ZA 1U33A 4X7TA 2KT6A 3K71B 2PTUA 5E56A 2XG5B 1KTCA 2IIJA 3MCG1 4JUSA 2NY2C 2WXPA 2X6AA 1XCTA 2IVFC 4X6FB 1AGCA 2FK9A 5JORA 4KHXH 1GXEA 1AMYA 5ACZA 4GSDL 4PY7B 3VD0A 3D8MA 4OBRA 4MNQD 2Q87A 1RUKL 2J1XA 2VDNL 4ZFQA 1DJWA 2X4UB 5B21A 2OK0H 1T0OA 3HPLB 5FYKU 1SJEA 3CXFA 1V3JA 2MSPA 4V1DB 2P3YA 3BWAA 3OAYK 1JCKA 4GFTB 4X6DE 2QL1A 1PZ3A 2XWBA 1S7TA 2Q3XA 3UTTD 3WOVA 1HQRB 1WH0A 3QDJD 4XP4H 4I3RL 3RB7A 2J8HA 2APFA 1BZ9B 5D1ZB 3QXAA 2FLRT 3TN0D 3NJJA 5D1ZI 1ZOXA 5IHZA 3I6KB 4YLCA 4FQXA 4WU7B 3QXVA 4KZ0A 5H35A 3L3GB 1G9HA 1KNOB 3T5WA 3T77B 3UAAA 4ZFFA 1OWRM 2Y2YA 3SDDB 2YGVA 1K2DB 3BD4A 1P7BA 3BKCL 5CLTA 3OKEA 5I74B 4IEFA 4IQHA 1E28A 4Y1AA 3G5YB 4ZMPA 5ITFB 2R4SH 4MLIA 4HIXL 2J72A 2DF3A 3WNPA 3JV4B 3K0WA 1CFVL 3ZYOA 5C09B 5B1CA 4PWKA 3HR6A 3O6KH 3UIYA 4XPFL 3RDTC 5I17A 2YGQA 3U7WL 3MV8A 3R1GH 4QMEA 2BCKA 3M8OL 4N0UB 4G71B 5DS8A 2DWXA 4A2MA 1ZLEA 4PR5B 3F5WA 3MFFB 5DJZA 2F5AH 4ISVA 1FAIL 1M7DA 2PW1B 1AS7A 1F90L 1UACL 2QGDA 3HJEA 3MRRA 3ZYZA 3KDMA 3OPZH 4ODXB 2HX8A 1YEIL 2ENSA 5JYLA 3LQZB 4Z7UB 3WFDH 1FH5H 1XL6A 2FWSA 1X5JA 2LLLA 2Y36H 5C0AE 2L3BA 3LQAC 4AYFA 2DWSA 2KH2B 3MA9L 1IC7H 4Z95H 2IALB 2WO4A 3G6DL 3N9GH 4NKDB 4Z3IA 3RVVC 3CFBB 1AQKH 1UM6H 4NP9A 4YC2B 4HKXB 3K46A 3J2PA 3QEUA 1DBBH 1P6FA 1RIVH 3PDOA 2P1YA 3RKDC 3TF7C 3BEWB 4PD4J 2B1HL 3BQUB 1V7NL 4HS3B 3SPJA 3K1KC 4XXDA 2R2EB 1I3GL 2E9JA 3V6OC 3IXAB 4K5MA 4UINL 5E1IA 4J7RA 3MLRL 3CFIC 2EXSA 1J1XH 4LQ1A 1L4IA 5CF3A 4V2BA 4XNMA 4C4BA 4YHIA 5CEZH 4HHAB 5IOKA 1U2YA 1YNTA 4YN3A 5A2FA 3ARBC 5KZCB 3EJYC 1IJNA 4MNHA 3NIDE 3UBGA 2RH0A 3IFOA 3IJEA 4ZMLA 3PL6C 1OT4A 1PW3A 2B3RA 1ULVA 1YMMB 5LQBH 4LSQL 5GGVY 4B9YA 3BE1L 3ELAT 1JPGB 4PGDA 4XN2A 3RWEA 3VG9B 5EU3B 3HBPA 1H8SA 4Q52A 5GRUH 3U9PH 3NH7L 1XGTA 2VDKB 3X11A 1AHWB 4S1RL 5IB1B 4OZFA 1OT2A 1WGOA 5DD5L 2X4OB 4H88H 4P9MH 5M7QA 4MSWB 3KWXA 5HI4D 2YD3A 4OZHF 2A9AA 3VG0H 2NRDA 3K4AA 5DMIH 3VD1A 1BZ7A 3DGCR 4N87A 3UTZB 3HZVB 3KMDA 2ZCHH 2IXQA 3MRGB 5BQ7A 4G6AC 4GRLD 3VFNB 3WDIA 3US0A 4FQ1L 4HGKC 1FV1A 4PRHE 5TE7H 1DQTA 1ZTXH 2H32B 1EHNA 3PV6A 4YSUA 2AF2A 3WUZA 3OKNA 3I9PA 4OLXL 3MRBA 4CVZA 3OAWA 3RYMA 5GGVH 1JZ5A 2FQDA 3ARSA 4N5UA 4MS6A 3NYKA 2GBVA 1CLVA 4BV1A 2WZAA 3CVIH 4Y5YB 5EEYA 1ZGLB 3FCBA 4HIIB 1OT1A 3ARFD 2J71A 3AT0A 3EH2A 4P3CH 5AW5B 3UPRB 2HB0A 1S7RB 3K4DA 1U36A 2G3ZA 3OV6A 3O6LH 1A7QH 1KJ2B 5HI5D 2B16A 2ARWA 4ZW8A 3EBIA 2ATKB 4PRIA 1E9PA 1OAZL 4YHOH 2OMWA 2E76C 1R0AH 4XCFL 2Z93B 4C83B 4D94A 3VFOB 2XPGA 1W80A 4FQIL 1D5ZB 5F7BA 3V9EA 1V55B 1DSFH 2NT0A 2YWZA 4R8WL 4LKCA 3WELA 4CA4A 3TEUA 5I2IA 1OSZB 2VL5B 5BW7A 4U1KB 4D9QD 3RTQB 3HS0C 3VYPA 1WAAA 1U21A 2N3JA 5K9KA 5HGDB 5TTRA 2UZIL 3L1OL 5H37A 5D2LB 2RHEA 3P3SA 3V5DB 3DBSA 3E7JA 4K0OA 1YN6B 4DQAA 5A2IH 1YO4A 4Y9GA 2CBQA 4GO9A 2IG2L 1SUHA 1E43A 4AV4A 3EFOA 1B4LA 1FH2A 1MHHA 1WLHA 2CLZB 4EO5A 4GG6E 1PNCA 4U6HA 2YXMA 5TDPA 2UXVA 2OSWA 4R7DA 3DSNB 2R2BA 4HAFA 4QRRE 3BZDA 3SD5A 2OJZH 5G2NA 1G7LB 1BAWA 5EU6E 3GHEL 4JRLA 2F18A 4ZW5A 3IDXH 2ORBL 4HX1B 5T1DL 3PUUA 5AYUH 1NCBH 4HVBA 4C56B 2BHZA 3P4OB 4M8RA 4JPSA 2R2CA 4P5KB 3IDMA 2NTFA 3CZJA 2XG4A 2Y7NA 3FUIA 4WO4B 1IC4L 1S7QB 2A6KA 3D0VA 1UZ8B 2W8CA 2W1NA 2BNRB 2WHVA 4HS6A 5HDQL 4QI3A 1KXHA 1U8QB 1TFHA 4OZFH 4LAJH 1VPOH 4M5SA 5AW9B 2EDOA 3CX5K 3P40A 2XA8L 1Q72H 1X5ZA 2XY1A 1QLRA 3L3KA 4L4JA 3SGJC 3MODL 2XYCA 3FT9A 3HBQA 3G5XB 4K7FB 2AJYL 4CSTA 4NQQA 3HB3B 3H53A 4PJGA 1T1XA 1SJHA 5FW6A 3QI9A 4NWUL 2FIKA 3U0WL 3CZLA 1UWEH 4UYPA 3SCMD 5DVLA 3TBVA 2BVYA 2E4TA 1QEXA 3V5HA 3T0AA 4KO9A 3A4AA 4ZXBD 3MBEC 3RPIB 1S7WA 4ZAKC 3T2QA 2MNUA 2VJ0A 2R1XA 2W91A 3WE1A 3GRGA 4JFZL 1WFOA 5C0CA 4IMLA 1PVHA 3OMAB 2GEQA 5BVJB 3NFSL 1ZEAH 4AG4H 4HJ0D 1P5UA 1GS6X 3F05A 2VDKL 4I5BB 4Y2OA 1OW0A 3UACA 1FYTA 2KZKA 4PCTA 1K3IA 4V1DD 4ZFOA 2VZOA 2CHDA 2VZ3A 1WEJL 2O61B 4M4PA 1KWKA 2E7HA 1KENH 3FRPB 4ZDHA 5GGRA 2NY1B 1BAFL 2A6DA 2WVTA 3OJ2C 2LU7A 2XSKA 1PQZB 3BN9D 4YPGA 4OJFL 1YMHB 2Y69B 4X7SH 4U1NB 1ORQA 4D0DB 2DQGH 2C7UB 3HG1A 4X99B 4I88A 5LBVA 3SDDD 2GVYA 4NO0A 4OGYL 2F53A 4YNYB 4W81A 2QPFA 4PCKA 3WHE1 4M7KL 2IPTL 7PCYA 3MJGX 3PGCB 1KIPA 2A74B 4LHUG 5AW8B 2ZP0T 2ITDB 5LO7A 3NGBC 3KPQB 4G6KL 4OF6A 3TO4D 1Y0LB 5D70H 5DEFB 3ATBA 3TONA 1KYAA 1DVFB 4W9LC 5C09D 3GJFK 5H37H 3STLA 2ZXBA 3BWZA 1ZE3H 3FPYA 2XVGA 5ICXA 2FCBA 1U8OA 3D2UD 1CBVL 3VD9A 1SVBA 4JR9L 4S1QH 3L3HB 3U25A 3MOAH 3JWNG 5E6ID 2X44D 2Z8WC 2AAVA 2OQJA 4OCRH 5MENE 1QRNA 1P7QB 2F9BT 3DBXB 4O2EB 5DT1L 3OHXB 1KPVA 1XSKA 1KXQA 2D3NA 2JVUA 2W38A 3R8QA 3UTQA 4UM9A 5K9JL 1HINL 3LH2L 1IBBA 3EUDA 2HG5A 1G7HA 4RFEB 5IWLC 2EEDA 2ZOKB 3V7AG 2GJZA 3V2AR 2F61A 5IW1A 2ZKXA 1NGWA 5BO1L 3V10A 2AK4A 3T0WA 4O51B 4TYUA 1HHIB 3PHQA 4NFDA 4BHUA 5FWQA 1OGAD 1RULH 4KKAD 3SQBA 3TPUB 1FNEB 4QXGH 5I0YA 4IBWA 3IPFA 4XMUA 4LXFA 1IKFL 2GSGB 4JHAL 2O4EA 3OXSA 1LMIA 4AK1A 1UENA 2HVKA 1C12A 1YEEH 3WJLA 4U1HB 3OB8A 5HGAB 5DMKA 4KZCA 4PJDE 2P52A 3IXTA 3WTTA 1NWPA 3EYSL 4M1CC 3FFDA 3FU7B 2IO5A 1KFGA 1P2CB 2CIIA 2K0RA 1X7QA 5KZCD 3FSZA 3LEYH 5I6NA 5HHVH 4NT6A 4UAOB 4CU7A 3CU7A 4A38A 1RD6A 2J6EL 1BPLB 5EOCH 2AANA 3FH8A 4M61B 1HE7A 3W0WA 3X1BA 2DWYA 1L5GA 3BUPA 4NBZB 1EZSA 5ABZA 2WBJA 5SWQB 2ETWA 2OL3B 4JFQA 4N1CA 2XRAH 4WNQB 1KWGA 2DLIA 1G87A 1QD0A 5ESVB 4KZDL 4JFSA 1A0QL 3TFBA 3IF1A 4JFFE 2KDGA 4KXAA 1GS7A 2YPVA 3HMXH 1MCFA 2P4AB 2JQMA 2IFFL 3DV6B 5ANMB 2G0LA 1CDHA 2XU9A 2V8LA 4YFLI 1NFDA 3Q3GB 3M17A 5EPMA 1PTZA 5D6DC 1QHOA 3VSUA 3SDXF 1UM5L 2LV4A 3NP4A 5FUCE 2PCFB 3N40P 4ZUTB 1ND0B 4ONGL 4WW2F 4MQ7B 5E00A 5GZOA 3REVA 1FJ1B 5K93A 3VFTB 4PAZA 4PJEF 1TJIH 1U8JA 4QRPB 1JGVL 2OTUB 2WXRA 1DBAL 3WEBA 3HG4A 1QX1A 3K6NA 3EFDL 1UJ3B 4IIQA 2JTDA 1GW0A 4RGMC 4XAKD 4ALAH 1I4FB 1HKFA 3PGDB 1IUZA 2NR6D 1WAPA 2XNAA 2Z1PA 4XI5C 2EH8H 3Q1SL 3TLRA 3QZOA 5IQ9A 4OCNC 1XDTT 4BUHA 1KCWA 3HHRB 3QO1B 4Q6IC 3QEQB 3X14B 1P53A 1HH9A 4LLQB 4H1LH 4XNYH 4F33B 5TQ2H 4NQDB 4NUMA 4UNUA 2BNQE 4XMLH 4AMWA 4C58B 1YNKL 3DMMC 2X1QA 4Q4IA 1CIUA 2NZIA 5IMKA 4LLWA 2YD6A 4GS7B 3SE6A 1E5YA 5IB2B 5C0GB 4PJBA 3EZJB 3RWJB 4I8DA 3SQOL 3NJMA 5DFWH 5C2UB 2JXMA 1FVCB 3C8HA 4OQTL 3INUH 5IZ7A 1AXIB 2CSPA 2NXYC 2ZOOA 3UZEC 1E2ZA 2ZF8A 1IGFH 2AJXL 1ZS8A 2BWDA 4MD5A 4Y5VB 2AQSA 4R83A 1AH1A 4GNKB 3RTQD 2GCYA 3CZKA 2EDHA 2XI9A 3H0TB 2B3IA 1WQVT 4ORZC 4U3XA 4LSVH 5G4NA 3EYQD 1KBGL 4WLCA 3BSZH 3OLGA 4X8JB 3VE0B 4M1GL 3WEOA 1MLCA 2FEDC 4UU9A 3ZKMD 3OMZA 2R1YB 4WKZA 3T71A 1U3ZA 4H20L 5JNYA 2PW2B 4WUUD 3H2QA 1T89C 4ODTL 5EN2A 4HUUA 3VTMA 1CDBA 3IGUA 3K6IA 3LKSA 3QA3B 1EZVY 1XT5A 4R90L 4X4MA 1G9NH 4YXKL 5E8OB 2HVJA 2WY3B 3SO5A 3HG5A 3IJYB 4JZJC 3VXME 3X1FA 1V8HA 4YR6A 3GBDA 1A6WL 3DV4A 4LDOB 4GAYB 4K2UL 1SOXA 5MI0C 3OZ9L 4C56D 4LDLB 3VWKB 4QOKA 3VXUA 4WJ5A 1NMAL 5E8EA 4F8LA 4DO4A 4FZEH 2JKIS 2IAMC 4PJ9C 1T4WA 3GBLA 3QORA 4WO4D 4DN3H 4EDWH 1JGUH 1A6AB 3DX8A 3FO0L 1GYCA 1UWGH 2PYFB 3A47A 3NCXA 4Q56A 1FFQA 3FB7B 4E0RA 1R1CA 1PPIA 1LWJA 1N0XH 1LO2L 3ZDYE 4N2CA 1JF5A 4FTVE 4OM1H 4JQXA 1KIQA 5GS0C 4NIKB 2O93L 1ZK5A 3CMOL 4OD2A 1K4DB 4M7ZC 1ZDSA 4GP4B 4NCC2 4XN5A 4PJIB 2EYRB 1C5DA 2RBLA 4QHNB 1BEYH 1D5BA 2HT3C 3LVTA 4R26L 5SWSD 1LD9B 2YPLA 3MRIA 4S1SH 3W82A 1SEBB 4RQQA 3HB3D 1CDCA 5C6TH 3F8UB 5I23A 1TLMA 4FNUA 1XCTB 5E2VL 3U48A 2ZSWB 3ZDYF 3RZCC 5KBKA 4BSWA 5F7EL 2JCCF 2QBWA 4KC3B 5ACZB 3H1ZA 1MCPH 2BLFA 3FTZA 4FFYA 2B59B 2BNRE 1B90A 4ZMAT 3QRGL 3GTVA 3ZTDC 1QWNA 3VCLA 1AR1B 2KLTA 1UVQB 3CFDB 1SJEB 5I6XB 2F19L 1HDMA 1UWFA 4PGCA 4ZRGA 3BWAB 3V9CA 4P23A 4AL8L 2D31A 3QGVA 2XWBB 2DWDA 1S7TB 1PLGH 4PB0H 5J12C 2PP7A 4HWBH 1ZHLA 4OCWH 1RUPH 2VZUA 3QXAB 4E5XB 4XMWA 4R4ND 5GS1A 2NY1D 1PAMA 4L48A 1Q38A 1EAQA 5ADPL 4G7VH 1LK3H 1QFPA 4HXBH 1NAKL 4N8UA 3M7FB 1PBYA 4JEGB 3APFA 4HFWB 4KFMA 5ICYB 3OKEB 4IEFB 3I6LE 1NGPL 2NNCA 1GAFH 1L7TH 1UXWA 1X9RA 3RVTC 3I02A 4N8CH 5K5YA 1BZEA 3VFMA 1H6TA 4KHXL 4JRXB 4AENB 1DJZA 4GP5B 4WI3A 1NC2B 5KJRH 2XZQH 5EZLA 3S2AA 3VRIA 5GGSY 3ZE1B 5I6KA 2LU5A 1DVFD 3D69A 2BCKB 5EEVA 4M1DH 4HCRL 5D1ZC 4FCAA 5CJBA 3GNMH 2NX5E 3F5WB 1LHZA 1SMAA 2M83A 2DM7A 3OSKA 1Z3GL 5DJZB 4ISVB 1JPFA 5J8OA 3MRRB 3RRQA 3KDMB 3X1GA 3V9FA 2LHAA 3WHXB 4NJ9H 1IC1A 5EO0B 4MZRA 1PG7H 2PO6C 2XJLA 5JW5A 3K6SA 2ATAA 4N8PA 4TUUA 4AYFB 1I75A 1YA5A 1Z5LA 2VCOA 2JB6B 4ZBJA 5JR1L 4QTIL 3ZL1A 4TNEA 5JQIB 1PLAA 2NNAA 3OAZK 3CSPA 2OMUA 2XFXA 3QEUB 3PDOB 2LAGB 3P4LA 3WIAA 2GBTA 1S3KL 3T09A 4U3CA 4P3DA 1SOSA 4R2GC 2MCPH 5B8CC 5DJYB 5B8CB 4POZD 1HHKB 4H8WH 1OD9A 4L2YA 3VMNA 1SPDA 3ZZ1A 3VI4B 1HXKA 3CBKB 4L3CB 4Z7VE 5EV7A 4AGPA 4CADB 5HGBA 4WTWA 1WVZA 1LE5A 1YNTB 3FU3A 4BZ1A 4LCWB 3PQYB 4XH2A 3ZO0A 3IFOB 5K1NA 5FA4B 5IBUG 1VRSA 3ML9A 5IVXE 3RWEB 1RMFL 2E59A 2I60H 3WO3B 2F7IA 2OXHA 1GZPB 4PSRA 1A1NB 1Q1JL 2KLRA 1ZLWK 3W39B 2LABA 3X11B 4HISA 2VAAA 4OZFB 3ULSA 3VXQB 2WKGA 1YY8A 3BQUC 1JZEA 4Z95L 2WBKA 4KI5E 2YMXL 2OM5A 1IKNA 3MTRA 5D7SH 1MRFL 3MLUH 1W72L 3WKML 1DO6A 1MCCA 3FQRA 4MAUL 1BZ7B 5BJTA 1YNLH 1CXKA 4O2FB 2W9LA 1ECZA 1A7NH 2CBOA 4JHZA 1B0RB 2A1WH 1EMTL 1WICA 1TZHA 3FT3A 4W9EC 4JO2L 2W9DH 4XVSL 3TA4D 2D4DA 3BDBA 5FUCC 3H3BC 1FV1B 3U30B 1NC4D 1MHEB 4X5QA 1JSYA 3NJXA 5I0WA 1AKPA 5J89A 2EIZA 3BH9A 2VXTH 3KJ4B 3V6FA 5FGCE 3QUYC 1CK0H 4PJAE 4FNPA 4AQOA 3L2MA 3DOHA 3WNLA 1E3FA 4ZD3L 3BVVA 1MIMH 1ZLVH 3MUZ1 3HRZC 3PNRB 4YBQD 3HE7A 3TL5A 5GRXG 5IG7A 3KR3L 3ZE2E 1WBYA 2J25A 4TVPL 2C1OA 2PPCA 4PV9A 4ODWB 3EOBB 4F92B 1UT2A 1XFPA 2DMKA 3VG0L 2WLKA 4YDLB 1E9PB 3RIAK 1GZHC 3KDPB 4FNQA 5GSRA 4FG6D 4PJAF 4NQDD 3WXWH 3MV7D 2ZCHL 5B38G 3WFEL 1LO3H 5AVSB 4DZBA 1IM3B 4LKCB 2A77H 1F3DH 2NSMA 5MHSD 5DTFA 3I2CH 3QNXB 3QUZC 1E4KC 4N85A 3KZ8A 1ZTXL 3BP7B 2FJGB 4PQXA 2VR4A 2VYRE 4YSRA 5BV7H 1CICC 1PZ2A 2VMCA 1CXHA 1IZKA 2OULB 4FQQB 5H2BA 2ITCA 5K9KB 3WYRA 2X0VA 4PLKD 1D9KA 2V7HA 4CJ0A 4KKLD 3FCSA 4O02H 3RQ3A 5DR5L 4P2OA 5SX5K 5TDNB 3F7PC 2ZKMX 3TYFB 1S8DA 3EFOB 4NB7A 4KRPC 4EOWH 1F58H 2WXHA 2Q10A 3ABLB 4TNWK 1QBBA 3TJEL 5TDPB 3WNKA 4PPTA 2R2BB 1T7YA 2GTWB 1PDKA 1A6PA 1KCRL 3AU1A 4XO5A 1AP2A 3D25B 4BK4A 3FUJA 1E2WA 4YHOL 4RZKA 3ME0A 3ZBMA 4Z3FA 1ML0A 4BZ1H 3VYNA 1SXAA 2EP6A 1YN7A 4DPRA 2A2QT 5DQJA 4XN4A 2AJVH 3MC0A 3BVUA 3TIEA 2XG4B 3B2VH 2D9QB 4HJGB 4ODSL 5LWYL 4GI9A 3O2VL 2UY7A 3VWKD 3L16A 2A6KB 1GW6A 2H0EA 5T33H 4JL2A 1ADQH 2HFFB 2XN0A 2CCWA 4Q14A 4RAVA 3QDGB 4ZSOE 3ASOB 1X9QA 4NNXB 1UA6L 1QHPA 2WSKA 3BIBX 1UCBH 1MFNA 3FSOA 5HYEA 2NY3C 5CEZD 2FQGA 2YAHA 3NZHH 1FL5B 4UT9A 3G5WA 4YHPA 2XVBA 4LPCA 4PREB 5FCSH 3QFDB 2AGJL 3L3DA 4KJQC 4PJGB 4MJ2A 4PP1D 5AW4B 4HA1A 5F7FA 1T03L 4JFTA 2FIKB 3GSWB 3HE6A 4AT6B 4OKVA 5L6YH 3TBVB 3S5LB 1WPCA 5DJ8B 2O6CA 3RWHB 2XV2A 3V5HB 1DJYA 5L4JA 2EVFA 4XX1G 1EWHA 3I3EA 2N59A 4WHDA 5LDSA 4UF7C 3CDFA 3ZDXE 1RU9H 3F00A 2P9RA 5I8KL 4OD1H 5D71H 1DQQA 1BHGA 3IDYC 4PWGA 1BZQK 2LOEA 4IMLB 1FI8C 5AW0B 3PXLA 5AVZB 1SJXA 4JB9H 3DTUB 3NOIA 4RFOH 4Y2OB 4HCFA 3B9KC 4GSQA 4K7PH 2HRLA 4ZFOB 3S37L 2EDYA 2XJKA 3O6FC 3P4NA 1PZ5B 2YPKB 3CC1A 4LCCA 1OHQA 4Z5RA 3N42B 1CZ8H 3ZDXF 1SN5A 3MBWA 3N0AA 2KDYA 4ENED 3KVQA 3U36B 2D3LA 3L95A 1Y1UA 1HESA 3W11C 1MJUL 4HIPA 4GUCA 3QJRB 4I2XA 2YEQA 3NVQA 4TVPE 3RIFF 3T4AC 2F53B 1A3ZA 2EACA 3HLAB 2C9RA 4GJTB 4HGWB 1KIPB 4HQQL 4D9LL 2Z6FA 1NKRA 1USQA 3QRLA 2QPDB 4JRXD 1NC2D 2AJ3A 4H1LB 1EUUA 3MV9B 2WXOA 4XE5B 2DJUA 2QZ5A 2HUEA 1SYVA 5HGGS 1U8OB 3LKNB 3PV7A 5DFVD 4F20A 3HR5A 3CHOA 2KKQA 2NDGA 3FUFA 5IM7B 2H0JA 2IH1A 3LKQA 3LRGA 1IAKA 2ZYIA 4MKMA 2IWGA 5L2KE 5IMOA 4KO7A 1TEYA 1TUPA 4RDQF 3ZKXC 1YAZA 4ZTOL 2ZWNA 2B1OA 2HRPH 4F58H 4W9KC 3IAPA 4IRJB 1MCKA 2GJ6A 3STZB 4QJ3B 1F4AA 4G42B 4Y1AE 2EZ0C 4JGNA 1MFBL 1J0YA 2GFBB 2GJZB 3A6OA 5IW1B 5CKGA 1NGWB 4LEXH 4GH7B 2WIIA 4LVEA 2WSDA 1OPOA 4OGZA 4PJXB 3TBBA 1E5ZA 2UVFA 1H15A 1J05A 1ORSB 4OFPA 3SQBB 1RPQA 3C09B 4FI8A 1ASQA 2AEPH 4BHUI 5D70L 3MV8E 4MHHG 2HVKB 2OMBA 2ZWZA 4IDLA 1A4KB 2AV7A 2XUWA 3AM8A 3MO1B 3QVAA 4MMZB 5DJ6A 4Q7DA 5E99H 5KVEL 5DMKB 1TSHA 5CD5C 3O45B 4KGJA 5I0XA 2VXSL 1NCHA 3FFDB 2X6MA 3GMPB 1R6VA 1TOXA 2FATL 1S9WB 3QAQA 1X7QB 4UT9H 2Z0UA 4YBLB 4LCWD 3PQYD 4R5TA 5HVHB 3OTTA 1IARB 1DVZA 2BHYA 3GLEA 4N68A 2VIRA 4YHML 3P0GB 2YAQA 5I1KH 3V6ZA 3FHEA 1OCRB 2BK8A 3WJMA 5DUJA 2XWEA 2HKHL 3VFRA 1S9YA 1JPSH 1I3RB 2MOGA 3HAEA 4KI5C 2SODB 5EOCJ 5IEHA 1TTRA 3PXHA 5CSGA 3VD5A 1FZMA 2QSCH 3QIBA 3Q44A 4S10A 4AZ8B 3ZK0A 4ZFGL 5IQ7H 4JFQB 1U41A 1IBGH 4CKQA 2YSSB 4AQAA 3IF1B 3PJSA 1GR7A 2JELH 3O2DA 1QLFA 2P44B 5GPRA 1HCZA 1KGWA 2D0FA 4OCMC 4R4FH 4X9YA 2V9UA 3PFQA 2AABL 4MXVF 5F9OH 1JHTA 1M7UA 5TE4L 1MPAH 3KW8A 1YEEL 2DAVA 1KDJA 1NFDB 3OKMA 4KTYA 5DZ9A 3PXJA 5AZ2L 2C9XA 2DQCH 1RIUH 4XAWH 1PZUB 5KUMA 1WFJA 4M8VA 2XZAH 5E00B 2E6PA 3HNTL 3BZ4A 4AL8C 4JDEB 2FH6A 1U8JB 2HJFA 4ONHA 3FZUC 4KWUA 4Q74A 5DRNB 1M42A 5FCUL 2VR9A 3GUFA 2O5ZL 3IJHA 2YRBA 4HIHB 2G5BB 1YUHB 2OCCB 3VFUB 2XNAB 1P6AB 3LSOA 2YK1H 2WTPA 3F62A 3P3YA 5IQ9B 4EF3A 1P84J 3ZZLA 3PWJA 4L9DA 5GS2H 2VXQA 2V8MA 3AJ7A 1CU4L 4E9TA 5JYMA 2A9NH 4J8RA 3NDYE 4WCYL 3P2BA 3VQMA 4PJBB 1QFUL 5CMAB 1NLDH 1F0LA 4S0SD 2WCPA 1PEZA 1AE6L 2VOTA 3J8F7 3SY0A 1IM3D 5BZWA 5AYTA 4NLHA 3UXFA 4MX7B 2VH5H 2ZSVB 1ZS8B 2R9HD 3HI6H 3MCLL 4IBYA 4MD5B 4R7NA 3GO1H 1ZJBA 5E5MA 5INDA 4EXKA 4B27A 5T1LA 1NPNA 1M71A 3LS4H 1I7ZA 1RUQL 3SKOB 2R83A 2V6HA 4PUBL 4Y16C 1DQML 3QO0B 3MKGA 4PH8A 1NBQA 1WFMA 1T6WA 5D96B 3LRKA 1QFWI 1MLCB 4Y4KB 3AXHA 4N2EA 1RZ7H 1FBIL 4FEIA 4WKZB 4GW1A 3HOGA 4HS8H 4PRIE 5I5JA 3TEXA 4CRPA 5JNYB 5IFAL 1MVUA 2CXGA 3O3EA 3TT1H 3FUKA 1F56A 5FC9A 5EN2B 2OTWA 2QTEA 5EMYA 4HUUB 4WEMB 1PY4A 5TQ2L 3LKSB 1XGYH 2VXVH 1S7UB 3T8XB 5IQNA 1BBDL 2K8MA 3H9SB 1YECH 2YAOA 4TNWF 5F0MB 3UEQA 5CU5A 2JIXA 5I5MA 4UZGA 4EUPA 4YR6B 1A21A 1Z0NA 3DV4B 4RGOL 5AZUA 1NDMB 1IZJA 2HT4D 1WAAE 4QOKB 2DQTL 2R59A 4WJ5B 5E8EB 5TK2A 3W2DH 4WWKA 1AMXA 1CS6A 3MDJA 3QORB 5F96H 4ZW7A 5KVEE 3HAEH 1R9FA 3DX8B 5I16A 2WTRB 1YEFH 2O1AA 2FUTA 2P5EA 2IMNA 5GGSB 4E0RB 1XB6A 2EDTA 3L9RA 6FABL 3QDGD 2WNKA 3FTUA 3LZLA 4OJAA 4QXTB 2QHRL 4WEUD 4JDVA 3LMJL 5DVKA 3POHA 3LH9A 3HZYB 5DQ9A 1L3NA 1NLBH 1GY2A 1BQHA 4KQ3L 3O2DH 4QRUA 3MRCB 4U6VL 5GQBA 2BSRA 5BOPA 4F2FA 1AOHA 4MAYA 4GRWE 2YPLB 4LGRB 1CFTA 1F02I 1R3KA 4HF5L 4JFPA 4RQQB 3T6ZA 1KDIA 4U49A 5D72L 5BMFH 4PG9A 2EKSA 5CLYA 4QHUA 4OH2A 4ONOA 2UWEB 4W9ZA 5T3ZL 1XXDC 4PJCE 4YO0B 5FWRA 1FZJA 3RWIA 4BSWB 2Z7WA 4JANB 1TFPA 2NY6B 1HCVA 1PMYA 2CA3A 1QSFE 3GIVB 4X9GA 2V5SA 4M5YL 3KHOA 3U4EA 4KO6A 1IAIM 1I1AC 1SY6H 3L5WA 3VCLB 2D03L 3O8XD 2VLLB 1C1EL 4B50A 2O5NA 3JV6A 1BFTA 4P23B 3FU8A 1TJXA 2OI9C 4PJCF 4YOKA 4AM0B 2R0ZH 4I87A 2Z34A 3GXMA 2SEBB 1GOGA 2K78A 5KAQF 4OSUL 2GQHA 1YC8A 2WJ5A 5GS1B 1VF5C 4PJGE 2FL5B 2YPVL 3UJIH 5G4OA 3JBG7 5F1NB 2PF6A 3AAZA 5LGKA 2EC9T 1SLUA 3K3QA 4MQXC 5GSVA 1Y18B 5AZEL 2WYHA 5CAYB 3BRDA 5IJKA 1UXWB 1M53A 3I02B 1F5WA 5IT2H 3FMGL 1SBSH 2DEWX 5E03A 3G3LA 4ELMF 5I8OH 2VL4A 1ZLSH 1EJOH 2DBLH 4G3YL 2HPOA 3GTTA 5C0CE 5IGXH 1AO7B 4NN7C 2QFRA 4U33A 2VLMD 1JD9A 3MV9D 5C0BA 3OR7A 1FYTE 9PCYA 1H8NA 2I5YH 3VWJB 1T3FB 4FQXC 4RA0C 2WKOA 1ETZA 3SD2A 2A99A 3EO9L 3IJ7A 4PB0L 1FNSH 4OLYH 1W0VB 4KMLB 3FW6A 2TAAA 5JW5B 3K6SB 1I1RA 3HG1E 5AAMA 2YSTA 3VRLF 2DQ6A 4MD0B 4IRJD 2F53E 4PD4K 1UTDA 5LBGA 2JJUA 1W16A 4FHBD 3SO3C 2NNAB 4IYKA 5IJCC 1UUSA 2XFXB 3WN5B 2JK5B 5IFHH 3KLAA 4XVJH 3BAEL 4N8CL 2E9BA 3IMVA 3J7HA 4G9FE 2IWKA 4LLMB 4QXVA 4WFFE 4P3DB 4ADGA 1M3JA 3S35L 2BVTA 4DGIL 1MVYA 4PY8I 5DJ2A 4MZ3A 2VN7A 4NQSB 3U4BL 3B83A 3EDEA 1V3KA 2WANA 3CE1A 4LPYA 1QFWL 4M1DL 1ET7A 1QI4A 4XH2B 3IPBA 1QRNE 4K9JA 3GMNA 5FUZL 1RJZB 3LRHA 1FVDA 1S5IL 2EO9A 1LO4L 4MNQE 5I75B 5DQDH 1QQDA 3P4MA 4I0PA 1KXQE 2ZG1A 1G9MH 2DICA 3ALWA 4P4RA 4IOSA 3Q5OA 3QFJA 5KSUB 2A0LD 9CGTA 4UIMB 1YY8B 4TNVK 3UTTE 2AK4E 1HL8A 2YFNA 5BO0D 1RCYA 1K9TA 3FQ4A 5E9DA 1IM9A 2J73A 3FQRB 1CG9A 3STBA 5DFAA 1N0LB 2CALA 1NL0L 2P48B 2WKLA 5DFTA 5CGBA 4ABWA 5FFLA 3ETBF 1FWXA 4OLUH 8FABA 3DVNB 4L8SC 2DLTA 1E6OH 1U93A 5T3ZE 4R3SB 1JZ4A 4KNQA 3WV0A 5EC2A 2ALAA 4OCSH 2TRYA 5C70A 3MGTA 2EIZB 4MJJA 1UWXH 5E2UL 4XMKH 3BH9B 4A6YH 4DP2X 3E38A 2ERJC 3TA3A 2CO1A 2J5LC 3ROOB 1DJSA 5ITBL 5D7JA 1VGEL 4CMMB 1PGRB 4J4PA 4OT1H 1EFXB 3W0WE 3DC0A 3AS2A 5F9JB 2ZUVA 4BZ2A 3HE7B 5HTSA 1HSBB 4OGAD 5FHBL 2EABA 1KEGL 1WBYB 2F15A 2RGSA 4LBAA 4NLAA 4LL4A 1M6UA 1EBAA 4HBQA 2LVEA 1CO1A 3LXBA 5I15L 4ZMVA 3QUXB 3D85B 2VNCA 4FFYL 3SDCD 1E5BA 5AENA 4YSOA 2AW2A 3THMH 1SVCP 4L4TA 2EIDA 1QSVA 2WXQA 2EXWD 1EPFA 2P45B 1QNZH 2RJMA 2R0WH 1RFDH 3QJHB 3KGRA 4N2LA 1IGMH 2PETA 3L48A 1F3DJ 3L5HA 1M05A 3FULA 4FLHA 2XTJB 3EYFA 3ARDB 3ATDA 4NEHB 1O7SA 1TVHA 2X6VA 2JI3A 2ITCB 4RISL 3B6SB 3O0RL 3VB8A 4YDVA 2X70A 1LQSR 3FCSB 1EERB 4P2OB 3KBFA 1EZVX 4WF7A 1LP9A 3DO4A 4HWZA 2ENQA 35C8H 4HCGA 2WXFA 1LK2A 1O75A 1S8DB 1KPUB 3BMWA 3MLXH 4IDJH 4CVUA 3WS3B 1CF1A 3DGDA 1NDTA 3DDFA 4Y4KD 5EUOA 3SGEH 2BVUA 3LPOA 1MJ7L 2UVEA 4JFEA 4PV8A 4F9LC 1E9OB 1CD0A 1WV7T 2X1WL 4PY8J 1PDKB 1ACYH 1LO0H 4FFWC 4ZX6A 4NQVA 5BRZA 3P3RA 4OFYD 1GTFA 4PJBE 5ACMA 5IW6A 1NCNA 4B7IA 4XPHL 5BW7C 4XO3A 2FX7L 5C92A 3H9SD 1J9RA 1YN7B 4L9LA 1D5MA 1OQXA 4WTZG 1KBWA 4X0KA 5DQJB 3RZWA 2A77L 1MRDL 3TIEB 3LCYA 4N2BA 2QQKL 2UY7B 2WNXA 4L4VB 3NK3A 4M48L 4OFVA 3HIZA 1T80A 3QDMB 1C16A 1JERA 1MF2H 2DIJA 1QKZH 4F2MA 4RAVB 1PG7W 4ODHH 1TQCC 2CJUH 3B3IA 1WFTA 4QTHB 1BJMA 1MCJA 3ZHNA 3U46A 4MNGA 1AFVL 1D2OA 4XRCA 3FUEA 5IP4A 3H42L 3UG3A 3L3DB 5LBSH 5CP7A 3S2CA 1RZ8A 4X4ME 1F11A 1MLBB 3K7UA 1CPUA 43C9A 3FAXA 1XR9B 1RJYB 2HRGA 3BPLC 3FB8A 3IETB 4BFIB 1T5WB 3LKRA 3NJHA 5A7EA 2RFXA 5D1QB 4M03A 3VJ6B 2LGNA 1YYCA 2NY6D 3EYUH 3N44B 4OJYA 4WKXA 5HYJA 2AJVL 1DTUA 3FO9A 1UH4A 2NW2A 2Q8AL 1DQQB 2AMUA 1U2CA 1BM3H 1I1FA 1JZ3A 1G0XA 2AQ3A 2BVOA 3SBRA 1PG7X 3LIZH 2Z4QA 5E4EC 5LN8A 2H0PA 2VN6A 1G43A 1E27A 1NBYA 3FQXA 3G04B 3CZFB 3C60B 1H3UA 3OM3B 2FZ3A 3U2SA 4Z77A 1I9IH 4JO3H 4P23D 4X98A 4F93B 4NZFA 1D7BA 5KVDL 4XO4A 1MG3C 1CXEA 4NO3A 4MDIA 3ZHKA 3D1MC 2G2PA 3QI9C 4O2CA 1W15A 3KS0H 3JSSA 4IBQA 2YPLE 1WK0A 4S11A 3IDGB 3OB0H 3L95B 3MRFA 1N18A 4U6XA 4KQ4L 5HHOA 5IEKB 5L7XL 4FYRA 5CJQL 3WGVB 4JZOA 1BJ1H 5CS7A 2H1PL 4GIAA 4MA8H 2GIXA 5EIVA 3VGAC 1CDJA 3HHSA 1P5UC 2X2IA 5DLMH 4HP5A 1OW0C 3F85A 4LT7A 1H9VA 1AO7D 1AGFA 1SYVB 1OSPH 2Z35A 3LNHA 5LGYA 1M9SA 4XPAL 4AYSA 3EUUA 3HR5B 1FLRH 4Z78A 5DJXA 3I6GA 4P2QB 3PP4L 5GRZA 3ARYA 2NY0D 4LE8A 3FONB 3LKQB 3QW9A 5SX4H 4M6OH 2D7QA 4NZJA 1IAKB 5C0ND 3VWJD 4BZYA 5TQ0L 2NUPA 4LF3B 3WO4C 3KPPA 1KZYA 3QCVL 4DGYL 3CSGA 1A4JB 1J18A 5PCYA 3CFNA 4F5CE 2GTZA 3CLEH 2GJ6B 2R0KL 2ZKWA 5DMGD 3SZ6A 2BOBA 4GPVA 5ESQA 4M3KB 4HJTA 1VESA 4TUOA 4KVNH 2GUOB 4DIXA 4UIKH 4YZFE 5D7LA 2M26A 3N5AA 5FUOL 4Y2DA 3SGKA 1TNMA 1H15B 2NY4B 3ZDZB 1BF5A 4P5RA 1QTPA 5CN1A 1KGCD 3KWUA 3G7TA 1CE1H 1N6QH 5IB4A 5DJ6B 4WEEA 4PJ7A 3O4LB 3L2NA 3H7BA 4LHUA 3DUUA 1AC0A 1UGNA 5AOKA 1YUKB 5DK2B 1IBHA 4J28A 4G6FB 4JRYB 5I0VA 4ORGB 4YQXH 1AXTL 3OKYA 1DLFH 2LR4A 2VIRB 1MY7A 2EC9U 2KPWA 2EIKB 3V6ZB 3WJMB 3BX7C 1UD2A 1AZCA 4QNPE 3V0IA 3HAEB 4AVIA 3QP3A 1GY1A 2WXJA 1G7MA 4GXVH 1FZMB 2DLEA 1GC1L 3QIBB 5IHHA 2BMKA 4PG2A 1CGSL 4DN4L 1EO5A 4XCNA 1JNLL 3Q7JA 1Q9KA 3WJLC 1L6XA 1TJMA 5E8NA 3VACA 2WB7A 1G6RA 4ZUSA 1U8HA 4RH4A 4U7SA 3U9UA 2P80A 5IHBA 1NGQH 4DOHB 5I0DA 5HDBB 1JHTB 4TVSa 5HVHC 3SKNB 3FQYA 4LIQH 1NSNL 3RURA 1L0PA 1N6UA 3MJWA 4I9WE 4DW2L 1GYWA 4D0CA 3DARA 2KBGA 4MMXB 1A47A 1KLGB 4DPAX 1WRFA 4LPTA 1FZOA 1JV2B 4L1HA 4OJCA 1QUPA 1UZ6F 2HJFB 2WBJC 3QISA 4ONHB 3TV3L 1NQBA 3KL0A 1EFXD 2YQBA 1CLZH 3L1FA 1BP3B 4KAQL 3IJHB 2I69A 2X41A 3P0YH 1R17A 5KVDE 3ZKQD 3LSOB 3CX2A 4PJFA 4DCQB 2HRHA 3DOSA 4JDTL 2BERA 4NQEA 3PWJB 5CGTA 3QUXD 4Z0XA 3D85D 2P5WA 1FPTL 4MDRA 4A04A 1A7RL 2Q7YA 2A6JB 2OZ4A 2GT9B 3GI9H 2LLNA 2NXZB 3IU4L 4WSJA 3N85H 2Z4TA 4NNPL 3VI3B 2HTKC 1TVDA 3P73A 1TVBA 1QPPA 2G2RA 4GAJL 4HFUL 5DJAA 1KTDA 1OGAE 2XTJD 5JIMA 4IIQC 3ARDD 1QPXA 5KBMA 2Y06L 4PRBA 3QHZL 3R19A 1YEHH 1NFKA 1S7SA 4G6ML 1QUNB 3PGFH 1X4XA 4WGVB 4JDZA 2YAPA 3VXRD 4AK2A 3IDNB 5CEXB 4N5ED 2Z1KA 1BIIB 4G6JL 2H1XA 2I24N 4BFKA 5T1JA 1BD2E 4L1BA 3PHOA 4MQSB 3ZE0B 2DPKA 2YK1L 4EIZC 3EO0A 4FQCH 2WOYA 3NAAH 4Q0XL 1XGPA 3CFQA 3DX1A 5EA0L 4E68A 4F7MA 3VM5A 4FNLL 3MI6A 2L0DA 5DC4B 2F58L 4QRTA 2EC8A 4QR7A 3F7QA 4AOFA 4EUPB 2HFEA 1RHHB 4TSBL 3JUZA 3TNMB 3X13A 4FFTA 1INEL 1H0DA 3S96A 4BQBA 2L8AA 2YXVA 1G7QB 2YKLL 3ZGIA 2R7EA 4G2AA 1CI5A 3ARGB 3BWUC 2CKBA 4GRLC 4KKNA 3JVGA 1R75A 4URKA 4X5PA 2BSTA 4L4VD 1LNUA 2D9CA 3AG3B 3QDMD 1LVEA 3G08A 4N2AA 5GISL 3L9RB 4AEEA 2NW3A 2PTTA 2NNFA 4JDVB 2W9EH 3MGAA 4W9DC 4NENA 2HYMA 4RMRA 4W9FC 4HWEL 2Z31A 1BQHB 4DZ8A 1QACA 5D7HA 5IF0B 2Q20A 4QRUB 3S36L 5LG6A 3DK0A 2E6QA 2BSRB 1XQ4A 4HJJL 2WZPD 1VJSA 1HCFX 2BSDA 4DP9X 3ARFC 1P7HL 3ESVF 2ZNWA 3DJZA 4JFPB 5T1KA 2GITB 2ZXDA 1EHXA 5GGTA 1XH1A 4PG9B 4QHUB 5E51A 3MMEA 2VXVL 2EDXA 5A2KH 1T6VN 2ARJB 1GGYA 2QQLL 3QORC 4FMVA 3FHQA 1NCDH 1CDIA 4KBPA 1DLHB 2IQAA 5I1EH 1CD1A 4E41D 4HH8A 5CILH 1ZPUA 3GS4A 5FM5M 5D1QD 2OMTB 3FT4B 2GY7B 3BH4A 3L5WB 1HXYA 1BJ8A 5E0FA 2FJFB 1F18A 2G60H 1GYUA 5IR1B 4JQXC 3QIWA 2CGRL 2NYYD 4XP6H 3TZVA 4GMSL 2H3NA 2VRQA 3ATEA 1YY9D 3A5VA 1XF5B 3I3BA 3BUYA 1MAML 3O0LA 4EEEA 4APQA 2OP4L 2A7BA 3C60D 2MKLC 4B3EA 3BIAX 4FULA 4I77H 3PREA 4A6YB 3U2IA 4FL4B 3I74A 3IDUA 2AHIA 4IHBA 3O2DL 3W56A 3K2UL 2XN9A 1JK9B 3RNKB 3NCFB 1S9XA 2C3HA 3AAZB 4YFEA 1KEMH 2YXFA 3ARZA 2CR3A 3NIGB 4M6NL 5GSVB 1RH8A 2EE6A 2LU4A 3KPTA 4BFNA 5BMFL 1FVEB 5MEQA 5AUMA 3ABZA 3MOBL 3QPQC 1GJIA 2RQEA 2PPDA 2B4CC 1OVZA 1P4BL 2CRYA 3GRWH 2XA3A 2QFPA 2ATPB 1KGXA 3D33A 4Y1TA 4EKJA 4WUUE 2QVFB 3H9HA 2R29H 1J9SA 4NM4H 3VFSA 3F04A 4QDGA 3N1QC 3HUJA 2NQDA 4AEHL 1QI5A 5HY9B 2BWIA 3EDFA 5C0BB 2D73A 2Y3AA 5GS2D 1T66D 5D2LF 5DEJA 3LPFA 1Q90A 3SJVA 3GJEA 4AGMA 4P2QD 5JHMA 4OF8A 4OZIB 1ETZB 3AGWA 5HGHB 1PKQB 3HI5H 3Q01A 3U4KA 4H25B 2VISA 3NIFE 2V37A 5LGHH 1F4XL 1BCIA 2COQA 2VXQL 4BDVA 4KJWC 1A7OL 5JHDA 3F58H 3WIHH 5D7IA 4XNAA 1HVXA 3UP6A 4I2XE 5D7KD 2FE0A 2CE6A 1I7UA 5F71A 4UDTA 3C5ZB 2MWCA 4N2OA 4NJAL 1P4LA 1SYSB 1G1YA 4WHYH 3LXCA 4JN1H 4LLUB 1CTMA 3MFGB 4KJYA 4P2AA 2CKBH 5J6GA 2XCMC 1DQLH 1BZDA 5JPMC 1L7IH 4PS4H 3SDAB 2ADIA 1B0GA 4H8UA 1EJOL 5F6IB 3SCMC 1AGDA 4FABH 1HU8A 4K9EH 4ZXBC 5DJ2B 3IGAA 2J5WA 1OB0A 3O4LD 1NMCB 1HEZA 3E3QE 1OE3A 3RL1A 1ADWA 4DUVA 1M2VA 3OC8A 4G6FD 3VFVA 2J7LA 5DHMC 4JRYD 2ZUTA 3WSQL 3ZUCA 1X3DA 1T7VA 3C9NB 1YJDL 4Y88A 1HL5A 3P4MB 2R27A 1UD5A 2AXFB 3PAUA 4HJ0C 4LSUH 3RGVB 5EB9A 2A73A 2GJ6E 3QNYA 3MACH 2QADD 1OGPA 1MHPL 3X3GL 4F1SA 2BNUA 3EDDA 3PNWA 4QJ4B 4PW4A 4JLRB 4Z7OE 1TETH 1OARL 3BN9C 3ZJAA 4N0YH 1ZVSB 1HH6B 1IM9B 2XKNB 4LLDB 3CDCA 3G5ZA 4ZMQA 1ETA1 1Q0YH 2CM6A 1B2WL 2N56A 2I7SA 1A3RH 3EGXA 3MU3A 1E4WH 3Q8AA 3GHBH 4PRDA 8FABB 4WEBL 1NA8A 4YDNA 1ZXKA 2A83A 3K5SA 3GSUA 1LDPL 3I85A 5I75C 1LE9B 4MRCA 4FQLL 3KYNB 4HULB 1DDHB 3MLZH 1XB8A 3WMQA 2YBRB 3NA9H 3TA3B 1SLXA 3K6FA 4MGXA 4PJ5A 4DKEH 2BFVL 1HZHL 2YXWA 3P54A 5CSZA 3M1BA 1NUGA 4K15A 1IKNC 3UOAB 1EO7A 1MWAA 1U2HA 4OFQA 2FHCA 4BELD 4ZQKA 3LPGA 2GYSA 3L5XH 4MJIA 5ABAA 3WL9B 2R23A 2QQNL 2A38A 2GKIA 2JLLA 4RDQG 1MREH 5EBMB 4OM0L 2X6BA 1MIEH 5KS9A 1DO5A 3KJ6H 2R39A 1TU2B 2IF7A 3ARWA 1TNNA 3AVEA 1ZPLA 1TQBC 2AQPA 3QZWG 5FIEA 5JIPA 3FXIC 2W88A 5HDBE 3JTTA 3NFNB 4DKTA 3E1ZA 2FLBT 1WD8A 4HU2A 2YZ8A 4TPRH 4F7EB 1IB5A 5EF2A 2M2DA 2ROYA 4N3TA 1JI1A 5E1AB 2NXZD 5MEPB 4BXSV 1M05B 1J1OL 1JAEA 1VEPA 1SM3L 1U4EA 5D8JH 5FA3B 4XMKL 1RHFA 1Z0MA 4LVHC 2DLHA 1WZKA 5DRZA 4A2HA 4Z76A 1U92A 5C07D 1YDPA 4OCXL 4DPCX 2LTQC 4HWZB 3MRPB 2DYRB 4JVPA 1LK2B 4ZO9A 1B6UA 1I9EA 2GI7A 2L04A 2X4PB 4JFEB 5AOMA 5SX4I 1FZKA 2YRLA 3N50A 1DVSA 4L8DA 2Y5QA 3DJRA 4OCYH 4Z7QB 4UT6A 4YDJA 1CTOA 5BRZB 1K5NA 1A2YB 3ZGHA 1FAKT 3D3VA 4XVTH 2EDQA 3NACL 4JFXA 4JY5H 1HAWA 2DQMA 3MHZA 4MFHA 1N2RA 3TYGL 4LKXB 5TPWL 3KWWA 4L9LB 1D5MB 4Y4FD 4XVUC 1D9KC 2W65A 4MJ6A 3ZUNC 4ERSH 5JHLH 3AS0A 5B38A 4NN5B 4OKDA 4DEPB 3PWPA 4KX9A 1Z9MA 2W60A 4YSAA 3ARGD 2CU9A 2DQDL 3UZQA 1NIFA 3QT2A 2FBOJ 1C16B 2FYYA 4P46A 4F2MB 2X10A 1CL7L 5DJDB 4PTUA 4HJSA 4TQHA 1RZJH 3ZTNH 4UOW1 3MLSL 2K9FB 1DQKA 1PYWA 2VW7A 3GSNL 5DSCA 2VR5A 2R69L 4MNGB 5I66B 4NUGL 1HEHC 5L0QC 3ZSSA 4AJVA 3MRDA 1GC1C 3WTUA 5CP7B 5DDHA 5J13B 4P2RB 1F11B 4LFHG 5IIEA 3ZL4L 3VFGL 4LEOB 3ES6B 5AKSA 2CH8A 3MUY1 4UUJA 1J11A 3GPSA 1UD6A 3B8YA 3BLBA 3KYOA 4OTXH 3P30H 4Z7NE 1WC7A 1EJ6A 2RFXB 4K23H 5DO8A 3PRZA 1V5JA 1DN0A 2P7TA 1KV3A 3JYBA 3DSFH 4NGHL 2NW2B 2X9ZA 1VAHA 3DOIA 4A7GF 2E7LA 4P2YA 2WWMD 1CD9B 1BLNA 2ISDA 1MWAH 3MV7E 3LS5H 1QP1A 2P5EE 4G9DB 5I1CL 1DVYA 5FB8B 3O9WA 4O9HH 3GDBA 3LPWA 2F54A 3IGFA 5H4YA 3ZZQA 5LJYH 4LSRL 1AOZA 2FZ3B 1FP5A 2PPFA 4X98B 1H3XA 3L3OA 3HNSL 2AJUH 2C1PB 2FQFA 5D5MA 4O2CB 3HE6C 3CC5A 3T6VA 1C08A 3KS0J 1N4XL 2BIQA 3EYQC 3AREB 1IIKA 5AW6B 1BXAA 4GKZA 3GIZL 5HHOB 3ULVL 3C6EA 5D93B 5A3ID 3KD4A 4RRPM 1BJ1J 5JLZA 3VSVA 4NQCD 1VLXA 4FI7A 3ZKSD 3QUGA 4AC2A 2IBZY 2I27N 4YDKH 4LASL 5FDWB 1P5VA 2G30A 2B20A 3LN5B 3MYZA 2UZXA 4KKBD 1FL6B 2B0SH 2UX6A 4LVOB 3MNZB 4XO8A 5EO9A 1AGFB 3RA7L 2D8KA 4LCCC 2XLLA 2DJMA 2RD0A 4HMEA 4G1MB 1JZ2A 5F9WB 4YE4H 5A2AA 4BZ2L 2C7FA 2CR6A 4TULH 3MJ8A 3PP3H 5DD0H 1TQVA 1CFQA 4FXTA 2W07B 4GEIA 4Y89A 1Q9OA 3PHSA 4CMHC 1EHLL 2XQ0A 2XBZA 4ETYA 3UO8B 2CBPA 4JFYA 4BSVA 1UG9A 4NZUH 3I50L 1HWGB 3D39D 5F7WC 3RGBA 2MNJB 4ES8A 3C5ZD 5D7LB 3FTSA 1J87A 2MFNA 2OCJA 4M6ML 1DEEB 4TTDD 4H40A 4FXGA 4Y2DB 5FO7B 3SEPA 5E5UB 4TOYH 4EBQH 2BP3A 4Y5XA 3N3EA 3NCCB 4HCIA 3IU3B 1MY5A 4Q8BA 3W9EA 2EH7H 1BA9A 1GGUA 3SDAD 3JWDL 3ZYIA 3ARVA 2R8SH 3E3QC 4WHTA 5TD4A 5IB4B 4PJ7B 1WSST 4X4ZA 3K2IA 3H7BB 4LHUB 3S0PA 2DM4A 4NRXB 3S3PA 2DMCA 5L2JB 4JMXA 4ZT1A 3ULUL 4UOQA 2G5UA 3LNFA 1OSPL 4XN1A 4BFGA 5TH2A 3GMQB 5B4MC 2HX9A 3LQAH 2WPGA 1IBYA 4LNVA 4NUJA 3U0TA 3WKYA 1QR4A 3MUGA 1TEFA 3F7VA 4M3JA 1EEZB 4XCCH 3QQ9D 2XC8A 3LDBB 1KFAH 4PJIF 2V2TA 1HNYA 4L3EA 3RGVD 1A4AA 4UV4L 3IAQA 2OMVA 4JJ5A 2BDNL 2APSA 1A9BA 5E95B 2JKLA 1T4KA 4UQ2A 3TOPA 2BMKB 1TJGH 2OSXA 3CZEA 4UANA 4XCNB 3UYRL 3P9LA 1YC7A 1Q9KB 2G5RA 3AM8C 4KFZC 1R3HB 2D7TH 5E8NB 2DLGA 3I75B 1IM9D 4XOCA 1A14L 4ZUSB 4TF4A 1O6VA 4K71C 4XVOA 4LPUA 2AEQL 3C2AL 1YEKH 2FX8H 3ISYA 2F74A 3QUKA 1N6QL 2W92A 2CGYA 4H0HB 5DGQA 1TQTA 3EYOA 3DURA 1MZYA 4X50A 1TCMA 1D5IH 4Y19D 1U3HB 3EZ8A 1AI1H 1F4HA 1TJHL 2NY7L 1JZJA 3D50A 4NERA 4JY6A 1MCHA 2VLKB 4YHLH 4NPYB 2XHNA 3QIUA 4MYPA 2IANB 4RSYA 2GHZA 5C0RH 3Q6GL 3QFJE 4GQQA 2Z64C 5KOMC 3SGJA 4J4PD 1JCVA 1L9QA 1ZKAA 5CGYC 1THCA 1OF2B 1P84K 4FD0A 1U6AL 3A22A 1W0WA 5E9DE 5IHLB 3DOSB 3BESR 3S5YA 4UDUB 2Z7UA 3NPSB 3EGDA 3ROLA 4Z0XB 5CSBA 3ULVE 3HN8A 3IFLL 7FABH 3F7YB 3ZE1F 1RK7A 1JWUA 2ADJA 3GT6A 3MBEA 3T8MA 5CFHA 2OPCA 4WI9A 1JBJA 3WD5H 3DPBA 4BJLA 4AEIH 3P73B 1TVBB 2G2RB 1WHOA 1XF4B 1R47A 1N6VA 1CTNA 5LUMA 2ADFH 2IGFL 2AEOA 3SB3A 4UTBA 5CJ8A 2I26N 4PRBB 4PVMA 2DEYX 3BCDA 3UTPE 4ABQA 1S7SB 32C2A 1W8EA 1IAIL 2P8MA 3KCWA 3O3BA 1R5IB 4JDZB 2GY5A 1KIRB 4HPOH 4NN6B 5E08H 3N1GC 1A3LL 1TDQA 5DRWB 2VMJA 3PHOB 3QQDB 1A9EB 4KPHL 2WAHA 4PM1A 4L4TE 4M5ZH 3UTOA 2XQBH 3FOLA 4GQ9H 4KTEL 3NRQA 4EIUA 2WUBL 2OA9A