3K6IA

Crystal structure of chicken t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
SILATPILIPENQRPPFPRSVGKVIRSEGTEGAKFRLSGKGVDQDPKGIFRINEISGDVSVTRPLDREAIANYELEVEVTDLSGKIIDGPVRLDISVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6iA00
5CO1A 5DZVA 5JYLA 4XXWC 3UBHA 2OMTB 1O6SB 3LNGA 2X2UA 3K5SA 4APXA 4APXB 3FF7A 4OY9A 2OMYB 1WYJA 1NCIA 4ZMTA 4AK1A 2A4EA 2QVFB 2WBXA 3Q2NA 3UBFA 4XXWA 1SUHA 2WD0A 4AXWA 4AXWB 1NCHA 4AQ8C 4AQAA 2EE0A 4AQAB 4ZMXA 4ZMZA 3LNFA 2WCPA 1L3WA 2OMWB 3K5RA 4ZMNA 2A4CA 3UBGA 2OMUB 4NUMA 4ZMLA 4ZMQA 3K6IA 4NQQA 1ZVNA 2OMXB 2QVIA 4AQ8A 4QD2E 4ZMWA 4ZMVA 4ZT1A 4ZI8A 1NCJA 1OP4A 1Q1PA 3K6DA 5JYMA 4ZMOA 1NCGA 2V37A 2WHVA 5KJ4A 3LNHA 4NUPA 4NUQA 4ZTEA 2O72A 4ZMYA 1WUZA 3QRBA 3MVSA 1ZXKA 3Q2WA 3PPEA 2OMVB 4AQEA 4AQEB 3K6FA 1EDHA 3LNIA 2OMZB 2YSTA 3Q2VA 5CZRA 3LNDA 3FF8A 2YQGA 3LNEA 4ZMPA 3Q2LA 1FF5A
chains in the Genus database with same CATH superfamily
2R4SH 1JVKA 2HKHL 2IH3B 2NY0C 1AD9A 4HIIA 1S78C 4XVTH 1MLBB 2BVPA 3NCYP 4KDVA 4MNQD 4ODVH 2CLZA 2ZXWB 1C12A 3UZVB 1MCOL 4WVRA 4G43B 2CZNA 4XVJH 2V5TA 2VXUL 3WMQA 5EU3A 3CPUA 3W0WE 3T3PF 4HK3J 4IU3B 4IKLA 4LCUA 4B3VA 1OWRM 5LBGA 1LE5A 1MFBH 2QPSA 5JPNA 5HDOA 1YQVH 1ZTXH 3B5HA 2AQNA 1BVKA 2WP3O 5TDOA 3L3GB 3CFTA 3A6OA 4L37B 4P23A 1GKOA 3GGWB 4RMWA 2BIIA 3T3MF 4X5LA 2HJLA 3AXIA 3VU1A 1CB4A 1NEUA 3MOBH 4OFKA 3VXNA 2ZCHH 1AIFB 1ETB1 1MY5A 2GTZB 2LQRA 3VXUA 2IBZY 2BY3A 1ID5I 3RBGA 1MCPL 1INQB 2I9TB 4DEWA 2XWXA 1OM3H 4GP8B 3RL1B 5JQ6L 3X14A 5IFJB 1NFKA 5FM4A 3G5ZB 2IXQA 4ZDHA 2DQCH 4TUKL 3HS0C 2IALA 3TTSA 2WO4A 2AW2A 1J05B 4LLUA 4OLXL 1HL5A 2LVEA 5IVXA 2BY2A 1O6TA 4QNPF 4JFFA 4MWFA 3BGFC 3K80A 3HC3L 1JD9A 1Y1UA 1NMCB 4I2XB 4L23A 2XRAL 1AKJA 4Z7WA 43CAA 5KYUB 3P73A 4DEUA 1IC7L 1D5BA 4LDLB 3LKSB 5DYOB 1BGXH 1FJ1A 3EZJB 3WNIA 2ZJSL 4OLWL 3UDWA 2EDMA 1JUFB 4V1DA 2ZF9A 1F3DJ 1NGYA 3QFJB 3L1FA 4LZKA 4P46B 3SE6A 3QPKA 1IGTB 1SEBA 3MI6A 2FT8A 3HZYB 3RI5F 3G9VA 2QBWA 3D52A 2WQVA 4X5QA 5BZWA 4N5EC 4AM0B 1BZQK 3VXRB 1N7MH 2HT3C 1PEZA 2EYTA 2YFNA 5JOPD 1HILB 2VM9A 4PYHA 1NJ9A 4ELDA 1ZHNB 1P69B 3LRLA 1OPGL 3NK4A 3P3YA 3PIQA 4QTFA 2AV1A 1XIWD 2H2SC 3GBLA 4XNUH 5DU7A 4F7MB 5F96L 4X6DB 1A6UH 4Z78B 2VXVL 3FN0H 4AJVA 4FD0A 4P04A 4EZKA 2DI7A 2F53B 3O6KL 2WVTA 3DGGB 4XXDA 2G0KA 4YZFE 4DHLA 3A4DA 1MAJA 5GZOC 4KKLC 5ID1B 3I6KA 2EZ0D 3P77A 2VUKA 3WJJA 2C4XA 2DLHA 3F01A 5E9AA 1WBYA 3WSQL 3ZR5A 2R56L 3QARA 5AWNH 3JBG7 3QIUD 4KJQC 2AK1L 5KS9A 1QWUA 1EAPB 3MCLL 4JGJA 2OMYB 1OK0A 1PZ5A 1QKZL 2DQTH 2EIBA 3INUH 3MLSH 3QDAA 1LK2A 1AG0A 2CJSA 4MYWB 3WIFB 4DNLA 4HJ1A 2XTJE 3MREA 4KQ4H 4AKQA 1EAQA 1HHGA 1BVNP 2VM4A 4YLQT 1H8NA 2RFXA 3S96A 1YDPA 3C09C 1WAAF 3SPJA 2VN5A 5E8OA 4UAOB 5D7JB 5LAXB 3RZCB 3UTTA 2KT6A 3LQAC 4F1SA 3B34A 3QZWA 1OB1A 1XTMA 1VGEL 4M61B 3U4BH 8FABA 4XC3H 5A6IA 2PPAA 2C8NA 3SDCD 3JXAA 3GMOB 2FLRT 3IJ9A 3OLDA 2VE6B 2BC4B 4YDKL 1JF1B 1O7VA 4QJ3B 3ELAT 2K6WA 4JZJB 4PCYA 3OLIA 4HKZA 2D4DA 3BUBA 2AF2A 2H3KA 4I0KA 4ABWA 1XZWA 2WLJA 4G71B 3G3LA 4ZQKA 4WW1B 3HG1D 3IK2A 4JFHD 1HVXA 2OMXA 3WN5A 4F58H 3KPNB 4RZKA 1F2QA 1JHTA 4PIBA 4B9FA 3BAEL 4MB5A 2NY2C 4WI4A 1OAKL 2N4IA 2X6VA 2VRKA 2IPKB 3BUTA 3LD8C 5I1GH 3OKLB 1MCHA 4FFZL 4LNRB 1PYWA 2Q8BH 1FCGA 5JYMA 4H0LC 1MEXH 4W9DC 3VWJA 3E2HC 3UGEA 4S1SH 4LVOB 5DJAA 5DZJA 2VLRE 4TSBL 3WUZA 2EVJA 3MNDA 2F68X 1TQSA 4LHUD 4KKZA 4NNPH 4R7DB 4F2ME 2DM3A 2DWSA 3BP6A 3O11B 3UPAA 1TFHA 4ZS6C 4ADJA 1YYLH 4HCIA 2EO1A 5F7YC 4B9JA 3U36B 1FAIH 2CDFB 4WWOA 2F74A 3F7RA 5CAYB 1S9YB 3LRKA 5J9PB 1KBGH 4G11A 3WNLA 4F3FB 3SE4A 1R46A 2W0PA 2Z92B 3DI2B 2H26A 2VLJB 3QDHA 2ZQKA 4Y4HC 5KYYB 2G3NA 3UAJC 3LRHA 2JCWA 2X9YA 4ZTPH 2VLMD 4HLJA 4MQXC 3MYJA 5C70A 2OAAA 3PGDA 3MV8D 5FYLD 3FQRB 2H3NA 4PGDA 5IM7A 1G1KA 1S3RA 3PUUA 5H2BB 4WTXA 5H4YA 4MNQB 4PV9A 5AW4B 2YJQA 5BOZG 4IMKA 2VRQA 5DZ9A 1XCXA 3JSSA 4RNRB 4XRCB 2PYEE 4DGYH 4LOUC 1NBVH 1MFDL 4B27A 3OKDA 3IDIA 1W0WB 4X9GA 43C9A 3LAFA 2PMZA 3DX2A 4OD1H 4Z1PA 1TZIB 4UV7H 4PRDB 1W9XA 1QVOA 4RWHA 1YECH 4H20L 4MJ6B 3RUGB 4CILA 2A2QT 3D51A 2IFFH 3UERA 4QWWC 4MASA 1ZTXE 5E2TH 4H5SA 4WHDA 2AGJH 3EJZC 1PX4A 3KYAA 5AOIA 4IYKA 3ZQXA 1BEYL 2Z93B 5C2BH 1DVFC 5IQOA 3CH1B 2OSWA 2PW2B 3PGCB 3OHXA 3QUKA 6TAAA 2FLBT 1TCRA 4PRID 2GIXA 3TN0C 1BZDA 4K4KA 1A6VH 5B22A 4Z18A 1RHHA 4L2LA 3VDBA 2DRUA 1RLWA 2EDFA 3UYPA 2V17H 3O0LA 5IW6B 3D25A 1PKOA 5D70L 1CXFA 32C2B 2NNXA 3KYNB 4LIQL 4UT6L 2ZSWA 4MMYA 5IW1A 2VB5A 3CFJB 3ARZA 1JG9A 4PJHF 5DJ0A 1D9KA 2HFGH 1DLFL 4Y19E 1LO0H 2JTYA 3DBXA 3QUXA 2WBJD 3AS0A 3X2QB 1J1XH 5EOCL 5FXCH 5DT1H 4I5BB 2WQWA 4TKWA 4YSDA 5GRXG 1ACZA 4YHML 1TJHL 4G5ZH 1AGFA 1FDLH 1Z5LB 2ZOWA 3QQ4A 1YCSA 5JXED 2GITA 1E5CA 2BNQE 4U6HA 2MPAL 2Q76A 1L4IA 2WO3B 3WYRA 2OULB 1P5VB 3JTBA 2DQMA 4LCIL 3B37A 4ELMF 1J8SA 1XIWB 1WDAA 4CU8A 1M4KA 1GH7A 4EE2A 3ZPDA 4IBUA 3DYOA 3TA3A 5L88L 1D6VH 3E8VA 5ADOH 1RUKL 3NFNA 4D9LL 4ECNA 3L5WB 4BFIA 4WO4A 1EPFA 3GMMA 2ZF8A 1IBGL 2UWEE 3DJSA 5I73B 4KY1L 4EI5A 5ANMA 5EOTA 1BQHB 1FL5B 2H32B 4KTEL 5CN2A 1XR8B 3BWUC 3ULUH 5T3XL 2AERT 1BOYA 4JFXA 4DT2A 3QIUB 2W9DH 3WLBB 4BSWA 2XKNB 3C5JA 3EYUH 3BRGC 3OR7A 3QI9D 1J0IA 4Y2DD 3LNGA 1KB5H 1TVBB 3MC0A 3I6SA 4R2GD 3N42F 1UYWL 1N5YH 2P48B 5E8NB 5IB1A 5IIEA 5LNDA 2R27A 2B59B 3ZDZE 5FWRA 2X0VA 3VSQA 3ETBJ 4OFIA 4N8UA 4P2AA 4GRLD 3ULSB 4U1GC 2XA3A 3T1WA 4GSQA 3W9EB 1WSST 8CGTA 1QLEL 5DS8B 5FO8B 3AM8A 1XF2B 1WA2X 1IKNA 1WPCA 5AZEL 3SDCB 4DVRL 3KYMB 3SE9L 1MCLA 1S7WB 1BFSA 4IHOB 4XZUB 1WHPA 2CBPA 2NR6C 1AO7E 4I9WD 3PNRB 1OSPL 5D96B 2MMXA 5BV7C 1F4WL 3F7VA 4UT9H 4AUUA 3QC6X 3DX7A 4MQSB 2QSCH 1ZY9A 1AGDA 2G5BA 3FTWA 1ERNA 3ZE1E 2ZYHA 2WKLA 4PR5B 1CR9L 3RI5K 3KVQA 3HG1B 4GKNA 1YPZB 3Q6GL 3MJ8A 4QRPE 3EBGA 1J9QA 4OZIF 3GSNB 1QA9B 2AK4A 3V4VB 4HUXA 4E0RB 4AM0Q 4W9IC 1GGCL 3S37H 1TOXA 3UTPD 5FUCE 3D0LA 5BVJB 4XCNA 1YNTF 3IE4A 5HHOE 3VFGH 4MB3A 1O5DT 2W0KA 2YXMA 3UZQB 5JIPA 2NYKA 4NKMB 5FM5O 3BZFA 4AMWA 4GEJA 2JWYA 3HS9A 1B2YA 3BI9X 4LHUB 1PZ2A 3H9YA 5CWSB 1KWKA 4URKA 4IQHA 1ZA3A 1JXGA 1BPVA 4YAQA 1T83A 5FUZL 1SN5A 3MJWA 2QQLH 4RGMC 2BOLA 2A77H 1KZYA 4FE9A 2WLNA 4X9IA 2F6AA 5EU7E 2DQIL 3UX9B 3TA4D 1OVZA 5GGVL 1O0VA 1CFSA 3DDFA 5HGDA 5GGQH 5DK2B 1DJSA 4EO5A 1JNNL 3I74A 3QPXH 4EIZC 5F7KC 2AJZA 2FH8A 4WU5B 5EO9B 2XVLA 1S9WB 5BRZE 4L8CB 3NSXA 4J3VA 3M1CA 3T0EA 3KLQA 3D30A 3VJ6B 3MV8B 1DLHB 1DUYB 2X1XR 2C9RA 1OW0A 4OGAD 2OSYA 2IGTA 1EUTA 2R0ZH 4M8QB 2DWDA 4PJHA 4G82A 4JKNA 1I8AA 2QPDB 2YMOA 2BMKA 1U58B 3UEQA 1A1OA 1JNLL 2QGBA 4IBWA 3GMQA 1BECA 5GISL 3TPUB 1MF2L 4NUJA 5IKCB 1NCNA 3D9AL 1GZQA 2HLAB 2VL4A 4XOAA 4Z3TA 4HGMA 5CUSH 4GW4B 3WN6A 2YAOA 1TZHA 3TWCH 4Z3HA 2WUCH 3TFKD 4OFQA 2XPGB 3B2PA 2GUOA 4U3SA 3VFMB 1NAMB 1UXWB 4FEIA 2YUVA 3KJ4B 4JY6B 4QOKD 5DLMH 2DQEL 1KJ3H 1T7YA 2EINB 4JHWL 4WNJA 4L0YA 3TOPA 5L4FA 2C9PA 3Q1EA 1RUQL 2DTML 4JRFA 1U41A 4LCYB 2D2CC 5I8EA 4QHKI 2V9QA 1UADC 3IKCA 3X13A 4XPAL 4PRIB 4TLKA 5DD0H 4G1EA 4XN4A 5JIIA 1CLOL 1JBJA 3HZMA 3O45A 5DK3A 4FMVA 3IU4H 1F41A 4HCGA 4GG8A 4KO6A 3F64A 1BJ1H 3ZTJH 4E41E 4OZGB 5AKSA 3L54A 1N64L 1J48A 2QGEA 3PLYA 3ZZSA 4KJYA 1QO3B 4JFDA 1NCWL 3FH5A 2WBJB 1FNHA 4XMLL 1A4AA 1NGPL 3S35X 1AE6L 1FH5L 2I5YH 1MW3A 4GKOA 2EDRA 4WSGA 4P2OD 3VG9C 2HMID 5TH2B 4M7LL 1DN2A 3MLVL 3PL6D 4JPQA 2G5RA 3ARTA 3OC5A 1WLHA 3HJEA 1MCBA 5FGBC 2GCYB 3QULB 1D5ZA 3MCG1 1TVDA 4XP6L 3QFDB 4IRJA 3IDMA 2ZWSA 1J0JA 1X44A 2QVKA 1M7UA 4IBTA 1BWMA 2YPVL 1YUHA 3MVSA 5ESAB 3OMZA 1XF1A 5IHLB 3AB0B 4U6YA 5EHFA 5DJYB 4D8PA 1OF2A 4HLZG 4ONFL 3ILQD 4D9QD 2IMNA 3CC5B 5BS0D 1V3KA 2FO4A 2XWJB 3FQWB 1ONQB 4UINH 1SOXA 3AMLA 3BVNA 3IDUA 3MDJA 2J4WL 1RZIA 1J9RA 3D85A 4XXCC 5B38B 1LO3L 3A6BH 3X11B 1OIOA 3KLKA 4ZD3H 2MOVA 4XR8C 4YHKH 1Z3GL 3ULAB 3C75A 4LHQB 5BQDA 4R7VA 4DO4A 2GBTA 1JWMA 3QI9B 4MKMA 4XNMB 1TYRA 3DJZA 4Y2DB 3OR6B 3ZDXE 4R2GB 4RETB 4N87A 4P2RD 5FDWA 1U3YA 4ZRGA 1NWPA 3ULUE 1Q94B 3IKKA 3IDJA 3KVPA 1MJ8L 3JQOB 5E5RB 5EOQH 3CV5A 4ZFQA 2AMUA 2CA4A 1BMGA 3AT8A 3O3EA 4GRLB 4KC3B 1JHLH 1F4AA 3KPPA 2ICES 4M1DH 3V8CA 4JDTL 1AMXA 4F57L 3CZFB 5IHHA 2J2ZB 4G6AD 3WEXB 2VLLA 4XVSH 4Y9BA 2GI7A 2FSDA 2QDVA 1B4TA 1NC4D 3BVDB 4YZFF 1YEIL 4MA3B 1ZLVH 1MWAA 4BZ2H 3TEZA 1L0YA 3MV7A 2P47B 4IM8A 4A6YH 1RSFA 5ECGA 4IIQB 4A7VA 5ERWB 2QR0B 3L4ZA 4BH8B 2A4ZA 1JK8A 1BZ9B 3NFSH 4ZZFA 1LE9B 2V7NA 1EWHA 2YQ3A 3MMEA 4RAHA 5DO8A 1ZOXA 2A5UA 4R4BA 4XP5H 1CK0L 1PL3A 4KDTA 2AAVA 5ICZB 3BIKB 3BXNB 3IWUA 3BQUC 2CRZA 3BEVB 3ZZ1A 2WWKO 4O02B 2VTFA 4H8PA 1IBHA 5AZ2L 3HPJB 1CBJA 4P4KC 4BEIA 2DBLH 1FL3A 1WE5A 1JHKH 3CXDH 1P7KA 3VD0A 5ID0B 3KLAA 3WKML 4C4KT 2EUZA 2ZWZA 3T9WA 1PZDA 3OKMB 5C0FA 2D3VA 3QJFA 2ATAA 1EO7A 2Z8VC 1UATA 3FT9A 2BSSA 4FZ8L 2NDGA 2VDLH 4RH4A 3IN0A 4M8VA 4AEIH 4N6RB 4Y5XB 1T66C 2O5XL 1TQWA 3PY9A 4ETYA 2AQSA 3SPHA 1FVDA 4S1DC 4HMCA 2FVNA 2B8OT 3DIFB 2WXKA 5I2IA 3WMPA 3WKPA 3CZKA 1Q0YL 5LXGL 2AJYL 1HQ4B 3OF6D 2F2HA 4Q52A 3QUZD 2C7UB 4GJTB 2YZ8A 3RIKA 2ICEA 2PKDA 4H26A 4ZOAA 1EBPA 4EI6B 5GS0D 4BGDA 1UM6L 3QQXA 5F7EH 4H1LA 4BHUA 4N2BA 1QYGL 4LCCA 4WFGE 5IJKA 2A74C 3N91A 5DD5L 4E36A 5BO0D 2BCKA 1L0XA 4FHBD 3UXFA 1A02N 5DRXB 1PKQE 3MX0A 2CD0A 1OGAE 3FYEB 3GI9L 2F9BT 3EO1B 3OZLA 1T21B 2WP3T 4O51B 3ES6A 4IRZA 3UMNA 2X53A 2YGVA 1T1XB 3UG4A 4WJ5B 2ZTBA 4NBZB 3ZHFA 3Q05A 1L3NA 4GKSB 4HSQA 4JFZL 5I0XA 4Y5YC 5HJ3B 3L7FA 2P44B 2NSQA 1KIUA 4CDHA 1K4CB 3CHXA 5I1IH 2FSEA 4FQQA 1JZ3A 5CINL 3IJYA 1IEBB 4OY9A 4OZFG 3WIHL 1XSOA 4PJGB 3GXIA 3SDYH 3LYRA 3BAIA 1T1YA 4ACTA 4LSPH 1PPIA 2A9AA 4MJ4A 4AKPA 2A4EA 2HB0A 4UQAA 3OLGA 3FKUS 4QOKB 4Y8DC 2QHRL 2OXHA 4DJMA 1PD6A 1RJLA 1PSKL 1TIUA 2LTQC 1NKGA 2EDEA 3MRHA 1E7UA 4ZMAT 3KLHD 4RX4A 1GHFL 3HMWL 4YL4A 4P23D 1A7QL 5SV3A 3NYKA 5IGXH 2K1MA 1ZJBA 3T0BA 4YHZH 2DI8A 3MRJA 4V11A 5IK3B 4HW6A 1JGUL 4RSYA 4Y4FD 4R0LB 4PY8I 3VXUD 3X3GH 1QD0A 2C1PB 2RJMA 3PAYA 1BW8A 5KSVA 1GYVA 4DQOH 2VR8A 1P7HL 4J3OD 4LLDB 5GRUL 5I1KL 4RMTA 1U91B 2ZOTA 4BRJA 1SY6L 1WBXA 2Z7YA 5IJVB 4LGSB 3S2AA 4UB0L 4FGMA 5EU4B 1D6EA 3BAXA 4MXQC 2VAAA 3NTCL 1U8KA 2ZXBA 4PVBA 3H4FA 3TV3H 2QKIC 4XC1H 1CFNB 5AAMA 1TQBC 1U95A 4P2OB 5AD0A 3QXAB 4JPIB 5IWLC 1I1FB 1T0NA 1GOHA 3PL6B 1KB9J 4LSUH 3IM1A 4X80H 1AKJD 3MN8A 1TO4A 3ECBA 5DA4A 3NESA 1LEKB 3L7EB 3F12B 3DPBA 2XQYK 5HPMA 1R6VA 1I8MB 2VL5A 3PP4H 5B1AB 4G42B 2J44A 4J3TA 3QS2A 4PI2A 4V1DD 4X6CB 2VQUA 1TUPA 1D5RA 5BS0B 4IK7A 5HI5C 3NJVA 1Z9OA 1MCWM 2OTUA 4YE0A 3X12B 4DPBX 1ED3B 2BWIA 2J55A 2YD0A 5KW9H 4X7SH 3M17B 3HI5H 4JFPB 1MG2C 4QRTA 3GKWH 1CDBA 1F42A 1WITA 1ZAGA 2XKUA 1HOCB 4QHUB 1JV2A 1RZPA 4E5XG 4YUEH 2F58L 5GIRB 3ARDC 5J6GB 3A47A 1EQWA 3N41F 4FMKA 5D72L 3F84A 2H2PD 3BSGA 4PJFA 1GL4B 4P2RB 4PBWD 1QEXA 4P2YA 4YHLL 3IJEA 3BMVA 1WWCA 4NYLA 3K5SA 1VFAA 2H7WA 1A3QA 3D12B 4IBZA 5K39A 3L4UA 4WK4B 2WXQA 3VXQA 3CVHA 5EEUA 1CLYL 5CHNA 3I2CH 4PVLA 5EU6E 5AW2B 1XTLA 1P2CA 4G80A 3VRJA 3MNVB 4QTIH 1X6NA 3EFOB 1NC4B 2H8PA 4P9ML 1JI1A 3MBXH 4G8GE 1QABA 2YD3A 1M7DB 5AG9A 2UWEF 3X1GA 4JKWA 3UTTD 1BYNA 1JGLH 1XGUA 4HUVA 1JI2A 1MNUH 2NXZC 2VXQH 4KJWC 2JI3A 5FUCC 2ITFA 4XBGA 1SJEB 1UVQA 3OG6B 2H6OA 2VDMB 3BWAB 5I76B 2CXKA 5IMKB 5DD6B 3AAZB 1TMQA 3F8UB 5CR1A 3E38A 1BXUA 2R0WH 2CWRA 5IP4A 4F2MA 4XMVA 4EMZA 4J7RA 1IL1A 3CXFA 1E5YA 3VRIA 3ZDZF 1DCEA 4M62H 1SXBA 2I60H 4PJIB 2EDJA 3W81A 2NT1A 4ZUTA 3GJFK 4Y1AE 4C54A 4LFHG 1NUGA 3QAZB 3FT3A 5CKAA 5I1DB 4TVPH 2EXWD 4F33A 5EU7C 3B2DC 3ZMNA 4OI8A 4X9YA 3DXAE 5DFVC 1JERA 1DYZA 3CFEB 3FQNA 4N90E 4PJ8C 4AL8L 2R2EB 2HSIA 1G43A 2HWZH 4M5SA 3MUJA 1FPTL 2VQ1B 3GO1H 3S97C 3VWJD 4NGHH 1ZPLA 4LAQL 1PG7L 5E6RB 3ZE1F 1J87A 2J1KA 1EDQA 2JJTA 3V0JA 2Z65C 5J6HA 1LNUA 4URTB 3OAWA 5GGSY 4EJ1C 5BUGA 3QUZB 1T0MA 2NY5H 4MSWB 2GI0A 1HDMA 4PJBE 1T22B 2AJXH 3B4NA 2BNUA 1CYXA 2AEQH 3MRNA 1X5HA 4N1CA 4QAWA 4XMKH 3WDJA 4GXFA 1B90A 1IC4H 2DY2A 3QYNA 3ZE2E 1A7OL 5IFAH 3I02A 4KUZL 3TIDA 4OIBA 4GS7C 3HS8A 4NM4L 1NCAL 3BT2L 5AFAA 5KZCD 4MCNA 3VX1A 4B9YA 1QSEE 4N0CC 5CSZB 4LSDA 5EH1A 4HG4J 1FYTA 4MB1A 3VFSB 2NX5A 3IDYB 2D9CA 4UNTA 3QJHB 3A5VA 3STBA 2UZYB 3Q2LA 1EJOH 3EJCA 4PJEE 3QXVA 5INCB 3T0AA 3VXTA 1YEFH 2IPTH 2O5YH 5DZVA 3WNPA 5CBAB 4HIHA 4NQCE 1OANA 4FAAB 1AD9B 4HIIB 4GAJL 5DUML 1VLXA 3QUML 1IC0A 3B2VL 1C12B 3ARUA 5HVWA 1OCCB 1J86A 3RTLA 1FRGL 4XI5D 2RBLA 1H3TA 3SDXB 3ERXA 3MRGA 4LCUB 1A25A 1HL8A 2BDNH 4MJHA 5K5YA 5CCKL 5JPNB 3RPBA 1OALA 1BIHA 1YJDL 4DETA 4XPGL 4KK6D 1BVKB 5DMGD 1P4UA 2R1XA 3GBEA 1SUHA 3X1BA 4P23B 1PW3A 3D2UA 5G2NA 2I32A 1L5GA 1WWWX 5IHBA 4UOJA 2HJLB 1G0YR 3IETA 2TRYA 3NPZB 4FRWA 2IOOA 4K23H 2VNCA 3SQOH 5C0IA 2B5IB 4Y4FB 4B50A 3GI8H 2A4CA 2H0EA 4JVWA 1TZOA 2NW3A 3VXUB 4HOZA 3I84A 4Y8AA 1I7UB 4MDIA 3ARBA 4AGOA 3QJXA 1E9OA 5L7XL 1UM4H 3FSOA 3X3FH 2M2DA 2IDUA 4L9LC 2R8SH 2UVFA 3K7UA 3PXHA 4TSCL 3X14B 2BJML 1CICC 1IAIM 2IXQB 4ZDHB 3A6CH 4X8CA 4HJJH 4G9FA 3HI1A 1JV5A 2XN1A 3HMXL 2IALB 5DVMA 2GIYA 4QHNA 5F1NA 3JWDH 1X7SA 4LLUB 3TO4A 1A7RH 4NN6B 5IVXB 2R15A 1IB5A 3C6LC 4MWFB 1JN6A 5DHYA 1RMFH 1YAIA 1G9ML 4F7KA 5JZ7D 3R8QA 1WEJH 1VPOL 2EH8H 2LFEA 1T7WA 1AZVA 4XE5B 1AKJB 2GTWA 4Z7WB 3F00A 4CAGA 2V37A 43CAB 3QUXD 3QXTA 1MI5A 5IZ7A 1L9MA 3NZSA 4PWHA 3BYTA 4QF1B 5F9JA 5FKAA 1I9EA 1D5BB 2DMBA 1U6AH 4R7XA 4PP1D 3O2VH 2WWMD 1FJ1B 1T0PB 5FOBA 5D1QE 5A16A 2TSBA 1KEGL 3ZYIA 1HNYA 2ARJA 4V1DB 2CO1A 3U7YH 4EXPX 4OFYA 4E9XA 4HF5H 5LNGA 4OCRL 1SEBB 3LKQA 4XN8A 4YPGA 2RALA 4IJ3C 1TG8A 5E51A 1ZTMA 4JCLA 4ZX4A 2OK0H 5BZWB 2ZWYA 3ESUF 2EYTB 2ADJA 4ZYKA 2JLPA 4YC2C 2DJUA 4TSAL 1BDYA 1NJ9B 3QCUH 2VC2H 5DMIL 2CLVA 4GSUA 4XWGH 3UBXA 3V6FA 3GRWH 4P0DA 2CKBH 2OS7A 3RA7L 3TA3D 1IZKA 2LT9A 2R0LL 2SEBB 2OYLA 4XXDB 4QR7A 2QADC 3M1BA 4J6RL 5AQ0A 5J8OA 1KEMH 3W38A 4NZRH 4AUJA 4WO4D 5HDBB 1RK0A 3I6KB 4V2CB 4EI5D 2EIEA 1A66A 3JZ7A 2A0LC 1RK1A 2Q2LA 1WBYB 4LSSL 2Y5EA 4WGWB 7FABH 5T1LA 1ODAA 5E2UL 3ARGA 1F5WA 3WFDL 1UWXK 1QW9A 5KS9B 1T1WA 1NSNL 1SPDA 5I8KL 4J4PA 1PZ5B 5CIPH 1U8IA 3SB3A 2LGNA 1LK2B 2A99A 4K5PA 2JV6A 4K8RH 4MBRA 1KWGA 3MREB 4JFWA 4S2SA 1HHGB 1B0IA 2ZX6A 1D5IL 2RFXB 5FHBH 3S96B 1AACA 1YDPB 4PJ6A 3O4LA 4KMQA 5EFIA 1KJ2H 5E8OB 4YHYC 3UTTB 3QZWB 1OB1B 4LGRB 3ILPA 1U8OA 3V6OE 4EZLA 1UB5A 2EDKA 3DETC 4KRMB 5GGUB 4BQBA 4WK0B 2D31A 4P59H 4F7PB 1OE2A 1UD5A 2I85A 3K5RA 3ZDXF 3ML8A 1ZIBA 4HKZB 4H88L 5DF0A 2XQYG 1N68A 3C60D 3ULUF 4OR1A 4XE0A 3CVIH 2AQPA 4WI7A 4ZQKB 1BVLB 1R5WA 2CJUH 3MCKA 3CPLA 1AXTL 2OMXB 3KGTA 5FYJD 3WN5B 1W72A 4FFYL 5DS1A 1FN4B 2XG4B 4ALAL 3S35H 1JHTB 4MZ3A 2AK4D 2XT1B 3V4UH 3HC4L 2WYIA 4AGNA 1ESOA 1U3JA 4ADGA 5K93A 3T3PB 1PYWB 2Y7NA 3FRPA 3VWJB 4ORZC 1H0DB 5AW0B 2NY1D 4OB5H 5DJAB 1OTUC 5DC0A 4ZJ9A 4TVPE 1UOWA 3IJ8A 4IMLA 3BVVA 4YBHA 3V0GA 3P0YH 3OXRA 4Y2NA 3LRMA 1JZJA 1M2OA 3BP6B 1SFHA 5DUPH 5I9QB 3T3MB 2KZWA 5FC9A 1CLZL 2WXLA 3P9WB 2Y36L 2GPZA 5CSBA 2BVQA 2F74B 1O6SA 3O8XA 2N56A 2Z7WA 2IV8A 1AGCA 3OB8A 5KZCB 1KLFA 3AQXA 5LN4A 1Z1WA 3UMTA 1CD0A 3KHOA 2H26B 4HS3A 1VACA 5KJ7E 4PYGA 3G6DL 5TQ0L 5IFHH 1HYSC 3ROLA 1FGVL 2DIJA 2XUWA 4XBPA 3MYJB 3T0ED 2QQKL 3KJ6H 1IVLA 3PGDB 5GGSA 3O0RL 1F4XH 1FAKT 3KPRE 4JQIH 3AY4A 2VLKA 2H3NB 4PGDB 2NT0A 2V2WA 4S0SD 5IM7B 3TYGL 1WT5A 4C55A 1YYMH 3NSDA 4J3XA 5F44A 4OT1H 4PV9B 1MCJA 2F5AH 2E9IA 2PO6A 1U4EA 3GIVA 3K2IA 4KK9C 1Y07A 4UIKL 1L9TA 4EIUA 1NEZG 5C08A 2A9BA 1CMOA 2IH1A 3DX8A 4HFWB 3SYOA 3HPLA 3VE0A 1AKPA 3E6FA 3GNMH 2HPTA 1FZJA 1KBVA 3OKDB 1EXUA 3IDIB 3PDDA 3Q1SL 4LLMA 5C0BD 43C9B 3L9EA 4F8TA 5CZVL 2DYRB 4UOZA 4TV3A 2XN9A 2YZ1A 3SY6A 1QVOB 3QR2A 3N9GL 3FQXA 5ITFB 3P4MA 3KXFE 2LAAA 1ZK5A 4KQ3H 3B7SA 1GA2A 2OMWA 2Y72A 3LS4L 4H5SB 4JO3L 4AH2A 4N2GA 3K72B 4OJAA 3IBEA 2ZXEB 4R4NC 4IGBC 3HCVA 2DICA 3SBWA 2GBVA 3ESOA 2DW5A 4OCSL 3OHXB 3QUKB 1SJXA 1TCRB 5AYUL 4Q6KA 4KHXL 1RHHB 4AQ8A 2NSMA 2VISA 3ULVL 4HYTB 4IOSA 3ZYJA 3D25B 3H2WA 4HKXA 4QPEA 3W9DB 3FTSA 3HHMA 5AALA 5HDWA 2F5BL 2ZSWB 1RH8A 4MMYB 5IW1B 3UTSE 3G04B 4H8VA 4ISVA 4KI5E 2X0UA 5DJ0B 5F9WC 1JZ2A 4JFDD 3GTNA 3QUXB 3LXUX 2DQJL 2K7QA 2Y07L 4NQEE 2OZ4H 3OD3A 4O5LL 3U2IA 4IRSC 5GJSH 4DTGL 4N25A 5IHUL 1AGFB 1A5FL 4MA7H 1JTTA 5JA8B 3QQ4B 5ETUB 5D93B 1AMYA 1DSFL 2VDKB 3EDFA 1DZ0A 3JYBA 3QR1A 5GZNC 5CEZD 1C9SA 1A7PL 3KM1A 4IRJD 1QR1A 1L9RA 3U9PH 1IGFH 1RZFH 2DQDL 3QHFL 3JTTA 2ZNXA 3T0VA 1NM4A 3H9SE 3LPGA 2FDBP 1XF3B 5D1ZC 3MO1B 3NCWA 2B16A 3G6JE 2DIEA 3RPKA 1KB5A 3TA3B 1DFBH 5GRVK 3NFNB 3LIZH 4BFIB 1V7NH 3WKQA 4WO4B 3GMMB 2EECA 4EI5B 5ANMB 1EO8H 2JKJA 3D85D 5EOTB 4PBDA 3F58L 2J8UA 4HAGA 1AIZA 3ATEA 1FF5A 1J0YA 4JFXB 3SDDD 5MEPA 2HA1A 2YD1A 3H42H 4E9YA 3V9FA 4BSWB 2E86A 3C5JB 3FSZA 3OR7B 1V7MH 5C0AD 3OX8A 4M1GL 3NA9L 1IEHA 4KVCL 3PG2A 3U1SL 4APXA 1FE8H 2YGPA 3B7YA 5IB1B 2YWZA 4GXVH 3ZKMD 5IIEB 3WLWC 1YC7A 2DKSA 4KJPC 2XWRA 3T6ZA 3D8MA 1SBSL 1I8LC 2AJVH 3C6SA 3GINA 3QIBA 5DURD 1CZ8H 5L6YH 4U1NA 2Y1VA 2WD0A 1J5HA 3RHWF 1EXGA 5FKPB 5I1HH 4FXTA 7PAZA 1AXIB 2Z34A 3F7VB 4U3XA 2K3HA 5EWIL 1BZEA 3DX7B 4XO3A 2PR4H 3C60B 2P52A 1FFNA 1AGDB 2G5BB 5SX5K 4DGWC 1RPQA 1ACXA 4EZMA 4EIBA 1W15A 4K3DL 2Y5QA 2N1KA 1INDL 1G1CA 3NUKA 1UCTA 3MJ8B 5I6PA 3P9LA 3MPCA 2LAGB 4MKTA 1MFUA 5CLTA 2DQHH 2AK4B 4K94L 2ENSA 2Y23A 4HUXB 2E9WA 2F54E 3PREA 4BKSC 2AITA 4XNDA 3D0LB 1S9XA 4GBXC 4XCNB 1VZGA 4PG2C 5ICYA 1IBDA 4R3SA 4B9IA 1WH0A 2NY1B 5IVZA 1J0KA 3FU5A 4LARH 2BIPA 3T8XA 4DN3H 5LQBH 3QEGL 5C9JA 3BZFB 3CSTA 4IKJA 3TO2A 2YA2A 4Z7OE 3W5MA 3WJLA 4PGJA 1J8HE 5MENA 1MFCH 2YD9A 3PJLA 1DVQA 4U6VL 3MA9L 4ZNEE 3TXAA 4XPFH 4FYRA 4H44C 1ZA3B 1DQJA 3K0YA 4YAQB 3MXWL 1MCRA 2XZCL 4I77H 4MA1C 4HH8A 4QXWA 1LDSA 2V9UA 3MV9E 5EUKA 1QRNA 4G6KL 5IROA 5A2AA 4HWUA 5KVEH 1CFSB 4X6BA 2EIDA 5HGDB 3DWTA 2IJ0C 1E9PA 3T4AC 3BDYH 3CFQA 2K70A 3MRMB 3MBEA 1CL7L 4DGVH 3MRBA 4B41A 4M48H 3GEFA 3T0EB 2Y1AA 4TNEA 3QO0A 2QTEA 6FABL 1BZOA 4G7QB 4HKBA 1KCSL 4WWKA 2CU9A 1MY7A 3DK2A 1KCRL 3L3JA 3U7WH 4PJHB 2W9LA 3Q5OA 2GJ6E 2NZ9D 4HA1A 1RZ8A 3LH2H 1D7FA 4HIQA 4APQC 1CO1A 2BMKB 1TETL 4M93C 1A1OB 2C9XA 4PJBF 1U33A 3NSJA 4OGYH 3D07A 1KSRA 4UQBA 4NKDA 1JWSB 3GMQB 4NWUH 1OLLA 2HXAA 4MRBA 3APMA 4Q56A 2M1KA 3ZE2F 4NUJB 5JIQA 1MFMA 5C0BB 1JVLA 4L1TA 3U0TA 1Y0LA 3L5HA 3WELA 3Q8BA 2X2YA 4TUKH 1TZHB 1R5VA 3NQIA 1WC7A 2PTVA 2GUOB 4U3SB 2EIZB 1HWWA 4TXVB 1FZMA 5EN2A 4PJEF 4UILL 3H6AA 4XAWL 3LB6C 3SO3B 3S3BB 2BW4A 3HRZC 1HZHL 4RX4D 2WB1A 5I8EB 4JQXA 3BD5A 3IKCB 3X13B 4EOWL 3MACL 4OCXH 4G1EB 1T03H 2VDRH 3U0WL 1FNSH 4TULH 1H5BC 3LKNA 3EHBD 3WHE1 3HZMB 3O45B 1RIHH 1A8JH 1K6QH 4QXGH 2W88A 3FO9A 4JPSA 3P4NA 4ODXA 5D1QC 4GG8B 3PUCA 5A2CA 1AZNA 3N42B 1BJMA 1OL0A 4FFVC 1JNJA 4LCWE 4NUGH 1GGBH 4ZUUB 2WQXA 4KJYB 4JFDB 4CKVX 2XVBA 3HFFA 4D3CH 2LABA 1JYWA 3DMMA 2YD2A 2B1HH 2X1PA 5E1AA 3L3IB 3SE3C 1JAEA 4ONHB 4AGMA 1UD8A 5TF0A 4ZFOA 2JKIS 1Z0NA 2J3SA 2Z3FA 1ES0A 2ERJC 1D5ZB 4W6XB 3FMGH 2DLGA 4IRJB 5FEBA 2PP7A 2EO7A 3IDMB 1KN2H 5E0FA 5CMAA 1X5MA 1YUHB 1A9EA 3MRLA 5F7LB 4FG6D 2EH7H 4Z7VE 4OI7A 1SN0A 3N04A 4D8PB 1OF2B 4FHJA 1IFRA 2XQ0A 5I8OL 2X2IA 2FO4B 3BN9C 4ANUA 3BKMH 3BVNB 5C6TL 5DFAA 1KGYE 4LKCA 2UZXB 1RZIB 2V7HA 1KYUA 4XCEA 3D85B 1KCUL 3JZYA 4R97B 5DI8A 4ETQA 4K3JH 2P8MA 2FX8H 4QHLA 3SDDB 1J8RA 6PAZA 4AEHL 4OTXL 1W8EA 4YHNA 4DGUA 5DZAA 1BZ7A 1JWMB 5C0AB 5A1AA 3A67H 4XP4H 4WNSA 5FS5A 2XG5A 4YDKH 3WNOA 1IGYA 3QUGA 2OMBA 2WTPA 3GBNH 3UC0L 2UUDH 3V6OC 1ET8A 4NC1E 5FDWB 4E9RA 2F7OA 3CVDA 3TJEH 4G8AC 4XCYA 1RUPL 2B39A 5PCYA 3IDJB 4A6YA 1GR7A 2EE3A 4Q9QH 1WYJA 2Z8WC 3HIZA 1Y6MR 3SEPA 3O3EB 3RG1C 2XA8H 1H8SA 3CFKA 3KPPB 4F20A 1NDGA 1HCZA 5DURB 3ZKXC 1HE8A 2QFRA 2X0WA 1E4WH 2VLLB 1OAKH 1XR9A 5HYEA 1NIEA 4XCFL 4KZDL 1MWAB 2FIRT 4TS6A 4KH2A 2XYBA 4HD9A 3BP4B 1GCFA 3GPSA 2FQDA 4TNWK 1JK8B 4BZ1L 4OGXL 5J7CC 3MMEB 5D2LB 1PAZA 4R4BB 4A1RA 3FUKA 1SXSA 5AW7B 3FFOA 3C9NA 4PJBA 3U83A 1J10A 1FL3B 2IOMA 1V55B 2WXPA 3IEAA 1YN7A 4ZSOA 1A3RL 3N1QC 1IAOA 1P7KB 4Y2OA 5DMJB 3VM7A 3KLAB 2WJ7A 3EUDA 4U3CA 1U8CA 4EN3C 3DA0A 2DZEA 5C0FB 5F8RC 1X7TA 1UWEH 4I2XE 2Y7LA 4CU6A 4NIYE 4RFOL 5CKGA 4I8DA 1RJYA 2BSSB 1VF5C 4H8QA 3RY5A 2WQSA 4Z8FL 1E6JL 4X4XB 4JCWA 1T1ZA 5HYJA 3GTVA 4QEGA 1RXLA 1FVDB 4MD4A 4IBVA 3T65A 3MUZ1 5I2IB 3EAKA 4NO0A 2FJHA 4F8PA 5CLYA 4KQ0A 2ZT9C 3AT0A 1T04A 3QFJE 3LEYH 4Q7DA 4IDJL 1MJUL 1NCDL 4YDIH 5DJDA 1W6WA 2ICEB 2EDNA 2PPEA 5L9DH 1EH9A 2WXGA 4OJDH 3T71A 4H1LB 2P24B 2ZKMX 3E3QE 4OLZL 1E6OH 5LGKA 4JHZA 2VW4A 5KVEE 3MX0B 3DUHA 4JPWH 4X6DE 4JFVA 3H7BB 4RMBA 2BLFA 2HX8A 2NNCA 2ZX7A 4GOSA 1IKOP 15C8L 3IMRA 4YXKL 1FYTD 4F7CA 3B5TA 2NX5D 1INEL 1XAKA 3ES6B 1T6WA 1MCWW 2KHAA 4Z77A 1KGCE 3KGRA 4HHAA 4L8SC 2DOCA 1JFHA 1NUDA 2F61A 5E4EB 1CYWA 3L7FB 1SM3L 3LSOA 3QZMA 3WOVA 1BVOA 1KIUB 3CMOH 1S7VB 3BOVA 4GQ9L 3EYSL 4DERA 2FSEB 4FQQB 4OM0H 1MHHA 5DVPA 3IJYB 3V6BR 3DGDA 1OCOB 1T1YB 4UT7H 2YMXL 1VADB 1MCIA 4KXCA 1E4KA 1TNNA 2CRYA 5KUKA 4QJ5B 4HULB 3CUPB 2OXHB 3BGMA 1EFQA 5JOFA 1RJLB 2X88A 3QPQC 4N26A 1RFDH 3WO4B 4A2FA 2VR7A 1FFOA 2XFXA 4UQIM 3BESR 4ZXBC 4IK6A 5ALBL 1ZHBA 2IDFA 4KI5C 4N2DA 4P3DA 3MRJB 2K8QA 4GLRH 5E5MB 4FA6A 1OTTD 3EFDL 3GSNH 1BG9A 2E6JA 3JWDC 3UJIL 1TJMA 3EHBB 5IJDC 1CGYA 3ARBD 4LEXL 1II4E 1ZVNA 5KSVB 5D1XC 2DJ4A 2LFGA 3LN9A 4XPTH 3SKMA 2ED6A 4B9KC 4P4RA 4K9JA 3GT6A 4U1KA 1P1VA 1KN4H 4G9FD 4U4BA 4U31A 5FUOH 3T08A 3II1A 1D6EB 2A83A 2RHEA 2VAAB 1U8KB 1BM3L 2O30A 2K8MA 4KX7A 3ELQA 3TO4D 5H94B 1KF9B 1NMAH 1P9MC 1U95B 4U1HA 5AD0B 2BRQA 1ZLSH 4P8QA 4FN0A 4UIMA 4WDIA 4HX1A 5I1CH 1RD6A 5MHSE 2CH8A 1TKWA 3FUMA 4D9LH 4AL8C 3DX1A 1MI5D 1P1ZB 2JJUA 4FI8A 2VH5H 3IB4A 5HPMB 4HVBA 2J1XA 2VL5B 4L3CA 5I1JH 1F11A 1NL0L 1DBAL 5T1DL 2OJZH 1TITA 5IMLA 4OFYD 4UNIA 1SYVA 4YBQC 5C0JA 1BQRA 1G7IA 4H0GA 2OTUB 3Q13A 4TQEH 2VDNH 5BMFH 5FYLH 1OT1A 2A6IA 4QRTB 1Z9PA 1ODUA 5DUBB 1QOKA 2MQGA 3H55A 4B9ZA 4L4TA 1JPTH 3US0A 4FA8A 1AZZC 3H9HA 1JE6A 4ZW7A 2WSPA 4HEME 2OR9L 2C9UA 4PJDE 3S36H 5HHXH 1BJ8A 4PJFB 2EE6A 2VDQB 4K8RC 2BHYA 1WFMA 3UBHA 3IJEB 4MNQE 2X4RA 4NYLB 2BY0A 1ZLWH 4A37A 5T1LD 5KSAC 5MI0B 3M45A 2BSTA 3ARGD 2V3EA 2VXQA 3DX0A 4LEEA 5K39B 1CR9H 1A4CA 3VXQB 3GHEH 3CVHB 4KV5E 1WIUA 2Q8AH 4J4PD 4ZAKC 1DCLA 5CHNB 3G6JF 4S1QL 1NAMH 1P2CB 4LPUA 3EJYD 5TFSH 5K33A 2X10A 4G80B 2Z31C 3VRJB 4XVUC 5HSFA 3QXDA 2H8PB 2JIXD 5JXAH 3VFWA 3O4LD 4PLJC 4PWEA 3LXBA 5HHQA 2JE8A 3JVGC 4I3SL 1AR1D 4LSRL 4YNYB 1XGUB 1KC5H 1YJDC 4HUVB 3RUGE 1FG9C 4NKQB 1BAFH 3B9KA 3FCGA 3BAKA 4DSYA 4PMFA 3CZNA 4GSDL 4MX7A 3L3HA 3FU6A 5KBKA 3J2PA 1UVQB 3FT2A 4XBGB 2GHWB 5I6KA 2X6UA 2ZKHH 4C4BA 3HC0A 3O4OC 2ZXQA 1DDHA 2I07A 3WFCH 1A3ZA 2O5ZH 1KCVH 4K9EL 4UV4L 3K6IA 2HKFL 4W9EC 1FV1A 4J8RA 4F2MB 1NIAA 3FC8A 3NCEB 4NSKA 2EKJA 1YEGH 3PV7A 5HVGB 5I5IA 5LGYA 2ITDA 1XGYL 2R29A 3VFPA 4JG0H 3VRIB 1RAMA 2QSTA 2R2CA 3L2MA 3ZXAC 2EVGA 4BGLA 4ZUTB 5FO2A 4TRPH 1JGVH 1A7BA 3FT3B 2PPCA 3MLTA 2Q9OA 2QGCA 3BE1L 4F33B 1S7QA 2CIKA 2UXFA 3BZEA 3FQNB 1UM5L 1HINH 1JNNH 5E1IA 3TEYA 4EIGB 4M8RA 2A9NL 4XH2A 4KKQA 1G9MC 4GEIA 1XH0A 1ZIAA 2AXWA 2VITA 2ORBH 5TK4A 2DBJA 5J6HB 2X6MA 3RX9A 1F1AA 3B7RL 3CE1A 1ZGLP 2EADA 1T0MB 5CGYD 5BW7C 1HDMB 4M4RA 1KLGA 2BNUB 4FTDA 4F8NA 3MRNB 1L0QA 3JV6A 4PVMA 2IVFC 5JOPE 4RGOL 5LXVA 4Y0GA 3O8XD 3I02B 3TIDB 3D3VA 2UX6A 4JMNA 5F7BA 2MNWA 4X7EC 3WG7B 2AABL 1FYTB 4Z7OF 2FE0A 2NX5B 2EE2A 1C5CL 3ZKND 3QORA 1KCBA 2P9RA 3GK8L 2A6KA 4XNYL 2LU4A 3PU7A 4JHWH 5FM8A 3VXTB 2AMGA 2VLKD 1UWYA 4HIHB 1RUQH 2OM5A 3GZQA 4FQ1H 3C2AH 4HUMB 2APFA 2PO6D 4YXHH 3IDNB 4Q6IA 4X7DC 3IPEA 1VCAA 3BZ4A 1X4YA 3MRGB 4LL4A 5C08D 3POHA 2OQJA 1CLOH 3BPNC 3ZTJG 2NXYC 5E8DL 1WWAX 1DANT 2VWEC 4G7VH 1N70A 2CHXA 3LH9A 2E46A 3U0PA 1CTMA 4RRPA 5DRZA 1SMAA 3OWRA 2R1XB 4JM0A 2GEEA 3UTSA 2XN9D 3T6VA 5AENA 4JDEB 4M7ZC 4GLRI 1RZJH 3D2UB 1CDHA 1NIDA 5KYWA 5DD3H 4BFNA 1RHFA 4XMLH 3IETB 3SO5A 1YQ2A 2J5LC 1IGIL 1FH5H 5C0IB 1WTLA 2WOYA 4O02H 2NW3B 2HP4A 4WV1A 3CD4A 4MDIB 3ARBB 2GFBA 5DWPA 4D0BA 4X4YA 3AXLA 3FQ1A 3BN3B 3N41B 1E9OB 1IT9H 5JHBA 1M3IA 4A63A 2N0KA 3HG1E 5E6IC 4AYEC 4XP6H 2R0KH 1YPZE 3BPLB 4ELKB 3NQKA 2I9LA 1TJGH 5T5FA 4G9FB 3HI1B 4PBVC 4X8JA 1JV5B 1ZGLB 1CXLA 4YSOA 3PWNA 4QHNB 5F1NB 1MAML 2Z91A 1ICTA 4IOSD 3TO4B 1T5WB 2IG2H 1PJWA 1JN6B 5DHYB 1MPAL 4ALAC 2B4CH 3IFNH 2DM7A 4KKAC 4NZTL 3BH8A 2COQA 2IBZX 2P5EA 3B9AA 2GTWB 2WLIA 1TTAA 2BFVL 3N3EA 3VFNA 1N59A 4A66A 4BE6A 1MI5B 5F9JB 2X2JA 2PXYD 2ODHA 5FKAB 4NPYA 3R1GH 3V4PA 4Y16C 3ZT7A 3GRWA 3RJDA 1E9QA 3FU0A 5FOBB 5A16B 2CKBA 4S0TD 3CZJA 3ARQA 4XB8A 4Y7OC 2ARJB 2X44D 4FXGC 4WWID 5F8QC 3HE6C 4MNHA 4DEPB 1RU9H 3LKQB 2CR6A 3RJQB 3EUUA 1OPOA 3QC5X 1JXJA 4YPGB 2AXFA 1TQVA 2VXSH 1A3LL 4UQ2A 1A7NH 2ITEA 4ZYKB 3ULUD 1IM9A 4JO4L 4W6WB 5BUPA 2CLVB 3UBXB 1Z7JA 2WPGA 3EADA 5HJDA 3V6FB 3H54A 5GGTL 1R24A 1CPUA 5TPWH 2UXVA 1HXKA 3VD3A 3KR3H 2VLME 2W60A 4ODHL 3JWNH 3GM0A 5CIPA 2ZUQB 5F0JB 1GYCA 1A6TA 3MV8E 5FYLE 1PLCA 5J5EA 4P49A 1RK0B 1DZBA 4X50A 4LLQA 1RK1B 4O2CA 1Q90A 2D7NA 2ADFH 5T1LB 2TAAA 5F97E 3ARGB 3VYPA 5TQ2H 3L4XA 1DBBH 3CHSA 1T1WB 4Z0XB 2ZCKL 1DBJL 5CD5C 1LO2L 4JX0A 1U8IB 3T8MA 3K6OA 4KRNA 3HW7A 3QHZH 4S2SB 4JN2A 3VGGA 4JQVA 2JIXB 3IRCA 3O4LB 5AYQA 1JIBA 1JRHH 4UTBL 5I71C 2F54A 5J4MA 1AR1B 5H8DA 3SKJL 3LOWA 3QIBD 2EDDA 1NCHA 3ILPB 4YX2H 1U8OB 4DP8X 5IOKA 1WICA 1UB5B 5T33H 5T3ZD 2D31B 1ITBB 3STZA 1EHKB 4TOYL 4ZW5A 2HLFD 2IBBA 3KCPB 1NFAA 1J8HA 4DPRA 3V0HA 1R5IA 4HBCL 2EIJB 2A3TA 4AITA 1NMCC 4XXCA 4C56A 4DIXA 4FABL 4LB8A 4GUPA 1FO0L 4PRIE 1EEUA 1R5WB 5EV7A 3MCKB 3CPLB 5DJZA 3WAJA 2EILB 1W72B 3GXMA 3MV9A 4KPHL 4X5WA 3RY4A 1Q0YH 1XEDA 4M00A 4KNSA 3T09A 3RX5A 3FB8A 1CFQA 3N1PC 3ZT5A 1G9NL 1OAUH 5E03A 5B7EA 4YHPA 3Q9QA 1A9BA 4XN5A 4KO5A 5D6DC 4YQXL 3ULVC 4P46C 1IE5A 3FRPB 5DD5H 5MERA 3HI6H 2DM2A 2L8AA 2H4EA 1P6WA 3Q43A 3EH4B 3L1GA 4M56A 2YFOA 2VZVA 2VR9A 4LU5H 2XZAL 3QWQB 4M5YL 1TMCB 4IMLB 1T6VN 3BVXA 3EIFA 3OXRB 3KL0A 4JY4A 1RP8A 5F72S 2CNZA 4CC0A 1AHWA 5MEND 1H3WM 4XHJD 3VXMA 1LEIA 1L7IL 1EGJL 1K8DA 1N26A 3NZHL 4ONOA 3ISRA 4H8WH 5CU9A 3GHBH 5I74B 1EAJA 2D7PA 2APXA 1XGQA 3GSQA 1GZHA 4JQIA 2BVQB 4KKRA 1QRND 2ICWB 3O8XB 3RIAF 5IROD 1A6WL 2HT2D 3FL7A 4J2QA 4KHTL 5FFLA 1AGCB 2DMCA 1KLFB 5ISZA 3K8KA 1ILUA 4HS3B 4FADA 3ROOA 1VACB 3MBED 5GS1A 3KYOA 1MH5B 3FW6A 4M7LT 3NFPB 2FD6H 5DEFA 4YH6A 3ROLB 4N1HB 5GGSB 2VLKB 1IFGA 5E2WH 4WWKD 1WCBB 2V2WB 4O58H 3N2JA 4UUJA 4UAOC 4W68A 3S88L 1U8NA 2OL3L 1BQKA 3BKCL 3CN3A 5JNYA 3CK0L 2OMTB 2PO6B 3A3YB 3GIVB 3IU3A 2FEEL 4RAVA 4F1ZA 4AI7A 1EHAA 5I5JA 2KZ1B 1A14L 5C08B 3O6ML 2IH1B 1QUNB 3DX8B 3Q6FA 4JZJC 4GT7A 3BH4A 2PPDA 3HPLB 4MYPA 5JIHA 2K4AA 3VE0B 4HJIA 5B1JA 1FZJB 4F24A 1JYXA 1EXUB 3SGEH 4DN4L 4LLMB 4E9VA 3UO1H 4X6DF 1ULVA 4XMTA 2XN9B 3VXSA 3OAUL 4GAGH 2WAHA 4LCWA 1RUML 1BV8A 3V79C 4HSAC 3FQXB 3EO9H 3P4MB 3U4KA 1JXKA 1RCYA 2VDMH 3QCVL 4I9WE 5I6LA 4OJFL 2FUTA 2BRRL 2A74A 2OMWB 3KEDA 2GEQA 4AH2B 2YMTA 5C0ND 4PRPA 2YEQA 2WNKA 1M6OB 3HCVB 3IJ7A 4PRNA 4G7YH 4LVOC 3KS0J 2B9BA 1CE1L 1QNZH 3CG8A 3RL2A 4EUPA 3WHXA 2VISB 4N0YL 3U25A 2YARA 1FNGA 2JSFA 4JO2H 2R1WA 4HKXB 1FORH 3M88A 2MOGA 3UTPE 1S7TA 2NY0D 2QJDA 2VAJA 1S78D 5AW9B 2G0LA 2GKIA 3K2KA 2VR5A 5FYKD 4ISVB 1Q4NX 2WQUA 2ZYIA 3O2DH 4OKVA 1KDIA 1N0XH 5C0CA 4KNUA 4UDTB 3FB5A 3DO7A 3DMMD 2PXYB 3AGWA 3W1ZA 3GF8A 4AG4H 5GJTH 1RZGA 3E8UL 3GMNA 5DO2D 3IVKA 2VN4A 4XPHL 1DJYA 3DX6B 5D7LD 5LBSL 3A4FA 4HUCA 5HYQA 3PFQA 2BIOA 4GG6F 4IOFC 2FX9L 2VQTA 5D72H 3VA2C 3RKDD 5GS0H 3LIZA 4FNPA 2IH8A 2OW6A 2IH3A 3MLXL 4TLTA 4OZHA 1QR1B 1QSFA 1E4JA 1L6XA 3QNYA 1Q72H 2WSKA 1SZNA 4XCCH 3US9A 3ATBA 3JTTB 1PLGL 4AQEA 1PD0A 3E9TA 4HJUA 1NLBH 5J06A 3Q01A 5SWQA 4EDWL 4L8BA 5CLZA 4HWEL 1C1EL 1WFOA 3QS3A 1KB5B 2ZE0A 2ZUXA 2YBGA 2D03H 4G72B 1D5MA 4HIXH 4G83A 3TEXA 1ZEAH 3HNTL 3NCYS 1CGUA 1R3LA 2MWCA 3MLRH 5AOZA 4LBEA 5DJCA 2J8UB 4WUKL 2IQAA 3DHJA 3D4YA 4NHCH 4XO9A 5MEPB 3AS1A 2QKIA 3JWNE 2JJWA 3LH8A 1ILSA 4L9DA 1MJ7L 2CBTA 2DMHA 4PI0A 2E27H 3OX8B 2GTZA 1BOGA 4GO6B 5AOMA 1N8OE 2BVUA 4NLHA 4APXB 1Q9LA 1WP6A 1R3KA 1JRHI 1GY1A 2I9TA 4WCYH 2WGNB 3F7KA 4JZNB 4NKOA 4PJGE 3RL1A 1JFQH 5KUMA 3RURA 3G5ZA 4GW5A 2WUBL 5A2BA 1WG3A 3C6SB 4AUYA 2X28A 1LK3H 3QIBB 5C8JA 1F02I 4QOKE 3EOTH 4K5OA 4WW2F 1J05A 3F04A 2ZUUA 2JKXA 1X5LA 4JFEA 4U1NB 4HCFA 3N5AA 3ZGIA 5T5NG 5E2VL 4NZUH 4GSXA 4PJDF 4N5ED 5IBTL 4OM1H 2E9GA 4I2XA 1AXSA 4X4ME 3X1NA 3D34A 1T2JA 2WMPA 1FFNB 2Q2EB 2QSVA 5AKVA 5DVKA 1IAIL 4OQTL 3T2QA 2MKLC 2ARJQ 1IAKA 4KV5F 4LLWA 4HEPA 3P9LB 3IE9A 1CGSL 5GS2D 1JUFA 5JHLL 1RQ5A 1IGTA 3S3PA 2AVGA 2YAHA 2EXYD 3EW3B 4OJYA 5EULV 4R7NA 1S9XB 2NNAA 1LYQA 4D0CA 5ICYB 1B4LA 1TZAA 4LNVA 4EQ2A 1MCCA 3RUGF 5IVZB 4PPTA 1M05A 5HHVH 3T8XB 4J3WA 3CC1A 5C9JB 3FFCA 3TO2B 1BQLL 1XIWC 4RIRA 5MENB 3OKKA 1B9ZA 1CGWA 3I50L 1O7DE 3O6LH 4NN7B 2NY7H 1DQJB 4P9HL 4FLHA 3BX7C 3NIGF 4OCYH 5EPMA 4E9TA 5FF6A 2QVTA 4FQIH 2LW3A 5HYJD 4BSVA 3WIIL 2D7TL 2E6QA 3KBHE 2LHAA 5I73C 5EUKB 4R8WL 1QRNB 3U9UB 3UZEC 4NO0D 1LEGA 4JLRA 5FO7A 3I9GH 4X6CE 4D9QE 1PFOA 2XN0A 3AWEA 4X6BB 3KPOB 4QO1A 3K6FA 3QIUC 4UYQA 3RY6C 1E9PB 1PAMA 3QZLA 3CQFA 5F1IA 2NZ1A 1MIML 2ADIA 3MBEB 4GRWB 2MCG1 4HXBH 4ZOEA 3MRBB 4ZO9A 1UENA 5GHWH 5K59E 2XKSA 4IKKA 3AS3A 3WL9A 3EJQA 3QO0B 3CAFA 4ZPTA 3AFLA 3L48A 4G6JL 3VQ1C 2HFFB 1UA6H 3RZCA 4HKBB 5HP5A 4WWKB 3UCQA 2X6AA 1U3HC 4LPTA 3L3JB 4WHYH 2FJGA 4BXVA 1RZ8B 5DHVH 2MSPA 1IC1A 1UJ3C 3HHRB 2FEJA 5IQ9A 5JTWA 2OYKA 4FNTA 2BC4A 2X7LA 3VTMA 5BZDB 1L6ZA 4P2RE 3SDCC 1AC0A 5DDHA 4YXLL 3SGEI 1RSYA 3MLZL 2WW8A 4NKDB 5C07E 3PWLA 4ORGA 4GG6A 1JTPA 4H8HA 1GMIA 4OFDA 4PHXA 2NSXA 3WKNA 3FK3A 4B9GA 3CU7A 2LLNA 1QWNA 3U0TB 3FO1A 4NWTL 1CN4A 1FBIH 2YEVB 5KJRH 4K3EL 4LFHD 1R5VB 1AQDA 1WZLA 1WC7B 3SJVA 1EK3A 1BZ8A 5EDSA 1VENA 3CN1A 1KOAA 1T80A 4XTRD 3HNSH 3LXCA 3K81A 5EN2B 5TD4A 3NIDB 4LNRA 1A0QL 5CJXA 4GI8A 1BHGA 3UJTL 1N3NA 4I3RH 2X9XA 4GFTB 1I3UA 2MEJB 3IDXL 2KERA 3S98A 3ENEA 4JREB 4R84A 4FCHA 3LKNB 1NBQA 4ERSH 4XBMA 4JMXA 1DVZA 1JZGA 3PAZA 4J8QA 1KTBA 4ODXB 3VH8G 3P4NB 2EO9A 3CFUA 2NY0B 3IBOA 4JM4L 1X5JA 5D71H 3HAEA 4LE8A 5LCVL 3TWYA 4E9LA 4JE4B 3TZVA 1ZLUK 1JZDC 4KK5D 4R4FH 1EMTH 4QGTA 3DMMB 1KCWA 1HL9A 4ZMOA 5E1AB 2YAQA 1U8JB 1U2YA 5I30L 4WSJA 3OJMB 3SE8L 5D2NA 1H8OA 2C34A 4GKLA 4WW2A 2XIIA 2DB8A 2DIBA 1ES0B 4J6RH 5DD1H 2XWCA 5AB9A 2TSAA 4HEMA 4PJDA 2BVTA 4K2UL 5HYIA 2DEXX 4WQOA 4O2FA 2CPCA 3ABGA 3NAAH 1YPZF 5CMAB 5FV2A 1MHCA 4YSUA 1A9EB 1S2EA 4JY5L 3RE0A 4ZTOL 3B7UX 3UL4A 3VO0A 4KKBC 2W59A 1RZKH 1R47A 1VZHA 3EJZD 4Q9BA 1KCLA 1JMXA 3EH3B 2FHBA 3GMLB 4KFMA 1UGNA 1NFDA 1I3GL 3DHUA 4PLKD 4HGKC 3UYRH 2V7HB 4XCEB 4XNZB 1I9RL 1S5IL 5SWZE 4L4TD 4ETQB 5DI8B 1KELL 1L9QA 2P8MB 4IBYA 4QHLB 5I6OA 1OXYA 4YHNB 1KXHA 4RZCB 5CO1A 1BZ7B 3JWOH 4OV6F 3RILA 2XG5B 1IGYB 3GIZL 3ISWA 3CCHB 3ME0B 1W8OA 4OFVA 4NQSA 5BRQA 2IPUK 2G60H 1WK0A 3PHOA 5EZLA 4LL1A 3BW9A 4Y4KA 4A6YB 5FYJL 3PS6A 3S2CA 3QIWA 4Y5VA 1Z3RA 3SDXE 1RVFL 4ABUA 3MOQA 2FEEI 2HTLD 4BRVA 4YSSA 1NDGB 5GSVA 4WO0A 1UWGH 4JJHA 1MFNA 5C9KA 4XPBL 5LGJA 3WTSA 1XR9B 3RWFA 3ZUNC 2FHFA 1EHXA 1JNHB 5FHAH 4P3CH 3P3UA 2VR3A 3B9KD 3LQMA 3BIBX 4TVPD 2WBJC 4LASH 3VXUE 2E7DA 5DA0B 1E4XL 3I3EA 4U3HA 3OZ9L 1CLCA 4MRCA 1MHPL 1Z5LA 5CILH 2X09A 1GGYA 4Z0BL 3VA6A 3C9NB 4OUUA 4JHAL 4PJBB 1DJWA 5JXEC 1EHNA 3CDZA 1RULH 1YN7B 4ZSOB 4R26L 1GMEA 1IAOB 4MA8H 4Y2OB 1ZSHA 2Y3AA 2EDOA 1U8CB 4XP1L 7TAAA 5EZIH 1B4RA 1IGJA 2BZ7A 3AB0C 1DP0A 3VG0L 3T6XA 3GZOA 3RWDB 1J88A 2HCZX 5I15L 1RJYB 1S9VA 2VDKH 4FCAA 4Z7WE 3S6CA 3C09B 5E99L 5EEWA 1T1ZB 3N44B 5C92A 5HYJB 3AG3B 1FL5A 4MD4B 3T65B 4P99A 2AEWA 3K2UL 5BVPL 4ODUA 1NPUA 4NO0B 1XVSA 4UANA 4V1DE 2FECL 1T04B 3VTAA 2XKNA 5DJDB 1XGZA 2WYHA 3QI9C 1JK9A 4P5SA 4Y2DC 5CGTA 1S3KL 3RWCA 3FNKA 4Z95H 4R2GC 1WA1X 3BP5A 2XHNA 3VD1A 4NC0B 3TLRA 3D3VD 1Q1JL 5EIVA 1E5UI 1XHHA 4B95C 1NM9A 1RPKA 3VNZA 1X5YA 3UP6A 3W9EA 4F7CB 3U9WA 5DJ6A 2C5DC 4GRLC 1R3IL 3BPCA 1CBVH 2QHLA 5T1MA 3RVXD 3QORD 4ODSH 4BQ8A 1PZAA 4HIJA 4Z77B 4XZUA 1RPUA 4AVKA 2EIKB 1OARL 4HHAB 1HCYA 5I24A 4E2OA 4F27A 3FPXA 4KRPD 1P84J 1SMOA 2OJ1A 2LOEA 2QQQA 3LS4H 3GUTA 4ZS7H 3LSOB 5AVZB 5BUAA 3I9PA 5FWQA 2EDYA 1PGRB 3S3SA 1B2WH 1MHHB 2YOAA 4HOXA 5EZOL 5CCGE 5F9AC 4PW4A 3GWJA 1CU4L 5FW7A 1IC5H 3H8NA 4GAYA 5FA3A 2WBXA 1F6LL 2PWEA 3ZHDA 1GC1H 2CGRL 2Q0ZX 3BGMB 3UTTE 5JOFB 3FUDA 5B7MA 3VD7A 1WZ1L 3UTSD 2F8XC 2PETA 1FFOB 2XFXB 3DJTA 1MQKH 1OGTA 5EIIG 3DURA 1AP2A 3UZQA 4LKXA 4ZMNA 3DV6A 2CM5A 3KCWA 4P3DB 1RJCA 3DSFH 5FM5M 2IGLA 3FCSB 3MRRA 3IS1X 2E5EA 2B4CC 3SKMB 3IMWA 3KH3A 4N0RA 2AJ3B 3AQDA 4Y5XC 4U1KB 4UZGA 1ZLVK 3WXWH 1Q0XH 2HKAA 4PWFA 1IAII 4LSQL 2A83B 3L3KA 5CJOL 1QFWL 3V0WH 3HC2A 3GLAA 3T5WA 1CCZA 1RK7A 4KROD 4NENA 4U1HB 3T3PE 1GIGL 1YRKA 4FLOA 1KJVA 1AY1H 5DRWA 4ES8A 4UIMB 4WDIB 4HX1B 4L8CA 4E9QA 2P5ED 5D5MB 1SHWA 2KL6A 4L1SA 5JW4N 1JZ5A 4LOFA 1P4BL 4FF9A 2YSSA 5DR5L 5AL0A 3TVMA 5C0RH 4OGAC 5CN1A 4L3CB 1F11B 5IBLD 2VDOB 2D2OA 4KITB 1U58A 3O6FA 4KZ0A 3OPZH 3JV4A 4MVBC 2EVHA 4M1GH 4QJ4B 2BVOA 3JWNC 1SYVB 3NEXA 5C0JB 1LDPL 3FQTA 4ATTA 2J88H 3CFCL 2E7LA 2V9TA 2ROYA 1IM9D 1LQBC 2DDQH 1KXVA 2L3BA 3FULA 4PY7A 1NKRA 2HPOA 4L4TB 5ABAA 3TNNB 1QI3A 3MJ6A 2IAMA 2LE9A 2X12A 4CMHB 2UY6A 3MGAA 1KY6A 1FNLA 3U4EA 4JHUA 2RCSH 2BERA 1NAMA 4G8IA 1A6ZA 3QO1A 3TFKC 3FUJA 4WF7A 4KK8D 4RRPM 1SHXA 1B3JA 5BJTA 2DD8L 2FGWL 1TU2A 2IQ9L 3MLUL 4PTTA 4LCYA 2X4RB 5CJQL 3SN6N 1OOAA 4MQ7A 4FTVA 2BSTB 3I6LD 3QJTB 1URIA 2KYIA 4OW6A 2BOBA 1CG9B 4AK1A 4N9OB 3GD1C 4WENB 4R0LC 5GZNA 7PCYA 2D3LA 2CE6A 1URZA 2ADGA 2BSBA 3QXDB 4RAUA 4TL4A 2BPBA 1H3PL 4YS4A 1GJIA 4R7LA 5HHQB 4PS3A 4AMKL 2F54D 4YWGL 1XGPA 3BISA 1QO3A 1RERA 3B9KB 4MLIA 3UH8A 1NCBH 1HKLH 1KB9K 3L3HB 3WD5L 3TT3L 2X6BA 3FT2B 3HC0B 3RFRA 4DPAX 1DDHB 2BHUA 2I07B 2HMIC 3TT1H 4P2OC 3R8BB 1A64A 1J8HD 3QG6A 4D9RE 3RVUC 3L1OH 4J8RB 5DCCA 3PL6C 4NSKB 4UOW1 4C56D 5JLZA 4W81A 4NERA 3QFDA 2ITDB 3VFPB 4TMPA 1O7DC 3BPOC 1JPSL 3WFBL 3ZLQC 3FRUA 2YKLH 2XVKA 2C3VB 1XD0A 1HIMH 3MLTB 4ZT1A 5DVOA 3IAQA 2EUVA 1S7QB 2CIKB 1F3RB 3ILQC 1FIEA 1CL7H 1AQHA 1V54B 2W0FA 4H8WC 1XDTT 4OI9A 1F86A 3RIFF 3AVEA 4XH2B 3G5VA 1XZ0A 1DHKA 5CEZH 4M6NL 3LKRA 1GPOH 1OP3H 6FABH 4U1GB 4HH9A 3CIAA 4PJ9A 3X11A 2FK9A 1FLRH 1WFNA 3RNKA 2VITB 1E90A 2HTKD 3OXSB 3CSPA 4K5NA 5I66A 1SLUA 4WGVB 3VXMD 2IPUG 2B2XL 4HQQL 5BV7B 4M4RB 3Q8CA 1KLGB 4DUWA 2HYMA 3JV6B 4U6XA 1J1OL 4R90H 3HFMH 1HHHA 5EA0H 3WTTA 3D3VB 1EHLH 1RIVH 5ISZD 2W9EH 2C9AA 5CFAA 1FZKA 1JZIA 3SPGA 2JKRM 4ZO6A 4MCMA 2F19H 3QORB 4OCWL 4ZOCA 4XOBA 1KTRL 2A6KB 3MV11 1N6QH 1FGNL 3NCXA 5ANME 4MA3A 5DS2A 1FIGL 4KRPB 12E8H 4N22A 4PQXA 1VEOA 3WFEH 4WJKB 4WTWA 5ERWA 3QJQB 3CQQA 3NSYA 5DVNA 1ZLWK 1BZ9A 2DKUA 3KL3A 3UTZA 4F2FA 4Q9RH 2BS9A 4X6CF 5EC2B 1T3FA 4WNQB 4Y1TA 4Q6IB 1WUNT 2Q20A 5ICZA 3ATAA 2OQJB 4O02A 3Q8AA 3IJHA 4HJ0D 4GMTH 1MZZA 4TLSA 4CBZA 5K59F 3RNQA 1MWAH 2HH0L 5A2JH 3U0PB 4A7GF 1H3VA 5I0WA 5DRZB 4XNAA 5HYFA 3UTSB 3W2DL 4WIQA 3VXSD 3F62A 1JPGA 1HWHB 3HNVH 4N20A 4LCWD 2EE0A 5KYWB 4F80A 3H85A 2WCPA 1AOHA 3RTQA 3QAZC 5EO1B 2W92A 3DUSB 5JUEH 2AJUH 4WV1B 1BYPA 2AEPH 2DLIA 4PRPD 3DTUB 4D0BB 2GFBB 4RISH 4X4YB 3AXLB 1TF4A 3BJLA 2VSMB 4BV1A 4HP5A 1Z0MA 5D7SL 1P4IL 1PZSA 1PLBA 4M5ZL 2A9DA 2I9LB 3V0AC 4GXUN 3VWKC 3GB7A 4X8JB 1NGQH 3PWNB 3T2NH 2ZD0A 2AK4E 5KEZA 2Z91B 4G1MA 3KH4A 4ANVA 3O2WH 4KROB 3QUZC 4Y89A 4HOMA 1F4YH 2BFGA 2V9RA 2VMEA 1N0LB 2ZPKL 3L45A 3QQDA 1G9NC 5GS0C 1ZJAA 2L7QA 3QW9A 2P5EB 3TIEA 2CSPA 4HG4K 2WLIB 2EEAA 3F65A 5C0CD 5I5RA 3VFNB 1N59B 5E6YA 3TC9A 3QRLA 3ZDWA 3RKPA 4UMSA 3DO4A 1M71A 3P4OA 4NPYB 2BSRA 3V4PB 5IHWA 1MLCA 1E9QB 2B1AL 3INOA 2CKBB 5LUMA 3UP1A 3C5ZA 2D3NA 1PDKA 4MNHB 1AJ7L 3IDYC 5GRWA 5C86A 2WWNA 2HVJA 4G7RB 2O5NA 4H1LH 4U1JA 5D4IA 2VMDA 3W39A 5HJ3A 2AXFB 4DFHA 1QSFD 4WWPA 1GKEA 4UQ2B 2VR6A 3IXAA 2F7PA 3GJFB 1IM9B 1IEBA 2B0SH 1ADQL 3SDAA 3CVHL 4K7FB 4FQJH 4GAFB 1R24B 2EC8A 5DXWA 4IRZH 1AANA 3FHAA 4DGIL 5DQDL 2W60B 4Y9FA 3OKNA 3T0EE 5CIPB 1YEKH 4BA8A 4QOKA 1A6TB 4M7JL 1IKFL 4M9PA 5JPNC 4GO8A 5C3IA 5F7FA 1OAXH 4HWBH 3CLEH 3C08L 4LLQB 4RSVA 4PJHE 3WTWA 3L3DA 4O2CB 4QI3A 2FL5A 1MRFH 4PTUA 1DL7L 3E7JA 4HXAL 3VG9B 4HUNB 4Q8BA 4NS0A 4P23C 4U33A 2B77A 4XBEL 3L2LA 4OGXH 4PJCE 3GXUB 1IUZA 5I1EH 3V8OA 1MIEH 4P57A 1YN6B 5IQNA 4N8VA 2B5IC 3WHE0 2ZX9A 2A1WL 2C7FA 3KGUA 4XN2A 4RGNC 5C0BE 2UY7A 2FB4L 4FFTA 3HG3A 4JN2B 5HPOA 4RQQA 1Y6NR 2F54B 5AW3B 4J3OC 4AQ1A 3M8OL 4R5TA 1U8PA 4K7PL 1YNKL 4NFCA 3S0PA 5FW6A 4JFED 4LK4A 2FO8A 4ZBJA 1AI1L 2RQEA 1YEJL 1ZANH 1SBBA 3HKFA 4LSVH 4IKNA 1GGIL 4OLUH 4NN6C 1J8HB 4TPRH 1R5IB 1BYOA 1X7QA 4C56B 5E94A 4AV5A 5IOPA 2Z35A 2P3YA 3L1EA 4HT1L 1QFUL 4GUPB 5EF0A 5DJZB 3SDXF 2QMKA 1I9IH 2WN2A 3ARDD 4X5WB 3CNKA 2XETA 4DKFL 1OSZB 3A4AA 3U1QA 3FB8B 1CFQB 2WQRA 3ARYA 5HI4C 3VDCA 4YHPB 3UDWC 1KPVA 1N5AA 2R4SL 1A9BB 3P54A 4OF3A 2WIIB 3TCTA 1DQDH 2R69L 4MXVF 4JFDE 4XVTL 5AAWA 1V3JA 3L2NA 5MERB 4ODVL 1FSKB 4CNIA 2FEDD 4OLZH 2AS5M 3N1GC 4N0FA 1OHZA 4WI6A 4KZEH 4XVJL 3FFCD 2ZZUT 4LSTH 1JGEA 4JY4B 3WIHA 4ES9A 4JHBA 1AHWB 2VMCA 3VXMB 1MFBL 1LEIB 2ZOKB 1K8DB 3MOAH 5B39A 3EJJX 1RIUH 2V5MA 2PN5A 2Y22A 5CEZE 3DIDA 1YQVL 1ZTXL 5ALCH 2EXTA 3GSQB 1XGQB 4P2RA 5EF2A 2MFNA 2NXZD 2CO2A 5KOMC 5C07A 3FZUC 3WJJC 1RLBA 2IIJA 1W16A 3SBQA 1SOKA 2LLGA 3TBSA 1T2XA 4CGTA 5IESH 5ISZB 1QATA 4WJG3 1YZZA 3T6WA 2ZCHL 4ZPVA 4FXKA 5GQBA 3ROOB 5GS1B 3KYOB 5E9NA 5DEFB 5JMRA 3ATFA 1S7UB 4Z7WF 2VDQH 3EFOA 3K6NA 5ACMA 3BZ5A 1OM3L 3D06A 3FUNA 3EXJA 4WGKA 2L4OA 2YQ2A 4A7QA 4UUJB 3IJSB 3AC0A 1U8NB 4XO8A 5C0AE 3RFZA 5DFVD 1K5NA 4ABVA 1G7JA 3IU3B 3IMSA 2YD5A 4W70A 2QPUA 4RAVB 3NN8B 3PWJB 4L5FH 4J5VA 1CIUA 1AZRA 3KNBA 3KS0H 4JANA 5IMKA 4GI6A 1WIPA 4P5TA 3I3DA 3Q6FB 1KV7A 3W11D 2NNFA 3C5XA 4CDGC 1SF3A 2GK2A 5CEXA 1BGXL 3SPVA 3UBFA 1YVLA 3NJKA 3VXSB 6CGTA 1I1AA 4LCWB 4LHUG 2YUXA 3MLWH 4JO1H 3WN5C 3ILDA 3SJVD 5IY5B 1EEZA 5DSCA 2W80C 3CFEA 1J5IA 2A74B 3WS6A 4YDJA 1A1MA 2HLEB 1C08A 1N7ML 1XD1A 1DBMH 1ZCRA 3B8SA 3FHEA 4PRPB 1QPPA 3H0TA 3LKPA 4OQ1A 3WXVL 4M02A 3VWJC 1R3JA 2P4AB 3CX5J 2R7EB 1UD3A 3DHMA 4XNUL 5D2LE 4PRNB 5H37A 4I0PA 1A6UL 1OCZB 3AACA 3FN0L 3T1FA 1C7SA 1JS4A 3RL2B 4EUPB 3WHXB 4M8UA 4ZMWA 4ZMVA 1FNGB 1BIIA 2R1WB 2J6WA 1TSHA 3V5KA 1S7TB 2UVEA 1JMZA 4OKVB 5AWNL 5C0CB 3P2BA 1H8LA 3TZVD 3FB5B 3DO7B 1XWVA 3SE4C 2X4QA 3MLSL 5SWZA 2DQTL 1RZGB 3INUL 3GMNB 4BHUI 4OKDA 4LLYA 1KIRA 2XTLA 4KX9A 1F0LA 4KQ4L 5HYQB 3N1FC 1OP5H 3H3PH 3DOSA 3HZKA 3EDDA 2ESVA 1A65A 5I18H 4MXWL 5CBAA 4OZHB 3IGLA 1UTDA 1QSFB 5C0EB 4N2EA 2CLRA 2IDQA 1M2VA 3QNYB 4P9HC 3ZX1A 4NO5B 4XB7A 3ZRFC 4XC3L 2EE9A 4AQEB 2N0MA 4M7KH 4DKTA 4N24A 4K3GA 3FU7B 2V5YA 1PEWA 2OTPA 3GBMH 5SWQB 4L8BB 3SDXA 1O9VA 2A9MH 3NGBB 2J72A 4IMKC 3D87B 3JWOC 1D5MB 2HUEA 1CICD 3EBAA 3IAPA 3H1ZA 1R3LB 1HXMA 1GTFA 2WCSA 1J11A 4LBEB 5DJCB 2XCMC 3HR5B 4KK6C 2IQAB 4F58L 5DMGC 4KH9A 2QKIB 3CGTA 1TQBB 4GSDH 5K9KA 2GABA 1TJXA 4Y4FA 2K6YA 1OAYH 4CMMA 1BOGB 1B88A 5HVHB 3F7QA 3T4YA 2CA3A 1MRDH 1Q9LB 1R19A 2XWBA 3FYIB 1I7UA 1MEXL 2VERN 4JFYA 1R3KB 3KPSD 3VH8A 4Y4KD 5BZXA 4DW2L 2NY6B 4NKOB 4DH2A 3QIWD 1B6UA 4GW5B 1OSEA 5IB2A 3WY3A 4NNPL 3IPFA 3OHXC 5C8JB 5F6IB 1LMKA 4K07A 1HNFA 3QR0A 4JFEB 5E08H 2JNZA 5LJYH 2G3XA 1YYLL 3CX2A 2FUQA 5HD8C 1FAIL 4WHCA 5LWYL 3I9IA 2I7SA 1AXSB 1KBGL 5JZ7C 2WMPB 2NY3D 3SZ6A 5CP3A 3FS9A 4QF1A 4XB3A 1D9KC 4FKKA 3AJ7A 3QUXC 5GRVL 3ARDB 4PD4J 1WQVT 1IAKB 1UD6A 4LLWB 2WNGA 4NQVA 4ZTPL 5DQ9A 5F6HI 3SYQA 2VN6A 3DVGA 4YK4C 5A7BA 4P5KA 1F8TH 4A67A 1XCTA 5B38G 3WEAA 4R7NB 2NNAB 3NACH 4PS4H 4D0CB 3TEUA 2O6PA 1BQ5A 1M05B 3UIZA 3FFCB 3S5LA 1BF5A 1DBKL 4NRXB 4RIRB 2SEBA 3OKKB 2BS8A 4FFWD 4ZTEA 1NAKH 2NYYD 4DGYL 3TA3C 5FF6B 1NBVL 4PB0H 5EPMB 3ECVA 3S48A 5TDNA 4A7UA 5JHDA 4BSVB 1BFTA 5EBGA 4WO4C 4OD1L 2NXZB 2MCAA 4UV7L 4M9OA 2PWGA 3V6ZA 5FLVA 1QHPA 1YEEH 4EI5C 2BHZA 3CZLA 3QG7H 1YECL 3NP4A 3FXIC 5TE4H 1LEGB 2BO0A 4JLRB 2VKXA 5FO7B 4QO1B 3FO2A 5DHVA 5E2TL 5F1IB 4UTAL 2ADIB 4HIEA 2AGJL 2QPFA 4BFJA 2ZKYA 3THMH 4EBQH 2OR8A 3B56A 3OB0H 2H0PA 3WL9B 4ZPTB 3KYKH 2APVA 2GTQA 3DK0A 4YN3A 4FNLH 3LPFA 3ZOAA 1A6VL 5ECJE 4GUOA 2FJGB 1WWBX 1X9UA 2V17L 4LPCA 5D4QA 5IQ9B 3PGFH 2OP4H 3MUUA 4GMSH 4PJFE 5GGUA 1OCWH 2X7LB 3AM8C 4FNQA 4BINA 4F7PA 1IKNC 1NBZA 3IYLW 4L3FA 5DDHB 3GKZA 3QWNA 1MFAH 3PHAA 1CDGA 3EXLA 4G9DA 1NOLA 3NBNA 3PWLB 1GC1C 3NJHA 4ORGB 4GG6B 2HFGL 5BNXD 1LO0L 2BINA 4AMXA 2PF6A 4AE1A 5BXFA 1J1XL 3VVVA 1BVLA 5DT1L 1CQYA 2P5WA 3FO1B 1SVBA 4L5FE 1F58H 4WTQA 3WEMA 4G5ZL 2ZCLH 2QVFB 1FN4A 2XG4A 1FDLL 4BQCA 2VDRB 1AQDB 5DHEA 3CJJA 5DFWH 3PP3K 3SJVB 5KAQG 3WFHA 1MAMH 4MMZA 1E8WA 1XH1A 2ZOLA 4BQ6A 2WBWB 4GP5B 1DQLH 1U92A 2OLDA 4HC1H 4AW7A 1H0DA 1UJTA 1N3NB 2BY1A 4W6YB 4BFGA 4LAJH 4LO9A 4MS6A 1MW2A 2NY1C 3ABKB 1O75A 1P5UA 1W72H 4GFXA 2F8IA 4ZMQA 5F71A 1B0GA 2DL9A 1D6VL 4XX5A 1JVOA 1RZ7H 5J11B 1F1DA 3H3BC 5EMYA 2CR3A 2J1WA 1V8HA 2GSMB 2YD6A 5LBVA 2X4OA 1YY9D 3HAEB 4OSUH 5DTFA 4WU7A 3ULUL 4ZI8A 2I27N 1A3LH 2FJSA 1TZGH 2W9DL 4KK9D 3TZVB 1CVSC 5T3XD 3EYUL 1ACCA 3JWNG 2BSDA 1KB5L 2HN7A 3FFDA 3G5XA 5HYSA 4FERA 1NA8A 3B5GA 5D2NB 1N5YL 4WW2B 4ODHH 2GVYA 1LJMA 4JR9H 1HXYB 3MA7B 4O2EA 4PJDB 4Q0XH 3MR9B 4LLAA 3UABA 4O2FB 4FQ2H 1MHCB 3TVMD 1OW0C 4QRRE 3GSOA 3ARFA 1R33A 3O6FD 2CG9X 1HJCA 1Y6KR 5IUCA 2ZCKH 4R4ND 4FP8H 4UT9L 3EJUA 4U7SA 1H6FA 4HFWA 2Y4SA 3D09A 1NFDB 1WV7T 2QSCL 3TH3T