1PG7H

Murine 6a6 fab in complex with humanized anti-tissue factor d3h44 fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
213
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFNIKEYYMHWVRQAPGKGLEWVGLIDPEQGNTIYDPKFQDRATISADNSKNTAYLQMNSLRAEDTAVYYCARDTAAYFDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords humanized antibody D3H44
publication title Structural insight into how an anti-idiotypic antibody against D3H44 (anti-tissue factor antibody) restores normal coagulation.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 213
sequence length 217
chains with identical sequence I
ec nomenclature
pdb deposition date 2003-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pg7H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1pg7H01
1FNGB 2AERT 1EUUA 1AR2A 2DQIH 2HVKB 1RVFL 3P3YA 1R3LB 1I8LA 1NLDH 1R0AL 1E4KA 3HPLA 1J0IA 4CNIA 5C0AA 4U0RB 4LSPH 2RGSA 5DJ6A 1WT5A 4FQLH 4GAYA 4PJGA 3VCLA 2IMNA 4HWBA 2HFEB 5HYIA 3ARPA 1ONQA 1YEGL 2NY5L 4J6RH 3RTQD 4I3SH 3C8KB 5E2VL 3DI2B 1YY9D 4HXAL 3BESR 3VFWB 4TNVF 5SWSB 4GAJH 1X5LA 3MJ7A 1XIWB 3RL2B 1KTKE 4HFUH 1J1XL 5MEPB 3RDTA 4U0QB 5GGRA 4FTVE 1K4CA 3WUWB 4XPTL 3V2AR 3MV7B 2X9WA 1CDCA 2Q86A 25C8L 5JLZA 4RMVA 4J3VA 1SHMA 2GSGB 2AJXH 5C0EA 3HI1B 1MREL 5FM8A 3O3EB 1GGYA 2UYLB 2EDFA 4PGZA 1A1NB 2GK0B 4TSBH 32C2A 3PABA 2HT4C 3CDYA 2BNUB 1XF3B 3BXNB 4NUGH 3ZT5A 1VEOA 3HE7C 3I2CL 4I4WB 1HHHB 2HFFB 4KTDH 3S35X 1IZJA 2J4WL 1KIQB 5DJAA 1MCFA 5FK9B 5GSVA 1AY1L 2VDNL 1OQOA 3AU1A 4N5ED 2F8XC 3LVEA 3RI5F 1P1ZA 2HTLC 4P46B 1Q0XL 2EYTB 4QRTB 3VG0L 4HEME 3VFSA 2NZ9C 5B22A 1BM3H 2CD0A 4PLJC 2H6PB 3U0WL 3MJ9H 5ESVB 1YEJH 1LNUB 3QRGH 4JFEA 3ILQD 3NCEB 3GIZH 3PWPB 2EIDA 5C92A 5D2NA 3VFOB 2OK0L 2A83B 4JRXD 5JNYB 2BMKA 5I1EL 3WIFB 4G8IB 4PY8I 1BOGA 4PRPE 1CZ8L 1EAPA 3HG1A 2CMRL 4UT9L 5HHMD 1QOKA 2UWEF 5EO1A 4KV5F 1V7NL 12E8H 1SYSA 1Q72H 3U30B 4YBLC 2B5IC 3TZVA 4FQQA 3LQZA 4ISVA 3QDJA 4WW2C 5DJCB 5FUCE 4LSQH 1DLHB 3CD4A 4KKLC 1BFVL 4M1GH 3FQTB 3ZKNC 1RUMH 2DQHL 5FF6A 3WDJA 5IB1B 1F58H 2EIEA 1UQSB 4WFED 4XPFH 4GRWE 1PSKH 2XNAB 4PTUB 4LDOB 1R5VA 3BRFA 4OQ1A 2ZUUA 1NEZA 4PV9A 2J5LB 3GMQB 4KI1A 2AJZA 1AD0B 4MD0B 3V6BR 4F7CB 3ULSB 5J11B 1RZFH 3ROOA 1MCDA 2VNCA 4CVXA 1FDLL 3HC0B 4PD4J 4G6MH 5IBLC 3BHBA 3VGAB 4X4YA 4NQCA 1RAMA 1Z9LA 3UJTH 3RWIB 4ZPTB 3TT3L 2IFFH 4LPTA 1NGQH 5HSFA 2ZG3A 1RSFA 2YR3A 4JFPB 3CC5B 4KRPC 4X9BA 1F13A 3J8F7 4DKFL 1D7FA 3MBXH 5TF1H 3CSYA 2B1HL 4L8SC 3WIHL 3TPKA 1U8NB 3VD3A 5C0BE 4GG6B 3KLDA 5CHNA 2NXZC 4G6FB 2WBWB 3G9VA 3F62A 1T0NB 3IETA 4EUPA 4I0PA 3U9PH 3IKCB 1EO7A 1K5NA 1JHTB 2EE6A 3WE6B 2H2PD 3VGGA 4LNRB 4FFWD 1U8HB 4ZFZA 3TH3T 2PO6B 2DLGA 1B4JH 4AEIL 5IFJB 5FKPB 5GRVK 4OLYH 3HI5L 3MRQB 4KK6D 4ZO6A 4X4ME 1MUJB 3H6JA 3WD5L 3SDCB 1YY9C 1QA9B 1HIMH 5D7LA 2WUBH 3MJGX 1FNAA 1R3KB 1YJDC 1CK0L 1R5IA 4WU5A 4P2RE 3LKPA 2YZ8A 3CFDB 2OR9L 1V3KA 4PRAA 4K2UH 3ZKXC 1XR8A 2R69H 1X5KA 4MLSA 4HPOL 5I75B 1RZGB 2F54E 3OSKA 4DKDC 5I1AB 1ZVSA 2FGZA 5CIPB 1VKXA 3P77B 2EKJA 2FH8A 3GO1H 5CLTA 7FABL 3NTCL 1OAKL 3O6LH 4WY7H 2J88H 5SV4A 1IMHC 2LV4A 4F80A 1DCLA 2ESVD 3CMOH 4Q2ZB 1HCVA 2LVCA 4BUHA 2DQIL 3RVWC 3H9SB 5EULV 4JFOA 1MFNA 1NLDL 1LO0H 4TTDC 1UACH 4XVTH 3TF7C 1VSCA 3WL9B 1JWUB 4MNGB 5I66B 4M4RA 1MCBA 3EHBD 4LSPL 5CJQH 5MERA 1PEWA 3U83A 3VWJD 5T3ZE 3BZFA 2UZYB 2V9TA 2X42A 4MZ2A 3DVGA 3EO0A 3E0GA 4FQLL 3GSWA 1XF2A 2XT1B 3GSUA 4BM7A 1INEH 5AEAA 4WUUD 1IGFH 5L2JB 1NCNA 2ENSA 4J6RL 3UTZB 4I3SL 4YGAB 5D7JC 4XMPH 3OB0K 4GAJL 4HFUL 4JLRA 3RL1B 2BNQD 4K55A 1VFMA 4EI5D 2D0GA 5L8LB 4WO4C 3TBWA 1UA6H 3JVGC 1S7XB 4ERSH 5HYJE 2AJXL 3ARFA 3DYMA 3UBXA 1YEHH 4X99B 3SOBH 3MOAH 2B0SH 4PRIB 5L2KB 3S4SG 1UC6A 3E2HB 4TYUA 5T3ZH 3MBEA 4NQXA 4WHCA 4CVWA 1LE5B 4TSBL 5KN5B 1S7UA 4CN4A 4NUJA 4C4KO 1GOHA 3SKUD 5IT2H 4U1MB 4YHPA 4NUGL 1HNFA 3E3QE 1I3UA 3L95B 4KTDL 5C0JA 2Z31A 1D5BB 3HZYB 1P4LB 3W0WE 2OZ4H 3LY6A 4Y19D 3QA3B 1BM3L 4N9GA 4L9LA 3AS0A 2RAMA 3RWCB 5CEZE 4ZFFB 1QSEB 3QXWA 3MJ9L 1YEJL 1OP9A 5IVXA 4NGHH 3QRGL 1KPRA 4OLWH 3HE6A 3GIZL 3S34H 4B50A 1BZ7B 3OWEA 4PV8A 3ARTA 3RVTC 4GRWF 3ES6B 3L3JA 1BF8A 1U58B 5A2LH 1OT1A 3QEQB 1CIDA 4LCIH 3E1F1 4PJIB 3BAEH 3D6GA 5D1QB 2PCPB 12E8L 1Q72L 2E9WA 4Z18A 2X6MA 1UJ3A 2X4RA 3RPKA 5JXEA 3B9KD 3QIBC 3EYQD 3NFNB 5DJDB 3GB7A 4HUWB 1UWEH 3B8SA 1IGCH 3ORJA 5GZOC 2HN7A 4LSQL 1XGRA 5C7XH 3H3PH 4M1GL 1BX2B 1ADQA 4M8QB 3RNKB 3D85A 5CJOH 1RUML 3LDBC 2FLRT 1F58L 1I1YB 2D31A 2Z8WC 2ARJA 5F1IA 5F8QC 5I6XB 3HUJE 4KK6C 3VFNB 4XPFL 4HUVB 1PSKL 4P5TC 1MQKH 1N5AA 3CMGA 4L8DA 4UQ2A 2NW2B 1SMOA 5CD3A 3D0VA 1IEAA 2XTLA 3F5WB 3EYFA 5K93A 3L3DB 3UPRB 1NC4D 1RZFL 1CT8B 1F5WA 2N4IA 5MEOA 1B3JA 5A3ID 3OJVC 4M1CD 3QDGE 2VLKA 4G6ML 1FRGH 1OGAE 4C4KT 4EKXA 2L7JA 5J3HD 3VXOB 4CU6A 4WHDA 1T83C 2AJSH 5GGTH 3O6FD 4NP4H 3OKEB 3UJTL 2IFFL 3B6SA 1NGQL 4H0GA 4LCUB 5DT1H 5DUBB 5EUOB 2FJHA 1M05B 5FB8B 5IIEA 4KY1H 1M7DB 3MBXL 3GJFH 4DTGH 3QQ4A 5TF1L 5B8CB 2FNBA 3G6AA 1DR9A 3DROB 1A6ZB 1K4DB 3OG6B 4YWGH 1BPVA 1IAIH 4D8PA 1S7RA 4R0LA 5F7HA 1DUYB 2GAZB 5H2BA 5JMRA 3VDBA 4L8CA 5IEHA 4PJ9D 5C0CD 1ZEAH 4ZO8A 3QZWA 1G9EA 3U9PL 1K6QH 3UX9B 1KEMH 2KPNA 1NJ9B 1NQBA 1HQ4B 5LAXB 4OLYL 3WHXB 1PKQB 3KHOA 1DTUA 4WWKB 4BQ9A 1VHPA 4YHIA 3U9UA 1RJZA 1HIML 5DEFA 1DBJH 3MYJA 2WUBL 1XIWC 5EA0H 4LLMB 1LP9A 1I8MA 4KDVA 4M8VA 3X13B 1FORH 2WBJB 1DN0A 1G7MA 4JY6B 4AY0A 2VDQH 4K2UL 3U4BH 1YN7A 2R69L 3O4LD 5E56A 3UTTA 4ZSOE 4E41A 1OVZA 3BIKA 2WWMC 3V5KB 3EYUH 1U36A 2JJSC 3GO1L 3KNBB 3BQUA 2A6JA 4QRQA 5T5NG 2R8SH 4CADA 3TYGH 3O6LL 4WY7L 4ZQKB 2J88L 3MRJB 3U4AA 2BVUA 1NUFA 3CMOL 2GT9B 4JM4H 4MSWB 3EBAA 4F7MA 2OLDA 2LAGB 3C6SA 3I02B 4X83A 1JUFA 1LO0L 5E1HB 1NFDE 1UACL 4XVTL 3S36H 1DBMH 1VADA 4X6FB 4Y4HB 3VXUA 5E4EB 3TBYA 3T0AA 1QFOA 4LPYA 5CJQL 5FM5M 4C56B 4X8JA 1QPPA 5EBMA 3BPLC 3D69A 3QUZD 3VI4E 5E9DA 2WINA 2EC9U 4MNQE 4GLRH 1IQWH 1KJ2B 2NTFB 3NCBB 2G2RA 3ME0A 1INEL 3FQRA 5I8EA 1IGFL 4OAWB 4U6YB 1TMCB 4ZFGH 4QGYA 2EKSA 1D3CA 4XMPL 2W0KA 3I6GA 2EEAA 1U8QA 4PJEA 4Y1AA 3TCXA 3PGCB 1Q38A 5JW4N 2H3NA 3O9WD 4LU5H 4PLOB 3VFGH 5TFSH 2DIBA 3U30C 3VXPB 1UA6L 4ERSL 5JPNB 1YEHL 4XP5H 3TWCH 3SOBL 3MOAL 2B0SL 3LKSB 1ZHBA 4F9PA 5T3ZL 3DOSA 4PJ5D 3MV8D 1SY6H 4IRSC 5IT2L 3SHSA 1T5WA 5J6GB 4U1LA 5DHVH 3QNZA 2E27H 4WIQA 1DVFB 3BPOB 1NANI 4JAMB 2OZ4L 2QLVB 2WWKT 4LEOB 1D5IH 5BVJB 5T3XD 1QKZH 1RZ8B 3T0EA 4PS4H 4X8XA 4NGHL 5J6HA 3UO1H 2Y1VA 1XGPA 2Z93A 4WEUD 3S34L 5DEGB 1HN1A 1S7SB 2ZUYA 3ULVD 3HUJF 3O6FC 3OAYK 3QUYC 5HPMA 4Y4FA 4Y5YC 5ESAB 1IVLA 5E70A 4ELME 4LCIL 2PTTB 2ZKHH 3BAEL 1H5BC 2H9GB 1ZLWK 2ATKA 4JFDB 2PTUA 3HKFA 4ODSH 1F11B 4PJ8A 1N2RA 3KPPA 1TNMA 3ARWA 2W60B 3ILPA 1EDQA 4CRPA 1YMMB 4OF5A 1UWEL 4K7PX 5K9OA 1IGCL 1KJVA 1VCAA 3GMPB 4BH7A 4G7VH 5C7XL 3H3PL 4LP5A 1FC2D 4MWFB 2HP4A 3BEVB 1O7VA 5CJOL 2G5RA 3SDDD 5HXMA 3B3IA 3MRCA 1QLFA 1QYGH 4OGZA 2VWEE 3R8QA 1ZGLA 4GRMB 1MQKL 3IU3A 4XNQA 1NGYA 5CGYD 2APFA 1FIGH 5M7QA 2ZOKB 2F5AH 2NQCA 1FGNH 2CLRB 3GFUA 3QQ3A 3RWJA 1JGLH 1YMHB 5C0GB 3TC9A 5GRYA 4RA0C 1FRGL 2R0KH 5F7LB 5SWSE 3DGGA 1I7ZA 2AJSL 5GGTL 4YEEA 4NP4L 2OSLA 5DT1L 3SN6N 5IJKC 4KY1L 1MCWW 3CDCA 3MV7E 3NVQA 4OV5A 3W9EB 4POUB 4WTZG 4PYHA 4DTGL 3UTSD 1CTOA 2AJ3B 43C9B 2DMBA 1FFRA 2FL5A 3QDMA 2NXYD 2NMSA 4ZOEA 5DJ0B 4APQA 5EWIH 4YWGL 4Z0XB 1IAIL 4MLIA 5IQ9A 1LD9B 1RU9H 3QUZC 2AEPH 1QRND 1ZEAL 2ILLA 3NH7H 4EIGB 1A7NH 4RGNB 1M6OB 3CZJA 1K6QL 3DRTB 1KEML 1KCRH 2IAND 4V1DD 4UOJA 2Q87A 1QQDB 3SGKA 5J89A 3MGOB 5F89A 1ZT7B 5C09D 3GGWB 1DBJL 4LF3A 4J23A 5DK2B 1NFDF 2NY3B 2DM4A 5EA0L 2FEDC 3WNLA 4CKVX 2EEBA 4RSVA 5LGKA 1FORL 3RWEB 1OSZA 3PWPE 1R24B 1MCQA 2ZOLA 3REVA 2VDQL 3VI4F 2HYMA 3U4BL 4JKWA 3QULB 2YPLA 3O41B 1INQA 1G7HB 4KDTC 5I16B 4KAQH 1NGXA 1TZIA 3EYUL 2CPCA 5L8JB 2FJFA 4LBEB 5BRZA 5FO8A 5B4MD 2R8SL 3ALPA 5D7KE 3TYGL 4YDJB 4HIJB 5C3TA 1RHHA 5F6IC 4JKMA 4JM4L 1ZTXH 4XNMB 3DUUA 5F9JA 1I1AA 4JZOB 4WI6A 5MENA 2ATPB 3S36L 5HHPA 2M1KA 5DFVC 1XH3B 3QIWB 3BDXA 1CICD 2BOCA 2CR6A 4OF8A 2DQFA 1IQWL 4H26A 2AAVA 2DKMA 4NQSB 4P57B 4GKZA 4ZFGL 2AXFA 3MRHB 1MELA 5LG1A 5ALCH 1LQSR 4LU5L 3VFGL 3LPGA 5TFSL 4WVRA 2EE3A 3JWOH 2PW1B 3SCMA 4OB5H 3MXVH 1XF4A 3RIAK 5IMKB 4XP5L 3TWCL 1I7UB 1J9CT 3MNVB 3DX8A 4NO3B 1MCJA 2FECI 4FG6C 4ELMF 1SY6L 5I6XC 3QFJD 5F88A 4YHYC 4GG6E 5I74C 1N5YH 1P5VA 5FGBA 2E27L 4X4XB 5CGYC 5DRNA 1JK8A 1U8LB 4TVPE 4K8RC 1F00I 3C5ZB 4YXLH 3VMNA 1D5IL 5CBEA 3O2WH 3FRUA 5F1KC 1QKZL 5F9WC 4NCDA 5BXFB 2Q76B 1OD7A 4PS4L 2E7LC 4XT1C 2WNGA 1AC0A 4PY7B 2KQMA 3MV9B 3UO1L 1FNSH 2WSKA 4NSKB 3IDUA 3KPMA 3WIHA 1MVFA 3PGDB 3S3PA 1U8KA 1LVEA 1S7WA 1JYNA 3TVMB 2ZKHL 1MI5D 1IC5H 4HIIB 1NEZG 1QLRB 2UWEA 4GFTB 4M6AA 2NR6C 2NXYC 4ODSL 4QRSB 3RGVB 5E7BA 3BEWA 3QBTB 3TESA 3VFUB 2ADIA 4XH2B 3VGEA 1BVKA 1A64A 4P23A 4G7VL 4L8BA 4R2GD 2Z8RA 4JJHA 3H9SE 5FGCB 4Y2DB 5TE4H 2WAHA 1QYGL 4Z5RA 3TFKC 2Z35B 4MNGE 2FBJL 1NGZA 5HHOA 4DZ8B 4F9LC 1D6VH 1WIPA 1FIGL 1TQCB 4IRJD 1ULVA 4MAYA 4MDIB 3UTPD 5DO2C 4LRNH 2F5AL 4HFWB 4ODUA 3LPFA 1FGNL 4NKDA 5GSRA 5EU5A 2K7QA 1CDUA 3LB6C 1JGLL 4M48H 4DK3A 1Q9LA 4G8GA 4EDXB 2ZSVB 1AHWA 4EUPG 1ZA3B 1QBAA 4OZFH 2IADA 3QUMH 2R0KL 4OF0A 3TIEA 1TVHB 3CDGB 3MLUH 3P30H 4UOW0 3VXTA 1F3RB 2P46B 3I6LD 1OTUD 5C08D 3NCFB 3BGAA 5EWIL 5GRWA 4PRIE 5L2KE 4AG4H 3IDXH 5E4EC 3MREB 1RU9L 4XVUD 3VRLE 2AEPL 1CICC 3L5WB 3NH7L 1A7NL 3OKLA 2PXYA 2YMXH 2H26B 1G7JB 5GGSB 5HGAB 1C7SA 4Z7UB 1KCRL 3RVVD 1UXWB 3MLZH 1NC2A 1I3GH 4X6EA 5TDOA 2NCMA 4XPGH 5KW9H 2VABB 4NZRH 5ESQA 2CKBA 1VFBB 2NNAB 2X4OB 4RMTA 4UUJB 4GRLD 3DVNA 3ALWA 1FL3B 5TGBB 2OMNA 5DA4A 5B38B 5KAQF 1KXVC 1L9NA 2IQ9H 1QSEE 2CGRH 2NX5B 5IFAH 4U05A 2DIAA 1C5DA 2RCSH 5A2FA 4P2QB 1B4RA 4NNXB 1TZHA 1G0DA 3QEQE 1E27B 5I1CH 4KAQL 3TP4A 4NPYA 3IFPB 4PJIE 4X7TA 5GQBA 3FONA 3TO2A 2ZUTA 2F5BH 3FQUB 1I1FA 4K3GA 4RQQB 1I7TA 1RJLB 4U3XA 3AS3A 4CVUA 4FTVA 1ZTXL 2PKDA 3MJ9A 1QEWA 3TA3C 1S78D 5HVWA 3LEXA 5I0ZA 3SQOH 2G60H 1IM9B 3EJYD 2DN7A 4IHOB 3UBXG 3R1GH 2IALA 3LKRB 1MCKA 4N0CC 5CEXA 1K8IB 1X5FA 3K4DA 3FOMB 4GG6F 3NIDE 3BWUC 4ZMAT 2VLRA 1KIPA 4HWNA 5I1LB 4LRIA 3KYNA 3FQXA 2Y7QB 1G7IB 4DUXA 1S5HA 4JJ5B 4UDUB 1HH9A 3OAUH 5EFIA 1ZSDA 3L6FB 4H8WC 5ALCL 2JB5H 4QF1B 4JHZA 5H94B 3GMMB 5ELIA 4KMTH 4LLVB 3JWOL 2EH8H 1WQVT 2IBZY 4OB5L 5EUOE 3MXVL 4KI5E 4CMMB 1MAMH 1S9XB 2FATH 5IG7A 1HCFX 1OLZA 3PHOB 4NRXB 4LPVA 4YH6A 4AT6B 4FXGB 1G9NC 4G80A 4PRPA 3TPUA 1N5YL 1EEUA 2ZCHH 3BYTA 4ZDHA 4ZYKB 3IRPX 1DP0A 2NY1B 1WBYB 2K3TA 4YXLL 1NCWH 3SBWC 4ZAKB 3O2WL 1IE5A 5J1TC 3CCHA 1JI2A 3ARBB 4M02A 3U6RA 3VWKA 1PKQE 1H3TA 2MHAA 2RFXA 4HLZH 1FNSL 2YUXA 3MSPA 1W2KT 1SEQH 2QSCH 4P3DA 1CFNB 1CXEA 4GW4A 4PP1D 4L4TB 2IPTH 1D5XA 4NO0B 1IC5L 2YD9A 5JMOC 1OTUC 4NYLA 3DMMB 1ORQB 5K9QI 1CDYA 1JI1A 5IMMA 3EZJB 3QXDA 3PV6A 1WC7A 5E99H 3ZE0E 2FX8H 3GMOB 1CFVH 1ZA6A 5BS0A 4L3CB 2A6KB 4HC1H 2APBA 3KPRB 3IFOB 4RGNC 1I9RH 2BOBA 4FQXD 3RVVC 2R9HD 5TE4L 5L9DH 3MLVH 4LSSH 4ODWB 2JLLA 4F3FA 3IDYC 3T65A 3P0YH 2Y5TA 1U3HA 4LHQB 2P43B 4C56E 1AXTH 1W0WB 1D6VL 3AREA 4GRLC 4D0DA 3PE9A 1FO0B 4LRNL 4W4NA 2LQRA 1XEDA 3VRLF 4IOFD 2VIRB 1WIOA 4M48L 3U4EB 1MLBB 5DC0A 3L5HA 4LL9A 3QZWG 1ZGLP 4U6TA 5ENWB 3QUML 3SKNA 5DYOA 2OTPA 4MD4B 1RJYA 3MLUL 3P30L 1FL6A 4XXCC 1UM5H 4I77H 2VLJB 4U6XB 4YHLH 4P2RA 5MEQB 4FQHA 4OBSA 2MPAH 1S78C 3BGFB 1QG3A 4F37F 4HV8B 4WV1B 4AG4L 1L4IA 3IDXL 3AVEA 1NANH 3VWJB 2F54A 3HMXH 3QIWC 1E4WH 3EJYC 1XF1A 4PJIF 1MH5B 2JJWA 3AS1A 4OLXH 2YMXL 1IAOA 3UDWA 1YDPB 1IQDB 4WUUB 4MCZB 3MLZL 2FO4B 2R1XB 1I3GL 4XPGL 5KW9L 1KXTB 2W65B 3PIQA 3HHRB 4NZRL 2X4SA 4JQVA 3FO2A 4EI5B 5F21B 2IQ9L 5TDNA 3VFVB 3V79C 2CGRL 3VH8G 4A6YH 3N9GH 2HFTA 2YRPA 3SDXB 3BE1H 4HWEH 5IFAL 2RCSL 5DQJB 2HVJA 1UYWH 3X11B 3UJJH 4HIEA 1KTRL 4YGVA 3V6ZB 1BBJB 3X17A 3EDEA 5I1CL 3GMRB 2YD2A 3ULUC 1KIRA 4L9DA 1RURH 3NIDF 1TVBB 4JFDE 5HYSA 1KJMB 2F5BL 4JM2C 1M71A 1QD0A 2OZ4A 1J1OH 5K9KA 3ECBB 3T2OA 1FFQA 2XXCB 3MTRA 2AQ3A 3DV4B 5DXWA 3MRLB 3UC0H 5ERWB 1YMME 4NO5A 5CP7A 4Y19B 3C5ZC 4QRPD 3JBG7 5HYJA 5EUOF 4KI5F 4XNZB 3SQOL 2VO5A 2G60L 5CZXD 1RJCA 4LOUC 4PJCE 3V0VB 2VSDA 1NBYB 3EKCA 4DN4H 3R1GL 4QRUA 3HMWH 2E6PA 3WO4C 5HYQA 2R1YA 3FO9A 1MFEH 4PP1C 4JPIA 4Z78A 1BZQK 1EBPA 4ETQB 1OOAA 4XCCH 5I76A 3MRIB 3W0WA 1WCBB 3RNQB 3TN0A 3QRFM 3OAUL 4BSWA 1F3JB 3WBDA 3IT8D 2JB5L 2N7BA 2KBGA 1MCCA 2ICWA 1AGCA 3B9KB 1EEYB 1LK2B 4KMTL 3N1QC 4PGDB 2WLZA 4RAVB 2EH8L 1T1WA 1CD1A 2VZTA 3DETC 5DVKA 3MRPB 1G7LA 2FDBP 5FYJH 1MAML 1JNJA 3DX7A 2HMID 2FATL 1NKRA 1UKTA 4HUXA 4FQXC 2R9HC 4P4RB 1QR1B 2DWEA 1HHJB 4F7PA 2VITA 3ROLA 4MXVE 3W39A 2ZCHL 4QCIA 2DKSA 4CJ1A 1TQCC 4RWYH 5A16B 1T4KB 4JN2A 3S96B 3JUYA 3ZE0F 1Q9OA 1D9KB 4RGNE 1NCWL 3SDAD 1NC4B 4R4FH 3ZSSA 3KXFB 4P59H 3U7AA 3U0PB 3MRMA 4UBDD 4IOFC 5D2LB 4NNYB 4MS8C 3VA2C 5FV1L 1EMTH 4S1SH 3HUJA 1SEQL 1VB9A 2QSCL 3BZDA 3WHE0 5BW7A 3VG9B 5E6ID 4F7TA 3GNMH 2IPTL 4M43H 5KVFH 5I1HH 2OTWA 2G75A 4XWGH 4LCCA 5HHQB 3F7RA 3PWUA 5HJ3B 5E99L 2DYPA 3BGMA 4I5BB 1AO7D 4XVJH 4E0RB 4D9RD 2FX8L 4IIQB 4PJ9B 3PL6C 5C0CB 1CFVL 3QDGA 3TJEH 4P4KA 5LKNA 2V2TB 4HC1L 4U1NA 1I9RL 1MY5A 4KKNA 2X1PA 4PJXB 4H88H 4XC3H 3V0AC 3MLVL 5L9DL 3OZ9H 4LSSL 5INDA 5BZDA 5HVFB 1T1XB 1KACB 3P0YL 1AXTL 3C2SA 3IFNH 4PLNC 3WV0A 5CJXC 3U82B 3IDIB 1AGBA 3ARGC 5GISH 3HPLB 4MDJA 1ZGLM 5C0AB 5E00B 5F9OH 4X0KA 5I17A 4U49A 3GSOB 4HGKC 4WTXA 3TIDB 1AKJD 2C1OB 3K81A 2AABH 3FZUC 4GAYB 1IT9H 4PJGB 4ZUWA 5HY9B 4XVSH 2Y36H 2PN5A 4MA1B 4Y5VA 4Q97A 1UM5L 4I77L 3CFCH 4OD2A 5CWSB 4YHLL 4O02H 4Q58C 2MPAL 3C8DA 1FV1B 3MJ7B 1YYLH 4M9OA 5D7IB 3ULUE 1HOCB 5GGRB 3CZFA 4ZSOA 1DBBH 2VC2H 5F8RC 3HMXL 2UY6A 2YSSB 1E4WL 2BRRH 5HGBA 3T0BA 1AJ7H 2JJTA 4OLXL 4JFQA 2PETA 3H2WA 5IWLA 4UIKH 3EO1A 3V52H 5C0EB 4Q6YA 3U46B 4M61B 2W07A 4YDVB 4Y8AA 3KYAA 1A9BA 4WU7A 4AH2A 4XNYH 2VISA 4UIMB 4M5ZH 2GJ6D 1NFDA 4KJYA 1NAMB 1RUAH 3L7EA 4UV7H 4A6YL 2Q3ZA 4PGBA 1A3LH 3N9GL 2B4CC 4U2ZA 3BE1L 3LKQB 4HWEL 3MV9E 4NWTH 1HHGA 1UYWL 4PJCF 1SY6A 3UJJL 4MNQA 3FL7A 1MJJB 5DI8A 4LEXH 4RGOH 3V7MA 3S8WA 4PJ5B 4ODVH 3QJHA 4BK4A 4JFEB 1RURL 3MV8B 1Y18A 4LLQB 2FSEB 1J1OL 5L6YH 3W11D 4ELKB 4ZUVA 4Z76B 1J8KA 4FHBD 4O2EA 4G42B 3FHQA 1N8ZA 2QV2A 3UC0L 2P42B 3TO4D 2NY1C 1TTFA 5CEYB 1YNTA 1GOFA 3FQNB 2AK4A 3D18B 4O5LH 3HG1B 4FRWA 2X7LB 5FA3B 5HDBE 4ZAKC 5FGCE 4QRRD 3K8MA 2JIXA 3QIUD 1DE4B 3CXHK 1P7QA 2VDPH 3HLAA 5L0QC 1UH2A 4DN4L 5LVEA 3HMWL 4NQDD 3L3IA 1AP2B 3T3PE 1DLFH 2Q8BH 4JGJA 3T8XA 1L7IH 1S7QA 1MFEL 3VFTA 4MXVF 4NOFA 1XGQB 3MYZA 4XCCL 2XN9D 4PG9B 3SQBA 4J7RA 4GBXA 1YN6B 4BFIA 4JANA 2R0LH 5F7KC 4IJ3B 5INCB 2YK1H 4JKKA 1AC6A 3BUYA 1T21A 5D1XA 3LKOA 1XGYH 5FYJL 5C8JB 1QFUH 3SDDB 5B21A 4JDVA 4NN5C 4ELMA 1A7BA 5C0DA 3QI9D 4F57H 4XBGA 3VXMD 5E8EB 1IC1A 1NH6A 4LAQH 2LVEA 4X7EC 1OP5H 2GY7B 1XGTA 2GW5A 1CIUA 4RWYL 3CSYB 1F8TH 1M7XA 5IK3A 5E08H 4P3CH 1DSFH 1NGPH 2IBBA 4HIHB 2W38A 2VOTA 4R4FL 4Z7UE 4P59L 2Y07H 1AI1H 1FNGA 1YPZB 1RPQA 2BFVH 1EMTL 4S1SL 3ZLQC 3IETB 4EUPB 4I0PB 1JGEB 1FQ9C 2NX5E 4B5EA 3GNML 3O0RH 1O5DT 5E6ZA 2A0LD 3UTSB 4M43L 3P4OB 1E4JA 5KVFL 1A0QH 1T0PB 4P2QE 1FFPA 5EBWA 4XWGL 1U0QA 1OP3H 1PX4A 3BGFC 2NPLX 2HFEA 4WV1C 1OAUH 1I7RB 4XVJL 3MLTB 3C8KA 2EYSB 3TJEL 1VGKA 3I84A 3VFWA 1G6RH 3K4AA 1XR8B 4MJID 1AGDB 5MEPA 1ZVSB 4H88L 4XC3L 5C07D 4PGEB 3WUWA 1LE9A 3MV7A 3OZ9L 4HUUB 3S37X 5KOMC 4Z95H 4I3RH 1YJDH 2GSGA 3IFNL 3HI1A 2YA2A 3O3EA 5GISL 2NYYD 3ULUF 2NW3B 2GK0A 1FNFA 1T66D 2VR4A 2DWDB 1WITA 5F9OL 2BNUA 1XF3A 3H8NA 3BXNA 5KTEH 4HH9B 5AG8A 2ZG2A 4I4WA 3OL2A 1KIQA 2AABL 1EJ6A 5FK9A 1IT9L 3GSWB 4RFOH 4XVSL 2EDOA 2Y36L 3GSUB 5SX5H 4P46A 2EYTA 4KKBC 4QRTA 2FECL 1TITA 3CFCL 2H6PA 1JPSH 5DRWB 5ESVA 2WUCH 4O02L 1LNUA 1QBBA 2GSIB 4E42B 5CD5C 2Q20A 3FB5B 2IPUG 4MD5B 1YYLL 3PWPA 5E94B 3VFOA 4M3JA 1DBBL 3DWTA 2VSCA 2VC2L 2A83A 3IXTA 3SE3C 2BRRL 2NY0D 3WIFA 4G8IA 1AJ7L 2A2QT 4UIKL 3RPIB 3V52L 4ODTH 3WN5C 5E8NB 3QQ9C 4HJGB 4NQXB 1WGOA 4XNYL 3MQIA 3WDHA 1L0QA 4M5ZL 4M6OH 5EB9A 1CGVA 5DJCA 3FJTA 1DLHA 3OAZK 3RI5K 1RUAL 4UV7L 2Q7YB 3FQTA 1A3LL 4WWID 5HDBF 5IB1A 4HDIB 4NWTL 1YZZA 1UQSA 4JFZH 1LEIA 3RJQB 2XNAA 4PTUA 4N9GB 4L9LB 4LEXL 4RGOL 4L4TE 3T3PF 4ODVL 5TQ0H 3GMQA 3NIFE 3HE6B 4Z7WB 3WFCH 1PZ5A 1AD0A 4MD0A 5L6YL 3ULSA 1CGXA 1IKFH 1NPUA 5DGRA 5I9QC 5TDPB 3ZKSD 3HC0A 1W72H 2EE9A 4K3DH 2R29H 5SX4H 4O5LL 5C6PB 1D9KC 3KPRE 2XWTB 3RWIA 1OM3H 1P5UA 3ETBF 3WFBH 1HNGA 3D5OF 3CC5A 2DLEA 5DWUH 3C60D 3TCLA 2X4RB 4I18B 3PDGA 3STZB 1EA9C 2VDPL 3QDJD 4WHYH 4XAWH 2DLFH 1XGRB 1DLFL 2Q8BL 3HNVH 6CGTA 4GG6A 1L7IL 5FO9B 2LE9A 1FYHB 3D85B 4GG8B 3VG9C 3VFMB 4OZ4B 2A0LC 2XICA 1MI5B 3FAWA 4LFHD 1T0NA 2AQ1A 4D3CH 3IKCA 1A6WH 2YUWA 1JHTA 3WE6A 4G9DA 4IDJH 4Z7UF 4LNRA 1U8HA 5CD3B 2PO6A 5IFJA 1X7QB 2R0LL 3D0VB 1U8OB 1MJ7H 3MRQA 2YK1L 1MUJA 2VZ3A 4OT1H 1JFQH 5I18H 3SDCA 5KVEH 1QA9A 3FN0H 1XGYL 4ESKA 4HF5H 5MEOB 5JDSB 2VLJE 1R3KA 3QAZB 1MEXH 4R2GB 3FCTB 1QFUL 2GK2A 4EI6A 3H3KA 4YBHA 5DC4B 3V6OA 3WKMH 3CFDA 4NT6B 2VL4A 4NQCD 4S2SB 4F33B 4F57L 2LFGA 4YZFE 5IIEB 4LAQL 2G9HB 4RGMC 1RZGA 4IRJB 5I1AA 1F8TL 5CIPA 5E08L 3IF1A 4P3CL 4YPGB 3QUMA 1DSFL 1NGPL 1I8LC 5HHXH 3KAAA 1E4KC 1WAAE 3ELAT 4WUUE 2Y07L 4H1LB 2OJEA 2ZPKH 5CJ8A 3VGDA 3O3BB 1AI1L 4JEGB 2VAAB 5BV7H 3C87A 4GOSA 5H2BB 2BFVL 5JOPD 5IEHB 2JCCA 1WT5C 3H9SA 1T03H 5HI3D 5SV3A 1UWGH 3QZWB 2C7UB 5DK0B 2R56H 1HZHH 3OKMB 3QT2A 1GCFA 3WL9A 2E7CA 4S0SD 2B8OT 3O0RL 3SDXE 1A0QL 4KZDH 2EC9T 4YHIB 5J12C 2GYSA 5EUKB 5DEFB 2IBZX 2P5WA 3RZCB 1X5IA 3RDTC 3C2AH 1OAUL 2KUTA 4MB4A 2UY7A 3P4MA 4PGCA 1DN0B 4JDTH 4DVBB 1G6RL 1TNNA 3UTTB 3RL1A 4OTXH 1BD2D 4E41B 2DM3A 3AMLA 2F53B 2EDKA 1FNHA 2OYPA 4Y19E 4Z95L 1NMBH 3ABZA 1S7XA 2A6JB 2BSSB 4I3RL 4QRQB 1YJDL 3AGVA 4CN6A 1V3JA 4FXKB 1AE6H 4I48A 4PRIA 5L2KA 4X9GA 1LE5A 3BN9D 5IQ7H 5KN5A 4U1MA 5KTEL 3VI3E 1N6VA 1NCDH 3NGBB 4KVCH 1I8IB 3L95A 3HZYA 2YD6A 2BZDA 2EXYD 3V4VH 4RFOL 4R90H 4LVNC 5EOCH 3UJIH 3FQRB 5I8EB 5HPOA 5D2NC 3EDJA 3RWCA 1JPSL 1GXEA 1QSEA 2EKSB 2WUCL 1JGUH 2D7TH 2R2CA 4Y1AB 5FAAA 1ZLUH 3E6HB 1BZ7A 5ID0B 3ES6A 2FD6H 3PP3H 4PRNB 1E6JH 1U58A 4LP4A 5E0QA 2ZUWA 3QEQA 2NY4D 3TZVC 4PJIA 2NY2B 1PEZA 3NIFF 1OARH 3ARFD 1MWAB 3BVNB 4ODTL 3IS0X 5D1QA 5FYKD 4QOKB 2PCPA 5HYSG 3MBED 1JN6A 2XV6B 4KVNL 3NFNA 4J3OC 1JNHA 3AXLB 5DJDA 4DKAA 3TNMB 4HUWA 4M6OL 5IW1B 4XP6H 3WUZA 3KXFE 1C16B 5D2LE 4OCLC 5IB2A 2IEPA 4FZ8H 3RNKA 2R4RH 4RX4A 1I1YA 2OTUA 5CINH 2XOTA 3DSNA 1JGVH 1LEGB 2R2HA 1J8HB 3MA7A 3VFNA 4JFZL 4HUVA 4WUKH 5DD6B 2NW2A 5TQ0L 2LTQB 3CSPA 1CDGA 1MCLA 5IP4A 1A7OH 2Z93B 3WFCL 3MRGB 1CT8A 4U7KA 1IKFL 3MACH 4N0YH 5D8JH 5I8CA 3N0PB 3TBVB 5ANMB 1W72L 4WNQB 5C0CE 4EN3A 4K3DL 1ZLSH 3VXOA 2R29L 1OM3L 4LCUA 5FB8A 5DUBA 3WFBL 1M05A 3Q5OA 1M7DA 5DWUL 4HT1H 4B7LA 5KSVB 1CQYA 3H0TB 5B8CA 4P2OB 3QP3A 4XAWL 2DLFL 2BX5A 1FYTD 3DROA 4MMXC 4JG0H 1A6ZA 3GSNB 1K4DA 2CK0H 1UADC 5HHNB 4I0PC 1CN4A 1OAZH 3HNVL 4YDIH 4YZFF 4KHXH 4IM8A 1DUYA 3MRCB 2GAZA 3D3VA 5T5FH 4G3YH 1BOYA 4D3CL 1UVQB 1A6WL 1NJ9A 1WAAF 1QR4A 4IDJL 1HQ4A 3BFOA 3MODH 5ITBH 1MJ7L 1NCCH 3WHXA 1PKQA 1RQ5A 3L1OH 4OT1L 1JFQL 3KDMB 4WWKA 2O26U 5I18L 4BJLA 1PBYA 5KVEL 3FN0L 5MI0B 3VFPB 3OQ3B 4HF5L 1MEXL 4LLMA 2KDGA 5KSBB 2IAMB 3WKML 3SDXF 3TYFB 3X13A 2WBJA 4JY6A 5D93B 5D7IE 4XCNB 2OSLB 1WLHA 5HHVH 1A7PH 3E6FB 3T4YB 2X70B 2L4OA 3V5KA 1U3JA 3EOTH 1RIHH 3BN9C 3QDMB 5HHXL 3KNBA 4FFYH 1IGJB 2HTKC 4N9OB 4ZQKA 2ZPKL 3MRJA 4ZXBD 4ENEC 5BV7L 5IQ9B 1HSBB 2GT9A 5C9JB 4MSWA 4UAOC 4P9MH 5CSBA 3I02A 1T03L 1UWGL 2R56L 1HZHL 1A6TB 4NJAH 4ZPVB 5GS1A 4X6FA 1QTYT 4Y4HA 1IRAY 4C56A 3S98A 2VL5B 2DTMH 4KZDL 4LASH 2FB4H 3IJSB 2O5YH 5F89B 1KJ2A 1LWRA 2DLTA 1EIBA 1YQ2A 3C2AL 4WFHD 4PJ5E 4OAWA 4LSRH 4MHHG 4JFEE 4U6YA 3VI3F 4KK8C 3MV8E 5IFHH 2ZOLB 4JDTL 3REVB 1FVDB 3LEVH 4PGJA 2C3GA 1K2DB 2V9RA 4OTXL 3PGCA 3ARFC 5IF0B 1INQB 3OXSA 5C0ND 4B0MM 4OIIH 1NGXB 5DJXB 5CKGA 3MBEC 5DEZA 1R3HA 3VXPA 5FO8B 3HG1E 3R4DA 3ZHDA 1NMBL 2VDMH 3BQUD 4RMRA 3L3KB 5JPNA 1NAMH 4OUOA 2JK5B 5IOPB 1AE6L 1RHHB 3DVIA 3LKSA 5HI5D 1HXYA 3LN4A 4JDZB 3B4NA 1GIGH 2Z31C 3RIAF 2J12B 5IQ7L 4U1HB 4U1KB 9CGTA 3ULVE 4W6YB 1DFBH 1GGBH 3WNNA 3VXUD 4ZNCD 4H0IA 1HKFA 2V7HB 1Q94B 1NCDL 4KVCL 3UAJD 3NZ8B 1X4YA 1F90H 4L9LC 3Q0HA 4WGVB 1DVFA 2BOCB 4MJ6B 3V4VL 4R90L 1FAIH 3EOBB 3HE6C 5EOCL 3UJIL 4LEOA 4N90D 2VDKH 2ADGB 4GKZB 4C55A 4N8CH 5D2LF 1JGUL 1YA5A 2D7TL 5C0RH 3ARDD 1GH7A 4QRPB 3A0OA 4U4BA 1S7SA 1X5ZA 5T3XH 5CP3A 5EZIH 3LN5B 2FD6L 5I8KH 1B6UA 1E6JL 1GL4B 2X5PA 5ESAA 2OCFD 4PUBH 5DURB 1UJ3C 5DVLA 2PTTA 5JXEC 3SCMB 1LO4H 2JF1A 2H9GA 3ULVH 1OARL 1CFQA 1H15B 2LU3A 4JFDA 2HJLB 4NN7B 5AZ2H 1F11A 1NLBH 3BMVA 3H7BA 4V2CB 1YQVH 3QQNA 2W60A 3ZTJH 1YMMA 4XP6L 1KULA 3GMPA 4KC3B 1H3GA 4MWFA 1YPZE 4Q9QH 3BEVA 5DRNB 1BZ9B 4NZJA 3DVFA 3UXFA 5CINL 2I9TA 1B0WA 1TCMA 4PJCA 1JGVL 5MP6H 3QH3B 3RX8A 3GJFK 3NPSC 5CBEB 3KYKH 4WUKL 1NGWA 3UTSE 2VLME 2ZOKA 4AIZB 2LABA 4UZGA 1A7OL 4HHAB 2QTEA 4XC1H 1U8KB 3MACL 5J1AA 3QXUA 4N0YL 5D8JL 15C8H 5C0GA 4NFBA 4KZEH 4F15C 1FVEB 3CLEH 1C1EH 1ZLSL 3QWRD 3SDAB 3BKYH 3VXSB 5D5MB 4A2LA 1SBSH 4NQUA 2VH5H 3BEWB 3P4NB 4S1QH 4ZUTA 4HT1L 4R0LC 1F45A 2YXFA 4G8FB 3JTSB 1WIUA 5DRZB 2Q7NA 3AAZB 43C9A 1BVKB 3TBTB 3QXTA 3HI6H 4PRDB 4JG0L 5DSCB 2CK0L 5AWNH 4OUUB 5DJ0A 1OAZL 2P5ED 1JBJA 5D7IF 5E6IB 4YDIL 5F7FA 4KHXL 1LD9A 1GZPB 3HPJB 5T5FL 2VMFA 3HZKB 4G3YL 4HKJB 1M6OA 1UKSA 3DRTA 3BRGC 4RDQF 1LHZA 4NQEB 5DUPH 1A21A 3MODL 4QXTA 5ITBL 1NCCL 2VXUH 4U1IB 2DQJH 2Y6SC 5EU5B 1ZT7A 3GGWA 2Z8VC 4G8GB 5DK2A 1AHWB 4CGTA 4R96A 2C5DC 2IADB 1F4XH 5T1LD 3O2DA 3RWEA 3TIEB 3S35H 2QBWA 2NY6B 5ISZA 5HHVL 1A7PL 3BQUC 1CLZH 3FN3A 4DFIA 1G7HA 3D2UA 5HI5C 3EOTL 1RIHL 4LBEA 1XGUB 4WFGE 4FFYL 4APQD 4UDTA 4XMKH 4J12A 1RUQH 3LS5H 4YDJA 4AYFA 2P47B 3NGBC 1DZBA 4P9ML 4JZOA 2FIKB 3V95A 2ATPA 2PXYB 1WBXB 3WUWG 2BERA 4NJAL 4Q9CA 3DXAA 2QADD 1NC2B 3ZYOA 1XH3A 2ADJB 2DTML 4LASL 2FB4L 3MFFB 5SWZD 2AEQH 2O5YL 3DPBA 2VRAA 3DTXB 1MNUH 3ULVF 4NQSA 4P57A 4LSRL 2W1NA 4J3SA 2E9BA 1C5DB 5CFHA 4Z7WE 1MFBH 4DEPB 3LEVL 1AR1D 2NY2C 2YPLD 2DI7A 5ADOH 3MRHA 4KRLB 3KWWB 4HK3J 4OIIL 2XPGB 4NPYB 1J18A 4F9PC 4OCXH 1UKQA 4GS7B 1A4KA 2PW1A 2VDML 2YN5A 4Y89A 2GJ6B 5IMKA 1NAML 3MX0A 1I7UA 3OGOE 1I7TB 4K7FB 3ARQA 5JIHA 3MNVA 3B5GA 1KV3A 4NO3A 1QEWB 1GIGL 1I1AD 4PP2B 5MEND 4G6JH 1DFBL 1GGBL 5H37H 1T5XB 2HH0H 3IGAB 1F90L 1BFTA 2BVOA 4KJPD 3LKNA 4X4XA 1MI5E 4BSJA 1U8LA 3CSGA 3T0EC 5DJ2A 3QYCA 1FAIL 3HAEH 2ZJSH 2VDKL 4RBPH 1P6FA 1KTDA 2IF7A 4G9FB 2VLRB 4N8CL 1P53A 4Y4FC 5BXFA 2Q76A 1DQJB 2RIKA 1YPZF 3N85H 3TO4B 4PY7A 3K2UH 3KYNB 3LOWA 4YDKH 3ARVA 5C0RL 4NSKA 2EDLA 2MCPH 3O8XB 4G6AC 5M94B 4Y4KD 3C6LD 2N1KA 5T3XL 4PRHD 5EZIL 5I8KL 1WFOA 1SJHA 4PJ8C 1QBLH 4QRRB 3ARSA 3TVMA 4PUBL 4LHUB 1CI5A 1XCQB 4OGAD 1LO4L 1QLRA 3ULVL 3PWVB 5AZ2L 3RGVA 1NLBL 4QRSA 2FR4B 2X9XA 4HPYH 1YQVL 3WLBB 3V9FA 3VFUA 4XH2A 4HD9A 4G80B 1T7VA 3ARYA 4RZCA 3NA9H 3GZKA 2ORBH 5DZLA 4Q9QL 4Y2DA 1CTNA 1WSST 5DZNA 5MP6L 4WW1A 1I8KB 1I9IH 2Z35A 3KYKL 4DZ8A 5MI0C 4RMUA 3RKDC 4YBQC 3KPSD 3NCCB 3U6RB 4PJBB 5F7YC 1G9NH 3AB0C 5EIVA 2MHAB 1EERB 4HFWA 2ZUSA 3IVKB 4KK9C 4XC1L 3M45A 4U31A 4GW4B 3B8YA 15C8L 4EDXA 2ZSVA 4KZEL 1A8JH 2VXVH 3CLEL 4L3EA 1C1EL 3UTQA 4CMHC 3BPNC 2X44D 3MOBH 5JW4R 3PDOA 3BKYL 3P0VH 3UTTE 2VDRH 3CDGA 5F93C 4E41E 1SBSL 4H1LH 2VH5L 3SE8H 4APQC 4S1QL 4R4BA 2F53E 2ENYA 35C8H 1KB5H 4YHMH 5BS0B 1OWWA 3HI6L 3P40A 4P23D 5AWNL 4KXZI 3QSKB 1A7RH 2X1QA 4ZFOL 1KUMA 1EJOH 2QKIA 1OCWH 3MREA 1KF9B 3SGKC 5C1MB 2DAVA 3L5WA 2Y5TB 5E2TH 2VE6A 5HHOD 2H26A 4DOHB 1G7JA 5GGSA 3T04D 4Z7UA 5DUPL 2X9YA 1UXWA 3RTQA 2VABA 1FFNA 3OR7B 2VXUL 3I85A 2DQJL 1VFBA 1JMXA 1YYMH 2NNAA 3RJDA 4AM0B 2DQGH 5B38A 5ACLA 5HVHB 2IC2A 5GRJH 2XA3A 4AEFA 2HKHH 2H1PH 2NX5A 1F4XL 1CE1H 3SKNB 4Y1AE 3S35L 2PUQT 5EOTB 4YNYA 4MXWH 2P24A 1ZHNB 2FCBA 4L3AA 4NNXA 4ODHH 3NFPA 2MQ3A 1CLZL 3IFPA 4FQHB 5JW5B 3WDIA 2CDEA 1I1AC 1Q9WB 5F7DB 3MRDB 4ODXB 4XMKL 4Z7WF 2V7NA 1RUQL 3LS5L 2BRQA 4QOKE 4NKMA 1JZ7A 4RQQA 1II4E 5IHZB 1RJLA 2GI7A 4W6WB 4R7DB 3FQWB 4OQTH 3K46A 2GUOA 2H32H 3UZQA 1IM9A 1I85A 4IHOA 2X4SB 1J8HE 1T7ZA 2AEQL 3QJFA 4XWOC 1TQBB 3PGFH 1CLOH 4X6CA 2VLLB 1MNUL 3KPOB 5TDNB 3B5TA 3BH8B 3GSQB 1K8IA 3FOMA 1EHNA 4JRXA 1EPFA 4EXPX 5I1LA 1KG0B 2NY0B 1MFBL 2Y7QA 1G7IA 4LCWD 3VW3H 1YC7A 4UDUA 3SCMC 4HIEB 4I0CC 5ADOL 5D1ZD 4NN7C 3NPZB 3L6FA 5HGHB 4QF1A 5ANME 5H94A 1KIRB 3GMMA 4LLVA 4OCXL 5CUSH 1PY4A 1ZWIA 4CMMA 1BGXH 5K9KB 1S9XA 5FGBC 4FTVD 5DD5H 3WFEH 3PHOA 1H3VA 3EGSB 4NRXA 4FXGA 3C5JB 1CYGA 4G6JL 5FOBA 4MXQD 4XB7A 2HH0L 4J8RA 1SVZA 4HG4J 3FOLB 1QLEH 3LD8C 4ZYKA 5IM7A 1WBYA 2ZJSL 4UT6H 1K3IA 4CDHA 5HYFA 1FN4B 3FO9B 3U2SB 3ARBA 4Z78B 3N85L 4YDKL 4MCYB 1HYSC 5J1SC 3K2UL 5I76B 3TN0B 4YK4C 4OCSH 1CFNA 3S3JA 2CRYA 2XWBA 5FYJD 2AV7B 5KSBE 2F58H 1QBLL 3QO1B 3Q5YA 4L4TA 3STBA 1U92B 4GKSB 1CD1B 3GSNH 4XHQA 3DMMA 1ORQA 3ESUF 1G7LB 1E0OB 3AROA 5IROA 4P23C 2CO6B 4OM0H 3NMEA 4HUXB 4HPYL 4PR5A 2DWEB 3QDME 5D9SB 4MA3B 4GXUN 1EZVY 1MAJA 4L3CA 2A6KA 1BEYH 4PRPD 1BLNB 4MQXD 1P2CB 4XX1E 1IGYB 5ABDE 3NA9L 3KPRA 2CK2A 3IFOA 2ORBL 3GKZA 4OD1H 2SEBB 4MAYC 3BUTA 5EZLB 1Q9OB 1E28B 4ODWA 3UZVB 4KJWD 1I9IL 2BVTA 1CDJA 3GRWA 3G5VB 3FFCD 1W0WA 4KROD 3VWKD 1Z9OA 3GJFB 1G9NL 1AHWC 1FP5A 2V5RA 4QWWD 3C5SB 1VPOH 1S3KH 3HUJB 1ZAGA 1OPGH 2VIRA 4LIQH 2F9BT 1MLBA 2VXVL 2H8PB 1KT2B 5ENWA 2G75B 5ITFB 3MOBL 3P0VL 3O45A 2VDRL 4MD4A 1IZKA 5ETUB 3SE8L 5JA8B 5EU4B 3Q2CA 2DYPB 4KRMB 2VLJA 35C8L 1KB5L 4U6XA 3FT3B 4YHML 3DO7B 3HA0A 5MEQA 5K9JH 3MUY1 3CXDH 2DIJA 3QCTH 1ZK9A 4XCYB 2PXYC 1IL1A 1A7RL 3VWJA 2CRZA 1HINH 1EJOL 2VZOA 1OCWL 4MA8H 4HUNB 3RWFB 3N1GC 4CUCA 4HEPG 5E2TL 1MH5A 1U3HD 4FQIH 1WAAA 1YDPA 4WUUA 4MCZA 5C0BD 3RP1A 2FEEL 2R1XA 5DVNA 4BA8A 2W65A 3G5ZB 4K7PY 4MDJB 1YYML 2PW2B 2UUDH 4QGTA 5I17B 1KGCE 1BD2B 2DQGL 4EI5A 4H25B 3VFVA 3OKKB 1KIUA 5GRJL 4Q6IB 3MLPA 2HKHL 5EDXA 2H1PL 1CE1L 4L4VB 5TF0A 5HD8C 4QRPE 1HHKB 3X11A 2GTWA 4MXWL 4ODHL 1L0YA 3LRSB 3SJVD 3V6ZA 4KK5C 4P3WA 4F37K 4YX2H 3EUUA 3GMRA 2BVQB 3IXAB 2I07A 1N0LA 1TVBA 4I8DA 1B9ZA 1KJMA 1NCAH 2DOCA 2HLAB 3QNXB 3ECBA 4ZSOB 4NKOB 2F54D 1ITBB 3DV4A 1U8IA 5HGBB 1QP1A 5KSAB 3KYMB 4JFQB 4Y19A 2ZZUT 3UYOD 4KUZH 4OQTL 2C3VA 4QHNA 3MRNB 3BYYA 2X4NA 2CH8A 1A9BB 3V0VA 2HKFH 4LRIC 2VISB 1NBYA 2FJGA 3PGFL 1CLOL 4XPAH 4K7PH 4PGBB 4WFFD 3U0TB 1H3PH 2NY4B 4WEBH 2AI0H 4ETQA 3QPQD 4S0TD 1U9KA 4HSQA 3CGTA 3MRIA 3VW3L 2AJUH 3RNQA 3HE7D 2NLJB 4JGUA 1LO2H 5DHVB 4GQ9H 3CVHH 1X6LA 3QJHB 3FAXA 3RX7A 3B9KA 4DJMA 1EEYA 1LK2A 4PGDA 5DQDH 5CUSL 2HTLD 3VXSE 3BT2H 5D5ME 1KYOJ 2NZ9D 1BGXL 3MRPA 4ZUVB 2B4CH 1ZHLB 4O2EB 5LCVH 1B0RB 5DD5L 3WFEL 5KSBF 1D6EB 4GXVH 4P4RA 1QR1A 1HHJA 2AK4B 4HMCA 3V4PH 4EIZC 3QEHB 3QPXH 3O3DB 1BJ8A 4KJWC 1KSRA 5HI4C 5DMKA 4JZJB 1QLEL 3HZMB 3WNOA 4KROC 4EZMA 1T7WA 5JPMB 1T22A 3VWKC 3DV6A 3HLAB 1T4KA 3S96A 4DWHA 3OKYA 3O2VH 4EOWH 4OF3A 4UT6L 1NC4A 4YAQB 3EYVB 1TFHA 4NQEE 2B20A 1S7QB 3KXFA 3U0PA 3WFZA 1P4BH 4UMGA 1SMAA 3W0WD 2GHWB 4KKLD 1JV5B 2AXGB 4G8GE 4OCSL 5T1KB 4NM4H 1KB9J 5EU3B 4PD4K 2F58L 5ICYB 2MWCA 2YWZA 5CEZD 4W70A 1JTPA 3BUYB 1FYTB 1GAFH 3GSNL 1CGWA 1QFWM 5HHQA 1IC4H 3VD9A 4OM0L 5HJ3A 4I5BA 4E0RA 4IIQA 1FLTX 4PJ9A 3TT1H 5C0CA 2WANA 2PR4H 5JQHC 3EZ8A 1T0MB 5H35A 1BEYL 2V2TA 1U3HC 4U2YA 3AREC 4OD1L 2EDEA 5IK3B 2DLIA 3HRZB 3RFZC 1OTTC 4YDLC 4JFXB 3THMH 5CGTA 1HH6B 2IWGA 1ZE3C 3IDIA 2YD4A 1SJVA 3GBLA 3BDYH 2OL3H 1G84A 1VPOL 1S3KL 3O4LA 5E00A 1OPGL 5CJ5A 2NXZD 3BWAB 1JPST 4LIQL 4Y7MA 4HKBB 3GSOA 4R26H 3TIDA 5F1NB 4DZBB 2C1OA 5EO0B 1CL7I 4ZG1A 1FFPB 5EBWB 5HY9A 2V2WA 5GRZA 1F02I 3CX5J 4BELD 2DBJA 5JORB 3M1BA 1ZKAA 3WEXB 5CWSA 1XT5A 5K9JL 1OGAD 3CXDL 1VGKB 2GJ6E 4QEGA 3QCTL 1FV1A 5D7IA 1U95B 4PIRF 3UDWC 1CGYA 1HOCA 1FAKT 1QPXA 2ERJB 3L5JA 3D0LB 1LE9B 1HINL 3NZHH 1IM3B 1AD9A 4MA8L 3MO1A 2YSSA 1X4ZA 3MV11 5A1AA 3V5DB 4FQIL 1WEJH 4JQVC 3U46A 4DAGH 4M61A 4YDVA 3ALXA 4X98A 2DM2A 2FIRT 1FE8H 1DQDH 4GO6B 3QPQC 1F4AA 1VEMA 3ZE2E 1NDGB 4UIMA 2HJKB 4PG2A 4G9FE 1NAMA 2VUYA 2Y06H 2VLRE 3STLB 4OZIB 3O9WA 2YHGA 4FNLH 3RVWD 3BIBX 5KZCD 1NCUA 4I13B 3LKQA 2J7LA 1GC1H 3MRKB 3QB7C 4TTDD 2E3VA 1CVRA 1MJJA 4QRRE 4ZS6D 4E9LA 4YX2L 4PJ5A 4YO0B 4DGYH 3MV8A 1QO3B 4OFVA 4LLQA 1NCAL 2FSEA 1R3JB 5DHYA 3CSBA 4TVSa 1BQHA 4ELKA 4Z76A 2AXJA 4G42A 1DQQB 2C26A 5D7JD 3IXTB 2W0PA 4R3SB 5CEYA 3FQNA 3WJJA 4KPHH 3D87B 3CFKB 3D18A 2X7LA 5D5MF 2VN4A 4WO4D 4KUZL 5FA3A 5EU6D 2YWYA 4A2MA 3E3QC 2HKFL 1DE4A 3ARDB 1H8SA 2DICA 1O0VA 3OPZH 5C0IB 1RK0B 3MR9B 1KCKA 1AP2A 3TN0C 4XPAL 1T2XA 3T0XA 4PJBE 4K7PL 1H3PL 3GM8A 2DL9A 4WEBL 1XGQA 2AI0L 3LMJH 4HX1B 1LEIB 2AJUL 3QO0B 2FLBT 2X4QB 3BH9A 3OJDB 4PG9A 1LO2L 4GQ9L 3CVHL 1YN6A 1IAKB 4KXZH 5DQDL 5INCA 3BT2L 1PZ5B 1X44A 2YOCA 5CCKH 3IKKA 2B4CL 5LCVL 5C8JA 2AW2A 1P6AB 43CAA 5KVGH 2M8XA 3SDDA 5BS0E 2CIKB 4GXVL 3RWDB 4P5KB 4K71C 2F19L 3V4PL 3QPXL 1NMAH 5C71A 4C59B 3RVTD 5J7CC 5E8EA 3P9MB 2ZWLT 3W82A 2JIXD 4MVBC 3TCLB 1JYWA 5DZOA 5J8OA 5IJVB 1MLCA 3SPVA 1AGFB 3O2VL 4HIHA 4EOWL 4DOHE 2CIIA 4OFYA 4R8WH 4JVUA 5BW7C 1YPZA 4DCQB 1MHHB 3PQYB 1P4BL 3QIBD 4OBRA 5EC2B 5GZOD 2Q1EA 4LCCC 4NM4L 1JGEA 3UPCA 1D5MB 1N26A 2EDJA 4G9DB 5SWQB 3MROB 2A6IB 3UTSA 3P4OA 4P5TD 1ZXQA 4X80H 4Y88A 1GAFL 4P4KC 3SO5A 1IC4L 4RMQA 1KCSH 4EI6B 1I7RA 3MLTA 4ODBD 5JUEH 3TT1L 2PR4L 2EYSA 4PJHB 1AGDA 1W0VB 2IANA 4JR9H 4V1DA 3CFBB 4R97C 4PGEA 1NFIB 4OZFB 3IF1B 1INDH 3QUMB 3SO3B 1IGIH 4HUUA 4ORGB 2BHYA 1HQRB 3THML 3VU2A 3F7VB 5C09A 3LSOB 3UP1A 3P9WB 4FZEH 2OJEB 1IKNA 4CW1B 3QXAB 4OLUH 2BVPB 2CLZB 1U42A 5T1LB 3BDYL 2JCCB 2OL3L 2NW3A 3GJEB 1GGTA 2V5MA 4LKXA 3PNWB 1FZOB 2DWDA 4G8EB 1P84J 4Y5VC 5JOFB 2IH1B 4HUMB 3WS6A 5LJYH 4HH9A 4R26L 2H2SD 5DMGC 4ZS6C 2X40A 1K8DB 5DMJB 5KOVC 3MC0A 3N50A 2P5WB 3ZE2F 3RVXD 3P4MB 4PGCB 5DRWA 4OCYH 5ALBH 1HDMB 5B38G 5GJSH 2GSIA 4E42A 1NUNB 2IFGA 5SWSD 3IDJB 3FB5A 1FPTH 1FNLA 4MD5A 1XIWD 2JJTC 3QFDA 5E94A 5IWLC 4YQXH 5DD3H 3ZE1E 3NZHL 3MV7D 4XPBH 1H8NA 4V2BA 3B2VH 3MRBA 2XZZA 1WEJL 4J3WA 3RPIA 2WWMD 4I48B 5E8NA 5GS0C 5BZWA 4DAGL 4HJGA 5ACZB 5FHBH 1FE8L 4OF6A 4YEFA 1DQDL 1GSMA 3QUXB 1J12A 3NIGE 1Z3GH 2Y06L 3BP5B 2Q7YA 5I1JH 4FNLL 3RWGB 4HDIA 1EVTC 1GC1L 1NL0H 1EFQA 2PNDA 1NMCB 4P46D 4WI7A 1OAXH 1LEKA 5EU7E 1YEEH 3L7FA 4NHCH 2KZ1B 1NEUA 6FABH 2XA8H 4PJBF 4DGYL 4JFFB 2DF3A 4Z7WA 4BUGA 2D4FA 3LCYA 4ZD3H 1CLYH 4KJQC 5TDPA 5J57B 4YE4H 4KTEH 3BP4A 3R06A 4KPHL 4D94A 4JG1H 5EG6C 1VESA 2XWTA 2ITDB 1MCNA 4ORZC 1E6OH 5D7KD 3QHZH 4DUWA 1UGNA 1JN6B 4I18A 5DJZB 3STZA 1JNHB 2MKLC 3OPZL 4NKQB 3CPLB 1MCRA 3IRZA 3C6LB 3NCYP 4PRHB 4M93B 5IB2B 1HI6B 5FO9A 4GBXC 4GG8A 4X9FA 3VFMA 2OTUB 4OZ4A 1MI5A 3LMJL 4IRSD 3V8CA 2AKRB 2L7UA 3MA7B 2R2HB 1MFAH 1OP5K 1N6QH 2E8YA 4NQVB 1EXUA 5D1XC 1JIBA 2WIMA 2XRAH 3WNKA 1OY3B 3UEZA 1X7QA 1U8OA 4NHUB 2KZWA 3BRDA 5JW3H 5CCKL 5J56B 5BVPH 4JFYB 5JDSA 5I8CB 5KVGL 3FCTA 3OGCA 4EN3B 4NT6A 4S2SA 2QJDA 4F33A 1NMAL 1TPXB 4XP1H 3QUYD 1BMGA 3BJLA 2G9HA 1TVDA 4IRJA 5GPRA 1OP3K 2Z4QB 1QSFD 3NCJH 3CFEB 5FYLH 4YPGA 1DN2A 3QHTC 2J3SA 2VWEC 4R8WL 4WI2A 4IDLA 1KLGB 4FQCH 4H1LA 4U0RC 3O3BA 4D2NA 2VAAA 5FFLA 1QVOB 2H2SC 2X41A 3D3VB 4TVPD 4I2XB 1DDHB 1BD2E 2C7UA 3I3DA 5DK0A 3OKMA 5D7SH 3MFGB 5F7UA 2PO6D 1B4JL 3CLFH 4HS3A 1M1SA 4MYWB 3RVXC 2VR9A 4L4VE 5J13B 4HAFA 4Z7VB 2Z92A 4X80L 1U6AH 2ZUQB 2GY5A 3SDCD 1I9EA 1KBGH 2OJZH 5EUKA 5CILH 3KPNA 1GVIA 3RZCA 1KCSL 1DEDA 5JUEL 3G08B 3C9NB 4N8VA 1IEBB 1L7TH 4DVBA 3E8UH 1T6WA 4C83B 2WWKO 2EDXA 2F53A 1INDL 1IGIL 2X4PB 2EO9A 4XAKE 1U3ZA 2BSSA 4FZEL 1FSKB 1MY7A 4FXKA 2H45A 4OLUL 2XY2A 3EDDA 4K3HA 3ZE1F 4LHJB 2YUVA 5GS1B 4P46C 4NN6B 4QHKJ 2DQDH 1F4YH 1I8IA 1RZJH 1G7PB 1MQ8A 1YC8A 1RY7B 4FFZH 4HLJA 3NIGF 4POZD 4TSAH 4OQTA 2D7QA 4UV4H 4OCYL 5ALBL 3EFDH 5GJSL 4D0CB 3IDNB 4NBXB 1FPTL 4O2FB 4PJDB 1EZVX 3QEUB 3E6HA 2FEDD 5ID0A 3MCLH 3OXSB 4PRNA 4A6YB 4YQXL 4LLDA 5DD3L 4XPBL 1IJ9A 3B2VL 1R3HB 2AK4E 1JCKA 2JJVA 5KS9B 4R7NB 5FYKU 1I3RA 1EV2E 1MWAA 3BVNA 1A02N 5E8OB 4HULB 4LVOB 1GGIH 4S10A 5L2KD 1HXYB 1KN2H 1PQZB 4QOKA 3LN4B 2J1KA 4LVHB 5FHBL 3P9LB 4D9QD 1BAFH 3JV4B 5E1AB 4BYHA 4BSVB 3A6CH 3AXLA 2DKUA 2XI9A 3TNMA 5CJBA 3ZKMD 2HG5A 5IW1A 3MCKB 3VFRA 1Z3GL 3MPCA 1C16A 5FYKH 4RFNB 3IJHB 1EFXD 5I1JL 3EYOA 5K59E 4OM1H 3IDMB 2J5LC 1NL0L 1L0XA 2ADFH 1LEGA 1LO3H 1J8HA 4PBWD 4NC2B 1N64H 1OAXL 1UT9A 1YEEL 5DFVD 1G6VK 5J11C 2ICWJ 1VFOA 1IILE 4NHCL 5DD6A 6FABL 2XA8L 4OLWL 1FYTE 1BBDH 3VGAC 3AUVA 2E7BA 3MRGA 2HJFB 3AM8A 3RZWA 4ZD3L 1CLYL 4NWUH 3QEQD 1KEGH 4YE4L 3TBVA 4KTEL 5ANMA 4WNQA 2ZUVA 1FHGA 5I71B 4JG1L 1HILB 5F70A 2F74B 1CFQB 3SKJH 2XTJB 4MX7B 1KELH 4S11A 1E6OL 1TJHH 4X7DC 2QSTA 3QHZL 4Y5XA 3FO1A 3H7BB 3P4LA 3RHWK 3I50H 5KSVA 3B9EA 2EIZB 1UXSB 3H0TA 4P2OA 4QTIH 5AG9A 4GW1B 1MCIA 3EFFB 4GT7A 3GSNA 4EVNA 1KNOB 5HHNA 5E24E 1CL7H 2APVA 5CLWA 4FG6D 1J88A 2I9TB 2PO6C 2K9UA 1T89A 4MB3A 4PJCB 1N6QL 3FB7B 1MFAL 1CR9H 3DECA 2GIYA 1JZ6A 4YFLF 1WZ1H 3SDCC 1SVCP 1ADQH 1UVQA 1NGWB 2XRAL 1FJ1B 4ONFH 2VKXA 4K8RD 4OKVB 3V6OC 2P45B 3QNYB 3KDMA 5JW3L 5BVPL 3VFPA 3K3QA 4KFZC 5J1AB 4OZGB 5I75C 4WRLA 2AQ2A 5KSBA 5EOQH 3ZO0A 2IAMA 4G6KH 3K1KC 1MCEA 3TYFA 3SO3C 4XP1L 4P5MB 4O00A 4XCNA 3JWNC 3FFCB 3E6FA 3T4YA 2YD5A 2P8MA 4ZUTB 2X70A 3O4OB 3V7AE 3TV3H 1TJIH 2MQCA 3NCJL 4W4OA 5GRUH 5FYLL 1T1ZB 2NR6D 3G6DH 4GMSH 3RRQA 4WFHE 1IGJA 5CZKA 2DMKA 3WCYA 1S9VA 4FQCL 4BQBA 2JE8A 1HSBA 3AC0A 5C9JA 1KC5H 4Y16B 2E7HA 2HAZA 1VERA 3OHXB 1A6TA 4ZPVA 5D7SL 3TNNB 4OZIE 4I0KA 1Y6KR 3IU4H 5JIIA 4POZC 3CLFL 4QXTB 4LPWA 3DX9A 1UB6B 2VL5A 4U7SA 1U6AL 4WI9A 4WWKD 1A14H 3TFKD 3IJSA 1KBGL 2OJZL 5GIRA 2YZ1A 5CILL 3VXNB 4NKIH 2V5SA 5DO2D 4R96B 2B7DT 2WBJD 3FB6B 1L7TL 4M7ZB 5ISZB 1FVDA 2HT2C 3LB6D 2DB8A 4JY4B 3ZDYE 1K2DA 3E8UL 4H0HB 1XF5A 2ICES 5IF0A 3D2UB 3VMPA 3E2HC 5DJXA 1BF2A 3V4UH 2A73B 4UT7H 1ZVYA 4HS8H 3IYLW 4UDTB 1ZS8B 3L3KA 4ZUSB 3ZKMC 2JK5A 5IOPA 3KLHC 4IMLB 2XZAH 1PFCA 4M7KH 4MA7H 1G1CA 4JDZA 4XZUB 1ZLUK 2Z9TA 3MA9H 4U1HA 3V5HB 4U1KA 3CAFA 3PP3K 1DBML 3SJVB 4Y4HD 3DXAB 2V7HA 1Q94A 2BNRB 2LU4A 4M4PA 2DQDL 3B43A 3NZ8A 2I5YH 1F4YL 4FOMA 1RZJL 4RDQG 4MJ6A 3S4SA 3DBXB 3EOBA 1SM3H 4FFZL 4B7IA 4GKOA 4TSAL 2ADGA 2YPVH 4UV4L 5IBUG 5JOEA 5IV2B 3EFDL 5K59F 3HRPA 3BDBA 3Q6FB 4QRPA 4S1RH 5CMAA 3MCLL 4NC1E 3LN5A 5D1QC 2OS7A 2PYFB 3TJHC 1BWMA 3OV6A 1A4KB 1PGRB 2H41A 3OKDB 1H15A 5F44A 2HJLA 1GGIL 1KN2L 4TNWF 1JF5A 1OTSD 4TPRH 1BAFL 3A6CL 1JZ8A 3HE7B 5FYKL 1A2YB 1F42A 4PB0H 2BVOB 3PQYE 3LKNB 1BZ9A 4WENB 4OM1L 3TA3D 4EQ2A 5DJ2B 2ADFL 2J2ZA 2MMXA 1LO3L 4HW6A 1N64L 3QH3A 1KTDB 2ICEB 3DSFH 4AIZA 1PLGH 5JZ7D 4EN3C 1BBDL 3UZEA 4HHAA 3TEUA 4N0CD 1NKOA 3DO3A 4KI5C 1SJHB 1RIUH 4LMQI 4RA3A 4I9WE 4NWUL 3V6OE 2DQTH 3ZTJG 1KEGL 1CFSB 4JPKH 2OR7A 1FVEA 3LIZH 5B8CC 5E8PA 4N1CA 5D6CA 1MHEB 4PJHE 3SDAA 4JFDD 2R0WH 4WHTB 3SKJL 5D5MA 2VXQH 3VXRD 3VXSA 5JW4Q 1KELL 4JB9H 1JWSB 1TJHL 1PG7X 4FS0A 4YBLB 2B5IB 3P4NA 2YPKB 3I50L 5D70H 4WW2B 4G8FA 3D39D 3JTSA 4QHKI 4QTIL 5DRZA 3AAZA 1X4XA 1OGTB 3TBTA 3BZEA 4PRDA 1Z2KA 5DSCA 4OUUA 4RZCB 1X5JA 5EZOH 3F12B 5E6IA 1CL7L 3RIFK 3DRQB 2JCCE 5FECA 1GZPA 4QXUH 3HPJA 2Q6WB 5GZNC 1CR9L 3HZKA 4MMZC 4WW1B 5J13C 4HKJA 4WWKC 1WZ1L 2HLFC 2ZUQC 1ADQL 3S37H 2OI9B 4ONFL 4NQEA 4WGWB 1AO7A 3MZGB 4J1UB 2D2OA 4QLRA 2GTZB 4U1IA 1FZKA 2WBJC 2P5WE 2BSED 1ERNA 4MQ7A 2QEJA 5EOQL 4OZIF 1Q0YH 4L3EB 3UTQB 4G6KL 4IRZH 2A1WH 3PDOB 4N0RA 3OG4B 5KBNC 4KRPB 4UILH 2IBGA 4YXKH 1VEPA 3OTTA 4R4BB 3EYSH 4KMLB 4L8SB 1NFKA 3TV3L 1TJIL 3RUGA 4PYGA 1XMWA 4WCYH 5GRUL 1XGUA 1HK6A 2DI9A 2MKWA 3G6DL 4GMSL 4JY5H 2ZG1A 4JO1H 2PTVA 2NXZB 1RD6A 1P4IH 5GS1C 4Y4HC 5GGUB 3ZDYF 1AKJA 4GW5A 2QKIB 1KC5L 1R3IH 4UINH 2ICWI 2FIKA 2VE6B 3O6MH 4RGND 5EOCJ 1G6RB 1WBXA 4ZTPH 1UENA 1I3VA 3IU4L 1WV7T 4WI3A 5MHSD 2J8UB 5DJYA 3RTQB 3H9HB 1FFNB 2CKNA 2ADJA 2DMCA 1A14L 3MFFA 3B5HA 2YC1B 3DTXA 1C12B 4NKIL 2V6HA 2NY3D 2D3VA 4OCWH 1W0YT 3JV5A 4JFFE 3WFHB 4N0UB 3ZKXB 4L5FH 1JPGB 4YNYB 4JHAH 3REWB 2P24B 4F2MB 3NFPB 2XQBH 1LGVA 3KWWA 1T2QH 1U91B 2XPGA 1LO5B 3V4UL 2CDEB 1OTSC 4NDMB 4OV6F 4UT7L 4HS8L 1G0XA 2A74A 4GAFB 2GJ6A 1RZIA 2V7NB 1N0XH 3BPCB 4NKMB 2XZAL 2D9CA 4M7KL 3T4AB 5KZCB 5FHAH 4K7FA 3SKMA 4WDIB 1KJ3H 1A6PA 4IOIB 4MA7L 3CVIH 4LCYA 5I0DA 1QSZA 4PP2A 1DVFC 3MA9L 3BPOC 1X9QA 2YN3A 4PRHE 4IBLT 1T5XA 3IGAA 1V3LA 2I5YL 2GUOB 2ITCA 3QIWD 1ZMYA 5JZ7C 3Q3GA 4OIAA 3QJFB 3FMGH 4O2CA 1SM3L 2MQ0A 4X6CB 3GEWB 4AENB 2GCYA 3VXQA 4JRYD 2YPVL 4G9FA 5D7JB 4JRXB 3M17B 4YHKH 1DQJA 3TO4A 2IJ0C 5HHMB 3O8XA 4JKPH 4HKXA 4S1RL 5EU6B 2XTJC 1ODAA 1JF1A 4QRRA 5KJRH 3QIUA 4LHUA 1M4KA 5H37G 1XCQA 4PJ7A 1A4JB 1UM6H 4BFEA 1ZWIB 1Z6JT 3ARRA 1T80A 3PWVA 4XXDB 4MHHI 4EXKA 2FR4A 3ULUD 1J05B 3LN9A 4TPRL 5I1DB 3WLBA 4FN0A 4JM2D 5FOBB 2XN9A 4J8RB 1RZKH 2VXSH 4PB0L 4PJHF 2R1WB 5FV2A 4UU9A 5IM7B 3D3VE 4KKCD 4BZ1H 1W72B 4I2XE 5E2UH 3C5ZD 1S9KC 1I8KA 3F6IA 4FQ1H 2YS4A 1H0DB 4LOUD 4PJBA 3DSFL 4Z7VE 5IUSA 1PLGL 4HK0A 3MV9D 5DHXB 2F15A 2JCCF 3IVKA 2E9JA 3QI9A 3I9GH 3RY5A 3PWJB 2C1PB 5FO7B 4I1NB 3PHQA 1LDSA 5KANG 2XWBB 5GGQH 1RIUL 2DQTL 4QKXB 5GS3A 2EICA 1BREA 4JPKL 3LIZL 3O4OC 2AVGA 1AXIB 2R0WL 2VXQL 5ICZB 4JB9L 3RGVD 1LILA 3QIBB 4PR5B 5D70L 5EC1B 3KPQB 3Q1SH 2Y72A 1PVHA 1KCVH 3DETD 5GJTH 2APXA 5EZOL 1KENH 3LDBB 1RUPH 4U6HB 1CXLA 1PY9A 4Y2DD 3VD5A 4QXUL 1LDPH 4Z9KB 4JQXA 1Z9SA 4CVZB 3NCYS 3S37L 4RNRB 5SX4I 3W81A 1T1YB 2EE2A 2NY3C 5L7XH 3OR7A 3EJZD 4HUKB 4QNPE 4H1LG 3WSQH 5K33A 4AM0A 2P8LA 4HXBH 4MS8D 5C07A 3F6LA 5BV7B 2O5ZH 2P4AB 4X9IA 1Q0YL 3V6FB 4IRZL 2A1WL 1MOEA 3O45B 1K3ZA 4PJDE 5EOTA 5E8DH 1HSAA 1WBZB 1ZHNA 2XKNA 4UILL 4YXKL 2DJSA 2ESVB 3EYSL 2FWOA 1Z5LB 4D9LH 2PYED 1JPFB 4WCYL 5KS9E 5JW5A 5B39B 5FEBA 2ED7A 4JY5L 1Q9WA 4JO1L 5F7DA 3MRDA 5BJTB 4ODXA 1P4IL 1IL1B 2BY3A 1AH1A 4GSDH 4N8VG 1A3QA 5IHZA 3CFIC 3ZDXE 3PL6D 1R3IL 3T0VA 3F7YB 4UINL 4LCWE 3MUGB 1JYXA 3AY4A 1MIMH 3O6ML 4R7DA 4POYA 3HS0B 4ZTPL 2L0DA 2ZUXA 1PDKA 3FQWA 5EN2B 1YEKH 4R4NC 1MJ8H 5JR1H 3CX2A 5LGJB 5IMOB 5DQ9B 2BNQB 4KHTH 2VLLA 3KPOA 3ARGD 5HYEA 3BH8A 3GSQA 1ZVHA 5ID1B 2XFXB 2NX5D 4OCWL 2CKBH 4JGMA 1KG0A 4L5FL 1JNLH 4P2QD 4JHAL 2GTWB 3GSXB 2JB6B 4NZTH 2XQBL 5FM5O 4K9EH 1T2QL 5HGHA 3FZUD 5L88H 3X12B 2I07B 2QQLH 1CD8A 1OAQH 4RBPK 2XTJE 2G5BB 1EO5A 1N0XL 1OT2A 3P73B 3QWQB 5FHAL 1KJ3L 8CGTA 3CVIL 2BC4A 1U8IB 4QY8A 3MJ6A 2ZCKH 3EGSA 4KKCC 3C5JA 3J7HA 3RWHB 5FYJE 3DX6B 5DTFB 2C3VB 4QHNB 3BPLB 5J9PA 1EEZA 3FOLA 3S5LB 4HGMA 2X4NB 2XXMB 1P7KB 3KLSA 1IM9D 2FJGB 4Z77B 3FMGL 3G9AB 1J1PH 3GI8H 4YUEH 1FN4A 1X5YA 3OX8B 3GSVB 3DI3B 3U2SA 4YHKL 5E5UB 4MCYA 3TVMC 4X6BB 4LK4A 3BSZH 3PWLA 4JKPL 2W91A 4NIKB 5FYJU 4YXHH 4OZGE 1ZT4B 5F97E 3RGVC 2AV7A 4C57C 3QO1A 3C60A 5KJRL 4ZNEE 1JL8A 4FFVC 1U92A 1UM6L 4GKSA 4Z7VF 3QDAA 3FFCE 3OJMB 1R6VA 3L3OB 4WJ5B 1S7VA 4IRSB 4Y2DC 3PP4H 3VRJB 5D9SA 4MA3A 4ZOCA 4HGWA 3C08H 1BLNA 1RZKL 1P2CA 1IGYA 2CLVB 5DMKB 2VXSL 1JPTH 2EXWD 2OI9C 1CG9A 1T22B 2NY1D 2SEBA 3DUSB 3I3EA 4XBEH 4BZ1L 3DV6B 1ETZB 5E2UL 2GEEA 5EZLA 1E28A 3EJZC 5IEKB 5IHUH 4N0FB 2CDGB 4FQ1L 2ZCLH 5GGTA 3G5VA 4ZAKD 3BX7C 3KYOA 5E4IA 3ARBD 2VERN 3GI9H 1AQDB 3GJFA 3C5SA 4BH8B 1DBAH 3HB3C 3O6FB 3I9GL 3QUYB 5J4MA 1L9MA 4Y5YB 5GGQL 3MV01 2XZCH 4PJFB 4L4TD 4W6XB 4HJJH 2H8PA 1H5BB 2C3WA 1QSFB 3GIVB 4NO0D 2J6EH 1KT2A 5ISZE 5ITFA 4GRWH 1CE6A 1JGDB 3DMMD 4QNPF 1U93A 5ETUA 1AXSB 5EU4A 3VE0B 5TQ2H 1CWVA 2IQAA 4QHUB 3FT3A 3Q1SL 3DO7A 2MSPA 1KCVL 1H3XA 5H35B 5GJTL 3I6KB 4XCYA 3KPRD 3QR2A 1WCQA 1KENL 4PJDF 1RUPL 4MNHB 1LDPL 3RTQC 2EDWA 3BW9B 2YA1A 3RWFA 3SJVE 5KS9F 3DXAE 1MCSA 2BCKB 2BNRE 3NABH 4YC2B 4AK1A 1F6LL 5L7XL 2WV3A 3G5ZA 4XX1G 1MFCH 1AGEA 4P9HH 3WSQL 3ZDXF 2K1MA 2PW2A 3GHBH 1I4FB 2FGWH 3KPTA 3O4LB 5KG9B 1BD2A 3WLWD 4HXBL 4Y2OA 1N6UA 4H25A 3OKKA 4UNTA 2O5ZL 4Q6IA 2E5EA 1CFBA 3P11H 3QISA 1UZ8B 2V2WB 4L4VA 4LMQE 1QSVA 1HHKA 5E8DL 4LSDA 3X14B 3P2TA 3LRSA 3M1BB 4GXUM 2VLJD 5CZVH 4D9LL 5BMFH 2BVQA 3IXAA 5IBTH 4N5EC 4QYOB 4Z7NE 2P48B 2BVEA 4WFFE 2HLAA 3QNXA 1YEFH 4GSDL 3DIFB 1U3YA 4NKOA 3QUZB 4GMTH 1AD9B 2BXYA 3L3HA 3MO1B 1I85C 1MIML 3ILQC 5KSAA 3KYMA 4F58H 2BY1A 1YEKL 1MJ8L 3MRNA 3BP7A 5JR1L 4X98B 2Q8AH 2QSVA 5IBUB 1U41A 4KHTL 3NFSH 5CS7A 4S1DD 3EW3B 1S5IH 3L5XH 1RV6X 3O9WB 4YR6B 3U0TA 2CKBL 5AUMB 3HFMH 5JHDD 4DW2H 1FNEB 2R2EB 1JNLL 3LZFH 4NZTL 3VJ6B 3MZTA 5LWYH 1RFDH 2NLJA 4K9EL 2B2XH 5DHVA 1J0KA 5L88L 2EYRB 3WMSA 1NSNH 2QQLL 5D71H 1OAQL 4KKBD 5EBGA 3SY0A 5DHYB 5FA4B 3S88H 5F6IB 1BQHB 1EHXA 3FKUS 1EFXB 1ZHLA 3B83A 3MJ8B 4OZGF 1B0RA 2EXWC 2LAAA 5CD5D 1J7VR 1BFOB 2ZCKL 1D6EA 1ZV5A 5IB4B 3AFLA 2RHEA 1J87A 3QEHA 3C09B 3O3DA 4I3GA 4GKNB 2E7MA 3HZMA 4JZJA 3H9YA 4LGSB 5JPMA 3ARBC 4AEHH 1WFTA 3PHSA 3BO8B 1J1PL 3GI8L 2APTA 4YUEL 3QQ9D 3EYVA 4YAQA 2VZ1A 1Y6NR 1YUHB 4FXLA 1KPUB 5JQ6H 4IOSD 3BSZL 3TBSB 4YXHL 4OIBA 3BH9B 3DMMC 1BVLB 1JV5A 2AXGA 5T1KA 5EU3A 5IROC 3CU1A 3U48A 5ICYA 4L3EE 4PB9H 5HTSA 2GJZB 3SGJA 1FYTA 1Y6MR 2CR3A 4BZYA 5DRXB 2A77H 3QG6A 43CAB 5CEZH 2H2PC 4FFWC 1KLUB 2YEZB 1WFNA 4YHYB 3FN9A 3PP4L 5I74B 5HDOA 1T0MA 3C08L 4ONOA 4D0BB 2B1AH 1JPTL 1A7QH 1MPAH 3GUTA 5EO9B 4HZLB 4XBEL 3HRZA 1MLCB 3SPVB 1D9KD 3HZVB 3QHFH 3GDBA 5IHUL 1S9WB 2CIIB 4JFXA 2ZCLL 3KXFD 5F9WB 3HTLX 4P2YA 2J8UE 1HH6A 1V3MA 3WLWC 5I2IB 3GI9L 5BV7C 4HAGA 3OF6D 4ACPA 1DBAL 4C54A 2QSQA 2AV1A 4U1JB 1F6FB 2X1XR 3QDHA 5FUZH 3BWAA 2XZCL 4HKBA 4ZFOB 5F1NA 4DZBA 4HJJL 4N0UE 4R6UA 5I1HL 2J6EL 5EO0A 1VA9A 1Z0NA 5AD0B 2NXYB 3VMOA 4G7YH 5JORA 4ZXBA 4HCRH 3EHBC 3VWJC 2UUDK 3WEXA 5TQ2L 1XCTB 1QRNB 5C0FB 4ZO7A 1ACYH 1U95A 2IANB 4V1DB 3D0LA 1FH5H 1IM3A 5DVOA 5FGRA 4PREA 2X4TB 5C09B 1UEMA 1FZMA 3Q6GH 3V5DA 5DMYA 3NABL 5F3HB 1Z0MA 4EI5C 4S1DC 4E5XA 4Z7NF