3K6IA

Crystal structure of chicken t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'SILATPILIPENQRPPFPRSVGKVIRSEGTEGAKFRLSGKGVDQDPKGIFRINEISGDVSVTRPLDREAIANYELEVEVTDLSGKIIDGPVRLDISVID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cadherin
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6iA00
2QVFB 4ZT1A 4AQEA 4ZMLA 1OP4A 3FF7A 2OMTB 3UBFA 1L3WA 4ZI8A 4ZMZA 4ZTEA 3K6DA 5DZVA 1EDHA 4APXA 4ZMXA 4AXWA 1SUHA 2A4EA 2A4CA 3LNDA 2OMUB 4ZMOA 3Q2LA 4ZMPA 1NCIA 1O6SB 3Q2VA 4XXWC 4AQ8C 4ZMQA 3Q2WA 2YSTA 4ZMVA 2OMZB 4AQAB 1NCHA 4NQQA 2OMXB 3LNEA 2WD0A 1NCJA 2OMVB 2O72A 2OMYB 5CZRA 5JYLA 3FF8A 2OMWB 3Q2NA 4QD2E 5KJ4A 2V37A 3K6IA 5CO1A 4AK1A 1NCGA 1WYJA 4ZMTA 3K5RA 2WCPA 3UBHA 4AQAA 4APXB 2WHVA 4OY9A 5JYMA 3UBGA 2EE0A 1FF5A 3QRBA 4NUMA 3LNGA 2X2UA 4AQEB 3K6FA 3K5SA 2QVIA 3PPEA 1Q1PA 4XXWA 3LNFA 4AQ8A 2YQGA 3LNHA 4ZMNA 1WUZA 4ZMWA 1ZVNA 2WBXA 3LNIA 1ZXKA 4NUQA 4AXWB 4NUPA 4ZMYA 3MVSA
chains in the Genus database with same CATH superfamily
5CEZH 4B9IA 5F9JA 3BUBA 4WSGA 1J5IA 2CSPA 2W9DL 4K3HA 5H94A 4JFYA 1CICC 1MFDH 1AOHA 2ZXQA 5LG1A 2G2RB 2XQ0A 3D2UD 2R4RL 3N1MC 3UAEA 3QIBA 1ZA6A 4PY7B 1IO4C 4I0PA 3WIHL 1XVSA 4M9PA 3KPQB 3DO3A 5I0YA 2ZNXA 4PTUA 3O11A 2QTEA 4NQSB 1DJHA 1FRGH 2HSIA 3MRRA 3RDTC 3KW8A 3IWVA 5INDA 1JHTA 3DIVA 3ALXA 3QZLA 4PJAE 2WQSA 5BVJA 5MENB 1IE5A 5IHUL 3NA9L 3MO1B 3RVWD 3WJJC 1JZ6A 4RZKA 3A4FA 3QDMD 3FOLB 3IFNL 1AHWB 4R7LA 1U4EA 5T1KA 1L9PA 3C75A 3B7SA 2M1KA 4KMLB 2R0ZH 2QKIC 3TN0D 4JN2A 1ZDQA 2VISB 4TVPE 5FK9A 5B39G 1BMZA 4QTIL 3D5OF 4TQEL 4Y5VC 3IDGA 3DGGB 5IEKA 1FDLL 3VDCA 5EEYA 1P4BH 3G6AB 3B56A 1UKQA 2WXOA 1UXWA 1TJXA 1FE8H 4P04A 4RX4A 1SOXA 3CVCA 4GW1A 4OJAA 2XVBA 3WDJA 1JWSA 1MFDL 2LAAA 4IM8A 2WNGA 2XWRA 1R46A 1WCBA 4KK9D 3SY0B 4X6CE 5CEXB 1NKOA 1LO4H 1UT9A 4TUKH 1DO5A 4NSKA 2PXYA 4FJZA 3PAUA 5DRNA 3DTXA 1JHLL 1E8YA 1SY6L 1ZHLB 1DYZA 4N1HB 1NANH 1QKZL 3H1ZA 3SQOL 3TTSA 2JI2A 3VXSA 3T0EA 1BIHA 4EDWL 4PGDB 1OY3B 2JJUA 2QV2A 3KAAA 4GG8B 3UTQB 4MVBC 3RIAK 4AV5A 5E2JA 2NZIA 1WCQA 2HKHH 3SPJA 5CINH 1KBGH 1UVQB 2GTZA 4PJGA 3RB5A 4HWZA 3QRBA 2DF3A 2AV7B 2OR9L 5FYKD 1QOKA 4JFED 4PJCF 1JNNL 3ZDYF 3ZYZA 3KLAA 5E70A 5FFLA 1I82A 1KC5H 1EV2E 1QLRB 1XH0A 1KTKE 4OQTL 3JT0A 2XKNB 3QSKB 3ZKXC 2E4FA 5A2BA 5MEPA 4X4MA 2RFXA 4WTQA 4BCYA 4KZDH 1DE4B 4RAVA 3VFWA 2KERA 3WE1A 2YA1A 1CD1A 4J28A 4P23B 2VITA 3NCMA 2G3MA 5JIHA 2HTKD 3FB6B 3K2KA 3NEXA 1RQ5A 3EKCA 3ARBB 1T2QH 1PCSA 4JO1H 2QVMA 2UZYB 1JZIA 1MELA 4TPRL 1FE8L 2D31B 1AXSB 4JFDA 5F0PB 4Z7AA 2EYRA 2IDTA 3MRMB 3B9EA 1AZUA 4ODTH 3FQXA 2F7OA 4AJWA 4HJSA 4DP0X 2BK8A 3G7TA 4L48A 2IALB 4PJ7A 2QFRA 1T1XB 3OHXC 3VMNA 3M45A 3H9SE 1LO4L 2R9HC 4TUKL 4HUUB 4ACTA 4WFGE 4QWWC 3V4LA 3V6OA 3V9CA 5LKNA 3DK2A 5LWYL 3FXIC 3MV9B 4FX5A 1C5BH 2H3KA 1F4XH 4Y7MA 2CR0A 3B9AA 3L1EA 1IBBA 6PAZA 4BKLA 43CAB 2XYCA 4K7PY 6PCYA 3O2VL 2X9WA 3TJHC 1HEHC 4KVNH 3PWUA 4X5XA 5ITFA 2CG9X 4YC2C 5HHVL 1NGYA 4WO4B 4ECNA 5IB4A 2CDEA 5J11B 5KVGH 4QNPF 3EGSA 4AIZA 2IAAC 4FS0A 2W1NA 4F9LA 1CFQA 1YNLH 2JJTA 3WEAA 4D3CH 3CHOA 5FB8A 2G75B 3P0YL 4Q0XH 4G82A 4OH2A 1PD0A 4YFEA 5D2LB 4JUSA 3BJLA 1DDTA 1BJ1H 3MFFA 3CZEA 1T2QL 1BX2B 1OZTG 3QIWB 3D07A 4YHIB 1BXXA 4I18A 5DD1L 5HDBE 2J1WA 3LIZH 4XZ4A 5I9QB 5AAMA 3RIAF 2NY5H 4MCZB 4MDJA 1UUNA 4MRCA 4N3TA 3G5ZB 2VE6A 4PGEA 5LUMA 5I73B 3BXNA 4NUGH 2Z31A 5IR1A 4PS4H 43C9A 2PUQT 5KUMA 5H37H 4CC4C 1TVBB 5I1EH 1OQOA 4Q56A 4P3DB 1RFDL 4HGMA 3S6CA 2AC0A 1OK0A 3V7MA 3KLKA 3QORB 1SJVA 4NHCL 1FGVH 1C5BL 2CUIA 3EYFB 3M46A 4ZK8A 1HE8A 3BQVA 4P05A 2BOBB 4AMWA 2DWTA 1D9KA 3T9WA 4FXGB 5C0IB 2VRKA 3RVWC 5HDRA 4FOMA 4JN1L 1R0AH 3RJOA 4BEIA 3GSOA 4XCNA 1BYOA 3ZMEA 3TT1H 4YHML 4D0DB 2VZUA 4G6KH 4MA8L 3GMQA 3MUZ1 3TN0C 4ZUTA 5CBEA 1YNLL 1FYTA 4Q0XL 4UAHA 3EDDA 2W0FB 3ZR6A 1HL8A 3EJJX 5KVEE 1XH3A 1YC7A 1G1CA 2V33A 1EEQA 1I4FB 2V17H 3L16A 5C09B 1WBXB 4CSTA 4UTAH 1N8ZB 1WZKA 2YPLD 3LIZL 5GGSB 4B5EA 2A9NL 3IBOA 1E8ZA 3CH1A 1IGYA 2DQ6A 5AKVA 3KYMB 4KBPA 1DVTA 1MW2A 1U3NA 3PDOB 4G9FD 2WYIA 3LDBB 4KK9C 1FJ1B 1DR9A 4PS4L 3PWPA 3DK0A 5I1EL 2QSTA 1U8JA 4CVXB 2XG5B 1EO7A 3TOPA 3EYVB 2DKUA 4FQQB 4X9HA 1H19A 3I85A 4ZW5A 1A6TB 1CG9B 2IV9A 3NRFA 4MQSB 2JXMB 4Q6IC 4ZYKB 4M5YH 5KYWA 2Q3AA 3C6LA 3ULAB 1GXEA 4N6RB 4XBPA 4NPKA 4U1GC 3RILA 2WSKA 4AW4A 1LWHA 1R0AL 3F04A 3V0DA 4PLNC 3HI5H 1EEZB 1E4JA 1OHQA 1R17A 2HJKB 3WO4B 2UWEA 3EYQD 3OHXA 3P2BA 3TT1L 2ZCLH 4U1SB 4TXVB 4F7CB 3ES6B 4G6KL 4JE4B 3HZVB 5HPMB 1K8IA 1TLMA 3T0EE 4HZAA 5EN3A 1G6RB 5D1XC 5DMYA 4HIIB 4MMXA 5TDNA 3EBHA 4HDIA 2HTKC 4FP8H 5FKAA 5ADPH 1T7XA 5CEZD 5L2JA 4PJGE 1KMGA 2FWSA 2KQNA 4P5MA 3QCTH 2X4SA 2IPTH 5D2NA 3GZKA 1BOGA 3BP4A 4IKJA 4HCRA 4XXCC 3X1GA 4P59L 1F3DH 1ODAA 3T0BA 1KCVL 1QW8A 2ADIA 1K6QH 3BH8B 3ECBB 1J1PL 1RK0A 5JR1H 1AGBB 3MJ7A 4X4ME 1U2YA 3S2AA 3QWRD 5D8JH 3E1F1 2RR3A 1FZJB 4ZD3L 2YLKA 4OKDA 1KTJA 5FEBA 3MV9D 2AHIA 1AVAA 3DX2A 5JPMB 1HJBC 3F6LA 1QWNA 3F7YB 1MKFA 4M5YL 4AEEA 1LD9A 3ILDA 1MJ7L 4KQ3H 1QLEH 5I5MA 5T3XE 1EHLL 1PNCA 5E1AA 4BK8A 4PJ7E 3HI5L 2H5UA 1I3UA 3QCVL 5F9AC 1P7QB 1VEOA 2ZCLL 3MJWA 4JKPH 1MW3A 2D7TH 1DQKA 1LK3H 1DN0A 1JDDA 3BT2L 3CH8A 3MU3A 3CD4A 4LDEB 3KNBA 3QBTB 1A7NH 5BV7H 1BXAA 1Z5LA 4FFVD 4ELKB 2BO0A 1WJ3A 5ADPL 5E2UH 1TT6A 3W5NA 4DPCX 3TVMB 3WOVA 1WE5A 1CXLA 4R83A 1NSNH 4Z7QB 2IPTL 3L3OC 4HYTB 3R19A 5C9JB 2BMKB 1VKXA 4YEEA 1QABA 2LLNA 3C5ZA 2DTMH 1PKQB 5IFHH 1YPZE 4H25B 4JDVB 3AREB 3C60A 1CXKA 1ZLVH 5GRJH 5D93B 3KWUA 4PW3A 5D8JL 3WKNA 4CL7A 1U8PB 4F5CA 4WWID 1JFQH 1A1NA 3RZCB 3IKCA 2OP4H 3EJSA 3ZKNC 3KYOB 4YDKL 3IWUA 4NXKA 1M7IB 4BA8A 3MRLA 1SJHA 1K4CA 4XNXH 2FH6A 1XL4A 1UCTA 1BVOA 4YDIH 4KQ3L 5FLUA 1H5BA 3BAKA 1QLEL 4WNQB 4EI5B 2WAHA 2VMDA 5C08B 4P4RB 2YD1A 1Q90A 1N67A 2D7TL 4NN7B 1LK3L 4PJBB 5AUMA 4OFIA 4XXWC 5H4YA 1ONQA 3MBXH 5GRXG 1IM3B 4A2LA 5GISL 3BD4A 3PF2A 4BQ8A 5BV7L 2C4FU 2UVFA 3DURA 4RGNB 5AW4B 3BZEB 4AYGA 1E6OH 4IKIA 1NGXA 4NJ9H 1RZQA 1MHCA 5D7IB 5JORB 2IEPA 3AS3A 5MP6H 5F21B 5DJ0A 3RGHA 2Y5QA 5JUEL 2DTML 3ESNA 5A16B 5IFHL 4ZBJA 3VGAC 2F54E 1FH5H 2YPKB 3IXAB 4FLSA 4W9JC 2BHFA 1ZPLA 1BD2B 4MQ7A 1I75A 2DLIA 3DJTA 3ARSA 4MFHA 1FYTE 1CUOA 3RGBA 3U7YH 3V9FA 3ZSTA 3GBML 4X80H 5D1XA 4XP6H 4GRLD 1LILA 1JFQL 1AR2A 4OLYL 7CGTA 2RJMA 1KB5L 4G5ZH 3UC0H 1J9QA 2IPUG 4GY4A 4H40A 2PWGA 1ETJA 4XAKE 5DTFA 4ZUWA 4N8VA 4NKOA 3BAJA 5CR1A 1YJDH 2DJMA 1JERA 3KPRA 4N2IA 3TEYA 3IB4A 4P46A 2WWMC 4YDIL 3N44B 1R5VB 4DKFH 5J4MA 3B8YA 3MXWL 4JPQA 1BFOA 4HJ1A 2VR8A 2YXFA 2BOCA 1M05B 5ANMA 3PWPE 4NPYA 1YEJL 4JG5A 5CCKL 1UZ8A 2NW2B 4QEGA 5EUOF 4TVSa 1HT6A 1T3FA 5JLZA 4XNZB 3OKKA 3LRLA 4D0CB 1XL6A 4P23C 1PMYA 2F18A 2ADYA 3F05A 1LQSR 1E6OL 4NLHA 2UZXA 3I2CL 3V0JA 4PREA 1NCWH 1QFUH 2NLJA 5CN2A 1S3RA 2JKTM 2XZCH 1F4AA 3DOSB 1BLNB 4N2AA 5HYJB 3II3A 4MJ6B 5L9DL 4HUWA 1FH5L 4M02A 1L3WA 1N8OE 5GGSY 3VD2A 3ZSSA 1XZWA 3M07A 2VMEA 5IROA 3DXAD 2BVOB 3SDYH 3NIDB 2G9HA 3UC0L 1SDYA 1N70A 5B1KA 5C0BB 1S9KC 3VWJD 4P2OD 3PG2A 1JGLH 3TCTA 3AXLA 4FXKC 3S88L 2LTQB 4NQED 4PAZA 4DKFL 3HNSH 2ZAHA 3BMWA 3MBED 4V1DD 2BW5A 4MHHI 2K9UA 3GHEH 2R1WB 4AITA 3I3DA 5BRZB 4RZCB 3F58H 2FJHB 2B15A 1E3XA 4W9FC 1E6JH 2G2RA 3BPOB 4K94L 3W3BA 1AKJD 4TQPA 3OLGA 4PY7A 4FFVC 4XC1L 5DS8B 5JQ6H 3KPQA 1MCFA 4LQ1A 2JCWA 4BH8B 3HS0C 4NQSA 3ASOB 1U3HB 3K6NA 4FNLH 2NCEA 1J12A 1NCWL 1QFUL 2HT2D 3EFOB 4PI0A 3QXVA 3GXUB 2XZCL 5MENA 3S0PA 4P2YA 3KWWB 5I9QC 4NENB 2J1KA 3FOLA 1AHWA 4NZTH 4UM8B 3ZIMA 4P2CG 4F1SA 4N85A 1AQHA 1BW8A 3B4NA 3OF6A 5I73C 1NIAA 5CO1A 2Q6WB 2GSGB 3B1TA 3B1UA 4WUKL 2VSDA 2E5EA 4KKCD 1TETH 3ARED 2WKOA 3LVEA 3NIFB 1FLRH 4PRHB 3Q9QA 4IOIB 4Z7IA 1E9OB 5EIIG 3SDYL 4EZMA 2VISA 1ES0B 4Z7OB 4APXB 1U8CA 5F1IA 3E6FA 4H1LH 3DGGA 5LNEA 3G6AA 4G6FB 3GNMH 5IQ7L 5B1CA 1K8DA 4ZOCA 3HNSL 4FXGC 4ENZA 1P1VA 5CNHA 3MRIB 3TEUA 3U7WH 2OMUA 4ZUSB 3KPMA 4PJ9D 2BS71 2NY4D 4EI5D 3FO2B 3F58L 2K7QA 5D7KE 4OCRL 3W57A 2XJKA 5CEXA 2VERA 4JRXB 3SPVA 1B4RA 1ZHLA 4PCSA 2OI9B 3BI9X 4K5MA 3TFBA 5JQ6L 1JYWA 3DV6A 5DRXA 1EFXB 4M29A 1IM3D 2LHAA 4PGDA 3FUIA 2EC9U 4GG8A 3KGTA 3GIVA 4FNLL 3UTQA 3D1MC 1BM3H 1PIFA 2WBXA 5DQDL 2R27A 3F01A 1RUAH 4QYOB 3DDFA 2AV7A 3D34A 2VJ8A 4ZMLA 4FLQA 4ABVA 2RGSA 4B9GA 4NFCA 1Z5YD 3UG3A 1OE2A 3WTYA 1ZIAA 2EIEA 1QLRA 2NXYB 3LDBC 2WUBL 3QDGB 2JKRM 4UV4H 3NJNA 5D6CB 2YD4A 1MCKA 2XKNA 3LSOB 3VD1A 1TETL 3DJ9A 4GRLC 1TYJA 1UG9A 1FHNA 1M7XA 2VMJA 1DE4A 2HT4D 3V5KB 4W9HC 2YEVB 1IZJA 2JKWA 1CBVH 3TESA 1IVTA 1SLWA 1XHHA 3FB6A 1GY2A 3ARBA 4R5VA 2UZYA 5EU4B 4X9GA 5CGBA 1L7IH 2D31A 3IE4A 1AXSA 1N0LA 1D7CA 3MRMA 2JJSC 5D6DC 2W60B 4NBZB 2P5ED 3U7WL 5FHBH 1MJ8H 2P48B 4JX0A 3HN3A 1MRFH 1U3ZA 1LL1A 1T1XA 4DJMA 8FABB 1O5DT 4YLQT 1JK9B 5D1XE 4HUUA 2YARA 3ME0A 3BVUA 1C08B 1QMUA 3FQYA 4UV7H 4YR6B 4JUTA 3KPRE 2GABA 1BQHA 2FECI 4B9FA 4H8VA 2NY5C 4XNMB 3ABMB 3QA3A 1A6UL 1BM3L 5HHOB 3BHBA 4MAUL 1DQQA 1H8SA 1E43A 1RUAL 5I5RA 1LO3H 2HB0A 2VN5A 4P07A 4NERA 1GOFA 4FQPA 4Z5RB 3OSVA 4MQTB 1H6TA 4WUUD 4WO4A 1EMTH 4PW9A 3FPXA 4WK2B 4R96A 5HYJD 4ODUB 4UV4L 4H1LB 5LCVH 4AGLA 4ZTOL 4ODHH 5B38B 3GMLB 1A21A 3CDFA 5J7CC 5AKSA 3RY5A 3CAFA 3UCRA 5EOTB 4HCFA 4Y9EA 4P2OC 2AJUL 3D06A 3IFLH 3HG2A 5E5UB 5LGHH 5JPMC 1BX2A 1JPEA 1C8QA 3FFCB 3QIWA 3WJMA 1L7IL 4YHIA 1BECA 1PZ3A 4QRRD 4J3TA 4U1LB 1MJ8L 3G5ZA 4GW5A 4LRNH 5E6RB 3QJOA 5AZ2H 4G6ML 5BRZD 3SDAB 1CN4A 1OTUD 4BELD 3PHAA 4P3DA 1EWHA 1LMIA 1SXAA 3V0HA 3IMRA 1R33A 3QORA 5I6XB 3F12B 4RRPG 1A25A 3EYFA 3T3PF 2AJZB 1CK0H 3TBYB 2BOBA 1CLZH 1G5GA 1Q8MA 1ZVNA 2DQFB 2HT2C 4EE2A 4PG2A 2H7WA 4AV4A 5F89B 4FXGA 5I1HH 3EDJA 3ROLA 2VR3A 1LO3L 3FB7B 1KPUB 1LQBC 1MZYA 5HBBA 4ESKA 4OFYD 5HY9B 2FH8A 1E30A 2VC2B 2DQMA 1WWAX 2NDGA 2C9UA 2J71A 1EMTL 3QXTA 4D0DA 1WPCA 3HN5A 1JXGA 4KKCC 2V3EA 1UB5A 3AREC 2PLTA 1F00I 1ZSDB 2NOYA 2H1PL 5TDPB 5K1JA 3AC0A 2Y7QB 2ZX5A 3FBQA 1VFOA 3L7FB 4JDEB 4KV5E 4YSSA 4LQFH 3BGAA 2R23B 2WXQA 2W0FA 2DEXX 2VT0A 3HI1B 3IFLL 2GK0B 4JQXA 5E00B 5GZOD 5MENE 1I4FA 2ARWA 5C09A 4G7VL 1WBXA 4BE5A 3WTTA 2RHEA 1N8ZA 3IGAB 3JQOB 3VXRB 4G6FD 2HX9A 2ENPA 3VXMB 4UOZA 2TAAA 4LKCB 4I8DA 1E2ZA 3QW9A 3KYMA 2NY4C 4B95C 4EI5C 4KMTH 4QJ5B 2VDKH 2OLDA 3V0GA 5DVKA 4H0IA 5AZ2L 4F2EA 3H42H 3UJTH 2HMID 4NN7C 5LVEA 3GB7B 1I8LC 2XG5A 4WCYH 4Y9BA 5HGGS 2QZQA 4HLJA 3EYVA 5F9WB 3D2TA 3HPJB 1CK0L 3L3DB 2VL4A 3ARPA 1A6TA 1CLZL 4YVUA 4AYFB 2HLFD 1MAKA 2CIKA 2JXMA 5I1HL 4QXGL 1WICA 4OLVH 2CLZB 4N6RA 5LBVA 5HI5D 3ISRA 4U2YA 3RVXC 4W9IC 3X11B 3ELQA 2R29H 1EEZA 5KS9F 2VGLM 4U3SA 3HN8A 5T5NF 5AW6B 1UZGA 2DM4A 2DL2A 3K6IA 1JE6A 4FQJL 2G3NA 4F7CA 4NCDA 3ES6A 1T4KB 1FFNB 3PWVA 4AWJC 1JDAA 5BW7C 2MCAA 2UYLA 1G6RA 1XGQA 4AENA 2AJVL 1XTLA 4HIIA 2X6CA 2OV0A 3RWDB 4I85A 4XVUC 3LD8C 4ES9A 4I0CC 15C8L 3ARUA 2XICA 5KVMC 3EHBB 3CN4A 3SKMA 3VTTA 3OM3B 3FNKA 2CNYA 5DURB 4KMTL 1ZGLB 2VDKL 3BH8A 3ECBA 1S7RB 2WQRA 3ZJAA 2E9JA 3BQUA 2EDJA 1AD9B 3H42L 3T6VA 2BP5M 3B8SA 3MROB 4JM2B 3J2PA 2XIIA 5KVDL 5B3NA 4OAWB 1KPRB 4XNZC 2YC1A 3A0OA 4C83B 2B9AA 4YX2H 4UZGA 5JPMA 3E2HB 1NH6A 5T1DL 3F7YA 4H7VA 5JTWA 4B27A 4PCTA 4Z7UF 5I6KA 1N0XH 2ED6A 2EXYD 4X8GA 1DVUA 2CHZA 2VNCA 5AKRA 2X05A 5TF0A 4FEIA 3U1SH 4DUWA 2DAVA 2R29L 4X7SH 5JOPD 3O81A 1P7QA 1OOAA 2YS4A 4GI8A 3UGXA 4IS6B 3MKKA 3KGSA 1XEDA 4AKPA 4BE6A 2IWFA 2HRGA 4RGOH 1ETA1 2AJ3B 4B50A 1BMGA 4DN4H 1UGNA 3MV9E 2ZWKA 4WVRA 3MUGB 5I6LA 3JWDH 4ELKA 1SOKA 3SDCB 1G9MC 3TVMA 2MIZA 4XGZB 3RE0A 4Z78B 3MRDB 2DQTL 4XNQB 1AG0A 3FUHA 3NSCA 2CIIB 3ZE1B 2EDTA 1UM5H 2BMKA 4DP6X 1PKQA 3MV8D 4Y5YA 4ODVH 2KHAA 2BSCA 3UEQA 3GXMA 4ANVA 3B7YA 4JDVA 3OAZH 3VQLA 1JUFB 1LDSA 1OTUC 1UKTA 3V0VB 1SJEB 1NBCA 3BPOC 3WS6C 1U8PA 2MRYA 1SPDA 5D2LE 3GUTB 3RZCA 1SVCP 2F0CA 2OMZB 3KYOA 5B1AB 2WLKA 4YX2L 1M7IA 1R3KB 3OGCB 3ZTCC 5TE6H 2XBDA 3KEDA 1YC8A 3GIZH 2P9RA 2FEEI 3FRPB 4GSRA 1GGTA 3BAYA 1GS7A 1USQA 2AQ3A 4M7JH 3U7AA 4X6DF 4MNHA 4WNQA 4R2GD 4M3JA 3F00A 3U1SL 1YHPA 3QEQB 2BP8B 4X7SL 3UG5A 1NICA 2OYMA 4QTHB 3CV5A 1G1OA 1F11B 4PJBA 4PVNA 1G7PB 4RGOL 4FA8A 1YJDC 4RWHA 5DC4B 2D3LA 3N3EA 1N64H 3OB0K 3ARFD 3SDDA 5I8OH 1PSKL 1YEGH 3QO0B 5IEHB 1YO4A 2UZIH 3BZEA 4PJHF 3RUGF 3N1GC 3CG8A 5ID1B 2YD6A 5B22A 5D7IA 4N9GA 2E27H 2QGBA 2HPOA 4ZFOB 1UM5L 3SGJC 3VXRD 3DSNA 5I16A 5A16A 3WEOA 2YPKA 3IXAA 5TQ0L 2HMIC 1O6TA 1BD2A 3QEGH 5TF1H 3ZYIA 1JNJA 3OKOB 5F7NC 3B43A 4R26L 3D51A 4M6NH 4XXDB 2DN7A 2KBGA 4JE0A 1J9RA 3K46A 5C09E 5TE6L 2HLFC 2LR4A 3GIZL 4BYHA 1U8KB 3GK8L 1MY7A 4AXWB 5HI5C 1R5VA 4FYSA 4M7JL 5CUSL 3VX1A 3VGFA 2EH7L 3FN0H 5BS0D 3QUXD 4HXAH 5AYUH 3FOMB 2NQ3A 1Y1UA 1OAJA 4NNPL 4X6FB 3BUIA 3J07A 3L08A 4DKTA 3FTWA 5SX4I 1OAQH 4JRLA 3QWQB 1XGPB 3MLXH 2EVJA 3GXFA 4OT1L 5F0MB 3IRPX 4U4IA 4PJCB 2Y7SA 4D0CA 3ZDYB 2WQAA 2Z91A 1F2QA 4WU7B 5LN8A 3HC3L 4I4WB 2X9XA 3FBKA 1NC4B 4W6WB 3DROB 4UT9A 2E27L 3VFNA 3BWUF 4PV9B 3DOSA 3FS9A 4LB8A 1BLNA 1OF2B 2H8PB 4MJ6A 1XCWA 3DRQA 2ED7A 3GRWA 1RZJH 1UWFA 4BHUA 5DURD 4YJZL 5JW4M 3ECQA 5TF1L 5GQBA 2Y2YA 2VQUA 4GO9A 4N0CD 3X3GH 3BH9B 4MMZA 2BVOA 4JM2D 5I1AA 4ZDHB 1AGDB 1MFBL 3CU1A 3IGUA 3J7HA 3GKZA 4TNFA 5ICXB 4KI5D 2CKNA 5C0BA 3VA6A 1A22B 1WA2X 1YA5A 2J4WL 1CGTA 3RWCB 4LGSB 4JFSA 2BVYA 2MCPH 2FIRT 5ESAB 3ET9F 3KPOB 1UYWL 3BVDB 4DCQB 5BJTA 3GYRA 4HXAL 4QY8B 5AYUL 2R1WA 4QXWA 3CZJA 3B5GA 2AFNA 4RZCA 3VFPB 2FJHA 3BJ91 3ZBMA 3BGFB 1ASQA 3WSQH 1OAQL 3WS6A 5C2BH 5IWLC 4L0ZA 4N1CA 4YO0B 1QFWI 5FA3A 5CHNB 5DS8A 2OQJA 4QMEA 1IAMA 2WCPA 4BH8A 3F3HA 1ZOXA 1U3HA 3W38A 3UZEA 1IC5H 2P8MA 1MG3C 2H0EA 3EFOA 2DQDL 3FMGH 2A6DB 1J11A 2CHNA 1DLHA 4BFKA 4LSSL 2XA3A 1ZLWK 4NENA 1X5LA 1BAWA 1W0VB 3DX3A 5C0RH 1RUML 1FNSH 4UM8A 3VDAA 2EE6A 1RZJL 4PJFA 1WGOA 4WEMB 5HJDA 1NUGA 2K45A 1GS8A 4YDZA 5JHDD 1MWAH 2CJSA 2GSGA 2PCYA 4QHNB 3SDAC 3DSFH 3OTTA 4NRYB 3MUHL 3X3GL 4PRHA 4IOIA 1E9OA 5KSUA 1Y6MR 4ISVB 2MTAA 1ES0A 5KAQF 1N2RB 4FERA 3GGWB 3VH8A 5I6XC 1DBMH 4W9KC 1AG6A 4IMKA 1OHZA 4NKIL 4Z7QE 3FSAA 5BOPA 1DQLH 5C2UB 1TDQA 5EF1A 2XWJB 2V4LA 3TPUB 2IC2A 3HC4L 2XQYA 4R2GC 4TULH 3QIUA 1PKQE 3BYTA 3LKSB 5HVGB 2QVFB 1RLBA 1K5NB 4PN6A 5D1ZA 4ZUSA 1E67A 3A24A 3UBXI 1P4UA 3BC9A 1HWWA 4Y8DC 3TU6A 4A6YB 3OZLA 3ZDWA 3PNWB 3FO2A 3PL6A 4S10A 4PJEF 1DN2A 4L3CB 3WSQL 3ZPDA 4JRXA 5C2BL 3AU1B 3IKKA 4AQ1A 3ARFC 1E4KC 1INEH 5ES4B 3Q8FA 3NP3A 4H8PA 1EFXA 4DKEL 3ROOB 5C71A 1IC5L 1I8MB 4HEPA 4PJ8A 1NIFA 1QSFB 4QYOA 2ZF9A 3HLAB 5C08E 2EUVA 3HMXA 1P1ZA 4NOBA 3WMPA 4GRMA 3BOVA 1BBDL 1FNSL 4K23H 4LOEA 4J2XA 4PJBE 5JOEA 4ICXA 2J55A 2P45B 3QDGA 4GB9A 5D6CA 1XIWB 3PUCA 4ZFZB 1UM4H 3LSOA 3PNRB 4AI7A 3DSFL 4PWIA 1SQMA 1HX0A 3TZVB 3MYJA 3V5KA 4RGNE 4DP2X 3TPKA 1U8NB 1RUQH 5FM8A 5F9WC 1NM4A 5IMLB 4NQCB 5D7IE 4HD9A 3BSZA 1I8IB 2O6FA 4LHUD 4MA3B 3RL2B 3RWHB 2GFBB 3OVUB 3T1WA 3M8OL 2G5RA 4J8QA 5LN4A 3B6SB 3BDXA 3O6FA 1BD2E 3ELAT 3ARXA 8FABA 3C5XA 1JK9A 5SV3A 2PYEB 3SPGA 1H8OA 3L4XA 3IFOB 4G70B 5IW6A 4WV1B 3D52A 4ETQA 1O9WA 3Q6GH 4MB5A 4MS8D 5GGVH 4NGHH 4BDVB 4M93B 5EA0H 4FCHA 4XNMA 4HPYL 2WN3A 3JV6B 5HHOA 3VWKB 2ADJA 1UH3A 3QFDA 1HVXA 2HVKA 3JVGC 1IIKA 2DQJH 1NC4D 4Z5RA 3TBTB 1MCQA 3EHBC 1Y0LB 2IWKA 1I3GH 1EXUB 1EA9C 4JPSA 3O3DB 4X7TB 1T0PB 4OCLC 4C57C 3NJVA 2DS4A 4ELMA 4ZX6A 1HNYA 4ODUA 4N0CC 1W80A 1UM4L 1WD8A 4JM2C 1KJVB 3LS4H 2FTAA 3FYEB 1YMMB 2R69A 2A73B 3IRCA 4KI5C 4N2MA 3CUPB 3MZGB 5EOTA 1DJZA 1RUQL 1TVHB 2AK1H 3VACA 2YXVA 4WF7A 1KIQB 2ILLA 3DECA 1E4XH 4X98B 2A83B 1C16A 4PJ5D 5IQOA 3FFCA 4NC1C 4EUPH 1BAGA 1W72B 5HD8C 3L95B 1GJIA 5JMOC 2ZKHH 5HYJE 3MI6A 2GJZA 5GGQL 2A1WH 1DJWA 2ALAA 2FNBA 3AGWA 3EYOB 1OP4A 5DQ9A 3SDAA 4G6JL 1G94A 1I8AA 1XD0A 3P9LA 4OM1L 3ZTEA 4YHLL 5FX3A 1R34A 3NIDE 1P5UC 3EYSL 4UDUB 4HS6A 5B1JA 5C0BE 3RY4A 3Q6GL 1JHKH 5GGVL 1MJJB 3E80A 3QQ3B 4MJIA 4UAOC 3AMLA 4KOBA 2FT6A 2AJZA 1SEBB 3SDCC 3TBYA 3HG5A 3QR1A 3IFPB 2DQFA 3HLKA 4Y4FB 5F89A 3EAKA 3NUKA 3FB7A 1KPUA 2YMXL 1S8DB 5D72H 4L3ED 5HY9A 1I3GL 1X5JA 1KJMB 1A4CA 5BRZE 5I1LB 1YEEH 1M53A 1I1AD 2WMPA 3S98A 3W39B 3L45A 4GSUA 4JY6B 3TT3H 1A02N 4L29B 4KKRA 1QD0A 4NNYB 4QRUA 4TS6A 1BXUA 1ZSDA 4JVUA 3LS4L 1JPSL 5CLZA 2Y7QA 2WWOA 4FI7A 3L7FA 4JDEA 2PP7A 1O7SA 2R23A 3OKEB 2AK1L 3HI1A 5ALBH 1E4XL 4K5NA 4UIKL 5F93C 3VD3A 4Y16B 4R4FH 3Q44A 3VXMA 2ZKHL 1D7BA 2JTYA 2PF6A 5AVXB 4Q9QL 1WAAA 1LMKA 2E7CA 4XN8A 3NIFE 1ERNA 4PRHE 4HS8H 4IHOB 2CO7B 3CN3A 4Z7OE 3GB7A 1JHKL 3FYIB 5DJZB 1T1WB 1UWGH 3OG6B 4G3YL 4AGQA 3L3DA 4NHUA 1TR7A 4LDLB 2N7BA 4WIQA 4KQ0A 3NAAH 5IBUB 4K4KA 3X11A 2EDYA 4X8CA 3W2DH 2A6IA 5FUCC 2Z93B 3Q1EA 4JRXE 5KSAB 3O2DH 4OLXH 4PI2A 2ZE0A 1GTNA 1T4KA 4WKZB 1FFNA 3FQWB 4UQ2B 1QRNA 4N8PA 1XIWD 4HKJB 5IFJB 4X9BA 3CCHB 2ICEB 5IVZA 3TZVD 3CZKA 1XGTB 3LNHA 1U33A 1IU1A 4PRID 5J8OA 4ONFH 3QEUB 3V6FB 2YEZA 4NUQA 4J23A 1LP9F 6CGTA 4R4FL 4M03A 1FSKB 1K5WA 2AJXH 2Q3XA 4NKDB 5DD6B 3BVXA 5BZZA 1F5WA 4NM4H 5E6UB 1S7RA 3QDGE 5CIPH 4XNBA 3JWDC 4PB0L 5SWSD 3WTSA 1MHEB 1AD9A 3MRBB 7PAZA 3JBG7 4HS8L 4YH6A 1WRFA 2WXMA 5FGRA 3SPCA 1MDTA 4MS8C 2PN5A 2H6OA 1KPRA 2EDQA 5DK0A 2ZZUT 1YEFH 1H3XA 4C83A 4HT1H 4CBPA 3D33A 4FNQA 1QTSA 4D7BA 2B1HH 1UOKA 1F6AB 4JQIA 3GSQB 5JW3L 2VDRB 4XVJH 3NAAL 4OZIA 4QRQB 4IRSD 4DNLA 3W2DL 3P73A 4UQCA 4JL1A 4NO0D 4QAWA 4IS6A 1UWXK 1Q38A 3O2DL 3QFJB 3EBAA 2AJ3A 4D94A 5D96C 3MUGA 2E9GA 5HHOE 4Y2LA 1EFQA 3SDCA 1VHPA 4XGZA 2OL3L 2X4TA 4BWWA 4Z78A 1IC1A 3MRDA 4U1JB 5BQ7B 3FHAA 1IGCL 1SN5A 4NQXB 3WDIA 3UTSD 3HKZA 2FL5B 2AJXL 4P9HL 1X6LA 1GL4B 2UUDK 5FPIA 1RV6X 1YMHB 2A9DA 2DH3A 4BSVB 3WGUB 1JUFA 5L2KD 3BWAB 3BGFC 3V0VA 4J3OH 1P6FA 4ETQB 2PPFA 4OGXH 1U8MB 2A9ML 4K71B 3OJ2C 5E1GA 3E6HB 2IANB 3GUTA 4ZAKB 3CDZB 1YEFL 3QDJA 1V55B 3GSWB 4W4OA 5GRUH 1R3KA 1J0YA 3OGCA 3H9HB 2NTFB 3FFCE 1WUNT 3FRPA 5JYMA 2E7LA 4R8WL 1YLBB 1JF6A 3OJMB 1Q0EA 1NGPH 1T6WA 4OF7A 4A7GF 1THAA 3DDGA 1TJHH 3WGVB 3QEQA 2BP8A 1I1AC 4OCYH 1KYUA 5E1HB 3OB8A 3HR5B 1U9KA 4WEEA 4TLKA 5DR5H 1F11A 2OSLB 1G7PA 5LDUA 4YHZH 2HP4A 3GEFA 4OBSA 3IDJB 1RULH 5CILL 4KFZC 3MLSH 4AJVA 2OCFD 4GSDH 1PZAA 3BPLC 4ICWA 5I1KH 3QO0A 1E3FA 5IEHA 3OXSB 2AXHA 4QKTA 5ID1A 1NEZG 1IZKA 2MKWA 4PCYA 4NRXA 1RP8A 3EJPA 3EBGA 2QPSA 2A74C 1Q72L 4A63A 3K4DA 2ZYRA 4IGBD 1OAXH 1RHFA 1WIOA 2BP0A 2JB5H 9PCYA 4RIRB 4XO5A 4F7KA 4HUXB 4BFNA 1IAOB 3OKOA 1G7HB 4FJYA 4OGXL 2MOQA 3RNKB 5AOIA 3WFEH 4XXDA 5C6TL 2AZUA 5ITBH 3QPQD 4A2EA 3MTRA 3R8QA 5F97E 1MZZA 3VXRE 1U8KA 3VXME 1RZJC 2VO5A 2DJUA 4AXWA 1CBJA 2D7QA 5J1AA 3LV3B 1NGPL 2GW5A 2VJXA 1TJHL 3TP4A 4L0YA 5SWZB 4OCYL 5DRWB 3FOMA 3P2TA 4ERSL 1A64A 1IAIM 5EC2A 3FH7A 1Q0XH 4KXCA 4B9ZA 3CVIL 1H3WM 4WI6A 2VQ1A 2Q7NA 3G5XB 4H13C 1XIWC 1S4IA 5ERWB 1RULL 3FUEA 1VCAA 4N22A 4PJCA 3TZVC 4FQXD 2HCZX 5I1KL 3ZUCA 1GGIL 4WU7A 1FV1B 1QHOA 4I4WA 4ZODA 1BGXL 4HHAB 2M83A 3HS8A 2RCSL 1LE5B 1GS6X 5M94B 4FMVA 1HYSC 2N7SA 4AMKL 2AK4D 2CU9A 3T0VA 4ZSOB 2JE8A 5I6PA 3MV11 2XY1A 3JV4B 1OF2A 3U4EB 1OAXL 1PX3A 4KJPD 1QLFA 1PNDA 2OZ4L 1FO0L 1K9TA 1TITA 5TK2A 3P2DA 5EOQH 5F9DC 2EDDA 2Y1AA 3HZYB 3X1FA 2R83A 3WO3B 1JV5B 3BH9A 3STLB 4KX8A 1CDHA 4WV1C 1AGDA 4ZDHA 4KXBA 1C5CH 4OZFA 5ITBL 1JPGB 4M93C 5DJ8B 2TSBA 2D4FA 3RWCA 3FQNB 4WKXA 5ESAA 3QZBA 4DK5A 3KPOA 3LEYH 4NN6B 2XC8A 2DTSA 4MNQB 1WFIA 4QOKB 4W6YB 4IRSC 3RHWK 4Y19A 4DCQA 1TTCA 2AV1A 4FG4A 1OPGH 2BSSB 1HKLL 1Q0XL 4WY7H 3VFPA 4L5FH 5J6HB 2V0AA 3CLEL 2PWEA 4KI5E 2H32H 1J9CT 1MQ8A 4WJG3 5BQDA 2WZ6A 1NA8A 3X1EA 1QUNB 2JVUA 4G59C 3BISA 5AVUB 4AUJA 3FCGA 3V4VA 2VM4A 5KYUB 4CKVX 2A6DA 4KNUA 3A67H 3WNNA 1XSOA 3ASNB 1UJ3B 1KJ2H 4LHJB 2ZOWA 3HZ3A 4XI5D 4BFIB 2ENYA 3HAEH 2EDBA 4FA7B 5EU7E 3LEVL 4RBPK 2WNKA 1CQYA 1EAPB 2GIYA 1A0QH 1MCLA 1T1ZB 4U1HB 2RALA 1JPFA 4NRYA 3VXUB 1DBAH 2RIKA 3IJSB 4IMLB 2EINB 4RETB 4HOZA 2XJLA 3SE9H 3LPPA 3QNFA 4ZAKD 2BSTB 4M3KB 1S9WA 5KVFL 1RLWA 3SJVA 3LEYL 4HZLB 3ZE1E 1CDJA 5DHYB 2AAVA 4G2AA 1LO0H 3LKSA 3O2WH 1JDCA 3P4MB 1K5NA 3F7RA 4AE0A 1CFMA 2HRPH 3G9VA 3T3PB 4WY7L 3PNWA 1X5AA 4KTDL 1L9QA 3MR9B 4L3CA 4OFKA 4W4NA 3A4AA 1UADC 3WI9A 2ZX7A 1ADQH 2PWFA 2I07B 5FYJH 5JHMA 2HFGH 2WJ7A 2JCCF 1IB5A 1N10A 3D2UA 1N4XH 4KO6A 1CDYA 1AP2B 2FGWH 3BLPX 3ROOA 4L2LA 1Z9PA 1ZJAA 2CHDA 2JQAA 2NQCA 1VGKB 1E7VA 1Z2KA 5JMRA 3Q6FB 3GBLA 1AH1A 2L04A 1QSFA 4OLZH 3QEQE 3HLAA 4Y16C 5K1NA 2ZUVA 4JEGB 3A23A 1EXGA 1PW3A 4XVTH 4DGYH 1IQWL 2WVTA 4E9XA 4LL1A 3JWNH 3RHWF 1SJXA 1ZLUH 2BIMA 4ZFZA 3U36A 4JNXA 5KW9L 2MMXA 1BZDA 4CW1B 1DBAL 4NB7A 1OL0A 4J2QA 1P2CB 4YSEA 3REVA 3MRJB 3SE9L 4L37B 1U8NA 4YSQA 5IMLA 4NQCA 1L6PA 2IPUK 3P77B 3FH8A 1RCYA 2PETA 5DJXA 1I8IA 2WSDA 1RZPA 4MA3A 3EJUA 4XMLH 3RL2A 5FUCE 2AP2A 3EG9B 4NLAA 3O2WL 3P30H 4M8QB 4OLEA 3Q3GB 1TU2A 1D6VL 3I75B 4XCCL 3B6SA 4FNSA 2HRPL 2J7LA 4V2CB 1CFTB 1B0IA 2JWYA 3I6KB 4A66A 5EEUA 1FNEA 2WQWA 2FIKB 2PYEA 3SE4A 3BAEH 2HFGL 4M3HA 2BSBA 2CHXA 2Q1EA 4WV1A 1N4XL 3WCYA 2A6JB 3FB5B 3HEIB 4FQXC 4BDVA 5KS9B 2F7IA 1SFHA 2ICEC 4XNYL 4XX1E 4H8QA 4GMTL 3JV6A 5G4OA 4LE8A 3VWKA 2OXGA 5LXGH 4YSAA 5KANG 3KCPB 1ZEAH 2D3JA 4HHWA 4OLZL 4XVSH 1T0MB 1SN2A 1FSKC 1Y0LA 1EXUA 3NN8B 5EO1B 1HEJC 5JIDA 4J3OD 4XVTL 4DGYL 2R51A 1I3VA 4K2UH 1FCCA 3PRZA 2CGRL 3DC0A 1VESA 4GKOA 3L3JB 4MJ5B 3S35X 5D7EA 4PJCE 5IF0A 2DDQH 2GBAA 1YMMA 3ZDYE 5HYSA 1TVHA 3QZWB 4BFFA 1KIQA 4N2DA 4XP5H 4X98A 4ZMXA 4IBVA 1XH2A 2N1KA 4RFEA 1MRCH 1W72A 4K8RL 4O2EB 2R2EB 3P30L 2KUTA 4MNQD 5HI4D 3AQYA 4Z23A 5EU6A 2J20A 4WW1A 1RUPH 4TVUA 2ADGB 1O5PA 3NFPB 1NWPA 1EIBA 2KZWA 2WB7A 4Z7UB 2JJWA 2XTJB 5HGAB 4QJ4B 2ZSVB 5H35B 3GSNA 4JLRB 3N2JA 2YKLH 1MJJA 3QQ3A 4I48B 2W38A 4NIKB 5H4ZA 4Q7DA 1SEBA 1WZAA 4Y4FA 2D9QB 3QK0A 1VJSA 2FQGA 3RTLA 4Y4HA 4C8XA 1ZEAL 4QO1A 5C3TA 4XVSL 5C0GB 3JYBA 1S8DA 2O72A 5AZUA 3ZRSA 3TBVB 4FLRA 1KJMA 4GRWH 5I1LA 2DMCA 1DBKL 2ICWJ 3GXPA 3S2CA 1BQ5A 3LXCA 4MQXD 4L29A 1E8XA 2YIHA 4YBLB 2ERJC 3D9AH 3L6FB 4NNYA 3U2SB 2P3YA 4EN2A 3GI9L 3O9WA 3EADA 1IGTB 2X6MA 4K71C 4LF3B 3OKEA 3EOBB 4XNUH 4ZAKC 3RWIB 4QNPE 5JW5B 3K91A 3UPRA 3IDMB 1QBML 1BAFH 5IQMA 1U0QA 1MRCL 1UOWA 2V7HB 4J6RL 4Y16A 4DP4X 3QXUA 5CZXD 2E8ZA 3LH9A 4HX1B 3C08H 1OSZB 1NBZA 3MUY1 5SX5K 3EIFA 4TQHA 4QRBA 1LXMA 1X44A 3KBFA 5F7LB 2NNFA 3FSZA 2Y4SA 2IMMA 4IHOA 3FONA 3N1PC 3OX8B 1KACB 2CO7A 2QADD 4X6DB 2XT1B 1HSAA 3QG7H 1ZTXH 4AQ8A 5AFAA 1EHXA 2QL1A 3CLFH 5DJZA 1T1WA 3UAJD 2XN1A 4YNYA 5DMIH 3RKPA 1T7YA 4NXSA 2GQHA 4FYTA 5FECB 1SVBA 1F18A 4BQCA 2BVUA 2Z65C 4XP9H 4R7NB 4HKXB 4YHYB 4U6HA 1JCKA 2CZNA 1Z32X 4H20H 3L3HB 2P5WB 4PJHB 3RUGB 1UM6H 4QJ3B 5KSAA 1CFSB 2YAPA 3DOHA 3FQWA 4UQ2A 1U30A 1YEHH 1TTRA 1OT1A 1U6AL 2QPEB 4HKJA 5DQJA 3WELA 3CCHA 1N3NA 5AVRB 3AUVA 2DQCH 4RSVA 5BUPA 4XNUL 5IG7A 1B9ZA 4UBDD 4DZ8A 1QSFE 1YECL 1PAMA 5I8EB 5IB5B 2WVUA 3HFMH 3TO4D 5E5LA 2MTPA 3H54A 4UQ3B 1J9TA 2WW8A 2XN9B 4NP9A 3C08L 5DJDB 3REWA 4F8QA 4PM1A 1FFRA 4K9EC 2B9BA 2AMUA 1XCQB 5JIQA 1MHEA 2QVKA 3MRBA 3CK0H 1SEQH 1BVNP 2FHFA 3SE3A 4UYPA 4HC1A 2FRGP 3LN4B 1A3LH 5IP4A 2ZWYA 4L4VA 4BSJA 3O41B 3CLFL 2D9CA 4NQCE 3MLWL 3QQ9C 2Z92B 4F24A 5DMIL 1E5AA 1SXBA 1EH9A 1K85A 1F6AA 3NDZE 3GSQA 4G6AD 5EUOA 4OZGB 3M1OA 4XP9L 1PZDA 4QUOA 2Y07L 4EIZC 4HK0B 1HL5A 4QRQA 4H20L 5F7AA 3GMRB 2CNZA 1B3JA 2OJZH 3AXIA 1WD9A 3MYZA 2PYEE 2FQEA 4TN9A 3V5DB 2E6QA 3QFJA 1UA6L 3MV7D 1AQKH 3IYLW 3N9GH 3BP6B 2ICWI 4K3GA 4EQ3A 1DJXA 1QNZH 2DQCL 3MQIA 2OW7A 3POCA 5E95B 3KWTA 3DV4B 4FXLA 4L23A 3RU8H 1MREL 1MFEH 4U1JA 3T1FB 3S3BB 1KBWA 5LGJA 4K5PA 4NQXA 3C8HA 2AQQA 1EDQA 4MXVF 2FL5A 3M7FB 5HI4C 5DF0A 2CPUA 5JZ7D 5FYJD 2AS5M 3DLQR 4ZW6A 1OT2A 4BSVA 1SY6A 3CK0L 3VRLF 3EUUA 3QG6B 4JMNA 2EH8H 4JO4L 1YMME 2WXRA 1U8MA 3OKYA 1KB9J 5HHQB 3NPZB 1GGBH 2IANA 1DJSA 2VDOH 3CDZA 3FDWA 5HSFA 1QQDB 2H6UA 1H6FA 1A8JH 2WBKA 2ODHA 2NTFA 3UDWC 3GJFK 3WFZA 4NFBA 4YDVA 4JY5H 5B1BB 1N12A 2E3VA 3BIAX 3WUZA 4HS3B 1IGFH 3KM1A 4OQTA 2K4WA 2OJZL 2ID5A 1G9HA 4QT5A 3HR5A 1EQWA 3VFGH 1VPOH 5CCJA 2OSLA 1AQKL 1M6OB 3GLEA 1ET5A 1TFPA 4FL4B 3N9GL 4YOKA 3IDJA 3WTWA 3MRKB 3WHXB 2R56H 1CS6A 1G9NL 2ZG1A 2IWGA 2BDNH 3OXSA 3OQRA 3DPBA 3RU8L 5AVQB 3SBWA 3HUJF 5CZXC 4ODWB 3BZ5A 5A2CA 4PFEA 1B90A 2QQLL 3FZUD 3FRUB 3IEAA 4CUCA 2C1OA 4ZX3A 4XN9A 4RIRA 4IJ3B 2CCWA 4HUXA 4DVRH 2P26A 1S7QB 3MXVH 5DSCB 2HN7A 2QADC 4JFHE 2J2ZA 4GS7C 3RNKA 2WINA 3QI9B 4FQIH 3AGVA 3SCMD 4AZ8B 3KZ8A 4R0LB 4MS6A 3PXHA 4CDHA 4EMZA 1RZKC 2XXMB 4JY5L 3QNZB 3RB7A 3OWEA 1W0WB 3CDYA 3MDJA 4UM9B 1PLGH 5FR3A 5SWZA 3DMMD 5DRWA 1CL7H 5FO8A 2CE6A 1CZ8H 1VPOL 2P5WD 2NUTB 2PO6D 3G5XA 1OQXA 2ARJQ 2XXFA 2XWCA 2OJEB 3A6CH 1BBJB 4BIKA 4BFGA 4UBDC 3KE0A 3FFDB 3PWNA 3R18A 4HBQA 1FV1A 2BDNL 2VDPB 3QS3A 2WLLA 2Y72A 4UB0H 1YYMH 3IF1B 4GEJA 2VW4A 4HHAA 4GIOA 1A5FL 1LE5A 2BZ7A 3ZHDA 3SEPA 3TO4C 3TYGH 1HI6A 2CBPA 4NRZB 4XWOD 4ZSOA 5TPWL 2KYIA 3JV4A 3U4EA 4TQIA 1TTBA 2EO9A 5E23A 4O4YL 5KSBF 2Z7UA 4H8WH 1J9SA 4DVRL 2R4SL 2ZJSH 1M6UA 1MW1A 4JCWA 1SHMA 1JV5A 4YAQB 3STLA 1VEMA 2BWDA 4K15A 4O2CA 4Z0XB 4H2CA 4WI5A 3INUL 4URTB 3OC5A 3GXIA 5DJ8A 3FQNA 4JANB 2DD8H 4QGTA 2EAEA 2Z35B 5FYLH 2FJSA 2WKLA 4LGRB 4AYMC 2P24B 2WVVB 5IHHA 3U6XA 5GS0H 4QOKA 1NGQH 5AZEH 1E2WA 2F9BT 2FYVA 2EEAA 1PLGL 3BCDA 3MC0A 4B9CA 4I13B 2NY2D 1TZIB 3FTVA 1I3RB 3CMGA 2BSSA 5J6HA 1DVFD 1CZ8L 2OMTB 1IAKB 5LBSL 3APCA 5TGBB 4HLZH 4YSDA 5GRYA 3IDIB 2YMOA 3UTOA 4G8EB 3A6CL 1FVEB 5ENWB 5FHAL 3QUMH 3T04D 3BE1L 3TM6A 1OCOB 4LCUB 4BA0A 1XF3B 5D7JB 3O6KL 4LSRH 4N2HA 3UDWA 1QUNA 4GXUN 1YYML 3LIZA 5CS7A 4WI4A 3D4GA 1IJ9A 5JIKA 5KYUA 2AGJH 3PHQA 4WNJA 4LVNB 4P2QD 1R6VA 1LDPL 1BG1A 1UJ3A 1KB3A 5JZ7C 4BXSV 2FX7H 1BDYA 4BFIA 2HLEB 3TEXA 3EBIA 4A38A 3QFJE 5FO2A 1KLGB 3ULVH 1FGNL 1EAPA 4H8WL 4UQAA 5LBGA 1T1ZA 2ZJSL 4U1HA 4HOXA 3L5WB 3VXUA 3WNMA 3RTQD 2VZ1A 4IMLA 2XTJC 4JVPA 1YSOA 2C34A 5F0LB 3O4LD 5I19H 3NCEB 3Q48A 5J0BA 3MJGX 3LRGA 5K59F 3K71B 2BSTA 2DD8L 2D73A 3NCCB 5DMGD 4S1RH 2QQQA 4RFNC 4ZOBA 4HZLA 1TFHA 4O02L 4JZJA 4XP4H 1XCXA 1NGQL 5AZEL 3G5YA 3GXNA 5IQ9B 5FC9A 4U6XB 4HGWB 1IAII 3CFBB 1RKRA 3MR9A 4HJJL 3O3AB 1NIBA 2I07A 1GZPB 1RU9L 1P0SE 2IANE 1U3JA 3FT0A 3QUML 4KVCH 3L2MA 3OSKA 2F74B 4LSPH 1AP2A 1GJWA 2AQTA 4LSRL 1GGCH 4HWBL 5FFOA 1VGKA 3CJJA 3DKHA 2Y9RT 3Q6FA 4YHPB 2WLJA 3PFUA 5GZNA 1KUMA 3L5XH 1XGYH 2WANA 3QUYD 1KIPB 1OSYA 3FZUC 3GKWL 3VD5A 2VZ3A 5GGTH 2EDXA 2AABH 3MOBH 5ICUA 3S4SG 4ORGB 3QJUB 1P6WA 3K2UH 5DD0H 2EADA 1SF5A 3PQYA 1YY8B 2GIMA 3VG9C 3M86A 3E1ZA 1FNHA 1S78C 1P2CA 2IF7A 1FWXA 2ZKYA 3MRJA 4WFFD 3SCMC 1VFBA 2BWIA 1T89C 2KLTA 1KB9K 3JTSB 2YZ1A 3QI9D 1NINA 3P77A 1DDHA 2XV3A 4S1RL 1WFOA 4U6YA 2ATKB 3V4PB 2GUYA 3GWJA 2VLRB 1EGJH 1P9MC 1LEIA 1VZIA 4M8QA 3DMMC 3Q3GA 4YHYC 4UM9D 4OSUL 5AVTB 4WWKA 3I6KA 4PP1D 1AC6A 3OKLB 2PO6C 2ZPKH 1WT5C 1DEEA 3CFCH 2XZZA 3SSGA 2O6EA 4OTXH 4J1UA 4FLHA 1HILB 2ZWNA 3FSWA 4UNTA 2A6JA 4NT6B 4LOUC 4KVCL 1DBJH 5KS9A 1BP3B 4GP4B 4LSPL 1TJIH 4C56B 5J13B 4JFZH 4D0BA 4XE0A 3ZK0A 1NMAH 4JHZA 5F7EL 2CRZA 2L3BA 1GGCL 3K4ZA 3CFMA 3OWRA 4JHBA 3WXWL 3AWFA 4GKZA 3KCPA 2DQEL 2XQBH 3SGDI 4XWOC 2XVKA 1BF5A 5SWZE 4E9WA 3L5XL 2FO1A 1XGYL 2YGOA 3AT8A 3G5VB 3HBPA 3IRZA 3NPSB 3NN8A 2R2BB 4Z0BH 5EO1A 5IB3B 2AABL 1VDGA 3AMKA 3MJ9H 2VRQA 3N85H 1VA9A 5FUOH 2X7LB 4WI8A 2MJWA 3KVDD 1LP9B 3L3JA 4LIQH 2Z9TA 4MJ5A 4OF8A 1H3GA 3KMDA 4K3JH 2ENSA 4ZQKB 5E03A 1DBBH 3FT2B 2M8XA 4MBRA 4IBUA 2E9BA 4IDJH 4PJ6A 4N2BA 3FSVA 1BHGA 3DGCR 4JPIB 2Q7YA 4ZSOE 5JQHC 2ENJA 4O2EA 5F2FA 3I9IA 2HX7A 2R2EA 2MNWA 2XBTA 2OMYB 3DUSA 2NY2C 4UT6H 3SQBB 1UQSB 5E7FA 1CWVA 2OS7A 4JO3H 1DVFC 1RPQA 4H0LC 3BKMH 5EBGA 2Y7LA 4AEIL 2A2QT 1AZRA 2ZPKL 2ADGA 3DJZA 1UWXH 1BFTA 4IOSD 2GC4C 3CFCL 2C4XA 3CHSA 3WIFB 5I1CH 4OTXL 5B39B 2ZSVA 5H35A 4JLRA 3RFRA 1DBJL 2VXVL 4WTZA 4H26B 4JFZL 1UEMA 1BF2A 5D7JD 2O6CA 5BVPL 4MNQE 4QOKE 1KBBA 4J12A 2XQBL 2ZUTA 5C0GA 1U8OB 3TBVA 2DEYX 3W0WB 5T33H 1KXQA 3MJ9L 3N85L 3NABH 5IQLA 5FUOL 3FU7B 2IH9A 1TUPA 5BZDB 2O61A 1XT5A 1KB5A 4Z9KB 1AJ7H 2NR6A 4K3JL 4V2BA 1IGTA 1DBBL 1H3PH 4LF3A 3EOBA 3SODB 5JW5A 4IDJL 3VJ6B 5DMGC 1ICTA 4E41D 3IDMA 2G60H 5TH2B 4M6OL 2WCGA 4QRTA 2VLJD 1UCBH 1G7QA 1KPVB 4IRJB 4DK6A 5DHVB 3KXFB 3L4ZA 1MG2C 3MVSA 1B6DA 4TL4A 4UT6L 4FFYL 1EJOH 3RWFB 1OSZA 2PMZA 1OW0C 1X4ZA 1KFGA 2A7BA 3AS2A 3C09B 1T0NB 2EIZB 4JO3L 4I1PA 1K4DB 1MXDA 2PPEA 2O1AA 3VXUE 4IIQA 2APFA 1S5HB 2UXTA 4POZD 1B4JH 5GGRY 3HNVL 4X4KA 3QCUH 4FL4C 4U1IB 3TBSA 4G7RB 1OTSD 4ZTEA 3K2IA 4FI6A 1L3NA 3VU2A 1DUZB 4X5WB 1T89A 2FE0A 4PWJA 3WLWD 5I1JH 3LS5H 1AGCB 1J5HA 4YE4L 1JI2A 4BQ6A 3S8WA 2VQTA 4JK0D 4TLSA 5FECA 3WN6A 1DFXA 4R7NA 4HKXA 2IDQA 4IOFD 4WHYH 3T3PE 4GKNB 3L3HA 3MA9H 3MNMA 5F1NA 5T33L 2I60H 3LOWA 1FORH 3RUGA 4RMQA 3QJFB 1CFSA 1PEWA 1WT5A 1UA3A 4IJ3C 3ZGHA 3ZZSA 3G04A 2J43A 4UTCA 3DETD 5FYLD 4N24A 1H3PL 3CC5A 4FG2A 4YGAB 1OCZB 3ARRA 4JGUA 4M56A 4J3BA 4HVBA 4YXHH 5GS0D 3QI9C 1WZLA 2GUOA 3HE7D 4R0LC 5GZOA 5JPNA 2Y5TA 1UCBL 4QTFA 3VTAA 5EIVA 1A4KA 1X9LA 2Z0BA 3P4OB 3QARA 2P46B 2CBTA 2XN9A 3RAJH 1UENA 35C8H 5FOBB 4PP1C 2FATL 3WJLA 4EDXB 2OM5A 1TQCC 4TV3A 5JYLA 1R47A 4EZJA 4KGJA 5B7EA 4X5QA 1TCMA 1TZAA 3O41A 4Q97A 3BUYB 3FU9A 2I27N 3A6BL 2X4PB 4Z3FA 2X28A 4FFZH 3H7LA 3O4OC 4C56D 3LS5L 2B2XH 4L5FE 2BS8A 4XCFH 3U9PH 3T3MF 4I3GA 1TSHA 4JY4B 4TSAH 4PGBB 5DUML 2EEFA 3IK2A 3ULVD 2D2OA 4OGQC 2WKOF 3FU8A 5DVOA 4LPWA 1LM8V 1DQDH 3U48A 4ALAH 4ZXBB 2DWEA 2B20A 1SGKA 5KS9E 5IJBC 2COQA 4JKKA 4LPYA 3BSGA 2YD5A 2X89D 2WXKA 4DO6A 2XG4A 4YXHL 1J5CA 3DV4A 3QHFH 4D9RD 4A2MA 5C0JB 3O3EB 1KIUB 4Q4IA 4LBAA 3T1FA 3WUWA 1R3JB 3HI6H 5E8OB 1MLCB 1FH2A 1TMQA 4WI3A 4XMPL 3MV01 1ACXA 1MVYA 35C8L 3BLBA 1U93B 3JTBA 2YD7A 5ISZB 2BJML 4ZPVA 2DLFH 4ZTPH 3TCLB 5F96L 1ZY9A 5GS1A 3CFTA 1Z3GH 4FEMA 3R0MA 5CAYB 2F2HA 4GMSH 2WTPA 3JV5A 3QVAA 3QULB 3S34L 2FWOA 1AO7B 3ARDB 3O3UN 5HHQA 3SYQA 1QQDA 5GPRA 4QLWA 5D7JC 1CMOA 3FSOA 2BZDA 2X3CA 1JZEA 4NWUL 4CADA 3U9PL 1IV8A 4Z77A 5IUCA 4LMQI 4TSAL 3ZL4L 3O45B 4HH8A 3T8XB 4M48H 5AAWC 2GEEA 2KPWA 4XZUB 1OW0A 4HS3A 2WZAA 2GI0A 2O5XH 4O58H 3VW3L 2OSYA 4L3AA 4P2RD 4TVPH 2X87A 2W94A 1DQDL 4DP1X 4Z7UE 2XTJE 3E38A 1M6OA 2F1BA 5B7FA 3KH3A 3LKOB 5K1VA 4RMTA 1QG3A 3MRKA 3WHXA 3CPLB 3HG1D 1JV2A 3Q2WA 2UVEA 4X0KB 4FC3E 1L9OA 5DZNA 1NMCB 4H8UA 3KJ6H 3TWCH 3CC1A 4F8LA 4J4PA 5KBLA 5GGUB 3SD2A 1GPOH 2Z4QB 1RHHA 1JGVH 4ODWA 3L9RA 4X42A 1FL5B 3FRUA 5IT2H 3KXFD 3CHXA 3H85A 1GC1L 2OYKA 2AEQH 4LLVA 4KNTA 2VN6A 3WIAA 2FAUA 1XDTT 2DLFL 3OXRB 5DSCA 4C4KT 4XMXA 5IMMB 1M1XA 1Z3GL 1V27A 3N55A 4Q74A 1S9VB 4MAYB 4MMYB 4FN0A 3SIKA 3WLWC 1NPJA 3VD9A 3CZFB 3AT0A 3T4AC 4FHKA 3RG1C 4IRZH 4PJEA 4YEFA 3HA0A 4AZ8A 4PIRF 3PU7A 2XVLA 3KPLB 5HXMA 2AJSH 1FBIH 2ARJB 4OJCA 2JCCB 1AI1H 4M48L 1ETZB 2VLKB 3DIDA 3QNZA 4H8WC 4IOFC 1W0WA 1J8KA 1YQVH 4LZKA 3EOAA 1BWWA 4O58L 1RK1B 4AQEB 3PXLA 3WTUA 1SZNA 3BPNB 4LSDA 4TVPL 4F7EB 1JSYA 3PV6B 1M56B 4X6DE 3V8OA 4KZEH 1TEGA 2YUXA 1WDAA 4NKMB 4YVNA 5EBMB 4PPTA 1BBJA 1EJ6A 5GS0C 5T5FH 2C3XA 2CA4A 4GXVL 1P7BA 3T8VA 2GY5A 1AD0B 4XMKH 5PAZA 4AL8H 4X83A 4CN6A 5IUSA 1MNNA 4U6TA 3NTCH 5CGMA 4FHBD 3KJ6L 5GS2H 1YN6B 1XB6A 2F68X 3N6YA 3FAXA 3GBDA 4AGMA 1GPOL 4A2FA 1JGVL 4XPTL 4LSQL 4NRZA 3KYKL 4XNAA 5ETUB 2P5WE 4PJHE 4YWGH 3RUGE 1OCRB 4P5RA 1ND0B 4FQ1L 1XF4B 2HFFB 4MB4A 3GM8A 2FLMA 4I77L 5AYQA 3T4YB 2F53D 4YAQA 2XN0A 4YQXH 4BINA 4PG9B 4Z0XA 4HETA 3RY6C 1EVTC 4JANA 4M4PA 2E4TA 3WV0A 2Z35A 5F7YC 3S36H 1F02I 1FBIL 3A47A 4N2CA 4JKWA 1LWJA 1M2VB 3ULVC 2KLRA 4LP5A 4CMHB 2XN9E 2APWA 3U9UB 1YQVL 4BUQA 3OZ9L 3B5TA 3NPSC 1TZIA 1WO2A 1XSIA 1I3RA 3OKDA 3Q8CA 4X5PA 5CLTA 4F57H 4NAQA 1KGUA 2OMTA 2Q3ZA 1IAKA 3K1DA 4JPWH 3P3TA 5TGBA 4JFTA 2IV8A 4QCIB 5ECGA 3IDIA 4G8EA 2XKUA 1FVEA 1N18A 1NCIA 2BNQB 3LAFA 3MLZH 4HKBB 1NCTA 4LCUA 4WFHE 1XF3A 4PCKA 1EUUA 4XMKL 3SKNB 1ZPUA 4JJ5B 1NFIB 1EHNA 4OZGE 2D0GA 3S3SA 3ARVA 2EIJB 4A04A 1JMZA 1TZOA 3C5JA 1E5UI 5T1LB 1V7MH 2JIXB 2OMVB 5DJ6B 3DUHA 2ITCA 2VXQL 2OMBA 4WO0A 3DVGB 4QPEA 5IJVB 5ISZD 2X2HA 3H0TA 4XTRD 3CDGB 3VQMA 5H37G 3TJEH 4YQXL 4YXLH 3JTTA 4HUKB 3ARDD 1TZGH 4YHOL 5AB2A 2IADB 4BHUI 2DL9A 3A4EA 3K71A 4N0FB 2XA8H 4L8DA 4B0MB 3E3QC 5E4EB 1ACYL 3G6DL 5CU9A 5JQIB 2IAMD 3HC2A 3UBGA 4YIQA 3MOQA 4DEWA 1KCSH 2VAAB 4A7UA 4YSTA 3FO9B 5GIRB 5IQ9A 5KJRH 1QR1B 1C7TA 4BV1A 4HGWA 1BJMA 2BC4A 4ATWA 3MTXA 3Q8EA 3UTTA 4AG4H 3CFBA 4ACPA 5DYFA 2Y1ZA 5C86A 1CTNA 5KVEH 1YUKB 3QXDB 4Z8FH 3LKRB 1GZPA 4OGYH 2WIMA 3MLZL 5HDWA 3UX9B 2HVBA 2F74A 2NY6D 1AE6H 1NKRA 3UGEA 4YSOA 2QPFA 1WUZA 2FBRA 2JKSA 1RZ8B 4YHPA 3QYNA 3KLLA 1C5DB 4PGCB 1Q94A 1KIPA 3V10A 3VFRB 1A6WL 4IU2B 3B37A 4ZT1A 2ORBL 2XRAH 4ORGA 3C09C 5KYNA 4IQHA 3AB0B 2HFEB 1ECZA 1YY8A 3TH3T 3LXBA 3TJEL 1AOZA 4YXKH 4X7CC 4YXLL 1IMHC 2IOIA 2R0LH 3JTSA 5C0AD 5KZCD 3WFCL 2NSMA 2FCBA 4ONOA 1CYGA 2EIKB 3KL0A 2GJ6D 1R3IH 2VLRA 2Z7ZA 4PMFA 4R7XA 4YSPA 5EOCH 5I30H 2J8HA 2VLKD 2W9EL 5KJRL 2ZKMX 4NBYB 1SJMA 4HJGB 5EULV 3TC9A 2DMBA 3OKLA 4DIXA 3D3VA 4AOFA 1JVLA 4KRPD 5BXFB 5KVEL 2BNUB 1MRDL 4G80A 3ETTA 4Z8FL 4URKA 2ZXWB 1ZVSA 1DSWA 4NT6A 2OL3B 5D1ZI 3PHSA 1HHKA 1GYVA 2RQ8A 1HDMB 1ZVHA 2VDQL 5MI0C 1JZ3A 3KCWA 2R1XB 5F3BB 1DZ0A 4PR5A 3G5VA 4AVIA 2XRAL 3KPSA 2BXYA 2FBJH 2X7LA 2VM9A 1B0GB 3T09A 3WEXA 5H94B 1MUJA 4JFYB 1DCEA 4ANUA 4I0KA 1B2YA 1KXVA 1LP9A 4KNQA 4WHCA 3Q2CA 1NC2D 2YQ3A 4YXKL 3IE9A 4ZQKA 4RESB 5AVYB 2F61A 4OLWH 3FT2A 1FFPA 1WZ1H 2PTTA 1ZA6B 3CIAA 4WGVB 4I0PB 4AIEA 1QSEA 3HRZA 2XWEA 4PEEA 2FD6H 4PTUB 3O11B 3NIGF 3OMIB 3MRRB 4JPIA 4TVPD 4GQ9H 5I30L 5EOCL 1JNHB 3S36X 3PP3H 4ZZFA 3II1A 3WMSA 2OMYA 5BVJB 4H0HB 4MD0A 2FX8L 4OGAD 1UQSA 3EDFA 4NOFA 3HW7A 5EZOH 4HFUH 2CWRA 5I1DA 1XSKA 2VXUL 5T1KB 3RVUC 3WIFA 1AY1H 1S3KH 5B39A 3CFNA 4NQDA 4NO2B 5D4HA 2APTA 3TV3L 4NZRL 4H26A 3NFNA 3D30A 1KIRB 4JQVA 4U3HA 2MKLC 3I6LD 4N1EA 2EDMA 1MCPL 5I75C 1TENA 2VR9A 1XR9B 4OD1H 2X1XR 4N87A 3MRFA 5T1LD 4ZMYA 3W0WA 5A1AA 3Q5TA 2J1ZA 3NCJL 2FBJL 4AEHH 3FU7A 1JK8B 3ZHFA 5BZDA 4A67A 4PJDF 1N59B 1M71B 4XTRC 1JWSB 4CILA 4UI2A 4GYBA 4N0UB 4W1TA 1I9IH 4NSKB 2PXYB 4OLWL 5DRNB 1NZRA 2BIIA 3ARDC 4IKLA 3BLKA 5T3XL 3VJ6A 1VFMA 5ESVB 3VXSB 3QNXB 1XFPA 2DW5A 3O8XD 5AW3B 3ZT5A 5TH2A 1CXIA 3SYPA 4CSPA 4GQ9L 4IRJA 3L7EB 5DHVA 4HWZB 2Z3FA 3KHOA 4DTGL 3RWFA 2DMHA 5EZOL 3U0PB 1F6FB 2NY1B 3PPSA 4PLJD 1E9PA 3VFMB 3LH2L 1S5HA 4ANKA 2EEDA 2X9YA 2XQYK 4GJTB 4XPAL 4FAAB 1AY1L 5A3IC 1SHWA 4A7GA 1LE9A 4U1IA 1SYSA 1X9QA 5GS2D 2B59A 3QYMA 5MEPB 1DUZA 3HBZA 3NQIA 4X5WA 2NNXA 2APSA 3C8KB 5IHZA 4EN3D 1AGCA 2E7BA 3BKCL 4WFGD 4FA6A 1NMCC 1NM9A 3D12B 4M43H 2F5BH 3CZSA 4Z3IA 3FN3A 2MOGA 2H3NA 3VNZA 4OCWL 1IC4H 3WY2A 4YSUA 3ZKSD 5FXCH 4ODXA 4OD1L 1FO0B 1UTDA 1XGZA 4GKNA 4GXFA 4JFDB 3FT4A 1GMIA 2VDLB 4AEHL 2ZUYA 2VZSA 2LGNA 3E8VA 3HNTH 3Q2NA 4OJFH 3HUJB 2DQIH 3CHQA 1A8ZA 1BVLA 1I9IL 2Q5BA 1X5YA 3B7TA 2QSCH 1V7NH 4DQAA 3MOAL 4KRLB 4O5LL 4OUUB 1MFVA 1NCDH 2F8XC 3OD3A 5GSVA 4RWYL 5E2WH 4A7VA 2XNAB 1ACZA 3QAZB 4ALAC 4BKLB 1H3TA 3ZE2F 1RIHH 2J8OA 4JJOA 4LGPB 4UQEA 2WZPA 5C3IA 2E76C 5FOBA 3PWUB 5ITFB 3D69B 3K80A 5C07A 1G1YA 5KVDE 1NGYB 1MVUA 3MRCA 3FU6A 5EH1A 3BPNC 3KJ4B 12E8H 4KRPC 4P3CH 4IYKA 5FYLE 2DLTA 2CDEB 3Q5OA 3EGSB 2J88L 2YEQA 4AIZB 1EXHA 1UD8A 3BUYA 2PNDA 1C8PA 1OSEA 2NUPB 5FB8B 2WYZA 3U1PA 3GJEA 3QJHB 5I71B 5E8PB 3SGKC 2VLRE 5AW9B 2F5BL 4KU1A 5SV4A 4BM7A 3TTYA 1JJUA 1R75A 3MFFB 1OCCB 1KJ3L 1ZXKA 2CO4A 5KBKA 3NG5A 1IFRA 4FNUA 4Z76A 4BK5A 4JHUA 4WK4B 1L9RA 1BZOA 1X5IA 1KLUA 4KKPA 4MBOA 2VE6B 2YGQA 4PGEB 2IOMA 3BXNB 4OJFL 4ZXBA 4GP8B 1UD2A 2E46A 2Z31B 3UP6A 4C56E 4HZ1A 2O26U 3VAEA 3GJFB 3TH2T 4BZ2A 2FO8A 1ZA3B 4ELDA 1AQMA 4DEPB 1IIIA 2Z6FA 3FK3A 1NIEA 3QIBD 5C0JA 3O3EA 1KIUA 4I0PD 2DIJA 5E2WL 3UMNA 1EX0A 2EXTA 1R3JA 1AIFB 1MLCA 2DICA 2YO3A 1FP5A 3LZQA 2WO4A 3PWJB 2YD9A 4RMRA 3WFDH 4OGAC 3ZMRA 1RIHL 3TF4A 1NBYA 1U93A 5TTRA 4DFIA 4UYQA 4F33A 1LP9E 1UH4A 3TCLA 2KZBA 5DWUH 1E27A 1OB1A 4NM8H 4U1MB 5T1KD 2X4NB 2R15A 1MEXL 3QULA 1AO7A 4LSTH 1VFAA 5CBEB 3RFZB 2AVFA 3NFSH 4K55A 3VB9A 2WIIA 1AZBA 4HH9B 4MDIA 1D3CA 5E8EB 1IKOP 5D1QA 5F88A 3O45A 1E4HA 3T8XA 2XPZA 2KDGA 2RD0A 1OF0A 4R7DB 4YDLC 3EO9L 1W9XA 1Z9OA 4Y1AB 4UIMA 2Y6SD 4YPGB 1X7TA 2A9CA 5BO1H 4YMPA 1YNKH 2WBJB 4RX4D 1CE1L 4YSRA 2CJ3A 3ILQD 1ZHNB 2WP3O 3ARGA 1ED3A 1PZ5B 2OR7A 3CPLA 2PXYD 3E3QE 5AAPA 4X0KA 3UBHA 1I8UA 4GOSA 3O8XC 4H1LG 1CLOH 5B38G 4JO5A 3VXSD 2F19H 3T0ED 2Z4QA 3WXVH 3QNYB 1QBLH 4JDZB 3W0WE 3FW6A 3C6LB 4PBVC 3BKJH 3ZO0A 4Y4KB 1FL5A 4XBPB 2ICWB 2EXWD 4KQ4H 4F3FB 4O2FB 2UWEB 2NY1D 2XUWA 4AL8C 4OLUL 5L2KA 1GZHA 5IMMA 1BXVA 4NM8L 3SKJH 1S9VA 4LSTL 4MAYA 2B5IB 4MMYA 4JR9L 2NYYD 1K8IB 1SRDA 4PUBH 1Q1JH 2XOTA 3NFSL 3CZFA 2DPKA 4XN4A 4EN3C 1JZFA 1FIGH 3CWGA 4MMXB 5FYKU 5TDNB 3S3DB 4DGVH 2PKDA 1EO8H 4ZMNA 2P8PB 3KXFE 2JCCA 2NSXA 4AQZA 1E5CA 2GK2A 4Y9FA 5D2NB 2B39A 3CBJB 3ALWA 1RK1A 4K7PH 4AQEA 3D50A 2IPKA 4E9RA 3V0EA 4JFDD 5BO1L 4F7EA 4F2MA 1YNKL 1U91B 3AB0C 3VYNA 5J12B 2BNRB 4NKMA 3VM5A 3MJ7B 5EBMA 2MHAB 2GJRA 3QAQA 1JVOA 4NNXB 1A1MA 1LYQA 4ATTA 1U92B 2HA1A 4RMSA 4UINH 4O9HH 3BDYH 4V11A 1AXTH 2IH3B 3P9WB 4HUMB 2VDNB 1Z9SB 4AQOA 3GBNL 3WXVL 1QBLL 3A5VA 2BIOA 1RMFH 1LD9B 2XWTB 3BKJL 4X4YB 4ZO9A 2RH0A 1HC1A 3N42F 3C2AH 4HBCL 1XF4A 5DEGB 2HFFA 1NGZA 3II2A 5GSRA 1NCBH 3FU0A 4UZUA 1CGSL 4DKDC 3HOGA 3T4YA 1PQZB 1IL1B 1JZJA 1S9XA 1DN0B 1EZVY 2HRLA 4G8IB 4PUBL 3SKJL 4C4UA 1KWKA 5IVNA 1Q1JL 4BGDA 1U58B 4TSBH 3WDHA 1CGXA 4DGVL 4XHJD 1OP9A 3MRHA 3NDYE 1G0XA 1M2VA 4WI9A 2R1YB 1CLYL 4WWOA 3U9UA 3JWOC 4JW3A 1ORQB 4I87A 4P57A 4K7PL 5EUKA 2FLRT 4KRMB 1HJCA 4PJIF 2WXNA 1VKXB 4V33A 3C5ZB 1HQRB 4PB9L 5JXEC 2AEPL 5FYKL 5EZIL 5DT1L 2Z31D 2BNQA 2N1TE 4HKBA 4NJAH 4MAZA 2ICES 1TG8A 3CNKA 1A47A 3DX7B 3IJ8A 5CJXC 3OJDB 1X5HA 3SKNA 4UINL 1ILSA 1LHZA 4I0PC 4JJ5A 1DJGA 4LEEA 1NFIA 3BDYL 1Y07A 3QC6X 1GSKA 3BESR 4CVUA 2JIXA 2L8AA 2OMVA 2UXGA 1IKNA 3B83A 5DJ6A 2PABA 1D9KD 1MCIA 4K3EH 1EZUA 2O5YH 2WQVA 3L4CA 1R3HB 4UILH 2XI9A 4PJXF 3O3BB 1IAIH 4BZ1L 5DJ2B 1MLBB 5IQNA 5EIQA 1LEKA 5EN2A 2F54D 4U33A 5DFWH 3K8LA 5IB1A 3QWOB 4TSBL 1FVDA 4R90H 1JS4A 1F1DA 1FZMB 3DNKA 1FYTD 3DURB 4N0FA 1JZ4A 4XAKD 5ALCH 4PWGA 4LSUH 4FTVA 5DJ0B 5GIRA 4N68A 5ISZE 1QR1A 1HWGB 3ZTJH 4X9IA 3VD7A 4OFPA 4Y1TA 4HOMA 1YAIA 5IJKA 3ILQC 3QXDA 3VGDA 3LKRA 3EYUL 2WTRB 1AO7E 1YRKA 4MQ7B 1BIIA 3PWPD 2WBWB 2PXYC 1F4WL 1DO6A 3H3PH 3ASWA 3FJTA 4X6EB 1L7TH 1O9VA 3CFKA 2QT6A 3T0EC 2WKGA 4N8VB 1D5BB 1RZ8A 2AEOA 5IGXH 1C5DA 2YXWA 2NY7H 2C9VA 5LLIC 3GM0A 3UJJH 3VFRA 4K3EL 2O5YL 1OAUH 1KG0B 1BFOB 3C6LD 3QHZH 3CIQA 1W8OA 4QRPA 4UILL 4DP8X 2NY1C 2HFEA 3UABA 5ANMB 4X0NA 2X40A 2C1PA 4Y2DB 2AQ2A 4KX7A 2XZQH 4GFTB 5F8QC 3AFLA 4PRDB 4QWWD 1T3FB 1T6VN 4R90L 3OKKB 4OZIF 3N06B 4NX0A 1A3QA 2F58H 3B9KA 4NZ8A 1RJCA 2LV4A 4OQ1A 1FC1A 2WD0A 1AS8A 4PREB 1HZLA 3OMZA 2O6DA 4OI9A 2AJYH 2IH1B 3GLAA 2WXGA 4C59B 1QI5A 3LKQA 3QQNA 1VADA 5BXFA 4TSCH 3FPYA 2BNUA 1X7SA 3X3FL 4R9HA 3GS7A 5K9QG 4JFXB 5AOMA 2OL3A 5C0EA 3TA4D 2AMGA 3V7AE 4AH2A 1E5ZA 4KHTH 3K2MC 2I9LB 5DDHB 3V6OC 1HDMA 1SMDA 2GEQA 4HUCA 2JCCE 4DERA 2ZWSA 2VLKE 3PJNA 5F3BA 4FFWD 4XX5A 5IGXL 1P6AB 2V2WB 3OAYH 2NY7L 4HIQA 3QAZC 2BHUA 1IQDB 5I17A 2F8VA 1OO2A 1KGIA 1OAUL 1V54B 4PBDA 4GLRH 1B0GA 1CLCA 3VDBA 3UEZA 2ESVA 1J1XH 5JXEA 3KJ4C 1UFGA 4P5TA 3LY6A 1NQBA 4UQIM 3CHPA 2XZQL 5CJXA 3IMVA 1ILUA 2NZ9D 4AGNA 2JJTC 1EJFA 1TPXC 4XHJC 4F9LC 1T04A 2HJFB 3F5WB 2ZCKL 1OGSA 4OB5H 5IB2A 1WA1X 1JNHA 2FJUB 1OM3L 2AJYL 4I18C 5AAMC 3WIIH 2VN4A 1M42A 1ZIBA 3ARWA 4LHUG 4XX1G 5D5MF 1HIMH 2BXZA 4TSCL 5EIIA 3Q13A 1DQVA 4PTTA 5K39B 2Z31C 3QE5A 4LEOB 3P69A 3D05A 3D0VB 4NO2A 3C60D 1HAWA 3NJHA 2HLAB 3TONA 5D7KD 1KIRA 4YGVB 2LFEA 2F7PA 1ZVYA 1U8CB 3BCFA 5F1IB 3E6FB 3FTXA 1MCHA 1RD6A 4AVHA 1X5XA 4FZ8L 4OJDH 1D9KC 7FABH 1K8DB 5HVHC 1XR9A 3B2DC 1OP5H 1A9EB 2XV2A 3EH3B 3I50H 2P43B 4MWFB 5EZJB 2A6KA 5CEZL 1JK8A 2OMUB 4HW6A 3KPMB 1N59A 1M71A 1EBPA 3H2WA 3PY9A 2EICA 2BNQE 4UNUA 1ML0A 2UV3A 4TUJA 2I32A 4N0UA 3I6LE 3SPVB 4Z7WA 5KWYC 1GCYA 1PG7X 4Y2OA 1MCRA 5ESVA 3DV6B 5DRXB 3QNXA 3WN5A 2H0FA 3D4YA 3AXHA 1FRGL 2EDWA 3LHPH 2B4CC 4G1MB 3GIVB 4OB5L 4ADGA 3V95A 4KKQA 3L7EA 2QQNH 3QGVA 4TQ8A 3BRDA 3BUTA 3I02B 1USZA 3U0PA 4ADJA 2VLLB 1GW6A 3VI4F 3VFMA 1HIML 4AC2A 4HMDA 2R0ZL 3KGRA 3US1A 3EXJA 3C8KA 1UXLA 1MHPH 1M3IA 5D1XD 3IGLA 3T0AA 1MQKH 4BKSC 1DZBA 5K5YA 3WNIA 4G8GB 4KROB 2EDOA 3NSYA 1P4BL 1YY9D 3KPRD 3BZ4A 2OZ4A 1FO0A 3D4ZA 3SKUD 4P46D 3SDXA 5I1IH 3C6LC 1N0LB 2ZWZA 2IFFH 1A7PH 2XV0A 1A66A 3AS0A 3BP5B 3L3GB 3HUJA 5E6YA 1SNRA 4ZJ9A 3BD5A 3TV8A 1LNUA 1QASA 2B5IC 3ME0B 4NKQB 2EDEA 4GUPB 2FX9H 3KVQA 4MMXC 2I5YH 4OUUA 1BQHB 2VQ4A 2XNAA 3LHPL 3ZGIA 3QA3B 5EU5B 2XTLA 2HKHL 2I69A 3BHBB 1DQQB 5CINL 1KBGL 2QQNL 4NUPA 5D2NC 5MEQB 1MF2H 3L9EA 4WHDA 3D69A 2M26A 1VERA 4FF9A 1IBHA 2PP9A 1SHXA 3FTYA 4AK2A 4GT7A 4A2GA 4R96B 1KC5L 5BRQA 5J12C 1QVOB 1UATA 2Y23A 2NUPA 3QH3A 4KZDL 1MHPL 5IROD 3QJHA 3CFDA 5E8PA 3QR2A 3GEWB 4FFWC 5D7SH 5FWQA 3ORJA 4JO1L 3UYRH 3IDXH 5TK4A 1G6RH 3WJMB 4ODBD 1HU8A 3KD4A 2IFFL 4ODTL 1A7PL 2YR3A 4GW5B 1MCWW 4JFWA 4JVWA 1BLIA 5DGQA 2A77H 1S2EA 4RGMC 4RRPA 1OGAB 5HP5A 3GPSA 3PJSA 1J10A 1KZYA 3GJFA 2NZ9C 3IGFA 2KZKA 5ANHA 2CRYA 1ZA3A 4JRWA 4O02B 5I0WA 5KSBA 2I5YL 1F56A 3ZKND 3NYKA 1F4XL 4JRYA 3U46B 1AIFA 3PWJA 3LNEA 3GTVA 3ROLB 2RB8A 4XWGH 1Q9OB 4KVNL 5CZRA 5ECJE 1DQTA 5MEND 3TYFA 5L8LB 1JXDA 3C5ZC 4D9LH 1IJNA 3CLWA 5KVGL 1UB5B 1ZCRA 2B1AH 2W07B 3C60C 3OF6D 2X4NA 4U1MA 5CLWA 3RFZA 4D3CL 2AQPA 3STZA 4HH9A 5E8EA 3ZT6A 5D7SL