4FFYH

Crystal structure of denv1-e111 single chain variable fragment bound to denv-1 diii, strain 16007.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
QVQLLQPGAELVKPGASMKLSCKASGYTFTNWWMHWVRLRPGRGLEWIGRIDPNSDVNKYNEKFENRASLTVDKHSSTAYMQLSSLTSEDSAIYYCARWFFPWYFDVWGTGTTVTVSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords DENV1-E111 single chain variable fragment (light chain)
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Mus musculus
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffyH00
2Z8SA 1TCMA 5FA3A 5I30L 4DEPC 2GY7B 2WV3A 3DVFA 1MWAH 3TNNA 2EC9U 2G2RB 4HJJL 1DQJA 2Z8VC 4HFUL 2BY3A 1Q72H 4MX7A 5F1IA 2AGJH 2F19H 2VO5A 5C0BE 1NL0H 2QQQA 4L1HA 1F3DH 2EDDA 1TJIL 2GEEA 3DI2B 3O2WH 3Q6FA 3OWEA 4F7TB 5JHDB 5CHNB 3VXNB 4X0KA 4OCWH 1T7WA 4RMQA 4UI2A 5FOBB 4Y4KD 4FFVD 5FYLE 2NZIA 4JB9H 4I9WE 3IDIA 4XC3H 4ZUSA 4HIIA 1CDGA 1MRFH 3GSUB 1JZ8A 4L5FL 3EOAB 4MQ7A 4JG0L 2VXVL 5F7WC 2ZOKB 4I48B 3QXTA 4XVUD 4NOBA 4ZNEE 1BQSA 3RL1B 3SBWC 3HNSL 1CL7L 2V5MA 3BP5A 1OARL 5D6CA 2EDYA 4XNXH 1DVFD 5L6YH 5E6IB 3HAEA 1P7HL 3CFBB 2Y07L 4WTWA 1OAKH 3V8CA 4RMVA 4JFDE 5BMFL 4MNGA 4O2CA 2KBGA 4PJ7B 5GRJL 4DGYH 3FCTB 4M5YH 5F7KC 1D9KB 3IRZA 2FR4B 2HT4D 1GGTA 3TWCL 3H3BC 2HVJB 2E9JA 3U0PA 2CUHA 4JO4L 4GBXB 3ARZA 3F62A 5C0CA 2PO6A 2YSSB 1V3JA 2ZUVA 3N06B 1EDQA 4GW4A 2R1YA 1IM9A 3O3BB 2A6DA 3ILQC 3MCLL 5I8EB 4MNHB 3H0TB 1TJHH 2C7UA 2R2HB 2HVKA 4PRPE 1WCQA 3C09B 4ZTPH 1ZGLM 5ESVA 1KB5H 2ED7A 3VRLF 5FYKU 1UM6L 3FQTB 1IAII 3GRWH 5M7QA 5C07D 4NQUA 1QRKA 3JTTA 4TULH 1OGAB 4JFPA 5GRXG 1EEYB 4MA1C 4ODSH 5L88L 5JOEA 3CZFB 3RVUC 1BHGA 4F3FA 4X9HA 3WIHL 4KZEL 2VXUH 3MLWL 1PYWA 2MNUA 4YH6A 4OKDA 2V9QA 1W72A 5IW6A 1T0NB 3AREA 3T0WA 4JM2D 5BV7C 5DEGB 4W6YB 5ACZB 5JOFA 1G7HB 3QUXC 4LCIL 2B20A 3AAZB 4PV8A 5F70A 1M7DA 1A1NB 1QLRA 5AYUH 4KJQC 4KRLB 4OTXH 1S7UB 3VXOA 4AENB 5F1OB 1QFUH 4D0CA 1Q9OB 5JXEA 3O4LB 3QEQE 3WFDH 4K9EC 5DD5H 4LSVL 3RWEA 2WUCH 4ZYKB 4MJ6A 2RB8A 4L9LC 3CFCL 4JQXC 3PGDA 2VLME 5HD8C 3REVB 3B9AA 2J8UB 3C60D 4MCYA 5D1ZD 4LVHB 3I2CL 3DYOA 5FXCH 1CDCA 2VLRD 5ADOH 1U93A 3JWDC 1INDH 1QSFE 4KMTH 1LEKB 3VFTB 4JQVA 4JFFA 4O2EB 5E6ZA 1FZMB 1VB9A 4IHOB 4KKCC 2DQFA 5GS1A 3LB6D 4M6ML 1NEZA 5CEYB 4QHKI 4WTZG 3ECBB 1IGIH 2V17H 2NY7L 4NCC1 5KBNC 2HT3C 4OZIF 4L4VB 4AEEA 1CR9L 1IEBA 1FRGH 4K8RD 1Q9WB 3PQYE 4TTGA 3DVIA 1RVFH 4LLYA 4QXUH 1XGRB 3EYFA 3O6FB 4LSUL 1VFUA 5D7SH 5DFVC 5HY9A 3KDMA 3WE6B 4QNPE 4AEIL 4TUKL 1J0IA 2EEDA 4LIQL 1N6QL 2YHGA 2YKLL 2V6HA 4PB9H 4XCEA 1BFOB 2FX8H 4JM4L 4Y4FA 2BSSA 5I73B 3LSOA 1UXSB 4ZFOL 3FZUD 2YXFA 4ELKB 5CJBA 4DGIH 5BXFA 4AL8H 5C08B 3MRDA 2VDKL 5D7KD 3MLVL 3QUZC 3FJTA 2EE6A 4L8SB 3QIUC 1P1ZA 1KJ2H 3B8YA 1JYWA 1JZ7A 4WI7A 5HGBB 2BRQA 2R29L 3RWGB 3W0WD 3MLRH 3QIBA 1YUHB 3SDAD 4RDQG 3GBMH 3GSOB 3QUKB 1H3TA 1H8NA 4X99B 4W4OC 1LO0L 1DQML 1YPZB 1L7TL 3QXVA 3PJSB 3RVTD 1ZK9A 5IIEA 5M95B 2JCCB 3QR2A 3SGJA 1MIML 4NKDA 3S88H 4N90D 5DA4A 3CFBA 3OSKA 4LPXA 4HWZB 3I02A 5KW9H 4JO1L 4NO0D 2BZDA 4NQDE 5KSAC 2PCPB 3NH7H 4FXLA 4KK9C 1YZZA 3DSNA 4AH2B 2E9IA 2VDOH 4FQXD 5KJRL 1NUNB 3ZKQD 3DO7B 3WXVH 4Z9KB 3TYGL 3VG9B 3ULUC 4NT6A 5JLZA 1EJ6A 1EUUA 2EYSB 1QFWH 4ODHH 4NKQB 3KPPB 5E24E 1PJ9A 4WUKH 1B4JL 3KLSA 4QKXB 1A47A 1IQWL 3SGEH 4JVWA 4FQCH 5EUOB 3S96A 4U7MA 3BO8A 1CXLA 3MQIA 1QFPA 3RTQB 3MODL 4ODTH 1TVBB 4I77L 4JO2H 4HKJA 4R2GB 1CGUA 5E5MA 5TE4H 1FLRH 4Z7VA 2VDRL 3EDJA 3UTOA 3DV6B 2ZUQC 3BZ4A 3J8F7 4HUXA 3UX9B 4EUPA 3VXRD 2OR7A 2VXQL 3QWOA 1CK0L 1IGFH 4ZXBB 4Y4HB 1RK1A 5B21A 1S3KL 1IGMH 4S1SH 4BFIA 4NWTH 2ITCB 2FH6A 3VFWA 4OV5B 1TNMA 4DQOH 2G5RA 3TYFA 1MFAL 2BNQD 3NFSH 3BZEB 5FM5O 1EIBA 3WBDA 5B38B 1MAKA 2EICA 1AR2A 3PV6B 1NDGA 1YYML 1N4XL 2QQLL 3LKSB 2YPLA 2WP3O 5E2VH 4KUZL 5LWYL 3KLHD 1T22A 1QEWB 4GSDH 5CILH 4POZC 2FNBA 1HSAA 4D8PA 5HYFA 4XMLH 3HNTH 4PGCA 2BCKB 2NYYC 4HFWA 3K3QA 3AM8C 4HCRA 4JFDD 1CD0A 1G6RA 3G9AB 4Y1AA 4F80A 1T83C 4OIBA 5DMYA 1AR1C 3QRGL 1TPXC 2R2EA 3GI9H 2APVA 3FKUS 4P3DA 4EVNB 1RU9H 1AIFA 2MCPL 5DRWB 3ZMRA 3GSVB 3Q5TA 5C8JB 4RA3A 1D5ZB 1MNUH 5INDB 4ZFZA 5J89A 1EK3A 1CD9B 5LCVH 1C7TA 5D2LB 1SYVB 2ZSWA 3HI1A 1F4YL 4GKNB 4L3CB 4KTYA 1RJYB 4TN9A 1QBML 5INCA 1QFHA 1U8IB 4LCWE 4PRPD 4QRQB 1BVKA 1GSMA 2AJVH 4LGSB 4XPAL 5T3XD 2PTTA 4PJEE 1G0YR 2VDPH 5JNYB 2HJLB 3QUYB 3BHBB 5EU7E 1EMTL 1H3PL 1LP9B 1MFNA 4GG8B 4HPOL 3T4AA 5FK9A 3C6SA 2X89A 1T2XA 3HUJA 3DXAB 5DJYB 1FV1A 5D7IF 4YEFA 2JIXB 5EO1B 1DUZB 3JV5A 5FA4A 1QPXA 3PDGA 4UT7H 2CD0A 1RZKC 3NTCL 4Z95L 2NMSA 3X13B 4X99A 1SEBB 3P3YA 5D2NA 4X4YB 4CKVX 1I8KA 3UYRL 1DZBA 4RFEA 2VQ1A 4V1DA 1XF3A 5F44A 4QRPE 2CXGA 4NZRL 4GG6E 1I3UA 3CXDH 4Z7WB 5IGXL 1CICD 3B43A 5EBLB 2A6KA 1IT9H 2MJWA 1AGEB 1O7SA 2PNDA 2CIIA 2VLKA 4NOFA 4BQ6A 1HQ4B 2PO6C 5DUML 3KHQA 1T1WA 2XFXB 1I9JL 2EDOA 1IC5H 4HIXL 4JCMA 4J6RH 4RSVA 2DTML 3IAPA 1MCOH 1I7TB 3A6CL 4FTVE 5C7XH 3QG7L 2R0KL 1MFBH 4DAGL 4NC2B 2CDEA 1Z2KA 5I1LA 3U7AA 4ODWB 3AS2A 2GTZB 3FTGA 3QFJE 1HKFA 4JG1H 3S35H 4RGOL 5TE7L 3PWPA 2X4SA 3PV7A 1ACZA 4WU7A 1JK8A 5L9DL 4YHIA 5ETUA 4QOKA 4C57C 2BFVL 2PR4L 1P5VA 3AREC 1IC7H 3TESA 3ZT6A 5JORB 3PF2A 5CINH 3CSBA 4OI7A 2H41A 1XCTB 2FRGP 3LQMA 3BGAA 5B8CA 1AJ7L 1IKNA 1NFDE 2DWEB 4FABH 5SWZA 5JXEC 2VISB 4O51A 1JGVL 2EO1A 3KPNB 5HGHB 1FO0H 1NCCL 2M8XA 3DO3A 3T77A 4GW1A 4LRIA 4U6VL 1DBML 3FT2A 5E2TH 2W9EL 1NGZB 2ZKHH 4PY7B 2ID5A 4K7FB 4JKMA 4JQVC 2Q7NA 4OUUA 4L4TD 1RI8A 3PE9A 1BBJA 1XGPA 1MQ8A 3MX0A 4P5MB 5HHOB 3CFJB 4S1QL 4XCNA 3RGVB 2P8MB 4M93B 4NQDD 3QDJD 1T4KA 5GS1C 4KRPD 4P0DA 3T2PA 4NNXB 3ARFD 2EKSB 4K3EL 2OZ4A 2E8YA 1YMHA 3E3QE 1QRND 1MHPL 2XZAH 4RGMB 4X4ZA 1UKTA 4EI5B 3M17A 3K7UA 3VFVA 4Z18A 1BQUA 1SM3H 4OZGA 2Q8AH 1RHHA 3IT8D 2FLBT 4O58H 4O4YL 1S7RA 3EDDA 4KGLA 5T1LA 1FCCA 5JIHA 1JGEA 1A6WL 1JZ3A 1D6VH 1MH5B 4I3SH 4Y4FC 32C2B 3LV3A 4FQHA 2BSRB 4IOIB 5EORL 3CJJA 4EDWH 3DRQA 1H9VA 4V2CB 3MRPA 3WUWG 1I9RH 2ADJA 4I0PA 3UJTH 2I9LA 3NIFE 1LO3H 3TZVD 5F7LB 3IXTB 1QSZA 4PJFA 5HJ3A 3LN4A 5HXMA 3CMGA 3QIBC 4IMKC 4NP4L 5DD0L 2DQHH 2Q76A 1RHFA 2FL5B 3HPLA 1BQHA 3DETD 3JWOL 4QT5B 5H37H 2X7LB 1A3LH 3U9UA 5DJAA 5EU5B 3Q0HA 1MIEH 4HKXA 5HHXL 4L8CB 2B1HH 3SGJC 4WDIB 1KACB 4LASH 4ZAKD 5JDSB 2D4DA 3BPOC 4CN1A 4ZO8A 4KJYA 4PRIA 4WUUD 1WK0A 1KSRA 2HRPH 1G0DA 3HR5B 2R1WA 4GS7C 3GJFK 2HYMA 1TZHA 4RNRA 2VNCA 5IG7B 5E99L 2QR0A 3NN8A 1RUMH 1JF1B 1S9VA 1FJ1A 2ADGB 1MJJB 1TENA 1JWSB 1AO7D 5GISH 4QRTA 2EZ0C 1QKZH 3QI9D 1YNLH 4UAOC 1E4WL 1NCBL 4K3JH 1SJEA 3GMPA 3PDDA 2IF7A 3VH8A 5I76B 4Q0XL 1W2KT 1TZGL 4MA3A 1H5BB 2NTFA 4KI5C 3QCUL 2VZ3A 4B50A 2ILLA 1JPFA 3GMLB 1X5LA 1WAAF 1H3XA 2EDQA 3MROB 5KSBA 3CDGA 4XWOD 3MV9A 3KXFA 2KZ1B 1M4KA 2GTWB 2XG5A 4YQXH 3VWKA 4Q9RL 2OCFD 3MRHA 4R4NC 3V4UH 4Y2DD 4G5ZL 1OM3H 3OJDB 3SDDD 3GSRB 4FP8L 3L3OA 2O61B 3OGOE 5E1HB 1QPPA 4KJPD 1P2CB 3E8UH 3QO1A 2DJSA 1NGXB 3TJHD 1CGSH 4XC1L 4CNIB 5ESQB 2HLAB 2I07B 5J4MA 3OAZK 4XBPB 3LEYL 1JHLH 1IAIL 5JQ6L 2VE6A 2ZSVB 5SV3A 5KZCB 3CX5K 3FQUA 3P4MA 4X9BA 5BS0B 1BM3H 3NFPB 2A1WL 5HHME 2IFFL 1AI1H 4L3EE 3LRGA 3K74B 3A6BH 2VZ1A 3BT2L 5FM4A 3BH9B 5T1KD 4R8WH 3D18B 4LF3A 2MPAL 4OI8A 2W0LA 3KNBA 2WBJA 3IFNH 3FN0L 3RVXC 1ZGLB 1QQDA 1KCRL 1YNKL 3VFRA 3T4YA 1KFAH 3X11A 2W60B 1ZA3A 3GIZH 3WFBH 5J7CC 1ED3A 4UDUB 3S37L 1G84A 5B3JE 2Z4QB 5H35B 4TQEL 1PG7W 1XCQB 2VLJB 2X4UB 4Y5XB 1T7YA 5DA0B 2DF3A 2ITDB 3WL9A 4JY6B 4PJ5A 3QPXH 1S8DB 2FJFA 4Z77B 4RMRA 1NLBL 1YEGL 2AXGB 1X5GA 5IV2A 1ADQH 1FYTA 4FTVD 4H8WL 4IJ3C 1F5WA 4G6MH 4PRNA 4NGHL 2V2WA 1KG0B 3SKNB 1JPTH 4MA7L 2QADD 2XN9E 1H3UA 2AVGA 3G5YB 3DURA 1HZHL 4IOIA 4PJBE 1U8KA 2V5TA 1IRAY 4XBGA 2CLZA 1IAKA 2V7HB 3K8LA 4K7PL 5CGYC 2HKFH 3VRIB 2SEBA 1QZ1A 1VEOA 4WFHE 4NNPH 3IFOA 4FFWD 4LHUA 2X4NA 3VG0H 3F7YB 2MCG1 1GZQA 5BVPH 1UADC 1EBPA 1LK3L 3T3MF 4FXGA 3CVHB 3B9VA 3JV6B 3K1KC 1WIOA 4QTIH 1MRDL 1KGCE 5TDNA 5IFHL 4WV1C 1TXKA 3F5WB 1KJMB 1MAML 5D2NC 5TH2B 1UVQA 2ATPB 5C70A 1X6NA 3QJFA 1YN7A 4WDIA 5D70H 5D71H 2WANA 2ZUYA 4RQQB 2HJFA 1UKSA 2D7PA 3KYMB 4YDJB 4XP1H 2EDEA 3DNKA 3IAGC 3B2VH 1ZT4A 4YHLH 2FZ3B 4NQXA 3MRKA 1KCSL 1F4WL 3EJYD 5D7JD 5J9PA 4NSKB 1MCNA 3BKJH 4JRXE 2LQRA 1KJ3L 1JNNH 2FATL 5IQ9B 3MA9L 2J7LA 3C8KB 4LDEB 3H42L 1VHPA 4Y2OA 2MKLC 2BC4A 5LJYH 5AAWA 5BV7H 3V6ZA 2UZYB 5F93C 3ARBA 2GW5A 4KMLB 2LFGA 3LKRB 4G6AD 1GZPB 3EFDH 4YZFE 3BE1L 4OD2A 3SOBL 1BOYA 1C8PA 25C8H 5IOPB 1A0QL 4WW1A 5JW5B 3VJ6B 4W4NA 3TIEB 4HSQA 4WEUD 3LMJL 3WDJA 5CFHA 4K9EH 5C0AE 1GGCH 2UWEB 4JANA 1SBSH 4MLIA 4WU5A 4P99A 3DVNA 3IFPA 2Q6WA 1T03H 5B8CC 4BUHA 3LS4L 1IKNC 3LS5L 2I07A 3TVMD 1HHKA 5MI0B 3VXSE 1RMFL 5F7EH 2BVUA 3FONB 2ESVD 3F7RA 4MAUH 3IS1X 4D3CH 3O2DL 3GSNB 4KRMB 2IAMB 3GMMB 5DI8B 4R6UA 4LRIC 5JPNA 2AK1L 1NMBH 4QHLB 5FKPA 3DSFH 2BMKA 5DMGC 4HBQA 5TGBA 4LFHG 4RX4A 4J3UA 5F9WC 4PJCE 4NKIL 4Z76A 4OZIA 2R0ZL 5IFAL 4FZ8L 1A4JB 3B9KD 5GGRB 5J8OA 5MEOA 3BMVA 4PP2A 5FYJL 4PLJD 3T3PE 5BO1H 5TQ2L 4M7LT 3P11H 5FYKH 3V52H 1MFEH 5TQ0L 4AM0B 4K2UH 4Z7UF 3RJQB 2KZWA 3EYOB 2YD6A 2YA0A 5I8OH 5F9JA 5FECB 4F58L 5DVKA 5F8RC 1V7NH 2GSIA 4ZNCD 5IKCA 2BJMH 2IMMA 4MAYB 3V4VH 1H15A 2VC2H 2FWOA 3OPZL 3FHQA 3P9LA 1ULVA 4WGVB 4X4XA 1NAMB 1U3HA 4JDTL 5DTFA 1VSCA 4NO3B 4NQEB 3UZEA 2H32A 3JSSA 3QXDB 1CXEA 4ODXA 1MQKH 3VGAC 4U49A 3REWB 1G7IA 4PRBB 3MO1B 3X14A 1U8HA 4KROD 1F90L 1ZE3C 2YD2A 3V8OA 4J3WA 5F7YC 1CD1B 4I0PC 1HN1A 4MDIA 3M07A 2QQNH 5EFIA 5C0IA 5FDWB 4KKBC 3D0VA 4JZOA 5IMMB 1D7FA 2JJVA 2DM2A 5E95B 6FABL 4IOSD 4RBPH 3IDXL 1I3GL 1EJOL 2NR6C 4C56A 5I18L 1P5UA 3WLWD 5FO8A 5F88A 3PP3H 3ZT5A 2PXYB 2NXYB 3T8XA 1P7QD 3TO2A 4P48A 4P2QB 2ATPA 2H1PH 4L29B 4DKAA 1UWEL 5DFTA 5HHMD 4L3ED 5KVMC 3G04A 4RFNB 5I66B 3ULUH 5FGSA 2AJUH 4KWUA 1TFHA 2GAZA 4YDKL 4ZPTA 4RGND 1Y18B 2NZ9C 5JMRA 7FABH 1JPSL 4IS6A 3P73A 1MJ7L 4JN2B 2HLFD 4P2RB 2EDRA 4D9QD 3IU4H 2LV4A 4G42A 3CSYA 4F2MB 4UT9H 2HWZH 4JZJA 4UV7L 4G8GE 4JKPH 4OFYA 4WI6A 3HMXL 4FQ2L 4HQQL 3QUMA 3SCMD 1PKQB 2BDNH 4X5WB 5GRUH 1NH6A 4DVBA 3IDMA 1AKJA 2M1KA 2QSCH 4HJGB 4LPUA 3IJYA 3MV8B 1CG9A 1FL6A 2X44D 5K9KB 4M1GH 4JY4A 5H37G 2GYSA 3VWKC 5IHLB 4PJAB 3SPVA 5AAMA 1U8LB 1MPAL 1F00I 1Z0NA 2R1XB 1KXQE 1V7MH 1WV7T 4WW2B 5BJTB 1OP9A 4JN1L 2I9TB 2W91A 3GO1H 4ZSOB 5GZND 5KN5A 3C9NB 4XVSL 4HS6A 3ZE1F 3ARUA 3R06A 1JNHB 4WFHD 2C4FT 4P59H 4X83A 4XGZA 4D0DA 5I1HL 5JOPE 5ILTH 2V9TA 2NY3B 4NRZB 4OLVL 1EA9C 1XIWA 2VIRB 4XNMB 3NIGE 3UTTE 2Z31D 3HG1E 3U2SA 3FQNA 3MOAL 5F1SA 5IROA 1KGCD 1JFQL 2BX5A 3CH1B 3TN0A 1T1YA 1YJDH 1U91A 4KXZI 1ZANL 1QP1A 1RIHH 3UBXB 4DTGL 4IRJA 1C5DA 4X6FB 1YN6A 5T3XH 3O41A 5LGJA 2W1NA 3U30C 5D7LB 1R3JB 4HJ0C 4PR5A 2DLFL 3QWQB 2OQJB 5BRZE 4N8VA 4OLEA 2XNAB 1YMME 1GOFA 3Q5OA 2DQUL 3OJ2C 2J8HA 5DZNA 2ARJQ 4H25B 3RKDD 3Q3GB 1ZLWH 2A9NL 5GHWH 3V2AR 1UB6B 4PY8J 5DQJA 2G5BA 1X7QA 4YHNB 4FMKA 3NACL 3ZKNC 1IE5A 3TH4T 4XHJD 3HC0B 1GGYA 4FA8A 1P4IH 5EC2A 4QY8B 1PZ5A 3WD5H 1KB9K 3SQOH 1FNSH 2J2ZA 1FDLL 1PKOA 4P5KB 5FYJE 5E8EA 5F71A 2VUYA 1BEYH 1BFVL 2YEZA 5D1QD 4O00A 5D7IA 2IPTL 3FT3A 3PWLB 2YPKA 5DJ0A 4NQCB 5D5ME 1RZKH 2DI9A 4YHZH 1CI5A 5IK3B 3L7EB 1HH6A 4P46D 5F3HA 5I1JH 3WEXB 1KJVB 3C87A 3THML 5JXAL 2JJWA 4PJXB 3QXAB 2ATKA 4R90L 4L9DA 2O5ZH 5MENE 3QZWG 2AV1B 2GJZB 2ZJSL 1MREH 5DJ6A 1TCRB 3VXSD 4F37F 5FO9A 3U46A 2PXYA 3MLYL 4N0RA 4IRSA 4M4PA 3MRLB 5DHVB 1QFWM 3RAJL 4NNYB 5CUSL 3ZYZA 3LVEA 4HXAL 4ELMF 2W07A 1GPOH 1FZKA 4HBCL 3ARDA 3ZE0F 1FFQA 1A6VL 4R0LB 1VPOH 1ACYH 4H20L 2X1QA 4Y88A 3T0EA 3AUVA 4G9FB 1EEQA 5I30H 3QIWA 4DUVA 2F54E 5AYQA 2GCYA 1QVOA 5F6IB 1FFOA 3QA3A 3LQZB 1Q94A 4HJJH 4B53A 3DX8A 3NIDE 5DK0B 3ARBC 4LSPL 3AB0C 1TZIA 4TNVK 3VXUA 2R56L 1TJIH 5ICYA 1F02I 5C07B 5MERB 1MHHB 1YQVL 4JRWA 2A83B 2YWZA 1R5IB 3MV8A 4JFQA 3O4OB 5JW4Q 4JREB 2FCBA 5DFWH 3C5SA 2YD7A 1NBVH 5LGKA 4RISL 3PWVA 4GAYB 4M00A 4OD3L 5L2KD 3RVUD 4WO4B 4GRWB 3TV3L 2BERA 3KS0H 2X6MA 3E6HB 4L5FH 1E27B 1XZ0B 1DN0B 4HIEB 3MRJB 4LCUA 3RIAK 2PW1B 3U48A 1SJHB 3H9HA 3G6JF 2K7QA 1T6VN 4OIIL 2C1OA 3F7QA 2KL6A 4TVPE 3N1GC 3QUXD 3O81A 3QDGB 1A7BA 1CL7H 1E6JL 1OARH 1S78D 2XA3A 2R0WL 4DZ8A 3FMGL 2GJJA 4Y5YB 1DDHB 2P1YA 4EXPX 3D2UD 1D5IL 1ZHKB 2Y07H 4LAQL 5HVWA 4Z7NE 5BMFH 4DN4L 3C60B 5GRJH 2NY1B 3OKKB 3UO1H 2ORBL 2VLRB 1BD2B 2XZCH 2EH7L 4LBEA 5CWSA 4MNGE 4HV8B 4GAGL 3OKEB 1ORQA 4JO4H 3OHXB 3NCFB 2GI7A 3UTSA 1I1AA 5C0CE 1B0RA 5C0EA 3BPCA 3ARRA 3CSPA 3MSPA 2Z35B 3MCLH 4JGJA 5DJ2B 2LTQB 4ODVH 4P5TA 5T3ZL 3S5LG 5BZDB 1AHWB 1L6ZA 3I6GA 3FOMB 1ZLSH 1UM6H 3CX5J 1IZKA 4OGAC 1U3HC 5E94A 1T0PB 4G8GD 3O9WB 4NHCH 3WN5A 4S1DC 4N9GB 5GRVL 3D87B 1CDBA 3I75B 3MV7A 5MEPA 4KZEH 2EYTB 3QDMA 4HIJB 1GGIL 1OD7A 2CSPA 2J6EL 7CGTA 3PL6C 5AG8A 3BPLB 5J1AB 4MS8C 1F8TL 4RFOL 4BQ8A 4LCIH 3A6OA 1AXTL 4ZUVB 4MMZC 4RAUB 1N8ZA 1YEDA 4N0UA 4NC1C 3W9DB 3VCLB 1HNGA 1MLCB 2LVEA 2YK1H 1Z0MA 3P30L 1LVEA 2NPLX 4ZDHB 2DQDL 4KGJA 5CJXA 4HUVB 2DL2A 4HUUA 3WFHB 4LSVH 4YIQA 4M61B 5FUCC 2XRAL 3VXMD 5KS9F 1A7OL 1OAXL 3I9GL 3LY6A 5DYOA 3MBEB 4YWGL 3MGOB 4U1KA 2FBJL 1NCNA 3I2CH 4MNQD 3UTTD 3U0TB 1J12A 4MCZB 1OT2A 2GK0B 3FO1B 3LZFL 5D9SB 1MSPA 2AKRA 1YY8A 5E70A 3E6FB 3SE4A 3LAFA 4UV4H 1EEZA 4MDJB 3MNZB 1AY1L 4NO0B 4WI2A 4M6MH 1KENL 4MQXC 1PG7X 2NY7H 3QQ4A 4FQXB 3EFFA 5BRZD 1UWGL 3D39D 5IR1A 4MYWB 1S7QA 3WJLA 1YMMD 1WAAA 2Z93A 4JZJC 3NGBB 1ZT1B 4U2ZA 1T3FA 4ETQA 4HC1A 1KN4H 1HCFX 1E4KA 1X5AA 4XP9L 4LIQH 3GJFA 1N6QH 3C5ZB 5ITFB 2YKLH 4PJGF 5F7UA 1FNEA 5ANMA 4P4RA 4JM4H 4WY7H 5FGCE 2QSTA 2MQCA 1U2HA 5IP4A 5SV4A 4CADB 3VD3A 4Z0XA 5FYJD 5CP7B 3HA0A 2EXWC 4U6TA 5C0BB 2CIKA 3MLVH 4APQA 5JHDE 4QHNA 2K1MA 4KUCF 1Q8MA 3NCJL 3WFZA 4ZO6A 3UROR 4NN5C 5JIPA 4JFOB 1ES0A 3GMQB 3QHFL 2R29H 4OCNC 3D0LB 1CBVL 4RCAA 2QBWA 2PYEA 4Y5VB 4TPRL 3MRRB 1XIWC 2B2XL 4HCRH 1LO0H 1DQMH 1L7TH 3PGCB 3RDTD 1ZSDA 2X4QA 1RZ7H 3P9MB 1MIMH 3TN0C 2X1OA 4CU8A 2RQ8A 3TBWA 3TFKD 1R5WA 2BY2A 5DJXB 1RUPL 4IRJC 1RD6A 5ESAB 2ZUTA 3OV6A 4JO1H 4WTZA 3EGSA 1S5HB 3MLXL 2P48B 1A9EA 3BQUA 1G9EA 1CD8A 1U8JB 2OS7A 5KJRH 4WFFE 3HR6A 2WLZA 4PJ7E 4D94A 1JRHI 4G9DB 5EOCJ 1HYRC 3CFEB 3TYGH 3MBXL 2NYYD 3QH3B 4LLMB 3QNYB 1NC4A 4KVCL 1PVHA 2Y6SC 1LDSA 2AI0L 2CKBB 2P5WA 4X6DF 1VGKB 4Q7DA 1DE4A 2F54D 1WTGT 3DV4B 4GLRH 4JO3L 3AC0A 4CMHB 5TDOB 4G6JH 5GGUB 1BFSA 3ESVF 3MODH 2AK4D 1CFQB 4KI5E 4PRPB 1JV5A 5FUZL 3IB4A 1N2RA 5IF0A 2MHAB 4HZLA 1OGAE 1XGUA 2DIAA 2VXQH 1CK0H 4Z7VE 5DRNA 1DANT 3KWWB 3CC5A 3HCVA 3V6FB 1S3KH 4HKBB 2A0LD 4U0RB 4OFDA 3D25A 4LNVA 4F15C 5HHPB 5TF1L 3WO4C 1MFAH 3WHE1 1MWAB 2XIDA 3MJ9A 2GSGA 2JJUA 3ROOA 2WIIB 1YEEL 5D1XD 5C09B 4TNWF 1YYMH 3RWHA 4ONGL 1N4XH 2QQLH 1D5BA 4P4KA 3RPKA 3WDIA 4D0BA 3TBYA 4NFCA 3MNVA 1CT8A 4G8EA 4KUZH 5LWYH 4YAQB 4XAKE 4MQSB 4GKZB 4Y19D 4NIKB 4IRSC 3QEQB 2Q7YB 3HB3C 4PJIF 4LDLB 5C2BL 2LAAA 5KSUA 1OTUC 5HYIA 4ONHA 3L9RB 1HXMA 1XF1A 3LEVL 4LSSL 5F21B 3ARDC 1SY6L 4Q58C 4YFLF 1MCIA 5CZKA 3SE9L 1QSFB 2MCPH 5ADPL 4Y1AE 2WZPD 3T0EC 1F3DJ 1M71A 5DEFB 3VDCA 5C3LD 3QIWC 3SJVA 3LOWA 3IF1B 3UPAA 3L3HA 1FFPB 4PGEB 1F4YH 1ZTXL 1MHEB 1IARB 5EOQH 4OCSL 3FO9A 2OLDA 3HAEG 1QBMH 2D7TL 3MRQB 4Z5RB 4ZQKB 1UEMA 2FEDD 5DRXB 2F5AL 2X4RA 4X7TA 5E00B 4DFHA 1E4XI 1I1YB 3BKML 5GIRB 2VLLA 1FVDB 3WV0A 3PQYB 3BEVB 3RZCA 4XPAH 2AQ1A 2FGWL 4JVPA 3L3DA 3H7BA 1LILA 3LRSB 4X8JA 1EMTH 4BZ2L 1QR1A 4HPOH 3OXSA 1U6AH 1WC7B 4JJ5A 1S9YB 1DBAH 1OB1B 5EC1A 2YD1A 5DC9B 2NY2C 4HEME 4HKZA 4AIXA 1DBKL 4OBRA 2YMXL 2JJTA 3OQ3B 3HUJE 1W0VA 3GKWL 4LKCB 4HIHB 2DQGL 4QGYA 5E9DD 5HTSA 3W39B 1KB5B 3NTCH 4Z95H 4XP4H 3MRGA 1FC2D 1AFVL 3MPCA 5ENWA 5GSVA 5EBMA 4D2NA 1SYSA 4WWKA 5CLTA 2APWA 3UYRH 3ZZ1A 4QRRA 4CVZA 5HHQB 2NY4C 4HHAB 3G9VA 4KK8D 5AD0B 3TEUA 4ZPVB 1IM3A 3OKDA 3B5TA 4NZRH 5I2IB 3UTZA 4Y16D 5D2NE 3QAZC 3ZHKA 3ZT7A 4Z7UA 5BVJB 5IGXH 3STZB 3LKQB 3OKLB 4V1DE 2JCCE 3S36X 2LU4A 4EN3A 1KUMA 2H3NA 1CGYA 4PYGA 3FFCA 4K23L 1WVZA 2OL3B 4JFZL 1KIQB 5HDLA 5DUMH 1JNLH 3DIFA 1I9JH 3D5OF 5CZVL 1I1AC 3P4OB 4HIXH 2X9YA 4NRYB 5DHXB 4OB5H 4KRPB 2DTMH 2V7NB 4JLRB 3BAEL 4H5SB 3U9PL 5J13B 3QG7H 4P5TC 1WIPA 2AV7B 2CDGB 5EIIB 4M7ZC 4XTRC 1G7LA 4DAGH 5E8PB 3BYTA 5AUMA 4PY8I 1JTTA 4XP5L 1JWUA 1DLFL 5EBWA 4X6BB 3WUWB 4LLWA 2A9ML 3WN5C 4RGOH 3DX9A 2VDML 5DK3A 4JFHE 5EUOE 1AGCB 4WHDA 3IRPX 5L9DH 3DX7A 1QSEA 1DEEB 3HMWH 2BFVH 2PR4H 4FQ1L 5IMOB 1NEZG 1UCBL 5C0NC 3S9DB 5DMKA 3P4NA 3ARPA 1EH9A 4JFYA 4QOKE 1JPGB 4NZTL 3OX8B 3MXWL 1QOKA 3RWDB 2FJHB 3FRUA 3G6DL 4PUBL 5JHDD 1AJ7H 4TUJA 1WLHA 1A21A 3PGFL 5CJXC 3OG4B 4JDVB 1RJZB 1AGDB 2NW2A 1LEGA 2J5LB 3CK0L 3WHXB 4P3CL 3ZE2F 4ETYA 4XXCA 3PIQA 4UQ3A 3MRNA 1A3RH 3DVGA 4PYHA 2IANA 4OD1L 4YDLC 3PXJA 4U6VH 1DBMH 1SMAA 5B39A 4UIKL 1BOGA 5FHBL 1N59B 2W9EH 5I75B 5DJCB 4BKLB 4IOFC 3Q5YA 3UC0L 1CFNA 3BFOA 1IGYA 3IS0X 3SE4C 5EU3A 4S1QH 3PHOA 4PLKC 1A7PL 3I6KA 4PJ8A 5E6ID 3STBA 3BEWA 1VADB 2HTLD 4NJAL 3IDJA 5DHYA 1U8NB 4K3EH 1I8MA 4WFFD 4DKFL 3BIKA 1MHPH 4L4JA 5I15L 5LKNA 2CR6A 3WJLC 1D9KD 3GBNL 1J8HA 1RULL 5ITBL 2C3GA 1LEIB 5A16B 3F65A 4O4YH 1E4KC 4GBXD 3F12A 1AXSB 1JGDB 4HZAA 3PHQA 1KEGL 4OZGE 4QF1A 1A6WH 4MXWL 5DJ8B 4WI4A 4YHYC 4PPTA 1K4DB 1E6OL 5EORH 2ARJB 4WI5A 5HYSA 4E41A 1CIDA 4KI5D 4LCWB 3HE7B 4YBHA 4BSWA 3LRSA 4APQC 3IDNA 4LKXB 4E42B 2GY5A 1OGAD 4M62L 3SDDB 4BELD 5E0QA 1IGTB 2HFFB 5K59F 1MCDA 4C55A 1LP9E 1FBIL 2W0FB 4LQFL 4NP4H 1QLEH 3BPNC 3T09A 1FFNA 4NQSB 4PJFE 3DXAE 1S7XA 4NO5A 4JM2F 3TH2T 4MVBD 3FFDB 1KB5A 3NCCB 1KEML 2F15A 3HZVB 2A38A 5HHXH 3GRWA 1A1MB 2DI7A 4GUPB 4LVHC 2HMID 3FRPG 3RJDA 4LVNC 3ZO0A 4EXKA 4XAKD 3EO0A 3MLZL 3B9EA 3BVNA 5T1KB 1MI5A 1TITA 5E99H 4PRIE 3BQUC 1OP3K 3Q6GL 4OKVB 2PW2B 1XGYL 5F7DA 5IUSA 3ZTJH 4X5XB 4QRPB 4GG6B 5SX4H 1PZUB 1HILB 2OJEB 3CDFA 1E4WH 1NCBH 3KPOA 4Y1AD 1JUFB 5D4QA 4UT6H 5CBEB 3MUJA 1CS6A 5LG1A 4Q0XH 1HHGB 4YC2B 3QPQC 1TZGH 1MFDL 4JDZA 1J0HA 2XTJC 3O6LL 1RURL 1LD9A 1HNFA 1ZEAL 2AJYL 5IB1A 3MRFB 3B8SA 3K0WA 1AD9A 4Q9RH 4I18A 2X4OB 2P5EB 3O6FD 1A14L 4G5ZH 1D5XA 1QFOA 4KQ4H 4FP8H 1OSZB 3QFJB 5ECJE 2KUTA 1R3KB 4HX1A 3LEXB 4GKSB 3UZQA 3CFKB 5I17A 5JQ6H 3QEGL 5IVXF 1R24B 3CU7A 1R0AL 4XP6H 2F53A 3CLFL 4JDVA 2X40A 2OMBA 2E5EA 2A1WH 4MXVF 4ELMA 5DUBB 4P4KC 2IFFH 3QCVL 4Y89A 4KKNA 2NX5A 3BT2H 5JHLL 1BJ1H 2VAAA 4RBPK 1PDKA 1A6AB 2C4FU 4CUCA 2MPAH 2RJMA 1EHAA 3PP3K 4XXDB 3GMOB 1RK0B 5BCAA 1A4KB 3FN0H 2XKNB 1KCRH 2F5BL 1YNKH 1EGJL 4JHWL 1OAUH 15C8L 1KLGA 1WFTA 1NDMA 4V1DD 4LARL 4QWWC 3VFUB 2QHRL 1K8IA 3BISA 3W5MA 3KHOA 2XKUA 4YHKL 2VZTA 5DK2A 4ZTOL 3FB8A 4MD0B 1KJ2A 3DROA 5IFJB 2JELH 4HW6A 2WNGA 5GJSL 3U0WL 5KSVB 1JIBA 3QO0A 3BXNA 3ZDYE 3GMRB 3HKFA 4ISVA 3VFMA 1NLBH 1YEGH 3QG6B 1LGVA 2MSPA 3L7FA 3I50L 4PJ5E 5ICZB 4H8WH 3RX8A 4QXTA 2FYYA 1OP5H 4NGHH 3T0VA 2EYRB 3FB6B 1FYTE 4MA7H 1NCDL 3RZCC 2VYRE 3VGGA 4M7KL 1BQLL 1EAJA 2B5IC 5HGDB 2YD8A 3HI6L 4FFZL 4IMLB 3CVHL 3G6JA 4LLQB 4P23A 1T7XA 5IVOA 3RTQD 4Z78A 5CBAA 2DM7A 3JZ7A 3JVGA 4U1GB 2V2XB 3HI5L 1FPTL 3D9AL 1CLCA 4QOKD 3GSQB 4HUWA 3VE0A 2JJTC 4MLSA 1LK3H 3O45B 2N4IA 2IJ0C 3WLBA 1MRDH 1IZJA 3TVMB 5IFHH 3HLAA 4UUJA 2GHWB 1XGQA 1NCUA 3P0VL 1EXUB 2WAHA 4WWKC 1P9MA 1QA9B 3DUHA 3FT4A 3RWIB 5EOTA 3BP4B 5DO2C 2RFXB 2HN7A 1MHCB 4N5UA 2IH3A 1KTLB 3M8OL 4EN3C 4XH2B 2H6PB 4Y8AA 1IJ9A 2CUMA 3DRTA 3VGHA 2H9GB 4OKVA 2H26B 1KCSH 1F4WH 3OKMB 3ROLA 3VGFA 2H32H 2C3HA 5EUKB 3I84A 1N64L 5KG9A 4HH9A 1KJ3H 3KGRA 2FATH 4BM7A 4R7DB 5IEKA 3MA9H 2EDXA 4MD4A 3H42H 1OTSC 1NGQH 1B90A 3S4SA 2MKWA 1ZHNA 2WIMA 4WI3A 1LDPL 1GHFL 5B3NA 2CDFA 1Y0LA 4YDVB 1HH9B 3IDGA 5GGVL 4P57B 1UXWA 2VL5B 3AS0A 3BE1H 2VH5L 3TT3H 2Z92A 3F7PC 6CGTA 3DUSA 1BIIA 1JRHL 2BVYA 3QUYC 4AG4L 4PJHF 3D3VB 1I1RA 2ICCA 3N0PB 3NFNA 2Q86B 1EUTA 5I6XC 3HS0A 3EO1B 1NFIB 3GSNL 3SY0B 3MC0A 1OSZA 2H2PD 4PIRF 3MR9A 1JHTB 1T21B 5DD3H 3SDCB 1S7VB 1HXYB 2AXFA 3LS4H 3LS5H 1G7QB 1LNUB 1TQCB 4M1CD 1RMFH 1OF2B 4JHAL 2CR3A 3JTSA 5DDHB 4NZUL 4KKAC 1T7VA 4XXCC 3O2DH 4IIQB 4HUNB 2W9LA 1X5YA 2QKIA 3DXAD 2ZCHL 4KKBD 2AK1H 1O7VA 5IMLA 2EEBA 1N0XH 2JIXD 4M6OL 1OLLA 1JI2A 2ENYA 2NR6D 4NKIH 5IQ7H 4X9IA 2R0ZH 5IFAH 3G5XA 4FZ8H 3DGGB 5HHMB 1URLA 2FJGA 5TQ2H 1CZ8L 4N68A 1MVUA 1GAFL 5K9QG 2XY1A 4OZIE 4OAWA 2YUXA 2A74A 4PJ8C 1XGTB 2ICWJ 3OB0H 2ZG1A 4LNRB 4UQ2B 3V5KB 4BK5A 2KQMA 4WHTB 3NCYS 4PJGA 1U92A 4LPWA 1BQHG 1K8DB 4QHUA 4A2MA 1J10A 1EERB 4DUWA 5JZ7C 2GT9A 2A6IA 2VLJE 1I7RA 2BVOB 3MA7B 3MUY1 4P9ML 1AC6A 3TCLB 4KDTA 5E1AB 1D5MB 5CEZE 2Z91A 1FZOA 5EDXA 1KIPB 3UYPA 4XCYB 3SCMB 3HRZB 1UJ3A 1HCVA 1XR9B 2YD9A 1F90H 3D85A 2FSEA 1J1XL 1KNOA 1AQDB 5C0JA 2GUOA 1UKQA 3CLEL 3LD8C 1A6UL 3S37X 3RY6C 2BHZA 2XWTB 4QNPF 3MREB 2XN9B 5I1DB 3BMWA 3MZTA 5CSZA 3OAYH 1T66C 1RZGB 4PJBB 4CVXB 6FABH 2IALB 4M5ZL 3VH8G 1I3GH 5DD6A 3SKOA 1EJOH 1BVLB 1Q1JL 1CLZH 1Z3GL 3S97C 5I18H 3PDOB 2X05A 4U1NB 1S7WB 1X5JA 3BN9D 1EAPB 1DJSA 4C56E 1IL1B 1FG2B 5HVGB 2UY6A 1UWEH 2Y5EA 5IJVA 4EDXB 2C3VA 4PBXA 4MD5B 4BFEA 3MOBL 3BP6A 3ZHDA 4EEEA 4LLVA 1XAUA 2VTFA 4UDTB 4LCCB 1V3MA 3VWJC 4YDKH 4UOJA 1CU4L 1JPSH 1QYGH 4X6DA 4YHPB 5F7MC 4EJ1C 1I7ZB 3T65B 3LH2H 3NOIA 3TO4A 3HZYB 2WBJD 3QISA 3BW9A 1M6OB 1UB5A 2IGFL 2IQ9L 1AGFB 2X1PA 5KTEL 4OCXL 2NY0B 4PJDF 5HHOD 3RGVD 1VACA 2I27N 1AD0A 1RZ8B 4HQQH 1FNLA 1FO0A 2CGRL 3L3GB 5TPWL 3SDYL 4WNQA 2A73A 4JRXB 3CNKA 3BZFA 3H3KA 5I1GL 4EI5D 2WWMC 2FX7L 5CSGA 3GHEL 4XRCA 4DEPB 3NPSC 2XQBL 4HPYL 2FB4L 4U3XA 4I18C 1ZHBA 1FYTD 4C83B 4YXLL 4L8BB 2GFBA 2G60L 1MPAH 1OQOA 2ZOLB 3RX5A 3W11D 3UTPE 3WHE0 4POYA 1WBXB 4HWEL 4NO2B 4JN1H 2IADB 4HDIB 4LOUC 1R3LA 1ONQB 4XVSH 2D4FA 4GFTB 1E28B 5EZIL 3B6SB 1IBGL 3IETA 5HGGS 3FQXB 4U6XB 3AU1A 3P0YL 3QYCA 3RUGF 3U7YL 5C0AB 4PJ9A 2WINB 2ICEA 5I1HH 1LNUA 3ZTJG 1FZJB 4PJIA 3IGAA 4JGUA 4TSAL 3KPQA 2IEPA 4OLVH 2JE8A 1P7KA 1YEFL 4O02L 3F7VB 1OAZL 2RCSL 1VFAB 2DIBA 3MOAH 2ICWA 1JFQH 1I7UA 1M05A 5F6HJ 2LU3A 2DLEA 4NJ9L 2JK5B 4JFEA 4Y0GA 4DTGH 2AQ3A 5EULV 4GKOA 4NQVA 2D9QB 3BGMA 2DLFH 5CLWA 3LDBB 3GK8L 3JV4B 4LHUG 5CIPB 5IB4B 4LLDB 3M1BB 3DMMA 4RRPG 5B4MC 2BVPB 3H3PL 1A7QL 1JTPA 2DAVA 4FQJH 4OJFL 4GAJH 3ZDXE 1U95B 1FNGB 2DJUA 2DYPA 5DMJB 3H9SA 3ZDZE 4X6EB 5ISZA 3I6LE 3NACH 3ARGC 5C92A 1I4FA 4POUB 3EHBC 5EU4B 3GMNB 2OTWB 4WCYL 1HYSD 2NXZC 1FDLH 3N1FC 1G9ML 3GIVB 5HI4C 1BFVH 4ZUTA 1CXKA 2DQIL 5DS8A 5K93A 2NLJB 1INQB 2IPTH 3QQ9D 3NVQA 1NC2B 3FB7B 2W9DL 3MJ7A 4P23C 2RR3A 4Z6AT 5D7IE 3QNZA 4JRYB 1UZ8A 3T1FA 5FCUL 1TJGL 2R23A 3ZKMC 2RHEA 2IFGA 2P7TB 3IFLL 3THMH 5JXAH 5IBLC 3WFCL 4X6CF 4MA1B 5FFLA 3ZHLA 2BSED 5T1MA 2X09A 4R90H 1J0YA 4DCQB 1XFPA 1UC6A 3LQAC 2ZJSH 1DANU 3EYUH 4GRLA 3P2TA 1G9NL 1CDUA 4HGWB 4PJEF 3U4EA 4PG9B 5BV7B 5MP6L 3QUXB 4NRXA 3MLYH 1R3HB 1P9MC 5HDOA 3WXWL 3FAWA 1BLNA 1FG2A 3FO2B 1U8QB 4TUOB 4MJ5A 4JAMB 3RAJH 5CUSH 1F6AA 5KZCD 4HXAH 4MA8L 4FQLL 1YNTA 1HHJB 2YC1B 5FO7A 1YEHL 4UOW1 4E5XB 1FVEB 2HTKD 2F74B 4PGZA 2C3XA 3WS3B 5I1IL 3ARWA 1A6VH 5CJOL 3O3DA 4L9LB 2ADFL 4PRHA 3S5LB 1QFWI 3TA3A 2P24B 3V0VB 1U8OA 4RWHA 2YN3A 4R3SA 4BH8B 3UPCA 5CKAA 4NPYB 1J1PL 4NKOB 3SGEI 2BOCA 4OZFA 4U1HB 5LXGL 2BY0A 5FF6B 2C26A 1NBZB 1F3JB 1AGFA 2D31A 2EKJA 5DQ9A 5C9JB 1TTFA 3M45A 1MF2L 1IEAA 1K2DA 3BH8B 4ZOAA 4M8QA 4LSPH 3X3GL 3DX6A 2VLJD 5J3HC 4AEHL 5HHNA 1RIVH 2R56H 4XMKL 4G8GB 1UT9A 3VXUE 4BQCA 3EDEA 4GAFB 5JPMA 4JJHA 2P43B 2BRRL 4IM8A 4N8CH 2YD3A 1KXVC 5F97E 1QLFA 3MV8E 4NYLA 2R15A 4OD3H 1LE5A 1MCPL 3IVKA 3QZWA 3QULA 4Y4KA 3TV3H 4HGMA 5GJTL 5HI5C 1MCFA 1UG9A 1MJ8L 1C5BL 3K80A 2W38A 4MS8D 4OLUL 3B3IB 2DQJH 2IPKA 1MCQA 3SKMB 1IQDB 1E6JH 5CCKL 2VB5A 3OB8A 3TJEL 5JR1L 2R0WH 1YECH 3FMGH 3FOLB 2VR5A 3QUZB 1XF4A 2G75A 2Y1VA 4OZ4A 4LAQH 1DVFA 3QIUB 2XOTA 4R4FL 1EZVY 4MSWA 3H8NA 3MUHL 1WGOA 4DN4H 3L3JA 1JMXA 4NM4L 4A6YA 5IHZB 2OK0H 3CAFA 4GMSL 3UTTB 2ORBH 1L9MA 1NFDF 3HG1B 2EH7H 4GAGH 2WUBL 4K8RL 1G7MA 4QLRA 2JF1A 4HC1H 1AGBB 1LO2L 3LKOB 1A2YA 4MHHG 3MRCB 1MEXL 5D93B 5CAYB 1XF5B 2YA2A 1DCLA 3QQ3B 4HH8A 5D7LE 3UTSE 5GS0C 4ENEC 5IESL 5T3ZH 2E7LA 5KSAB 3DUUA 1YEKH 5T1DH 1EO5A 5CZXC 4FZEL 5FHAL 1YMMB 3OF6D 5DD1H 5IVZB 3TBVA 4KDTC 3A0OA 3DBXB 3IKCA 4ZD3H 3VXTA 1K4CB 1NUGA 5HYJA 3ES6A 3HN3A 1FL3A 1H3GA 1UJ3C 1GGIH 1KLFA 5JW4N 5I8CA 3ULVL 4I2XA 2J6EH 3RPIB 1P84K 5K9JL 3MV7E 1U2CA 3QDME 5HPOA 1AXTH 2APFA 3FQWA 3OKOB 4FOMA 4JM2A 1AKJD 1C12B 1GL4B 3TC9A 1IC1A 4YUEH 3UTPD 3DTXB 2B4CL 4CL7A 3P30H 4NQCE 3L3KA 5GGSB 4N0UE 4BFBD 4KVNL 2ZUQB 4X98A 4TRPH 1OL0A 4GO6B 4G8IB 2CLRB 4PJXE 2XRAH 3LN5B 2NY5C 1OAXH 3DYMA 3I9GH 4CMMB 35C8L 1A6ZA 4YWGH 5J6HA 1PGRB 2FBJH 4BH7A 1VFBB 1ZVHA 5MENB 3L5WB 4OQ1A 5D1ZA 1NJ9A 1N5YL 5DZLA 1RZJL 4HXBL 3LZFH 1GRWA 5LAXB 1AY1H 1DUYB 3KYKH 5GRYA 1BF8A 3V5HA 1ZT7A 1Q9LB 1KENH 1ORSA 1JZ4A 4G80A 1B0GB 3BKCL 2B7DT 2DWDA 1IGCL 3K81A 4IRJD 3L6FB 2ZCKL 5EIQA 3TO4C 1UWGH 4YO0A 2NNAB 3RI5F 2HG5B 5FKAA 2BNRB 2O26U 2DLHA 1A7NL 3S34L 3VGDA 4AIZA 5E2JA 1A9BA 4G9FE 5JUEL 4GOSA 4XP9H 2FO1A 4N0FA 1TPXB 5GZOD 4MJ4A 1FN4A 3I6LD 2F54B 3RNQB 3IJHA 2ADIA 2IBZY 4U31A 5LQBL 4HT1L 1FGNH 5FA3B 1T89A 5ANME 3UPRA 3MJ9H 5FYLL 4N8VG 3TNNB 3BDYL 5IVXA 2DQTL 3NPZB 3KPLA 4JPVL 1DQJB 5A3IC 4NQED 4PTUA 2E7BA 4MX7B 5EOCL 5F1IB 3NCJH 1UM4L 3G6AA 2FD6L 5C6TL 3QHFH 3Q6FB 4PJ9C 3FO0H 1SJVA 3LKPA 1CBVH 2MFNA 3RVWC 4KY1L 5D6DA 3W0WA 4U1IA 4X0KB 3SDAA 2B2XH 5L8KB 1T5XA 1RY7B 3FQRA 3VRJA 2PYEE 3LRHA 1C08A 4OGYL 3TPKA 3V5DB 2DS4A 4ZS6D 1J18A 2EE2A 3IDIB 4ZUSB 4HIIB 1IAOA 4MQ7B 1RUPH 3QNXA 4RAVA 4X8XA 3MLPA 2CKBL 4HK0A 4O5LL 2PXYD 2R9HD 2Q8BL 2NXYD 4N1HB 3BP5B 1QO3A 5D6CB 1I3RA 4P2QD 3HB3D 4F9LA 3DMMC 3HAEB 4Q9BA 1YDPB 1BD2E 5JIKA 1PLGH 3MBXH 2HT2D 1YQ2A 5KVEL 1UM5L 4G3YL 3FAXA 2BVEA 2IH1A 4MNGB 2ICWI 4HG4K 4O2CB 3RWFA 2AI0H 1JI1A 1M7IA 1W0WA 4OLZL 4JO3H 3MV11 3ARVA 3U0PB 2P5WE 3GGWA 3H6JA 4GJTB 4PP1C 5C0CB 2PO6B 5KAQF 1G7PA 4I4WA 1RIUL 2WP3T 3C8DA 4GW4B 4JPWL 2R1YB 1F11A 2XTJE 1MWAL 1IM9B 4PBVC 5FUZH 3RHWK 5B3JF 2A6DB 2VDQL 2VWEC 1EO7A 2C7UB 2HVKB 3VXRA 3NZ8A 5ESVB 1FH5L 2C1PA 4QEGA 4F7PA 3JTTB 1NL0L 1T0MA 3MV8D 3HPJA 2A6JB 2ZWLT 3O2WL 5TF1H 5C2UB 3AMKA 2A77H 2YPVL 4F3FB 3VI4F 1PYWB 2BNQA 4B5EA 1YEEH 2Y4SA 1W72B 4GRLC 5IW6B 4OCWL 5DEZA 5A40E 5FOJA 3VDAA 3AREB 2OX5A 5JOFB 1WSST 1CGTA 3T2NH 4PV8B 5CS7A 1MRFL 4U3HA 1NBYA 5IEHA 1M7DB 4YHOL 3D6GA 1QLRB 4YXHL 5E8NA 2FLRT 5C2BH 3VXOB 3MMEA 3RL2A 1BP3B 1PG7L 4D0CB 4BZ1L 2NY3D 1UZ6F 3LEVH 3RWEB 4LSSH 1Z6JT 1B0WA 4MJ6B 1SY6H 3TA3C 4XNXL 5L7XH 3PGDB 1G0XA 5DQDH 3S6CA 1Q9LA 1J8KA 5I19L 1CN4A 4MCYB 1VKXA 4UIMA 1HQRA 3VMNA 4TSCH 1TETL 3WDHA 1U93B 5F89A 4BSVA 3KYOA 1ZTXH 2FIKA 4JFFB 5D7LD 5EG6C 2EDFA 5E7FA 3UTSD 5A2IH 3SJVE 2VZVA 4OCSH 4NWUL 1B3JA 4OFIA 2QSQA 2BXYA 1U3YA 2D7TH 4KKLD 4PJHA 2DQFB 5GS1B 5HGAA 1NEZB 1T6WA 3BKMH 3KS0J 5E6YA 2XTLA 4L8DA 1IEBB 3QWRD 5FB8A 3ZKSD 4B7IA 1BZ9A 2UVEA 3QHZL 3WNMA 4LLYB 5J1SC 4BZ2H 4YPGA 3EYFB 5HY9B 5FGCB 3KDMB 2X9XA 4Y4KC 4FFVC 4XCEB 4CN4A 1DBKH 4Y4FB 2BSSB 5JA8B 2YMXH 3LSOB 2VXUL 4YZFF 2DKUA 3ZKXB 3GNMH 4S2SA 4P2OA 3O11A 3GKWH 3SN6N 1NANI 2DQGH 3HE6A 43CAA 3H2WA 4NQCD 4XVUC 5BXFB 1RFDH 1AFVH 3MRDB 1T1XA 2OL3L 1RZFL 1EBAA 1KLUA 3V5DA 5AYUL 1DVFC 3BIAX 1P1ZB 4FNLH 5H8DA 3V6OA 2XXMB 1N6UA 3O3AB 1HWHB 4QRRE 4QTHA 5DWUL 4XWGH 3QIBB 1G9NC 5IBTH 1CICA 3EYQD 3ESUF 1CQYA 5F6HI 4Z7UE 3EZJB 1FL5A 4OCMC 4K23H 2DQCH 1G1YA 5IIEB 4TOYL 3BWAA 2YN5A 1VDGA 4NKDB 3FFCE 3BPOB 2Y06L 1YDPA 5CD3A 1QBLL 2CK2A 1NQBA 3BAEH 3I02B 4Z7OE 4PLKD 4LCYA 4ALAL 2E7LC 4GS7B 3PNWA 3VDBA 4PJCF 5AZ2L 5DT1L 1IAMA 1A3QA 3OG6B 4F7MA 4R96A 1H0DA 3AGVA 1IGIL 4XP5H 1DN2A 2W65A 5DRZA 4PV9A 5KVGL 1S7TA 4G9FD 2A9MH 1X5HA 4I5BA 1CGXA 3KLAA 2VDMH 2DMKA 2EH8L 2XT1B 3KR3H 4OBSA 1A64A 4NT6B 5EZLA 4D9RE 5JLZB 1C16A 3EYSL 4JREC 5HYQA 4UAOB 4NN6C 4FQ1H 5KANG 5F7NC 1UCBH 1RZIA 3F58L 1KC5L 2AJXL 3MGAA 5C71A 3L95A 3L1OL 4JM2C 3S96B 3BO8B 4NZTH 5KOVC 3HZKA 3MXWH 1OT1A 4U1SA 3G6DH 4D9LL 1TTUA 4X5LA 4PUBH 1LE9A 4HKJB 3EOBA 5E5MB 3RIFF 3PGFH 2A6JA 4Z7VB 3R1GL 1X3DA 3ME0A 3BZ4B 2A2QT 4HUXB 3CK0H 3H9YA 4DGIL 4EUPB 4P3CH 4XZUA 1YEJL 3QWOB 1JF6A 3OKNA 4H1LA 1MY7A 3IXAA 1RK1B 3WSQL 1T7ZA 4WO4D 4OD1H 5DC0A 4BFIB 1PX3A 5C09E 4UIKH 1ODAA 4F33A 2PYED 5FHBH 3VFWB 3IU3A 1F6LL 5D1ZC 3LKNA 2IANE 3TYFB 3UC0H 3QDGD 3ABZA 3GBML 3TNMA 3NCEB 1J88A 4L4TA 4EI6A 3KJ6H 1F2QA 4PJDA 1NDGB 1ZHLA 3T1WA 2YPLB 4NQDA 3QDJA 2W0PA 2CLVA 1VGEL 2OM5A 4DKFH 1T22B 4R7NB 3ARFA 3OZ9L 5I15H 5C0DA 1U36A 1HIMH 2NY1D 1HSAB 4PTTA 4XAWL 5DSCA 1AHWC 4D8PB 1QRNA 3GBNH 1BD2D 1RULH 4PGCB 5ITBH 3NH7L 4HFWB 5LBSH 4XCFL 3FB5A 1G6RB 4Y1AB 3TBTB 3CUPA 1J8HE 5CKGA 2NY6D 2R2EB 2XWJA 3RVVD 4P3DB 3BUYA 4NKMA 4YPJA 1AIFB 4MXWH 5MEQA 1QFWL 1V5JA 1T89C 3QJHA 1E6OH 4ZFZB 3K8MA 5DR5L 2XYCA 3RUGA 3HI1B 2ZSWB 3FZUC 3UTQA 2GITA 1F97A 4Q2ZA 4XNQA 5C0FA 3ZE1E 3O9WD 4AMKL 4M62H 4E41E 5INCB 4IJ3B 4DOHE 1BVKB 2ARWA 4Q6YA 1CLYL 1FBIH 3TZVA 3EYVA 4OGZA 4HMCA 2PTTB 4LQFH 3BP7A 1KT2A 5D6DC 4EKXA 3SDAC 2Y36L 1JF5A 1XR8A 3S36L 1KEMH 4UU9B 4C59B 3A67H 4OLXL 4S1SL 3WKMH 2E9BA 3EJZD 5CSBA 4NWTL 3T4AB 5I1KL 3GM0A 3C6SB 2B1AH 5FK9B 3RVTC 1DSFL 4UNTA 3CGTA 3HUJB 4DQOL 1FV1B 5GRWA 4ZAKA 3ULVD 3O3AA 1H3VA 3MLZH 3WIHA 4WUUA 2X10A 5FA4B 3K2UH 4P4KD 1EFQA 4U1MA 3Q6GH 4IMKA 1XGYH 5ERWA 1MLBA 4FG6C 3MBED 4WV1B 5E2VL 5D2NB 2DMBA 4F9LC 1I8KB 2CQVA 2VQ1B 4RFEB 4V1DB 1XF3B 1AO7A 2L7UA 3HNTL 3G5ZA 3QI9A 3RNKA 4GT7A 2A6KB 3KPMA 3U83A 2VL4A 2CIIB 2VLKB 5HI3D 1MFDH 3OAUL 3ZYOA 1RURH 1T1WB 4Z8FH 1ZEAH 4NUJA 4KH2A 2AJYH 4X6CA 4ZFFA 3LQAH 1A14H 2ZUXA 4H0GA 4P3WA 3C5ZD 2DI8A 2CDEB 3P40A 4Y2DA 2J4WL 4PJEA 5I1LB 3PP4L 3MV01 1HOCA 3FTGB 2AJVL 3BGFB 1NKRA 2WLYA 3QEGH 3PWPB 2X4SB 2X5PA 1R0AH 4WU7B 3FRPA 1JK8B 4YHIB 5ETUB 2HJKA 4QOKB 3QXUA 2IQAA 5C0BD 3CZJA 4ERSL 2R8SL 3RY4A 5FGBA 2F53E 4J1UA 4OZHF 3W5NA 4UOW0 5E8OA 3OAYK 5D5MF 4BUGA 5ICXA 1JVKA 2EC8A 4F7CA 5B8CB 4WHCA 3MCG1 5SWZB 3MJGX 3CFDA 5FYLD 3JUYA 4ZFOA 3ULSB 4I9WD 1I1CA 4O51B 1U8PA 3MZGB 1EGJH 3SE8L 4JHWH 4QRRD 4LSTL 15C8H 1WFOA 4LARH 2QHRH 1FFRA 1KOAA 3HNVH 4IDLA 1P84J 1QNZL 3T77B 2QEJA 4GW1B 4ZTOH 3BD3A 2R0LL 3FT2B 1CDJA 4B41A 5B38G 5GJSH 5I16A 4QRSA 3U0WH 1I8IA 4R7NA 1X5KA 4RZCA 2VDLL 5F9WB 5SWSA 2DJ4A 3NZHL 4LLUA 3FFCD 4OUUB 1Z5LA 1BBJB 1XGPB 3TT1H 5DJDA 1KN2L 4U7KA 4XCNB 3I50H 2PETA 1T4KB 3TBTA 5J57B 1S9XA 4FTVA 3BDXA 1UYWL 1NCDH 1YJDC 1YMHB 1OTSD 4M7KH 3RP1A 1BQLH 2DQEL 3T2QA 3M17B 3VFVB 1KPVA 5C7XL 3HI6H 4FFZH 3CVHH 4PGBA 4OZGB 4D9RD 5BOPA 1RHHB 1N3NA 1DBJL 1S7RB 3QEUA 5T1LB 4XPFH 5TDPA 5HDBF 3STLA 4P2CG 3G6JE 1JGEB 3NIDF 4JG1L 3HI5H 4DVRL 1FPTH 3D9AH 3VGAB 1ND0A 3LV3B 1Q9KA 4OCYL 2CXKA 4FQHB 4P2OC 3HE6C 1UH3A 4QHMA 3CFIC 4PB0L 4YBLC 2ZZUT 4EQ3A 3DRQB 5CINL 3MRPB 2VABA 1NFDA 2HFGL 3P0VH 2ADJB 4I0PB 2I9LB 4UU9A 5F9AC 1JGUH 3WFEL 4J3VA 3V6OC 3L3IA 4PJFB 5HJ3B 3LN4B 4FABL 2UZIL 4KKAD 5GS0H 1OGTA 2B8OT 5C09D 1CICC 2Q76B 4J2XA 3HPLB 1BQHB 2DBJA 4ZG1A 3U9UB 2DRUA 1OLZA 5DJAB 4WV1A 4HKXB 3QEQD 1P4LA 4DWHA 3EDFA 1N64H 4KJYB 5D7JA 4PRIB 2VLMD 2R1WB 4CBPA 4Z7NF 4PJ8D 2HFEA 1TZHB 4RNRB 2D3VA 2QR0B 3NN8B 1LDPH 1GHFH 3KLDA 1CE1L 1CIUA 2CO7B 4I3RL 4GMTL 1S9VB 4NHUB 1FJ1B 1QSFD 5B39G 5K9OA 2EDBA 2JTDA 2VH5H 4KPHH 3ALPA 3SDXF 4QRTB 2XZAL 1KPRA 1UA6L 5FGRA 5IBUG 1SJEB 3VXQA 1JN6A 1JL8A 3GMPB 1TVDA 3GSNH 3VH8B 1HHIA 2P4AB 5I0ZA 2NY5H 4MA3B 2NTFB 5BZWA 2P5EE 3PQYD 1Q38A 2YUWA 2X1WL 1JPFB 2K7PA 2EIBA 5KSBB 4E41D 3CDGB 4JHAH 3P77A 3MV9B 3KXFB 2V5RA 4CJ1A 1JHKL 3VWKB 4NZUH 3MRHB 4HG4J 2V2TA 2ESVA 4ZOEA 4U6YA 3L3OB 3UJTL 2ZCHH 4UB0H 1T66D 3QO1B 1K5NA 2FHBA 4M6OH 4F7EA 3G5VA 3DGCR 4HS8L 5HYSG 2VE6B 1EPFA 2DMCA 3FQUB 3P4MB 4KI1A 4DGVL 3ULSA 4K55A 1GAFH 3B9KA 2VQUA 5CJ5A 1SBBA 3BJLA 4K7PY 4GW5A 2B1HL 3N9GL 2VZOA 1L9NA 3DARA 3SQBA 5AWNH 3HRPA 1ZLUH 2VOTA 3ARFC 4LF3B 3ZSTA 3R8BB 2E9WA 4Q6IA 3KNBB 3QT2A 2WBJB 5HPMA 4PJGE 1QQDB 3U30B 4KV5F 3VFRB 2UY7A 5CJQH 3T4YB 3X11B 1ZA3B 4P9MH 2FO4A 1FNAA 2VERN 1JPST 1ED3B 5GISL 4MJ2A 5EN2A 5JIIA 2X70A 2OP4L 1NCTA 5J11C 5C3TA 1YNLL 2HH0L 1OTTD 4M02A 1J1XH 3WL9B 3VD4A 2ZPKL 4PJ5B 4CW1A 3MFGB 4KJWD 2FJFB 3CDYA 3CLEH 4LVOC 1A6UH 5HHVH 2UZXB 5IV2B 1FYTB 2BK8A 4WJ5A 4OCLC 1CL7I 4PRNB 2V2WB 4LRNH 3TZVC 4M5ZH 4YQXL 2BHYA 1U41A 2ERJC 3DURB 1T2QL 4XB8A 1CXFA 1HHHA 1U8KB 5LVEA 3U6RA 4XBGB 2CLZB 1IAKB 1OQXA 3DETC 4NBZB 3WIFA 4ZUWA 4JPIA 2XWBA 2SEBB 4QXWA 3IFOB 2L0DA 2PYFA 2APBA 4LHUB 1P7QA 3C8HA 1RUQH 2X4NB 4ZAKC 3MOBH 1GZQB 3ET9F 2FHFA 4X9FA 4L3EA 1LQSR 1QHPA 4FXGB 5EIVA 2OXGA 1X44A 1J87A 4M43L 4YR6A 1MUJA 2EDJA 5TDNB 1CU4H 3VFSA 1AI1L 3VFGL 3AS1A 1Y6KR 4X7CC 1WUNT 1UVQB 1J05A 3HC4L 3AXLA 3QJFB 1YN7B 3EOYG 4R8WL 2ED9A 1FSKC 4UBDD 1JCKA 1UEYA 3NAAH 2IGFH 2IQ9H 3QI9C 5KTEH 2HJFB 4E0RA 4OCXH 3GB7A 3IFNL 1FORL 3D1MC 1KFAL 1ZT4B 4LHQB 3BOVA 4QRUA 4QYOA 3QRFM 3VFNA 4NQXB 5EH1A 2CGRH 3MRKB 4XMPL 4NHUA 4H26A 1WJ3A 4XI5D 1DL7H 5GGTL 2OXHA 3WMSA 4PJ7F 1HI6A 5J9PB 2FX7H 3SGKA 3GHEH 4YBQD 4OFVA 2VR4A 5JW3L 2XQBH 3MYJA 4HPYH 4HF5L 3ZSSA 1WT5A 2D2OA 2G60H 3CPLA 2BC4B 4HWBL 4HWEH 1ADQL 4Y2DC 5F96L 3V6ZB 3ARBB 1BGXL 4G6ML 3AB0B 5EZIH 3D3VE 1BJ1J 4KJPC 1IBGH 4JQIH 4OD2B 3WNPA 1BMGA 3P0YH 4AQ1B 1HEZA 4GRMA 4LAJH 5EU7C 3U7YH 4RIRA 4P23D 4WW1B 1T04A 4FQQA 4TSAH 4LCWD 3HE7D 3INUL 1KTDA 1OWWA 4H0HB 1YEFH 3LPGA 4O02H 4KTDH 2RCSH 3BSZL 5FGBC 2HKFL 4JANB 4PJIE 5IBLD 2D0GA 4J3OC 4WU5B 1IKFL 2Z31A 3DVNB 3IFPB 5J6GB 2Q6WB 4YNYA 4NJ9H 5ID1A 5T5FH 3WNOA 3GDBA 4DUXA 3LHPL 2Y7QA 4OZFH 1HHKB 2X41A 2H8PA 1KBGL 3O8XA 3QCTH 4K3GA 3GK8H 4OF8A 2P47B 1R5VA 4Y8DC 1IGJA 5JPNB 1CXHA 3DWTA 3MCKA 5FKPB 3H3PH 5D71L 5E56A 5JO5A 1DBBH 1A7QH 2BMKB 4OJFH 5TGBB 1PAMA 1FIGL 4UNUA 3MRIA 4NM8L 3ALXA 4Z76B 4OZIB 1LK2A 3B2VL 5MEOB 4PP2B 2M2DA 4QRPD 1EEUA 2J8UF 4U7SA 2E8ZA 3H9SE 5L2JA 1KTKE 4OQTL 4WCYH 2DLGA 5K33A 5IMKA 1G9MH 3R4DA 4LP4A 4V2BA 4DZBA 2DQIH 3VFOA 4ONFH 3I3DA 5C0GA 5F9JB 4WENB 2QADC 5D1QA 2W9DH 2GSIB 5IKCB 1KPUA 1H15B 5BV7L 2KQNA 3OGCA 2VWEE 2FWOB 2B39A 1TJGH 3P9LB 5FCUH 3U1SL 4X4XB 4MWFA 1U3HB 3EFDL 5DTFB 1U58A 3IFLH 2H32B 4P46A 3WFCH 4ODXB 5DHVH 3GSWA 4FFWC 1BWMA 1NAKL 2I24N 3S4SG 2Y5TA 1G7IB 4OF5A 5IB5A 2P5ED 3X14B 4A6YH 1RJCA 1U8HB 4K9EL 1G9NH 1A5FL 2V5SA 3QFJD 1SBSL 1NUFA 3WNKA 5MP6H 4AIOA 3WS6A 4MDIB 3VXSA 3WXWH 2M26A 3UEZA 1TQBC 5EFIB 5C0IB 5IWLA 4LLAA 4M03A 3JWDL 3D0VB 1ETZA 4JZOB 4MA8H 5C0RL 4X7SL 1YEHH 4RRPA 2EE9A 5EBGA 43C9A 3GZKA 3TIDA 4C56B 5J1TC 5I1IH 5CJOH 4J8RA 5FO8B 5F88B 3DYPA 3K2MC 4S1RH 5DVMA 2CRMA 4PJCA 1A1OA 1FE8L 1NMBL 3T8XB 3TO2B 4OT1H 4OLWH 1NGYA 4PRHE 2VZUA 3JBG7 4XCCH 4GLRI 3EJYC 1BFTA 5D7JC 1FG9C 3VD5A 5LXGH 3MRMA 3I3BA 4URTB 2DKMA 2UVFA 3G04B 4IRZL 2OR9L 5GQBA 1YPZF 5KOMC 3MGTA 4UMGA 2X42A 1EO8L 1MF2H 2GAZB 3P11L 2JCCF 4G43A 4ZPTB 5E2WL 3E3QC 1KIRA 3X3GH 4M3KB 1IEHA 2EXYD 4IS6B 3P73B 4K2UL 3WIIL 4JVUA 4ZODA 4XMKH 4G6AC 2H2SD 4G42B 3E1F1 4R97C 3CSYB 4JZJB 2BRRH 2BJML 4U1JA 2XZQL 4Q74A 1MCKA 1FAKT 3QUMB 4NUGL 5GJTH 5AZEL 2D0FA 5L2KA 4DVBB 1MJ8H 3IDMB 3D85D 1AKJB 3D69A 1U42A 3IJYB 4XNUL 1CG9B 1C5BH 1FL6B 1GGUA 1HDMA 1DQQB 1L6XA 4OLUH 4JY4B 3EW3B 5CCKH 1QBAA 2G9HA 5EUOF 4ORGA 5GSRA 3TJEH 3ZL4L 3B4NA 5EPMB 3SPVB 5JR1H 1YY9D 5IW1A 3OR7A 2QQKL 5KN5B 4R4FH 1BWWA 1A6PA 2XA8L 4HS6B 3D2UA 4NN5B 1I1FA 5J6GA 3O2VH 3R06B 4QCIA 4LFHD 1I9IL 3MFFA 2E7MA 3VMPA 4GMSH 2IBGA 2OSLA 4XGZB 4D0DB 1T1ZA 3OL2A 1ROWA 4K8RH 5F9DC 3V7MA 3B9KC 1XIWB 1LO2H 4PLJC 1EVTC 3U2SB 2XPGA 2DM4A 3FQNB 1MEXH 5D72H 4J3XA 3TN0B 3SHSA 1T1YB 1U91B 3DHJA 4DN3L 3DOSA 2ZCLL 4IRJB 5IESH 1C5DB 1YN6B 4Q6IC 3O41B 2BHUA 3IJSA 3CSGA 4FZEH 3GSXA 5EO0A 5LGJB 3E2HC 4X4MA 3CXHK 4PR5B 4M8VA 4AEFA 1XF2A 4N8VB 4LEXL 2IPUG 4WEMB 3DLQR 4DK3A 4ZUUA 5E4EC 3IYLW 4FQIL 3ULVH 3L5XL 1ITBB 3PG2A 5DQJB 2G5BB 5EO9A 1VESA 5HYJE 5K9JH 1X7QB 4MXQD 1BX2A 4KROC 3O6KL 4K71C 5K59E 1CE6A 3EBAA 5CP3H 4XPTH 3MRBA 5JQHC 5EC2B 4CN6A 1PZ5B 4PRAA 4LQ1A 2B4CH 4XPBL 5E8EB 2E6QA 5D2LF 4JRYE 2YEZB 3D3VD 1WCBA 1GGBL 3B5GA 4OSUL 5D7IB 5H2BB 3FT3B 3K4ZA 1B4RA 1CVRA 2YPKB 5DJ0B 35C8H 3PL6A 3WLWC 1HH6B 5F3HB 3VXMA 3SDCD 1ZVSA 1FVCA 3AS3A 1RUKL 3UYOD 4F15B 2BVQA 4MB4A 3WO4B 1N5YH 1RZJH 4J4PD 4HXBH 4MNQA 2ATKB 3VXPA 4E9LA 1MAJA 1BVZA 1LP9F 4L3AA 2R4RL 5DJ6B 4ZO7A 2XACC 4RGNC 3U46B 5FO9B 3BKCH 3O6MH 2Z8RA 2ZCKH 2CRIA 1JWMA 1QD0A 4IRSB 3PWNA 3ARTA 2HLFC 1ZWIA 5BRZA 1A7NH 3D39A 2E6JA 5LGHL 1L0QA 4S11A 3W9EA 5K9QI 2X4PA 5JUEH 1PX4A 1FZKB 1U8MA 3ARDB 4OGXH 1T5WA 3O2DA 3RQ3A 3MLUL 3OR6A 3L5JA 2GJ6A 3OXRA 4HT1H 4Z7WF 5LQBH 2DYPD 1TLKA 5D96C 3T0EB 3SGKC 12E8L 4HLZH 3QIWB 3KYAA 5CEXA 2K9UA 2GCYB 1QVOB 1LWRA 3ARYA 4JFXB 5FYLH 2BSTA 2DQTH 2VKXA 1FFOB 1WT5C 2XZZA 3QA3B 4HS3A 5DJZA 5H94A 3U36A 1Q94B 1VCAA 4JPVH 3KPSA 3DX8B 1P4IL 5I74C 1UGNA 3WD5L 4G8FA 5EOCH 3V0WL 2X4TB 5IVXE 4CDGC 1TZIB 3VXUB 4YLQT 2FD6H 5C6TH 3KPRA 4OZHA 4TTDC 4YX2L 5ICYB 4IDJL 4TVPL 5FYKE 4U6HA 5D5MA 1V3LA 3F8UB 3X3FL 5ALCL 4JFQB 1DQQA 2JB6A 3VFPB 3C5SB 4U05A 4YHZL 5EU6B 4OGYH 5EPMA 4R4BA 3PWVB 3W0WE 5C6WH 1WBZA 2AABH 2XN9D 5HVHC 5IB3B 2Z31C 2R2BA 1T20A 2NY2B 5FEBA 1FQ9C 2AJ3A 1IC4L 4LCUB 4OI9A 3H9HB 2CKBH 3C5JA 4HK3J 2C1OB 5F7FA 3O8XC 4O5LH 2D9CA 2Q8BH 4N90E 4KK6D 1P69B 4DZ8B 4N0YL 1R3IL 4LMQE 5ID0A 2NY4B 1A6TA 3IDYC 1P4BL 1N5AB 4G3YH 4PBWD 3QAZB 1QHOA 3RWJA 4U3CA 1J1OL 1ZS8A 3TA3D 4PRHD 3RKDC 3MNWA 1OWRM 1GPOL 2UYLA 4KHXL 3SGDH 4LBEB 3JWOC 5CWSB 1ORQB 4XHJC 3UTSB 4PGDA 1RIUH 1E0OB 4G6KH 4EOWL 2FIRT 4KAQL 4U1LA 2OR8A 1I1AB 2AK4A 4JPWH 4LEOA 5KVDL 1OOAA 5JA9A 5TFSL 1B0RB 1UJTA 5C0EB 3BPCB 4NDMA 4NN7C 2NY0D 2VDQH 5D1QC 3CU1A 1W72L 4P5TB 5I1AA 3V79C 3I6GB 2CJUL 2AEQL 4JZNA 1FH5H 3ULUE 4M7ZB 4UILH 5EZJA 1JMZA 4JRXD 4F37K 3ZDYF 1ZMYA 5E94B 3VXRE 4OZFG 1MJUL 4P46C 4LSQL 1S7SA 3WN5B 3HZMA 2YPVH 2O5YL 3MV7B 5MEPB 3QDMB 4CJ0A 3O3EA 2CUIA 4YJZL 4NCC2 1NBVL 5H2BA 2P8PA 4M48L 5D1XA 3HMXA 5IHUH 2BNQE 3VU2A 3WS6C 5IB2A 1J7VR 1N8ZB 1YEDB 4N0UB 4YHOH 4YXHH 5C0AD 4Y19A 3ILPA 5IWLC 1PG7H 3PABA 4BZ1H 4HUUB 5F72S 5SX4I 2P42B 3LDBC 3CDCA 4YIQB 3TPUA 4Z0BH 2BNUA 5SX5H 5DMIH 1EFXA 1QG3A 5DYOB 3T0BA 2ZNWA 5I19H 4YDLB 5A2JH 4U1KB 1K6QH 4PREA 3SO3C 1CFVL 1TETH 1CFTA 5SWQA 1Q0XL 1CQKA 1NLDL 3UO1L 1JYNA 1AC0A 3SDXA 3MLTA 4ACPA 2Y72A 2XZCL 4YGVA 1H8SA 2AKRB 4MB5A 4AT6A 1YY8B 1EX0A 3GUTA 4NWUH 1LO5A 1EEZB 1PQZA 2BNRE 4LL9A 1AP2A 1EV2E 4JPKL 4XB7A 2D03L 3QQ4B 3EFFB 4PJHE 2ICES 3QEHA 2NQCA 1B6DA 5IR1B 3QHZH 1S7QB 4ODVL 5IT2L 2Z93B 1BIHA 1T3FB 3QFDA 4JFXA 4ETQB 1ZLSL 4O2FA 3MLSL 2P8LA 4H1LH 5T3XE 2D7QA 4U33A 3GJFB 5HYJD 4HFUH 1BAFL 2AJZA 1FNEB 1RJLA 2X4TA 4NHCL 4P4RB 4R26L 5ANMB 3SO5A 2BOBA 3MUGA 1DLHA 3ILQD 4YHYB 1NC2D 3X12A 3KYNA 4Z0XB 3C6LA 3PWJA 3UDWA 2ZUSA 5E9DA 4JRYD 3VFPA 2OL3H 4NBXB 2CIKB 4APQB 1CFBA 4QHNB 1S78C 5EU6A 1RZFH 4H8WC 1HSBA 5D8JL 5IB3A 2YK1L 1ES0B 5DWUH 3V4PL 1NGWA 4FXKA 4JG0H 2VXVH 4FFYL 4Y16A 3V6OE 3BIBX 2PYEB 4JKLA 3BPNB 1TVHA 4PLNC 1W8OA 1L7IL 1WBYA 1BECA 1G7JA 3HNSH 3ZYIA 3MOQA 1ZSDB 3GI8L 3H7LA 3EJJX 4TOYH 2X4QB 3CCHA 1ZA6A 3MJ8A 4KJQD 4M3JA 2Y06H 2FEEI 4LVNB 1D6EA 3TBWB 1R5WB 1QBLH 2VITA 1ZKAA 1BZ7A 1N5AA 1OHQA 2OTUA 4ALAH 3EGSB 3KJ4C 4UV4L 5AZ2H 2OTPA 5DT1H 1A9EB 3BQUB 3PWUA 2GK2A 4WHYH 3TWCH 5DZOA 5HD8D 4GXUM 5JW4M 5F3BA 5KVGH 4ODUA 2OJZL 2NY6B 2EH8H 4JHZA 3EYSH 1SVCP 2FH8A 1NC4B 5A1AA 2P5WB 1BREA 1KN4L 5FYJU 3F58H 2G2RA 4LU5L 1KC5H 1DE4B 2AJXH 4KKCD 2ED8A 1TTGA 3L1OH 2I5YL 2HT3D 2XTJB 4D9LH 4WY7L 1CDHA 2FDBP 5DUPL 3NA4A 3WCYA 2OBGA 4F7TA 3ARQA 3R1GH 5JHDA 1JV5B 5L88H 3ZTNL 5CHNA 2ZG2A 1N2RB 5IF0B 3VXNA 1GOHA 4HZLB 3WIHH 1YEJH 3MLWH 1XGUB 5FYKD 5DFVD 5DRNB 3OJMB 3CC5B 3HCVB 3BD4A 3D48R 5FOBA 3WSQH 3EZ8A 4DK6A 1WF5A 4CU7A 3D25B 3GSUA 4MJIB 3EOAA 1RAMA 3CVIL 4HWNA 2ZOKA 5C9KA 4I48A 2GSGB 5BOZG 3ROOB 3RL1A 2YRZA 4HCRL 1G6RL 3QUZD 5J12C 3RWHB 4P4KB 1D5BB 4D0BB 1RZ7L 1K3IA 3TBYB 3CFCH 5D93C 3QIUD 2APTA 3MNVB 1CT8B 4G8EB 4L4TE 5E6IA 5JOPD 3IAQA 2AERT 1II4E 1VGEH 4PJDE 2YRPA 3OZ9H 3S3JA 3BDBA 4XAWH 3QDJE 5KSUB 4ONHB 4Z7QF 4PJ7A 3HG1D 4FG6D 1HXMB 2MQ3A 3FCTA 2FR4A 1D9KA 4H88L 3RZWA 2NW3B 4XCFH 1B88A 2HVJA 1QRNE 4MHHI 4KK5C 5IJKA 4GBXA 2YRLA 4JFFE 2YSSA 4XX1E 1S5IL 1M71B 2EIDA 2X2YA 1CR9H 3SJVB 3O3BA 5DR5H 5KSAD 1WICA 3L3HB 5I8EA 4MNHA 3H0TA 1J86A 2R2HA 4KK9D 5KVFL 3FO9B 4G6JL 4AMKH 3FQTA 3RUGE 4LSUH 5DGQA 4WGWB 1CGVA 4FMFA 4AEIH 4TUKH 2X4RB 1OGAA 4X7TB 3ULUD 1V8HA 1YC8A 1EEYA 2VLLB 1CLYH 3RZCB 3CZFA 2B5IB 3L3DB 3H7BB 1I75A 1MRCL 1NSNL 2Y36H 4X8JB 1T0NA 1FGVL 3S36H 1VENA 1QR1B 5DEGA 4OLXH 3OXSB 5ACZA 5I1KH 1G7HA 2VDKH 4JJ5B 3AAZA 1ZXQA 3RDTC 5I1CL 1DSFH 2IPUK 5EC1B 1A1NA 3RA7L 4HKZB 5GS2D 1S7UA 4YK4C 4AENA 4M1DL 3TFKC 1Q9OA 2AEIT 1W0VB 3EUUA 3O4LA 3VD7A 2UWEF 3QHTC 2J6EA 4ZYKA 1P6FA 2Q3ZA 3MRGB 3N85L 4WUUE 3ORJA 1OW0A 5ENWB 5GSVB 5EBMB 4HLZG 1SYSB 4QRRB 4WWKB 3REVA 4CVZB 5MEND 4HMEA 2J8UA 1IM3B 3OKDB 4XNZC 3UTZB 1D3CA 2CRYA 4Z7UB 1LEKA 3VFTA 1AO7E 4EN3B 2H3NB 4O2EA 3S8WA 4ONOA 1FZMA 1BJMA 3FFCB 4XVJL 4IHOA 1ZLUK 4BSJA 3NA9L 3OAUH 5CEYA 3ECBA 3DIFB 4POZD 2CPCA 4CVWA 2BNRD 4L4VA 5I9QC 5EA0L 1Q9WA 5EOQL 4JGMA 3ZDXF 1R6VA 1B4JH 1AR1D 4TNWK 1G7LB 1XGRA 3O6FA 4X6CE 5CGTA 3WE6A 1IQWH 3ZDZF 2J4WH 3LIZL 1RUAL 2FGZA 5AUMB 3PP4H 1JWUB 5EBWB 4LLWB 2A0LC 3NABL 5BQ7B 1BFOA 4I77H 3DX9B 5I71C 1UXSA 5I8KL 1K9TA 2EE3A 4ELKA 2VDRH 3DX7B 1TMCB 1QSEB 1AE6L 4ERSH 2R8SH 1U6AL 5DMKB 5C08A 1X5IA 3P4NB 5D1XC 2W92A 5I6XB 1OSPL 5J56B 1DBAL 1VA9A 4JFYB 1CGWA 3CXHJ 4L8SA 4P2OD 3FRUB 1MCSA 3HE6D 4TUJB 4LIQE 4MJIA 5HGBA 3RWGA 5L0QC 1YUHA 2NW2B 1LEGB 1J5OL 4ODBD 3SE8H 4XP4L 3GSOA 3QUKA 4LSTH 3PIQB 1YPZA 4UQ3B 3MRNB 3PJSA 3DVGB 1QNZH 2IANB 2JCCA 3F6LA 2R0LH 3TGXA 4TVPD 4RWYL 5B39B 2OZ4L 5E5UB 1BOGB 4OLYL 1XMWA 2VDLH 3C08L 2YPLE