3K6IA

Crystal structure of chicken t-cadherin ec1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
SILATPILIPENQRPPFPRSVGKVIRSEGTEGAKFRLSGKGVDQDPKGIFRINEISGDVSVTRPLDREAIANYELEVEVTDLSGKIIDGPVRLDISVID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cadherin structures reveal a novel adhesive binding mechanism
pubmed doi rcsb
source organism Gallus gallus
molecule tags Cell adhesion
molecule keywords T-cadherin
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2009-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3k6iA00
4AQ8C 5JYMA 1OP4A 3LNIA 4ZMLA 4OY9A 2O72A 2A4CA 2YSTA 4AQEA 2OMZB 1ZVNA 4AXWA 4APXA 4ZT1A 1SUHA 4ZMQA 1WUZA 4ZMXA 1ZXKA 2OMVB 4ZMTA 1NCGA 5JYLA 1NCJA 5DZVA 1NCIA 4ZI8A 4XXWA 2WD0A 4XXWC 2A4EA 2OMYB 3K6DA 4APXB 4NQQA 3K6FA 4AQAA 3K6IA 4QD2E 4NUMA 3LNDA 2V37A 1NCHA 1Q1PA 5KJ4A 4ZMVA 4ZMOA 4ZMWA 2WHVA 5CZRA 3Q2NA 3LNGA 4NUQA 3FF7A 1FF5A 4AQEB 3MVSA 4AQAB 3Q2VA 4AXWB 3K5RA 2QVIA 3K5SA 4ZMYA 2WCPA 1O6SB 3QRBA 5CO1A 1EDHA 3UBFA 3Q2WA 2OMTB 2WBXA 3LNHA 4NUPA 3FF8A 2OMXB 2X2UA 4ZMNA 4AQ8A 4ZMPA 3Q2LA 4AK1A 3LNFA 3PPEA 2YQGA 2OMUB 3UBHA 2EE0A 1WYJA 4ZTEA 2OMWB 1L3WA 4ZMZA 2QVFB 3LNEA 3UBGA
chains in the Genus database with same CATH superfamily
3U30C 4HPHA 1G6RL 1KCBA 1TITA 2XWTB 3A6BL 3FHAA 1G6VK 1S8DB 2DMHA 4D8PB 3PJSB 3BKJL 5CIPH 5C0GA 2WVVB 3DX9A 2XWEA 3OQ3B 3RI5K 5KSAA 4AEHL 5MP6H 5EV7A 5H94A 3ZBMA 1TCRB 4YQXL 2JV6A 4LLVA 4DEPB 3N85H 3L45A 1YYML 3KR3L 4F7KA 2IMNA 3FTSA 3I6GA 1G6RH 5A6MA 2IBZX 4CKQA 4L05A 4ZO9A 3QFJB 1MY5A 3T2OA 4M1GH 5DFVD 1EAJA 4JY4B 3SDDD 2FGWH 3CFBA 4F7EA 4XRCB 2UVEA 1TU2A 3RB7A 5JYLA 5EEZA 1EHNA 1RD6A 5JW4M 1Q0XL 3LS5H 1Y6MR 4NHCL 5I1JH 5JUEL 4NCC1 2HT4D 4YDKH 3G04A 4QY8B 1N5AB 4O5LH 5JW5A 4HLEA 5E0QA 4Y9GA 1ETZB 1JVLA 5D6DC 4FNUA 5L2JA 3OWEA 1BQUA 1GW6A 3ZX1A 4ZMVA 4HUXA 3VI4A 2GVYA 2YSSA 3ABZA 4RBPK 4ZUWB 5C3LD 2DAVA 2KQMA 4M62H 2BVOA 2K70A 5IEKB 1CF1A 3KEHA 4B6ZA 3FB8B 2X4PB 3L2LA 4W93A 4NYLA 3C6LA 4PSPA 1AIFB 4BCXA 4DUVA 4F20A 1BJMA 1S5IH 4F8TA 2BXYA 4R26L 5FKAA 1CFMA 5TPWH 3DVNB 4JVWA 3LZRA 4N25A 5KVFH 2PPCA 3CK0H 4YSAA 1INQA 3GIZL 2QQNH 2R4SL 1DLFL 3QDGB 4NFCA 4NQVA 4MXVF 5GIRB 2OTWA 5TTRA 2ZQKA 2GT9A 1B0IA 3G9VA 4QRPB 1FYTB 3QORB 3E3QC 4L29A 5IF0B 3P69A 5BZDB 1KIPA 3MRRA 2X28A 2FEDD 1AC0A 1LWRA 3KCWA 3ZHKA 2VM4A 1QTPA 1T6WA 4XH2A 5B3JF 4POUB 2DWYA 3W11C 4EIZC 2NY6D 3UG3A 4OF6A 4P2QE 2XG5A 2WMPB 4XCEA 5FR3A 1FGNL 1Z3GH 3WYRA 3DJRA 4EZMA 3U4AA 3Q01A 2YPVL 3NVQA 4X6DE 2Y06H 1ZOXA 1OTSC 2PW1A 2C1OA 1QWHA 4FKEA 1SHSA 4RNRA 5JPNA 2CDFA 2Z4TA 3QQNA 4WWKC 5DVLA 5ENWA 5LB1A 1A7NH 1FRGL 4GI6A 4NSKA 4B0MM 1RXLA 4L5FL 5FX3A 1XR8B 4PJAF 3FQTA 4H25B 4GB9A 1I1FA 3B3BA 1LE5A 3MNMA 2QL1A 2PCFB 1NGQH 3SE4A 2KZ1B 3UCRA 5JIDA 6PAZA 4ZK8A 3OAUL 4FXGA 3KZ8A 1JI2A 5GS2H 1Z0NA 4OIBA 2BZCA 3QO1A 4K94L 3VX1A 3TPKA 2NCMA 5HGBA 2QJDA 4R5XA 1I3UA 4PRAA 4AEIH 3QHTC 3CSTA 3DKHA 4MFHA 4FQ2L 5I1CL 5LDSA 1XD1A 4MA7H 3BH9B 4IS6B 5HHVL 3QAZB 3UERA 2XSKA 3TO4D 2JB5H 3BKYL 2OKMA 1DQDL 2ZXGA 5T1DH 4R7NA 4POYA 1HCVA 4ZJ9A 5SX4I 4N0RA 4JPWH 1ZLWK 3OXRB 5H37H 2X4TA 4WHTB 4NZTL 3U9PH 4G1MB 3JZ7A 2WTRB 3IE9A 1FVDB 1DEEB 5DA4A 3CSYA 2DQCH 4OIIL 4WTWA 2KZBA 2WLIB 3B6SA 4ELKA 4X7SL 5B7FA 4N8VB 2VL5A 5IQMA 1MEXH 3QPKA 1JV5B 4I7ZC 3THML 2PWGA 3W9EA 3RZCB 2YS4A 5HYSG 2OPCA 3GJEB 2XN2A 2DI8A 2UY7B 3DMMA 4HOZA 3K4ZA 1JUFA 5A16A 3P4OA 3CLWA 4HIEB 4A6YB 4HWBH 2VABA 3HI6H 4JM0A 4OIIH 3GSRB 1KPRA 4AGNA 4AL8H 3GSQB 4TSCH 3U36B 3VGDA 4XPAH 3MBEC 12E8H 4BM7A 2HVKA 4ZOEA 4LNRB 1KCVH 1FSKC 2AQ1A 2XC8A 3RTQD 4YXLL 5DQJA 4HW6A 3O45B 3EH3B 3L5IA 3M1CA 2Z64C 2MEJB 2RTTA 3NJLA 3T77A 1XT5A 3ISYA 4PTUA 4YHNB 1EPFA 2YGOA 5TD4A 3QRGL 4GH7B 1A6TB 2GUOA 4OLXH 2FLMA 2WYZA 3WFCH 4X50A 3HE6B 1OGAB 5GGSA 2WBJC 4PJIA 1Y6NR 2WCSA 3KJ4B 1I7ZA 1NCBL 3UTPE 2AXFB 4LPTA 1U21A 3UEZA 5TGBA 2J8OA 4MJ5A 4PGJA 4ZTOH 3FQWB 5CEYB 4LCVA 3GSNH 3TASA 1P9MA 3SDCD 3NCYS 4NO0A 5AYUH 3TBTA 3VXUE 3UBXB 3QDMA 4RH4A 4Z7WB 2OX5B 2OZNA 2PR4L 3L4CA 3E8VA 2Q87A 1BFSA 1UXSA 2VMFA 4OZ4B 3L3KA 2E9JA 3B9KA 4E9SA 3NJGA 2F8XC 2EJ1A 2CBMA 1JZDC 2K9UA 4AEFA 5HJBA 1ACZA 2B4CC 1U8OB 1M2VA 4GG8A 4IRSA 1UFUA 4IKKA 3ZYIA 2BPBA 4X0KB 1OPGH 4PRBB 3CVCA 1T6VN 4BA8A 1GS8A 1FC1A 1DFXA 3W5MA 3MV7E 1VEPA 2P8MA 4CDGC 3QZNA 4HZ1A 1CB4A 1NCJA 4R3SA 3EGXB 4OJFH 1KIUB 4AIZA 4E0RB 1N2RB 3QQ9D 2HP4A 1C08A 2MH4A 4OCNC 3SCMC 1AY1H 1LWJA 3M17A 3K6FA 4NQQA 1JXJA 2A9AA 4OCYL 1CDCA 1TSRA 1QFPA 1S7VB 4LSVH 4X83A 2DMKA 4KJYA 2DLGA 2OA9A 1FFPB 3E6HB 4Y4HC 4GRLD 2VDKB 3H9SB 3PWPE 3P3RA 3ZDZF 4NUGH 1EEYA 3QQ3B 1EFXA 2EEFA 4JGJA 3KWTA 2P48B 4PREA 5KSUB 3NFSL 3U25A 1JGDB 3BPLC 1GGBL 1Q1JL 2NSMA 3V2AR 1RJLB 5D7LA 2JF1A 4JZNB 2VXUH 2X6VA 3LZFL 3INUL 3HAEH 5DS8A 3EYSL 5EEXA 4PRDA 2HKFH 1A65A 4M8VA 4RA3A 1R5IB 1M7DB 1N64H 5DR5H 3GWJA 5F93C 1DBKH 1TZIB 4BZYA 3HZMA 2C8NA 2J20A 2HB0A 2AJVH 4PJ9C 1L0XA 3O9WB 4TQEL 4UILH 1OF0A 2GIYA 3S98A 3OAYH 2JI1A 5K1NA 1RVFL 4FXKC 1T1WB 3V8CA 5IT2L 1K3IA 4ABUA 2XWZA 3JUZA 1YN6A 3CFEB 3C2SA 3U0TB 3P4MA 5EC2B 3BSZL 3C5ZD 2FHBA 3BIBX 1PGRB 4GXFA 4HT1H 4Y2DA 3NCEB 3TGXA 1NPNA 2D9CA 3TBVA 2NX5E 3V7AE 2XTJC 2YXFA 5DS2A 1IAOA 1YEWA 5BO1L 3L2MA 3MLYL 3S88L 3E38A 2IALB 4GXUN 3CTTA 3BEWA 4ZW7A 2VXQH 4ILDA 4YDJA 4HJTA 2FJFB 3E80A 3WKMH 5IEHA 3PABB 2DM4A 4L1SA 4P57B 3QFJD 3MV01 2E86A 4KZEH 2ADGA 2BVQA 4QHNB 1KXHA 2VDLH 4XPGL 5GS1B 3A6CH 4AYSA 4Q9BA 5SV3A 3U4BL 4QRRD 3TF7C 2R83A 5DURD 3UYOD 1NFIA 3E6FA 4JJHA 3FAWA 3CFMA 4WU5A 3MUHL 3WDIA 4R83A 1G1KA 1VRSA 4JDEA 3S8GB 4YO0B 3K4DA 3FTUA 3M88A 1SY6A 1IEAA 3L6FB 1JTOA 1L9TA 1E8ZA 4PY8J 2WD0A 4NAJA 1JPGA 4Y16C 4YDMA 3WN5C 2YC1B 4DGIH 4A2GA 1RIVH 1NGQL 3MOAH 5HBBA 4LQFL 1HL5A 1X5JA 1QX1A 1YCSA 2BSEA 4X9HA 2QADB 3LNDA 4GAGH 4JO5A 2MCPL 1T2XA 1RJZA 4BZ2A 4C57C 4QPEA 2J3SA 4MJIB 1IBHA 5I1KH 2LABA 3RPIB 1OY3B 4ZW8A 3HNTL 3QDGD 4ISVB 4XMKL 4LCCA 4F5CA 1E4JA 1I8IA 3RB5A 1QEXA 1BEYL 2N56A 2JE8A 1NBVH 3QE5A 4P48A 3K5RA 1WS7A 3DDFA 3EDEA 5BVJA 3UJTL 4ONGL 3DTUB 2HKAA 3MUJA 4M6AA 3UACA 2WCPA 4LE8A 5KG9B 4HIHB 1C12A 2CRMA 5EZLB 3SN6N 3VM5A 4I9WE 5D1QD 1QRND 4MMZB 4N90D 5DUMH 1VKXB 5EPMA 1OSEA 1N70A 5TK4A 3MLXL 3WLBB 4ZO7A 1JZJA 4JCWA 2G0KA 3BZFB 3WD5L 3M46A 3K2UL 3G08A 3U7YH 4EVNB 4ALAH 3ELQA 3D39B 3D0LB 4ZFGH 4DFHA 1FPTH 1E27B 2CQVA 3KPSE 4XO9A 5HI3D 4A39A 1M57B 1SLVA 4OM1L 4UTAA 2DDQH 1PVHA 3FFOA 4KY1H 4MJIE 2RCSH 2GSIA 2VDOB 3Q6GH 4KNTA 4NRYB 4YNYB 5E8NB 3S5ZA 4MZ2A 4YDIH 2V2XA 5EB9A 5TQ0H 3A23A 3FU6A 3AS3A 2J57A 4HEPA 4MCYB 1MNNA 4L9LB 4RFOL 4Z7NB 1AIZA 1SPDA 4UTBL 4JO1L 4C4BA 4LDLB 2BNRB 2JI2A 3EYFA 5FUCE 2WZAA 3OR7A 2OAAA 3BWUF 1AGDA 4EEEA 3HZYA 3V6OC 4QHUB 2M1KA 2V33A 1KEML 4JFHE 2OR8A 5LXGL 4IHOA 4NO5B 5I75B 3C6LD 2B9AA 3OGCA 1NGWB 3LHAA 3CSBA 4F58L 3KH4A 3MX0B 2Z35B 2EDQA 2UV3A 1LO4L 1U58B 4PBWD 2OS7A 4HLJA 4V1DE 2XJKA 3DVGB 2Y6SC 3FBQA 3I74A 3TEXA 2O1AA 3ILPB 1BG1A 2VZVA 4G7RB 4CN6A 2A1WL 3KLKA 4E5XB 1LP9B 5INDB 1YRKA 2MOGA 4UM9D 5JPNC 3RUGA 4TVPE 4JKKA 4JQIL 1IKNA 2QVMA 4FL4B 2CCVA 5L4IA 1TETH 1U30A 2ICEC 3ROLA 5IMLB 1T03L 3LN4A 4M48L 4OI7A 1CTNA 2J55A 4PW9A 4TNWF 4R8WH 4NJ9L 4ZS7L 5I9QC 4OSUL 3APNA 3HVNA 4IKJA 1RKRA 2XBDA 4QYOA 2MPVA 5I1AA 1I8MA 1H15B 5IQ9B 3TBBA 1SMOA 3KPSA 3R7RA 4BFNA 5JOFA 3W11D 1F0LA 1RURH 4QYAA 1YN7B 3TJHD 1T4KB 4KPHH 1RUQL 4JGNA 3GUTA 3APFA 4MJ6B 1A3LL 4NQCD 2YPKA 1XF3A 1FCGA 3Q6FB 3V6FA 1MFNA 2BCKB 4PR5A 1PD1A 2MNUA 2X89A 2BERA 1L3NA 4KHXL 5F8RC 2V2WB 4GP4B 2CLVB 4TVUA 4UQ9A 3CH1A 3V0WH 1LK2B 2W0FA 4HJJL 2Y2WA 3Q2WA 3QCVL 5D5ME 4CVWA 3KPRB 3CX2A 3SGDI 3C9NB 1INEL 1P0SE 5DJXA 4JPVL 1MCLA 3H9HA 4FP8L 5DD3L 3GEFA 3DIVA 1GJWA 3OZKA 1A14H 5KYYB 3L7EB 4NXKA 2J6EL 3D69A 5DUPL 2E3VA 1IEHA 2HFTA 4BJLA 5E9DA 3EYSH 4XNDA 4CADA 4XBGB 4MDIA 3FH7A 1S7RB 3L7FA 1YNTF 4X4ZA 2GPZA 1UTDA 4BFRA 5ESAA 4C4UA 3V4PH 3W38A 2JWYA 2CALA 3LPFA 2XVKA 3STLA 4YXHH 2KZKA 2W92A 2XRAL 4LF3A 3ZDXB 3ARFB 1E2VA 2J72A 1KZQA 2G5UA 3V5DB 2Z93A 3OKDA 4OFYA 5KWYC 4IBWA 2F53A 2IWKA 5J9PB 4KKRA 1MCJA 3ETSA 2ZKXA 2AXWA 2R59A 1XCXA 1B6UA 3ZQWA 3NPZB 4AH2A 4Z7WF 3T2PA 5GS0L 1IJNA 3UBXG 4OI9A 4M3HA 5F7HA 1VZHA 1E4HA 4OM0L 2YFOA 1SJMA 1AHWB 1EJ8A 1EDYA 1QSVA 2MRYA 1ZHLB 5K1VA 3BI9X 3V4PB 5EOCH 3VXOA 5E7BA 1IC5L 3GK8H 1AQHA 1CGYA 3HHRB 4U1NA 3TURA 3FQ2A 4M93C 1ET5A 1USZA 2WC7A 2JJSA 2RBLA 6FABH 5JW3H 3EOTL 3SDAA 3QULA 1PEWA 1RV6X 3IFOB 4XO3A 3GLDA 1HE7A 1UB5A 4L8CB 1BBJB 5IB2A 2ZX8A 3VRJA 3B7YA 1VGEL 4PJ5B 1HESA 1GOGA 1K4CB 2LW3A 1AD9A 4ZNEA 4XMTA 5I6NA 1ID5I 2VLKB 2NNFA 3VWJC 1JGUH 2VH5L 5ID1A 5CUSL 2FX8L 2DDQL 4B9JA 4J4PD 3HJ0A 4IOIB 1EJFA 1DJIA 4I77L 4N90E 3SJVB 5CCKL 4WI4A 4PV9B 1GZQA 4PS3A 2JMRA 3DX7A 4KVNL 4ZQKB 4DZBA 3ML9A 2TAAA 3ARGA 1RIVL 5FO2A 1GC1C 4KAQL 5HDOA 4ESKA 3SO3B 4DGIL 3C60C 4LEOA 2XA8L 1S5HB 2GI7A 4F2ME 1D9KC 1Z9SA 3NCFB 3SKOA 4NERA 1RUML 2A6JB 4N6RB 3NIGB 4MJHA 5L8KB 1TQWA 1EJOL 4JPIB 1AR1C 4XI5D 5A2AA 5I16A 3EBIA 4MX7A 3CVHA 1C5BH 5DHVH 3GMLB 4AM0B 1DTUA 4ELMA 1C16B 1SFHA 1A0QL 1F4WL 2G5BA 2L4OA 2WP3O 4BFGA 3QXDA 4ODHH 1PZBA 2ESVA 1HWWA 3RIAF 2R29A 1LDPH 4PGZA 43C9A 4QI3A 5C2BL 3HMXA 3MLUH 2QR0B 4RQQA 4G80B 4UDTB 2XG4A 3UEQA 2P5WB 1UVQB 4FE9A 5DEFB 3D34A 1K5NB 1L0YA 4XNYH 5GGTA 3S96A 3TYGH 3T0EE 3EO0B 4HULB 5CU9A 3GFUA 1RK1A 2NQ3A 3GMRA 1S9VA 2BJMH 2VITA 4KWUA 4Y5XC 3SO5A 4MASA 5CBAA 4C59B 1U3HA 2OK0H 3L3OB 4YDZA 3MLUL 2EEBA 3HLAB 3LS4H 5B8CA 1MHCA 4BFFA 1YYCA 4L4VE 1ADQL 2A9CA 2KDGA 2X4OA 4CC0A 4X5PA 2A74B 1HHGB 1NFDA 1EO5A 1JZIA 5KJ7E 2VN5A 2W65B 4WVRA 4P5TC 4XPTL 5FYKE 2A73B 1O7VA 1I7TA 2DYPD 4CSSA 2YGNA 4N85A 4EPSA 5GRVK 1XIWA 1CDYA 1WAEA 1DQKA 2AQPA 1KYAA 2WLLA 2NRDA 3MXWH 4WO4B 2XN9E 3JWDC 2N01B 1HT6A 3V4UL 3QO0A 2Z31D 4HCRH 3QJXA 3VI4F 5I1CH 1KLGB 5E94B 1FJ1B 2VM3A 4L4TD 4OZIE 3QUXA 4KO6A 1CR9H 2ZUYA 4WTXA 3QQDB 1DFBH 3JWOH 1GZHC 1QI3A 3BN9C 1LHZA 3H9SE 3PWNA 3MYZA 4KVCL 4X6DF 5EULV 3LDBC 3WTUA 4G6ML 5TDPB 3IFPB 3RJQB 5GS1C 5IB5A 1BQHG 4JQXC 1JNHA 2Z6FA 1S7XA 4K9EH 4TULH 4V11A 1YPZE 4F2EA 2IDQA 4P3WA 1MG3C 5G4OA 5IHWA 1NCCH 1P4BL 2B9BA 3MTXA 1VF5C 3QXVA 2WYTA 1PZSA 1ZSHA 3MRJA 2XY2A 1J0HA 4GRWB 5AB1A 3SKMB 4W81A 4S1QH 4HSCX 1Y1DA 3GMPB 5DSCB 4OIFA 5FYLD 1AJ7H 4G8GA 2DQGH 4O5LL 3RVTC 2EDBA 1AE6H 3ZSTA 2UXFA 3SDXF 3ULUC 2ZWZA 5H4YA 2YK1H 3GSXB 4K71B 5DYOB 5EN2B 5KBNC 4TL4A 4DPBX 3ULVF 1PQZB 4DERA 5FAAA 2FWLB 2AGJL 2E27H 3SGJC 4QTHA 5DHMC 1Q0EA 3UFIA 3DV4A 4O4YL 4L4VA 1BREA 3U82B 3GB7A 2FO4A 4GIAA 4YC2B 4JO2L 3IT8D 3QDMD 1FZJA 3BCFA 2MPAL 4MD5A 2EE2A 3BP4B 1MVUA 2NY1B 3FHQA 2NT1A 2R29L 3NEOA 2VZ3A 2Q8BL 4LVHB 4QOKB 2AEOA 1AACA 3MO1B 4EMZA 5C71A 4YWGH 2J8UF 5DMGC 3C2AL 2E47A 4P3DA 4FLRA 1ULVA 5KVDH 4PBVC 2YRPA 3TX4A 5E4IA 4DPRA 1NGXA 5I73C 1NDGB 1UWFA 2AXGB 4ANKA 2B2XL 3IMUA 2OXHB 2YSTA 2J4WH 1OM3H 1JV2A 3Q8AA 2YBRB 3EF7A 4NNYA 1P4UA 1E90A 3EYOB 5ACLA 3KPMA 5BV7L 4W6YB 4S1RH 2WZ5A 4F58H 3TLRA 3FNKA 3O2WL 2PP7A 4Z6AT 2YJLA 4CAGA 3ASWA 3CHXA 2CHNA 2NY2C 4NAQA 5D4QA 1G7PA 5J1AB 3OHXC 4J6RL 3MJ6A 4RZCA 4UM9B 2BWQA 3F58L 5CZXD 3HBPA 3F7QA 4GRLA 2I26N 1OPGL 3PWVB 1JZ2A 2GUYA 5DHEA 3V4VB 1SJHB 5J6GA 4X5XB 1VDGA 3CXDL 2OR9H 3FB8A 4QRFA 4UINL 4XE0A 1V55B 4N9GA 2W0KA 5ICXB 5I19H 3E2HB 3MLVL 3QUZB 4LCYA 1DYZA 4HK3N 4UV7H 3MJ7A 4WSGA 3HZKB 3AREA 3CC5B 5LGHH 2A83A 1INQB 4HJIA 4LASL 4WEEA 2AJSL 1UACL 3ZDXE 2G60H 2F1AA 4IQHA 2OTWB 1OSZA 3QWRA 4NJ9H 4ODBD 3UMNA 1UCBL 5HHOB 3A4AA 4OFDA 3OAWA 4FHBD 1JNNH 2GABA 4Y89A 3IJEA 4BELD 2X4QA 3Q2VA 1NA8A 3ZDYF 4G5ZL 2Y22A 4ZUTB 3II2A 4ODUB 1G7HB 4Z7AA 4N2KA 1J0IA 1GW0A 1K8IA 1T0OA 5JOPE 4XCEB 5HHMB 2V6HA 5EUOF 3BUYB 4X6FA 3AZUA 1TJHH 4JREC 2C4XA 1UYWH 3WEOA 3U9UA 1G7MA 4NQDB 5C6TL 1D6EA 3OAZK 3U9WA 2WVTA 6FABL 2LOEA 4RNRB 4A38A 5CHNA 4L3EB 5D2LE 1HWHB 5JPNB 2I9TA 5ENWB 3WENA 3BAIA 1L0PA 5I6MA 4G7VL 1FYHB 2VJ8A 3IPEA 1XCTB 2ICEB 1FVEA 2YQ2A 4DAGL 5ICYB 4W4OC 2F53E 2XV2A 3MUGA 3ARXA 3AABA 3P4LA 1FG2B 2G2NA 4I0PC 4NCC2 5C07E 1X5LA 1AQKH 2VC2B 2VH5H 5CP7B 5ECGA 1CICB 1THCA 4IJ3B 5FYJH 3T0WA 4KDTA 3VFGL 1FWXA 1V3MA 1NMBL 3ATAA 1YPZA 2AQNA 2H32A 2WOBA 4K7FB 4K3JL 1KCUL 1R3KA 2QLVB 2NZ9D 5CSZB 1DEDA 1XMEB 4WIQA 4YAQB 4R96A 5IB1B 1M6OA 4P2CG 4PCSA 4AJVA 4DQOL 3LMJL 3Q06A 3BC9A 1F11B 3JTTA 4CBPA 4JZOA 3RTQC 1DBMH 1EJOH 1QVOB 4BV1A 3GXTA 1MVFA 2LR4A 3MRQA 3O8XC 4F8NA 1T7VA 4W68A 4AT6B 2WNXA 1P4LB 1J5OH 2UY6B 3QQ4B 1D5RA 2IFGA 3WDHA 5E2JA 1L9RA 3QZWA 1I8KB 2BVPB 3R1GH 2H2PD 4JX0A 4LESA 5SX5H 1S7QB 3C08L 3HZ3A 4WQOA 3VFRA 4ZSOE 4CGTA 1TQSA 4D7PA 1NFDE 1PAZA 1P5VA 5D2NE 1W8EA 1IZJA 3SE8H 1XEUA 1TIUA 1WFOA 1BJ1J 3T3MF 1F18A 3QIWC 3U0WL 2FX9L 1MFBH 2UY7A 3DMMB 5CR1A 5HI5C 1UH4A 1OAXH 1E3ZA 2GSGB 2X53A 4DGWC 1U8JB 4PUBL 3NIGF 2JB6B 1X9RA 1KBVA 5FLUA 3US0A 2BHFA 3ALWA 4L3CB 1HHJA 3GBNH 4ODVL 4UOW0 3Q13A 4XAWL 5EU3A 2HVKB 1HNYA 1IAMA 5M95B 4M6OL 3H7LA 4LAJH 5D6CA 2MNWA 2XWDA 2ADFH 3FONB 2F74B 2IH3A 3S37X 1QR4A 3P2BA 1SRDA 1E28B 1ORQB 3JT0A 4HCFA 4AXWB 5I1KL 2CR6A 3HG1A 4XBGA 1KB9J 3B3IB 4Z78A 2GUOB 4P04A 3TWYA 3HE6A 4XMPL 3BHBB 3Q7JA 4L1LA 3BO8B 2IWGA 4A66A 3RPKA 1E9OB 5KAQG 2D4DA 5JHAA 2LVCA 1E9QB 3LNHA 1LVEA 1WC7B 4IEFA 2HJFB 3WUWA 2EUWA 3T3ME 2HWZH 2C1PB 2O6FA 2K45A 2PCYA 1QYGL 1QSZA 3Q2LA 3T3MB 5KYUA 5JQ6L 3T71A 3OSKA 3MRMB 1BAGA 4N2EA 3TT3H 4H8WC 3ZKMD 1PZUB 1RZ7L 3SDAC 3ARDD 1E4XH 3MNZA 4J6RH 3GYRA 4I0CC 5HJ3B 4ODTL 1D5IH 4PRPB 2JCCF 1IEBB 2ZXBA 4X0KA 5MI0B 4UNTA 3U7WL 2K9FB 2MQCA 3DV6B 3WJMA 5CFHA 2FEDC 4C56D 3QEQD 2E7MA 3BP6B 2H1XA 1G5AA 1X5XA 3UTZB 1MDTA 3KL5A 4NZUH 3GGWB 3QR1A 5AEAA 1CBVH 1FORH 2VQ4A 1G6RB 1D5IL 1JPFB 3ARGC 4YLBA 4NN6C 4L8SB 4RFOH 4ZX6A 4PGDB 2NY5C 4W9GC 5D55A 5DQDH 3STBA 3DIDA 1DVXA 3WFEL 5DUJA 4A2LA 4N24A 4RDQF 4TUOB 2GFBA 3N85L 5EWIL 4ZNCD 5E5MB 1A7RL 5J6HB 2ZKWA 5HYJB 1FFQA 3L9BA 5EDSA 1VLXA 5KVDL 4NZRL 3QI9D 2R51A 4PREB 5KSUA 3S34H 1C5DB 2PYFB 2IBBA 1MHEA 4OGAC 2WIIA 5EBWA 4Z95L 4KZEL 2XZQH 3WY4A 4TKWA 4KUCF 1Q1JH 2JCCE 2XQYG 3VXMB 3LRGA 4QRTB 2APTA 4QGYA 4RWYL 5I0XA 1YA5A 1WT5C 2Z0BA 3I02B 3A24A 3EFDH 4ZRGA 1KTLB 1MI5E 4HLZH 4WUKL 1PYWA 2VDRB 5DO2D 3T2QA 5C0AA 4GS7C 2QKIB 4JMXA 1KGUA 3GLAA 4TRPH 4NKOA 1RP9A 4L3FA 2HH0L 2HFEA 4Q9RH 4S2SA 4KC3B 3I2CL 1CFSA 5B22A 3JWNE 3RUGF 2R4RL 3FO1B 4IOFD 4XCCL 3VTTA 1MCIA 4UYQA 1ID2A 1SOSA 2ZOTA 1ZV2A 2A0LC 4AX3A 4BFIB 1FSKB 1ZWIA 3MODH 1HZHL 5D7EA 4PJCF 1T83C 4IU3A 1OQXA 2BOCB 5LAPA 3UTTB 1TSHA 1PLGL 2F5BH 4PEEA 5EO1B 4PH8A 5JNYA 1XWVA 4LPWA 3T0DA 4N6QA 5ITBH 1GRWA 1IAOB 2FT7A 3TEWA 3LDBB 3VXPB 2IALA 3UAAA 3WY2A 1CFQA 2EIMB 2N4IA 3BAKA 4P8QA 2V5MA 2RR3A 4HUVA 3VGAC 4YUEL 4N0UA 3FT0A 3UTPD 3X14A 4G71B 4GBXA 2GTWB 3QORD 1UWGL 4FJ6A 3EDJA 3IDXH 3MMEA 4KKPA 4W9IC 5GRUL 4MHHI 2KKQA 2CM6A 4P57A 5HDQH 4Z7OB 2DYPA 2IOOA 3W0WD 1BMWA 3I6KB 4B95C 2ADGB 4UT9L 4WW2F 4JHWL 3ZE1E 1JWUA 1CLZH 3EAKA 2IVFC 1QUNA 2XVLA 1IZKA 3D9AL 1UGKA 4U1JB 4GYBA 4OFYD 3ENEA 5CKGA 5HVHB 1T5WA 2X10A 3JZYA 4TUJA 3NIFE 1U0QA 2HVJA 3VH8B 1A4JA 3RUGE 4CRPA 4M7ZC 1JZ7A 1KULA 1EANA 5ICZA 3JUYA 1UEYA 3TIEB 2BM3A 4JDEB 2E59A 1B88A 4JFQA 3I6SA 2PO6D 3GMNA 2EIJB 1IGYA 2HT3D 4UAHA 2QHRL 5D1XC 1BWMA 4FS0A 4LGPB 4MXQC 4DN4H 5L88H 4K94H 2QHLA 3BUPA 3GPSA 4YE4L 1BX2B 2FEEI 3D30A 4X6EA 1VGEH 4NN7C 4JY6B 2QSCH 1KXQA 4F9LC 3FO2A 3QJFB 1A66A 5LGYA 1KBWA 3NDYE 4JFTA 1WIUA 3C5XA 1F6FB 2R2BA 4M4RB 1J8HD 4O02L 4U1LA 3DJTA 4LFHG 2ARJQ 1JS4A 2Z3FA 3EJJX 4PJGE 3ECBB 2KPNA 2VDQB 3QJVB 4LVEA 1DDHB 2V37A 4EOWH 2WXMA 4FCHA 5KS9A 1YQ2A 2C3VB 5MEPA 5HHMD 2BVYA 4OVUA 2CHZA 4IKIA 4WUUB 5K5YA 3V0VA 5JMOC 1RHFA 1IBFA 3C5ZC 4XC1H 2C4FT 3ARYA 3FFDA 4PJ7B 4YBHA 3ZJAA 3ESPA 2D0FA 2H2SD 5B3NA 4FFVD 4P4KA 1P7HL 4DP9X 3OPZL 4R2GD 4GRWF 1UZGA 2K4WA 2J8HA 4XPTH 5FK9B 5SWQB 3L1FA 3WY1A 1BZ9B 1J8KA 2WVUA 1JAEA 4IGBC 1KYUA 2XV3A 4FEMA 2ICCA 2ISDA 1JVKA 1S9WA 2WGXA 1AVAA 2HTLC 2YUWA 4O2CA 5CINH 2YWZA 2ZIDA 3RIAK 1D5XB 4LCWA 1JK8A 4HV8A 2GG1A 1UOVA 3HIZA 2AP2A 2ALAA 2QFRA 4J28A 2SODB 2I7SA 4AQ8A 1CLYL 4QAWA 3NIDF 1EXGA 4KTDH 4EI5A 4NN5C 3VXSD 2XZZA 1UT9A 2I27N 2UYLB 3V95A 3WLWD 3X3GL 4JRXB 3WUWG 2PMZA 3RBSA 4AENB 2YUXA 2V7NB 3LKOA 4JZJA 1SLUA 3RGVA 2HT2D 5F44A 3SOBH 1R75A 3Q8BA 4NO5A 5GRJH 4CU8A 3OLEA 2D0HA 3HE6D 2OJZL 3F5WA 3BRGC 1OP4A 4HCGA 4FNPA 2DS4A 2CO7A 2OTUB 3E3QE 1MHHA 2WAQA 1HN1A 2QDWA 4Y2LA 1KBGL 1CE6B 4KTGA 3G6JA 3D2UA 3VFTA 1I9EA 4A6YH 3DUSA 3L4TA 4I18C 3WL9B 5F97E 1YAIA 3EFDL 5ACMA 2EUZA 4JS7A 3NFNB 3OVUB 2WZ0A 3H3BC 2BY1A 3D07A 1UWEL 2GHWB 2YAPA 3RY6A 3S5LB 3VYOA 1CICC 4IJ3C 4W6WB 1UZ6E 3DMMD 1RERA 3LQZB 3IAQA 5B39B 4XP4L 4X7TA 2Q1EA 1CDHA 3E1F1 4J3UA 4PPTA 2QTVA 1VIWA 4Q8BA 1OARL 4CVZB 4JFSA 3OR6A 3WBDA 3ZE1B 4A1RA 3ULSB 4P59L 1TR7A 3GNMH 4XP5H 3AW5A 4I2XB 3KGTA 4PGBB 3EYUL 4FNSA 4ZOCA 2UZXB 5KYWB 1JTTA 4YE0A 2I7OA 2QPEB 4ZMWA 5DHVA 4N2HA 1T4KA 1QEWB 1KJMA 2R7EA 2A9NH 3NCMA 2DIJA 2BCKA 3FF7A 3WCYA 2O61A 5EZIL 2YPLB 3GT6A 3D4ZA 3DK0A 5AVQB 3NCBB 3S4SB 1GXEA 3T8VA 3K6SB 1AMYA 2W0FB 1WQVT 3IMRA 4G6MH 1YEHL 2IQ9H 4GOSA 1EZUA 4UZUA 4JRYB 5C09A 5SWZE 4DIXA 1G5GA 3VDCA 7FABL 2E46A 3SOTA 1NWPA 3ETTA 3ERXA 2CO4A 4HJJH 3O6LH 1BD2B 1ADQA 3HVDA 2VLJA 3AGVA 4OBRA 2WLJA 2XZQL 5GRYA 1EAPB 1OD9A 5HDWA 5EU6E 2YD2A 4M9PA 1GGCL 4P07A 1MXGA 1UKSA 3K72B 3QISA 1IC1A 5DUBA 3GI8L 4ABWA 1QA9B 2FZ3B 3ISRA 2C4FU 3B7TA 3IETA 4BUHA 3CMOL 3LQAL 3SKJH 2VZOA 4CJ0A 3SE3A 3G6JE 3T6XA 5AOMA 3SQBA 3UO8B 3KBFA 2ZUQB 3ARFA 2VLLA 3QEQB 3V5DA 1WFJA 4ZMAT 2EXSA 2X4UA 1N59B 3IJ7A 5LN8A 5FCSH 3NCWA 2YZ1A 4OZHA 2F53B 1S7WA 3HG3A 4KKLD 3PWJB 1JYXA 1FLTX 1G7IB 1PX3A 3FBKA 5J1TC 4KHTL 3CC1A 1DJXA 3PWPA 3VXQA 3ZL2A 3ZT6A 3A21A 4BKTC 1TT6A 4WKXA 1GZPA 1FNEA 1YJDH 4YHZL 1D9KA 1PS3A 4CC4C 1DO5A 3KPTA 4DT2A 4Z76A 1EGJH 3HAEB 4OJAA 4H13C 4GRMA 1ET7A 3QGVA 4LHUD 2XNAA 3KNBB 4LVOC 3ZDXF 4FI7A 5HHVH 4HKZA 1ZCRA 5EEVA 1XL6A 1A7RH 1G9MH 1PZ5B 4H88H 4K7PL 4OV5B 5D2NC 1OM3L 1Q9WA 3LPWA 1EH9A 1NM4A 4H1LG 4KPHL 5CILL 2GBVA 5C08A 5D7LD 3SDAB 3C8DA 4EUPB 2YMXH 3P9WB 3IFOA 5DFWH 4LKXB 4S1RL 2N0KA 1CLZL 2DWDA 1OZTG 4M43L 4M8RA 5F1NB 3RNKA 5IBTH 2CDEA 2EILB 3U6XA 1CDJA 3WHE0 3AY4A 1M1SA 1N8ZB 1U95B 5ADPH 3RY6C 1IKFH 3ZYZA 4DKDC 4DOHB 1AZVA 4OW6A 4YSRA 3FSAA 3O3BB 1VB9A 4EN3D 1OLZA 5D7IB 3TU6A 3H8NA 5KSBB 2FBRA 3NQIA 1SLXA 5DT1H 4MCZB 3HFMH 3Q44A 3KH3A 1EQWA 3H4HA 4LHUG 3U1SH 2V17H 3GHPA 1XTMA 4POZC 1IGTB 4BSWA 4TLSA 4C54A 3KBEA 3SDYL 1OAZH 5DF0A 4OZHE 5F7DB 3ASNB 5I1GL 1SVZA 3WMQA 4APQC 3JYCA 4WENB 4TNEA 4P5KB 1YVLA 1WAAA 1IMHC 3MZGB 3IMTA 3OG6B 5JO5B 1O0VA 4D8OA 1JXFA 2F7RA 1TZHB 3QXDB 5KW9H 3IKCA 1P5UC 3AVEA 2ESVB 4J23A 5FGCE 2ZSVA 1N0XH 5IM7B 4BQBA 1J8HA 2H32H 5DJYB 5DUML 3DHMA 3QDJB 4A7SA 4U3SA 1NBYA 4AEIL 4YLQT 1I9IL 2VLJE 3U4EB 1GSKA 3D0VB 3ZE0F 3FU5A 2W38A 3VJ6A 3FT9A 2ZUTA 1S6NA 2X2UA 1VSCA 1AKJA 2PPEA 1K5NA 4MMXB 5C2BH 1SHWA 1TVDA 3PPEA 5CS7A 1H8LA 2OZ4A 4RBPH 1ETB1 5C0GB 3BVWA 2NR6D 3S97C 2C3GA 2PWHA 4ODVH 4OIAA 5HD8D 3X11B 5DD1L 1XGUB 1SN5A 4TQIA 4BA0A 2A74A 3FQ1A 4HUWA 3SE3C 1NFDB 4NFDA 3TONA 3OJMB 2ZXAA 2W65A 2WK2A 1JOIA 2V2TA 2AK4A 5L2KB 5GGRB 1LTXA 4U3HA 4JY4A 1ZV9A 3UIZA 4MGXA 2FRGP 3CFBB 1KTDB 1IJ9A 4DETA 2PPDA 1HKFA 2JKSA 4PGEA 4DQOH 2QFPA 5CEXA 2JQZA 1ACXA 5GGTH 1XF4B 1JF1B 3WO4C 3WNKA 4PAZA 4RMRA 2BRQA 4Z7UF 2FR4B 3V52H 4OCMC 5EU5B 3O6FB 2HKHL 3WHXA 5IHZB 1N5AA 5FFGA 4IOSA 4P5RA 5FFOA 3HCVB 4B9GA 2BIHA 4P2QB 4Q89A 1D6VH 3VU1A 3JV6B 4EI5D 1UQSB 4Z7UA 1CLOL 1RUKL 1QPKA 2GIMA 1H0DB 4OR1A 3PWNB 1ZT7A 2NLJB 1E9PA 1S78C 4LPYA 4AMKL 2HRPL 3WN6A 3QIBB 4JRWA 3S37H 2RCSL 3C6LB 4X98B 4GSRA 1P6AB 2CAKA 4M7ZB 4GW5A 3BDYH 2VQ1A 2UXVA 1AD0A 2DEWX 3LKNA 3QCTL 3NIFB 4PB9H 4WDIB 5DGRA 1T0MB 5E1GA 5EORH 3PGCB 3TZVA 3MNDA 4K9EL 4WLCA 1FIGL 3WFZA 1OALA 5HGGS 4FNRA 4DGUA 3LXCA 3O6MH 4QRPA 3NEXA 3UPCA 2C26A 3QORA 5BZDA 1KIPB 3KLHC 3MRRB 2HKFL 4I48B 3WI9A 4XP4H 3HG5A 1G1YA 3OAYK 2OTPA 5C0CB 2YEQA 4UIKH 2OV0A 1ZPLA 4XZUB 1P4IH 2VN4A 5MEQB 4JFEB 4AQZA 3NQKA 2ADFL 4RMUA 5DLLA 1UT2A 2K3HA 1NC2B 3K3QA 3ZR5A 1B3JA 2UWEE 3KYKL 4LVNC 1I7UA 4WFGE 2G0LA 1WAAF 2WBXA 1RCYA 5F6HJ 4MNQD 2D73A 4XCNB 5E9AA 5DD0L 3MA9L 1WUNT 5C07D 2BX5A 2R9HD 4B9KC 3UH8A 2PO6C 1S4IA 5BW7A 1N3NB 4H25A 5BO1H 4Q4EA 4PWHA 4ZUSB 2MJWA 5DD3H 4OZFA 4EIUA 1JPTH 1KIRB 2EADA 3WAKA 2R1YA 5E6IA 3ZZLA 2ZKHH 1OWWA 3KPRD 3EO9H 5E08H 3CXFA 4JHZA 3QEGL 2ZG1A 1AXIB 3NIGE 4P9HC 5EWIH 1NANI 3VQ2C 5H37G 2KMWA 4DVBB 5FB8B 4F80A 3JVFC 1WK0A 2DYSB 3F7PC 3PJNA 2D2CC 1G7PB 5J1AA 2F8VA 1PKQB 4C8XA 4WF7A 2ZCLH 3HW7A 4UM9A 1XH0A 3EJZD 3HE7B 4GRLB 1KCRH 2CHXA 4Z8FH 4J27A 5I0DA 3IPBA 1KDJA 3FT3A 2H6PA 4HWEL 3FUKA 1WDAA 4PVLA 5GZNA 3PXJA 4GNKB 1LQBC 1ANUA 3MJ7B 4NP9A 2AK4D 1K3ZA 2E5EA 3HZKA 2PR4H 2RD0A 3S3CB 1FO0A 1WA0X 2DQUH 3VTMA 2A83B 3K91A 3QUYC 8FABA 1O5PA 4IBSA 3UZEC 3MFFA 4ZXBA 1AGBB 2Z4QB 4I8DA 4ZW3A 5BVPH 3VW3L 2VE6A 2JIXD 1GOHA 3WS6C 3ZQ9A 2VL5B 3U46B 2QDVA 1V3LA 3ILEA 4NQSA 3HNVL 3RZWA 1DBML 4J5VA 2X4QB 3DI2B 4DN3H 3O3DB 2G60L 1RZ8B 3WE6B 2O6PA 3B4NA 1HX0A 2NY0B 4ODUA 4X5LA 1G7HA 2VSDA 1UACH 4IOFC 4E41E 3D85A 3RKDC 3WTVA 2VABB 5IHHA 4FXGC 3TH2T 3C09C 4JM2B 4Z3FA 3GSRA 4G6KH 1W80A 4XNAA 3MOBH 1WWCA 4I4WA 3ZTEA 3S8FB 1KT2A 2L8AA 3EDFA 4MYPA 2WWMD 4P2RE 2X1PA 1BVKB 1R3LA 2MWCA 3QT2A 5DFVC 2WSPA 2CRYA 2APVA 4LSVL 4PRHE 4L3EA 1V27A 4FP8H 3ZPDA 4NIKB 2OCJA 3MRFB 2VR3A 3T77B 4DP2X 4J2XA 3RHWF 3UYRL 4Z3TA 4X9GA 3MLXH 1MI5D 1TJHL 4N0UE 3AWFA 1I75A 1A6TA 5C92A 1Q0XH 4JUSA 3RIFK 4EE2A 4YX2H 1FG2A 1W72B 5E23A 3BVVA 5C9JB 5CP7A 2GY5A 3T2LA 4FDWA 1F2XK 1F4XL 1PNDA 1UJ3A 2AQSA 3AMKA 5H37A 3QUMA 4RLDA 3VMOA 5DD5H 3DX1A 4E9TA 5JIKA 1RAMA 3MBEB 4L0ZA 5B3JE 1F11A 1Z1WA 4OUOA 4XNMA 3VO0A 1Z5LB 2NY1C 4HDIB 4JZOB 4OZFH 4XVSH 4EOWL 1J86A 1MIEH 2VJ0A 1IL1A 2B1HH 2Q7AA 1UXSB 4YDIL 4E42B 1K85A 3B5TA 1NAMH 5IZ7A 5K9KA 4JFEE 1ZE3H 3WKPA 5IJBC 5A2BA 1C9SA 3BWAA 2WO4A 3GIVA 1Z9MA 4GUQA 1H19A 3MOAL 2WN3A 3GBML 4GUPB 3QQ4A 4GAFB 4KKAD 2PO6A 2D2OA 3VQ1C 4YDNA 5DK0A 4LKCA 1BVNT 2F5AL 4NX0A 4QTFA 5BS0A 3M7FB 2YQBA 3Q8FA 1KLUB 1TPXB 3MRKA 3OLIA 5CN3A 1QW9A 3LZPA 4AZUA 2AJYH 2CD0A 5I66B 1CG9B 2Y4SA 4PJGF 1J5OL 3PS6A 5A6LA 4JFOB 5GISH 3VGGA 4HGWB 1P5VB 1AR1B 2BJML 2P5EB 5F7WC 2NNXA 3DURA 4Y4FB 4ANWA 3DC0A 5CFAA 4KNQA 4OLVL 3P11L 1IU1A 4KKNA 1KJ2B 4AUUA 2WBJA 5FECB 2GITB 4W9ZA 3HFFA 4KK8D 4KJYB 1WRFA 1IAIL 2CXKA 3COOA 1JDAA 1A25A 1OAUL 3DX3A 2B08A 3QA3A 1UZ8B 5HY9A 2AMGA 2ALWA 4RFNB 3U4KA 2WXLA 4BEIA 3VXTB 5C1MB 4OD2B 3SPVB 1E2WA 4X0NA 3JXAA 2YGQA 2B7DT 2ENQA 2WLZA 4LLMA 4NIYE 1CXIA 3ABMB 4H1LB 3F04A 1KTCA 1QLFB 2DWEB 3T8XA 2MTPA 5T3ZE 3HG1B 3LKSA 1RPUA 4JDTH 2OR7A 4IRSC 3RJOA 2X2JA 1JWMB 2R0WH 3VVWA 3ZMEA 4HKBB 1DZ0A 3PHOA 4CJ1A 1TOXA 3ECQA 4ONFH 1G1OA 1XGTA 5DD0H 5ALCH 3W39B 5KANG 5BZXA 1TZIA 3D7PA 3HZMB 1UH3A 4JN1H 2DJSA 5FV2A 3SY6A 4AVHA 5MHSD 1QZ1A 4Y4HB 2DQFA 1WC7A 1TZAA 4Y1TA 4MXVE 2E7BA 2Q9OA 3UPRB 4MSWA 4CVXB 4XI5C 2C1PA 2G2RB 2X3CA 1DSYA 1YN6B 3T1FA 5BPPA 3U0TA 3EH4B 2W88A 5I82A 5JXED 3ULVE 5CD3A 3FFCA 5ERWB 4Y2DB 3VYNA 1DUZA 3QCTH 4PB9L 4PV1C 1JE6A 1I1RA 1NBVL 4LBAA 5D9SB 3TFBA 5F0PB 3SBPA 2FL5A 2CR3A 4ZYKB 1E2ZA 3UJTH 4ZZKA 4XNZC 5DJCA 3EH5B 2YEVB 4UANA 2R2HB 1WT5A 2VN3A 2FLRT 4U4IA 5C0BD 1OHQA 4YDJB 2BSSB 3KJ4C 1KELH 4LOUC 4PJ8C 4NPKA 5BQDA 3DIFA 4G42A 5IEHB 1BV8A 1GS7A 4KV5F 5K9OA 2WLKA 3HC2A 3O9WC 2Q3ZA 2YKLH 1FG9C 2OSXA 5TK2A 2NW3A 4HXAL 4M1DH 1DANT 1DVZA 4J3BA 2MNJB 1FPTL 3NRQA 4N8UA 5FW7A 4IMLB 4K7PY 5J6HA 2J56A 3EGSB 2XTJE 5H35B 5F9WB 5BRZE 4ZFOA 5HYJA 1QPXA 2HFFB 2XTJB 5E8PB 3RWFB 5BRZB 1IEAB 4JANB 1OOAA 1UWGH 5GRUH 4QF1B 3H0TB 3UC2A 5HYSA 4FG0A 3IDNA 4Z7NF 1M53A 2P42B 4PJAB 2AGJH 2EYSA 4Y4KD 3NTCL 3KXFE 4JPKH 2V5TA 1R0AH 1HILB 2EIZB 3ZQXA 2GBTA 2XZAH 1GVIA 2FB4H 4QRTA 5FO7B 3FRPG 4HJSA 5D1ZB 1VCAA 4NGHH 3CMOH 3MOQA 3LPGA 2Y7MA 4XMUA 3POHA 4GJTB 3LIZA 3FUHA 4J7RA 5IWLA 5BMFH 2N7AA 1PW3A 3UROR 3RA7H 2J25A 3GMQB 4K07A 4NO2A 3TA3B 3LZOA 1X5HA 3O0RH 3TT1H 5I1EL 3IDGB 1AGEB 4P2OD 4JQIA 4KRPD 2HFEB 5KSVB 1CFSB 2QTEA 1DQQB 4AYEC 5L4MA 3FO1A 1S3RA 4RAHA 5BVJB 5DRZB 4BH7A 1HC1A 2H0JA 4JVPA 1RU9H 1WISA 1TYJA 2HX7A 5KG9A 4HIHA 4LP8A 4P5MA 2EO7A 3BPLB 1OIOA 4LLDB 2NXYD 3EJYD 4W4OA 3A67H 1JGEB 5JOPD 2RA1A 1XSIA 4GSUA 4PVMA 4YE4H 2HH0H 2NUPB 4BK5C 3MGTA 4Q9RL 3RWEA 4D9RD 3Q05A 4HIJB 2ZAIA 5EO1A 1HZHH 1FHNA 3V9EA 1JVOA 4GO9A 1TQCC 2M83A 3M45A 2WLYA 3G08B 4MJ4A 1A3ZA 3QFDA 4Z9KB 4DN3L 1LO5A 2HLAA 2IANE 4GBXB 3AG4B 3G9AB 2G4EA 4MQTB 1URZA 3C2AH 1G9NH 3GZPA 3DETC 5IVZA 5IBTL 4BHUI 4JG0H 4NRYA 1MWAH 3F2LA 2IOIA 5EU6B 5I8OL 4NOFA 1CIUA 4QR7A 1CBJA 4CW1B 5C0JA 4OLVH 2H0PA 1TVHB 2WNKA 3FDWA 3DX8B 1D5BA 1G7QB 4OFVA 1G9NL 5ICZB 5ICUA 1R1CA 3IMVA 2YOAA 4L3ED 4LXFA 1E0OB 4B60A 2DH2A 3ESVF 1PLCA 4H7VA 2X87A 3L3JA 2N0MA 1IX2A 4MA8H 1S7UB 2K8MA 5HI4C 5IESH 1WWAX 3GZKA 5MENE 4OZIB 2DMBA 2WWOA 1U3HC 1EZLA 2Z7ZA 1OF2B 1JRHI 3P3TA 4OLEA 5F70A 3SKUD 1KPUB 4NN6B 3UAEA 4DN4L 5L88L 2IADB 4JPSA 3QJFA 4ELME 4HIXH 3ZXAC 4P5TA 5IJKA 4FNLH 2R4RH 1EGJA 1WGOA 5LKNA 2QGEA 3HNTH 4MQSB 2NYYD 4KITB 4J12A 1T22B 1E7VA 2JXMB 2Y5QA 5CM1A 1EGJL 4DP7X 1NFDF 4P2RD 5DT1L 4E5XA 2CIKB 2C7UB 3VMPA 1ZIAA 2X70A 2PLTA 3GBMH 4BCZA 2HMID 4ZI8A 1KJVB 1FH5L 3QWOB 4U1GB 1KENH 3V4VL 1A47A 2YXMA 4GY4A 3V0VB 5IMKB 5FGCB 4X8CA 1MDAA 2ZWYA 1RK7A 4F3FB 2WQSA 4MA1B 3IKKA 2P7TB 5FHAL 4O9HL 1AO7E 1A0QH 1F4WH 4XO4A 1KGCD 2XWJB 1GPOH 3OZLA 2ICWJ 3G6DL 3HE7C 3WD5H 2E56A 3O8XB 3CZFA 1DLFH 1OP5K 2CO1A 4TTGA 2ZCZA 3SBWA 3LXBA 4XOEA 5SWQA 3UMTA 4W9FC 5E5LA 1PJ9A 4I18A 4U6XA 5HPMA 3QVAA 3KVDD 2O30A 2YRBA 1XHHA 3D4YA 5FGBA 1BPVA 1JYWA 2OMBA 1AJ7L 2FBOJ 2CK2A 5BOJA 3Q1SL 1T04A 2IDSA 3EFOA 3FL7A 5CLZA 3TIDA 4R84A 1IM3B 5CIPA 5IR1B 3TCXA 1KTRL 1D5XA 1JK8B 4HV8B 5CMAA 3CU7A 3QNFA 1Y0LB 1UD3A 1QG3A 2A5UA 3ET9F 4UU9A 4R5VA 3LOWA 2H1PL 5BZWB 2CA3A 1IGMH 4NO0D 1IGCH 1MEXL 3OKEA 4GSDL 3X1FA 3FSWA 5I9QB 4ENEC 2TRYA 4LQFH 1MJ8L 3BAEH 2BW5A 5CP3H 3V0HA 3MRLB 3BWZA 4X4YA 1Z9OA 1FRGH 1A6WH 2V8MA 3VGAB 1O6TA 1SN2A 3NT0A 2W81C 2A9DA 2C9SA 3BQUA 3T4AA 4ZMPA 4J3OG 1R9FA 3OAZH 4LF3B 3IU4H 1KN2H 3BUBA 2IDFA 1WZKA 5DJDA 1CE6A 3L4YA 1HK6A 3D2UB 3HUJA 3EO1B 3V6OA 1ZRUA 2WQVA 2IOMA 1K6QH 2YD8A 3DUSB 2FJHB 4QOKE 3NG5A 3VUAA 2AMUA 2GJZB 4NQXA 1E50A 5D1QE 1ZLSL 4WI5A 1OAQH 5E9DE 4HUCA 3FFCD 3G3LA 2DQIH 4V2CB 5F0LB 1N67A 2JJTA 4FFYL 4Y8AA 3BISA 5DI8B 1YEEL 3PP4H 4XMPH 4DZ8A 5E6UB 4OY9A 5ID0A 3QI9A 2H6UA 5D7JC 1E67A 1FDLL 4ZDHB 1DQJA 1RU9L 5D7KD 3TO4A 1HZKA 2W9LA 3HG2A 4PJGB 1P9MC 3VGBA 3VXOB 1FZMB 2J71A 2ICWA 2CJ3A 3BAJA 3ESNA 2HXAA 4MJ2A 5F7UA 2J1XA 4KMLB 3OZ9L 2YRZA 4ZODA 2VW4A 1BLIA 4EN3C 3ARFC 4NN7B 5JPMC 2UZXA 3FO0L 1EBPA 4GG6E 3FTZA 3QNXB 4U7SA 1E5ZA 3BAYA 3HG1D 3UTQA 3RVWC 1PZ2A 1BBJA 4PLJD 1OO2A 4D94A 5IB2B 1IFGA 5LGKA 3AS0A 3V0EA 1U8KA 2EAEA 4PJ5A 2EXYD 4DWHA 3DRQB 1NAKH 4G9DB 4HPOL 4HGMA 1U2CA 4ZUUB 3VFWB 1PG7H 4YHZH 4APXB 4Z3IA 4ODTH 2FIKB 3D4CA 4Z7VE 5AWNL 4ETQA 4C83A 5FF6B 4NS0A 5FYKH 1WFNA 3B43A 4JRYA 5GSRA 3ZO9A 2IQAA 5HYJD 1FO0H 1NOLA 4M1CD 4U6VL 3LEVL 4PV9A 4JRLA 2PETA 3DX7B 1OW0A 3VFPB 1QQDA 3ARGB 3CBRA 3GXFA 1U3JA 3C5ZB 4JB9L 4JPKL 3EJTA 4JCMA 4WEBL 3W82A 3ZHDA 1K4DB 2UZYB 2YA2A 2F68X 3Q48A 1XF1A 2ED6A 4F7TB 4YHMH 3FOLB 1RZJC 3VB9A 3SKOB 4Y2NA 1AGCA 3GMMA 3B5HA 2V4LA 4OKVB 1SGKA 4FQQB 4MX7B 4YHLH 3GMLA 4HETA 4AM0A 1C16A 3EH2A 5JDJA 3DPBB 4A2MA 3DSNB 5SX4H 4UM8B 1GOFA 1U8HA 3HHMA 3SQBB 1FN4B 25C8L 4JAMA 3VG0H 3NJXA 2NDFA 1P4IL 5CKAA 3QEQA 4HPYH 5AVWB 2NX5D 1JI1A 2ENPA 3AROA 4F2MA 3LZFH 4W9LC 3RJDA 2Z91B 1HHKA 2X0UA 4RQQB 3QEGH 4NOBA 5HSFA 1EHLH 4FD0A 1ZTMA 2XG4B 1KUMA 1LP9F 4PW3A 5KVGE 2P5WA 1GYVA 2QGDA 1H5BA 3WE1A 3VXQB 3F58H 4WFED 3SO3C 4X9BA 4MWFB 1FNEB 1YC7A 2DD8H 5AAMC 1OAYH 4GS7B 5GGVL 4FLHA 3RDTD 5CEZE 1MLCA 1OXYA 2OMUB 4PBXA 8CGTA 3L3OA 3G7TA 1KEGH 2WKGA 1QNIA 3MA9H 4KROC 4JHAL 2FD6H 3Q43A 3U1QA 3NSXA 1FNAA 4RRPA 5HHQA 1UKQA 4HKZB 5IT2H 4IRSD 1UEMA 1CK0L 4G9FE 2CRZA 2PXYD 4OV5A 1L7IL 4OJYA 3L1OL 3RTQA 1EXHA 4RMQA 2A73A 3N1FC 4KJWC 1I7TB 5EIIA 3VGHA 2W1NA 4P9MH 4XVJH 2BHYA 4HH8A 2NSXA 1OGPA 4WO4A 4M00A 5AOJA 1W6LA 2DI7A 2E6PA 3PU7A 4N22A 4U7MA 2DRUA 4OGZA 2XXGA 5JR1H 1JFHA 3NJFA 2BMKA 2D03H 4JGMA 1YG9A 2HN7A 1C7TA 5AW8B 5ADPL 5HVWA 5KVEH 3QQDA 5IVXE 1PX4A 1NDTA 5GRVL 5E1IA 3U7AA 3KPQB 3SJVE 4OZGA 1CDBA 4BSWB 2Q3XA 5AD0B 1TUPA 4JFDE 1NAML 5IP4A 3S2AA 1KDIA 1I9JL 2FJGB 4R97C 3HOGA 4W9CC 4OCLC 1TDQA 2Q7YA 4HIXL 4XNXH 5T3XL 1OT4A 5LJYH 4UQDA 3C5SA 3ZTCC 5DMGD 5CZRA 2MMXA 3H53A 1ES0A 2F58L 1B2WH 2CO3A 3HI5L 5E2UH 2AJYL 2FEEL 3G5ZA 2D31A 5CCHE 1CICD 3HJEA 4PRPE 1U8LA 1KTKE 1XF5A 2QHRH 4Y5VC 2DQ6A 4I13B 4YOKA 2MCPH 3ATBA 3VJ6B 4FF9A 1BVZA 1YJDL 5C97A 2CBQA 3HE6C 1AKJB 2IDCA 5ISZD 3O2VL 2XZCH 1NOAA 4AJWA 1R34A 2FO4B 4WUUD 3KYOB 3BDYL 5C3TA 3DJZA 2WZ6A 2CUMA 1FZJB 3EOBB 3TA3C 4D3CH 4MD5B 4KX9A 1SHXA 5DEGB 4IDLA 3BP4A 3BJ91 4PJEB 5DTFB 2PTUA 4FTVB 1EDHA 3FXIC 3X11A 3BH8B 3HS8A 1XGUA 4PY7B 4IYKA 5A3ID 1G94A 4DKTA 4J8RB 2BVUA 3T2NL 3RP1A 4GKSB 3OWRA 3NIFF 4EIBA 2XBZA 3NSDA 3DO7A 4ECNA 3S35X 5BS0D 4HZLB 1BVNP 3T1WA 2R0WL 5GRXG 1ZHKB 4ZFQA 1KTDA 4Y9FA 1OCWL 4XWGH 2VYRE 2VDQH 1HHIB 4O2EA 4FCAA 2R9HC 4XMXA 4HEME 5IROC 3AU1A 4JFHD 1BFVL 5CCKH 4KO5A 1L7TH 1A9BB 4HHWA 2A9BA 3HI1A 5KZCB 2KH2B 3O4LE 1XMWA 1MCKA 5JORA 5IROD 4Z7UB 3FTGB 5C0CE 2MKWA 1H0DA 3I6LD 4JRXD 3EXJA 1XH1A 4RISL 1EAQA 2BS71 1FAIL 4Q0XH 4XP6L 4EQ3A 4X5XA 4FQLL 1UB6B 1AQDA 1O5DT 5DFTA 3WFDH 1KB9K 3TFKC 3QUXC 2J88H 2F61A 3T08A 1AD0B 5A2LH 1JPTL 5GISL 1P1VA 1ZPUA 4X8XA 3QEQE 2ATKA 5LGJB 4JO1H 4IKNA 4TSBL 2PCPA 2MTAA 4JLRA 3DTXB 1NCGA 4QXVA 3KPSD 3AXIA 1KELL 4EI6B 4JQXA 5JQIB 1GJUA 4N8PA 4JDZA 5IVOA 2FHCA 4R7VA 5AKRA 2O26U 5L6YL 5A2IH 4K3DH 2NY2B 4NUMA 1QYGH 5C0CA 1CIDA 3C08H 1UGNA 2EDHA 4J1UA 1I8AA 1DE4B 1I3RB 2WHVA 2PUQT 3JYBA 4GW1A 4RAVA 1JN6A 3BUYA 4HJEA 1U6AL 4UOW1 3N50A 1MJJB 5D71H 3ULVH 4DUXA 2IWFA 4OAWA 3HPJA 4J39A 1F1AA 5B38A 2E4TA 3F8UB 2WP3T 1CURA 1NQBA 2OL3A 4UOZA 3SE9L 3ARDB 4LB8A 1GY1A 5DJ0A 3OV6A 3VXME 1AKPA 2EKSB 5ICYA 3LN5B 1XCTA 2ICEA 1BZ8A 2FD6L 5ABDE 1N7MH 4L8DB 4KI5D 4GFXA 4O2FA 1MJ8H 2L7JA 3BAEL 4HIPA 1R5WA 1T20B 1I3VA 1HS6A 4ZUSA 3QRBA 3MV7A 4GMTH 1HEZA 4NGHL 3HN3A 3ZYOA 4MDJA 5FKPA 5HVFB 1C5CL 2WLHA 4NUGL 5AVYB 1UWXH 2QGBA 1OQOA 3ARZA 1BLNA 4HFWA 1RPQA 4X80L 4EDWH 5G5DB 3IWUA 1D6VL 3L3HA 4R96B 4X7FC 4NUPA 5IB1A 4JDVB 4P5TD 3JV4A 3MV9D 4WNSA 3O11A 1U2HA 3O4LB 3QG7L 1P4BH 1UM4H 2WXJA 4LVHC 1QVOA 3RAJH 3TOPA 5BV7C 2XYBA 4JO4L 1BFTA 1NCDL 3MRQB 5IFAL 3GTNA 4UDUB 4LHUA 1UURA 4OB5L 3ARWA 4KXBA 3LRLA 1YMHA 2BSDA 3D33A 4X6BB 4AT6A 2IBZY 1H6FA 1U8MB 2R1XB 3BPCB 3HC4L 2QVFB 1KCRL 4GAYA 4HWZA 4YVUA 3MFGB 1R3HB 1S7QA 4GQ9H 3RWCB 4Y19E 2NY7H 5DU7A 4LHJB 1H8NA 2AJSH 4E9VA 5D1XA 4QHLA 2DQUL 3UX9B 3GO1H 1WA1X 3IFLL 4IBZA 3SDDC 3UZVB 4AY0A 5D6DA 2A1WH 1AXSA 1JWSA 4JKWA 3T6VA 4JL1A 3LPPA 3QZLA 5HHPB 4P2OA 3CFNA 1U8JA 3CBJB 4XGZA 5EZIH 3GJFA 4TVPD 5KJRL 4L0PB 1ZHBA 3KL3A 2JJUA 1U8QA 4HHAB 1CBVL 2RH0A 4PIBA 4OCYH 2ZAGA 3BOVA 4N1EA 2YEZA 1RUPH 3IDJA 2OCCB 1AZCA 4U2ZA 1XQ4A 4HKXA 3FONA 2OYMA 4U1IA 4D3CL 2E7LC 3AJ7A 1TJXA 1IE5A 4KH2A 1E28A 4LLQA 4YUEH 5KVGL 1UA6H 3D52A 1MPAH 3NH7H 4K23L 2XTSA 1TZ8A 3BVDB 3P2TA 3ARQA 4MMZC 3QJOA 1MZYA 3G5YB 3K8MA 2WYHA 1XEDA 4G7VH 5HYQB 3L9YA 2DI9A 5EMYA 3NZ8B 5FYLE 3KLHD 3TVMB 3BFWA 3R8QA 3CDCA 3O3AB 3BHBA 3MJ9L 4BUGA 5J13C 3INUH 4AQEB 3QIWB 3WFHA 4AQAB 5D8JL 2Q6WB 5IHLB 4YHOH 2H26A 5F21B 4EN3B 5A2CA 4MAYD 5H2BB 1OCWH 4XWGL 3KR3H 5F1IA 2VT0A 2P5WD 3C5JB 4L4VD 5B1JC 3UCQA 4ZMYA 2BHUA 5C86A 2FYVA 1Z9LA 4E9WA 2AV7A 5EO9A 1EO8H 1FNGB 1I3GH 1X3DA 3DHJA 5CJ5A 5J06A 5KYUB 3MRMA 1O6SB 3FU7B 2P47B 2GI0A 2GK0B 3P1VA 4JDTL 1OGSA 4HAKA 1J48A 3BWAB 3GIVB 2KLSA 1GGYA 4ONFL 1WFUA 4GUPA 1FL5A 2PABA 2PO6B 3BT2H 1X5YA 2GJPA 1WF5A 5A2FA 5F3BB 1NIBA 1UXMA 1Q94A 4DCQB 2Y9RT 3CUPA 4KKCD 5HDRA 3MNVB 4L5FE 4WO4D 1X5KA 2RHEA 2ZX7A 1A6AA 1N18A 4JFOA 3CDFA 2EKJA 5CILH 1UZ6F 3QR2A 1L7IH 4HAGA 4L8SA 1NKRA 1CD9B 1PFCA 3GI9H 4TUOA 4EZKA 3MV9A 3UTSD 5TDOB 5GJSH 1KBPA 4GXUM 2XKNB 3IFNL 2VISB 3KGSA 3L54A 2DW5A 3CXHJ 2A4CA 3QA3B 4HX1A 3HB3C 3PGDA 1UJTA 3T0ED 3VXUD 1NLDH 2O5YH 1OANA 5KAQF 1CI3M 1C5DA 2BOLA 2WXKA 2X4SB 4UOJA 3VD5A 4TOYH 1QASA 2YMTA 4MMXC 3WEAA 4CU6A 2G3MA 2F7OA 1HE8A 4OZIF 2V17L 3ARED 1WEJH 4L4JA 2VDQL 4FL4C 4GKOA 1IBYA 4AVKA 1HKLH 4IIQB 4KKQA 3FZUD 3DLQR 3QW9A 1KZYA 2BP8B 3NSYA 3VFGH 4WWPA 4F2FA 2ZCKH 2EC8A 4X7SH 4FTDA 3I02A 5IMMA 2H9GB 4DGVL 3KE0A 1SOQA 3FB5A 3V8OA 1W8OA 3KDMA 4YDVB 5AAWC 3HG4A 4XMLH 1ZMYA 1AHKA 3F84A 1ED3B 3UPRA 2LAGB 4V33A 1CGXA 3FCBA 5EF0A 1ZTXE 1FAIH 2B14A 4KAQH 2AF2A 4L37A 3OC8A 4WFEE 5D93C 5DJ6A 3WO4B 2Z9TA 3M1BB 2ARWA 4Y16B 3JQOB 1KCVL 5JZ7C 2E7LA 5BJTB 1A6PA 2Y5TB 5IOPB 3O6FC 5EOQH 4D0BA 7FABH 1T7WA 2B1OA 3LYRA 4FFYA 5D9SA 3FN3A 2KUTA 3G6JF 2XT1B 3LRKA 1Q9OA 3ABKB 4TSAL 2VIRB 4FHKA 4RDQG 1J12A 2NXZD 3VXPA 1S9XB 5C07A 2Y2TA 3BGMB 4HUVB 2Y69B 3D2TA 4D9QD 4A7UA 3Q1SH 3N40F 3ARTA 1Q9KA 5KOVC 1F13A 2Y6SD 3DIFB 5EOQL 5B38G 4N8VG 1F86A 4OGXL 5I17B 2APBA 1QNZH 3QC6X 4PJHF 2K6YA 2X3AA 4LLUB 1JWUB 2Q76B 4BKSC 4MNGA 3FB7A 3KPOA 5K93A 5DVPA 2MCG1 2DM7A 2QSVA 1A02N 1JK9A 3VWKD 3LNFA 5FC9A 4IMLA 4G8AC 1INDL 3FRPA 1OCOB 3QDHA 3V52L 3B9KD 3D09A 1H9DA 2DJMA 4U6YA 1ZGLP 5HHNB 2NY5L 5DRNA 2D7OA 4QGTA 2G4GA 1RK0A 5BUPA 1HAUA 5JIQA 5BXFA 3IDNB 4OU3A 4Q6IC 1T3FB 2L0DA 3S34L 4ZMZA 4F8LA 2AITA 4Y19D 2FECI 5G4NA 3ZKXC 1BX2A 4Y9BA 2VMCA 4XPAL 2VERN 2G3ZA 3V0DA 5E8DH 4M61A 2XFXB 3ALPA 1F3RB 4YXLH 1PG7L 1L6PA 4WJG3 2YMXL 2Z65C 4BQ8A 2NYZA 2PWFA 3QWRD 4NRZB 3TYFB 3V4LA 3GMQA 1PSKL 2I69A 4NO2B 4WHYG 5CGYD 4FFVC 4XPBH 3TA3A 1B4RA 1HH6B 1AGEA 4L9LC 1NPJA 4L4TA 8PAZA 1JFQL 3OB0H 1DDHA 1X9QA 5AL0A 3ME0B 3DX6A 2J8UB 2LGNA 3FFCE 4DK6A 4P5MB 4E2OA 4WW2B 2MHAB 1PD6A 1C8PA 3H3PL 4KFMA 1TNNA 3CZEA 2X1XR 1GGCH 2J2ZB 5I75C 5GS2D 2HSIA 2YD6A 4XN8A 3L3GA 3IVKB 5F7AA 1VESA 2CWRA 2NY7L 2L3BA 5DMIL 4GXVL 3WIAA 3UDWA 2J12B 4YHLL 1F45A 1ZEAH 3BVNA 4R4BA 1YECH 4L1DA 3QFDB 3OJVC 4D7BA 3DDGA 4IW4C 2CLRB 4XNBA 5GS0H 2MQ3A 4H26A 3UP1A 2X6MA 4N5UA 3SE9H 3PAZA 4PJCB 2B5IC 2GBAA 3QXTA 2B8OT 4XOCA 1SYVB 3NFPA 3K71A 2X4RA 1DN2A 5D2LF 4KGLA 3OKYA 4MD0A 2X09A 3IN2A 4S1DC 3QUKB 3PIQB 3D9AH 3ROOB 4GEIA 3AQYA 3BP5B 4N2FA 2Q86B 4BWUA 1SJXA 5AZUA 3H7BB 4PJ9D 4WWID 5FHAH 2IH8A 3RQ3A 3TV3H 3V7AG 3LQMA 5E08L 3EOTH 5CEZH 2CLZA 2P43B 4NT6B 3O4LD 4LMQE 1T21B 5KSAC 2XN9B 5CD5D 2VR5A 4QNPE 1S9YA 2XX0A 1FIEA 1HEHC 2JVUA 1F3DH 1RZKC 2VZSA 5D7IF 5KSBF 4UB0L 2IANA 2OMXB 4QO1B 1NAMB 2EE6A 1OCRB 2BZDA 2NZIA 2V0AA 4I9XA 4NKDB 4Y5XB 4BSJA 5GS0D 4OUUB 4IU2A 1MHHB 2F15A 3VFMA 3VX0A 1MLBB 3HS0B 5C6TH 5C0FB 3LS5L 1NCNA 3QEHB 5BMFL 1DVFD 2LU5A 3JWOC 1B2WL 4M8QA 4MQ7A 4MMYA 3TT1L 4I3GA 2IADA 1NFAA 3BCDA 1HL8A 3T65B 1J8RA 3KCPB 3TH3T 1XSJA 5IJVB 3IXAB 4Y7MA 3FYIB 1AYRA 1QR1A 3IMWA 1ROCA 1T66C 1AZNA 1MRCH 5I15H 4XOAA 1A2YB 2RFXA 5E51A 2O4EA 3S5LA 3K80A 1IQDA 3IDMA 4HMDA 3HRZA 2CIKA 1OAZL 2OYLA 4K5LA 5C9KA 3VRIB 3C60A 3DK2A 4B97A 3H9ZA 1TTGA 2BCMA 4Q2ZB 1MFEH 1MUJB 1XCWA 3OKLA 4CVZA 3OR6B 5JZ7D 1W0WA 3IU4L 4LOUD 5SV4A 3ATEA 4ANUA 3F7VA 3F85A 4NZJA 4EI5C 5KJRH 1RQ5A 4LCIL 3SE4C 3V5HB 5IMOA 4DKEH 4F24A 2Y1ZA 3G5XA 4H44C 3O8XA 3BSZH 4B9PA 1AP2A 1LXMA 1MIEL 4NHUB 1PCXA 4TUKL 5EHFA 1QEWA 2RIKA 2R7EB 4Q9CA 3GI9L 4I87A 3P9MA 3IDUA 2COQA 2W07A 3W1ZA 3MUZ1 4H1LH 4YHPB 3II3A 4Z7IA 4EZJA 5IFHH 3WTXA 3RL1B 2ZAHA 3QUMH 5JXAL 4YX2L 1T04B 3TIDB 1IM3A 5IR1A 4L3EE 3SGDH 1JGVL 5F71A 2GJ6A 2PP8A 1ZT1B 4B27A 2NTFA 4MNHA 1IKOP 4DKAA 1PY0A 4IBTA 1EDQA 4J3TA 2B16A 3QSKB 3HUJF 4K3HA 4LIQL 3OKEB 2XA3A 1BOYA 3ML8A 2B1AL 4BGDA 3Q8CA 1CLYH 5DWPA 1TQCB 4PP2B 3SODB 1FAKT 3NJKA 1S7TB 5L0QB 1FBIH 4G8EA 4TSCL 3P0YL 3V5KB 4N5EC 4PRPD 5HGAA 2AEQH 3Q9PA 3NZUA 2R0KL 4ODWB 2FZ3A 4RFNC 3CFKB 3T4AB 1QO3B 4Y5YB 5FUOL 1U93A 4H2CA 1X44A 3B2UD 1VZGA 3GLEA 3GSOA 4KXCA 3FQUB 2P3YA 3OHMB 1L5GA 3FB6A 2R0LH 4BWTA 4KY1L 3KPNB 1FBIL 3VFNB 2X4UB 3O2VH 3NP4A 4TQ8A 5DZPA 5LQBH 3AQXA 2PW2A 2R0KH 3NUKA 1PKOA 3PE9A 3FCTB 4PJEE 4PCKA 5D7HA 5DMKA 1ND0A 1EXUA 3QZOA 2WQXA 3GS0A 4XAKD 5T1MB 1D9KB 2XCMC 4X6CA 1K6QL 1E4KC 4ERSL 1YEKL 4Z76B 1CT8B 1U6AH 2CUHA 1BXUA 3KBHE 4KZCA 4ZAKB 4A7GA 3MBWB 4ZNEE 2HX8A 1R5VB 2GYSA 2ICWB 1OAUH 3AG3B 1OP9A 1KGJA 2G3NA 1I1AB 1OPOA 4QWWC 1NZRA 2EE3A 3ZTJH 1E5AA 5C08B 4CN1A 1U3NA 2ZOKB 2ZWKA 3PHSA 4LQ1A 1T89C 3LNIA 3CN1A 2VDML 1G7LB 1YYLL 3T4YB 1TVBA 3S35L 5IKCB 2FQFA 1ADQH 2IC2A 1HU8A 2EP6A 1FFNA 1YAZA 3MUY1 3DRQA 3BW9A 2LT9A 5E1AB 4QXUL 3FO0H 2X9ZA 4ZUUA 3VFWA 5GGVH 4APXA 2YQ3A 2FJUB 3CDGA 5AB0A 1MFBL 3CX5J 4UQEA 1C5CH 3LZQA 4E9LA 5CN2A 5A40E 3O3BA 4KNSA 3I6LE 4M7JH 5PCYA 5F96H 4CVUA 4IBYA 3CDYA 4MCZA 2OMVB 4TN9A 3RDJA 2IV8A 3VFPA 3VH8G 1C8QA 4YEEA 3LJ3A 4MDRA 4Y4KB 3RWGB 4P9ML 5D2NB 2FATH 35C8H 2BIQA 4Y19A 4JKPL 3ULUE 3L5JA 1LEIB 4ZW5A 1F6AB 1TYEB 2EZ0C 3V0JA 3IGUA 3I3EA 2XYCA 5KJ4A 4N0FA 3BP7B 3IJSB 3QC5X 3VXRE 4QJ4B 4UM8A 4KHXH 3IKCB 1A5FL 5I74C 2ZKHL 1FL3A 3RIFF 4G9FB 3TWCL 1GAFH 3LIUA 1I1YB 5EUOB 5E00A 1NBYB 2IV9A 5C0EA 1L9MA 4GRWE 3O41A 5DZJA 1KBBA 1TTCA 1Q90A 1BD2E 1OK8A 2DEYX 1N0LA 5EA0H 1DSFL 4PJ7F 1OWRM 2DYRB 3H3PH 4MMXA 2EYTA 5LAXA 2I07A 2UWEB 2YLKA 4UV7L 1F5WA 4KHTH 5FOBA 5BQ7B 4NLHA 4UI2A 3QJHB 4YHYC 2H7WA 1YPZF 3EIFA 4XNXL 1P69B 2J7LA 4MA3A 1V7ML 2EEXA 4J3OC 4C58B 4OV6F 3GZOA 5I1EH 2P5EE 4UT6A 3GSNA 4H5SB 5EA0L 3APMA 3ARSA 2WVSA 4I3SH 3VE0B 2G9HB 3ZTNH 5FW8A 3FW6A 1NCWH 5T33L 3FT1A 2V2TB 2AK4B 5GGRA 4M6ML 3QJZA 4F7PB 3KLDA 4Z7OE 3ES6A 2JKNA 1A7BA 1X7QB 2V5SA 2X6BA 3M8OH 2X2YA 4Z0BH 1HQRB 2R69A 3SCMA 4F57L 3SB3A 4XCYA 3WKNA 5EU5A 3WHXB 2G75A 4GBXC 4PP1D 5IHZA 4HS8L 3MN8A 4FABH 1SQ2N 2AEPH 3K74B 4WI3A 4OB5H 1IKFL 1BJ1H 3NSFA 3TL5A 5CD5C 2ICES 3T2NH 2ITCA 4PJDB 3OB0K 1YC8A 4EBQH 4AKPA 3KPQA 4GFTB 1F2QA 1EZVX 5DO2C 1F8TL 5AYTA 4OF7A 4KFZC 4UF7C 3AGWA 2EQDA 3F64A 43CAB 4EZLA 1JFQH 1KLFB 2JKJA 5JPMB 4X8JB 2WW8A 3HZVA 3LH2H 3LKPA 1G84A 3DECA 1BQHB 1M3IA 1ACYH 3ATDA 4HS6B 4AKOA 4HLZG 3B5GA 4JFFE 5DK3A 1UA3A 1CDUA 4I0PA 4ORGB 3LRSB 4GSQA 3ARUA 4ONHB 1F1DA 2IFFH 5CGMA 2IPUG 4XXWC 3G5ZB 2RB8A 1UASA 4LLWB 2D31B 2CHWA 4Z1PA 3ECUA 5DRXA 4P2RB 3B1UA 2ENYA 2DZEA 1U8LB 2QBWA 4ABVA 4I77H 5FO8B 4UQCA 4BK8A 4QLWA 1NBCA 2IBGA 3GTVA 3ARBD 1NCHA 4DP0X 4HQQL 4PIRF 5EU7E 3VU2A 5E2UL 2NZ9C 1A9EA 3DSFH 3B2VL 3IGKA 1AG0A 5T5FL 4BFKA 3OKOB 1JNNL 1S8DA 3I75B 3PJSA 4HEMA 2LE9A 4PJ9B 5DEGA 2A6KA 4TV3A 4U1KA 1JZ3A 4DKEL 3GC3A 4ODXA 2BSRA 2FCBA 3BH8A 1SDDB 3H42H 4AWJC 3L48A 2BFVH 3VRLE 4XCNA 1LMKA 1ZAGA 4ANXA 5HGHB 1WEJL 4MYWB 3DO7B 5CCJA 4A7TA 4K3DL 4ADJA 4HZLA 1A6UH 2OYPA 1XGPA 5LUMA 1UADC 4X99A 1Y7VA 1PDKB 2ZKYA 2IH1A 4GG6A 1BQSA 3IAPA 5MEND 3PWLA 1U91A 4PRHD 1CXLA 3W2DH 1FL6A 3SDXE 1C1EL 2VKWA 4R2GC 3L4VA 4G6FD 1ITBB 4HP5A 3ZIYA 1JNJA 1SYSA 3GHEL 4M6OH 4QXUH 4QY8A 5JW5B 5AW4B 1HSBA 3K81A 1E3XA 4B3VA 3P0YH 4PWIA 4BQ9A 5L2JB 5JORB 1ZKAA 4J6IA 4HJ0D 1W91A 5AOIA 4FFWD 4XBPB 3CVDA 5IEKA 1P2CA 2I5YH 2R2EB 3FT3B 3VXUA 1X5ZA 5D70H 3B7UX 3PREA 5D1QA 2MQ0A 1AIFA 2AABL 1PPIA 1OE3A 3U6RA 1IV8A 2H6OA 1QHQA 2NPLX 2NY3D 2AKRA 1GHFL 1OKEA 2XQYA 4ATWA 6PCYA 8FABB 1YEGL 4AJ0A 4RIRA 4AEEA 4F91B 2Z4QA 3GRGA 1X5FA 2EDEA 4XVTH 2Z31A 3RWDA 5FO9B 4JFDA 1FYTA 3BKML 1WFIA 2E8YA 1A7PH 2QADC 3TT3L 4HWBA 3GF8A 2ATAA 4QRUB 5AW2B 2JKLA 2AC0A 2VDNH 5B1BB 3WE6A 3M7OA 4JRYD 3ZT5A 5A1AA 3QK0A 3FCGA 3PQYD 1EJ6A 4GO8A 2YAHA 3GIZH 3QR0A 1EX0A 4WGVB 2WMPA 1IAKB 4JM2A 4XXCC 1I3RA 4RAVB 3CFIC 4ALAC 1TTAA 1RH8A 4WI7A 3IRPX 1MJJA 4QXGL 1UATA 4OAWB 2JLLA 2A6DA 3RWHA 3CGTA 2W80C 3OJDA 1SJEB 2E9WA 3N06B 5K9JH 1WFTA 2IGLA 1S2EA 3MRFA 3RI5F 1BYNA 3F7RA 3BLKA 1KG0B 5KBMA 2ZNXA 3LY6A 2DIEA 4NSKB 4OSUH 5HDBE 4APQD 3LEYL 5C0BB 3FRUB 1H5BC 3IJ8A 4FQXD 3ZTNL 1ZGLA 1DLHA 2YK1L 3BE1H 3LNGA 1BFVH 2VLRA 1NCTA 2NX5A 4KVPA 3HRZC 3SGKC 2PCFA 3DMMC 3E8UL 1TQTA 4FXLA 4F15C 3TEUA 1N7ML 1AZBA 4RGOL 2XV0A 4FXGB 3DXAA 1IC4L 3GPEA 1NICA 1RUPL 2DLIA 2ZXQA 3QAQA 5D96C 3OLGA 1SEQH 4DP6X 1M1XA 4TL5A 2Z7YA 5T1LA 3KDPB 4RISH 4ZFZA 2R0LL 4QHPA 4HDIA 1RJYB 4UQ2B 1T0NA 4CL7A 2X1WL 2VDRH 1SXBA 3R18A 4E42A 2WJ5A 4JQVA 4C47A 4IBQA 4LHUB 3VXSA 1YEFH 3FSZA 5DD6A 5GGSY 3FTXA 1BBDH 1BJ8A 1YEEH 2PXYA 5I6LA 2F54E 3CMGA 2FB4L 3DROB 3DWTA 2R1XA 1VENA 3BPCA 5C0DA 4YHKL 3PUCA 4NNXB 2TRHA 1FYTE 3M1OA 2WXOA 4BYHA 4X42A 3KLSA 1KLUA 1VEOA 4HEPG 5I71B 3TWCH 1RHHB 3VMNA 1CG9A 3V55A 1KGCE 3CSYB 2I32A 3NFSH 2EDTA 2WLIA 3B6SB 3HKZA 5D1ZD 4MRBA 2E7DA 3GTTA 2ZUSA 4PJBA 4XTRD 5D1XB 4QHLB 5HDBB 1MN4A 1OB1B 3SHSA 1A4CA 1RLBA 1U8IA 4Y4FA 4M29A 5B1JA 4AUYA 5JIPA 3U7WH 1INDH 1OGTB 3AAZB 3VNZA 4M3JA 5FECA 4JHAH 1KMGA 4FQ1L 4XX5A 4FLQA 4I2XE 3UGXA 4OLUH 3GSVA 5A16B 4HIEA 4A6YA 1UJ3C 2IGTA 3GJFB 3PF2A 3UIYA 2AVGA 1XCQB 1ZHBB 3CHRA 3D3VE 4GLRI 1IBBA 1MW2A 5BRQA 4G6KL 4OLWL 1ZA3A 3TN0D 4XX1G 2FYYB 3T3PE 3O45A 4X7DC 5FF6A 3GMOA 3UYPA 5K59E 2IPKA 4PTUB 5IBUB 1YNTB 4KO7A 3AG1B 3FQ4A 3CV5A 4JO2H 1LO3H 2CIIB 3P9LA 5F7KC 3WEXB 5J89A 1NGYB 1U8CA 2DLTA 3PHOB 4BRVA 4UTAH 2VRKA 4HS8H 2NW2A 3SCMD 3N0AA 1YUHA 1XGTB 3H54A 4IJTA 4MLIA 3ZW3A 5GGSB 3LHPH 3AY2A 3K7UA 1A6UL 1I7ZB 3SKNA 3UC0H 4AQAA 4X9FA 2Q6WA 1SQMA 4WW1A 5EU4A 4FXTA 5H2BA 3TESA 1D5ZA 1Z2KA 2WNGA 1AANA 4GI8A 4XO5A 3T1FB 5LBSL 2YKKA 2K78A 4Z7WA 2WWMC 4HBCL 5D7IE 4UT6H 5DD5L 5D8JH 3TNNB 4BD4A 5KSBE 1Z3RA 3ARDC 1O6SA 4LSSL 3QIUB 3L3KB 1MVYA 1ZEAL 2VDLL 2OMNA 1X5IA 5BRPA 4TPRL 1BQKA 4G8IB 2O6CA 1DSFH 3X13B 1ZV5A 2FL5B 4F33A 4UB0H 1Q9LA 3QZWG 3KWUA 1BM7A 2QVKA 4PRBA 2R2CA 2IAND 5DGQA