3K6IA

Crystal structure of chicken t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
SILATPILIPENQRPPFPRSVGKVIRSEGTEGAKFRLSGKGVDQDPKGIFRINEISGDVSVTRPLDREAIANYELEVEVTDLSGKIIDGPVRLDISVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Gallus gallus
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6iA00
4NUMA 2WD0A 4ZI8A 4ZMWA 2YSTA 4ZT1A 3LNGA 3LNIA 2OMTB 4AQAA 2OMVB 4ZMPA 4AQAB 1ZVNA 1SUHA 3Q2LA 2V37A 4NUQA 1WYJA 5CO1A 4ZMQA 4ZMVA 5CZRA 1L3WA 4XXWC 4ZMYA 3Q2NA 3K6IA 2O72A 1O6SB 3K6FA 1ZXKA 1NCGA 3UBHA 2A4CA 3K5RA 4AQEA 4AQEB 4OY9A 5JYLA 4AQ8A 5JYMA 4APXA 3Q2VA 3LNFA 4QD2E 4APXB 1Q1PA 3LNDA 3FF8A 5KJ4A 4ZMLA 3FF7A 3K6DA 2YQGA 2WBXA 4AXWA 4AXWB 4AK1A 2OMXB 2OMYB 3UBGA 4ZMZA 1NCJA 3MVSA 3PPEA 2A4EA 3QRBA 3LNEA 2WCPA 3UBFA 4XXWA 3LNHA 1EDHA 4ZMXA 1OP4A 2OMWB 4ZMTA 1NCHA 4NQQA 3Q2WA 2X2UA 4ZMOA 2EE0A 5DZVA 2QVIA 2QVFB 3K5SA 4ZTEA 2OMZB 4NUPA 2OMUB 4ZMNA 4AQ8C 1NCIA 1FF5A 2WHVA 1WUZA
chains in the Genus database with same CATH superfamily
3ZR6A 2XZZA 1LYQA 2IVFC 2ZWZA 5FA3A 1F1AA 4P2OB 2IH9A 2QZ5A 2ZKHH 5AW3B 4HUNB 4U49A 5E03A 4OZFH 2CO3A 4OCYL 1KPRB 4NUJB 2K7QA 1R0AH 1S3KL 2F0CA 3G6DH 1NMCB 2O5XH 4ZMPA 1FVEA 2BSBA 1F6AA 3SKMB 1RPQA 4HGKC 1CD1B 4FFWC 3T2NL 1NCDL 2W5PA 3PXJA 4IKIA 4WTZG 1CBVH 1QLFA 1YY9C 2YGQA 3NIGE 4LCVA 2IPUK 2X53A 1MJ8L 4JMXA 4M3HA 4JDEB 2VXUL 1V7MH 5HJGA 5JXEC 4FZEL 2QL1A 1C7TA 1DBBL 5I15H 3SBWC 2NUTB 1LK3H 5DO2D 3V0WH 1AO7D 1IGTA 1TMCB 4G59C 4G8GB 4N0CD 1JZHA 2C34A 3MO1B 4DPBX 1N0XL 1BG1A 2FJFA 3U2SA 1YO4A 3HI6H 1NEZA 2BVQA 1IBDA 2I69A 4OZIF 1F8TH 5DUJA 2NPLX 2AW2A 3S35X 4OCRH 3R7RA 4YHPA 2GK0B 1KBVA 3WMPA 1I3VA 4O4YL 3BHBB 3FCBA 5CIPB 1E40A 2X6VA 2J1WA 4FZ8L 5GS2H 4DKFH 2B77A 4AYFB 2EO9A 2YUZA 1BZDA 1HHGB 1ID5I 2ED6A 2HFEB 5CJ5A 1RFDL 3UBGA 4NOFA 2XTJD 3EH1A 4YDZA 4P9MH 2YD5A 3ERXA 3TP4A 5LVEA 5DSCB 1C8QA 1V3KA 4GUCA 4Q58C 4YBLB 4LOUC 3VI3F 3LKOB 1CU4H 3T3PE 2GTWA 2XXFA 3WSQL 1HI6A 1D6EA 1HESA 4G1EA 4KHXH 1RIUL 1HHHB 3DWTA 4DP9X 4HX1B 2E3VA 3HE7B 1BVNT 2BRRH 3FFCA 1UB6A 2JELH 2WTOA 4JHAH 1VZHA 3P4MA 3QDGA 1BD2D 1NANH 2GJ6B 4GLRI 1IIKA 4AH2A 1GOFA 3RPIA 2XTLA 1XF3A 1FDLH 1AXTL 4JFYB 2GB2A 4AGOA 5ANME 2OZ4A 1MCHA 4RETB 1B4JH 4ZYKB 3T6VA 4CGTA 2EDTA 2MHAA 4X5WA 3THMH 1ITBB 2AJVL 1KTRL 2BY1A 3T71A 2FECI 3IF1B 1BJ1H 3MUGA 5AOLA 4A7GA 2V9TA 3QUXB 4GG6B 3ULUL 1HQRB 5HXMA 1S9VB 1SYSA 4KRPC 4LEBA 4URTB 4X7EC 4TL5A 5IKCB 1FCGA 3G6AA 4YDJB 3SDXA 2K0RA 4L3AA 4YDLB 1JXGA 3FUHA 1FL6A 1J8HE 2IBZY 4FTVA 3SE8H 1FC2D 3CHRA 5SV4A 1A8JH 4MCZA 3UZQB 2OMVA 3I75A 5ALCH 1C12A 3BFQG 5C09B 4XCYA 4N8UA 2PP8A 2IO5A 5JOEA 2DIJA 4MA8H 4QAMB 4LSUL 4IIZA 3LS4H 2E75C 4XC3L 3SN6N 2DI8A 4HEME 3MUJA 3OGCA 1VIWA 2BP8B 1MVYA 4UQ3B 2J2ZB 3AT8A 4JO3H 2NY3B 2GIYA 4L8SC 1BZEA 4OI9A 2Y1ZA 1ET8A 3OKNB 2CKBB 2JI2A 2BC4B 2G2PA 2PABA 5EBMB 4AL8L 4DGIH 2BNQE 2COQA 1ZV5A 4L37B 4DP1X 5HJBA 3UG4A 1OSEA 1UADC 3VB8A 4KPHH 3ZE0B 5LWYL 4F9LC 4B3VA 1BZ8A 3IGUA 4BFRA 5T1KB 4P23A 1NM4A 1CE1H 1LWHA 4LOFA 3PHSA 1SXZA 4ELMA 3H4FA 5BV7C 5AW7B 1UUNA 3HC4L 4P04A 5DO2C 3B34A 2OS7A 4N0CC 1TPXB 4OGQC 1D7DA 2CXGA 3WKML 1CE6B 1JGUL 4P59L 1BVKB 4OUUB 4QRRE 5F6IC 3NK3A 5I19L 5FA4B 1S9WB 2OL3A 1FA4A 3C6LD 4EIUA 4Y5YB 3VGHA 5DD1L 2V7NB 1GKOA 3VFNA 1MIEL 2VLJE 3QJVB 2IV9A 3CHPA 4NAQA 3TBCA 5D6CB 2X40A 4PJFB 5J89A 3QO0A 4OF6A 3ZKQD 2WQAA 3EYFB 4KHTH 5IVOA 2XTJC 3BO8A 1AKPA 1JN6A 2R2EB 1NAMH 3MOBH 5IFJB 2WSDA 5ABDE 5AAWC 3QCUL 3RLSA 4PJIA 3JWNC 1DBJL 2BHZA 4P06A 4XMWA 4F33B 1GGBL 3HMXH 1X9UA 2WBJD 3E80A 4AYSA 2HFFB 3CFJB 1TJXA 5F7WC 4BFIA 4OLWH 3VW3L 3KYAA 3P4OA 4P4KD 3VI4E 1KZQA 3VUAA 4KX9A 4JLRA 3QHZL 1KPVB 3Q6FB 1LDSA 3HN3A 3Q9QA 3MCKB 4NPKA 4QXVA 5DHXB 5ICYB 5DMKA 3U0PA 1QHQA 4DK5A 4HS3B 3NAAH 3SKJH 3TLRA 2FX7L 5MI0C 4Z95L 1DLFH 3ZE1E 4TVPH 1AS6A 5CP7B 1A7NH 3ATFA 1N67A 5DHDA 5IV2A 3BKYL 5AW6B 4POUB 5IP4A 1CG9B 1OF2A 2WO3B 3H2WA 3RUGE 5BXFA 3EFFA 4G7SB 1UEYA 1ET7A 4UBDD 5I9QC 1PPIA 3IMTA 2DW5A 1FGNH 3O6LL 5CLXA 3FTWA 4G43B 4DH2A 1J86A 4Z7NF 3BZFA 3VXOB 4RAVA 4URKA 4JO1H 4E42B 2P24B 4XAWH 3EADA 5HHVH 5GJSH 2HRHA 4QTIH 1YEIL 3FRPB 3PGCB 3HMWH 3MV9D 4H88L 5KG9B 5I1HH 3DI2B 1YC8A 1N9PA 3QIBA 4NNPH 3GSNA 1C7SA 3ZDXF 4GFTB 5FYLD 2UZXA 1CWVA 1TJIL 3FL7A 1NAKH 2J8UB 1ND0B 3TO4A 2OK0H 3X1EA 2ZCKL 5F93C 3FB7B 1ZEAL 2O1AA 3LMJL 4NUGL 5T3XE 5IQLA 3C60B 4MA1C 2Q3XA 1FQ9C 5C0AA 3D2UA 1E3FA 4OZ4B 1YUHB 5K5YA 3G04B 3OXSB 2EYSB 3QPXH 2NYYC 2WIMA 3TVMB 5CWSB 3V4UH 3DI3B 4UDTA 4FXGB 4EZMA 5E8OB 3QYMA 1CXKA 1KELL 1FNEA 4FNLL 2BSCA 4JQXA 1IQWH 2R69H 3IDIA 4LL4A 2WCPA 4MAZA 5CAYB 1DLHB 3QQ4A 4TUJB 1P4UA 3I9AA 5I74C 3QEQA 3QDMA 4XVJL 4O02A 4AMWA 4I0PA 2CBPA 2GBVA 2JSFA 3DXAB 1A6UL 2ZUSA 3CN2A 4HUWB 5F1IB 4PS4L 1VFAB 4GUPB 4YHZH 3C6LC 4PJ5D 1YN7A 3CFTA 4N85A 3WTTA 3P30L 4J1UB 4HLJA 1MI5D 1KJMA 2I60L 1QO3A 3D85D 4NN5C 3BAEL 1WFOA 5FK9A 3PWPA 4ANXA 4PWHA 2D7NA 5EORL 2BS8A 4PHZA 3CLWA 3NEXA 1JNLH 5GRWA 1FYTB 1KACB 4NJ9L 1MLBA 2F2HA 5JIQA 2NSMA 4R7VA 3IVKA 3G5XB 3WKPA 1B0GB 5EBWB 5SWQA 2ZOKB 3QH3A 1PNCA 4OLUH 3ZIYA 5IK3B 2BCMA 3DHMA 1CD8A 3MLYL 2WBJC 1BBDH 1YMMB 1RXLA 5KZCB 1NEZG 1NMBL 4LCIL 4P4KC 2VJ0A 4LLMB 4J3OH 1F0LA 2EEBA 5FHAH 1Q8MA 2Z8RA 2R4RH 1I1YB 3FUMA 3KPPB 3MFFA 2G75A 4WNSA 2HRLA 2WZPA 4A39A 2D3VA 2ATPB 4G72B 5IHUH 3B7TA 4HZLB 5GRVK 4W9CC 2BVPB 2AKRB 2O6DA 4GXVH 1CXEA 4S2SB 3TS8A 2AK1L 2AV7B 1L0PA 2AANA 4Q89A 4FF9A 4CA4A 1JPTH 1CLZL 3V6OE 1BFTA 4HUXB 4QHNB 5GRZA 3IDGB 5JPNC 3RNQA 1KGJA 3IFLL 2FJHA 4UBDC 3W0WE 4OB5L 3ARDD 4HUUB 4LBEB 1CICD 1BHGA 1MCRA 4AEFA 2EDOA 4AWJC 2K8QA 4I2XE 3VRLF 2E8YA 3ZDYE 3STBA 2AQNA 3C12A 5IVZB 1CI5A 4D8OA 2X1XR 4E41E 3K74B 1AACA 4JN1H 1R3LA 1KCLA 3MV8A 1KCBA 3UH8A 3V0AC 1OV8A 2LTQC 3S5LG 3L3GA 2EIMB 4ZSOA 5GGTA 4DGVL 3RTQD 3N40F 3L1OH 4JANB 4EN3A 1FBIL 4PJHB 4Z7OE 2HG5B 2OP4L 5CN1A 5KAQG 2ID5A 4LLQA 3L3DB 4AXWA 1EZVY 3ULVD 3REVB 1CFVL 2HKFH 1A6WH 3HLAB 1JFQL 5EZJB 5C6WH 4G8EA 4MBOA 3CWGA 4E9SA 2O26U 1UQSB 4JO2L 4FNSA 1AE6L 1GXEA 4GFXA 5AVWB 1B0RA 1NLDL 2X6CA 2XX0A 1HHIB 2PO6D 4OVUA 4R0LB 3VXUA 4TNWK 1FNGA 2IANA 4N9OB 3RHWK 2HVKB 2ZWKA 3FCSB 3PF2A 4KTEH 4J39A 4B53A 5IB1B 2BNRB 1CZ8H 2WLIA 1TTAA 2A6DB 2A9NH 2ZUQB 1M05B 4ZS7H 3GI8H 1UUSA 4F2EA 2Z4QA 4LF3A 1EAPB 3OZKA 1YEKL 2VDMH 5E8DL 4DPAX 1KJ2L 1R33A 4NKIL 4ZG1A 4P3WA 4R8WH 4B9ZA 3DX6B 1PY4A 3UZEC 4NPYB 3VXUB 4PU2A 2Y1AA 1OD9A 1FPTH 3CSTA 3KCPA 1QTPA 2YA1A 2Y5TB 1DQDL 2DQEL 3D39B 1DFBL 4M5YL 3ZYIA 1Y0LA 4A37A 1CGUA 3QBTB 5IHZB 1T1YA 2RQ8A 1TJHL 4BHUA 5C0BD 4X98B 5BRZA 2OTPA 1KGCE 1YEDA 4G8FA 1JPEA 4KVNL 4LDOB 1MCDA 4AEIH 1J0YA 2YAHA 1EZUA 1M2VB 4NX0A 4ZT1A 4D3CL 1HZHH 4YN3A 3I2CH 4JM0A 4RAUB 2VDQH 3MA9L 1DE4A 4RLDA 3N1FC 5DWUH 1VGEL 3GBEA 4EVNA 3LQAH 4BFKA 5LJYH 3SGDI 3ZDWA 1CLCA 5TQ2H 4XMZA 4B9CA 4YNYB 2BOBA 4FQHA 5E56A 4ADJA 3O45B 2COVD 1QSZA 4RX4A 4KTDL 2X88A 1AVAA 5BW7C 5I6KA 4UILH 3QXWA 5CKAA 4XPHL 1IGIL 3ZU8A 4K94L 4MD0B 5CJ8A 1U3HA 1H3VA 2OYKA 3SQOL 1OSZA 4N90D 3C9NB 1TOXA 5DR5H 1RZ8A 2J7LA 4GAYB 4CMMB 3TT3L 4W9JC 3ULUF 1MJ7L 2XACC 5TFSH 4NZUH 3DIVA 3BAIA 4R4ND 4X6BA 1V5JA 1FIGL 3KL5A 2VDRL 4HEMA 1E9OB 3ARDC 5JHLH 4KNQA 4O2CA 2UYLB 2R2CA 1CICC 4X83A 1HXMA 5DZOA 3SE4A 5AL0A 4S1QL 1JZJA 3U4AA 3SEPA 4WSKA 1I8KB 1ZJAA 1RIHH 5DK0B 4W9FC 4OZHE 3P3TA 1Z5YD 1R3JB 4AGNA 2I5YL 1MG3C 3HAEA 4M7ZC 2BNQA 1NCJA 4EMZA 5C0FA 4IDJH 4YXHL 3V5HA 3RTQC 5B39G 2YRZA 3LEYL 1N7MH 4YSSA 1UWYA 2GJRA 2WQWA 3L8QA 1IGMH 2DWDB 3JTBA 4N1CA 2PPCA 5E4IA 3VA2C 3KDMB 4HK3J 2UWEF 5GRUH 3VXSA 3ULVC 5DUPL 2X2JA 4CSPA 2E7MA 4AE0A 5FWQA 3BIKA 1IC5H 2RHEA 4M48H 1L9QA 2CK0H 4HSAC 4CVUA 3ZJAA 5KSUB 2HH0H 2WXIA 1WEJL 5FYKU 4NKDA 5DEJA 3CX2A 4K7PH 4JR9H 3MLUL 1Q9LB 1WFUA 3WS6A 5LDSA 3OR7B 3MA7B 2IAMB 4WJ5A 2PO6C 35C8L 1XSJA 1KT2A 1C9SA 1RZGB 4PGBA 2X4OA 4YAQA 1FFNA 5BPPA 3T0WA 2VLJA 4JKMA 5E2UL 1S7VA 4LARL 4AYEC 4PAZA 3QWRD 4FFYA 1HXKA 3BRDA 4U6VH 5J7CC 1JD9A 1DHKA 3EH3B 2R4SH 3OPZL 3P11H 4E2OA 5C7XH 3LKQB 1PFCA 4P46B 3RWCB 3P0YH 3TIEB 5GXBB 3WO3B 3ATAA 2HN7B 3X11A 4IBLT 5A16B 4JFPB 4X50A 3QQ3A 4IGBB 2CDFA 2QEJA 4XNMB 4WSGA 3VO0A 3VI4A 2HB0A 3OQRA 4PRID 4NXSA 1RHHB 4D0CA 1IC4H 1ZVNA 3EXJA 3C08H 4XBMA 3V8CA 3BZEB 1KSRA 4IK6A 2F5BL 4PJ7F 3T04D 4X0NA 3HRPA 3OC5A 1YEJL 4JRXA 5L2KD 1QNZH 4YH6A 3VH8G 2CO4A 2LU5A 4JG5A 4KU1A 3ZUCA 1BLNB 5CBAA 5D7EA 4K8RD 4HWZB 5DHYB 4XMKL 1AZRA 2ENSA 5F6IB 4Z3GA 1IX2A 4WUUD 3MJ9H 5LN4A 3TFBA 3CC5B 5DJAA 3QI9A 2DL2A 1GS6X 3TC9A 3SGJA 1HH9A 2VOTA 3VD9A 4IU3A 4YLQT 1G9NC 5KTEH 5JIIA 4PJEA 1OW0C 1OGTA 2AXFA 4X42A 1FH5L 2JFCA 5D7LB 1OTTD 3KLAB 3NH7H 2WBXA 4OD2B 5F8RC 4WI4A 4A7UA 4HLZG 4Q74A 3P1VA 2JCCF 4WI8A 1KIPA 5FGCB 3O41A 2HYMA 5K9OB 4R4NC 3WFEH 2XQBH 2A4EA 2OQJA 1DVUA 3CCHB 3J2PA 3I3DA 1UOVA 3DRQA 1N3NA 5FGBC 1YNKL 3MRDB 4JY5L 1ZS8B 1Q9OB 1BD2B 1EWHA 1IE4A 2VC2L 5H37A 5GGUB 4YK4C 4WFGD 2QSVA 1AGEB 3MCLH 2A9CA 2E7BA 3DBXA 1KN4H 2PLTA 1IBGL 4QT5A 3U46A 3BPLC 3ZL2A 4H0IA 2XVLA 1ZLSH 3KPSE 4I87A 4AGPA 3Q2WA 3AW5A 4P0DA 1P6AB 4FX5A 3L16A 2BIHA 3EGXA 3VXMB 3WKNA 4HSQA 2XKUA 4LQFH 4JCMA 2D2OA 4KJWD 4KTYA 4U1GB 3BAXA 2EUWA 4OLXH 1VB9A 4ZAKD 1KPUA 4RRPG 3OKMB 1ILUA 2EDXA 3D1MC 3A3YB 4H40A 1FFQA 1K5NB 4ZUTB 4U6YB 2UXVA 1G87A 5FR3A 5MEND 2H26A 1EFQA 2YSSA 3WENA 1W72H 3HRZB 3JWDC 3EYVA 1WFIA 2Q2EB 2Y9RT 1IAIH 3N43B 4I89A 1ITCA 2H32A 3QYNA 2WGXA 2I9LB 2ZYRA 3Q1EA 1JWSA 4NP9A 4JB9H 3CDFA 4F8PA 2JJTC 2QDVA 1W0WA 4CILA 1IL1B 1QMUA 4OLZH 2GK0A 1FJ1B 1MW3A 1NDGB 5EF0A 1D6VH 3V9EA 1EEUA 2GUYA 2UVFA 1GR7A 2IXQB 4B5EA 4X4ZA 2V37A 4DGWC 5LN8A 5J1TC 1TETL 2AJSL 2P8MB 4PJGF 1T89A 3C5XA 3OKOA 1DQQA 3P9LB 5E6RB 2LAGB 5T3ZD 3T65B 3CZKA 4ZOEA 4HYTB 1KB5B 2WNKA 4M4RB 4X80L 5DK2B 5EO9A 5K39A 4PR5B 5CCGE 3EYSH 3LQZB 3N42F 1GPOL 2CO6B 3UYRL 1VSCA 1PDKB 3FH8A 3QZWG 3FQ2A 5CJBA 5I74B 5KW9L 2WXPA 1I7RA 1XCQB 4R7NB 5JW3H 3DNKA 1S9YB 2O6CA 1QBLH 5DQ9A 4K8RC 3H42L 2IMMA 1AZCA 4HS8H 1AQDB 1IAKB 1DJXA 2C5DC 2XDHA 3OKKA 5K33A 3GUTB 3M17B 2AV1B 1QATA 4JPQA 4PBVC 4KFZC 3SJVD 3W0WA 5D1QB 4IM8A 4YSEA 5ANHA 2DI9A 3P77B 4JFYA 1G9MC 4I9WE 2JMRA 1U2HA 3EZJB 1UJ3B 1OAKL 2B8OT 1FRGH 4LCWB 4PJXF 4AM0A 2OCJA 4JY4A 4FN0A 3RRQA 1L9MA 3GRWL 2MCMA 4F7PB 4PRHE 4Y5XC 4YHNB 5FO8A 1MUJA 1OTTC 3S88H 4OBSA 3DURA 1A6AA 1PNDA 4JUTA 4ELDA 2FLBT 3PAUA 3RU8L 3K6SA 4ODXB 2VIRA 5JDSB 4ZNCD 3RPKA 3U0WL 2A9BA 2BFVH 1AAJA 3MHZA 3R1GL 2OSYA 1GW6A 1QSED 3D25A 4O9HH 2EYRB 2P8LA 1NCHA 3NCYP 4R7LA 1O7DC 5DWPA 3EJYD 5D2NC 2G3MA 4FLOA 4GW4B 2EE0A 3HE6B 4PLKD 4G9FE 2F18A 1CQYA 1YSOA 1S7SB 4FQ2H 1T1WB 4LEOA 4XP4L 2QPFA 1JGLL 3K2IA 4HG4J 2IOIA 2QTEA 5TE6H 5JXAH 1T66D 2BHYA 4KKRA 1UYWH 2DTSA 4XVTH 5GGRB 3BD3A 3QWNA 1KFAH 4N0YH 4FQCL 5JPNB 3ZY7A 3VNYA 5C0DA 1S7XB 1U8IA 1YY8B 2N7AA 4N8CL 5CHNA 1KENL 1E9QA 4KV5F 4HULB 4KJWC 4OQTL 4UINH 2CCLA 1SOKA 4ZAKC 5DJDA 4LPYA 3ULAB 4CBZA 1FLTX 1TJGL 3ILQD 3Q5TA 2VDOH 3CC1A 1AHWB 1DEDA 3H2PA 3S34L 2F7PA 1H15A 2IMNA 1EHLH 3CVBA 4Y4FD 3PWLA 4PCKA 4WKZB 2XKNB 4QNPE 2WZ0A 1IRAY 3ZDZB 1QQDB 3HAEG 2YPKB 3KG5A 4JZJC 2YGOA 3LSOA 2YRLA 3JTTB 2YGVA 5GS0H 4E9WA 3DSFH 3HCVB 5GHWL 3MJ6A 4Z7WB 4OUUA 1MPAH 2DLGA 1S9WA 4NO3B 3FHQA 2WVTA 1Z32X 4XCNB 1YUKB 3TESA 5BQ7A 1M57B 1S7UB 5I8KH 1EX0A 4P5TA 3AB0C 2VQ1A 3KNBB 4NYLB 5EUKB 4JFOB 1GHFL 4OF3A 3EOAB 3QDHA 4DN4L 1QUNA 4BDVB 2YWZA 5LGYA 4DTGL 4PM1A 1Q1PA 3NFNB 2GITB 1I85C 5CLWA 2ICWI 3FT3B 5IUCA 1Z66A 1E30A 2NY6D 5FHBH 3LN5A 3KXFB 1EXHA 5LUMA 1HSBA 1AGBB 3IRZA 3BWAB 4ZW7A 4F33A 5HYJB 3PHQA 4ADIA 5IGXL 1EHKB 3V6ZB 3U1SH 2DICA 2F15A 5KS9E 2V5TA 3IMSA 4MQSB 4ZW6A 3QORA 4WDIA 4P8QA 3Q8CA 5CEXB 2ZOOA 1MCPL 25C8H 2CMRH 1TQTA 1X44A 4K7FB 3O2WL 4XXWA 2Z4TA 1HZKA 3NGBC 1Z9LA 1GYCA 3BKCH 2JXMB 3HFML 4LAQH 2W07B 4M5ZH 3DX8A 3SSGA 3STZB 4JFFE 4QCIB 4WHDA 5ELIA 2J1ZA 1NFDE 1Z9SA 3TBWB 3BZ5A 4WIQA 3BRGC 4LU5L 4PY7B 2OSXA 1MCEA 3E8UH 4X4XB 1IEBA 3HJ0A 5C8JA 3H9ZA 3KH3A 3H9YA 4KGJA 4YHYC 5I5IA 1G7IB 2CHXA 3D3VD 4DN3L 2BSSB 4G43A 4JPIA 2WXNA 1I7ZA 2AGJH 3BH8B 3BXNB 4JHBA 4ZFOA 2XV3A 3ILPB 1NWOA 4GQZA 4H4NA 1JGVH 1U58B 1CF8H 2XN9E 4JRYE 5GGVY 2XTJE 2X6BA 3KLQA 2Z1KA 3GZKA 4A6YA 1XIWD 3C8DA 3EJYC 4PJAB 1N6VA 1BAFL 8FABB 3RWGA 1CTMA 1MELA 1XH3A 3N44F 4OZGB 3B3IB 4XCEA 2WKGA 4HETA 4F37K 1MLCB 2G9HA 1UD5A 4QOKD 5L0QC 2EUVA 1IAIM 1VCAA 2L7UA 1J9TA 2L04A 2PF6A 2MPVA 1YZZA 1ZLUK 1H9DA 2XWBB 4WUKH 3MREA 3PY9A 5D7SL 1M7UA 1T66C 3PL6B 3UYOD 2IPUG 5DJCA 4G80B 1ACYL 3CFBB 2UZPA 3TBTA 4MA7H 4WW1A 5DHVB 4F7MB 4NRZB 1A14H 3ARDB 3ULUD 4IBWA 1NGZB 3MRHA 5SWSE 4LLYA 2XV6B 1U93A 4L9DA 3TN0A 4IJTA 4NIKB 4YUEL 3ZMNA 1U95B 3FQTA 2JJWA 3ILQC 2W95A 4F8QA 2V4LA 4FXGA 1KIRB 4M7ZB 3O3BA 4UTCA 3UBHA 3PHAA 4H5SA 1GZQA 3RGVA 3QZPA 3RTQB 1R4XA 3X13B 4F2MA 4HH9B 2V17H 2ZXDA 1WS7A 4Y4FC 1QABA 1F4WH 3BQUD 5LLIC 3MYJA 3EOTL 3AVEA 3L4YA 4MB3A 3WFCH 2W0LA 4TUJA 3OAWA 5DCCA 2DQJH 4HPYL 3RJQB 3STLA 1L7IH 2WXHA 1M3IA 5A2IH 1I3RB 1S7WB 3DXAA 4PG2A 3S37H 3RPBA 1ED3B 2YOCA 2Q86B 2VM3A 3GHEL 5IVXA 2G5RA 2Q6WA 1QI5A 4DP8X 5CZVL 4F91B 1A9BA 3FUJA 2AEQH 1XH2A 2FYYB 3FH5A 3ULSA 4JFDA 4QY8B 4JJ5A 4Z7VF 1DANU 1SMDA 3MRLB 2XVBA 4IEFA 4F1SA 3OXRB 5IOPA 1NBZB 1BOGB 3E8VA 4ZX5A 3CBJB 4ODSL 5IR1B 4UTAH 4WO4B 5JO5B 4K7PY 4PJ9D 5C3LD 4ERSL 5DLMH 4NLAA 1NICA 1MJJA 4LASH 4MAUL 2NY6C 2Y22A 2ZOKA 1UVQB 3LEXB 3BSHA 4UB0H 1J12A 2YBRA 4MWFA 5C0IA 2HJKA 1A3LH 4BH7B 4RDQG 4U1IA 3ROLB 2R29A 3GM8A 4IOSD 4QHLB 1IILE 3SBRA 4JDTH 4ELKB 5CR1A 4XO3A 4LRIC 3HS0C 5L4IA 3HUJA 4YQXH 1CGYA 5EU7E 5C07A 3PP3H 5I73C 3NFPB 4DNLA 5B8CC 2XV2A 3QJTB 1UKTA 4RWYH 4BKLB 4F7CA 1BJMA 4S2SA 4XBPB 4OIBA 3DKHA 1CDCA 3O0RL 5HDBE 3SYOA 4MZRA 3FDWA 1E90A 4KJPD 3B9EA 3DGGB 3OWEA 1UACH 1ZMYA 2B5IC 4HJJL 2XZQL 3RJOA 3VXRA 3M6DA 1NGPL 3CIQA 5I17B 3RVXD 1F3DJ 2R0WH 3LB6C 3PGDA 3L5JA 2YK1H 3QPKA 4PJ8D 2D31B 4R83A 4X6EA 1Y7VA 1V05A 2Z9TA 3MRPB 4HIXH 4LKCB 1FFOB 3WEBA 3CZEA 3V4PA 3P3YA 4OGYL 1HDMB 1F4HA 4JPWH 2H7WA 4KRNA 4TXVB 1XIWC 1O0VA 1MFBH 3VWJA 2W8CA 4D9QE 3DX7B 1YECH 3ECVA 3AJ7A 2ZD0A 2LVEA 2F5AL 2P5EB 4PJHA 2HG5A 5EO0A 5J13C 2MQ3A 1G4MA 1XF1A 3AQYA 3L3DA 3W5MA 1NEUA 1Q90A 2E76C 4K23L 4E5XB 3D8MA 3FSAA 4MJIE 2FBOJ 2WUBH 3HG3A 4PHXA 4MRCA 1OQXA 5IW6A 1JMZA 4DP2X 4UQ2B 3BSZA 5TDPB 2FQDA 3V4VA 5EOQH 4TNEA 4IJ3C 4UIKH 3UTQB 1A6VL 3BWSA 1RERA 3QQDB 5IQNA 2GJPA 3LTVA 1HHIA 3O2DL 4L5FH 3LKNA 5EU6D 4R0LA 3ULUC 4HDIA 3KPRD 3F65A 3OM3B 4MMYB 4QHUB 3VMNA 1VGKA 2V8MA 2ZG1A 2A6DA 4K3EH 3RWEA 4RWHA 4KJQD 1QUPA 3GO1H 4YFLF 4PH8A 1DDHA 1BXUA 1JPGB 4HXBH 4FRWA 3JTSA 4Q8BA 1MWAB 4PV8B 4N9GA 4RFOL 5KJRH 3BQUC 1KG0A 1R5VA 3P2DA 4U6HB 1EHNA 2XNAB 2C9PA 2IDQA 1JI1A 2F7IA 3PGFH 4G71B 4JMNA 1KLFA 2VZTA 3FO1B 4JFUA 5E2WL 2VXQL 5ITBL 3NJGA 3ZBMA 3ETBJ 4ZUWA 3L08A 4XO9A 2NDFA 2M83A 3Q9PA 5BZXA 1I1AD 1LEKB 3D39A 2AXJA 1A7QL 1J0KA 1U33A 2GPZA 2F53D 4M29A 4TUOA 4Y1AB 3G6JB 2BIMA 1LE9A 4NOBA 4LLWA 5J57B 2OZ4L 2VDKB 4OFYA 5JXEA 2GEQA 4HJTA 1E5ZA 4HFWB 4YL4A 3SBWA 1RZKH 4JFWA 4AL8C 3E3QE 4JGUA 1MIMH 1BF8A 1CDJA 1QLEH 2YMTA 3DTXA 2H45A 1IGCH 4GSXA 4PJ9C 2QGDA 1INQB 3SPGA 5KWYC 4JPKL 1M2VA 3L45A 1BMGA 1DVFB 1QLRA 4NN7C 4WI3A 3OB0H 4KMLB 4PRHA 3VRIB 3KLHD 1ZJBA 1N26A 2GHWB 5FX3A 3K1KC 3CVIL 2VR5A 4Y7MA 1UA7A 3GI9L 3LIZL 4OV5A 4Y19E 2OSWA 1SLVA 3GXMA 5AOJA 1P0SE 2OMZB 4NUPA 4YNYA 2VAAA 2HPTA 4Y2LA 3IU3B 4HEPA 5HYIA 3TPKA 1OZUA 5K59E 1PLGL 3CXHJ 3NACH 3E2HC 1QTSA 4ZOAA 3EGDB 5T1MA 1DYZA 2WTPA 3TPUA 1M53A 1U91B 1BEYH 2WXKA 1MG2C 1R3KA 3LKRB 1TZIB 2P7TA 2RFXA 2W9EH 3JV0A 1U8MA 3BUYA 3IPBA 4UQAA 2V5MA 2OMTA 4KJPC 3LNIA 5L2KB 1Y18B 2IOOA 2YWYA 4XP6L 1KTCA 1INEH 1E2ZA 1ZVYA 5IJDC 2ZT9C 3RVXC 4AIZA 2E56A 4MRBA 4FNPA 4QF1B 5DD6A 1FNHA 4XVSL 2UYLA 4G8IA 1YEHL 3RY4A 3CSYB 1K85A 1NIBA 3B2PA 4PJ8C 4HBCL 4WUUB 2VMEA 2QBWA 3EFOB 5DK0A 2BDNL 4X99B 2DJMA 3ASNB 1NCUA 5EPMB 1Z3GL 3FQYA 1ET5A 3ABGA 3JBG7 5DYOA 1R5IB 2E6PA 1AGDB 1BVZA 4OLVH 1IM3A 1OAXL 3H3PH 4J12A 4XNUH 4HWEL 4PV9A 3TEWA 2W0KA 3EO0B 5DA0B 4GW1B 3ARZA 3MMEB 1J05A 4KQ0A 5FECA 3T0EB 2FX9L 4KQ3H 3I3EA 2Z7YA 4XNZB 2HLAB 3VU1A 2X42A 4HOXA 2GHZA 1N5YH 2LLNA 3HZ3A 3LS5H 1X9RA 4PJDB 5HHOE 5FGRA 4ZW3A 1U92B 2BH0A 3NJLA 4GKZA 4UT7H 1RZGA 3HR5A 4AZ8A 2NNAB 2QVTA 3SDAB 1DO5A 3ASWA 5JHAA 1KV7A 3QJFB 3QXAB 1NIEA 4ZDHB 4OD3L 3BOVA 1RZ7L 1LQBC 4KJQC 1KV3A 4K3GA 1EUUA 4U7SA 3T77B 4Q4IA 5JW4Q 4XB8A 1AIFA 1H8LA 3TIEA 2GQHA 2J73A 5C2BL 4L8SA 4M6NL 1M9WA 3EIFA 3ZHNA 1WTLA 2IDCA 4XNQA 4G42A 4JFPA 4OCNC 2DQUL 5KJ7E 1I1AC 1FZMB 5F88B 1A2YB 1RSFA 1W8NA 4AQ1C 1PLAA 2ZXGA 2DQCL 4RBPH 5J0BA 5FGSA 1RHHA 2ZXEB 2WAHA 3EKCA 3IGAB 4Z7NB 1J5OH 5MENB 3N3EA 2ODHA 4P9HH 5AKVA 1AO7A 2ODIA 4H1LA 15C8H 3B2UD 1EAOA 1HN1A 5IBTH 3VGDA 4JFFA 4G5ZL 2NNFA 1J0IA 5DHYA 1I9RL 1T2QL 1FYHB 4M5TA 2ED8A 1QEWA 4KJYB 5FS5A 4PGEB 3KLHC 4QRBA 5BZDB 1RJLA 4HKJB 4F24A 3REWB 2D7PA 1Q72L 2OPCA 4WFED 5JNYB 3KGTA 2YC1A 3AB0B 2K6ZA 2WWOA 4MDJB 1I3GL 3AU1B 1WWCA 2AQQA 2D7MA 4N2BA 3I02A 2XIBA 2BSED 1A1NB 3RWJA 5HGAA 3L3OA 2M1KA 1T1ZA 1CUOA 1R3HA 4HF5H 4UM8B 5GGSB 1CLYL 4MBRA 2NY0B 3FUDA 4UM9D 5HHMD 4A2FA 3WCYA 5AAWA 1WFJA 4PJBA 3V0VB 4OAWA 5E6ZA 4UWQB 1V3JA 3KWVA 4LRNH 4FAAB 1U3JA 4N2CA 2FNWA 3KPLA 2DTML 4F58L 5M94B 2DOCA 1SVZA 5KYWA 2QDWA 3CLEL 5E9DD 1U30A 3CK0L 3CCHA 5E51A 3WXVH 4U7KA 2GJZB 4OFQA 5D7JD 3V6FB 1I8AA 1BWMA 1ZS8A 1BD2A 2VW4A 2Z65C 3GXIA 3SJVB 2D03H 4W4NA 4KROD 1DQTA 3KEDA 4QD2E 3H53A 5E5MB 5IJBC 2OBGA 2HPOA 5DZ9A 3X1GA 1WG3A 3ZTEA 2HWZH 1G6RH 1SZNA 2YEZB 3CMOL 4AV0A 4O58H 5GSVB 4S1RL 2EXSA 1P9MC 3EJRA 5I6XC 2ITFA 4MMXC 5E24E 5I30L 3LRHA 3F7PC 1QYGL 2QFPA 2OAAA 2XOTA 4MCYA 3NOIA 2ATAA 3VFPB 2BVEA 4W6YB 1Z5HA 3MLZL 2QQNL 1QZNA 1NL0H 3QRBA 3TV8A 3DO3A 1ZHNA 1NIFA 3AUVA 4HS6B 1CL7H 1J9CT 3V5DB 4Q6IC 2PCYA 5DC9B 2HX7A 3RURA 1T83C 3OTTA 2JJSC 3RFZB 3D9AL 5AEAA 2VH5H 1UZ6E 4ZUTA 3KVPA 1UWEH 4U6YA 3TV3L 3ZO0A 1NCBL 3GMOA 1I7TB 5JUEH 1TZHB 3WFZA 2TRHA 4RRPM 5L0QB 3HNVL 1BZ7A 1LP9F 2VWEE 2F58L 4N2AA 2JKIS 4LZKA 4UDUA 5C0CE 4J28A 1IV8A 3WUZA 5C0JA 1X5MA 1FZKB 1IL1A 1PZ3A 1WZ1H 2C8NA 1H3XA 1TYJA 3FTUA 4L4TB 3X3GL 4A55A 5AOMA 1FJ1A 1QA9A 1TENA 4V1DE 2IWEA 2JB5L 4JE4B 4DUWA 2IXQA 3B9DA 4NGHL 4KH2A 1J8SA 1LGVA 4ZJ9A 2EVIA 4UIMA 3GJFB 5H2BA 3CU7A 1BYOA 2ZF9A 1TCRA 3PHOB 1MHCB 2RACA 4UQBA 3MYZA 4GAJL 5CEYB 3VCLB 3FQNA 3FPYA 2V9QA 2QKSA 3FRUB 4JQIH 5AD0B 1E9PB 1ECZA 1V10A 1PDKA 1ZGLB 5DD3L 5HHQA 2AI0H 2YAQA 2Z6FA 5JPMC 3II3A 3B2UC 4NCC1 5I6LA 5CCKL 4F7KA 3OJMB 5F9AC 3NQKA 5JIPA 2Q76A 1S9YA 3AG3B 1HQ4A 5H94B 5DRZA 4HAKA 2CA4A 5A6IA 2K3HA 1P1ZA 5JHDB 4BHUI 3IDMB 2GFBB 3GUTA 3JUZA 4TQ8A 3C6LA 4X4KA 5F7EH 3LDBC 5AW1B 4HG4K 3JXAA 2ZCZA 5KSVB 4U1MB 2I85A 3W2DH 3VMOA 4LSPH 1RZJH 4JO8A 5E9NA 1ZIBA 4HFUL 3UTSD 1R1CA 3HS8A 1HHKA 4YSRA 5J9PA 1JI2A 4PRNB 5I1GH 1VAHA 1THCA 3D50A 2J6EH 3IJSB 3NCMA 1VEPA 5GPRA 1H8NA 5SX4H 5KYUA 1P4LA 5EOTB 2IADA 3MZGB 4HWBA 5IQ7H 2B39A 5F7FA 3LPGA 2WBJA 4XBEL 4MJIA 1O6VA 4P4KA 3BP7B 4NDMA 3US9A 5D7JC 2SODB 5LGJA 4P49A 3H55A 2IH1A 4J4PD 1T2XA 4Q9QL 1K9TA 4KKBD 3NZ8A 4R4FH 5B8CB 4KROC 5JW4R 1JS4A 4Y9BA 1FNSH 4NWTL 3FAXA 2CH8A 3FU7B 4PRPE 1SY6A 2ZYHA 3KYNA 2VXTL 2Z31B 3LKSB 3VSTA 4LL9A 3UBFA 2J4WL 1NCWH 3OHXB 5CIPH 5HGGS 2ZPKL 1GRWA 4K94C 5JPNA 3WU1A 1S7XA 4NBZB 4XN1A 2G60H 3QRLA 4YHIA 5C6TH 5AZ2H 5A2AA 4J3XA 5T5FA 4NENB 1L0XA 3GHBH 4G6KH 3QO1A 5CD3A 4FQQA 2GUOB 5EZOH 4TQIA 2QV2A 1ES0A 3MV9A 4U1JB 1WZMA 4OIIL 3SQBA 4U1HB 1HNYA 2E59A 2XKNA 2Y3NA 5EUOF 4ZMNA 4PS7A 2ZKHL 4MSWB 1T0OA 2K70A 5KYXB 5HYFA 1RJZA 1JNHB 3G6DL 4QTHB 1VKXA 5F7NC 4Z77B 2ZSWB 4P3DB 2XRAH 1S7UA 3ZKSD 4MXWL 4YDMA 2VERA 5D2LE 3UGXA 4XOCA 3EYOB 3IJHA 2VXSH 1N59B 5IB3A 1HNGA 1OEZW 3FB8B 4Y19A 4X9BA 1V7ML 2ADFH 4Y1SA 2MOGA 4IW4C 3T8XA 3V0WL 1LK3L 1C08B 2DRUA 3C6EA 1T0NA 2E46A 2XWXA 4FEIA 1WD8A 4I48A 3CN4A 3UJJH 4A7GF 4GKSB 2DYPD 4N5UA 4WU5A 4FFVD 1WJ3A 5KOMC 2J1YA 2O72A 1F8TL 1DBAL 2EVGA 1GL4B 2XCMC 3GMLB 4HKZA 3UZEA 1CL7I 3AACA 1YPZB 5IMMB 2ERJB 3B3BA 2GT9B 3FO9B 4G8GE 2JK5B 1B88A 1WQVT 4UT6A 4GNKB 3T3ME 4KK8D 2UWEB 4GMSH 3SDXF 4PJ5A 2VLKE 5C08D 4P2QB 1A6TB 1M3JA 1MI5A 1R47A 4DETA 3MNVA 3D85A 1HCFX 2JXMA 3MFGB 3LVEA 3SHSA 4ABQA 3WE6A 4L2LA 3IS1X 4GW5B 4PJ9B 1CFTB 1N0LA 2CKBH 2LGNA 2LABA 4FS0A 3VD4A 4KHXL 1CYWA 2Z7UA 1RK0A 4TQHA 4X7SH 2H6PB 4XX1E 4OGZA 5ISZD 4WI5A 3AG1B 43CAB 2BRRL 5KBLA 4MLSA 3ES6A 4JHAL 5J6GB 2GY7B 1PZDA 5F6HI 5E1HB 1FDLL 8FABA 1U2YA 4PJAA 3UTPD 5KSAD 5AOIA 2EIEA 5BW7A 3WN6A 5KUKA 4S0SD 1XR8B 1K8IB 2F74A 3IETB 1ZLDA 4J4PC 4YSTA 5E5LA 3L5WB 2FHBA 1PU0A 1F6FB 1B4JL 1S9XB 4L0PB 4KUCF 1PS3A 1SN2A 5F9OL 3THML 3CZFB 2R0ZH 3KYKH 1XR9B 4X4MA 4YIQB 2C3GA 3LX9A 1MQKH 3QJHA 4NCDA 4KKQA 2FTAA 4ISVB 3JWNG 5D4JA 4PJ7B 3MU3A 1AYRA 3IWUA 2CHZA 1CICA 5F70A 2HX9A 4J6RH 1Q4NX 1N5AA 3MNDA 4U33A 4GG6E 3AXIA 4CN6A 1JZ5A 5KVFH 1KIRA 3QJXA 1E3ZA 3GRGA 3QDJB 5ALCL 2W92A 4HCRH 3V0GA 3RTQA 4Z7AA 1ZA6B 3MLTB 4MA8L 1MEXH 2VRAA 4LB8A 3LS4L 1P69B 2FZ3B 3HB3D 5JA9A 5INDB 5SX4I 2X1WL 5DI8B 1A4KA 2EDDA 3NK4A 4XPGL 5EWIH 3G5VA 4D9RE 4JO3L 1QR1A 4XBGA 1RUAH 3FB5B 3N5AA 3NABH 3QSKB 5C09E 1H6TA 3QPQD 4M61A 4XCFH 6FABL 3MGTB 2Y24A 4XP9H 1O5DT 5J06A 4DGIL 2D2CC 3J7HA 3WO4B 3TH4T 2JCCB 2UVEA 2PO6A 1L9SA 4H26B 3WG7B 1KIQA 1FSKC 5I18L 3KPRB 4KPHL 1M71A 3BP6A 2ALAA 1HNFA 4M3KB 2IAAC 1CE1L 1EFXB 1JWUA 1ZSDA 5IR1A 2ENQA 4PREB 4X4YB 3GMNB 2NQDA 2BOCB 1DN2A 2WO2B 1SHSA 4AGQA 4KY1H 2WBKA 3VXPB 3FFDB 5JYLA 4FFVC 4ZK8A 2EEAA 1XGQA 3O9WD 4WI2A 3AY4C 4XP5L 5HPMB 5EDSA 2YPVH 1OM9A 5DUBA 4DZ8A 1REIA 3JQOB 4XX5A 1QPPA 1YYLH 3GMMB 4TUKH 3PIQB 3CDZB 4D0DB 5T3XL 4WHYG 3Q05A 4KK8C 3ZQXA 3T0AA 1WA2X 2PYEE 4L8CA 1KCKA 3QUHA 2B59B 1YQ2A 4JPVH 4LO9A 4P4RB 4PP2B 4KHTL 3MLWH 5C0BA 1NAML 3MOBL 5EEXA 4XXDA 4JZOA 1ORSA 3CH8A 1TKWB 2H3NB 1Q94B 3CDGB 1EMTH 3RWHA 3ZGHA 3QUMA 5LBVA 4HLEA 2VGLM 4PJFE 2JI1A 3HMXL 3VJ6B 2PPAA 4XTRD 3S3PA 5E1QA 1G7HA 2VJXA 3KPNB 3KGRA 2PPDA 3E0GA 4UOW0 3A6BH 4N3TA 4OZIA 4AC4A 5KVFE 3R8QA 2PW2B 3QUZB 3FHAA 4HXAH 1BZ9B 4DHLA 2QT6A 3UACA 3NAAL 3SKJL 1X4XA 4L9LC 5KSAC 3S36H 2VR9A 1QP1A 4JRLA 3TYGH 1P4BH 4HOWA 1DLFL 5A2KH 1OW0A 4PJGB 4TVPL 1A7NL 1O9VA 4N0UA 1U8JB 2NZIA 4ZTOH 3TX4A 2V2TA 3HS9A 1DSYA 5DQJB 3V7AE 3QFJB 2XX1A 3FFOA 3NJNA 1CLVA 3UMTA 4DP4X 3N42B 3KPQB 2A3TA 1FGNL 1HIML 3OKYA 3VI3A 2QQKH 3QQDA 5FGBA 1NTDA 4V1DA 5AYQA 4JO1L 1B2WH 2AEOA 1VHPA 4XAWL 3AMLA 5HHVL 3UPAA 2VSCA 2AVGA 2E9GA 2YRPA 4QTIL 4DKDC 1BA9A 1PX4A 2WLJA 2YAPA 3HMWL 3K8LA 4KY2A 1A65A 2HSIA 5F89B 5I1HL 5CO1A 4NNPL 2WLLA 1I82A 3QQNA 5E99H 1M9SA 3ECBA 4ZMVA 4HMCA 2X7LB 4OF0A 4PTTB 2VB5A 4AKOA 1GMEA 1NAKL 1ZHBA 4H13C 4FQLH 2BIPA 5L88H 2OK0L 1LO4H 4Q52A 1OLLA 2TRYA 4Z78A 4FFZH 5F7UA 5L2JB 4QRTB 3FO1A 1VESA 4FQ1H 2G0LA 1JFHA 2X4PB 3CXHK 3EHBB 3II1A 4HCIA 3BI9X 5E6ID 1UD3A 2JV6A 4UU9A 3APNA 1WZAA 2N7SA 3QPQC 4HBQA 4O51B 2NDGA 1GGIH 4OY9A 1KXVC 5IIEA 3QE5A 5DRWA 1LO3L 5F7BA 3WEOA 4DKTA 4LAJH 3T6ZA 1U8LA 3QPXL 4APXB 4XMTA 1J1XL 3V4UL 3AABA 1NCAH 1W2KT 4OKDA 2WVUA 1E43A 2ICWJ 3RIKA 3DROB 4KI5F 2R69L 3QWRA 1T3FA 2E7HA 2JJTA 2WQSA 3UYPB 2NTFA 2ZJSH 3BKMH 2XWTB 5CJOH 1N68A 5FYJU 3R06B 3JWOH 3O9WC 1JUFB 4F5CA 5BO1L 2FWOB 4FI7A 3DUSB 3FZUD 4PJCE 1PZCA 4YHZL 3O3DA 4FYTA 2NY4B 2P49B 5HGHA 4QRUA 1WBYA 5ADOL 4FDWA 4PRIA 5E0FA 3EGDA 4QTFA 3NIGF 4HV8A 4X6DA 4TOYH 1JNLL 4JREC 3EJPA 1FG2B 1VRSA 4JFZL 3JT2A 4HJ0D 2WIIB 2PCFA 5L2KA 1G5AA 4NJAH 4PRPA 4FOMA 4LSRH 4M43L 3JVFC 1EEZB 4BZ2H 1UGKA 3KJ6L 1BBDL 2KMWA 4XTRC 1JVKA 1MY7A 4QF1A 1FYTE 3H54A 1WITA 1SJHB 1UXSA 3JZ7A 1KJ2B 3EFOA 4MQXD 3IN0A 5FHAL 4X99A 2R4RL 4LBAA 3LRMA 1T7VA 2YFNA 1BFOB 5IHUL 2J20A 3UTZB 3QFDA 3VFWB 1AGDA 3H9SD 1YMME 1TTBA 2XFGB 3ORJA 2B4CH 4GXVL 4X9YA 3ARYA 4Y5XA 3MRNB 4LXFA 5LCVA 1JPTL 2Y1VA 3IGFA 4GW1A 3U0TB 5HHMB 1KCSL 2FHFA 4MD5B 1E4XH 4TN9A 3QWOB 1P5UC 5FOBB 4PRDA 2R7EB 5EEUA 1PQZA 2WNGA 3BH9A 4K71C 4YFDB 3HZKB 3T3PF 2H3KA 1ESOA 3IDYB 4JE0A 4AYID 4X9HA 1HINL 1EK3A 5E9DB 4CC1A 3GZPA 5D7JB 3ME0B 2BO0A 5D2NA 3QZNA 4F15B 3PYCA 3EJCA 2EDKA 2HCZX 4JN1L 4A2HA 4F8TA 4KROB 1NGYA 1WGVA 3TO2B 4DGUA 4ZDHA 2IH8A 3L1OL 4CADB 2R0KH 1BLIA 3CBKB 1JRHH 1AGCA 1DJGA 3SB3A 2I24N 2HKFL 1A6WL 3MBXH 1BIIB 2EYTB 3TU6A 4A68A 2MOVA 2NX5B 4BXSV 2FSDA 4ZPTA 3C2SA 5CJQH 3B43A 5JQIB 5E6IC 3U6RB 2ZXAA 3FN9A 4ZAKA 1P4IH 3FT9A 4AK1A 2ZONA 2BSTB 3L9EA 1FWXA 1OAZL 2YN5A 5TE4H 3L6FA 5C71A 4JK0D 3RIFF 2K78A 5ERWA 5LHDA 2A9NL 2KLRA 1KTJA 1KXHA 3CFEB 1AR1D 2VLKA 3GI8L 4K15A 3P2TA 4ZS7L 3ELQA 4OKVB 4OR1A 4OCWH 5AVZB 5TF0A 4HVBA 4U4IA 2VDML 4JZJA 5F2FA 3Q3GB 3N44B 2HA1A 1JOIA 1SOQA 2A83A 1ZS2A 3KL0A 4AW7A 4R8WL 2BNRE 3D4CA 3HEIB 3NJXA 2VSMB 1FPTL 3U9UA 2QFRA 4ZFOL 1TFPA 3FZUC 5EZLB 1NOLA 2FT6A 3CFKA 4A6YL 2C7UB 2GYSA 5BS0E 4GQQA 4Q2ZA 1M7XA 1N6QH 2AK4D 2EDQA 5E7FA 4EAEA 4AYMC 3NJFA 1F90L 2VLRB 3QJOA 3BP4B 2FJGB 3K5SA 1BAGA 1XMWA 1ORQB 2OW6A 3OR6B 1C5BH 1UM5H 3IFPA 1I85A 1N6UA 3B9KB 2NXZD 2F8XC 4N8PA 4AEIL 4HJ0C 3V4LA 1HZHL 3I2CL 4F8OA 4ANWA 4WI0A 4KZDH 2VDQL 3L2MA 2OR9H 3KWWA 3QW9A 3L3KB 5DWUL 3NDZE 4MXQD 5CD5D 3LQAL 1AMXA 4YVNA 1OGAE 4NQCE 2BZCA 2F53E 3IWVA 5TQ2L 3V6FA 3ZT5A 1F1DA 5CFHA 1JWMA 5EU3A 4PW4A 5JMOC 2LE9A 2R0LH 4MQXC 1GC1H 3C6SA 4Y2DD 5TPWH 2JTDA 1MOEA 2OTUB 2WXRA 4UILL 4POZD 5E5MA 4TPRH 3L4UA 1E6OH 4MHHG 2YEZA 1FO0B 3MCYA 1ZIAA 1I53A 1OCWL 3POHA 4FTVD 3UC0H 1FNLA 3ARQA 3MUZ1 4W6XB 3F7YB 4ZFFB 3QAZB 4JDZB 5CLTA 3PWJB 4TVSa 3K80A 4Z7VB 5FCUH 1CK0H 4QRPB 1NFKA 1JIBA 3D0AA 4NZUL 2DQFB 5HVHB 2K6WA 2IDUA 3BW9A 4HC1H 5TJWK 3VWKD 5EBGA 4HIHA 1QSEA 3V5DA 4L1BA 4E9QA 4TM9A 1YVLA 3OLDA 2X4TA 2JLLA 3VI4F 3U2JA 1AOZA 1RIHL 2V8LA 1KEGL 5ITFB 5F9JB 1B0WA 1MHPH 3DOSB 4M5SA 4PY8J 1WBZA 4LFHD 1BXXA 4IDJL 5EH1A 2NW2A 2DB8A 1XL4A 4QPEA 4BWTA 2G4GA 5ACZA 2NRDA 4J3BA 1CPUA 1IGML 4I8DA 4X9GA 5SV3A 3ZE1F 3TNMB 4JFQB 3KYOA 2BSDA 3PS6A 1OY3B 4KUCD 4M48L 3RUGF 2R29L 2X9ZA 4E5XG 3S3DB 1IGJB 2MNWA 4GBXA 2CWRA 3CNKA 1J8KA 2R39A 4KXZI 3NRFA 4OW6A 5DVKA 3WKQA 5FFLA 1KBBA 3BVUA 4ZO6A 4LLVA 3U30C 1JGEA 3MBWB 3NIDE 4ATWA 4K5OA 3X12A 3JWNH 2PETA 4JFTA 4IU2A 3SYCA 1AP2B 5C0RH 2QVMA 4BGLA 3GS0A 4NM8L 2J5WA 4TS6A 4Y16B 5AKTA 3EH4B 1X5ZA 2PYEA 5C6PB 4Y4FA 5FO7B 1OAYH 1AR1C 2GC7C 1E4XI 3EH5B 4ECNA 2BMKA 5C7XL 2R4SL 3P11L 1QSFB 3IDXL 1F13A 2X70B 3KM2A 3P0YL 1JE6A 4A7TA 3BFOA 3IJEB 5H94A 5C1MB 5AOKA 3GLZA 1K4CB 2YPLE 3ESPA 2B15A 2WXFA 3X3FH 3RI5F 3V55A 4G7YH 1NCIA 5KBMA 1ZLVH 3GSOB 4QGTA 1ZHLB 2A6IB 3VE0B 1SFDA 4XPAH 5LGHH 1IC4L 1T21A 2WYTA 3LZOA 1BYPA 2PYFA 4KO7A 4PRNA 2WC7A 2CIIB 4W9ZA 4WCYH 1JK9A 1MJUL 2VERN 5DXWA 3WHXA 3BSZL 4F80A 2F54B 3UAEA 1U42A 4FG0A 3ZIMA 3V4VL 3I6KB 2F7RA 2A9AA 1CFSB 3WIIH 4MXQC 3BPCB 3SDDB 4NQED 5CD5C 5DUMH 1U8KA 2V3EA 3DUUB 1UM4L 4LRIA 3HS0A 2E27H 5IMLB 1KXQE 5GISH 4XB7A 4XN9A 5DFTA 4UZGA 3VTAA 4M6OH 3OAZK 4Y2DC 2G2RB 3BE1H 1CB4A 5GZOD 5JIMA 5KTEL 5KVGH 4POZC 2R2BA 4KFMA 1JMXA 2GBAA 5EZIH 3L3JB 4MQ7A 4UQ9A 2C26A 2OXHA 4WHYH 4AQEA 1CYGA 3LKSA 3NH7L 1HEZA 2EXWD 1RULH 3QIBD 1YCSA 3FMGH 1IC0A 4YE4H 4U1LA 2FVNA 4FULA 2CRYA 2VDPL 2P4AB 3WFEL 4U1SA 2CJ3A 2XQBL 3VWKC 4MNGB 3W9DA 4JCWA 5D7LE 1KB5H 3D3VA 5D1XD 4ANVA 3P73A 5D1ZD 3M46A 2BERA 2APSA 4FERA 4HZ1A 3DX1A 2ZOTA 2X38A 4RMRA 3DTUB 4I18C 5FGCE 1FFPB 1XIWA 2ICEB 1NC2D 4BSVA 5KSAB 3D2UD 2DWTA 1IO4C 2LFGA 4U1JA 1KN4L 4F8NA 1QBBA 4QOKA 3IBOA 4KKZA 3GGWA 2IH3B 2N7BA 2JJUA 1PKQB 1LD9A 2Y23A 2BLFA 2YD0A 2XVGA 3QIUD 1ZLSL 2AZUA 1CFQB 2BCKB 3K2KA 1EO8H 1R75A 5MEQA 1ROWA 1CIDA 4LQFL 3I6GB 3IMVA 3LCYA 3ATEA 3FB6B 1WCBB 2UZYA 2XPYA 3CJJA 4DQOH 4OLXL 1DJWA 1E6JL 4NQSB 3FOMB 3CPLA 3ZK0A 2XLLA 2PXYB 4I0PD 1A5FH 3VXME 4PJCA 3T0BA 3MACH 3ZDYF 5DFVD 4Y9FA 5IF0A 1X9LA 1D5ZA 4NT6B 1OCZB 1EDQA 1T5KA 1IAIL 1B90A 3OKLB 1NFIA 3BQUA 4Z7OF 5L4MA 4JB9L 3ZSTA 5FDWB 2EDFA 3HB3B 1J5IA 4XVUD 1SDDB 5BOZG 4XMVA 4OLZL 5IB5A 2BY3A 2YEVB 1P7BA 5E08L 1IE5A 1D6VL 2UX6A 3EBIA 5IG7A 2AQ3A 3M1BB 3OMZA 2QADB 4LCYB 1PY9A 1PAZA 5FDYA 2JCWA 3GSXA 2HJFA 4KUZL 1KTDA 3M88A 5KVGE 3ZPDA 2YARA 3WYRA 2WN3A 4M8VA 4WGWB 3VACA 4J8RA 4UQCA 1M6OA 1JXDA 2Y72A 4TQPA 3EG9A 4W81A 1QFWL 3EYSL 4WV1C 1SXCA 2WINB 4Q6KA 4UQDA 1JK8B 4PJ9A 1SEBA 1VEMA 3HKFA 3PNWB 3DSNB 4LPTA 1RU9H 4NQUA 3WFBH 5KBKA 3GBNH 5JW3L 4A63A 4I1NB 4KI5D 1QBLL 4YX2H 2VKWA 2FIRT 4YXKL 2WVVA 1T03H 4K9EH 2HTLD 4J3OF 1MDTA 1FFTB 1NINA 1OLZA 2ZUXA 1G7QB 1XR8A 3BPOB 5LNDA 3BVNA 3H0TB 1ZT4B 5IEHB 1NCCH 2VN5A 4LVHB 1NIDA 1HHJA 2ESVB 6PCYA 5GZOC 2CGRH 4JREB 4FKEA 4QRQA 3GMQA 3CZFA 3G08B 3UO1H 5IW1B 1XR9A 4DUXA 3S88L 1DJHA 5D1QE 3QEUA 4X7TB 2EXWC 2XI9A 4EN3D 2W9LA 4APQB 4OSUH 4X2UA 3BUPA 4LCWE 1KYOK 4WO0A 2CLRB 2BFVL 4O9HL 4PJ7A 3ZUNC 2A1WL 2VE6A 5DZNA 4DJMA 2V7HB 2OR8A 4PJ8A 5D1XC 5I1CH 1A3ZA 5I0VA 5D1ZC 3UROR 4WWOA 4FJZA 1SBBA 3MJ8B 1Q0YH 2FB4H 4ZX6A 5IEKB 1H6UA 1KLUB 2ED9A 2Z92A 4FQ2L 3UCQA 2OJ1A 2JQMA 3NA4A 4HK0A 3P4NB 5TE6L 1KTLA 5D96C 2P47B 2VABB 5TDOA 3UTTB 3HN8A 5INDA 1UYWL 1GH7A 3QIUC 4N2FA 4XVTL 2CHWA 4YLCA 1H0DA 2HFTA 4N0YL 1P5UB 3MRFA 1BEXA 3N50A 1IJ9A 3Q5YA 1EXUA 4XE0A 3CVDA 4K71B 5JOPE 1H5BC 4P2RE 1LO5A 3CVHB 3HC0B 4GS7B 4UINL 2N56A 4BSWA 2JCCA 1U6AH 4U1KA 5EU6A 2X44D 1T7WA 2VDOL 2Z8WC 1TTGA 2PWGA 2MOQA 1CDBA 2JNZA 4H20L 4OM1H 1NGXB 2IGFH 4U6XB 4OZHF 5DFVC 5FUCC 5BS0A 1XGYH 2BY2A 2MKWA 2APFA 3X14B 1MNNA 3PXLA 1L0QA 5F71A 1OK0A 3CHQA 3FFDA 5F3HA 2X41A 3QT2A 4AQAA 4XN7A 1JPFB 4FGMA 5GS0L 2K1MA 3DSFL 3MDJA 4OLYH 1BVOA 5HYQA 1MPAL 43C9B 3GMMA 3OKDA 3FTZA 4HJGB 3OKEA 5JA8B 3GKWH 2JIXB 3ZDZE 1I1AA 2X2IA 1PYWA 3K6IA 4AQ1A 3RX9A 1OGAA 4FYRA 2F53A 2CPUA 2ICWB 4Z7WE 5G2NA 5DURB 3GBLA 4E9VA 1QRNB 2DLFL 4RX4D 5F72S 2LAAA 5BRQA 5HHPA 1TKWA 2H3NA 4JS7A 5DHVH 2BY0A 5FHBL 3EFDL 2ZUUA 2YD6A 3MRGA 2MFNA 3OC8A 5A2CA 4P05A 2IQAB 4ZMAT 1J8HD 1UH4A 1B4RA 3U1SL 3P4LA 2MCPH 4F57H 1LP9B 1Q9WB 1MHEA 4KI5C 4X5PA 5SX5H 3W37A 25C8L 2CMRL 1OB1A 3KXFE 2FWLB 2OMYB 3F05A 4NQDB 4PG9A 1J9SA 2HTLC 5GS1A 3LHAA 4C55A 5HYJE 3R19A 4WWKB 3TBYB 1CF1A 3TZVB 3VVWA 5FLUA 2ATKA 2HT4D 1CT8B 4KK5D 2CDGB 2Y36H 4GSUA 1G1KA 4LGPB 4LAQL 4LKXB 4M5ZL 5AYUH 4XAKE 2ZG3A 1IFHL 5GJTH 2F08A 3G5YB 2UUDH 1DQJB 2A6JA 2BNQD 4GP8B 1VFBA 1C5CH 2A6KB 3POCA 4RSVA 4Z18A 3UAAA 5ICZB 4IRJD 3H85A 3NDYE 3C5SB 4MMZC 2YKLH 4PI2A 2FH8A 2V6HA 3D5OF 5LDUA 1RLWA 2AGJL 1DSFH 2RQEA 1JGVL 1BQLH 4NZFA 3PV7A 4ZNEA 3LJ3A 1P1VA 3A4EA 4X8JB 5CKGA 3VFOA 3GB7A 3TWCL 3GS7A 4LMQE 5F89A 1Y1DA 1HX0A 3EXLA 5CLZA 4QRRD 1X5YA 4IIQB 2WAQA 4YDVA 5E1GA 1VZGA 1CTNA 3H9SB 4KOBA 5DMIH 3MGOA 2AAVA 1M2OA 1TQBC 4X8XA 3K7UA 1KGIA 1P9MA 1X3DA 2NT1A 4A66A 4UAOC 4BFJA 4MMXA 4WUKL 4G7RB 3LPPA 2APXA 4O5LH 1V3LA 2WLKA 4LSTH 4XE5B 2VLJD 4PJXA 5BO0D 1OARH 1W91A 2FUTA 2XKSA 3QA3A 3FN0H 1A47A 5FA3B 4HJEA 1NUNB 4N24A 5ESVA 3OG6B 3CHSA 4Q6IA 1T83A 2JJSA 1R9FA 1XZ0A 2XIDA 3OG4B 4B9FA 1JZDC 4YBQD 5F97E 1SUHA 2X4RA 2YPLA 1FVEB 1F6AB 2D7OA 2O6EA 3NJKA 1IIIA 1ZLWH 3M7OA 4OM0H 2WV3A 1M7IB 5BCAA 4GAFB 2Y3AA 4RISL 1D2PA 4OFPA 1H9VA 1QLFB 2ZX9A 1F4WL 3ZKXB 4C56D 1UB5A 3ARGD 2DQJL 4RMUA 3FCTA 2XWTA 1L7IL 3ESNA 1UFUA 1X5AA 4GJTB 1IGTB 2Y5EA 1TT6A 4AZUA 3TNNB 3S37L 2FJFB 3U2SB 3OZLA 3HNTL 4CSTA 1NEZB 2BVQB 1J7VR 4LVEA 3K72B 4GXUM 5AB0A 2RIKA 5AVYB 4YHPB 2NZ1A 12E8H 1A7RL 5D9SA 1MFAL 2JKWA 1OOWA 3PJNA 4G6AC 5HHXH 5ABZA 1F1GA 4KMQA 4L4VE 1KXQA 1GCFA 3SPVA 1SY6L 4UTAL 3TGXA 1RJYA 1BG9A 5HI4D 1OKEA 2FD6H 4JX0A 4LASL 3WY2A 5JPMA 5DHEA 3IMBA 4MAYD 4Y1TA 1VA9A 4FXKC 4UB0L 5AVVB 2ARJQ 1A3LL 1OANA 4BA8A 1O75A 3G5WA 1A21A 4UT9H 5A40E 1H6EA 4NRYA 4R5VA 5EUOB 4JDTL 5IBUG 2FL5A 4FEMA 2APTA 2GTWB 3FQWA 3LXAA 1KJ2A 3CH1A 1D6EB 2CCWA 4G1EB 5F7LB 2EABA 5K1NA 3NG5A 1ZVSA 1MWAH 2AZAA 1JHLH 2AK4B 2BSEA 2EO7A 2HT4C 3PQYE 3FFCB 2IG2H 4KK5C 5DT1H 5T3XD 4D9LH 3P4MB 5F9WB 4AH2B 3RPIB 4BWWA 2AQRA 1XF3B 1PEZA 3A4FA 4UM9A 5CINH 1IKNC 2NXZB 1UACL 5FYKH 4NZRH 2XU9A 1LE5A 2R0WL 1IC7H 2MHAB 4X5WB 5DDHA 4OLEA 4IRJC 2YK1L 3MUGB 4GQRA 4R9HA 1UD8A 3ZTDC 1WFTA 1PZAA 1X5KA 4ZFZA 5D7JA 1BQSA 4HIXL 3B56A 1J5DA 4FHBD 1JNNL 1PZ5A 2OJZH 4LVOC 1SYSB 3ARRA 1MRDH 4TMPA 1DJIA 1XAUA 4UUJA 1RPKA 3SDYL 1YECL 1ZANH 3G6AB 5D4IA 3SDXB 3JT0A 3N85H 4FTVB 1FL6B 4U31A 4HHAA 1I4FA 1R17A 4MCZB 3ZQ9A 2OMVB 3I75B 1C12B 4TVPD 4P48A 4XCYB 1KZYA 4O2EA 4NUQA 2EYTA 1I9JH 2Q8BH 4RMQA 2DF3A 5EOQL 1IT9H 2P5EE 4FCHA 3VWKB 4UIKL 4LNRA 3SDCD 3OGCB 4IRSD 4HJ1A 2VR7A 1UATA 4L5FL 1K2DA 3RZCA 4DEPB 2WVSA 3JVGA 3BAYA 2HKHL 5T1LD 3IMUA 1BMZA 4YBQC 1M1XA 1NIAA 3KGSA 4PYHA 4AENA 3CFEA 4R96B 3H9HA 3COOA 4AGLA 3GO1L 2V3DA 4M93B 4HXBL 5KJRL 5JYMA 2C4FT 3ZZLA 3ARGC 4NC1E 2AMUA 3SBQA 3PGFL 3I74A 1RUQL 4ELMB 1JJUA 5IHLB 4MX7A 3NSYA 1JZ6A 4ZQKA 5BUGA 3K2UH 2ITEA 3BVWA 2CHDA 3KPTA 2LU3A 4E9YA 4NKOA 2R56H 2C7UA 2R9HD 5J11B 4I3RH 2XYBA 3DIFA 2DQMA 5D55A 4NRXA 1PG7W 2XPZA 3QR0A 2OL3B 3KPMB 4TNGA 1DO6A 3EDKA 3W0WD 4CKQA 1RZKL 3ZTNL 1PBYA 1UCBH 3VFNB 3V52H 4EI0A 5FYKE 1IGCL 1P7QA 3K46A 5HI4C 2EKJA 4MHHI 4Y1AE 5EOCJ 3G6JE 3L48A 3QO0B 4KKPA 4QNPF 4BH8A 4E41D 5E1AA 4MAYC 3BO8B 1JN6B 3L3KA 5LG1A 4PJIB 2WTRA 3F8UB 3TOPA 1IGYA 3CXFA 1M1SA 1OM3H 3V0JA 1VACA 4Q9RH 1N64H 4YSOA 2D0FA 2DLEA 1BBJA 3OAYH 3P4OB 4DZBB 3NACL 4FQJH 1KJ3H 1HYRC 2DQIH 4JLRB 3G7TA 1PSKH 3UTSA 1BEYL 2BP0A 3OHMB 4G7QB 4HUVA 5BVJA 3U0PB 3JV4A 4A2GA 5DMKB 1JPSH 4ZFFA 1BX2A 1SNRA 4JDZA 2W9EL 1VENA 5ECGA 1HT6A 2B2XH 2VL5A 5TK2A 2ZSVA 3IGKA 3DHJA 5IV2B 3ARUA 4G1MA 1OF2B 4PB9H 4Z1PA 5BXFB 3EFFB 4MCMA 1WAAE 5KS9F 2O5NA 3O81A 1X5IA 2WQUA 2XQYA 1TEYA 3L4CA 4F1ZA 1R24A 5LGKA 2ZCLL 3ABLB 4J4PA 4LESA 5HY9A 4BZ1A 1NGQH 4EUPB 3S3CB 1B4LA 3BFWA 1N70A 4OLVL 4Y4HD 3BZFB 4FCAA 4J3OD 4RAVB 4V2CB 4XNUL 3MODH 3APDA 3TNMA 4JFQA 1Z9MA 1YNTF 1NFDF 3TTYA 3QIBB 3LPWA 4KQ3L 3WEMA 3GSNB 3GIZH 2CQVA 1OHQA 4YSAA 5IZ7A 2WOYA 2UZXB 3L5IA 4G3YL 3WNOA 7TAAA 1N5YL 3CZGA 3GEFA 1IGJA 3TO4B 4LPXA 3LS5L 1KGCD 3SDCC 4IRSC 1WVZA 1QTYT 3NZUA 1JERA 1ETA1 3QJQB 3KLKA 5JR1H 5J3HD 4UT7L 1ZVHA 1NMAH 2VLLA 1AP2A 2CA3A 5C0AB 1NC2B 3BPNC 3AT0A 3D2UB 3BWZA 1XT5A 1KGYE 1YA5A 4GEIA 4PJDE 1OP5H 4AJYV 1AKJA 1C1EH 4I77H 2DL9A 3MC0A 4UDTB 2HAZA 2DAVA 5PCYA 3KWTA 5IMKA 2Y7QA 1FNEB 2K6YA 3HN5A 1AI1L 4LIQH 1SGKA 3IDIB 4ZX3A 1OGPA 2DLIA 1X6NA 5D4QA 4F27A 3DECA 3QEQB 3QDMB 4OH2A 5B7FA 4O02B 3QORD 5JHMA 4I0PB 4M6AA 1ZHLA 1XDTT 2R9HC 5DRNA 1H19A 3K4DA 2ZAGA 3GXPA 4MKTA 4UTBH 3V6OC 5D71H 3FU0A 1KWKA 3ZQWA 1J5OL 3PUUA 2FATH 5I8OH 3FJTA 4P9HL 1JV5A 15C8L 1RURH 1G7PA 4KH9A 1QO3B 4AVJA 5FK9B 3ALXA 2DYPA 3PWPB 5IBTL 1IKOP 3LZQA 4WI7A 1UXLA 3AY4A 1T04A 3HTLX 4Z7NE 1MLBB 4XO4A 1CIUA 2EIKB 1BQHA 2R59A 5FM4A 1Z5LB 3QH3B 3EH2A 1RPUA 4X8GA 4YBHA 1PG7H 3V10A 4RZCB 1FORH 5IESH 5C08A 5ESQA 4QGYA 3ZZ1A 2FT8A 4HP5A 4PYGA 4C57C 2AQ2A 2IFFH 4FMKA 2HJLA 4AG4H 1NUDA 3L3JA 3K0YA 4RNRA 2G75B 5CSBA 1WCQA 2V9RA 3KYMA 1HL8A 5L8KB 1GZHC 1OPGL 2Q7AA 4N22A 1SHWA 3MV7E 4LRNL 3GJFH 1RV6X 4YC2C 1HEHC 4LK4A 1OXYA 4ICXA 2P46B 3CFMA 1J48A 2DI7A 4JGNA 3ZTJG 1LTXA 3QNFA 2BP5M 5ISZA 3UP1A 2KI6A 3S9DB 3WE1A 3LRLA 2X1OA 3RNQB 2FJHB 4IBTA 1HWGB 1XEDA 4AW4A 3QNXA 4R2GB 3L2LA 4L9LA 5AVRB 2FNBA 3W11D 4ENED 4HQQL 1BJ8A 2HWZL 1G6RL 2BZ7A 5JZ7D 4O58L 2MPAH 1ZE3H 4Y4KD 4NPJA 4J3OC 1RHFA 2IH3A 4Y4HC 3TJPA 3MV8B 1CFQA 1GSMA 1FAKT 3NJHA 3L3GB 3QISA 4MZIA 4ZSOB 3RGVD 1AXSA 5HDBF 4EN3B 2YXMA 3QJZA 3GRWA 3I6GA 4XXCC 4PFEA 4LLQB 3QJRB 4AXWB 3S6CA 3OMIB 1CL7L 4KITB 4LCCC 1NQBA 3FPXA 3QNYA 3T2NH 1NCDH 2ZYSA 1TZAA 4NNXA 4G8EB 2BVTA 2VH5L 4YWGH 3RNKA 5C9JA 4LHUD 2DS4A 1UWEL 1XFPA 4U3CA 4AYGA 3LIUA 4XVOA 5JUEL 2VXUH 4FZEH 5CNHA 1DBBH 2W91A 1FL5A 1FNGB 5E8EA 2VR8A 4L4VA 3QUGA 5C0ND 1U2CA 1MQ8A 3LN4A 2Z4QB 4IBVA 2BWIA 1RIVH 4G6JL 4LF3B 1EDYA 2BJMH 4DO6A 3FXIC 1YN6A 1G4RA 1XGTA 1KXVA 4PLNC 4HCFA 1XXFC 4FZ8H 1OCOB 4PD4K 3T4AC 1J11A 4L4TE 4N2HA 2DMGA 4TNFA 1RH8A 3D51A 4OQTA 1QZ1A 3KCPB 5ALBH 1CR9H 3WNPA 5TE7H 4DFHA 4MDIA 3BLPX 1AJ7L 3WLBA 2Q7YA 1ADWA 3L54A 1Y0LB 4JQIL 5LCVL 2Q0ZX 4JAMA 3PQYA 4PV1C 4DFIA 1HAWA 2AI0L 4F3FA 1T1YB 3MJWA 5I2IA 3QZLA 1AS8A 1OOAA 1P7KA 3C5ZD 3L9RA 1EJOH 4R97B 5BRZB 3O9WA 2NY7H 1YEDB 4G8FB 4ZOBA 4ZRGA 1SLXA 2VN4A 4FNRA 4HKBA 3P69A 2XQ0A 4OZFB 5F7EL 2X4NA 2ADIA 4HA1A 4Q97A 3KPSD 5FF6B 4K5NA 2EDHA 5HBBA 1DE4B 4M1CD 1SF5A 3AM8C 4CDHA 2YA2A 2ZUWA 3ARED 3Q2LA 4OIAA 4S0HA 1G7QA 5I1JH 5TDNB 4LSPL 1RZJL 5E2TH 3I84A 4FABH 2BOBB 3BP5A 5DQDH 5JHDE 4FQHB 3O4OC 3WL9A 3SY0A 5I1GL 2DWXA 3VWJD 4NHCH 3PREA 2AJVH 3GLDA 2VYRE 3MRCB 3SKUD 5M95B 4EI5D 3NSCA 1U3HB 2CO2A 5LXGH 1QRKA 4CVXA 5IQ7L 1SXSA 2EXTA 3K5RA 1OSZB 2OFQA 1CTOA 3QXDA 1RZ8B 5DZJA 2B1HH 2ZXWB 2WSPA 2HUEA 3L5HA 5J12B 4LSQH 3LRGA 4LQ1A 3LQAC 3MJ8A 3U79A 1IBFA 2C9SA 3WIHH 1FNSL 3CFIC 3L4TA 4O2CB 4C83A 1HXMB 1AZVA 3W11C 4ENEC 5HDWA 4EZJA 5K59F 3BSGA 5IUSA 5ENWA 5J6HA 5JZ7C 4Y4KC 5I28A 2FQGA 1NCWL 3HAEB 3LRSA 2W81C 3EGSA 2BNQB 4X5QA 1QI4A 2ISDA 5K9JH 1P5UA 2ZOWA 4RMVA 4NQEE 1GGTA 3V5HB 5C0FB 1OO2A 4AUUA 1DSWA 4MB5A 5L9DH 3NSJA 1CD0A 4CMHC 5C6TL 5AZ2L 3VXSB 5ECJE 1EDHA 3QIWD 4RMBA 3UPRB 3VG9B 3GHBL 4RZKA 4KKAD 3OGOE 3NRQA 4NKDB 2XN0A 3MJ7A 1LXMA 1XF2A 5LWYH 2CG9X 1YY9D 2DLTA 3RIFK 4JVUA 1PD6A 3BYTA 4WJ5B 4YEEA 4XPTH 3HC4H 3INOA 4OFYD 2MCG1 1DN0A 4HUMB 1WA0X 3O11A 4PGBB 1BFSA 5DVLA 2X4OB 4I9WD 1FFNB 3L3HA 1J0JA 2VLJB 2OM5A 5C0NC 2J3SA 3I50L 3ZSSA 5G4OA 1HKLL 2CNYA 3V9CA 4WKXA 4FJ6A 4PRHD 2DDQH 5E6IA 4YHKH 3S3JA 4HIIA 5TQ0H 4FHJA 2B0SH 2PMZA 2YMXL 3CFNA 1WUZA 3H56A 2VXSL 3X11B 4LE8A 3K81A 4GKNA 5GZND 2ADFL 4A2MA 4EF3A 1PX3A 3QQ3B 4NNYA 4G6MH 2CDFB 4NXKA 4M62H 3VI4B 1CXFA 3FSOA 3UJJL 2ZP8A 3IAGC 1A8ZA 1ML0A 3BESR 4D0CB 1AHKA 4G9FD 8PAZA 4ZOCA 2YXWA 3C5ZC 2DN7A 4HD9A 3L4WA 3D2TA 4Z7UA 3T2OA 4JRXB 2E9IA 3ZE1B 4FG4A 1AGFA 1SJEA 5EEWA 4RGNB 3T0VA 1AY1H 4GSQA 1YEEH 4RA3A 1BM3H 3HPJA 4RFEA 3RUGB 4K3DH 5DLLA 4U4BA 4M1CC 1T22B 1ZGLM 3WEAA 3AREC 2MMXA 1ADQH 4Z3EA 2HX8A 1YPZE 3TA3D 1MFVA 4LKXA 4KKNA 5DJAB 3QI9B 2IF7A 3BCFA 3N6YA 4NB7A 4W6WB 4N6RA 4X5RA 4PWIA 4ZW8A 2KQNA 2ICES 1JZGA 1HH9B 2CKBL 4IU3B 3N40P 3VWJC 4PJEB 2A6KA 4P2QE 2AXFB 2EH7H 4EI5C 1JCVA 3FF7A 4X7SL 2QPUA 4NZTH 2X6MA 4AQOA 1TQCB 5EEVA 1E5BA 3O6LH 1FGVH 1XF4A 3VSQA 1NUFA 3LXUX 4JL2A 5CCHE 2YAMA 2FQFA 3O41B 1UT2A 3Q2CA 4PIBA 4X8JA 3IU4H 2QTVA 2OQJB 3MOAH 4C59B 1BQHG 1NSNH 2VN3A 2DQHH 3DRQB 1N3NB 2PWHA 3H9SA 3PABA 4M03A 2ADGA 1S7QA 5ESAA 2KLSA 2PWDA 3PDOA 3KYKL 4ZW5A 1E7UA 4DOHB 4WNQA 1OP4A 2OMWA 5F21B 4W9IC 3OZ9H 3O2VH 3U4EA 4DSYA 1MQKL 2GBTA 4QT5B 3U46B 1NAMB 1AC6A 3UJTH 2XZCH 1SDYA 3TBSA 1ZEAH 4NUGH 2B1AL 3BD5A 1SJMA 2H9GB 3EGXB 3E1F1 3KJ4B 3QIWC 3ALPA 3EF4A 3SCMC 1TU2A 3GK8H 4OFVA 4KKAC 3Q1SL 2NOYA 5KVFL 4N2NA 2CNZA 1KPUB 1M7IA 3I85A 1J0HA 1QFUH 1MEXL 3BEWA 4Y8DC 2VN6A 4YHLH 5MHSE 1KELH 2H4EA 2NNRA 1CJYA 2DKUA 4BK4A 2EIBA 1JYVA 4FKKA 2XG5B 3FU5A 5KVMC 2H26B 2YSSB 4UNTA 1UH2A 4I1PA 3KE0A 4XVJH 3EYVB 3TNNA 2QKIC 1KY7A 1O6TA 3QDJE 2H32B 4XCFL 3L1EA 1TZGH 2BXYA 4MVBD 4JFFD 1JWSB 1A6UH 4ACTA 3FCGA 4FA6A 3RE0A 1AQHA 1JHKH 1W0WB 3K72A 2AITA 2E6QA 4LDEB 2IPKB 2NY2D 4JRFA 3RI5K 4P5SA 3KPOA 5FKPA 3P30H 4Y5VC 3MUHL 5ID1A 2A73A 1ZT1A 3DK0A 4LDCA 4AI7A 2I60H 4TNVF 5BJTA 5GZNC 3O2DA 2ZE0A 1UZ6F 3OKOB 3BYYA 2I9TA 1DQQB 5EORH 1T7XA 3T09A 4I13B 2AQSA 2XN9D 3LKPA 2C3WA 4KY1L 4JRYD 4OVVA 5GGSY 5K39B 3T1FA 5EO9B 3D34A 4IOIA 4KK6C 2VQ4A 1IMHC 4HOZA 3V0EA 3SD5A 3VFUB 4NBYB 3DO4A 1IM9D 2YPVL 2UZIL 4KMTH 2BNUA 5I6OA 5EUOA 1RVFH 3HC3H 4TUKL 1YYLL 3WN5C 3DHUA 2BZDA 1NMBH 3VSUA 5GS0D 3GZQA 1I7RB 1Q38A 2QQLH 4PLJD 2OZNA 2NLJA 4FA7B 2VXQA 5DQ9B 2A74C 4G7VH 4Y9GA 2AK4A 4JPVL 3V5KA 1HVXA 3SOBH 2ZAHA 3OKKB 4OU3A 1XSIA 3W0WB 3TA3C 2X4UA 3DOHA 3NEOA 4JPSA 5E7BA 1N4XL 5SWSD 4K3HA 1SBSH 2PPFA 5J6SA 3NPSC 1EMTL 5IJVA 4QAWA 4A2LA 4AM0B 5LBSH 4JY4B 3EYQD 2IV8A 1OK8A 4N87A 4LVNC 1D5BA 2KT6A 5FO8B 1MUJB 1X5XA 1KYUA 1GY2A 3DURB 1A6AB 3LNHA 1SYVA 3A6BL 4Z7OB 1HOEA 1E28B 3K6SB 5L4FA 5TK4A 2VIRB 4HXAL 1AFVH 1JZ4A 3QUKA 4PMEA 4HPOH 3D25B 5D70H 2XXGA 5I16A 4Y2DA 5GRVL 2P8LB 3S36L 3LIZA 3TYGL 1P4BL 3ZXAC 3OB8A 4L3EE 3AS1A 3P9MA 2EEFA 1AZBA 1FBIH 1GKEA 3IXTA 2D7QA 4PWJA 3Q8AA 5MP6H 2AJXL 3W39A 3SYPA 1CFVH 1O7SA 2WPGA 5D5ME 4LEOB 1PIGA 3OAUH 4YL9A 3ZYOA 1P2CA 5E2VH 4FLRA 4QJ3B 2YD7A 3VWKA 5AVXB 1B6UA 4RMWA 2QQKL 2F8VA 1OF0A 3Q6GH 4NZDA 2GG1A 3LYRA 1B2WL 4YOKA 5C0DB 3BMWA 1U8IB 3EO9H 3QFJE 5CHNB 3F2LA 4I18A 1E9QB 4PBWD 3OV6A 2F1AA 3TBBA 4X6DF 1H3PH 5FXCH 3FTGA 2C4XA 5E99L 1U8QA 4R96A 5DJDB 1XGUA 2NZ9D 4Y4HB 3BGFB 4CRPA 5IM7A 2NYYD 1XHHA 3AC0A 5DEFA 3WHE1 3IDNA 3PJSA 1UFGA 4DIXA 4HSCX 1LO4L 3GINA 3QR2A 1H15B 4FFZL 5E8DH 3PWLB 4FQ1L 1DQML 1YYMH 1RY7B 2E5EA 1A9VA 3C09B 3M1OA 5D7IA 2R83A 3LSOB 4OI8A 1FZJA 1GGIL 3BAWA 4MVBC 5HVWA 3CE1A 4JGJA 3AITA 4JEGB 5HPOA 3NN8A 3QAQA 1DQDH 1LO0H 1KLGA 5B38A 1DFBH 1FL3A 1BGXH 1UZ8A 2NY2C 1KIUA 2E8ZA 2NY1D 2R1WA 3IJ7A 3KPMA 1V54B 3GQFA 5BQ7B 3PAZA 1KBGH 1FI8C 1URIA 2Q3ZA 4P5TB 2VQ1B 2VT0A 1M42A 4R84A 3FO0L 1YDPB 4RMSA 1F02I 4XZ4A 1QUNB 4KVNH 2J8HA 1GIGH 3L3OC 2ZJSL 3ZE2B 3BKML 3N0AA 5CJOL 4H0HB 2H1PH 3JWOL 4N2KA 4D9QD 4KNSA 2J88H 3G5ZB 1GYAA 2X3CA 3LN5B 4BQCA 1TSRA 1HSBB 2QZQA 3PHQB 2HFGL 3QUYD 4I3SH 5GS0C 4WNJA 1ZV9A 3MVSA 4MJID 4XOAA 4K5PA 1ACXA 2VN7A 2YGNA 4PLJC 4WI9A 3WNIA 3QORB 4KX7A 4WDIB 5INCA 3U36A 2F19H 4DZBA 4EIZC 5D2LF 4FMVA 1I1FA 1IGIH 1GAFH 2R51A 4WV1A 1ZPLA 4XPHH 4TOYL 4C56E 1U8HA 3MKKA 3O3AA 1EZSA 1JXFA 4CC0A 4JN2A 5LAPA 1AD0A 4NJAL 5G4NA 1JDDA 3TT3H 5KBNC