4PG9B

Mhc class i in complex with sendai virus nucleoprotein peptide fapgnypal
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/peptide
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pg9B00
4G42A 5F97E 3RZWA 3PIQB 1KXVC 2HWZL 4U1LA 1OY3B 1Q94B 4MD0B 3EOBB 1YA5A 1FYTD 2ZOKA 3L1OH 4UNTA 5DGQA 3VFMB 4FXKA 5L7XL 3IDXL 2PW2A 3BE1H 2HH0H 3BW9A 4ZSOA 3MROA 4NRXB 4PP2A 4Q9RL 4R4FL 1LHZA 1MI5A 2W0FB 3BZFB 4ODXA 4MAYB 1N5AB 2ID5A 4ODTH 1B0GB 1JTOA 3QPQC 3U9UA 2HA1A 2EDLA 3HPLB 5IB1A 7FABH 3MRMA 5J6HB 1T3FB 1RZ7H 3TO4C 4N9OB 4OLZH 2E9IA 3PDGA 1T22B 1MCWW 3QIUC 2GSGB 1LEKA 4JHZA 3O4OB 1KJMA 5C0CA 2EH7L 3R06A 4KKLC 1ES0B 4MB3A 4JPVL 3V0VA 1CGXA 1WUNT 1ZEAL 1EUUA 4DEPB 4CVWA 3H7BB 3DUHA 1OL0A 1C16B 1XR9A 4BH8A 1RUML 4XP4L 3TIDB 5ID1A 2PXYC 4HGKC 1ONQA 1OPGH 1ZTXL 4KTEH 1KCUL 4JFXB 5EN2A 4J3UA 2FL5B 2NY5L 3JV4A 1Q72H 3RWHA 2HT3D 1U8HA 5CGYC 1J8HA 1G0XA 1R6VA 4YX2L 4M00A 3OKEB 1FNGB 2F5AL 3I6GA 3MV11 1G9MC 1CL7H 2JELL 1DANT 4FN0A 1MLBA 2X4RA 3HR5A 1P4BH 5C09B 3GBNH 2CDEA 2J8OA 3GI9H 2P24B 4IRSB 4P4RB 5KTEH 4KKCD 4XMKL 1A6UH 4ENEC 3MV7B 3V4UH 1HI6B 3W0WD 3MO1B 3UROR 1JCKA 1TENA 4YFDB 4PJCE 4YE4L 1G7HB 2PR4H 2VSCA 3A67L 2BVUA 4OZGB 1G9NC 4YDVA 3QH3A 4U3XA 5C6TH 3BGFC 4NQCA 1FDLL 4RMTA 4TVPE 1DR9A 5EWIL 5C0NC 2JCCF 1FYHB 5E94A 3LDBB 4A6YA 4DCQA 1OSPH 3HNVH 5EIIA 1KPUB 3FTGA 3HAEH 1J10A 3EYVB 1DQLL 2HLAA 3BP6B 1OTSD 4KQ4H 5D1QA 4GQ9L 1A9EB 4OB5L 4OZFA 3VXOA 1SM3L 3QJHB 1A7QH 4ZFOL 1UCBH 3G6JB 5MERB 2ZCKH 3DMMA 3TJEH 3KPMA 4D9LL 3MNWB 1MCKA 5IW1B 1J1PH 3PHQB 2YD3A 2AERT 4G9FD 1KTLA 1XGQA 2JB5H 4Q6IB 5DD6A 4KZDL 1CDCA 3O2VH 4L8SA 4NQEA 2NY1B 4K71C 1UM5H 2APWA 3O3EA 1QFWI 3A6CH 3UYRH 2DQGL 3GMOB 1NPUA 4AIXA 2ATKB 4RSVA 3RUGB 4PRHB 3HMWH 3KPSD 1FZMA 5H2BB 5KSVA 3B8YA 2E6PA 1XCTB 1ZGLP 2I9LA 2VDPL 3U46A 2CR6A 2BY3A 3QCTH 5C0IB 1RJCA 4PRAA 5JHDA 15C8H 2F9BT 3QEQA 2YA2A 4H5SB 4JPIB 4U6VL 3ULSB 4J8RA 2DJSA 1MFDH 1X4XA 3N1FC 2CUIA 1CU4L 4WU7B 4IRJD 1A5FL 4MDIB 5C0BB 5GRZA 1N6VA 5ID0A 2AKRB 2ZKHH 4OGZA 3VXQB 4U6YB 5C07A 3S34L 1ZOXA 4KUZH 2E27H 1EX0A 1ACYL 3Q5TA 5D5ME 3FQRB 4LLWB 1TZIB 1UWXH 3RGVA 1EMTL 3I6LD 1KB5A 2JTDA 2Z31C 3ZSSA 1S7TB 4G43A 3HTLX 3LH2L 5IQ7H 5HVHB 2ICWB 3HC3L 3P0VL 1Q9WA 1Z0MA 3ARXA 2A74A 3RTQC 3P77B 4D0DB 1MQKH 3NZHH 1VFAA 3S35X 2J6EL 4LL9A 2ITDA 1RURH 4LHQB 3UCRA 5H94A 5F7KC 4F9LC 3VD7A 1FZJA 4L9LC 3ZL4L 5ACMA 1RMFH 5ALBH 3QDGA 4PRID 1DQQB 3O6KH 1YN6A 3ETBF 3B2UD 3EOAA 1WGOA 1YY9D 5CJQL 3C87A 3MRKA 5FM5O 2VDML 3QIBC 1Q9OB 4HKXA 3QZWG 3SO5A 4WEBH 2VDKH 1U3HB 5EU6D 3RX7A 4OFDA 1Z9MA 2XICA 3DRQB 4EI6A 1LO5A 3MCKB 4LPXA 2EH8L 5IW6A 3O41B 4HHAB 5HHMB 4BQCA 3BT2L 1G7JB 4XCEB 1DLHB 1ZLSH 1F4XH 1KFAL 2WSKA 3C2AH 3OB8A 4XWGL 3DPBA 2GK0B 4D94A 3HNTH 2D9QB 5AYQA 1S9WA 3WL9A 3B9KC 4XNYH 4XWOD 1F02I 5FYLL 2Q7NA 1CGSL 3L3KB 1OWRM 2WIIA 4LEXH 3DGGA 3TNNA 3UC0L 2XTJC 2H2SD 1AP2A 1I4FB 2NTFB 4OD1H 2BC4B 4WW1B 4P57A 1I7UB 5GSRA 3MUY1 5GS1C 3HRZA 5IVXF 1NGPL 2AV7A 3T3MF 4CNIA 5HYSG 2CKBH 2ESVA 4KI5D 2FX8H 2DBLH 5E95B 4AIZA 4GRMB 4MA8L 3U0TA 5M94B 2BVOB 4L3AA 1GOHA 2YC1A 4PJIE 5FV1L 3S5LB 2EKJA 1V05A 3T0XA 4GKSA 5E2TL 5IB4A 3RX8A 1X5XA 2GCYA 5DR5L 3NA4A 4NO5B 5GGQH 4ODWB 4X98B 4KROB 4L3CB 4P23C 1T2QH 1BAFL 1FL6B 3W9DA 2WUBH 2BCKB 3M07A 4POYA 1Z5LA 3VDBA 3OAZK 4JVWA 1FFRA 4PRNA 4XP6L 4Z7UE 5AWNL 3LZFL 5J1AA 2EDYA 5IJKC 5ICZA 1X44A 4AENB 5D96B 3VWKD 3ARBD 5GIRA 2A6IA 1UFUA 4FS0A 2A6KB 3GSNB 2AV1A 1FNSL 2GJ6E 3BH8B 4PYGA 4YNYB 1YDPB 1GGCL 4QRTA 4DKDC 4P2QA 4Z7WF 1QSZA 3AS0A 1KTDB 2Z91B 4U3HA 2V5YA 3INUL 5FF6B 3MRDA 5EOQH 2VNCA 1J0YA 3RWIB 4OF3A 3DYOA 4ELMA 1J7VR 4L4TD 2GKIA 4X6FB 3T2PA 5KVMC 4J3XA 1MHHA 5J6GA 3NIGE 1NH6A 4BFIB 3N85H 3QI9C 1QR4A 4D9QD 1MH5A 1E6JH 5EO1A 3HG1B 4GW5B 2NX5B 4FQLH 3WIIL 4NZTH 3KPOB 3ARSA 4HCRH 4Y4FA 3MLXL 2BP3A 3MGOA 3P9WB 5B3JE 1WCQA 4H88L 2IG2L 2UZXB 4LVOC 2OK0L 1JPSL 3HE6B 3QUKA 1PDKA 1LVEA 5ICXA 5DRXB 4G8GE 4O4YH 3MLRH 1R3KB 4Z7VB 2OSLA 2ZWLT 2VZOA 3FONB 1NMAL 3MR9B 5ENWA 3P40A 4NNPL 4R90H 2V7HB 4GMSH 1VEMA 4PJ5D 1J0JA 4NWTL 1NUGA 3DIFB 4S2SA 5T1LD 5JZ7C 5F1IB 3L3HA 3QQ4B 3RJDA 4DVRL 1KXTB 1LO4L 3BKMH 1FRGL 3QR2A 5GHWL 4PGZA 1UXSA 3IFOA 4F8TA 1LE9B 1NCBL 3BGMA 5JW4M 1AI1L 3PL6C 2Q86A 4YHML 3ZE1E 3DRTA 3WNNA 3QQ9D 5CZVL 4PB9H 2RFXA 4JFHD 2FJGA 3HI6H 4FQXA 4MSWB 5I8KH 4Y5VB 3P4MA 4ZTPH 4CVZB 1PKOA 4IOIA 5EOCL 3PWVA 4TSBH 3OJMB 2VZUA 4M8QB 3TBVB 5GRUH 3RA7H 1YMMD 1IARB 4HUKB 3G04B 4Q58C 2NTSP 2FIRT 4KKAC 4HWZA 1ZWIB 1JI2A 5DJYA 1RJLB 5HYJB 2DAVA 5MP6H 4KJQD 3CVIL 4K7PY 2EYRA 2NY4C 1PYWA 4OCXL 3E3QC 4XNXL 2R1XA 4DKFL 5I16A 1V3LA 5E6ID 2BERA 3BZ4B 5AUMB 3WFBH 1Y18B 1OM3H 3K1DA 2HKFL 4LSTH 1A1MA 4OUOA 1K4DB 2DLFH 5AD0A 2BVEA 2CIIB 2YUZA 3LKSA 1N7MH 2I07A 1ZHKB 4MNHB 3ULVH 5GGVL 1E6OL 3GBLA 5C09E 3ZT5A 1KOAA 4OBSA 5IBTL 3DETD 3C9NA 2OM5A 4XVTL 5DURB 1FORH 3FZUD 5A2KH 4ZDHA 2CUHA 2BVTA 4WFED 4IJ3C 2VC2H 4YBQC 3DARA 2YEZA 3WLWD 5ISZE 5IIEB 3GSNL 5CILH 3CSYB 4FQ1L 4OZGE 1INEL 4M7KH 4JG0L 1SJXA 3UPAA 2A38A 1KG0A 3CH8A 1AGDB 5KVDH 1FAIL 3ECBA 2IGFL 2OQJB 1JFQH 5F6IC 1D5BA 4HMDA 1OB1B 4RA3A 3R8QA 3K0WA 1I1FB 5I8OL 3U2SB 3MXWL 2PO6C 1FFNB 4JDTL 1RK0B 3FQTA 3VG9B 3UJJH 5CD3A 4B53A 2EXYC 3G6JE 1M6OA 3L5XH 1DEEA 2BOCB 4M5ZH 3VFVA 1NLBH 3O3BA 3LRSA 4GLRH 2XWTA 3PV6A 1I7ZB 3GRWL 1AFVH 3S88L 2VJXA 4DN4L 4M1CD 3PHOA 3OHXA 1WZMA 5CKAA 4JN1H 3BP4B 1AGFB 1MHPH 1FIGL 3QP3A 5JW4Q 5EUKB 1X6NA 4PJBB 1CFVL 1TJHL 5IHLB 3VD3A 3O9WB 4PRHE 3MJ8B 4QTIL 3NBNA 1JPTH 1AQKL 5C0DB 1A2YB 1CT8B 1IGCL 1WBYA 2LTQB 4U0RB 5LXGH 2R9HC 4AM0A 4MLIA 1M4KA 5I15H 3S96B 4GBXC 5F7EH 3OWEA 4DOHB 1K2DA 1RU9H 4TPRL 5DJZA 4EI5A 1BLNA 3BKJH 1FL3B 5JQ6H 2VWEE 1IM9D 5C0BE 5T3ZL 3LCYA 5IG7B 5E8PA 4OFIA 5HGAA 2BNRB 3QQ3B 4HS3B 1AIFB 2BMKA 3IF1B 4JQXA 3AY4A 4J3SA 4YPGA 4PY7B 1YEDA 2AP2A 5DD0L 5IFHH 4TQEH 4PLKD 2VUOA 5DZOA 2R39A 4I9WE 5B4MD 3TH2T 5BJTB 3U36B 2C1PA 1BM3H 5JXAL 1F4YL 2EIZB 2QSTA 4KHTH 5DVLA 5FK9A 2EDXA 1U8PA 2X1QA 4WHYG 3CDYA 3TO4B 4XC3H 5BXFB 4B0MM 1CLZH 1A7NH 3QIUB 4G8IA 2DQTH 1FBIH 1YEIL 4MQ7A 4PGCB 1QKZH 4ZUSB 5IROC 4KKBC 4WDIA 1R3IH 3KVQA 4BZYA 3IDGA 3I85A 4WY7H 2H2PD 2WWKO 4U7MA 4I2XB 4PREA 1W0VB 2PXYB 2OTUB 3QEHB 2AGJL 4G7YH 5IFJB 3MV8D 4HQQL 4EUPH 5HHME 2DB8A 1MJ8L 3B6SA 5CP7A 3BD3A 1DBKL 1FFPB 4NGHL 3RVUC 3UO1H 3S9DB 2CJUH 1FO0B 5JXEA 1QNZH 2V9RA 5H37H 5BVPH 2AXGB 2F5BH 5HGDB 5I66B 4Y1AE 2YPKB 1F4AA 5I1KL 2EDRA 1RPQA 4JG1H 3SDDC 1VGKB 3C60D 3WKNA 4CVUA 5BCAA 3V0WH 3LEVL 4ZFZA 3U4AA 3AUVA 1QSEB 3F58L 4NWUL 5IMMA 2ADIB 4F80A 3HUJB 2OXGA 2YSSB 3CSGA 3VI4E 3FJTA 3ZTNL 2EDJA 2MQ0A 2Z92B 3LSOB 1NL0L 4HLZG 4ZXBD 5HY9A 5C2BH 1YNKL 1RUPL 4CMHC 3BGFB 4UT7L 1J11A 1FIEA 4EOWL 4LKCA 1PLGL 2D2OA 2YHGA 3L3IA 5LQBL 3VI3E 1GAFL 3MBEC 1MPAL 5FKAB 5DJAB 4QKXB 1W0WA 2F74A 1X5HA 5B22A 1LNUA 3UZEA 2GJ6A 3Q3GA 1HOCA 1YYMH 4NZDA 4XP1H 2D7PA 1PD6A 3MC0A 1OP3K 2C3VA 3ARTA 3RWGA 5GRYA 1RZ8B 5IR1B 3O8XA 4I3RL 1QBLH 2VOTA 5GS0H 4TULH 1C08B 1PBYA 5TDOB 1C5CH 4P2YA 5F3HB 5JLZA 4FFYH 4YPJA 4ZFOA 1CR9L 2IQAA 2WWKT 4PV9B 3N9GL 3S4SG 3WLBB 4OCMC 5C08A 1XGRB 3I9GL 3DX9B 3MRLB 4K71B 5A2IH 4P0DA 2C26A 5EO0B 4DZ8B 3C6LA 1ZHNA 4JZJA 5CP3H 4LARL 4NCC1 5C6PB 2R29L 4ERSH 2P42B 1PY9A 2HT2C 3WXVL 3NIDF 5DK2B 3NGBC 4G8GA 3ILPB 1CDYA 1S7XB 2WK2A 1WAAF 3MOQA 4YDJB 3HG1E 3PIQA 3T2QA 4F7CB 3BOVA 2H41A 2NNAB 4GG8B 1Q94A 4MD0A 4POZC 3EOBA 1T89C 3VXSD 1NAMB 2I60H 3VFMA 4NC1C 2YN5A 3CX5K 1GGIH 4NRXA 4BH7B 4Z7VE 3QISA 1F3DJ 1UEMA 2W0FA 3BZFA 4MYWB 4MAYA 3PE9A 1N5AA 3QUYC 1B0GA 1TQBC 2E9JA 5KN5A 2Z31B 2C3XA 1OAKH 1J1XH 4HXBH 3HPLA 5J6HA 1P53A 1PEZA 2X41A 5GGRY 1T3FA 5C3LD 4NQCD 3RTQB 2YMXH 1A4KA 4WFGE 1T22A 1YPZB 2GSGA 5CUSL 3SQBA 4YGAB 4ZOCA 3WIFB 4P59H 4ESKA 3OJVC 4DQOL 1U2CA 3JV6B 1MCRA 5DD5L 5CD5C 1INDH 1XGYH 4XC1H 5T3ZE 3H7BA 3FRUB 2WWMC 2VLMD 5JOPE 1CQYA 4X5XB 1C16A 1U8QB 1F45A 3TIDA 4HV8B 5C9KA 3GSUB 1Y0LB 3BDXA 2J6EA 2XQBL 3E6HB 3QIBB 1ORQB 2RB8A 4PLNC 4N8VB 2FL5A 2FATH 5DJ8B 1G9ML 3KR3H 1DL7L 1EUTA 2IMNA 3OKEA 1FNGA 3WD5H 5J13C 4NQED 4GRWH 2PTUA 2BHZA 3S35H 3U30C 3TYGH 4ZPVB 3DSFL 1T1WB 1N4XH 1FH5H 4JAMB 6FABL 3K7UA 1XGTB 5BO1H 4G80B 1JZ8A 1EEYB 3IRPX 3B9KB 3EZ8A 1G9NL 2P24A 2HT4D 4IRSA 4P4RA 3PWUB 2XTJB 3PABB 1IC7H 3MV7A 3DX7B 4MQTB 5JHDD 2HRPL 2AEIT 4YHPB 3DBXB 5GS1B 5E8OB 3MO1A 5JPNB 5DFVC 1G7HA 2GFBB 4IHOB 3IU4H 4NO0A 2NXYD 2VO5A 1MUJB 4OM1H 3WNKA 4OZGA 3MV01 3LIZH 3MFGB 1BWMA 4WO4D 4HWEH 2H26B 1CICC 4NQUA 4IS6B 2NPLX 1EO5A 4PLJD 4KWUA 1KPUA 2FD6L 3EYVA 2HT3C 4NBXB 3RGVD 4LIQL 3D5OF 3BP6A 5DO2D 2GTZB 1A9EA 1KCLA 4TNVK 3QJHA 5GJSH 5MERA 4P23B 5A43C 1KIUA 2X4UB 4OLWH 2IBZY 3RI5K 4K3DH 4RGND 3CH1B 4ZFGL 3MNWA 4M1DH 1BQUA 4FTVB 5IW1A 5D8JH 3QCUH 3H9ZA 3VRLF 5DHVB 5ADOL 4MB5A 4Q6IA 2VLLB 3QDGD 1YC7A 4NHCL 4EN3A 1AQDB 1IL1B 5EFIA 2Q3AA 1A1NB 3GMOA 5J0BA 3GI8H 2ATKA 3RUGA 4AG4L 4RAUB 4PRHA 5JNYB 5H2BA 5HBBA 1XCTA 1AXIB 1NAML 2AJXL 2Q6WB 4AQ1B 3RRQA 3WIHH 4JHWH 5C0IA 4M61B 4CN6A 4JPIA 1QRNE 3QI9B 1VFBA 1I85C 4TNVF 5H8DA 3ULSA 4EJ1C 4PJBE 5IVZB 1OTSC 1IAIM 4WU7A 4HWBH 3VXMB 4LSUH 4MDIA 1XT5A 3QQNA 5C0BA 3TH3T 5EIVA 3RI5F 2YXMA 2VQTA 3RX5A 4EDWL 2AKRA 5MENA 3VXQA 1I3GH 4U6YA 2J12B 2VDOH 3CXHK 4LVOB 4X0KB 4NO3B 3FQRA 5FV2A 5FO9A 5K9JH 4HMCA 4LLWA 1TZIA 2D31B 1IGTB 4BQ8A 4DOHE 1GGYA 1MFAH 5JPMB 3CFJB 1E4JA 1S7TA 2APXA 4IDLA 2DWDB 3RL2B 2ICWA 2ESVD 1EEUA 1FNHA 5I1CH 1FLRH 3FQXA 5ITBH 3P77A 4ZFFB 2BNRE 3W39B 5EZJA 2F19L 5K9QG 2OMNA 5IOPB 2VR9A 5D7KE 3VXRB 2AJVL 4RCAA 3IJHB 3LMJH 4QRQB 4UV7L 3PL6B 2QSVA 5A3ID 1DQQA 5INCB 4GAYB 5JDSB 1S9YB 5DEFB 5EORH 2RCSH 1FVCB 2D0FA 1Q9OA 4K55A 5DMGD 3IB4A 5FM8A 5DEGB 3QEGH 3OGCB 4IRJC 1S3KL 1GZQB 4MJ5B 2CRZA 1CD9B 4GRLC 3DRQA 3ET9F 4LF3A 3MCKA 2XY2A 3O41A 4HHAA 5C0AD 1K8IB 1EERB 1I75A 3TBSB 1G7JA 4XCEA 3NFPB 4H0HB 4LLYB 4R4ND 3PHSA 3M17B 2APVA 1CBVL 2YD4A 4NZRH 1NMBL 1CD1B 2HLFC 3B9EA 1ZE3C 4I2XE 4P2QD 3RPIA 1IILE 3HZVA 1HWGB 5BRZB 4UTBH 2JLLA 3L3KA 2NY4B 3V95A 3L3JB 1I4FA 2NTFA 1EO8H 2HVJB 3EDDA 2BC4A 4WW1A 1YMHB 1I7UA 4GAGH 4NM8L 3ULVD 4P4KC 2YWYA 3S36X 4UBDD 4EVNB 2NW2B 1SYSB 3OZ9H 5IVXB 4GKZB 4CADB 4X8JB 1A1OB 1Q38A 3B2UC 2BY2A 1IGFL 4WNQB 4WVRA 1YY9C 3V0AC 2V5TA 3BDBA 4N8CH 4XAKE 1AC0A 4N0YH 1AC6A 2DLHA 3MLWL 4NQSB 3S5LA 4DAGL 4H20H 3RKDD 25C8H 1QSEE 4IJ3B 1ED3B 2AQ1A 1G1YA 5CJ8A 1P1ZA 4Z0BL 4JJHA 3M1BB 3HUJE 4NO5A 5D72L 4ODWA 4OM0H 1MWAB 4X98A 4L3CA 2PW1B 4OUUB 3QXTA 1FL6A 1BQHG 3D39E 3IFPB 12E8L 5L88L 5E99H 1W0YT 2ZSWB 1N26A 4AENA 3LS4L 4H8WH 4F15C 2H2SC 1UACL 5F6IB 3CSPA 3OXRB 3GSNA 1CGYA 2A6KA 2JB6B 3BEWB 1JWMB 1KPVB 3GMPB 4ZNEE 2AXHA 3BH8A 5DUMH 3K2MC 4UAOC 4XPHL 2PO6B 5TE6H 1MFBL 3SQOH 4EZMA 4K8RH 1KTDA 3D25B 1XIWD 2Z91A 1RIUH 4Z7WB 5F96L 3I02B 3WHXB 1RZJH 2CDGB 3RQ3A 2WANA 3ULUH 1AJ7L 3O6MH 5I30L 4P48A 1NBYA 1A4JB 3RWIA 3FT4B 2BFVH 2X44D 5GS2D 3JZ7A 4BFIA 1JNNL 2DKSA 4J4PD 3HG1A 4GW5A 4F58H 2NX5A 5HI3C 5IBUG 3SOBL 3KPOA 3DNKA 4Q9QL 2VXUL 4E41E 1AR2A 3GRWA 5FHBL 1QYGH 2J88L 5D70H 5SWSD 3QIWD 5HYQB 3HE6A 1OAQL 1C8PA 2C1OA 3SKNB 3RY6C 2RIKA 5HDQL 1R3KA 4Z7VA 1UJTA 3KYAA 4GBXB 2AJUL 1W72H 3P9MB 3FONA 2ZCLL 3MR9A 3P9LB 3KPQB 4M43L 2V7HA 2O5ZH 1P5VA 3H42H 5FYKE 3THMH 1A3RL 3DIFA 5F1IA 2CK2A 3QQ4A 3AS1A 1IJ9A 1DBJH 4YO0B 4JKPL 2O61B 1AKJB 3ZHDA 5DJ0B 4TVPD 4JHAH 2R4SL 4ZTOH 2D9CA 2CLVB 4BZ2H 5FM5M 1LE9A 1CXFA 1DQDH 1IKNA 3DTXB 2XI9A 5GZND 1N8ZB 3B4NA 1T7WA 4MSWA 2W9LA 5KJRH 3WFEH 3R4DA 3KDMB 2NY3C 4Y5VA 4CU8A 1FGVL 4XI5D 2QR0B 3S8WA 3LKNA 2JJSA 2RAMA 4M8QA 4PTUB 3TBVA 1UM4H 2GQHA 2JK5B 1OD7A 5HD8C 1QEWB 3GSXB 1X5KA 2QQKL 3G04A 3MNZB 4QXUH 1NSNH 3RPKA 2B0SH 2DQEL 2VDQH 1RJLA 1F4WH 5HYJA 4KRNA 4ZAKC 4LSRH 4DTGH 3H3KA 3MLTB 3BMVA 1ZS8B 5HPOA 2D7NA 4K3GA 3BZ4A 4X6BB 2C4FU 3GMLB 5AUMA 3MOBL 1Y18A 1Q9KB 2W0KA 3NTCL 5TF0A 3WNMA 1G7IB 2X1XR 3EO1B 2VXVL 1K4DA 3QYCA 3KPRB 1R0AH 3QQ9C 3DUUB 1ZHKA 1X7QA 4MNHA 1MFEH 2AK1H 4Y2DC 1MWAL 3QCVH 4F7TA 3ZKNC 3VXUD 2AS5M 2XFXB 3VRIB 2XTJE 3NN8B 1TNMA 3IJYB 5AAMA 1U8KB 4HKZA 3SDDB 3KGRA 1AGBB 2VLKB 5BV7H 5BS0B 5IIEA 3CSYA 2FNBA 1JK8B 2FYYB 5T3XH 1PAMA 3VFGH 3P11H 1I8KA 3EO9H 1T04B 3GDBA 2V17L 3FO2B 4KJQC 3MGTB 4M6MH 4CMHB 5BMFH 1AGDA 5T5NG 4GO6B 2JCCE 3RKPA 4U0QB 3RAJL 2OQJA 3QXVA 4FZEL 4KU1A 3MBEB 2HN7B 1OB1A 1DQMH 1I1FA 5B38G 3U2SA 3VXPB 2AXFB 2AEPH 2ARJQ 3QZWB 4K9EC 1RK0A 1QQDB 4OD3L 2I25N 2EEDA 3RVVD 3LQMA 5GS3A 2BOCA 5GS0D 2XRAL 1ZHBB 4OKDA 5DSCB 5ALCL 4AYFA 1JV5B 2XYCA 3TESA 5DZNA 1RHHB 4FTVE 1ZVHA 1I7ZA 1CDBA 4WFHE 1U3YA 3S6CA 1PG7L 3BP4A 1AGFA 3FZUC 4Y16C 4LRIC 4Z8FH 3U7YL 4UQ3B 2ZOLB 5EUKA 3FCTB 4PJBA 2CIKB 4JPWL 1AR1C 2Z8VC 4FG6D 3KLHD 3DI3B 3WKMH 3RBSA 3O9WA 1D6VL 5C0DA 1A2YA 1CT8A 3MRBB 3BZEB 2WM0A 2K3TA 2YD6A 3S96A 1JMXA 2A6JA 5HYSB 3NGBB 3SE9L 4RGOH 5E56A 1X5JA 2X09A 2VZSA 3UYOD 2NXZD 3QDMD 4QRSA 2NR6D 2ICWJ 4O02L 2HKHH 3GB7B 2BNRA 3QQ3A 3GHBH 3I84A 4JY5L 3C8DA 4HS3A 5H35B 1AIFA 3IF1A 4U2YA 3R0NA 4WWID 3VFSB 1UWXK 3I3BA 3TGXA 2CK0L 2UYLA 1OOAA 1MJUH 3A6BL 3ARDD 1RIHL 1T0MB 4OLYL 2XOTA 3SGDH 3D9AL 1QLEH 3QUYB 1TQBB 3BKCL 4UZGA 3SN6N 5I71C 4OZFH 4OZIA 1W2KT 5BJTA 3LPGA 3U36A 5L9DH 4ODHH 1U92A 4DZBB 2XWBA 3UDWC 3DOSA 3FQWB 2EIZA 1H9VA 5IJVB 1AY1H 1TVHB 3B5GA 4BJLA 4TSAL 1JGUH 3TO4A 1OTUD 1BIHA 5BXFA 3QIUA 4KXZI 5E5RB 4QRUB 2Q8AH 1CE1H 1ZGLM 3F5WB 4PGCA 5HHOB 2UZIH 4ZUSA 2R2BB 2GJ6D 1HHGB 5JHLL 3V6BR 5EOCJ 5JA8B 4GAJL 4O5LL 4UIKL 3GZKA 3LKOB 1F3RB 2CRYA 1W0VA 2PXYA 2OTUA 3JTTB 3QEHA 3RVWD 2MHAA 4GSDL 1ZKAA 5DD3H 1RUAL 4PS4L 4CKVX 2IMMA 5CSBA 1FFPA 3I2CH 4Z9KB 4HUNB 3J7HA 3IKKA 4XP5L 5ESQB 3BP5B 4PLKC 1MCNA 5J13B 3U30B 2KH2B 4HJ0C 5SWZD 5ICYB 5B4MC 5BRZE 3FOLB 4PRDB 2AXGA 1TQCC 5HGDA 3E3QE 4YFLF 4FNLL 5I66A 5HVWA 5AZEL 2YPKA 1VGKA 1VA9A 3RWDA 4LDLB 1LDSA 3EDJA 4I0CC 4QWWD 3O0RL 1QSEA 4QHKI 1GPOH 2C3HA 2XZCH 1KB5H 3PGFH 2ADIA 4PB0H 2FH6A 3T3ME 3HUJA 2YSSA 5HXMA 2FWOB 2Z92A 5D1XD 3LSOA 2CRMA 4Y5YC 5D93C 1G7PB 2H2PC 4N5UA 2A6DB 1QTYT 4YFEA 4YH6A 2XT1B 3C2SA 2R0LL 1CICB 1QO3B 1VFUA 2ARJB 2VZVA 2EC9T 1SBSL 3BIBX 5D71H 5DJAA 5F9OL 5FKAA 2A9NL 4MAYD 3G6DH 4ZNEA 5FUOL 4IDJH 2AQ2A 4ETYA 2NZIA 3MV9B 5DVKA 3Q2CA 1ZLWH 3CMOL 3KLAB 4OV5B 1WEJL 4QXGH 4YGVB 2IFFL 1RZ8A 5IR1A 1TITA 5I1GH 1ETZB 5FKPB 1E4WH 1C08A 1SVCP 4HT1L 4HULB 5F3HA 1OLLA 3WHE0 1KEGH 3BKYL 5MEQB 1WCBA 4PV9A 1A9BB 5SV4A 2UY6A 1KIRA 1ZANH 1HXYB 1XGRA 3MACL 3MRLA 1JRHH 3W0WB 4J3TA 4M7LH 5CEZE 4Z7WE 3GSVB 1XAUA 4ZXBC 2EE3A 3QWRA 5FYJH 4O00A 4UT9L 5FIEA 2IQ9L 4OLUL 5DK2A 4AEHL 4JY4B 1S7XA 4UNUA 4XPBH 1MCWM 3U9PH 2ZP0T 3IAQA 5B39B 3VJ6B 4ZUUB 2K7QA 4YDJA 1G0DA 5IV2A 2P46B 2YN3A 4F7CA 4GG8A 5IVNA 4MCZB 1KBGL 3ROLB 4G5ZL 4OKVB 3WNOA 4HDIB 5MEPA 3MRJB 1NAMA 1QUNA 5C09D 4XXCC 3QXAA 4HUMB 4OD2B 4BH7A 2PYFB 2QQLH 4YDLC 4G3YH 2CGRL 2VKXA 4QHLA 2EO9A 1AXSB 1I9RL 1NLDH 2I5YH 2Z31A 5ISZD 2QV2A 2EXWD 4OIIL 3W9EB 1NFDE 3BSZH 5IHUL 3NACL 2WIMA 3RTQA 3PWNB 3NCYP 1IGML 4DFIA 1UJ3C 2UWEF 3MUJA 3WSQL 1T6VN 3TIEB 1YPZA 1NAKL 1KPRB 3WIFA 4CN4A 1S8DB 3JV6A 4I3GA 4F9LA 4HXAL 3FRUA 1NUNB 4L9LA 4G8EB 4X5XA 5HI5D 3VH8B 1U8QA 4Z76A 4P5KB 1KCRL 4HV8A 3GSUA 1Y0LA 1C7SA 3E6HA 3QIBA 1M7IB 1ORQA 5DWUL 1ZA3B 5FHAH 5JA9A 4N8VA 3UJTH 4IRJB 5GRXG 4F57L 4GRLB 3EYSL 3AMKA 3EJJX 2R56L 4XMLL 4ODUB 2MTPA 4JB9L 4U1GC 3WS6C 1CG9B 5F8QC 5TE4H 4YUEH 4ZPVA 1NUFA 1JZ3A 2NY1D 2EDQA 4JAMA 1LK3H 5F6HJ 1XGTA 4G80A 3V4VH 3RWFB 4JR9H 1EEYA 1RZKH 3B9KA 5GJTL 4CAGA 1IFHL 1O7VA 2G5RA 4JHBA 5FDYA 1HKFA 1FPTH 4RRPG 3PABA 4O9HH 5DFWH 4OI7A 3O45B 3BHBB 1B0WA 3DX7A 2CDFA 4APQC 5GS1A 3KPRE 3DBXA 4P4KB 5E8OA 5F9JB 4KK6D 5JPNA 2GFBA 4IHOA 3V9FA 4PGBB 1AGCB 1A47A 1MUJA 2AABL 4PRIB 3RU8L 5C0BD 1BD2B 1S9VB 3ZE2F 2H26A 2EC9U 4MB4A 4IS6A 4Q7DA 4N0UE 2HJLB 2BSRA 4XVSL 1NCWH 4ZS7L 2N7BA 4P5MB 1PKQB 2VLKE 4FP8H 2GTZA 4H1LB 5BS0E 5E08H 4FQIL 3GNMH 4MZ2A 2AVGA 4I9WD 4P23A 1U8OB 3JWOC 3BPCB 4YWGH 9CGTA 3S36H 3CH1A 3L3OB 3GIZH 3WNLA 1KN4L 4FTVA 3NCFB 3KXFE 5EA0H 2YRZA 2NY6C 1JHTB 4BFEA 1JGVL 4R7DB 5DHVA 1FNEB 1X5AA 1RQ5A 5IJKA 1IBGL 3ARWA 3O4LA 4F15B 4ODSL 2Y6SD 3ULVF 2VLLA 3MRRB 4RIRB 1OARL 5D6DA 4ETQB 4S11A 4IEFB 1AQDA 4UAOB 5CIPB 1IL1A 1BEYH 3BUTA 4RNRB 2YD1A 4RFOL 1A1NA 3PV7A 5I1IL 1LDPL 4RAUA 1U3HD 3V7MA 5JNYA 3TWCH 4OSUH 2Z4QB 5K59F 1DBMH 2JJTC 1MCSA 5HHMD 1A8JH 2Q6WA 4PLJC 1LP9F 4M61A 3DXAD 2H3NB 1KF9B 5GRVL 2XACC 4OJFH 1VKXB 3QI9A 2MNUA 4RMSA 3MGAA 5IVZA 4LOUD 2V7NB 1SEBB 3STBA 3VXMA 3QO0B 1T03H 1KNOB 1LO3L 3SEPA 3LEXB 1U36A 1Q0YH 1YN7B 1MCQA 4U6XB 4FQCL 4Y1AD 1A3LH 2D31A 1IGTA 2FECL 4PJ9C 3BRFA 3CFJA 1RHFA 2IAMC 3MBXH 4Y88A 2DWDA 3RL2A 1UA6H 1A0QL 4GXVL 2HMID 1NC4B 1T66D 4ZFFA 5JW5B 3TVMD 3W39A 1AD0B 5IB5B 3F62A 5IOPA 1P6FA 3VXRA 1V7NH 5IQ9B 1AD9B 3IJHA 5HHNB 3L5JA 4QRQA 1PGRB 1SYVB 1MRCL 2ADJB 2GY5A 3ZTJH 5JIPA 4TNWK 4Y8DC 5INCA 5JO5B 4LAQL 4L4TB 4GAYA 3F65A 5JDSA 1S9YA 3T8XB 4EEEA 5DEFA 1S78D 1FVCA 4KROD 3X13B 2E7LC 1T80A 4MDJB 4H0GA 1OAZH 1HHHB 2NY3B 1WBZB 5DEGA 4OF8A 5I1DB 3OGCA 1GZQA 4MJ5A 1GIGH 2XQYG 4K3HA 2D4DA 4G6MH 1K8IA 3ZKMD 3G9AB 2VL5A 1T83C 3BO8B 3TBSA 3CUPB 1YYLL 3TF7C 3T2NH 5HHOE 4DN3H 3O3DB 2FR4B 3MA7B 4LLYA 3P30H 3M17A 4M9OA 4S1SH 2WP3T 1G6RB 2Q87A 5C92A 2JE8A 2R4RH 4MGXA 4ZAKB 2HTLC 3PG2A 5BRZA 2DQJL 3CLFH 1E28B 1XMWA 1SY6H 3L3JA 4HJGB 3UTQB 4LK4A 1YMHA 4G6KL 4K3JH 4TNWF 3RWEB 4EVNA 4P9MH 2NW2A 1LEGA 1F42A 1SYSA 2DIAA 5E7FA 3TA3C 5IVXA 4GKZA 4CADA 4X8JA 3HG1D 5A3IC 1A1OA 3GKWH 2N4IA 4WNQA 4I3SH 5CJOL 2HJKB 4Y2DB 3QWOB 5IT2H 3IJSB 4YDIH 4PUBL 2DIJA 4BM7A 4WWKD 3ZZ1A 1HEZB 2GITB 4O58H 4NQSA 1UG9A 5T3XD 3STLB 2AK4B 4LPYA 1ED3A 3MRQB 1OD9A 2HWZH 2XZQL 3M1BA 4WUUB 5KSBE 1NGZB 1MWAA 5J89A 3SHSA 2VH5L 4OUUA 4R4NC 4RDQF 2AJSL 5FFLA 5L7XH 3C8HA 3OR6B 5CINL 3IETB 3AXLB 3IFPA 3IFLL 3SDXF 2ZUUA 4R4FH 1VGEH 3RDTD 2ZSWA 3KYKH 2F54A 3W11D 4RAHA 3OXRA 2JB6A 1KPVA 4Y19B 3ULVC 3CXDL 5T3ZD 3QUXC 4W70A 2PKDA 3MV9E 4JZOB 5JOPD 2PO6A 4XCCH 1RY7B 4WUKH 3KHQA 3D25A 1HQRB 1IKFL 4Z7WA 5GXBB 3I02A 4QOKE 3WHXA 5LGKA 2CDGA 3MLSL 2J4WL 1D5MB 3WHE1 1A4JA 5EO9B 4DJMA 3CFBB 3FT4A 1H0DB 1BVKB 1IQWL 1MCPL 4HGMA 4NKMA 5F71A 1NANI 1MHCA 4KAQH 3VFTB 1BPVA 1RUMH 3T3PF 4OQTH 5T5FH 4NKIL 4Y16B 3RKDC 3GFUA 3AS2A 4E5XB 2CXGA 3W0WE 4PRBB 4HC1H 5D7JD 5HYQA 2IFGA 1P84K 2FX9L 4EBQH 3NIDE 2OP4L 4GBXA 3P9MA 3HRPA 4OBRA 2X89D 1B4JH 3P9LA 3KPQA 4DGVL 2R8SL 2W0PA 2JELH 4MVBD 4D8PB 1FLTX 2GY7B 2IANA 1CLOL 2O61A 5DJ0A 1HN1A 1WITA 3WJLC 2CLVA 2MWCA 5K93A 4KK9D 4MHHG 5DURD 4JGMA 4LHUB 3O2DL 3OMZA 3DTXA 4BUHA 4MQXD 4G8FA 4C56E 3A67H 4HIHB 5KW9H 4QRRB 1N8ZA 3HI5L 4GUPB 4YDKH 3S3SA 4J4PC 2XA3A 2X1WL 3WN5C 4YHZL 5I71B 4PJ7B 2QR0A 2MKWA 2GUOB 2I9TB 3IDNB 5F89B 2IH3B 3SGEH 3QIWC 4YR6B 4E0RB 3R0MA 2F53B 2JK5A 1YY8B 1A6WH 3SGKA 1QEWA 3HR6A 3GSXA 4LLUB 3S37L 3MNZA 1MRFH 5IROA 1CFBA 1JF1B 4LKXB 1NGQH 4I13B 2FGWL 3MREB 5KS9F 3MLTA 1ZS8A 3EGSB 3ZMRA 1FE8H 1IM9B 1I3RA 4X6BA 3JV5A 4X9HA 2ZZUT 3GMLA 5DI8B 4MS8C 1Q9KA 4PJGA 3EO1A 5CCKL 3KPRA 1N5YL 2R2EB 1Q1JL 2OTPA 1QRND 3DUUA 3FAXA 2DQGH 5GZNC 1DCLA 1JUFB 1FZKB 4I0PC 3D85B 5DQDL 5EBWB 1DUZB 3TPUB 2XQYK 3VD9A 3TCLB 1GGBL 5JIIA 4L29B 3LKQB 1TQCB 5DRZA 2VDPH 4MJ6B 3D3VB 1P2CB 3VRIA 4RZCA 3NN8A 3IJYA 1U8KA 2BXZA 4TRPL 4Z7UF 5E5MB 5TQ2H 3SDDA 1AGBA 2VLKA 4X8XA 1BHGA 3OV6A 4BA8A 5BS0A 1A5FH 1KIPB 1ITBB 4PRIE 2FYYA 5DC9B 3QDAA 1OAYL 1BBJB 1BD2E 2DKMA 1T04A 2BNRD 5ADPL 3O81A 4K9EL 3FAWA 1HHKB 1BBDL 3FO2A 4Y5YB 4JFYB 5D93B 2ICCA 4R0LA 2G75B 1GOFA 2FX7H 4Q97A 2DYPD 2CXKA 3BDYH 3NIFF 3MBEA 3WUZA 1KLFA 4GRWF 3V52H 2HN7A 1PKQE 1MAMH 4HPYH 3MV8B 3VXPA 2AXFA 3P0VH 5KOMC 3QUMH 3NPZB 4NRZB 3QZWA 4HMEA 1QQDA 3QPQD 2BDNH 3OKNB 4LSSL 1LD9B 3UTOA 4N0RA 5DSCA 3AM8A 3SKMB 2J6EH 1FC1A 1JV5A 3BWAB 1RHHA 5K9QI 3QUZD 4TTGA 1Z9LA 3BAEH 1A7PH 3V4PH 3VRLE 1MCDA 4M6OH 4J12A 3D87B 4LGPB 4M48L 1TFHA 5CJQH 2ZOLA 2VDMH 4Y4HC 3WNPA 2CIKA 2V2WB 2XPGB 4DW2L 4X4YA 3MRNA 4UDTB 4OCNC 3RIFK 1NGWB 2ZNWA 5E00A 2PXYD 2EH8H 1TETL 4LPTA 3MRBA 1U8NB 3BZEA 4ZXBB 2YUWA 3HAEB 2ILLA 5C0JB 4U7KA 2ZPKH 5HYSA 3JUZA 3OJDB 3WFCL 3NCEB 4FQ2L 4Y8AA 1EVUA 3O2WL 3VFNB 5I8CB 2YKLH 1I1RA 3SE8H 5FYLH 4Z18A 3GB7A 3RVVC 3S5LG 5H35A 5GS0C 3B9AA 1T89A 2OJEB 4KH2A 3VFSA 4XAKD 3L95B 4NUGL 1WSST 3DROB 4TYUA 2VXTH 3HHRB 1T0MA 4YDLB 1QFWH 3DVFA 3QUYA 3WEXB 1BQHB 1ZT1B 5HGBA 1D5XB 4J6RL 3RIFF 4WJ5B 5DLMH 4DZBA 3D39D 3FQWA 4UB0H 3GSWA 1TVHA 1G6VK 3L1OL 1UJ3B 2W9EH 3QG7H 5DTFB 1IC5H 3BE1L 2HH0L 4QRUA 1IQDA 1X5LA 3F5WA 5B21A 4U1JB 1I1AD 5GQBA 2R2BA 4L4TE 5CZKA 1BAFH 1HHGA 2Y25A 4U6HA 2EECA 2NR6C 3LKOA 1DVFC 4QT5A 1VPOH 2XKSA 3JTTA 4XCFH 3BIKB 3LZFH 1E4XI 4X5LA 5ELIA 4OLZL 3VXSB 4LCWE 4FQJH 4HUWA 1F90H 3ARDC 4JFOB 4K7PX 5ESQA 4Q2ZB 3IFNH 1P7QB 4U1GB 4KY1H 3B2VH 5ICYA 3QHFL 4PP1C 1VFMA 2J8UF 2OMBA 3INUH 4E41D 3FOLA 2IALB 4PRDA 3KJ4C 4HZAA 4JRWA 1OPGL 4UMGA 5A1AA 2X05A 3MUZ1 3U4BH 2FEDC 1RK1B 1Q72L 5SX4H 1X4YA 2MSPA 1U58B 3JWNC 1OP5H 3T4AB 1MQ8A 1OAUH 4APQB 4KZEL 5FYKD 3PGDB 4MCYB 1SEQH 4JFHE 3Q48A 4RBPH 3P73B 1JPSH 2WNGA 1G7PA 3CC5B 2A6DA 1M7XA 4QCIB 1P4BL 1CICA 1QO3A 3RVWC 1NGYA 1XGPB 2ARJA 5KTEL 1HKLH 1IGJB 2AK4E 4V1DD 3IYLW 2H32H 4FQQB 4WUUE 2Z31D 3MV9A 2YK1H 5EU7C 4Y89A 1FRGH 5TDNB 3AVEA 3KLAA 2ATPB 2Z93B 4J2XA 5GHWH 1Y6NR 4OV5A 1MFNA 5DF0A 3RTQD 4YGVA 3OKKB 1ETZA 4YHMH 5FKPA 4NN7C 4R3SB 5D7IF 2NY6B 1OSPL 3QB7C 4Z95H 4Y19E 5A2LH 3MJ9H 5MEQA 2CKBB 1A9BA 2HG5A 3IDYC 2AJZB 3STZB 1HXYA 5IEHB 3EOYG 3W0WA 1Z6JT 2BOBB 1UCBL 3QIBD 3N50A 2ZCKL 3TJEL 4P3WA 5D1XC 2PTTB 1R24B 5I75C 4JCLA 4JY4A 2HRLA 3BIAX 2EDDA 1NEZG 1S7QB 2DLGA 5B39A 3VJ6A 4ZUUA 2JB5L 1WAAA 4JANB 3O2VL 4WFEE 4K2UH 1I85A 3CVIH 4JGJA 1GH7A 4OZHF 4OCXH 2C3WA 4MCZA 1UM5L 4XNXH 4DKFH 3ROLA 4M5YH 4MJIB 4OKVA 3A6CL 5LCVH 2LU3A 4HDIA 3MRJA 1E4XL 2GI7A 3OGOE 2DIBA 3HMWL 5LJYH 5DUPH 3JWDC 1S9XB 1RIVH 4OD2A 1WIOA 2PYFA 4YXHH 4KC3B 2D0HA 3VG0L 3O4OC 3U0WH 4L8CB 3QDHA 4PJ9B 3QCTL 1AXSA 15C8L 2IAMB 1F3JB 4JZNB 3W9EA 2ADFL 4NNYB 5E4IA 2IJ0C 1Q8MA 2OTWB 3BGAA 3PWNA 3V5HB 5FO8B 5I18H 4M7LT 4U1KB 1KLUB 2UWEB 1KPRA 5B38B 4KUZL 2I24N 1S8DA 1OGTB 1DQTA 3TT3H 2X5PA 1EBPA 4QRRE 4FQ1H 1CI5A 4G8EA 4PJDE 4Z7NF 4P5KA 5IQ7L 2YPLB 3QJFB 3S3JA 1BQSA 5CLWA 4P23D 2YZ1A 3P4NB 4P2CG 1M7IA 1ZA3A 3K2UH 4ZUWB 1FAIH 4YBHA 4IRJA 4FTVD 1BX2B 1MQKL 3NZHL 2F53E 4GRLA 4B5EA 3VFUB 2ZJSH 5GGSB 1R3JA 1RURL 1HWHB 4M03A 4LU5L 2C3GA 4ODUA 2NMSA 4IOSD 5ALBL 3QNYB 3O6KL 4JRXE 4IMLA 2G9HB 2H1PL 2DQCH 5ANME 3RWFA 1Z2KA 4HUXB 3A0OA 4HF5H 5DGRA 4DN4H 4WEBL 5I1EH 2VR5A 1VESA 1MFCH 4CU7A 3B8SA 3C6SB 4BKLB 5FDWB 1FIGH 3O45A 3BHBA 1YEJH 4P4KA 1K5NB 3I75B 5F9JA 2ICES 3QI9D 1F4XL 1IEAB 3TA3B 1IGYB 4PGBA 1AGCA 2I26N 4UOW0 3C2AL 4NHUA 4PRIA 4QTIH 1BD2A 3HNTL 1S9VA 5EB9A 5I9QC 3B9DA 4XNYL 3QBTB 4JFQB 3D3VE 1CGTA 4LDEB 4LEXL 2HJLA 3JWOL 3TYFB 1M7DB 1YJDH 4P5MA 3BN9D 3RNKB 1PKQA 3G9VA 5AEAA 2OR7A 5C0AB 1E27B 3H9HB 4H1LA 1GC1H 2VL4A 2CKBL 3D2UD 2QADC 2W0LA 1MCFA 3MOAH 3RJQB 3HI1A 3BPCA 2FX8L 2Y36L 2DBLL 3WBDA 4OTXL 3O11A 4WI3A 3L3OA 4CRPA 3CFCH 2WUCH 5DD0H 4ORGB 5DVNA 4LCUB 4R7DA 4DGYH 1FNEA 5IVOA 2ZUWA 3PL6D 2HFFB 3MRRA 4RIRA 3VU2A 3X11B 4ETQA 1E4KC 2L4OA 3QUXB 3PNWA 4KK6C 5JXAH 1F4YH 1MY7A 5GGQL 1BF2A 4RNRA 1T2QL 4NZUH 1KELH 4KDVA 4D9RE 2WUBL 2Z4QA 2BNQD 4IOFD 4GAFB 2XWJB 2H3NA 3FO0H 1LP9B 4FFVC 3MRFB 5DHXB 1VKXA 4LLVB 1FNFA 2V7NA 3KAAA 3OL2A 3G6AB 3QO0A 1KNOA 3ES6B 3LEXA 3CLEH 5AZ2H 1YN7A 4U6XA 1XCQB 5BRZD 3MX0A 4FMFA 5DJ2B 2NY4D 1MJ8H 3CFIC 4H8WC 3C8KB 4UUJB 2D4FA 2UUDH 4X7CC 3N85L 4K8RC 3VWKA 4OF0A 5DJXB 1E6JL 1FG2B 1QLRB 2BSSB 2DLTA 1NC4A 4NZTL 4X9FA 5JW5A 4HCRL 1AD0A 5IB5A 1BVLB 3O6FD 1ZHLA 5IQ9A 1AD9A 5HHNA 5DA4A 2AJYL 5GGTH 3F58H 1SYVA 1JVKA 4NC2B 2ADJA 2OZ4H 4O4YL 5I1LA 3MLRL 1EHLL 5JO5A 4L4TA 1IAOB 4YBQD 1NL0H 2E7CA 4R90L 4PJEA 2X7LB 4GMSL 4A2LA 4MDJA 4UT7H 1HHHA 3WN5B 5TH2B 1WBZA 1U91A 5I1DA 4W68A 3O2DA 4NOBA 3GEWB 4GLRI 1KLGB 1P9MC 3WO3B 4QHKJ 2DMKA 3QIWB 5SWSB 3BO8A 3CUPA 3VWJD 5IB2B 3ARFC 4PJ8C 1BJ1J 3O3DA 2FR4A 4PB9L 3A6OA 2FEEL 3TFKD 3HI6L 1JYNA 2A9MH 5I8KL 5CEYB 2EXYD 2PYEB 4ZTPL 4I3RH 5CEZD 2HMIC 2OR8A 1A14H 1T66C 3TVMC 5T1LA 4TSBL 5DFTA 3S98A 1C12A 4HJGA 4PTTB 3VXSE 3RWEA 4HIJB 3LHPH 5GRUL 5LGHH 4HUVB 5I0DA 4QO1A 3I9GH 4JFZL 5LAXB 5HYFA 4HBCL 4X7EC 2HJFB 1X5FA 3TBWB 4N0FB 4I0PB 1S78C 2PTVA 2HJKA 5MP6L 3QWOA 1A6VH 4TSCH 2Q76B 1HEZA 1IAKB 2GITA 2VQUA 3DURB 4NRYB 1T7VA 1O0VA 3TLRA 4XPGH 3CZFB 3WFBL 3W82A 1OM3L 3KPNB 3MRQA 1EFQA 4YAQB 4WUUA 2VYRE 4S10A 2DLFL 1NGZA 3U83A 5I2IB 1JP5A 1DN2A 5JIHA 4C54A 4JKLA 5DT1L 4N5EC 4BZ1H 1N7ML 3NA9H 3ARED 3ULVL 1IRAY 2R1WB 3IETA 2FBOJ 3AXLA 1WWCA 1AKJD 5CJXC 1CXIA 4EUPB 1ZA6A 1MRDH 4JO4H 3SDXB 2DM2A 5L6YL 4KRPD 2Y72A 3H3PL 2VC2L 4N8VG 1CFSB 4JZOA 1E0OB 1ZLWK 2EE2A 1LE5B 1J5OL 2PNDA 3FMGH 5CILL 1HQRA 4M7KL 5CUSH 1TDQA 4GG6F 4JFPB 2EDOA 4OT1H 2BSTB 5FYKU 5FA3A 1D5MA 5EO9A 4JFED 5DD5H 2NY7L 3CFBA 1H0DA 5KVDL 1BVKA 4WWKC 2WINA 5BV7C 3VXUB 4XNUH 2QLVB 5I1HH 4LRIA 5D5MB 3H0TB 2ITCB 4Y4HB 4PRBA 5I1JL 1UWGH 3UJJL 3U4EB 3L5XL 3MRHB 3WXWL 3X17A 5ESAB 1VACA 2CRIA 4M5ZL 3CDGA 4MA1C 4MZ3A 3FOMB 1NLBL 3ME0A 5DJ6B 1DBBL 1AFVL 3DV4B 4TOYH 4HS6A 3SDCC 3RDTC 5JW3H 4U1IB 1WWBX 2WBWB 4JN1L 1QPPA 4FABH 1EHXA 3DSFH 1MLCB 2GSIB 3KPRD 3W11C 5J1TC 2DM7A 1MHPL 3ARPA 2X70B 4ONFL 4QNPF 4D8PA 4MJIE 1YEFL 5E6ZA 1DJSA 2HTKD 3PJSB 2R0WH 1BOGB 3OTTA 3N1GC 1NQBA 2EYTA 1JPTL 5ITFB 2XTLA 5BQ7A 5LXGL 5KZCD 2DM4A 5I15L 4PJHF 5HGHB 3C08H 2VLKD 1RU9L 4QRRA 4GUPA 4LLAA 5BS0D 2X1PA 3T2OA 4QYOB 4PJ7A 1NCAL 4XB8A 3MRPB 4XBGB 3BPOC 1U2HA 4P2RB 3UDWA 2GUOA 2I9TA 3IDNA 5D7JC 4DUVA 5F89A 2UWEE 3KXFD 2F53A 3CX5J 1YY8A 1CVSC 4LIQH 3MBED 3OAUH 2UVFA 1MJJA 3ZT6A 4LLUA 4AL8H 5DHYB 5L2KB 5IFHL 2MFNA 5HGGS 4TQEL 4Q0XH 4KDWA 2V6HA 1JF1A 4LKXA 1BWWA 2YPLE 4GW1B 3TPKA 2VABB 4Z78B 1EXUB 3QDMB 3QXUA 4MVBC 4DUWA 4YXLL 3NCJH 1DVFB 3EGSA 5KS9B 1IM9A 4KHTL 5ADOH 1OGAD 5DQ9B 5DI8A 3UZQA 3BWUC 3SDAC 4XC3L 2YUVA 4KK9C 1FBIL 4ONOA 4PJIB 1DEDA 2R2EA 3UAJD 1VDGA 3ARDB 1KC5H 4MQXC 1RZFH 2IH1B 3KPLB 2YRPA 4P2OC 1JUFA 1FZKA 1R3IL 3BJ91 4G6JH 5EBWA 5F1OB 3TPUA 1UXWB 4KK8D 4WY7L 2D3VA 3TCLA 4NUJB 2DOCA 2LFGA 4L29A 4YK4C 4HAFA 1EA9C 3OKLB 3KJ4B 3LKQA 4G7YL 4MJ6A 3D3VA 1P2CA 3KPPA 4CVXB 4L8BB 3PQYB 4X4XB 1QFPA 5E5MA 1QSVA 3UPRB 4UOW1 1IC4H 4Z7UB 3HB3D 4UINH 3K1KC 1KIPA 4FXLA 5ACLA 1TCRB 1QNZL 4FQPA 4POZD 3TM6A 3DSNA 1HHKA 4M6NH 5BVPL 4JFYA 3ZE2E 4K7PH 2G75A 2F5BL 4DFHA 2P5WB 3F6LA 2YPVH 4JG1L 4MWFB 4KJWC 1UM6H 3HLAA 2V2TB 2OXHA 4N1CA 5DEZA 4GRWB 5C0AE 1O5DT 3MV8A 1QLFB 1F4HA 3V0WL 8CGTA 1BOYA 5IMKB 2OCFD 3QUYD 1LO2L 4U1SA 4WV1C 3OKNA 1Y6MR 5GGVY 1LD9A 4ZOAA 2F19H 3SKMA 2X2YA 2X9YA 5C2BL 2AJVH 5SWZB 2B2XH 4XGZB 2O26U 3ZHKA 4NN7B 5ESVB 4ODVL 2A0LD 2P7TA 1CLCA 3UP1A 1CK0L 5HHOD 3NH7H 3ULVE 5IESH 4OLXH 4EIZC 2XPGA 1YYML 2WWMD 4UDTA 4F8QA 3IDYB 3DX6A 1GRWA 4NBYB 1NGWA 3NCBB 1HCVA 5CS7A 3U6RB 3MLZH 1FSKC 5EU3A 1U8NA 5D1XB 4ZXBA 3HAEA 5K59E 5FCUL 1QBLL 5C0JA 5I75B 5BW7C 5GS0L 3OJDA 1LP9E 3G5XB 4TULL 4MXVF 1MEXL 1UWEL 1C5CL 5TE7H 1CBVH 1JF6A 4LCIL 4FFYL 5J8OA 5I8CA 1C1EL 3RWCA 4FFZL 2FRGP 1P4IH 1Z9OA 3EO0B 2VTFA 1QA9B 5DRNB 4WI8A 3TCXA 1MELA 3L95A 1H15B 4XXCA 3DROA 1IEBB 4ERSL 3K74B 3QUZC 3G5ZB 3Q5OA 3L7EB 1C5DB 3WEXA 1BQHA 1ZT1A 3GK8L 5E2WL 5KVGH 1N6QH 1D5XA 5GZOD 4TUKH 5DFVD 4WJ5A 1F2QA 5A2JH 4GW4A 1ERNA 4JO1H 3IXAB 4JFFB 1H3PL 2P8PB 1UJ3A 1J05B 2RQ8A 2WBJD 4DAGH 1CICD 5DTFA 5T1DH 4KJYA 1GGIL 4MNGB 5KSUB 3TZVD 1I7RB 4U1JA 4J1UB 1L9NA 5DQJB 4YHLH 2B1HH 3MV9D 1VENA 3RVTD 1KIQB 4HXBL 4HIEB 2OL3H 3BIKA 1B90A 4QOKD 2YMXL 4LEOB 1UACH 4PV8B 5SWSE 3VXSA 3UBXG 3NFNB 3F7RA 4P59L 4MXWL 4XPHH 5I8EB 4JFOA 1INDL 1C5BL 4XC1L 3WS6A 1P7QA 4XRCB 4P3CH 1WT5C 4XMPH 5DUBB 2Y5EA 1T2XA 5CFHA 1KCVH 4FXGB 5EZIH 3J8F7 1YECH 2PYEE 3GBML 2IALA 5EDXA 1TVBB 5ISZB 2J8UB 2G2RB 2EYSB 5IWLC 5KANG 5F21B 1WZ1H 3KR3L 1U58A 3T4AA 2QHLA 3FN3A 4APQA 2DL2A 2VXUH 4AEEA 1I1AC 1A21A 3WD5L 4HBQA 3S35L 3TYGL 5E0QA 1N4XL 3BH9B 3MLVH 4V2CB 3P73A 1EJ6A 5BO1L 3SO3C 5I9QB 5HDQH 4QCIA 4JVPA 3CVHB 1XGPA 2AJUH 3GSRA 4LRNL 3MNVB 5GISH 1IGJA 2DTML 4UQ2B 1F13A 2BHUA 5K33A 4Z77B 6CGTA 4FQQA 4C56D 1I9IH 1X3DA 5TDNA 2EIDA 2Z93A 3IU4L 1IT9H 1F2XK 4OM1L 4UDUB 2QADB 5CGTA 1P4LA 3OKKA 3VGGA 1U3JA 3LIZL 2AJ3A 4UILH 3HZKB 4L1DA 3SDXE 8FABB 4MHHI 4R3SA 1EAPA 4B41A 1B0RB 1GYAA 5D7IB 2KZWA 3GM0A 5HSFA 4URTB 3D18B 2CKBA 2VAAB 3FHQA 2QSCH 1U95B 2AJZA 3STZA 1FGVH 5IEHA 5GJSL 4WGWB 2ZUXA 3LQAC 3U7WL 4OLWL 2PTTA 1JPST 1OWWA 1R24A 2IC2A 3RHWK 4M1DL 4GRLD 4X99A 5D8JL 4WO4A 4NCC2 1MVUA 2JJTA 1S7QA 3VXUE 5I6XC 1HH6A 4FQXC 4M6AA 4NQVB 3JWDL 4JANA 2BHYA 3T3PE 1PVHA 5F7UA 2QBWA 4NNXB 4OZHB 5F7DB 2HLFD 3GI8L 3FL7A 5E2JA 1S9XA 1PSKH 5J9PB 1SBBA 1FN4B 3CPLA 1TVDA 4PJ9A 1J1OH 4JHWL 4P4KD 1FQ9C 1Z9SA 2A1WH 3MCG1 2IAMA 1F3JA 3FQNA 4JZNA 4QRPD 2M2DA 1PZ5B 2OTWA 1BD2D 4XBPB 3V5HA 5FO8A 1OLZA 2VIRA 4V2BA 3RHWF 4U1KA 2XXCB 1QFUH 1KLUA 1I3GL 1NCCL 2UWEA 4NQTA 5CMAB 4HJJL 5B38A 5EU5B 2ICWI 1UKQA 1G9EA 3KS0J 2VLRD 5CEXB 1KB9K 4HUUB 5K9JL 4FFWC 1OGTA 2LE9A 4HCRA 3DXAB 2YPLA 3QJFA 4JN2B 3EJZD 4H26B 5I1CL 3P4NA 1FLRL 5ITBL 2XZZA 4P2RE 1R3LB 4LAJH 4ZUWA 1NMCC 1DANU 1GJIA 1NFIB 1MCIA 1Q0XH 4UV4L 5I74C 5LBSL 3ILQD 1L0QA 1RUQH 3EKCA 3VFUA 5GGSA 2IPUK 1W72B 1BQLH 3Q1SH 1T83A 5L2KE 3LMJL 4Y1AB 2CR3A 5T1MB 3ARFB 4PJ8B 1Z3GH 3LAFA 3OBAA 3QNYA 3OKYA 2XRAH 1MNUL 2XA8H 4C57C 3K8LA 4F33B 2G9HA 5KVFH 1QVOB 5AG9A 2RCSL 3QDME 1U42A 3QFJB 4HUXA 1QG3A 2ZUQC 2DQDH 2A77L 2AAVA 5KS9E 3MMEB 3QEGL 1PG7H 2GEEA 2HFEB 1JWSB 3TVMB 4KHXH 3C6SA 4BKLA 5FDWA 5CSZB 4XP9H 5B3NA 3CVHL 4YHKH 3U7YH 2Q20A 1K5NA 3I75A 1FGNH 5CJBA 4JPWH 1ND0B 4EXKA 3VFPB 3W2DL 1IEAA 3TA3A 3GMQB 2EDKA 1D6VH 5HI3D 4U7SA 1HNFA 4NZRL 4WU5B 4H25B 4JFQA 1MIEL 4PJAF 1RZGB 3TYFA 1M7DA 3PQYE 5EC1A 1N0LA 1G7QB 1EO8L 4LSPH 1VB9A 4S1DD 4GAGL 5C0AA 3H9HA 3CZJA 4KPHL 1HILB 3LVEA 4HWNA 4LP4A 2JIXD 1LEIB 1NC4D 1XR8B 1H5BC 2CK0H 2P5WE 3VGFA 2YD2A 1I3VA 4OLYH 4N0YL 3NIFE 3D9AH 4X6EB 4OFPA 4GRWE 3OR7B 2HFFA 5DJCB 1TJGH 3X11A 25C8L 4YQXL 4I48B 3QUXA 2ARWA 4U1LB 5EU7E 2L7JA 4OM0L 5TFSH 2NY3D 4F7EB 4TSAH 4JQXC 5JDJA 3AY4C 1DLFH 4NP4L 5SWZE 3U1SH 2PW2B 4MD4B 3FB7A 4ZSOB 3MROB 4MA7L 5E99L 3OPZL 3B5HA 2XWJA 4LCWD 4WWKB 4OCRH 2FHFA 5HD8D 1LP9A 4H8WL 3MRFA 5BV7B 1T6WA 4LLVA 3BN9C 4O5LH 5DUML 1OSZB 5IB1B 3G6AA 3ES6A 5E1HB 5TE6L 1A7OL 1KTKE 4GSDH 4KKNA 3SQOL 1XCQA 1RUAH 4ZAKD 1NFDF 2YD8A 4HH8A 5DJ2A 4L5FH 4MA1B 4U1NB 4XPFH 3O6ML 1L9MA 1I9JL 3C8KA 3H8NA 4BYHA 3V0VB 2BFVL 4UUJA 4WW2A 4ACPA 3SDCB 3RDTB 3LQZA 2Y06H 2E7HA 3VGEA 1HHIB 2NYYD 5DJXA 1QLRA 1BFVH 4F58L 1ONQB 3PDDA 4FNLH 5K9KA 1II4E 4GQPH 4Y2DD 4WIQA 3X14B 3JV4B 3WJLA 1XIWA 4Z6AT 3ZKND 1WF5A 1CD0A 1J8HB 1AE6H 2AK4D 5IMLA 1R3HB 4IOFC 4ELKB 4TN9A 4W81A 1KYOK 5JXEC 4WUUD 1IAOA 4CJ0A 2O5ZL 2X7LA 2R1YA 5CKGA 3THML 4J4PA 2Q1EA 3WN5A 5TH2A 1T5XB 4MD5B 1N0XH 1DBJL 3BPOB 4JFFE 5F9OH 4JHAL 2A9NH 5D7JB 3MTRA 4D2NA 4ZTOL 1KLGA 5SWSA 4M62L 1QSFB 3QIWA 4BZ2L 4MNGE 4ALAH 5I17B 5EU4A 4B50A 4KRLB 5FUOH 5IB2A 4Y19D 5DZLA 3I6KA 5JOEA 4D0BB 1QBMH 1PG7W 4XAWH 5KJRL 1WEJH 4YDVB 3WFEL 5CEYA 1NC2B 2XKNB 4PJCA 5B39G 2VISB 1NEZB 4PTTA 1UM4L 1PFCA 3O6FC 5C0RH 1S7SB 5GRWA 3SDAB 1DE4B 4HUVA 3F7PC 1SJEB 4OFYD 4Y16D 4QXUL 1LO0H 3KPTA 2MCPH 1NSNL 2B0SL 1MCOH 2HJFA 2VRAA 4G7VH 4P2OB 2ZUTA 1F11B 4AH2A 3TBWA 1AR1D 4N0FA 4W6WB 1EH9A 2J8UE 4LSRL 5IGXH 4KXZH 4OLUH 3T4YB 4YK4B 4Y4KD 2Q76A 1IAKA 3DURA 4NRYA 3IT8D 1PW3A 1OP5K 5F6HI 3CZFA 5DD6B 1QR1A 5T1KD 3F7YB 1J0IA 3FN0H 1DQJB 3KPNA 4YAQA 2VMFA 3VWJC 5I2IA 4G5ZH 4NBZB 3SGDI 1R0AL 4RBPK 4QXTA 4P9HC 3RUGF 1F5WA 4GMTH 2AK1L 4M93C 1OT1A 3TFKC 2R1WA 2VDNL 4JRYB 3QCVL 3RP1A 3SDXA 3VH8G 1G7MB 2YBRB 4K7FB 4X7TB 2X42A 1TNNA 4LHUD 3U46B 2RGSA 2YA1A 3UPCA 1T21B 4J8RB 4OIIH 4ZUTB 4WCYH 5J56B 1CFSA 4QRRD 3GGWB 4LLMB 5F7MC 5BV7L 3TT1L 1LE5A 4WV1B 2NY0C 1QRNB 2BX5A 5T3XL 2AW2A 4K23H 1NAKH 5B8CC 3P11L 3EO9L 4JFPA 2XZAH 2BSTA 3L9RB 4F37K 4GG6B 5BMFL 2EO1A 4M6ML 1IE5A 2F53D 1G1CA 3L3DB 1EK3A 4M1GH 1CXEA 1S5HB 5D7IE 3VXUA 1Z0NA 5EZLB 4X9GA 3LN5B 1DQML 5L2JB 5D5MA 1MF2H 2AEPL 3H0TA 2ITCA 3QO1B 4JRXD 5HDBF 4HS8H 1CGUA 1V3JA 3U4EA 3MRHA 4XPAL 1MREH 4RRPA 3VFRA 5ESAA 3AREC 3EYSH 3FOMA 4W6XB 5DJ6A 1G0YR 1FSKB 4WFFD 2Y07L 4XH2A 4XMLH 3DV4A 5ERWB 2Q3ZA 4JB9H 4U1IA 2YD7A 5KBNC 3OKOB 3GSOB 2DYPB 4JDVB 1MLCA 2GSIA 1YN6B 4KRPC 3RL1B 4NCDA 2X70A 4R26H 1MJ7H 3FRPG 3D85D 5I1AB 1EBAA 4OZHE 4Z0XB 4HJ0D 3RWJB 3PJSA 1IFHH 3MSPA 3V6FB 2W65A 4F37F 5C9JA 4H1LG 5ITFA 3D3VD 5D7LD 3K46A 3TN0C 5HGHA 3QUZB 4PJHB 2FIKB 4RGOL 1L7TH 4K94H 1CDIA 5CP3A 1JIBA 2BRRH 3WL9B 3MRPA 4XBGA 2P5EB 2HKHL 3ULUE 4PGEB 3F7QA 2WIIB 2NW3B 3GHBL 1NGXB 1ZAGA 3BRGC 2MJWA 5GSRB 2BXYA 4I0KA 1NCUA 4X4ME 1MJUL 5DHYA 2E6QA 3Q6GL 4FQIH 1K3ZA 3DXAE 1QLEL 4GW1A 4Z7NE 2VABA 4Z78A 1EXUA 1OF2B 3QDMA 4ZYKB 3U0TB 1DVFA 4D9RD 5KS9A 2ZCHL 3U79A 5GRJL 2HTKC 2Y7QB 2E6JA 5DQ9A 1AY1L 2ORBH 4QGTA 1JGUL 3DVGB 1UH4A 2FZ3B 4YXKH 4ODSH 2XG5A 1S5IL 2C4XA 3BPNC 2Q8AL 4D0CB 5HYIA 1CE1L 4PJIA 2GCYB 5IB4B 3ARDA 2IH1A 3KPLA 4RFOH 1GGUA 4KMLB 4JPKH 1P69B 5KSBF 1MIMH 1UXWA 3QFJE 1UC6A 3SBWA 4NUJA 1WFOA 3OKLA 4MLSA 4JFDD 2F58L 4CVXA 3D39B 4QHNB 4L8BA 3PQYA 3UPRA 2DQFB 3MLPA 3D48R 4Z7UA 4NN6C 4MNQD 3I2CL 4EN3C 2MCG1 1DN0B 1WC7B 3QDJB 1I1AB 3O3UN 3GMRA 3IU3B 5IKCA 2IWGA 3SO3B 2EKSB 1U3ZA 4ZS6D 2PCPA 5J6GB 4MWFA 2X4SB 5F7NC 3SDYH 1MH5B 4KUCF 1QLFA 3FO9B 4CN1A 4W4OC 5BOZG 3HFMH 1JZ5A 4GXVH 5IMKA 2P45B 1GPOL 3F6IA 3PGFL 3UAJC 4HPOL 1K9TA 4HK0B 1BZ7B 4LVHC 1S7WA 3DI2B 5AG8A 1H8SA 1JPFB 4KK8C 5SWZA 4LGRB 4XGZA 3ESVF 4Q6YA 4E41B 3EYUH 3LPWA 5FB8B 5ESVA 5D71L 1WV7T 3G6DL 3WFZA 2PUQT 2EDHA 2FO4B 3MJ7B 3GJFH 3HB3C 3L3HB 4S1RH 3NABL 4PLOB 4QXGL 5D1XA 4ZSOE 2DQIH 2B1AH 4OF7A 5I1GL 2DRUA 3HNSL 1YYLH 1XF3B 4NIKB 1EGJH 1E4WL 1TIUA 1HSAB 3VXTB 5I6XB 1HH9B 4FQXB 1KEGL 5T3XE 4JO3H 1P7QD 3P4MB 4V1DB 1SVZA 3AGVA 1ZANL 3AS3A 1JRHL 3EOTH 3EO0A 2RHEA 1I9EA 1QA9A 4OGYH 5DRNA 1H15A 4G6KH 3D6GA 1W8OA 5FYJL 1IEBA 3QRGH 3DYPA 4QTHB 3G5ZA 4R9HA 2UUDK 2SEBB 3LOWA 3IRZA 4RMRA 3L7EA 1OW0C 1C5DA 3U9PL 2XNAB 4APQD 2VE6B 2A0LC 3I50L 1ES0A 1BP3B 1QOKA 2DN7A 2WAHA 5FOBB 2W9DH 4PUBH 4WHYH 4JCMA 2R1XB 4X83A 5HHVL 2D03H 1FVDB 3L5IA 5HI4D 4JFFA 1O7SA 2P8PA 2CLRB 1J05A 5LWYH 4HZLB 1FZOB 4JFXA 1FO0L 1J8HE 3KLDA 4MNGA 5C2UB 5EH1A 1XGUB 2QQLL 1T7ZA 1I7RA 5KSUA 1VFOA 1J0ZA 4G3YL 5DQJA 2VH5H 1NLDL 2I5YL 1KIQA 4KMTL 3ARGC 5JMRA 3IFLH 4HIEA 3BSZL 3HMXH 4BSVB 3C9NB 4LEOA 2D7MA 1NMCB 1EZVY 5I74B 4PV8A 1QSFE 2NY6D 4OCSH 3NFNA 5C09A 1BFOB 4OCYH 5I8EA 4NFCA 3RGHA 3QSKB 2YEZB 4LMQE 4XRCA 1HI6A 1IKFH 1ULVA 5DUBA 4FXGA 5GZOC 4OGXL 3MLSH 2DF3A 5JQHC 1TVBA 5ISZA 2J8UA 2G2RA 1D5ZB 3NFSH 2ZUQB 4XVJL 5FHAL 1RJZB 3OF6D 1MCPH 2BJML 3UJTL 4NT6B 2ADGB 4LQ1A 4J23A 4XT1C 3R1GH 5AYUH 5A16B 2WBJC 1NCDH 2JCCB 1R5WB 5D1ZD 4KV5F 3TZVC 4DWHA 4HLZH 5TE4L 4YUEL 3X3GH 3ZE0F 3QHZH 3BH9A 4LHUG 1FNAA 4MJID 5J12C 4HSQA 3PP3H 3RVTC 4LVNC 3V79C 4HFWB 3V4VL 2FX9H 4JR9L 1S7VB 3G6JA 3CVHA 1JNLH 2VQ1B 1K4CB 4GKOA 4DK3A 1FPTL 2AXJA 4UQ2A 4Z77A 3PHQA 2R8SH 4PJ9D 2IAMD 5DD1L 4NZJA 3PP4H 5LVEA 1BZ9B 1ZVSB 4PBVC 4UDUA 2MQ3A 2DBJA 4JRYE 4KJPC 1H5BB 4KVNL 4C58B 3HZKA 3O2DH 8FABA 3PWJB 5FYKL 3V8CA 1HSBB 1B0RA 3LQAL 3MA9L 1QFWM 5DJZB 1HNGA 4GS7C 2VAAA 4FP8L 1RULH 1E4KA 2YPLD 4H5SA 5E08L 3OG4B 2BK8A 2VN4A 3GNML 4LSQL 3EDEA 1KENH 3VGHA 4YWGL 5C07E 1YJDC 4QGYA 3S36L 4GG6E 3GIZL 4X7SH 4YPGB 1IKNC 3S37H 3NCYS 1GC1C 3O6LH 2RR3A 4TUJB 5IP4A 4NM4L 2EE6A 4EQ3A 4OZIF 3LY6A 4JM2F 1LK2B 5MEOB 3EFDH 1CDHA 4NNXA 1ADQH 32C2B 4NDMB 3WJJC 4QF1B 4OZHA 5F7DA 3LD8C 5F88B 3D2UB 2HTLD 4JQVC 3TWCL 4OSUL 1WZKA 4W4NA 4D0DA 4WI9A 1DBML 4OCWL 5J9PA 4BFGA 1N5YH 1FN4A 1HINH 4MQ7B 2MQCA 4X80L 1V3KA 4OJFL 4UOJA 3QEUB 1ITCA 3TA3D 5E2UH 1GGBH 4QNPE 2A83B 3LEYH 4PREB 1PZ5A 4XBPA 4YHOH 4UIMB 1UADC 4TRPH 5CMAA 1NANH 4BK5A 5J57B 1P84J 5EU5A 1U3HA 4U2ZA 1A3LL 1V8HA 5CEXA 2VZ3A 4HUUA 4PJHE 2MKLC 1MOEA 3K8KA 2BNQB 1WQVT 2L0DA 3DXAA 3KWWB 3MBXL 1DLHA 4JN2A 2LU4A 4H26A 1UA6L 3BX7C 3K8MA 2FBJL 2P5EE 4HH9B 3F7VB 5FYJE 1R3LA 1KXQE 1NFIA 2GK0A 4A2MA 1KJ2H 4GXUM 2FCBA 1VCAA 5DS8B 5IW3A 1U8MB 1V7NL 1P9MA 3ARZA 5MHSE 4RWYH 4Y1AA 3O3AB 4PJXF 3V6OC 5T1MA 3ARFA 3EUUA 3E6FB 2NZ9D 5JR1H 4YHIB 3QUXD 4F33A 1M1SA 3HAEG 1QVOA 2D7OA 2C9AA 3SCMD 3QFJA 1OAZL 3MMEA 4YZFE 3W5NA 1KT2B 2HFEA 1JWSA 4RISL 3TVMA 5IMOB 3IAGC 1YQVH 2MMXA 4GRMA 5CSZA 3O6FB 1W0WB 2BVOA 2VDLH 4M9PA 1ND0A 3MLUH 4NKQB 4XVUC 1T2JA 4DW2H 3VFPA 4DN3L 3SGJC 3GMQA 4WGVB 3BYTA 4U3CA 2IPTH 4S1SL 4WU5A 3EJZC 4H25A 4AMKH 3HE7D 3GMNB 1RZGA 3CLFL 4FZ8L 1T0NB 1SY6L 2BCKA 4PJAB 1G7QA 3ILQC 4M7JH 5EOTB 3O2WH 4K3JL 5DMJB 4P9ML 4DVBB 1HILA 3CMGA 3VWJB 3QDJE 5C08B 1EFXB 1LEIA 2VXQH 1XR8A 3GKWL 4AT6B 1YEKH 4YNYA 1UZ8B 1YDPA 4M93B 4ZQKB 1ROWA 5CJXA 5IT2L 4YDIL 4PGJA 5FF6A 3OR7A 2FJFB 4XXDB 35C8H 4ZO8A 4OI8A 4J6RH 1V7ML 4X6FA 4I48A 3WFDH 2G60H 4LASL 4DGIH 2FHCA 3BESR 4F7EA 5J06A 3GO1H 2NY0B 4NOFA 4POUB 4R8WH 3UBXB 4AEIH 3SKJH 3EYFB 4MD4A 3UTSB 5B8CB 4S1QL 4DUXA 1JBJA 3H9SB 1VGEL 1A7RH 2V9QA 3KYKL 3DLQR 4WWKA 4X4ZA 2UV3A 1L0XA 1TXKA 5DRXA 2J7LA 4S1DC 5KN5B 4F7PB 1EIBA 4JM2C 1I7TB 5HDOA 1OSZA 1A6ZB 5GSVB 1JZ2A 4XCCL 4WUKL 2PYED 1YEEH 1YPZF 1A4KB 3I3EA 1ZT7B 3LKRB 4CMMB 1NFDB 3AREB 3KHOA 4U1NA 3UEZA 1BFSA 3CGTA 3UBXI 4MS8D 1AO7B 3QUMB 3SDCA 3RDTA 1SJHB 5F9AC 5C0FB 3ZYJA 4MXVE 1HHIA 3VA6A 4KAQL 4KRPB 3QHFH 4OQTL 4V1DE 5T5FL 2R15A 2J2ZA 4LLQB 3OG6B 4PJDF 4JVUA 1W8NA 4I0PD 4HC1L 4LLDB 3X14A 4CVZA 4JM4H 5KANI 2J8HA 2Y5TB 4HKBB 3E1F1 4ZD3H 3VDCA 1U8IB 4EBQL 3HKFA 3TN0B 1BIIB 4KZEH 1R3HA 3T77B 4ELKA 4JFEB 3L6FB 1B4JL 3CFDB 1DDHB 1T5XA 4MD5A 1ZWIA 1L7IH 4TUOB 4JKWA 1AXTH 5D7JA 1DUYB 1QSFA 5I17A 5E8DH 5CHNB 3TBYB 3TH4T 3MYJB 4HG4K 4D0BA 2FJHB 4NO0B 5KW9L 3JUYA 1RUKH 4YDKL 2X89A 2NYYC 1T1YB 3T09A 2CIIA 1NC2A 2DQHL 2XKNA 4L4VB 2VISA 1DFBH 1NEZA 3FFCD 1VADB 5SX5H 1S7SA 4RMVA 1A6WL 3SDAA 1QPXA 3D69B 1DE4A 4N0UB 3BPNB 1SJEA 5KZCB 1MRFL 4ZNCD 4Y4HD 4L8DB 4P2OA 1F11A 3ARUA 4RFNC 2GK2A 1NGQL 4KQ3L 5BVJB 3AFLA 4K07A 2QQQA 3T4YA 4UT6H 1CFNB 4P9HL 1FE8L 2FB4H 2O5YL 3D0LB 2D7TL 3EYOB 4RX4A 4QY8B 5CWSB 5DDHB 4CL7A 3F7YA 3JXAA 1DQJA 3KXFB 5CEZL 4NN6B 3N06B 2XV6B 4EN3B 5EFIB 4ORZC 1E4XH 3RIAK 2W1NA 2W92A 1FFNA 3T0AA 4IMKA 5C70A 1IZKA 4JRYA 2BY1A 2HFGH 1DBAH 1G7MA 5HHXH 2YBRA 4K7FA 3VG0H 4X7TA 3ALPA 1IAII 5EZOL 2DD8H 1OGAB 4JLRB 5TQ2L 3T0DA 1T21A 1VFBB 4ZUTA 1QFHA 4D3CH 3GGWA 2ADFH 4LLMA 2B5IC 4PD4K 4WV1A 3TNMB 1QRNA 4LVHB 1CZ8H 5MENB 2B4CH 3ZKQD 4P2RD 3ARRA 5J11C 1NFKA 5M95B 3L9RA 5TPWH 2LAGB 4GG6A 4PRPB 1NDMB 3L3DA 3TV3H 2FX7L 1S5HA 5FO9B 1JHKH 3MJ8A 4Y4KC 3BDYL 3CK0H 1F58H 5EZLA 5L2KD 1GVIA 3V52L 1MAML 3LN5A 5L2JA 4HPYL 3WUWG 3QUML 3RIAF 5C0EB 3FQXB 3QO1A 5IHBA 2NY2C 1G7LB 3QHTC 1WWWX 2BDNL 4KDTC 1FL3A 1RJYB 2K1MA 3MPCA 1I8MB 5EZJB 1DVFD 5IB3B 5IG7A 1WFTA 4LU5H 5ERWA 2W60B 1UB5B 2P8MB 5F72S 3BAEL 1A7PL 2H32B 3V4PL 5BW7A 2JKXA 3OKOA 3GSOA 2DYPA 4JDVA 2AEQH 4M6OL 5SX4I 5T33H 4A6YH 4PY7A 1JZ4A 3RL1A 2H1PH 3MXVH 3TJHC 4UTAH 1NBVH 5I1AA 3FB6B 4Z0XA 3RWJA 2X9WA 1OCWL 3V6FA 2R69L 4PP1D 4LF3B 1T5WB 1TZHB 3E8UL 1PQZB 3PQYD 4XZUB 2FEDD 3QUZA 5DMIH 1YNLH 2ZPKL 4PJHA 5D2LF 5KVEH 2FIKA 1IC1A 4GFTB 1U6AL 5I19H 2YKLL 3RPIB 5DK0B 2P5EA 3HZVB 3SE8L 4PGEA 3JWOH 2NW3A 1NGXA 4N8PA 4WI6A 1KTRL 2ZG2A 1HE7A 2F8OA 4I2XA 2P5WD 1IEHA 5IFJA 2E8ZA 3JVGC 2VXTL 3HZYB 2BNQE 5D9SB 3PDOB 1QFWL 2Y36H 2Z8WC 3RZCD 3OB0H 4OTXH 5IFAH 1OF2A 1I1CA 4HIXL 5DLML 3ARGB 4ZYKA 1FO0A 2BVPB 4UB0L 2Y7QA 3ZO0A 3LV3B 1P7KB 3DVGA 1IAIL 1KJ3L 2FZ3A 2OR9H 1QD0A 2W9EL 3QG7L 1J86A 1IC5L 4X6DF 1JGDB 4D0CA 1P1ZB 3DJ9A 2MOVA 2Z35B 1WT5A 5F9DC 2DJUA 3ZDXF 5KSBB 4Z7OF 4KVCH 1VPOL 1N6UA 4XCFL 5IWLA 3D39A 4QHNA 1KULA 2DQFA 3NAAL 5D6DC 3FN9A 2WBJB 1M05B 2B39A 1CGVA 4FQJL 1F90L 2N56A 1DN0A 5L8KB 1WC7A 3QDJA 3TZVB 3PWPD 1I1AA 3IFNL 5KAQG 4KY1L 3IU3A 3EJYD 3B2VL 5ILTH 5J12B 5C7XH 1HXMB 4LVNB 1NBYB 2EKSA 4K3EH 4PJAE 4U33A 4WI4A 4QOKB 2X4SA 3U4BL 1ZXQA 3DUSB 2IPKB 3FO9A 2JF1A 3PXJA 3P4OB 5C08E 1OAUL 5TDOA 1K6QL 2P48B 4HK0A 1OP9A 1BZ7A 5F9WC 3WO4C 1FCCA 5MI0C 1SEQL 3WLBA 1JPFA 2C1OB 3DX9A 3QPXH 4JFFD 2AJYH 4E41A 2R0KH 5EO0A 3X3FH 4DZ8A 3F12B 1EHLH 3VW3H 2COQA 4H0IA 5FB8A 2IF7A 3DHJA 5TQ0H 2Q8BH 1HKLL 4IRZH 5TF1H 4M8VA 5FUZH 3ILPA 4GS7B 1F8TH 2FO4A 3MJ7A 3V7AE 3CCHB 4L3EB 1P5UA 2YK1L 1JZ6A 4DKEL 2GAZB 2Y23A 1YUHB 4J3WA 1LMKA 2NNAA 3SJVD 3UTSE 2WBKA 3FT3B 3GM8A 3H9SE 1EJOH 1GSMA 1XF3A 4ZS6C 5C8JB 1HSAA 3VXTA 4Z95L 1HH9A 3MJ9L 1NBQA 2OJZH 1D9KD 5I76B 4V1DA 1UYWH 4OGAD 4NJAH 4AY0A 4C56B 3LKNB 4QLRA 3LD8B 2R0ZH 4WHCA 1HYSD 2N1KA 1QBBA 3LPFA 4C4KO 1TZGH 4QTHA 2VAJA 4HFUH 1AO7E 2SEBA 4JFZH 3GHEH 3LS5H 2XNAA 4HBCH 2VE6A 4KGLA 4RDQG 1B9ZA 2O5XH 4EUPG 4K2UL 3CU1A 1DZBA 4P46C 5FOBA 3MJ6A 4NJ9L 1CTOA 1JHLH 4M5YL 1FVDA 1RFDL 5LCVL 3UJIH 2CLRA 2WQ8A 4HZLA 5JOFB 4PJGF 1FZOA 3VCLB 2X4PB 5DUPL 5H37G 1EDQA 1RIVL 4JO2L 1XGUA 4YXHL 5JUEH 5DJ8A 4JFEE 1BGXH 2X4OB 3UTZB 1C7TA 1FFOB 3U0WL 5DT1H 2MPAH 1X7QB 2FECI 2V5RA 1MHEB 1V3MA 4G9DB 1XF4B 2QADD 4BSVA 1T1WA 2EDFA 3TP4A 4F7TB 5L6YH 4HIIB 4JEGB 5I18L