4FFYH

Crystal structure of denv1-e111 single chain variable fragment bound to denv-1 diii, strain 16007.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
119
structure length
119
Chain Sequence
QVQLLQPGAELVKPGASMKLSCKASGYTFTNWWMHWVRLRPGRGLEWIGRIDPNSDVNKYNEKFENRASLTVDKHSSTAYMQLSSLTSEDSAIYYCARWFFPWYFDVWGTGTTVTVSSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DENV1-E111 single chain variable fragment (light chain)
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 30
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffyH00
5FK9A 4G3YL 1EZVY 1FFOA 2YZ8A 2F5AL 1SEQL 3IFOB 5GHWL 3P30L 4MD5B 2FDBP 3PGFH 5I8CA 4W68A 5LJYH 2BRQA 5DK0B 3FRPG 2OI9B 1YEIL 1DVFD 4U1LA 3DURB 5E2TH 1IBGL 1Y0LB 2F53E 1DUYB 2FH8A 4CU6A 4OFIA 3U83A 4JG1L 4LLDB 1UFUA 3AU1B 4LHJB 5IB4A 3CVHH 4LLAA 3LPWA 3CSBA 1WIPA 3D39B 1LILA 1U58A 4APQD 1RFDH 1ZS8B 4XNQA 3GZKA 5HD8C 3S97C 1JZ4A 3S37X 2DMKA 3PDOA 5D7IE 1J8HE 4Q2ZA 1X4XA 5AD0A 1B0WA 2DTML 1QTYT 3RKPA 2W9EH 4DVRH 1QLFA 3U0TA 3U36A 2DM3A 5DFVC 4M43H 5I1AA 4Z7UB 1JNHB 2BHYA 3BIAX 2JIXB 5IW6A 1OD9A 1LP9B 3D0LB 1OAXL 1BJ1H 2IAND 2Z8SA 3SDCB 1FZOB 3L7FA 3HPLA 3MUGA 3S88L 2W65B 3MSPA 2DKUA 2BVQB 1TVBA 3T0EC 1N3NA 1M1SA 2LFGA 4P57A 3VA2C 4UIKH 4QHLB 2Z91A 4RMTA 1TZGH 3H7BB 4Q9QL 5DUMH 2VE6B 2XY2A 1YECL 1II4E 4HAGA 4FQ1L 4NQDA 3T3MF 3L1OH 4O2FA 1T7ZA 1A4KB 2Z31D 3R0MA 5E7FA 1J1OH 2OR8A 5ERWA 4CADB 2NTFB 4HQQH 4U1SB 1E4KC 3U46B 4P2QA 1FYTD 4R7NB 4N0UE 1OAQH 1BECA 1E27A 4YR6B 5D70L 2F54D 3OG6B 1RUAL 4TSCL 2B1HH 3QO0A 1JWUB 4MZ2A 1LVEA 4D9LH 5ISZD 4X7EC 1U8NA 1QKZL 1V3LA 3G5YA 4WEUD 1KLUB 1CE6A 4OGAC 1G6RB 3DVNA 3CPLB 1JF6A 3OZ9H 1H8OA 4I48B 3VFNA 3OL2A 2LVEA 3BO8B 4S1QL 4KDVA 5D96B 4JB9L 1HKLH 4R9HA 1UJ3C 5E8DH 1QSFE 1F11A 1NCCH 1FH5H 4HUXA 3RVVC 4C54A 5JXEA 1SEBA 5IHZA 1JN6A 3O8XC 1K4DB 4DN3L 3S36X 3K74B 1XF3B 4LLVA 5FGCE 4WFHD 4GRWE 5D2NE 1UB6A 1PBYA 4LQ1A 1M7IB 3BEWA 1K4CB 2AXGA 3HR6A 5IQ7L 2QADB 3E2HB 3QAZB 5SWSB 2XTJB 1ZLUK 5DA4A 4YC2C 3VD5A 5ITFB 1LE5B 1HDMB 1MFEH 4WWKC 3NTCH 1FO0L 3QIBC 4OF6A 2XKNB 4NZJA 1HOCA 3WBDA 5C08E 4DW2H 1LHZA 2NX5E 5KVGL 3E0GA 1RZ7L 1W0VB 1AXTL 4HUUB 5FYLE 4NO0B 1FNAA 3QNXB 4OM0L 4DGYH 5HVFB 4YPGA 5E6YA 4IS6B 3WD5H 5BV7L 4KY1H 3HE7C 1T0MA 4IRJC 5IG7A 1G84A 2DWDB 1S7WA 4KUZH 5CINH 3C5ZC 3LS5L 3KXFB 1YEHH 2BSRA 3WEXA 1Q9KA 4JRYB 2KH2B 5JHDA 2EYSA 4HHAA 2P8PA 3DX8B 4M62L 1IGFH 3ZKSD 1OCWL 1S7VA 5DK2A 2ZCLL 4TVPD 1ZLVK 5JO5B 3R4DA 5FYKU 3E6FA 1AGCA 4OGXH 4JR9H 3MUJA 3REVA 3BD4A 4YAQB 4G6KH 1G7HB 3TBWA 1U8PB 3FRPA 4IIQA 4OSUH 3EDJA 4XCFH 4JJ5B 3HTLX 3O4LD 3QI9B 4MAUH 3MXVL 3HMXL 3LKOA 3PE9A 1RZJH 1SJVA 1ZAGA 2BVYA 3CZJA 1RK1A 5L2JA 4U1IB 3H9YA 2OJZH 4M6MH 4N0RA 1IM9D 1H3GA 3C08H 2M8XA 2IH1B 4UTAH 4CDHA 4TUOA 3G08B 5DA0B 2C4FU 4LASH 1G9ML 3ZYZA 2VXUL 2P1YA 3QUXC 1WITA 1MIEH 1ORQA 4OV5B 2CLRA 3SKNA 2VLJB 1YYMH 3RUGB 3GKWH 5HTSA 4WUKH 4L4TB 3T2QA 1U8QB 4M1CD 2LTQC 2V5MA 1KJ3H 1X9QA 4YNYA 3FO1A 1H0DB 5HDQL 3N1FC 3JVGC 3QG6A 3M8OH 3FB7A 5DJAA 4M5YL 1MREH 4UV7L 1J0YA 2XTLA 1ZE3C 4YO0B 4NKIH 5TGBA 3GSOA 2QSTA 4KROC 2PYEB 3MYZA 2EIZA 4NZRH 3EOBB 2AJSH 1HNGA 2HTKC 3ARDA 1MCIA 2NY2D 1T5WA 1MHPL 4KDTA 4PP2A 4N90D 3SDAA 2XG4A 1T20A 4KDWA 3W9EB 1MI5A 1CLYL 4D0CA 1YEGH 2NY4D 3FRUB 2P7TA 1ES0A 3C09B 1RJZA 3OV6A 3TN0C 3IU4L 3WDIA 1GSMA 3KYOA 4RBPK 5EUOE 2EXYC 5FGBC 5DFWH 2IAMC 3BSZH 2GJ6D 5F1NA 4M7JL 4GG6B 4DOHE 3JV5A 3WFBH 1T2XA 2WMPA 5KANI 3ARED 1MCHA 3IJSA 1DBKH 4WFGD 3V52L 4L3ED 1EEYA 1NJ9A 2RQ8A 5D7SH 2BVOA 1EVTC 4X4YB 1I8LA 3TFKC 2ZCHH 3VRLF 3EJJX 4QRRA 4N9GA 4UV4L 1VSCA 4YXLH 3ULUH 1GGCH 1T4KA 4M48H 1I1AD 3MO1B 3BH9B 4S1SL 4E42A 4ZUVB 3QDGA 4KK9D 2C26A 4ODBD 4HEPG 5C70A 5GS1A 4Q9RH 3ZKND 5KZCD 5E5MA 5EOCH 4FQHA 1YEDB 4KTDL 3GK8L 5DI8A 1CLZH 1S9YA 5IJKA 4MLIA 4TOYL 1K5NB 1TQBB 5SX4I 4JDTL 5IB2A 1VGKB 1C5BL 3O6FD 5FYJH 1S9VB 1G1YA 3FB8A 5CSZB 4BFBD 3C6LD 5B39A 1NUGA 4ZD3L 4TQEL 4P5TD 4LP5A 3F5WA 5EIVA 1UXSB 3G6AA 1Z9MA 5I15H 1WEJH 2FHBA 1ZA3B 5ADPL 4L4VE 4AEIH 2X5PA 3M1BB 2Y5TB 2UY7A 3X11A 1U91B 4NBYB 1RUQH 5GSVA 1ZVSB 2D03L 5GRXG 2BNQD 1WLHA 4YHKL 1OT1A 3FT4B 3HNSL 4XGZA 2IBBA 2AVGA 4L3CB 4JPIB 5HVWA 2WWKT 3SHSA 3D5OF 5KBNC 1Y6MR 3MJ6A 2PR4H 2FL5A 3EAKA 1RZFH 3QDAA 4NNPL 3GI8H 5J56B 1DBJH 2EO1A 3DGGB 4W6XB 1H15B 2XWJB 3O3BB 4PYGA 2C4XA 3S4SA 1I85C 4NRXA 5FHAL 2AJUL 4Z76A 2EDBA 2DWEA 4RZCA 3TESA 4E5XB 2F53A 1KB5H 2Z8RA 4KTEH 3W11C 4I13B 1MPAH 1CFVL 3PV6A 5TFSL 1J88A 4F37K 2FD6L 1GYAA 4M7ZC 3N85H 5D5MB 3OAZH 3BP4A 1OTUD 2X70A 3L7EA 4XBEH 2VXSL 3ARBA 3MODL 4KXZI 4ETQB 3ZTJG 4IEFB 4HKZB 3RQ3A 3HPJA 1QSVA 4MXVF 5H8DA 1YQVH 2YUXA 3NCYS 4R90H 1DBBH 5IBTH 1R5IA 3ZHDA 3K2MC 2HVJA 4YQXH 3AAZA 2AQ1A 5GIRB 3A6OA 4EDWH 4NQCA 4PGEA 3KLAA 4QGTA 1MJJA 4UTBL 1JPFA 3H9HA 1SBSH 4JKPL 2YPLA 3WL9B 4Z78B 4NKDB 2OK0H 1YMMB 5AAMA 3SKOA 4WI4A 3QA3B 1U8OA 3SDCC 2A1WL 5CWSA 2EH7L 4XHQA 3RGVA 5IGXH 4YGAB 5C0EA 2CUHA 3VXNB 3WXWH 4HWBA 1U95B 3GMMA 4XPAL 1CFNA 2WUBL 4FN0A 4PJ8D 4M1DL 3V5HA 1IM3A 4G42B 5DTFA 1S5IH 4WHCA 4AQOA 5I17B 5C0CB 3CLEH 3CIQA 3O6KH 4TUKH 5C0JB 4HULB 4XPTL 2XZZA 3BP6B 3I84A 4PJXB 4K3EL 3ME0A 4R3SB 4N0UA 5I18H 1FVDB 1RIHL 2QQQA 3BKCH 4PB0H 2Y06H 4N8CH 4UT7L 4NUGL 1MJ8H 5F9JA 1NKOA 4O5LH 4HWEH 4E41E 1YQ2A 4ONHB 3BVNB 5GJTH 1QA9A 1X3DA 2BNRB 2YA1A 1UM5H 4WO4B 4ONFH 4FZ8L 1A7RH 3FOLA 4PJ7B 3VGDA 3JTSA 2P49B 4NKOB 5IEKA 5EN2B 3RY4A 1FZJB 3UTQB 5A2JH 1P9MA 4G8FA 4X98A 1ZSDA 3PGFL 3OX8A 4P46B 4X4ZA 2X42A 4GAYB 3ARTA 5HPMB 3RX8A 3SJVD 4WI9A 4H1LB 5CEZE 4NKMB 4JN2A 4XP4H 1KPRA 5E2TL 4NC2B 4ZFZB 4NQED 5IQ9A 5D93B 5DJYB 4QYOA 4P4KD 4Z7WF 3TA3A 4Y1AE 4FP8H 1UQSA 5FDWA 2H32H 1JGVH 4U6XB 3B9KB 3MV7D 4X6DF 3CVHL 4MDIB 2KZ1B 4CN6A 2Y36H 4GRWH 5DQ9B 3VXQB 4HJGB 3X12A 3GSVB 2EDDA 4XTRD 1UEYA 2G5BA 3SE3A 1RFDL 3PWPB 1MHCA 3HAEB 2XYCA 5EU4A 3GSUA 4JFOA 4GRLA 3VU2A 1T89A 3VMNA 1BVKA 5E2JA 4DVRL 2W9EL 3JXAA 2VN7A 5C0BD 3NIDE 2CDFA 4M43L 5DMGD 1UXWB 3MNVA 5HDBF 1HQ4A 1DQDH 4FG6C 3T2OA 4OD1H 3AS1A 2YHGA 1GXEA 3MGOB 4J4PD 4Y19B 5FYLH 5HYQA 2XN9E 2ZWLT 4LLYA 4EUPH 4NCC1 1EEZB 2CH8A 1SY6H 4UIKL 3QUMB 2OX5A 1CDHA 1TZGL 5I75B 5I74B 5DUML 4O2EA 4AIOA 1MVUA 2ICEA 1AD9A 1FSKC 2YSSA 3L1OL 3SQBA 1U3JA 1VADB 1J1OL 3EO1B 4U1JB 4EN3A 4HQQL 5FKAB 5SWQB 3OF6A 4QO1A 1NLDH 1NC2B 3H3PH 1OAQL 5CJXC 2ZNXA 3MXWH 3I85A 2FGWH 4MA1C 3TIDA 2HFTA 4L8BA 2O5ZH 4D9LL 3BGFC 4R8WH 4PP1D 3QI9C 1U8JA 1DE4B 1T80A 2PXYB 3ARGA 2HMIC 4PJ5B 1NFDE 3OZ9L 5HVGB 3EFDH 4Z7WA 5FEBA 3VRIA 1CVSC 3WNPA 3ZTNH 4HGWB 1WT5C 5EBWA 1HKLL 4OZGF 4X6DA 5E8DL 4YDIH 1RPQA 1NCCL 3TNMA 1FH5L 2OJEA 1PLGH 5DC0A 1N5AA 1JI1A 2FIKB 4HS3B 1CDJA 4HH9A 4YHNA 4B50A 3ES6B 3P9LB 4PRIB 4PJ9D 3EJYD 4GH7B 3NTCL 4RAUA 5JORB 1NANH 4KJWC 1FP5A 3QEQD 1HYRC 4MJ6A 1DVFC 2DQTH 1M4KA 3LKSA 4DW2L 1R3HB 4V1DB 5E5RB 2YXMA 2L0DA 5JW4M 5EPMA 2R56H 4DGYL 4MJIA 4MNHA 5D1ZB 1FNFA 3VWJD 3ARUA 3WD5L 4L8SB 4KY1L 1E4XH 2Z92A 5EUOA 4XCCH 4APQC 2HG5A 4LLWB 1MQKH 1AP2A 4LPWA 2AGJH 4KH2A 4KUZL 1J86A 1TENA 3C09C 3K80A 5CINL 2XPGB 3V4VH 3CFKB 1YEHL 3QR2A 4LMQE 4JRXE 2NW2B 4KVCH 3KPRE 4PJAB 1IGFL 3QIUD 3DV6A 1NBZA 2ED9A 2FJFB 3VFVA 3D1MC 3ARWA 5I9QB 4JFFE 3VXMB 5AZEH 3CSPA 3T08A 4OI9A 4OGXL 4JR9L 3KNBA 4AMKH 1KTLA 5IW1B 4WV1C 4PPTA 4G6KL 1I1FB 4OI7A 5D1QB 4C83B 4OSUL 5EFIB 4ZOCA 3BP7A 4EI5D 3TBTA 2MQ0A 4IJ3B 4XCFL 1KPVB 1JUFB 2AV1A 4MAUL 2ESVA 5T5NG 4RMRA 1RZJL 1JNLH 4OZGA 1LE9B 2AXFA 1S7QA 2OJZL 2Z31C 4PJBF 4M6ML 5C86A 1J10A 3C08L 4JO4H 2VSDA 2H2SC 4UTAL 4JE4B 4UIMA 3WFHA 5D1XD 2DQDH 4LASL 5EOTA 5E2WH 4R2GD 3T0EA 1MIEL 4CVXA 1TQBC 4KJQD 4Y4KD 1EO7A 1YYML 2H8PA 2KUTA 3A6CH 1LP9E 4I18C 3GKWL 4WUKL 4QRTB 3RNQA 1LNUB 1TJHH 1KJ3L 3BQUA 2VZOA 4XB8A 5C07E 4UQ2A 3TLRA 2CUMA 4JZNB 5E2VH 3DXAE 1F5WA 3M8OL 3WLWD 5JOPD 2W0FA 1MREL 3QPXH 1QP1A 4YUEH 4NKIL 4PRHB 1DL7H 1IVLA 4OLXH 4I0PA 1E4KA 3VG0H 4NZRL 2AJSL 4XZUB 4LF3A 4XVTH 1ZT1B 3GSWB 4GKOA 4TNWK 3HG1A 2DS4A 4NFDA 5KSUB 4PJEA 4JAMB 3FFCE 1AY1H 4QRUB 2AK4E 3CFCH 2FEEI 2CKBB 2F8VA 1PZUB 1YEGL 5GZOD 4QWWD 4EQ3A 1NGXB 3PWUB 2WIIA 3SBWC 1DQQA 2XZCH 3DUHA 3GMOB 3KPMA 3QHTC 4FS0A 3OBAA 2PW1A 1FYHB 3BSZL 3P40A 2PUQT 4NSKA 1D6EB 3CFDA 2IMNA 3GFUA 3WFBL 4OFDA 3EYFB 4JFQB 4FA8A 5FO9B 4LKCA 1DBKL 5BZWB 1B90A 4KTYA 2BMKA 2WP3O 1GIGH 3PQYB 3V6OE 3R06B 2R0ZH 5E9DD 5D7SL 4MQ7A 3I50H 1AD0B 4RFNB 1IAKA 1OWWA 3OJVC 2ZCHL 4PJBA 1T03H 2VDNH 3K0WA 4G9FE 5GGVH 1LK2A 4YXLL 3MJ9H 5JIHA 3ULUL 5IV2A 1GGCL 5HI5C 5TDOA 1DQJB 4M48L 1N0XH 3MLTB 3QIBA 4BH7A 2E7MA 4MNQE 5M94B 5DHVH 1C1EH 2HA1A 4Q9RL 1A0QH 5IM7A 2VDRH 5EOCL 3FT2A 3UTTD 3PP3K 1CLZL 2IALB 2BY3A 2C5DC 4G8GB 1GRWA 4J7RA 4X6CE 3HE7A 4YJZL 2RIKA 4IRJA 3U2SA 3NIFF 5FYJL 1C16A 2HJKA 3VXRD 8FABB 2VZVA 4MJ4A 2BHUA 3C5ZA 2FBOJ 5MHSE 3UP1A 1T1XB 4H5SA 4FQXD 3SCMD 2GK2A 4CGTA 3MR9B 2VXQH 15C8H 1XF2B 4K94C 4HGMA 5I15L 3TGXA 1WEJL 1AC6A 1UENA 4AEIL 2UZIH 4UBDD 2CGRH 4BKLA 4XH2A 5M95B 2LU7A 4Y4HA 4E41A 1RUQL 3NGBB 5DVNA 5FV2A 1IQWH 1IFHH 2Q6WA 3RKDC 3H3BC 5IFAH 4NJAH 1AO7D 4M1CC 2UV3A 1ZWIA 2PR4L 5BVJA 3WS3A 5ELIA 1RZFL 1MLBA 4QNPF 3GI8L 3CDFA 1DBJL 3O11B 3C8DA 1AR2A 5IWLC 4WO4C 5B3NA 3DYOA 1XGYH 2Q7NA 4X5WA 3NFNB 3D69B 1XIWA 2D7NA 1KB5L 4KTEL 4D9QE 5C0AD 1MPAL 4IOSD 4WW1B 4P46C 1IKFH 3N85L 1ZHBB 3GBMH 3QUXA 2NY2C 4JVPA 3PWNA 3DBXA 6CGTA 2PCPA 1FBIH 4DEPB 3PDDA 1UZ6F 1VFOA 4XBEL 5CEZH 3WDJA 3CH1B 4AENB 1UKQA 1Z3GH 5J1AA 3HRZB 3MLXH 3O45B 2V2WB 1YQVL 4R90L 1DBBL 5IBTL 3BHBA 3VXSE 3AROA 4YQXL 3UTSE 1A3QA 4BUHA 5A2KH 1AGEB 3V5KB 4X4XA 4EDWL 3GJEA 1EIBA 1AH1A 4PG9A 1MUJA 4MMXC 2PF6A 2R2HB 3SO5A 3DRTA 1XGTB 4G8IA 5EZLA 4NUJB 3MV8A 1SBSL 3AREC 2OK0L 1PJ9A 5GS0H 3OSKA 3KYMB 3FQXB 1F3JB 3OXRB 5ABDE 2ZG1A 2Z8WC 4OCRH 1JWSA 3ZE0F 2YD1A 3F7QA 3MRHB 4MNGA 4U1MB 5IGXL 3IDMA 4M9OA 1EBAA 3VXPB 3WXWL 2Y1VA 2P5ED 3DHJA 3EIFA 3OMZA 2HT2D 2QL1A 3BWUC 3TN0A 3V2AR 4NO5B 3GSNA 1I1AC 1FZKA 5JUEH 1S5IL 3BT2H 1O7VA 3CLEL 2WINB 3O6KL 4HPOH 4GKSA 4P3DB 5FGBA 2R0WH 4TUKL 3ZKNC 2IAMA 3FO2B 2EKJA 3RZCA 1M6OB 2WLZA 2K7QA 5ICZA 3QUYA 5GRYA 1YC7A 3EO0B 1TIUA 4JZJB 3IDGB 5I18L 5E24E 2I9TB 1P2CA 2BOCB 2YBRA 3BKCL 4PB0L 2Y06L 3FHQA 4N8CL 3O6FC 1MJ8L 2IANE 3LVEA 3C5JA 5EU3B 3C6LC 4O5LL 4HWEL 4KKCD 1AGDB 1KN4H 4RAVB 5AAWA 4P5TC 3NN8B 3MRJA 4UOW0 5GJTL 2EEAA 1XFPA 1H3UA 3EYVB 4R0LB 4PTUB 1UM5L 3VFUA 4AK1A 3VGEA 3NPZB 1CFBA 4ONFL 2AABH 1A7RL 3PJSA 2COQA 4XBGA 3LKRA 2C3VA 1QR1A 1T1YA 4I2XE 3IGAA 5JMRA 1VFMA 3RX7A 3FAXA 4XP4L 3DI2B 3L6FA 5ESAB 2GEEA 1DQTA 4Z7UF 1Q94B 4GSDH 5E8NB 3S96B 3F7YA 1IAIH 4FP8L 4Y2DB 1JGVL 4MS8D 1YMHA 2GUOA 2CLVB 4MB4A 5ISZE 2Y36L 2W9DH 3SPVA 4HGKC 1RQ5A 1A4JB 3ARYA 2UUDK 1D9KB 5K9OB 4XXCA 4ZTPH 1DQDL 2UVFA 4OD1L 2XNAB 4WU5B 4JO1H 2NY1D 4P5KA 4A6YA 5AUMA 5FYLL 1NBYA 1DCLA 4XWOC 3OKKA 3CSYB 4C4KO 4JRXA 4CRPA 1T6WA 4WFHE 2ZG3A 4LCUA 2OSLA 1SY6L 4XCNA 1KJ2A 4N5ED 3NA9H 1NUFA 4G6FB 2VL5B 3IFOA 3VXUB 5E4EB 1ZEAH 2OR7A 4YZFE 1KNOB 5JA9A 2LAAA 1FG2B 5DK0A 3DURA 4HUVB 1Y0LA 4XP1H 1DUYA 3QEHB 3VJ6A 2G5RA 1NLDL 4LLDA 1NEZG 3AU1A 3FL7A 2HAZA 3H3PL 4LSSH 4PJ8C 3MXWL 2FGWL 4QCIB 1I8KB 5D1QC 2O5ZL 3MOQA 4YDLC 1CFTB 3D39A 3UX9B 2CIKB 4R8WL 1ZS8A 5F44A 3CAFA 4J1UB 3RTQD 4HH8A 1JNHA 4Z7UA 1CICD 2JIXA 2VUYA 3EFDL 3PHOB 5FCSH 1LP9A 5I1LA 3D0LA 3SDCA 5EC2B 1FZOA 2WV3A 1A02N 2RGSA 4JY4B 3ZTNL 4XHJD 1KUMA 2RJMA 4TVPE 2BVQA 5HYJD 4YDIL 1OWRM 4EIZC 1PLGL 1G0DA 3SDXB 2A6KA 4OZ4B 1I7TB 3RDTD 3X3GH 4QHLA 3F7PC 1LGVA 4K3HA 1A6AB 5DRNB 3H7BA 3HE6B 3V0AC 2VE6A 4FHBD 5MEOB 4PJDE 2EDRA 3L9RB 2EDYA 4AY0A 3RVXC 4BSJA 1A4KA 4CADA 2NTFA 3U46A 4MD0B 2DQTL 3B8YA 1P4IH 1ZVHA 4F7EB 4ZS6D 2WANA 2X7LB 4R7NA 4P4KC 3SDYH 4LKXA 4IRZH 2C1PB 1BOYA 2R56L 4YR6A 2BVUA 2J8HA 1JWUA 4FTVB 4U3XA 1VKXA 1WISA 1E4XL 3STZB 4XNMB 4XTRC 4XCCL 1KLUA 4LCWB 1BF8A 1MQKL 4OUUB 4XMPH 1G6RA 2AGJL 4YHLH 3V4VL 3RPIB 2Z0BA 4X6EB 1A7NH 3FFDB 2X9XA 4Y16B 4I48A 2AV7B 3ORJA 4KVCL 4OLZH 1MJUH 4QT5B 2ID5A 3BO8A 3T0DA 3ULVC 4DUVA 4HW6A 1K4DA 2J3SA 3H8NA 5AZEL 1XF3A 5EU7C 1PW3A 2E9JA 5DD1H 4AMKL 1M7IA 5KTEH 1K4CA 5JZ7D 4XXDB 5FIEA 5SWSA 2JK5B 3RUGF 5ITFA 1LE5A 1HDMA 3P4LA 4LLQB 1N0LA 2PN5A 5EH1A 1WAAF 3WUWA 3VFPB 1JNLL 1QBMH 2VZSA 4ZNEE 5EO0B 1A5FH 4JO4L 1W0VA 2GJ6E 4HUUA 4NO0A 5L6YH 5I1GH 3QNXA 5E8OB 2DQDL 5E2WL 1YEKH 5KJRH 4PJIB 1NBQA 4IS6A 1Z6JT 4WFGE 3V8CA 4M8VA 4L3EE 5MEQB 2FBJH 3A6CL 3ZKXB 4KRPB 2DWDA 3V7AG 1TJHL 4Y19E 3K4ZA 3RI5K 3VCLB 1EBPA 3KXFA 4PGZA 1F42A 4L3AA 1T5XB 1DEEA 3GNMH 4JRYA 5E2VL 2OTUA 3X13B 1RUMH 4OJFH 3DX8A 4QKXB 3HZYB 1CDIA 4LSTH 5HHMB 3QPXL 2Q1EA 4RNRB 4YUEL 2BOBA 1DL7L 3DI3B 4OLXL 1T1WB 3VG0L 1NCAH 3QXAB 3O3EB 1PDKA 5JO5A 4WGWB 1FO0B 5E8EB 5TQ2H 5CJXA 4XVTL 2QBWA 5EOCJ 3AS0A 4YAQA 4GG6F 1G7HA 3IKKA 3WJJC 5K9KB 2JJSC 1AY1L 4JJ5A 4DFHA 2V6HA 5HYSG 3CFCL 4X7CC 4PJ9C 3QI9A 1N59B 5ILTH 3V0VB 1N4XH 4KKNA 5I30H 3EJYC 5C0CD 2XZCL 4U1IA 5CSGA 5BV7B 1PX3A 1KJVB 4JZOB 1J0ZA 3ILPB 5E95B 3B2VH 1F2QA 5F6IC 4EI6B 1WT5A 1MNUH 1U93B 2XKSA 3EYUH 1T3FB 4P2RD 2BNQE 4QXWA 4OV5A 2VLJA 3ROLB 3RUGA 4DEPC 5BS0D 3VWJC 2ENSA 4L4TA 1U8QA 1GIGL 3O81A 5E00B 4PJCB 1MF2H 1WAAA 2R0ZL 3GBLA 3I50L 2UZXB 1H0DA 2HWZH 4NHUB 5CGYC 1PGRB 1T03L 1EV2E 3RHWF 2VDNL 2ENYA 5GGVL 3MJ9L 4YO0A 1N0XL 1NMBH 3QIUC 4AEEA 1BZ9B 1C1EL 2PYEA 3EOBA 4KQ4H 1A0QL 2VDRL 3O2DA 3MLYH 4Z7OF 1PQZB 4OAWB 2WNGA 3WFEH 4PGBB 4BFGA 5MEND 3SGKC 1QHOA 3MBEB 3FRUA 1F90H 4CW1B 3IKCB 2GFBB 3JSSA 3QDJB 2ADFH 1YPZE 4KRLB 3MCG1 2J5LB 2VXQL 15C8L 4HV8B 3JUZA 3MLRH 2R1XB 2UZIL 2CGRL 3DUUB 3KS0J 2H3NA 1U92B 4GG6A 5IMLB 3QJFB 4W4OC 4LGPB 2UVEA 3PWVB 4KJQC 1IQWL 4AIZB 4Y4KC 2Y72A 1IFHL 5D5MF 5IFAL 4NJAL 3QHFH 4X4YA 5IB3B 3ZHKA 2PNDA 1BOGB 4ZUUB 4RWHA 2X4UB 4P9HC 3PHSA 5CLTA 3MO1A 3BH9A 4ZUVA 3QNYA 1XGYL 4PY7B 5IJVB 3QPQD 4WI5A 3BP5B 2HVKA 1YEDA 2BVPB 1VFAB 3NCMA 1LO0H 3T1FB 3C60D 3WSQH 1IKFL 1K5NA 3GBML 4L8CB 3Q0HA 3EZJB 1S9WB 4BQBA 5H94B 1FBIL 1KPUB 1VGKA 5DJ0B 1S9VA 5CEZL 2D7MA 5CSZA 4J23A 3HAEG 5C2BH 1DTUA 1Z3GL 5GZOC 3HI6H 4QWWC 3MLXL 3N0PB 4Y2DC 1UXSA 3O0RH 4YDVB 2YXFA 5KS9E 3OKLB 2DL2A 5F7DB 5GGTA 2BZDA 4WI3A 5GQBA 2Y5TA 1U91A 4OF3A 3E6HB 1ZVSA 1J0KA 1U2HA 3FT4A 4RWYH 4L3CA 5LGKA 3K8MA 4JPIA 5GS0L 4GAGH 3WHE1 4TPRH 3QJHA 4PJXF 3SJVE 3BOVA 4PRHE 4OCRL 5BRZD 1D5MB 2YS4A 4NQEE 3KLDA 1L4IA 4RFOH 2CJUH 1XZ0B 4L9LB 1H15A 2XV6B 3EJZC 2XWJA 5DD6B 3O3BA 1CXLA 3SBWA 4Q74A 4NFBA 3RWCB 1EGJH 3MV7E 3KHQA 3T0XA 4PRID 2E7HA 2LQRA 5JUEL 4E5XA 3BT2L 4HPOL 2R0WL 3GMNB 1YC8A 3LN4B 5DJ2B 1NMCB 3QULB 4ORZC 3BGAA 5D5MA 4PJ7F 1EHNA 4ZNCD 2WBJB 3OKDB 4PGDB 4ETQA 5A2IH 5DS8B 3ARPA 4HKZA 4OZIB 5I1KH 3CCHB 4R96B 1KN4L 3ULVE 4YHPB 2NY5H 5D1ZD 4IRSB 3VGBA 1PKQB 5B21A 2FRGP 3D2UD 3PQYE 4H8WC 5DURD 2AABL 4D9RD 2FJHB 1R3JB 3DROB 4NPYB 5DJ8B 4Z78A 3WL9A 1EZVX 4NKDA 5DJCB 1YMMA 2DD8H 3QA3A 3W0WD 3ZMRA 3QP3A 4Z0BH 2NY6D 5C09E 3VXNA 4OB5H 1U95A 5DVLA 4TVPH 4YHIB 4LVNB 4GAFB 1CK0H 1B4JH 4GSDL 1EUUA 43C9B 3DGCR 1IAIL 3EKCA 3ZYJA 4G42A 3WNOA 2NXZB 5I17A 4RRPA 5C0JA 4TTDD 2ICWB 2W9DL 3BP6A 4PJXA 1UVQB 1RJLB 1YY9D 3O6MH 4ZXBB 3OPZH 1FVDA 1I8MB 3MFFB 3H0TB 3CDCA 3MRPB 3QH3B 1JHTB 4YWGH 2OZ4H 3ZT6A 4PY8J 4K94H 1JTPA 4EDXA 4GW4B 4ZTPL 3VD9A 4DK6A 4C56B 2DKMA 3DYPA 4ONHA 3BVNA 1A1OB 4R97B 4JO1L 5F9DC 3GEWB 5JDSB 5DMJB 2BNRA 1TJGH 1N7MH 4WO4A 3WIHH 5HHXH 5F9WB 4PJ7A 4BSVB 1QFHA 2I9LB 4NKOA 5EN2A 1FZJA 3NA9L 3UTQA 4YK4B 3ILQC 5INDB 5I73B 3QUZB 1XGUB 4HFWB 1YUHB 4P46A 1ZEAL 1BVZA 3FN0H 1RZGB 4GAYA 2DL9A 5HPMA 4RGMC 4H1LA 3ARFD 5L2KB 3QEQE 4NKMA 4XP1L 4ZFZA 3BZFA 3UYRH 1UJTA 3HFMH 5DJYA 4EJ1C 5SWZB 4JM2B 1PG7X 4BUGA 2HT2C 3VD4A 4LSSL 4U6XA 3B9KA 1N6UA 4MDIA 4F9LC 3U0PB 4ZNEA 3TH3T 5DQ9A 3VXQA 3F58H 4HJGA 3GSVA 1NC4A 2W60B 3CXHJ 1RAMA 4F7PB 3VA6A 3PWPA 2H41A 4MDJB 4FQIH 2JJTA 1NCDH 4GLRH 1W8NA 2UWEB 4YHYB 3GBNH 3SQOH 5FA3B 1X5AA 1UXWA 2EICA 1GOFA 2E6JA 5T5FH 3O2WH 1OD7A 1YNKH 5GXBB 5EZIH 3MGOA 3VG9C 4KKCC 4Y19A 1AJ7H 2DYPB 4J2XA 4WTZG 3FHAA 3L3OB 3MV9D 5CP3H 5E8PA 3X3GL 1O5DT 5CZXC 4MAYD 3QUMA 3K81A 2SEBB 1DN0B 1NL0H 3UZQA 4ODTH 1CD8A 4Z18A 1S7XB 4FFZH 1CDBA 3PABA 5FHBH 3CVHB 1NEUA 1VADA 2HFEB 3EO1A 4U1JA 2CRIA 5D4QA 3BZDA 5FKAA 1P4IL 5SWQA 3I3DA 5T1KD 3BKJH 3QWQB 4PJAF 1NC2A 3ZDZF 2GCYB 3SDYL 5EZOH 4IRZL 5I1IH 4GMTH 3VRJB 1HYSD 2EDOA 4JJHA 4MS8C 4I3RH 2AW2A 4PBXA 1DE4A 2IH3B 4XMPL 2PXYA 4YHLL 1AC0A 1A7NL 4PJ5A 5BV7C 1HHJB 4XMKH 4JFPB 4KI5D 1OGAE 1F3RB 2R23B 3MRRB 5D7LB 4OLZL 1MJUL 5DO2D 2VB5A 4HKBB 1KGCD 1QVOB 4HGWA 3ZTJH 4CMHB 2NY1C 2FX7H 3J7HA 2A77H 3P0VH 4PLJD 4UT6H 5DD1L 2FIKA 1NFKA 2VLKD 5KTEL 3STLB 1OQOA 4N5EC 4HAFA 3ES6A 3P9LA 1SHMA 3GSXB 4LLUB 4R26H 5JORA 2V5SA 5I8EB 3DPBA 3MV01 5I76B 1QBML 4E9LA 2IQ9H 2FB4H 1R3HA 4V1DA 3HNVH 4HC1A 1A5FL 2YWYA 4ZS7H 5L6YL 5I1GL 4WCYH 2E9BA 5CGMA 1JZ8A 1YEKL 5HGBB 2BXZA 5KJRL 1EXUB 1KEMH 3TNNB 1S8DB 4HD9A 2YWZA 4L8SA 1J05B 3QO0B 5L88H 2FBJL 1T7YA 3BI9X 3MRBB 5E9DE 4C57C 4LLWA 5IVXB 1G9MC 1JYXA 3VH8B 1RZKH 2XPGA 3QDMB 3CFKA 5IESH 1G0YR 3GNML 1IGIH 3RTQC 4P3CH 2J5LC 2NW2A 3DJ9A 1RUML 4OJFL 4PJAA 4LSTL 4F8TA 3B5TA 4B7LA 2R9HD 2FJFA 3VXTB 4XHJC 3MLWH 3B9AA 1NH6A 1XEDA 4MX7B 4S2SB 5AWNH 3VXMA 1F11B 1NCAL 2NY3D 4L9DA 5D7JD 3KHOA 3UTTE 3S3SA 3QFJD 1FZMB 3BGMB 5ALCH 1L7TH 1KIRA 2XIDA 4HKJB 1FIGH 5TQ2L 1D5ZB 5IW1A 2PTVA 1BQSA 2XXCB 2JB6B 1I1FA 3P4MB 3TBYB 3C9NB 5D1QA 3AGVA 5EFIA 2EH8H 1KPVA 1JUFA 1V3JA 2AQ2A 1V7MH 3KPSB 4W6YB 5J6HB 1CGTA 5ILTL 1N4XL 3GRWA 5I30L 4GFTB 1LE9A 4MMZC 4GQPH 2QSVA 5HGAB 2DF3A 1TNNA 5E4IA 2DRUA 4ZS6C 3B2VL 4QOKD 1RURH 1CD1B 1MNUL 5FKPB 3EYUL 5IVNA 3DYMA 3VFMB 1A6TA 1P7QB 5DJXB 3GRWH 1MCJA 3HR5B 4ZAKB 3OHXB 2NXYD 4M00A 4QRTA 1LNUA 1AO7E 1SVZA 4UNUA 25C8H 1MF2L 4JHWH 2EDWA 2O5XH 3TO4B 2HWZL 5ID1A 1FRGH 2FSEA 3GSQA 1GJIA 3D3VB 3O9WD 1JIBA 2P8PB 4X4ME 5T3XD 4PRHA 1NMBL 3MZGB 3NFSH 3GMRB 5E1HB 2EDNA 1X5XA 3X14B 5C8JB 2OM5A 1UM6H 3IB4A 4KQ4L 5HGGS 5C0AE 5KG9B 1KIPB 3U6RB 4KI5F 3MLYL 1Z9SA 1ZT1A 3GSWA 1NMAH 5E94B 5KSUA 3WFEL 5JZ7C 4NZUH 3OGCB 4IOIB 4JAMA 3UDWA 4QRUA 3C8KB 3ECBB 4LVHB 2CKBA 3QWOB 2CR6A 1P5VA 4L9LC 1F90L 1NGXA 3UXFA 3PWUA 2HLAB 4LNVA 4BQCA 2A6IA 2ADFL 4LCYB 4NGHH 5AG9A 3GMOA 3WJLA 3VWKB 2IPUK 4NRZB 1Z0NA 5I66B 3MLRL 4GG8B 1NMCC 4NN7C 4WEBH 1ZGLB 2APVA 4TSBH 3HUJB 1D6EA 4OBSA 2J6EA 3EYFA 4JFEB 4JFQA 5D72H 5FO9A 1BD2B 4KKLD 3GJFA 1WCBB 1D6VH 3UCRA 3PQYA 3R06A 2NY0B 1AD0A 5B3JE 2V9QA 4Q9CA 3S3JA 2P5EE 2P44B 3ULVH 2EDFA 4U6VH 3SDDD 4G6AC 1DQJA 4YHZH 3GJFH 2D31B 3LRGA 3MLTA 1C5CH 5D9SB 5C09A 3MGTA 3S3PA 1LO0L 1TVDA 3WIIH 1R24B 2IALA 3WSQL 2VDQH 1FAKT 3P3YA 3DSFH 4G8GA 4JFDB 1PSKH 3MC0A 2BCKB 1J12A 3S37H 8FABA 4N8VB 2OXHA 5KW9H 4LVNC 5C2BL 4XAKD 3HI6L 1T1XA 4TTGA 3MR9A 3G04B 3O0RL 3HC3H 1Z9LA 3HB3D 1XF2A 1K8IB 2BX5A 3QIWB 5DEGB 3O2VH 4HZAA 1VERA 1ZMYA 3VGAB 3LH2H 1C08B 2DI7A 5ENWB 4AQ1B 3FQNB 4RWYL 3QDHA 4GAGL 4TPRL 2NLJB 1NGZB 4PUBH 1FL5A 2XOTA 1C8PA 1FL6B 1IE5A 1ZT4B 4U1NB 4V2CB 1MCWM 3M07A 4NM8H 4RFOL 3O11A 2CJUL 4OCWH 1GGYA 1I7ZB 5F9WC 4Z7NE 4CU7A 1LQSR 4YDKH 1EGJL 1JV5B 3HRPA 3NFNA 3QO1B 4HCRA 1QSEB 4YFEA 3L3HB 1EFXD 1UWGH 4WW1A 4J8RB 5DI8B 1ZHBA 1AHWB 1S7UB 1OW0A 1JYWA 1B6UA 1X7QB 5JMOC 4QRPD 1VEOA 3SY0B 3CH1A 3FO0H 5JOEA 4AENA 3S8WA 4MXQD 5E6ID 3STBA 5I1KL 3HRZA 3O45A 2V2WA 1KTRL 2FO1A 2QV2A 6FABH 2NY5L 3G6JE 4LNRB 4Z7VB 3OKOB 3ZT7A 4UQ3B 4XNXH 1AGEA 3V5KA 3DARA 2CK0H 2DLHA 3MPCA 2R2HA 4DKFH 3S36H 1XGTA 4NUJA 3BIKB 2DD8L 3KYMA 3FQXA 1F3JA 3OXRA 4FFWC 4UNTA 1Q0YH 3N50A 1QO3B 4Z0BL 2R29H 3MRHA 1KB5B 4U1MA 4CVZB 3VXPA 4OB5L 1TCMA 4TVPL 3G5ZB 2ZUTA 1CK0L 1B4JL 2C9AA 2X41A 1DR9A 4NO5A 4O2CB 2WINA 2I07B 4P3DA 2ERJC 2LU4A 3QPQC 2F53B 3FO2A 4TSAH 3H9SD 3FOMB 1JZ2A 3EO0A 1RHFA 3O6ML 4JZJA 3OPZL 4RA3A 2I9TA 3LRSB 3TIEB 2BOCA 4YWGL 2OZ4L 4K94L 5C2UB 5EU3A 4EXPX 4LOUD 1T22B 3L5HA 4RAVA 1AGDA 1GGIH 3NN8A 5HYJE 2V7NB 2YC1B 2AJXH 3DETD 5D7IB 1IKNA 1J8HB 4F80A 4R4NC 4POYA 1TJGL 1HWHB 1N7ML 3WNMA 3EYVA 4R0LA 4PTUA 3WS6A 4PJFE 3WIHL 5HHXL 2R0KH 3FQWB 4OD3H 5CP7B 1JHKH 5IVOA 5DZNA 3PDGA 5HHNB 3CJJA 4X8XA 2P24A 1F00I 2HJFB 3ZE2F 2VKWA 3C2AH 3FN0L 2N7BA 3SKOB 2DM2A 5FM5O 2B2XH 1T0NB 2IQAB 5A2LH 2AEWA 2R0LH 3VI3E 5ESAA 3SE9H 3S35H 3I3EA 3UYRL 3HFML 1DSFH 1Q94A 1F4WH 5E8NA 3S96A 4MQTB 1M05B 3PL6D 5FXCH 1CFNB 1KOAA 4Y2DA 4CL7A 1TVHB 3INUH 2C4FT 3F58L 1ONQB 3SDXF 4DWHA 1ZLUH 3CFBB 1A4JA 3MUHL 1J18A 3U30C 3T3PF 4FQIL 3GMPB 4N0UB 1GC1C 1NCDL 5JIKA 1D9KA 3GBNL 5K9OA 4NYLA 3SKMB 3SQOL 1G9NC 1ZLSH 4P2CG 5F9JB 3MBXH 3O2WL 2XNAA 1YNKL 4WU5A 5EZIL 5IROC 3VFRA 4F7MB 1UCTA 1AJ7L 4WUUD 3IF1B 2Q3ZA 1CLOH 3CSYA 4MZ3A 5TDPB 4YLQT 1OTTC 4PV8B 1QRNB 3MUZ1 2W91A 2WQ8A 3Q3GB 3IDYB 1YNLH 4M61B 3MUY1 2VL5A 1NL0L 5FF6B 3VXUA 1QSFB 5ANME 4ODTL 2X4PB 1KNOA 1V05A 4FFZL 3PXHA 1FG2A 5FHBL 2H32B 3WUZA 3GMLB 5FGCB 3MMEB 4GRWB 1GHFH 5D2NB 3UAJD 3QEHA 4DFIA 3FCTB 1ADQH 4WW2B 1ZLVH 1EEQA 3BKJL 4ACPA 1BQHB 1U3YA 5EZOL 5F70A 5I1IL 3L5WA 4GMTL 4ZPVB 3SGJC 4Y5YB 2H2PD 2QQNH 3G5XA 4ELME 2CIKA 5C08B 4TTDC 1CZ8H 2NX5B 1IAOB 4JGMA 1JK8B 4I3RL 4POZD 3IS0X 3RWJB 4J1UA 3HS0B 1IGCH 4FMKA 3T2NH 3PXJA 4EUPB 2E9IA 2VZ3A 4XMKL 2VMFA 5JNYB 1N64H 5EC2A 1UC6A 1K3IA 4Z7QF 4JY4A 4H8WH 3MNVB 4NQUA 1PFCA 2BVTA 2V9RA 4X5XA 1V5JA 2FX7L 1Z5LA 2CRZA 1KCKA 1T66D 5IBLD 3SDXA 3QB7C 2YD4A 4OZ4A 2A77L 1I7TA 5EIIB 3P0VL 5IB5B 4F15B 5B38G 3GUTB 2QKIB 3W2DH 4UT6L 2DMCA 3QWRA 5EU6D 1A6AA 5DRNA 4OFYA 3TO4C 5ADOH 2VDMH 3MNZB 4PJIF 3HE6A 5FO8B 5D6CB 2OTPA 3DMMC 5C0ND 4R26L 2X1PA 4F2MB 3L9RA 1ZLWK 1JZ6A 5LWYH 1MY5A 1MCSA 3ARFC 1ZVYA 2IQ9L 2E27H 4QHKI 2FB4L 2MQ3A 4F7EA 1MCEA 3HNVL 3PP4H 1HCVA 2X7LA 4ZS7L 4WCYL 2C1PA 5J9PB 4NT6B 4P2RE 3Q5TA 4GXUN 4XPGH 4FTVA 1U36A 1KEML 5MERB 5BS0E 3STZA 3WFZA 2E5EA 5L88L 4LVHC 2VR5A 1YA5A 4XNMA 4PRPD 4LCIH 4X5LA 4LCWA 4OUUA 1U8JB 1RZKL 4V2BA 4P23D 4OV6F 3RPIA 4X6EA 3FFDA 4Y16A 5IESL 2AV7A 1IGIL 4P2OB 4P3CL 4FXGB 4XI5C 3E1F1 4QT5A 4XWGH 2HLFD 4HMCA 4RBPH 4BH8B 5INCB 2VYRE 3MACH 1PYWB 4GMSH 3MLWL 5CCKH 5AWNL 1F13A 4H0IA 5ALCL 1L7TL 2DB8A 2ITDB 1FIGL 1B0GB 3Q6GH 3LMJH 4XXDA 3OR7B 4MAYC 4ODUB 5MENE 2JK5A 2EH8L 3TVMC 2BRRH 2OL3H 1V7ML 4LLQA 4PJCF 3KPOB 3VFPA 1KCUH 3EDFA 3CGTA 1AKJB 5EO0A 4M4RA 1K6QH 2CRMA 5E8OA 1N26A 4K7PY 1RURL 5EPMB 2DIAA 4PJIA 1X44A 3BZ4B 4DKAA 1HYSC 3GRWL 3LOWA 4Q58C 4MNHB 5MEQA 4QEGA 3BRGC 1C5DB 5EUOB 25C8L 4JHWL 3VCLA 2O5XL 1T5XA 2Y25A 1FRGL 4DOHB 1JPST 3X13A 3S7GA 2FO4B 5BOPA 3HZYA 4HWZB 4RNRA 5DO2C 5BCAA 3DV6B 3NACH 3NFSL 1T1WA 5KSAD 4D2NA 3QXAA 1F3DJ 3O3EA 1P84K 4HS8H 1UM6L 4UAOC 2DQEH 5E8EA 5LGJB 4PLJC 1NMAL 2DQCH 5K9KA 4NZUL 3B5GA 2RR3A 4FNLH 5JQHC 3BZEB 1Z2KA 3ZDXE 1N59A 2ZCKH 3O6LH 4O02H 2VLMD 3V0VA 3VE0B 4NGHL 3MLUH 1D3CA 4O9HH 2NY7H 1KJVA 4JZOA 3V6FB 3ILPA 1S7SB 2QQLH 3SGEI 4EI6A 4WEBL 1U93A 1T3FA 1AHWC 3FKUS 4TSBL 3CFJB 3QQ4B 4KKAD 5D72L 1CDGA 4G7VH 4J3SA 5E99H 1D6VL 2VJXA 5E00A 4PJCA 3IETB 5BRZE 1VFBB 4L4VB 2VDLH 2CPCA 1OGTB 4NHUA 5ACMA 2EDTA 3T77B 1BBJB 2PO6D 3ULVL 4U6VL 4YHZL 3CDYA 2E6PA 1C5CL 5FOBB 2R9HC 3RIFF 1BZ9A 2GAZB 5BJTA 7CGTA 3MGAA 5I0ZA 3HMXA 4JG0H 4TVSa 3WIIL 2VDQL 5HHOD 1PQZA 4OAWA 3H2WA 3DSFL 4PGBA 1PSKL 1A3RH 1PAMA 4UB0H 1RZ8B 4O4YH 1S5HB 4OCLC 5HHVH 3MBEA 3HI5H 4OLEA 3S37L 3BMVA 5KW9L 4CW1A 3IKCA 2GFBA 4OI8A 3QDJA 3IDNB 1JF1B 2X89A 3VW3H 1CXKA 2YD2A 2D0FA 3HC3L 2BHZA 4GAJH 4HV8A 1QUNA 4G7YH 4GBXB 3TZVB 4XCNB 3LN9A 4H26B 2R1XA 5IVXE 3DUUA 4D9RE 5TE7H 5IMLA 1GCFA 3QJFA 2WQRA 3O2VL 1UJ3B 5DMYA 3DUSB 3LH2L 3KYAA 2PKDA 3PWVA 4AIZA 3O8XB 1LEKB 2ZUVA 5IHUH 3W0WE 1IGJB 4PUBL 5J57B 4F8QA 1E4WH 5DHVB 5IB3A 5GRJH 2A74B 5FUOH 2ADJB 3AM8C 5MEPB 1A8JH 1BOGA 1L6ZA 4ZUUA 2Q3AA 3BFOA 5HYIA 4NM8L 2X4UA 5FFLA 4YC2B 3QT2A 4OCWL 3BPLC 3D25B 5C6TH 1FLTX 4WWKB 43CAB 2CLZB 4YDKL 1JP5A 4PY7A 5IJVA 4BH7B 3BP5A 4XNZB 2BVPA 4K55A 2X4SB 4D94A 1P6FA 4IHOA 3T1FA 1UWGL 4NZDA 1JTTA 3VXOA 4L8CA 5T1MB 4BA8A 2FECL 4G5ZH 1S9WA 3D85B 5JW4Q 1M71A 3LKQB 5H94A 1KPUA 5DJ0A 2Y6SD 1FC1A 1QPXA 5J06A 3F62A 3FO0L 3QQ9D 4QTHB 1MCOH 4HIEB 1Q9WB 4YDVA 6FABL 2CUIA 4H5SB 3OKLA 4PRNA 2OQJB 1VEPA 2ICWI 5F7DA 5CMAB 1RHHB 4XNXL 2MCG1 2CK0L 1OPGH 1XR8B 4K71C 4DKFL 3CD4A 3S36L 1KSRA 2J1KA 4FZEH 1RV6X 5FO7B 4KKLC 3BAEH 4M4PA 1Q0YL 2N4IA 1CD9B 1MCCA 1QPPA 3RJQB 1D5MA 4HUKB 4YPJA 2R29L 2X1OA 2VOTA 1XZ0A 4L9LA 5DD6A 1MLBB 2IWGA 4D0BB 2MPAH 2Q7YB 3IFLH 4ZUSB 3RWCA 2ZG2A 3V6ZA 3NCYP 5B8CC 2QEJA 3GMNA 3LN4A 1I9JH 4MCZB 5DJ2A 4TSAL 3QULA 1CFSB 4NQDD 4X83A 1HIMH 1AGBB 2RB8A 4Y1AB 4G8EB 2WBJA 3OKDA 4YEEA 4PGDA 3CU7A 1TLKA 4P2QD 3U9PH 5DS8A 2DJUA 4K8RD 4F57H 2CDEB 4OZIA 5KAQF 3MA9H 3MOAH 4HF5H 3TJHC 3CCHA 1GGIL 1EA9C 3LEYH 4XP6H 3U79A 4BFEA 2AJXL 3UBXB 4IRSA 2EO9A 1PKQA 3MV9E 2DMBA 3HB3C 2V2XA 1V3MA 1F4HA 5E0QA 4JM2F 1T04A 2R0KL 3GJEB 2FJHA 3GIZH 1R3JA 4XCEB 4OD3L 1JHKL 4KROB 4NPYA 5DJ8A 5DJCA 1XR9B 1TNMA 5EZLB 3DX7B 1MCQA 1MRFH 2XN9B 3C2AL 5EBMB 4OT1H 3MROA 2B2XL 4LQFH 2E9WA 4NOFA 2GITB 3I9GH 2UWEF 2R0LL 5JXED 3SE9L 4N0CD 3S35L 3S6CA 4YHIA 1DSFL 3IDMB 4N68A 1JL8A 1KBGH 1F4WL 43C9A 1FFPB 1CLCA 1UA6H 1YDPB 4CVUA 5C9KA 2YRLA 1YN7B 3INUL 3K1DA 2ICWA 2AI0H 4HLZH 4K7FB 2A6JB 2IF7A 2XQYK 5ICYB 1RJLA 4ZXBA 1OM3H 3MFFA 1OAKH 1K85A 3H0TA 3MRPA 3QH3A 1JHTA 1OSZA 4LPCA 5EIQA 1NCNA 4P59H 4OQTH 4GW4A 4RQQB 3ALPA 1KENH 4MJ5B 1ZLSL 4C56A 1BFOB 2JTDA 4MXQC 5DQJB 3MBXL 1A1OA 1BREA 5JDSA 1UADC 4ELKB 2P46B 1CLOL 2NCMA 5CKGA 4FXLA 1NFDB 2DQHH 4HJJH 4BSVA 3UYOD 2VLKE 3O3DB 5JLZB 3R0NA 4WFFD 1YNLL 5INDA 3L5XH 3QUZA 1XGUA 3PWLB 4HFWA 1YUHA 3LKRB 5JHDD 2C3VB 2DQGH 1E0OB 1RZGA 2KZWA 5D2LE 3TYFA 5L2KA 1T2QH 1MSPA 3MRFB 1GHFL 5HYEA 2W0LA 3L6FB 1A3LH 2Z4QB 5SWZA 1ADQL 5KSBE 3N1MC 2QR0A 4JM2A 1H3VA 1CDYA 4XP5H 3U0PA 4ZMAT 4JDVB 2QQNL 2FCBA 3LEXB 3RY6C 1H3PH 3WIFB 2W60A 4I0KA 5FYKD 2D7TH 4KGJA 5J12C 1CZ8L 1CFQA 4MDJA 4LRNH 4ZDHB 5KOVC 1AGFB 4OLVH 2UWEA 2DM4A 4JQXC 2DTSA 1IGCL 3DX6B 3FTGB 3T2NL 3OG4B 4UINH 5FA3A 5ACLA 2YMXH 1N64L 1E6JH 3JWNC 4AG4H 5F21B 4H8WL 4OCMC 4LOUC 2QHLA 1WWCA 3EOAB 2DYPA 5KOMC 1MCWW 3L3OA 5AUMB 1Q38A 2X4TB 3QFJE 1DP0A 4PV9B 2FNBA 1PX4A 4LEOB 5KVEH 1AIFB 4JRXB 2OXGA 3W2DL 2O26U 3KPRB 4IM8A 4YDJB 2J88H 3QSKB 1A1NB 2V5YA 3N1GC 1HQRA 2SEBA 1BP3B 1DN0A 1MCKA 2VDML 5AYQA 5ADOL 3FQUB 4XCYB 3K1KC 1OTSD 2JB5H 3ARXA 1S7XA 2IBZY 3CDGB 4JFFB 4M7ZB 5LWYL 3CVHA 3S5LB 2HFEA 3RWIB 2E27L 1I7RB 2XY1A 4HSQA 2NR6D 3PP4L 5TF1H 1CQYA 3ARDD 4QOKE 2GCYA 1N8ZB 3VJ6B 5F7YC 3PL6C 3VRJA 1IGMH 3MRKB 2X4RB 3SDAD 4XPGL 1MI5D 4P4RA 3LQZA 4LCIL 3OAYK 2IH3A 1L0XA 1HHJA 4WI7A 2A9MH 4JFPA 3UYPA 4S11A 2R23A 3MRRA 5D7LA 4XWGL 1RJYB 2VR9A 2L7JA 4HKBA 1QVOA 5I1LB 2HJLB 3EYQC 2BFVH 3JV0A 5T3XE 5I2IB 3MACL 3K3QA 3KLHD 1OQXA 3LCYA 2PTUA 1MHHB 2OMBA 4GMSL 4NO2B 5CCKL 5DGQA 5C07B 1LWRA 4HLJA 1MCFA 4YBLB 3P4OB 1IC7H 2A6KB 3DXAB 4CJ0A 1W0YT 5K59F 3Q6GL 5ETUB 3LMJL 3STLA 2BDNH 3P77B 3QXUA 2GHWB 4HWUA 4POUB 4QRRD 5KN5B 3GSXA 4LLUA 2CK2A 2BRRL 5B22A 3AS3A 1CCZA 2OL3L 2X4OB 3KJ4B 4NQSA 5ALBH 5I8EA 3BE1H 1LK3H 3QDGD 4NIKB 2V17H 4QRSB 1KCUL 5I76A 1QG3A 2IEPA 5LXGH 1T83C 1A9EB 3FFCB 3WFDH 2AK4B 5IROA 1K6QL 3PP3H 1BWMA 5BMFH 4LKXB 5HGBA 3O41B 1EXUA 1LO3H 3TNNA 1S8DA 2H2PC 4ZOAA 1GC1H 5IVZB 1J05A 1DQMH 3TEUA 3MRBA 1VKXB 4HIIB 3VFOB 3RWGB 5IVXA 1G9NH 3D9AH 3VH8A 4POZC 1A1MB 3QDMA 2V5RA 1ORSB 4GBXC 5IIEB 3TZVC 3GI9H 2E7BA 1QRNE 3IU3A 4JFZH 3VXTA 4MX7A 4S2SA 5E6ZA 3NACL 3V8OA 3VGFA 1NGWB 4HS8L 3ZDYF 1FZMA 5IBLC 3BGMA 2DQEL 4HKJA 4G9FB 1D5ZA 4KV5F 3HUJF 2JB6A 2DQCL 3P4MA 3TBYA 3C9NA 5GGUB 1BVLB 4MNQB 4FNLL 2X4NB 4NQTA 1RK0B 3KPSA 4XAKE 2ZCKL 5J6HA 3O6LL 2HT3D 4NWTH 4O02L 1BQLH 3WUWB 3CX2A 3KG5A 3WO4C 5A16B 2F53D 2CR3A 3MLUL 4O9HL 2NY7L 5F7UA 1WIOA 5HGAA 4XNZC 4X6CB 2IG2H 1GVIA 4L8DB 4PG2A 5B39G 4MD4B 1KC5H 1WZ1H 2QQLL 1CD1A 5GRZA 5FKPA 1RMFH 1U41A 3VFMA 3WNLA 1G9EA 1F8TH 1P7QA 3UPCA 5DJXA 1A2YB 4Y5VB 3HR5A 3ARBD 4G7VL 4ZAKA 3AS2A 2AAVA 3OHXA 5E99L 3TO4A 2VDLL 4M6AA 3DMMA 2LU3A 1DEEB 1FORH 3KPQB 3D3VA 2OTUB 1I1YB 4NQCD 1FSKB 2HLFC 3GMQA 2L4OA 3R1GH 1CD0A 3GMRA 3ZZ1A 1OAZH 2BOBB 4HDIB 3X14A 5C8JA 2NYYD 2YPLD 5KG9A 1KIPA 3U6RA 4JG0L 3AVEA 1I9RH 1X5LA 1R5WB 5E94A 3OR6B 3S4SG 1G7QA 4JQVA 3RGVD 4LARH 1Q9OB 3EHBC 4MA1B 4QRPE 3OGCA 4IOIA 4U7SA 1A3RL 1MJ7H 3C8KA 3ECBA 4UB0L 4O4YL 5HHVL 3ULUF 5J1SC 3HI5L 3QWOA 3BGFB 3FB5A 2VLLB 2HLAA 1DANT 5EG6C 4L5FH 3S35X 3VW3L 4LCYA 2DN7A 5KANG 2IC2A 1HSAA 4GAJL 3VWKA 4G7YL 4KKBD 2B39A 2D4FA 4NRZA 5I66A 4GG8A 3MRIB 2BSSB 1ZGLA 3H3KA 1LMKA 1URLA 3LIZH 3HUJA 5DD5H 5TE7L 3BEVB 4JFEA 4JO3H 3QCUH 1BD2A 5T1LB 1WCBA 2EIBA 3A0OA 2VQTA 3VXSB 4HKXB 4N9OB 5IHUL 1A7PH 3UTSB 4ZTOH 1E4WL 4JGJA 4EIGB 5GRJL 5FUOL 3TVMA 4PJGE 5GS0C 1QBBA 5C6TL 2D31A 1YN6B 4K9EH 4KU1A 5IOPB 5D9SA 2EZ0C 1DVFB 1HKFA 4Z7VF 2A73B 1U8KB 5KSAC 5FB8B 2EEDA 1NSNH 2FHCA 4FXKB 3SN6N 3H9SE 2IJ0C 1R24A 3T4YB 5DDHA 4G5ZL 2W0PA 4JFDA 1KB9K 1FGNH 2BCKA 1T1ZB 4N8VA 1BGXH 1AR1C 3TA3D 4IMKA 4APQB 3PWJB 1MCOL 3G04A 4F58H 4FQPA 3CFEB 4OKVB 3UTZB 1K8IA 2VLRE 3QIWA 4NDMB 1MVFA 5DEGA 5CD5D 1DLFH 2IANB 5JPMB 3UPAA 1OPGL 5ACZB 1WBZB 1C08A 4GKZB 1XGQB 2H3NB 4GRLD 5ENWA 3FQNA 4KHXH 4KKAC 4M8QB 5GRVK 4FZEL 5IT2H 4KC3B 2UUDH 3JWDC 2NLJA 3BAEL 1NGZA 1QBLH 1FL6A 4WV1B 4LVOB 3S34H 1ZT4A 4U1NA 5FYJU 3U7WH 2PO6C 3BJ91 4RGND 2MPAL 2MKLC 1I7ZA 3SE4C 3IFLL 4I2XB 2HTLD 1JV5A 4NC1C 3QNYB 3QO1A 5ESVB 1QSEA 1I3RA 2Z31B 3L3JB 4KUCF 4LVEA 5D7IF 5HI3D 3L3HA 5IUSA 1I9JL 4U7KA 1B4RA 2HVKB 2C3HA 4J8RA 3WE6B 3RVTC 1AHWA 1S7UA 1FYTB 5CZVH 1A6UH 1HIML 1X7QA 5FV1L 4OF5A 4ZG1A 5HHPB 4EN3D 2AXHA 3SY0A 3U9PL 1V3KA 4I18B 3MTRA 5ISZB 1YYLH 3OF6D 4LLMA 1RUKH 4F57L 3MA9L 3MOAL 4HF5L 1TMCB 5J89A 2V7HB 1EAJA 3LEYL 4XP6L 4WUUE 4LNRA 4Z7VA 3OKOA 3TCXA 4OZHE 4UQ3A 2WP3T 4CJ1A 3DTXB 5DSCB 3FONB 5GPRA 2JCCE 5DMKB 1HE7A 3GIZL 1TDQA 3ARGD 2H6PB 2MNUA 4WTXA 1XCTB 5T3ZE 1T0PB 1CG9B 3BIKA 4G80B 2APFA 2PYFB 5BVPH 1MRFL 3RVUD 3WO3B 2JKXA 1FNGB 4OT1L 7FABH 3QJHB 4RMVA 4Y8DC 1QO3A 1WTLA 2G2RB 4LQFL 1KB5A 5CIPH 2DBJA 3I9GL 4JKKA 4CVZA 4KZEH 1RI8A 2GTWB 1T21B 2UZYB 3G5ZA 5EOQH 1KBGL 5T1DH 5LBSH 5HY9B 4TUJA 1UA6L 4O2CA 3X17A 3ROOA 3KDMB 5MP6H 4QHMB 3UJTH 2I07A 5IMOB 1EO8H 1BZQK 2AI0L 3FOMA 2VR4A 3THMH 2H9GB 1OM3L 2WSKA 5E1AB 1OAKL 4PJHE 3LRSA 2FLBT 2J8OA 3TIEA 4OTXH 3FQTB 4P59L 4OQTL 2Y6SC 4A2LA 1KENL 1T22A 1FFQA 2UYLB 3QQ9C 2APWA 4XBPB 2V7NA 2YC1A 2FEDC 4GRWF 4MJID 5D7IA 1J8HA 1MWAH 3NMEA 4WW2F 4GJTB 2CSPA 3KS0H 5C3LD 2DQHL 4HJJL 5EU6E 3FQWA 5CP7A 4ISVB 1BM3H 3L5XL 3OKEB 5HHNA 1GL4B 3RL1B 2CRYA 2HJFA 2DQGL 4O58H 4CKVX 5IFJB 3VFTB 1T2QL 5DMIH 3KWWB 3CLFH 1T0NA 2IQAA 5T3XH 1A3LL 4J3WA 2EIEA 1AXIB 2EDQA 1M05A 3O4LB 2R1YB 4YBLC 4HK0B 2ARJQ 4PJDB 1TVHA 1KXTB 4XP5L 2A0LC 4WENB 5GGRA 4U0RC 1H3PL 1ONQA 1C7SA 1VB9A 2D7TL 4PRPE 5HD8D 3CFBA 4MWFB 3KJ4C 3UZVB 2ESVD 4LRNL 5BW7A 3GMPA 3L3GB 2IPTH 3OWEA 4OLVL 5DFVD 3SKMA 1TQCB 4UINL 3WHE0 2YMXL 1E6JL 4EDXB 1HHKA 4K8RC 4K2UH 4Q7DA 4AG4L 1MFBH 4F7MA 3T0ED 3IF1A 3MRNA 3WN5B 5TDPA 2WLYA 3ZL4H 5KVEL 5AZ2H 4PV8A 1QRNA 4F33B 3Q3GA 3BQUD 2J88L 4M61A 5FF6A 4KMLB 5GZNC 1QSFA 2L7UA 5DJ6B 2X4PA 2JB5L 2LV4A 5J3HD 3PV7A 2H32A 3GMLA 1ITCA 2NY2B 1I9IH 3MLVH 3MMEA 2MHAB 2A38A 1NFIB 5A2FA 4I0PD 5D2NA 3V6OC 1R5VB 2B0SH 3FCTA 3BZFB 4WW2A 2Q20A 3BD3A 5TF1L 1NANI 5F7LB 2NY4B 1BQHA 1F4AA 3HG1D 3WNKA 3QYCA 4U6TA 4ZPVA 1IGML 5F1IB 4Y5YA 4F7TB 5F8QC 3RHWK 1JJUA 5C08A 2F19H 1NC4B 2A83B 4RMUA 2NX5A 1IAOA 5TPWH 1JK8A 4MB5A 2AEIT 3V4UH 4PRBB 3RWJA 3G5VB 32C2B 2GJ6B 1WWWX 1ND0B 1IEHA 3HS0A 3T0BA 4JEGB 4EUPA 1SJXA 2A9ML 4ODVH 3AREB 3F12B 5JNYA 3L3DB 1SY6A 5I1CH 1VPOH 2ARJB 4L3EB 2BFVL 3RVVD 4ZO6A 1JWMB 3P2TA 4Y5VC 1BFTA 5EIIA 4S1DD 4ZSOE 3GUTA 5IB5A 4OCYH 4HIJB 2QKIA 4Y4FC 1IC7L 4M3JA 5E8PB 2DLGA 4M1GH 1I1AB 3MLPA 1CGSH 1QHPA 2BDNL 3OGOE 3MNZA 4HUMB 5FO8A 5D6CA 5I0DA 2DQFB 5KZCB 4F2MA 3TO2B 1INDH 1U8HA 3HKFA 5EUOF 5D8JH 2VLME 1BFVH 2P8MB 1TZHB 4OZFH 5ALBL 3PABB 3BE1L 3QIBD 1LK3L 3B6SB 2V17L 4J12A 5LXGL 2C1OB 3VFSB 2J8UE 2XQYG 3O6FB 4LPTA 5L8JB 3V79C 3WFDL 1G6VK 3C6LB 4KK5D 5J9PA 2DICA 4NT6A 5CBEB 1I1CA 4P5TB 3GGWB 5BMFL 1UH3A 2GSGB 1LO3L 5MERA 3HE7D 1AQDB 2XA3A 5CHNB 4IRJD 1GC1L 1KEGH 1DQML 2KL6A 1CXEA 4MQSB 5KVFH 1G9NL 2JJVA 3C5ZD 3D9AL 4XVUD 4NFCA 4KJPD 1KFAH 1UWXK 5HGDB 4P2OA 4UDUB 2BNQB 4C4KT 2Z93B 4FXGA 4P5MB 4BH8A 2XWTB 3MLSH 4NC1E 3GI9L 5INCA 4Y4HD 4E41D 1U3HC 4JFZL 2M2DA 1PYWA 3IDJA 3WXVH 3BPNB 4EQ2A 5J4MA 1IRAY 3EDDA 3L5JA 3AFLA 1IT9H 3BD5A 2ITDA 5HHOE 1OP5K 1A9BB 1B0GA 3FZUD 3OR7A 5FCUH 4IOFC 4ODUA 3QXTA 2VNCA 1HHHB 1OTSC 1HXMB 2ADIB 5EO9B 2LE9A 3KPOA 4NWTL 4EKXA 1BQLL 3E8UH 5FUZH 4GKNB 1XIWD 1AKJA 1X5KA 2IG2L 2XZAH 4HWNA 2NR6C 1KC5L 1WZ1L 3QUXD 3CC5A 2NQCA 1HNFA 1RMFL 1FC2D 3DVGB 3BZ4A 1F8TL 1YPZB 1H5BB 1BX2B 3IVKB 1C5DA 2VLRA 5EO1B 5FA4B 3EDEA 1ODAA 4OIAA 3KR3H 2MJWA 4QXGH 4PJEF 1FORL 1YEFH 4X0KB 1I7UB 2FO4A 2FLRT 4HWZA 2VXTH 1WWBX 5MI0B 5HHQB 3R1GL 1OAZL 3MV8D 4PRAB 4N0YH 3I6LD 3NIGE 5C0DA 2HTKD 5LGJA 1I9RL 3U4AA 1TTGA 1KIRB 5JR1H 1MH5B 3D6GA 4PJ8B 1BFSA 4LVOC 4LARL 4P99A 4J6RH 5CEYB 1MJ7L 2R2CA 3BZEA 1R3LB 4YDLB 1K3ZA 4NC0B 4W81A 2H1PH 3TN0D 3VE0A 1MEXH 4L5FL 5EB9A 1WCQA 3V6FA 2EXYD 5DUBB 1S7SA 2IAMD 1KYOK 3ARRA 4KI1A 4ZYKB 3RZCD 2K3TA 1NAKH 3QUYD 1J5OH 5IJKC 1FLRH 3LIZL 3CFJA 5DD5L 3T09A 2VUOA 3QQ4A 3RWHB 3ET9F 4JO3L 3QCUL 1A6TB 3QXWA 2DQIH 3TPKA 5KS9B 3G9VA 1A7PL 3IETA 1VFBA 4L4VA 4ZTOL 1S78D 1OGTA 1HILB 1WQVT 3T77A 1BBJA 5FOJA 3BDYH 5ID1B 4QXTB 2FSEB 2BY0A 3GSQB 3I02B 1F97A 4C55A 3BUYB 4K9EL 5FOBA 3SJVB 2GAZA 1PG7H 2YD6A 3WCYA 3QCVH 4NQEB 1NSNL 1NAMH 4UUJB 4FFYH 2YD7A 3KPPB 4NQDE 5T3ZH 4P4KB 1J0IA 3B43A 3MV7B 4P2QE 1FGNL 1RZ8A 1S5HA 1BGXL 3P4NB 3BUTA 4LCCB 1UCBH 1WC7B 2NPLX 2R69H 3IDNA 1JF1A 1QQDB 1IL1B 4F58L 2A6IB 4RCAA 3EFFB 5GGSB 2CO7B 4GBXA 1SYVA 3Q6FB 2CMRH 4I4WB 3TZVA 1A6VH 4PTTB 4H26A 3K4DA 5C0BB 2DBLH 2Y9RT 2APBA 1DLFL 2NY5C 1UJ3A 4LGSB 3DUSA 3NH7H 2G9HA 4GRMB 1G7MB 4KHXL 3MJ9A 3O8XA 1X5GA 1LEKA 5I71C 4JQIH 5IT2L 3GJFB 1IGJA 1QBLL 4OD2B 5BOZG 2H26B 5DHVA 3S34L 2A74A 2WBKA 3UBXI 2ADJA 5MEPA 2QLVB 3U7WL 3JBG7 1VESA 3LDBC 1JYVA 2FX8H 4JRXD 3D25A 4WWKA 43CAA 4U4BA 2CLZA 5BXFB 2MTPA 5DRWA 4RX4A 4M9PA 3QXVA 2X4SA 4YH6A 1ZK9A 5C09B 3MGTB 4JFHE 4Q0XL 5T1MA 1TZIB 5CZVL 1A6UL 1QBAA 3D85A 3L95B 4IMLB 1BAFH 3LKQA 4LSQH 1SQ2N 2K9UA 2RCSH 4PS4H 1N2RB 1HHIB 1L9MA 1YYLL 4QTHA 1RUKL 5EU5B 4ESKA 1I8IB 4HIEA 1Q9WA 3SEPA 2MFNA 2EEBA 1P7HL 2OQJA 3U0WH 4KK8D 5CMAA 3D39D 1RHHA 4XC3L 5HDLA 3T3ME 3WKMH 1XR8A 4UDTB 2P5WE 2Q86B 5JHDE 2VDOH 3AMKA 2JIXD 5FO7A 5BVPL 3ESUF 3SDCD 1TQCC 1MCPH 4IDJH 7FABL 1W72H 1FL5B 4ZFGH 5E5UB 4KZEL 4HBCH 5HVHB 4EVNB 3WN5C 4KQ3H 4PJ9B 3RIAF 5I1JH 4D0BA 2C3GA 5EOQL 5T1DL 2Q7YA 5LBSL 5H37G 4ZUSA 1ZT7B 1LDSA 5F6HI 4CNIB 1ZANH 1OP3K 5MP6L 3QEQB 3UJTL 5FYKE 4FQJH 1EO8L 5CJBA 3T0AA 4MCZA 1IAII 1P9MC 1PEZA 2X1WL 1NFDF 1CFSA 5F6IB 2E8YA 4JN1H 1AGBA 3THML 4Y1AA 5F9OH 4G8EA 1ZHKB 2FYYA 4OTXL 2WAHA 3VWJB 1CL7H 3SKJH 2CDEA 2W0KA 1LO4H 4YXKH 1GAFH 1S9XB 2C3XA 4WHTA 2NY4C 3TA3C 2NTSP 1GGBH 4LIQE 1KYOJ 3JVGA 3UBXA 4TNVF 4JVWA 1MWAL 4X9HA 3IDIB 2WIMA 4MA7H 3SE3C 5CD5C 2D2OA 4XCEA 4DCQB 1KIQB 3QIUB 4GW1B 1XR9A 1BM3L 3DX7A 1P4LB 4O58L 2XN9A 5EBMA 4DN4H 3C5SB 1M7XA 5DF0A 5DMIL 4PR5B 3CLFL 1JYNA 3QQ3B 2GITA 4QTIH 1AQKH 2E6QA 5T3XL 4QY8B 3OJMB 2DLFH 4LMQI 4EI5B 2ZUXA 4W6WB 4HK3N 1QFWI 1FFPA 1YDPA 2QADD 4NCC2 3MA7B 1MI5E 3JV4B 1YN7A 5SWSD 2XTJD 4KK9C 3QRGH 3K2UH 2DAVA 2DLEA 1SJEB 4K7FA 2A6JA 5ICYA 2Q87A 3HCVA 1UH2A 4XVSH 1P7KB 2X40A 3V4PH 3EOTH 5D1XB 2MWCA 1X6NA 2IPTL 2DI9A 1WSST 4EN3C 4RQQA 1A47A 4Y4KB 4MJ5A 4NO0D 1BFOA 5DQJA 4K2UL 1MFBL 5MHSD 3W5NA 1BIIB 4ELKA 5ID0A 2V5TA 3SE4A 1NFDA 3ZL4L 1J11A 1OGAB 2ZUQC 5AZ2L 3JWDH 3O3DA 1CYGA 4XMLH 5JLZA 3HZVB 3KXFD 5DR5H 2R1WB 4WTWA 4QRRE 5FGSA 4JRYD 2ZUWA 3PWLA 3W39B 2JJWA 4JDZB 1ZHNB 3HNTH 2P24B 3RVUC 3QDGE 5GRWA 1I9IL 3I75B 2OBGA 1VGEH 3MLVL 3MRFA 5GJSH 4GXVH 1MELA 4X8JB 2F8OA 2Z4QA 3BPNC 2B0SL 4DK3A 2OP4H 4WJ5B 4OLWH 1FYTE 1LP9F 3BYYA 3WUWG 2N7AA 2VZTA 5DD3H 2O61B 4JDVA 2F54E 4OGYH 3LEXA 3D18B 3WIFA 5J8OA 1W2KT 5DVMA 1JMZA 4J3VA 1MY7A 3RPKA 2F19L 3QI9D 5TPWL 3V4UL 4ZDHA 2P42B 1AGFA 2HMID 2W38A 1FAIH 4D8PB 3FTGA 3DX6A 4ODVL 1OTUC 3SGDH 1I4FB 1ZA6B 4NHCH 1VPOL 4NYLB 4L1HA 5I16B 5I1CL 3MCLH 1WZKA 4LPXA 1RZKC 3EOAA 5E9DB 1NDMA 2G75B 4FQQB 3BW9A 3RA7H 3VFRB 2VLJD 2X4TA 4PV9A 5IF0B 4LEOA 4L4TD 1H5BC 1AIFA 1ED3B 4OCYL 1QFPA 1KCRH 3KPRA 1JRHI 1I85A 4YDJA 4M1GL 5DRXA 1A1NA 1CGSL 3MQIA 4QF1B 3FQUA 4PREB 4XCYA 1M7DB 3CDGA 4JFFA 1INDL 4UILH 5D8JL 3UTTB 4KJWD 1BFVL 3S5LA 12E8H 5MI0C 4YE4H 3IAGC 3RWIA 3BDBA 3G6DH 2PYED 3FN3A 1I7RA 4C58B 4M6NH 5EA0H 4B5EA 5TJWK 3VXRB 4OBRA 1N8ZA 2D9CA 4K7PX 4WGVB 1ZTXH 3VI4F 3MRKA 2X4RA 3VRLE 3NVQA 3UTOA 1GH7A 3L5WB 3SCMB 1RZIB 4FQXB 1KEGL 1WTGT 3G5XB 2VRAA 3FJTA 5KVFL 4UU9B 4ORGA 5J11C 3F65A 1KFAL 2B1AH 4AJ0A 1VACB 4NQCE 1T6VN 1IAMA 1RJYA 3MLSL 2HJLA 1FNEB 5I2IA 2PTTB 1AO7B 1MHHA 2VZ1A 2IPKB 4NO2A 2YPLE 4X5XB 3WXVL 4DUXA 5C07A 3T04D 4X6CF 1MCBA 1Z5LB 3VDBA 3P4OA 1IT9L 3DXAA 4R7DB 3W9DB 1DDHA 2XFXB 3IS1X 4R4FH 4M7LH 5ETUA 5AG8A 5FCUL 3P77A 5DEZA 4YIQB 1PY9A 3BQUC 2IGFH 5KN5A 4Y2OA 3B4NA 3UEZA 3O4LE 2X4OA 1UT9A 4BM7A 1GZPB 5C0AB 3VD3A 2I25N 4JFYB 5J3HC 1BWWA 2A9NH 4QRSA 4N1EA 3T0WA 5D7KD 5J0BA 3E8UL 5FUZL 4CMMB 1UACH 4I0PC 2H2SD 1A9EA 4HJ0D 3FFCA 2AK4A 2XZAL 4I5BB 3O41A 2J2ZA 4LFHD 5LQBH 5IVZA 3S98A 1VA9A 3QUKB 4DZ8B 1PY4A 4HIIA 3VFOA 5J1TC 3RWGA 4LCCC 1CGYA 1A1MA 2NW3B 4K8RH 1V7NH 4Q9BA 3KR3L 4QXGL 5EZJB 1ORSA 1DFBH 4JGUA 2WWMD 5ECJE 1YEFL 4KRNA 2R8SH 5IIEA 1TJIH 4JPVH 3PUCA 2VXTL 4RGMB 4Z5RA 5DMGC 4X7SH 4N1CA 3V6OA 5IKCB 4Y8AA 1KJMA 4U6HA 5DJDA 3MJ8B 1NGWA 5AEAA 2OL3B 2KPNA 4J4PC 4N0YL 3P73B 2QQKH 1IEAB 2P5EB 4G9FA 4S1DC 4MXVE 1FJ1B 5JR1L 5JW4N 3FMGH 4N90E 2XA8H 3V9FA 5GGUA 1BVLA 2K7PA 4J6RL 4MNQA 3B3IB 2X4NA 2PW2B 2X9WA 1N6QH 1RK0A 2LAGB 2X6MA 1CU4H 2H1PL 4OFPA 1J0JA 3ZKMD 1MEXL 1D5XB 5GGVY 4LFHG 5A16A 1PG7W 4OM1H 4X6CA 3MOBH 3D0VB 4L8DA 1OLLA 1NAKL 4MD4A 5HYFA 1J5OL 1FLRL 4KK5C 3VG9B 2VQ1B 1B6DA 1J1XH 1A2YA 1FFNB 4Y5VA 4J3OC 3WYRA 4NM4H 4Y4FA 4Z6AT 2DQIL 2B8OT 2EE2A 4JREB 3X3FH 1LD9B 4D0DB 4PP1C 1FN4B 4UT9H 4FOMA 4M6OH 4KJPC 4XVUC 2P5WA 3BDYL 4NNXB 2E7CA 3KPQA 4TYUA 4RGNE 2WW8A 5GS2D 5HI5D 5TF0A 2ZZUT 4X7DC 1I1YA 2I5YH 1H3XA 1DBML 4Y4HC 2WZPD 4OQ1A 4HDIA 2VH5H 4U1KB 1PG7L 1DJSA 1YMMD 3QCVL 2VKXA 1NAML 4FFYL 1FGVH 4RGOH 5T3ZL 1R5WA 3OR6A 4HEME 5CEXB 3MYJB 5CBAB 1Q9OA 3FZUC 2BC4B 4U0QB 5DRZB 5FDYA 5I1DB 5HVHC 1NKRA 2VLLA 4EOWH 1UCBL 2R69L 4LPVA 1NEZB 1MCRA 1XF5B 5CGTA 4ODHH 3VMPA 1XIWC 1N5YH 1QR4A 2CMRL 1A6VL 2DBLL 3MRIA 1U3HA 2BSSA 5FYKH 4GUPB 2Q76B 4AEFA 3BEVA 5F3HB 3NH7L 3TPUB 1K2DA 1UEMA 2NY1B 2OTWA 5T1LA 4QRQB 3G6JB 3RKDD 2R4SH 4Z7WE 3VXSA 1MLCB 4JQIL 1SMOA 4BFIA 4HKXA 3AMLA 3UTSA 1HK6A 2AJYH 4X6DE 5H2BB 5BZDB 1CIUA 1C12B 1NPUA 4CN4A 2BNRD 4LIQH 2AXJA 2FX8L 2KDGA 4WO4D 5C0FB 3OB0K 1YN6A 1JCKA 3MRCB 5IOPA 3RGHA 1DVFA 4X7FC 2A73A 4HS6B 1AE6H 1U8KA 1QFOA 3GHEH 5FB8A 5BJTB 1JNJA 3M17B 4FXKA 5HDBE 4P46D 3T4YA 3GHBH 4NBXB 2APTA 3OKNB 2XZQH 3H42H 1YJDC 4LHUB 2B4CC 1BAFL 4LSQL 4RRPG 1T1ZA 2RCSL 3KPLA 2YD8A 4PS4L 4Y5XC 4EI5C 4APQA 3PWJA 1FL3B 3B9KD 4MJIE 4L1DA 4LPUA 3RTQB 1NC4D 3U0WL 5IB1B 3CFEA 4NP4H 4OKVA 3UTZA 1CICB 2AJZB 4NDMA 3RZCC 3VDAA 4NNYB 3PWPD 3LEVH 5F1KC 4H25B 2IANA 4YZFF 3WKML 5JPMA 4LDOB 5ACZA 1WBZA 4GKZA 3QUYC 1XGQA 5D1XC 5HYJB 5IHBA 4M8QA 2P8LB 4R2GC 2VDOL 2LVCA 3QCTH 1KLGB 3RDTB 1MCPL 4WV1A 3UTPD 4IDJL 4PJFB 1W72L 4Y19D 1S78C 4ZFGL 4L29B 1ZGLP 4HBCL 4KQ3L 5I1JL 3WHXB 2Q8AH 2RFXB 4I2XA 4E0RB 4H1LG 4RSVA 3WLWC 1F3DH 4HIHB 1PEWA 1ZANL 5ESVA 3L3JA 2Z31A 3BRDA 5C0GB 4KAQH 3TCLB 5HJ3B 4FQJL 3WE6A 1IGTB 3NCEB 4IHOB 3NZHH 1MCDA 2ESVE 1FYTA 4MQXD 4JN1L 1X5IA 4OZGE 1ITBB 3VXOB 3DVIA 5F9OL 2ZUYA 2F54A 5HHPA 1A6ZB 1BJMA 1M71B 2Q8BH 4DGIH 4I18A 5ISZA 4A2MA 1CL7L 3SKJL 1LO4L 1NC2D 4YXKL 1GAFL 2V7HA 1IMHC 3T0EE 1GGBL 3D87B 2B20A 2M26A 3DTXA 4PRNB 5DSCA 3FONA 3SOBH 4FRWA 5DMKA 1CT8B 2XWBB 4MA7L 4CBPA 1I75A 4PJDF 2PXYD 2H6PA 1XCTA 2ATKB 1CG9A 4G80A 4PJ5D 2PYFA 3CK0H 5IR1B 1FG9C 4XXCC 1FNGA 1EGJA 2FHFA 4DN4L 5EULV 5I19H 2G2RA 1PKOA 3PHQB 5LGHH 2GTWA 1L9NA 2EDJA 1T21A 5IBUB 4QTIL 1AQKL 3AB0C 1CTNA 2DLFL 1U8MB 5HY9A 5ANMB 3U48A 3HG1E 3KDMA 4QHMA 4PJEE 2IADB 4BSWB 5IMOA 3V6ZB 3QRGL 3K2UL 4U7MA 4JANB 5HYSB 1YY8B 3GB7B 3AC0A 4ZFOL 1L0YA 1KACB 4NN7B 1OHQA 2ZSWB 4XVSL 3EYOB 2H9GA 3U9UA 2R15A 1VDGA 1ZLWH 5E1AA 5F88B 2OI9C 3EOTL 3V4PL 5GSRB 4MJ2A 4K3GA 3FQTA 4V1DD 5C0BE 5DK3A 4BJLA 2CDGB 1UGNA 1B88A 4ELMB 1W8OA 2UY6A 2UYLA 4HXBH 4XBPA 4GLRI 3DRQB 4XWOD 1UZ8B 2Y4SA 3SCMC 4FQXC 4KK8C 2HH0H 3V0WH 3LB6D 2V2XB 3JWDL 4XMLL 1T04B 4ISVA 3UJIH 2FGZA 4UBDC 4PJBE 4MCYB 5DR5L 5IMMB 5C92A 3OKEA 3RL1A 1BZ7B 2ILLA 5IFJA 1JZ7A 2IBZX 3HNTL 5FUCC 3VFTA 2XKUA 3KWWA 1IEBB 4JY6B 3MROB 1VGEL 5GJSL 4GXVL 1DBAH 5F7MC 1JPGB 3VXMD 1FFRA 2OP4L 2VABB 3O4LA 2R1YA 4OLWL 4YHMH 1FV1A 4HK0A 1H9VA 4PJDA 1TCRB 5DD3L 5D1QD 4OGYL 2OZ4A 3IAPA 2ZSVB 1IM9A 2FZ3B 4MWFA 3DV4B 5SX4H 5C6PB 4HWBH 3PGCB 1RIUH 3L3GA 4O51B 1FAIL 1JPSH 4P2RB 3MJ7B 1OSZB 3WIHA 4MVBD 4XPHH 2AJ3B 5BS0B 3WDHA 4LBEA 3QHZH 4NHCL 3T2PA 3MCLL 3C6SA 4ZOBA 3RA7L 4DVBB 3WN5A 2F74B 2HRPH 1JVKA 5IWLA 1QLEH 5DVOA 1RSFA 2DQUH 1KCRL 4F33A 2MKWA 1BMGA 5LKNA 4OLUH 2D7QA 3P0GB 5DJ6A 4YBQD 4YEFA 5LAXB 3RVXD 2FH6A 4UILL 5FECB 12E8L 4BQ8A 3TYFB 2MHAA 4PRHD 1NFIA 4YE4L 1Q8MA 5D96C 2F58H 1R5VA 1A14H 3G6DL 3P9MB 3P0YH 5MENB 1OVZA 1ROWA 4M6NL 4NJ9H 5EA0L 4C59B 2QR0B 3ISWA 4MSWB 1UB5B 1ZTXL 1Q0XH 5F1IA 4F7TA 4D3CH