4PG9B

Mhc class i in complex with sendai virus nucleoprotein peptide fapgnypal
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
molecule tags Immune system/peptide
source organism Mus musculus
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pg9B00
3HZMA 3ARGB 1F11B 2C4FT 1N5AB 1KTDB 1FDLH 1U3YA 4R8WL 5J13B 5IM7A 1KUMA 5HYJA 3WKNA 1KT2A 5I19L 2A73B 5DZLA 4QXWA 4PPTA 3WIIL 2GJJA 3SGEH 4F7PB 3SDCA 1LP9B 1MCNA 4L5FH 2MJWA 2H9GA 1SHMA 4MAYD 5JA8B 4JDVA 1MCOL 2VDPH 3KPTA 1T0MB 2W0FB 1IAIH 5JQ6L 2VDQL 3ILQD 3BHBA 4N0YH 3B9AA 3CFKB 4EKXA 3RZCD 2ADIB 2JJSC 1ZEAL 3ZKQD 1DJSA 4OBRA 1K8DA 1KNOA 2EDOA 3ARRA 3RZCA 1GHFL 4U1LA 3G6DH 4X6EB 2C3XA 3QUKB 2YN3A 3CFEB 1JI1A 3MRIB 4ODWB 4JE4B 4X4XA 4JCLA 5JW5B 3T0EE 4JDVB 5I8OL 5DJ8B 5DVNA 5C0EB 1INEH 2HJKB 2IH3A 5JO5A 4Y19D 3UJJL 1T04B 1V7NH 1A7QL 3B2UD 3KYNB 5D2NC 2VXVL 3FRUA 5DJAA 3VWJB 1A3RH 1JTTA 3E6FA 1OL0A 5D72L 1NH6A 1AI1H 3G5YA 3H3PL 4J12A 4JDTL 4Q9QL 3VFRA 5BJTA 4ZUWA 4JAMA 4M6OH 4PFEA 1YEHL 2WINB 2ENYA 1R3JB 3UYRH 1N6VA 4QHMA 5ENWB 2D4FA 4NBZB 4JZNA 3CC5A 4X6DE 4GRWF 5DD5L 1EO8L 4O58H 2M2DA 4ZUSA 3G04B 4M6OL 3MJ9H 4UT7H 4GMTL 3KYOA 3G5ZA 3EFDL 3MZTA 3BP7A 4WI6A 4PJ8B 4MCYB 1NANH 4RGOL 3I75A 4NO2A 2QHRL 2AJ3B 5GGVL 4AZ8A 3HG1E 3OJMB 3LS5H 1PEZA 1CDGA 3CXDH 3C5ZB 1KNOB 4PJ5D 4ELMF 1KTLB 1U9KA 4HKBB 3MRDB 3NIDF 2F54D 5SWSA 1LNUB 1KV3A 4I48A 2XNAA 1VFOA 2ORBH 4OSUH 1KJMB 2ARWA 5EO0B 4C56B 2N56A 2VZOA 2VJXA 3IDIA 3P11L 4HFWB 4I0PA 5AG9A 4OZFB 2DQEL 4QRSA 5EBMA 4LF3B 4HT1H 4S1RH 5HVHC 1FZJB 4NKDB 3RWEB 4CMMA 4MXVF 4S10A 1KELL 4O2FB 1TCMA 3B3IA 3FL7A 3TNNA 5H35A 1U92B 2P48B 2C9AA 3DNKA 4ORZC 3EDJA 1SEQH 3IU3B 1HZHL 5E6IB 1ZSDA 4TRPH 1U42A 2XTJE 4NN5B 4IIQB 3BKML 5MEND 5FO8A 3VXMA 4JO2H 4DKFH 3ULUF 1HHHA 1T21A 4MA3A 5C0ND 4ZSOA 1F3JA 1UEMA 1NUNB 4D9QE 5ICZB 3OB0K 5GJSL 1ZLWK 1C08B 4JRWA 1IGIL 1FFPB 4WCYL 4DAGL 1FZOA 2VLKD 4G8GA 5JXED 2B39A 4LPXA 4NYLB 1ZK9A 3BPOC 4FZ8H 3VWJC 5GZOD 5DEFA 1NFIB 3S7GA 3ZL4L 3CD4A 4K9EL 3S9DB 2FJGB 4HUKB 3BXNB 3ARXA 5D1XB 3IJSB 2BHZA 4AM0A 2QHRH 3MOAL 4PJ5B 5JIHA 5F7EH 4FFWC 4K23H 4KK6C 4HLZH 4MYWB 5BS0B 1VEPA 4YC2C 2R2CA 3DUHA 4NRZA 5J12C 1GJIA 1U2HA 2NY5H 1OB1B 5MP6H 4G8IB 4NQUA 5K59F 1KCSL 5ERWB 1QKZH 4FQQA 4MAYC 4JFFE 1HIML 3ISWA 3GKZA 4WI7A 4MNGB 3U7YH 1CGSH 3AY4A 3BKMH 3NIFF 3PWPE 3QEHB 5EZIH 3R06B 3TF7C 3DRQB 1IQDA 3D3VA 3QFJB 5TDNB 3UYPA 5I17A 3PP4L 4G80B 4ZTOH 1G6VK 4N9GB 5T33L 4FQCH 4IRJA 4U6HB 4G3YH 5J8OA 1GGIH 1E4XL 2YPKB 3LRSB 5LGJB 1K3IA 3QQ4B 2G5BA 3H9SA 3V0AC 2O5YL 1FYTD 4FQXA 4KVCH 2V2XA 1JV5A 3RU8H 5DQJB 5AAWA 4KC3B 4O2CB 5KAQF 3SE3C 3FJTA 1C1EL 3U48A 2ORBL 4ZXBD 4A6YA 4ZUUA 1B6DA 1DANU 5HI3C 4DUVA 4OLVL 5MEPA 3MRRB 1U8HB 2BHUA 4N0CD 5ID1B 2YD2A 3BIBX 1BVLA 1B2WL 4PTUA 5J7CC 4PRPE 4QXUH 1TNNA 4KV5E 2BRRH 3V9FA 1A6WL 4KWUA 1F4XH 3BESR 2E6PA 4ZOAA 4ZMAT 5BS0D 1XGRB 3IFPB 5B3NA 1MRFL 3TBWB 4WIQA 5F7LB 3SKJH 1KENL 4XBEH 1OP3K 1WCBA 2VLKA 2PXYA 2EDQA 4RX4A 1P1ZA 4JHAH 3CVHL 3OAZH 1HKLH 1NCWH 2WUCL 3B83A 4GUPA 3VD9A 5C07E 5FAAA 2DLGA 3LN5A 3U0TA 5CIPB 2YK1L 3QISA 3BGMB 5LJYH 1R24A 5BZDA 5KG9B 3MLSL 3JVGA 1X44A 3T0ED 1EMTH 1SY6A 3LSOA 4H8WC 3GSRA 4TPRL 3F5WB 3QDGB 3MRKA 4M7KL 4QXTA 4WGVB 3RPIB 5F21B 3HG1A 4WUKH 5J3HC 5I16A 4WW2B 1U8NA 3MLUL 2OI9C 3TJEH 4J3UA 4BELD 3F7PC 4LF3A 4JLRA 4PY8I 1XR8B 5TQ2H 5AYUL 3WNOA 4LSUL 3NOIA 2DICA 2G75B 2ZSWB 2HTKC 3BJ91 1MFDL 4ZDHB 1GHFH 2FGWL 1VFAB 3PHQA 4WW2F 4U1IA 2NX5B 3HPLB 3MLRH 1GGTA 1MNUH 1MI5B 1QA9A 2YD3A 1QPPA 1S8DB 4Q7DA 1UYWL 3O41A 2UZYB 1LILA 1AE6L 1B2WH 2ATPA 3MRBB 4G6AD 2DLHA 3OQ3B 1HNFA 1TZHA 2QV2A 1DL7L 2F53B 4XWOC 4G6KH 3ZYIA 1PY4A 3WXVH 3LOWA 1A2YB 5CEYA 5L6YL 5GGRY 1EZVY 3EFFB 4KROB 2QKIA 3VGHA 1M7IA 3CFIC 5IT2H 1OHQA 2NXZD 2JB6A 3DRTA 1P4IL 3UPAA 2VABA 1PBYA 4P9HL 4YFDB 1CDBA 2H26B 4PP2A 4OD3H 5EOCL 3WXVL 4AM0B 1F4YL 1INDL 3GMMA 4EUPB 3MLTA 4YX2L 2IBZY 3IXTB 4H26A 3ES6A 2IAMC 4FFWD 4HWEL 4GO6B 4KH2A 4QRTA 3E6FB 2J88L 4HH9B 4KY1L 1CXHA 1A0QH 3AMKA 3VJ6A 1G9MC 2EC9U 3H6JA 4UUJA 1FZOB 4KDTC 3BGAA 1PKQA 2W60A 3MOBH 4LNVA 2SEBB 1W0VA 1F3JB 3SKJL 4M5ZL 3ZE0E 5EZJA 5HGHA 4BH8B 1C7TA 3RL1A 1N26A 1G1CA 3BP4A 5GGQH 4QY8B 1F4WH 4LRIC 3KLAA 5C70A 3UEZA 5C9KA 4BSWA 3QUKA 1R3IL 1GC1C 5CAYB 5AAMA 1MI5D 3VI3E 3FQUA 3WFHB 5SX5K 1E4WL 4G8FA 1LEIB 4HIXH 5DDHB 3CFKA 2BC4A 2YA2A 4OLXH 3ZL4H 3RVVD 1KPUA 4YDIL 1MVUA 2IEPA 4P4KA 1FFQA 1TITA 3H3BC 3G08A 3MV7A 5CFHA 1ES0B 2R2HA 5DJ2A 3SDDA 1CBVL 2CLZA 1FGVL 2VLRA 3KJ6L 4PLJD 2EC8A 5EG6C 4NOBA 4ODVH 1CFNB 3QO1A 5E8NB 4X98A 3FOLA 3BP6B 4I48B 3ZDZF 1TZIB 4J4PC 1E4XH 1NL0L 3ULVC 4FG6C 2FECL 1YMHA 4PY8J 3QFJE 5KVDL 1DR9A 1HZHH 2OTUA 2YXFA 2ZG2A 3DMMC 4P2RE 3T0VA 5CGMA 4OLWL 2WNGA 2DIBA 1MH5A 3V4UH 5FUCC 3LKOB 2Q86B 3STZB 1U0QA 5F3BB 3UP1A 4X7EC 4Y4FC 4NCDA 3O4LD 4HT1L 5D1ZC 4UOW1 3RWDA 2IADB 4GRWE 4X9IA 3E1F1 2CLRA 4DGYL 15C8L 5DR5H 4F8QA 1MCLA 4LASH 2VQ1A 3EJZC 3MXWL 2VO5A 3JZ7A 1VGKA 2QEJA 3SEPA 4Y4KA 4F7TB 3ARSA 3L3GB 4KKCD 2HKFL 3FB7A 1AJ7H 1RJZB 1W2KT 1W0WB 4LASL 4BFIA 1Q94A 5A2LH 3LS5L 1QVOA 4LLVA 5GRXG 3SCMD 5IB5B 5DYOB 3Q6GH 2W92A 4HCRL 2WIMA 4UU9A 3QR2A 5F89B 1HYSC 2R0ZL 4TSAL 2X4NB 2VDRH 3D0VA 4IIQC 3OV6A 1XIWA 3BN9C 1UQSA 4GAYA 3MZGB 4LLQB 2PTTA 1Q1JL 5DC4B 2AJVH 4PJGF 3H9HA 1RHHB 4OLWH 4GJTB 4RX4D 3QDMD 3CCHB 2AK4B 3FT3A 4ZXBA 1IEBA 3DX9B 1NL0H 2DL9A 2OQJA 2IBBA 1IRAY 1JTOA 4X6EA 1TLKA 5C0FA 1OP9A 3QHZL 4WWID 3RKDC 4TRPL 1S7VB 5DMIH 2WWMC 2R29L 4TULL 1FVDA 5D72H 5KS9F 3RY5A 3L5JA 1U95B 4I77H 1T6WA 5C0IB 1QR1A 1BZ9A 1GGCL 3MRHB 1G6RL 3PWJB 4HIJB 4IOIB 4XP6L 3TBTA 3LQZB 3HE7B 1OGAA 2GSIA 3O6FD 4RGND 1U8PB 3DO7A 4GXVH 4N90D 5FGRA 1P6FA 2AJSL 4LBEA 3O11B 4MZ2A 1T66D 2WP3O 1AXSA 3DV6B 3OGCB 5D7SH 1RUPH 2OQJB 4PB0H 3FN0L 5JZ7D 3FQWB 2WP3T 2HN7A 1WIPA 4JVUA 3QDME 1QBAA 4JKPH 2X4RA 8FABB 1BBJA 5GIRB 2E6JA 1VGKB 1J1XH 4WFEE 1DVFA 2A2QT 4Y4HC 1MOEA 4LLQA 3DHJA 4JB9H 1U58A 1CDHA 1FNSH 4Y4FB 1HDMB 2GJ6B 4X7SL 2VC2H 2Y6SC 3NFNA 4MDJA 5K9OB 3ZKMC 5BV7L 4LAQH 1QHOA 5LAXA 5IQ7L 5C09B 3MACL 4MMZC 5DJ0B 3MUJA 1P4IH 3SDDD 1F90H 1WICA 2N7BA 3QULA 4LQFH 3GSVA 2Z35A 5DJZB 5L9DL 4TTDD 2L4OA 1FIGH 2XQBL 4NM4L 2F19L 5IBLC 3QXUA 5DVOA 1QFWI 2NPLX 1IJ9A 4U1SA 1AI1L 5I8KL 1JGVH 3W0WD 1CU4L 3JWOC 1X5ZA 1YQ2A 1EEZA 3A67H 1XGPB 3RAJL 4XVUC 5EPMB 3MLZL 4NWTH 2OP4L 1BAFH 1KYOK 4ZFFA 1K2DA 4R4ND 3EZJB 1FGNL 1BD2A 3A6CH 3P73B 4Q0XL 5F1SA 1PLGH 2FWOB 3WDHA 3UTTB 4M1DL 4LPCA 1IE5A 4Y16D 5D7JD 2YS4A 1OSZA 4PJFA 5GGQL 1OTTC 1EAPB 3QXDA 1MFDH 4TVPL 1OGTA 1EHNA 2DQUH 2YPVL 1MCSA 1U8OA 5GS3A 5DMKA 1FSKB 4X7CC 5JR1L 1IZKA 2JELL 5F8RC 4PRNA 2M1KA 1IT9H 5JUEH 4JPWH 4PV9B 1OT1A 2RR3A 3GJFH 3V6BR 1D5XB 3DI3B 3LD8B 4P3DB 4P2QA 1TJHL 2BNRD 4U2ZA 1IEAA 3VXRD 3DVFA 4LCIL 4PGDA 1DTUA 4O00A 5DK2B 1TETL 5LQBL 5TFSL 2VLJB 1DSFH 4OGZA 3V6OC 1E0OB 4U4BA 4N0CC 4ZSOE 4ZPTB 3MLYL 3L95A 2OI9B 5FHBL 3LCYA 4XMLH 3VFTA 1OGAE 4L3CA 5EUOB 3NZHL 3GMPA 4PY7B 1V7NL 3DROA 1N5YL 1R3JA 3P9MB 2P4AB 2PR4L 4H1LG 4JFZH 1UXSB 5HGHB 4XNXL 3MLVL 4OLUL 2FR4B 3W2DL 4C83A 2P8PA 1HXMA 3U9UB 1Y18B 4F15C 4D0DB 5HHMD 1CFTB 4HGKC 1Q9OA 3C60C 5ECJE 3UC0H 3P77A 4PJEA 4JFOB 1IL1B 3AS0A 6FABL 5F71A 3O2VH 4HKXA 1A7RL 1FCCA 4XGZA 1CCZA 4NZRH 3THML 2HJKA 4ZNEA 3P9MA 2EKSA 1TCRB 1BFVH 1EEYA 1S3KH 4PJBB 2XI9A 1AD0A 3RUGE 2ICES 3GMNA 5K9QG 1G9NH 3U1SL 2IQ9L 4ETQA 1KOAA 2DQFA 2NX5D 5FGCB 5TQ2L 3VFOA 4M93C 4N0FB 1FG2B 5A2IH 1EXUA 3F12A 1ODAA 3MV11 4M1CD 3GUTA 1F2QA 4V1DD 1P69B 1D5XA 1H5BC 1JTPA 3BEWB 3SQBA 1X3DA 2D31B 1VACB 5DMJB 3C6LC 2VUYA 5EA0L 2LU7A 4WW2A 1RZJC 4P23B 4ZTOL 4O02H 2NYYC 4D2NA 5FUZH 4XZUA 3GJEB 2QHLA 3JTSA 5F1NB 5H8DA 4BA8A 4F2MB 3KPLB 1T0NA 5EU6E 5IGXL 4HK0B 4LMQI 4EDWL 1FVCB 5HBBA 4LEXL 3KPQA 3EBAA 5FOBA 2NY7H 2YUVA 1LD9B 3V7MA 2OZ4A 3VD7A 4O51A 1N0XH 35C8H 2G2RA 4OCSL 4ZPVA 1XR8A 2CIIA 4DW2L 5JTWA 1F13A 5ICYA 5C08D 3SKUD 2LU3A 2RQ8A 2DWEA 3L6FB 3ARWA 2Y25A 4NQCB 1WCBB 1BFVL 2A6DB 4NQCD 3GO1H 1U8MA 3VFUB 4BZ2L 1EDQA 3B2UC 4Z7OF 1P9MA 5DVMA 3FFCE 4K3DL 5E5MB 2HLFC 3EJYD 6FABH 2A83B 1HCVA 4N8VB 2CD0A 2V7NB 3IB4A 4OT1L 3QDJD 2E9IA 4JPVH 4NQTA 5E08L 3EOYG 4FZ8L 3X14B 3ZYZA 1S9XB 3P9LB 5GRJL 3RI5K 3DVNA 3TFKC 1PX4A 2FDBP 1KJ3L 1ZA6B 2Q8AL 1NFDB 2XWJA 1C5DA 2A6DA 2EYRA 2HRPL 1R5VB 2ZCLL 2DAVA 2DWEB 5FK9B 3SGJA 4X80L 3I3EA 5JMRA 3H0TA 5HYJE 2DOCA 3P4OB 5D6DC 3MXVH 1ZHLA 3MRFA 2R69H 2Q3ZA 4RAVB 3QIWA 1I8KA 2FJHA 2ZZUT 1FRGH 5IEHB 5JHDE 3QIWD 1CGSL 1OLZA 5KSAA 3WXWH 4YFLF 4P4RB 5ID0A 4OLEA 2YN5A 1JRHL 1E28B 1KN4L 5I6XC 2W0LA 4YDKL 1CD1A 3GBMH 4YO0B 1RPQA 4GW1B 4ODTH 1ZHBA 1UJ3B 3C5SA 2UWEE 4JM2C 5DQJA 4OM0H 5DQDH 4PREB 1Q72L 4WI5A 4XPTH 4KHXL 4M7ZC 4M1DH 2P5WB 2Z31D 4OF8A 1TVBA 5I73B 4DFHA 4N1EA 2EDKA 5C6TL 3QJHB 4J4PD 4Y2OA 2C1PA 5CP3A 2DKMA 4PJHF 1QRNE 3G6JE 5HVFB 5IFJA 4X6CB 1T89A 4KTDL 2WWKT 3WLWC 1N4XL 3MROA 1CICA 1V05A 1CE1H 4HBCH 4C58B 1KEMH 4N8PA 1RQ5A 1OTUD 4L8CB 4XMPH 1F8TH 3OKOA 4K3HA 5FK9A 1A21A 5C0BA 2CDEB 2HH0L 4JFPB 5DD5H 2IBZX 5IFAH 1A6TB 4L3AA 3VXUB 3C5JB 5D7IB 3WN5A 1JCKA 1YEHH 4ZQKB 3QPQC 4F37F 3BEVB 2HG5A 4RISL 4U1KA 3WUZA 1MJ7L 3AB0B 3CMOL 4EEEA 4PJ9D 4KKAD 2FJGA 3B2VL 4GG6E 2J4WH 3ZHDA 5TF0A 4NJ9H 1MHHA 1AC6A 2VAJA 3LIZH 4KKNA 3RVTD 3HZYA 4WHYH 3RWDB 3DX7A 2NZ9C 4YDJA 3Q0HA 2OL3B 4Z7VA 4BUGA 3TT3H 4G42A 5CHNA 3QEQB 1LO0H 4K7PH 3GBLA 3WL9A 5JHLL 4CU8A 1UB5B 2OS7A 2YR3A 1YEGH 4RBPH 5DHVH 1A6ZA 3FTGB 2ED7A 3FFDB 3KXFB 1BJ1J 1QBMH 1RVFL 2IMMA 3QRGL 4TNVK 2WBJC 3TWCH 3K74B 5F6HJ 5HHXL 3Q6FA 2XZQH 2H32A 3JUZA 4KKLD 1JJUA 5C0CD 3QUYC 4P5TD 5B8CB 4Y2DB 3GGWA 1IGML 1NCTA 2B5IB 2J5LC 4ONFH 3OB0H 1NFKA 4LCCA 2E7HA 1L7TH 4JRXD 1DVFC 1KGCD 3RIFK 3UROR 2OL3L 5GRZA 4JRXA 2MCG1 1GZQB 1U91B 5KJRH 2Z92A 5AD0B 3LKRB 1TVHB 1MRDL 3BUTA 5IV2B 4M4PA 1UM6H 1AGFA 5K9KA 3QXWA 2YC1A 2AQ2A 2QSTA 4KTEL 2XWBB 3VXNA 4QOKB 3QNZB 1MFBH 3IDYC 4JDTH 4Q9QH 4D0BA 4XAWH 3V5KA 4X6FA 3MV7D 3ZKXC 1V3JA 3NCFB 4JAMB 5CJQL 3TV3H 1SYVB 3VGDA 2QADC 1MHHB 4QWWC 4YUEH 1IGFH 2D7QA 1QP1A 2BSSB 2VZSA 3ET9F 1TQCB 4HUVB 2CKNA 1P84K 2XPGA 3QDAA 1RZ8B 2BOCA 2QQKH 3VJ6B 2PYFB 4LPWA 5HDBE 3QUMA 3LPGA 4ODUA 3QT2A 1MPAH 2FNBA 4HIHA 4LLUB 2COQA 4NP4H 3WUWA 2FR4A 3PWVB 1BBJB 4PIRF 4WFFE 2F74B 1KCVL 3RDTB 5FB8B 2DF3A 4ZXBC 1RZGA 1UKQA 4YHNB 1QLRB 3H42H 1OTSC 2GIYA 3NCYS 4KPHH 3KPSE 3T08A 5KSUB 2DQIH 4G9DB 2VSDA 3PGCA 3UTQB 3G5YB 2VDPL 1M7IB 3CLFH 2Q8BL 4FTVA 3PQYE 1WITA 4EN3A 5JOFA 1E4KC 4NBXB 1QUNA 4YGAB 3EYQD 1FH5L 3ZDYF 2Y07L 2ZKHL 3GIVA 4JRXB 3OKKA 4X7FC 3MRHA 3B6SA 3NA4A 3PWJA 4W4OA 4YEFA 2AEQH 5C0IA 5J3HD 2P8MB 3MV7E 4R4NC 4QT5A 3IT8D 3HI5H 4UDTB 3BDYL 4LLWB 3AVEA 2X7LA 1S8DA 2HJLB 4L4TB 3S4SA 5KN5A 1NCNA 1OAXL 3RGHA 5F6IC 1G84A 1H3GA 3BO8B 1CBVH 2GTWA 1QFWL 3ZDYE 1QFPA 4AMKL 3SJVA 5TF1L 1T4KB 2Q7NA 4HHAA 1G7MA 3O3UN 1B3JA 4DKDC 1H3UA 4YDIH 2W0PA 4PLNC 1RZKL 4RAVA 3MRNB 2W9EH 5F7KC 3RWJA 3EHBD 1I8MA 1HQRA 1OTUC 3G6JA 4URTB 2IQAA 3G6AA 3ILQC 5FDYA 3U9PL 2XZCH 4JO1H 4JG0H 1PSKH 4M8QA 4XNYH 3I3DA 3CH1B 4OAWA 4CUCA 5IJVB 1GPOH 1OSPL 2XN9B 5FFLA 3S37H 4G7VH 4F58H 3E8UH 3QAZB 1KN2L 3ARVA 1T2JA 2X4OA 5F9JB 2ZUTA 5I75C 3QWRA 5DEGA 4OLZL 2RJMA 3FB7B 4RFEA 2X4SA 4OCXL 5C0DB 5E1HB 3MCG1 4G9FB 2XRAL 1QO3A 3GNML 3OKEA 2OR9H 4NJAL 5E2TL 5I71B 1JPGB 4WTWA 3VFUA 9CGTA 4BK5A 4ZO8A 2B7DT 2XTJC 4HGMA 2IANA 5ESQB 2XN9A 3QI9D 2DTML 3O4OC 2VITA 3HB3D 5F72S 1BLNA 1BZ7B 5DRXB 4EZMA 3GSNL 4RFOH 4YDVA 1RSFA 5IMKA 4JQVC 1KEGL 5F9WC 1W72A 1DFBL 3N85L 3UTZA 3KVQA 3S5LG 4R96B 3I9GL 3KPPB 3R8QA 3RIAK 5JNYA 4YXLH 4JM4L 3L3OA 4IRSD 3B9VA 3BO8A 3VFPB 1RJYA 3MA9L 3MYJA 2AXJA 4XP4H 3EGSA 4R2GC 1RZIA 4JM4H 3KPMB 5J56B 3VI4E 1R5WB 4K71C 5ABDE 35C8L 1UKSA 3EOAA 4P4KC 1MCKA 1UCTA 2A6IA 4WRLA 4L4TE 3N9GL 3HNSL 2XXMB 3WL9B 2I9TA 4R3SA 1E4KA 2Z4QA 4P23C 1YQVH 2ESVB 2APBA 2AABH 3X12A 3HAEA 2OL3A 4XPAL 5EWIL 1P7QD 2ZCHH 1LEIA 4OM1H 5I18H 3VRJA 5GGUA 4WU5B 1MRCH 4ETQB 4HV8A 4UTAL 2BVQA 3TJEL 1SYSA 1KLGB 5I1LA 2A9NH 4LRNH 2BMKA 2X89D 1XGUA 1ZMYA 5JW3L 3PQYB 4LNRA 3MV8A 3WKML 1AHWB 5EZJB 5F7NC 5E8DH 3CK0L 1XR9B 2BNRB 3VXRB 1LE9B 1E6JL 5FO9B 3IFNH 5J4MA 3KDMA 1VB9A 2PYFA 1LO3L 3QXAB 5LXGL 1P4BH 3RVVC 3MGOB 2X4NA 3D0VB 3QUYA 4HKXB 5D1QC 2I07A 4DUWA 1HKLL 4AH2A 5MEOB 4BFIB 5AZ2L 5DGQA 2FLBT 4OZ4A 5D7LE 2D7NA 5EB9A 1NMBH 1YC7A 1RU9H 1ORSB 4Y4KB 3N1MC 3W81A 1KIUA 4OZGE 3UC0L 3W39B 3ABZA 4KJPC 3SDCD 3WFDL 2CLRB 4OV6F 1G9ML 1I7UB 1HHJA 2K1MA 1PFCA 4Z6AT 5IUSA 1ZV5A 1YECL 4NDMA 5I1DA 4ELKA 3H8NA 2CK0L 3CZFB 3W0WA 4YAQB 4PTTA 3HAEB 3PHSA 4P9ML 5D1QA 2AGJL 4DFIA 2H3NB 4ZTPH 4YO0A 3GZKA 4XPHH 1WT5C 1IILE 2UWEF 3NABH 2A6IB 4PJFE 4HK3N 4KROC 3DX8A 3MSPA 3W9EB 2QR0A 1FVCA 2D7TH 5CBEB 3VGAB 4HUXB 4NZTH 4U6VH 5DMKB 3RUGB 4XZUB 4ERSL 4LDLB 5FA4B 2ZSVB 1XF2A 1FL3B 4LDOB 5FM5O 5A43C 2EKJA 4NKDA 2VLRD 1NUFA 3OR6B 2B4CH 4JM2B 3MRFB 4XCFL 3T04D 4YDVB 4LARH 2HKHH 2VUOA 5E8PB 5D7KE 4TUKH 3FFDA 3KXFA 4NQDB 4S1SL 4OCRH 4HGWB 4PJFF 4LLAA 1D9KA 1JI2A 3SGEI 4OJFH 3U7YL 3GMLB 3JWOH 4B41A 4X83A 3CSBA 5HYSA 4XI5D 5TH2A 5IB3B 3QUZA 5FYLD 4H25A 1S9YB 4HUNB 3SDAA 2LABA 4FXGB 1JWUA 4U3CA 4KZEL 1CGXA 1LEGA 1BD2D 4PJDE 1AIFB 2FEDD 2BNQB 2V2WA 1GSMA 2Z31A 2X09A 3T1WA 3FB6A 1H3TA 4QRUA 3NFNB 3C6SB 1NAML 4XNZB 3GMLA 2XQBH 3TLRA 4R7DB 2ED9A 4LQFL 4OAWB 5IJVA 1EJOH 1ZHNA 3KPOB 2UY6A 3AB0C 1MFAL 4LIQH 1YNLL 3TCXA 3BGFB 1UACH 3PDGA 4LNRB 3G6AB 1XEDA 1KJ2H 1RJCA 2Y07H 4ORGB 1Z0NA 5JOPE 4TQEH 2BSTA 1IARB 2HKHL 3GKWH 5IG7A 4X6CE 1JN6B 4IS6A 4PJAB 3K8KA 3DV6A 3GJFA 4P5KA 5JXAL 1ZXQA 5DUBA 1QRNB 1QBML 2HRLA 4U6VL 4S1DD 3H7BB 4Z7WA 1J1OL 2IH1A 3RX7A 3VFWB 4NO5A 1WWCA 1IC5L 3BEWA 1VGEL 1MPAL 5SWQB 2BSED 3SO5A 3QZWG 1C5BL 4KRLB 2HT2C 1I7ZA 2QQNH 1A1MB 4NUJB 4BKLA 1T20A 3EOTH 1JZ3A 2DQEH 4EN3D 4P5KB 2CK0H 3ILPA 3DUUB 4H20H 3R06A 4KUCF 5SWZA 1NGWB 1A1OB 1NC2B 4BFBD 3P4MB 4OZHF 5IQ9B 4BM7A 1JNHA 3BT2L 1KB5H 3ZKSD 1DZBA 4OF6A 5HYJB 3VMNA 1S7QB 4UTBL 1I3GH 4XAKD 1JE6A 1G7HA 2NY0C 5HHQB 2IPTL 4OCWL 3U0WH 4PP1C 1G9EA 4XRCB 1CDJA 4FQLL 4XP9L 5HJ3A 4OCRL 1JPTH 1GGUA 1XGUB 4NQEB 3TO4A 3L7FA 4MXWL 2YZ8A 1RJZA 2NY6C 5E00B 5EC1A 5HPOA 3E3QC 4QO1A 2YC1B 4ONGL 5E4IA 2J6EH 2CJUH 3U83A 4EVNB 4LP5A 1GZPA 1YEEH 2X70A 1AXIB 4HWNA 3T1FB 2V7HB 2JJVA 2LAGB 5DRNA 2DD8H 4LVHC 2LU4A 4MQSB 3TBVA 5TDPB 4JFQA 1R6VA 3R4DA 1D6EA 4NC1C 1HNGA 4X0KA 5C0JA 4CVUA 3SJVB 3WIHL 5DO2D 1H8OA 3PE9A 5D96C 2E8ZA 4DN4L 3HNVL 3O3DA 1DE4A 3BX7C 2QQNL 3CDGB 2JCCB 3OG6B 2YXMA 5DD6A 4LHUB 1IGCH 4BJLA 1RUML 4U0RB 3TBSB 4O4YL 4DK3A 4FQXD 4LCYA 5FOBB 3UZVB 4S1QH 2VDMH 2YZ1A 3TCLB 5EU6B 1BQHB 5E03A 4PGEB 5DURB 5DJXB 2OTWB 2AEWA 4FMFA 1B0RB 2VDQH 4OD1L 3S5LB 3SE8L 5BMFH 1ORQA 1AFVL 5HYEA 4YXKH 3VFOB 2JK5A 5LGHH 3LQAH 4FTVB 1MQKL 1JL8A 4IS6B 1IKNA 4PLOB 4PJAA 4EI5D 1WZ1L 1CICD 1KJ2L 1QEWA 2YUZA 3IRZA 5HVHB 3BZ4B 3PL6D 4KTDH 1NMCB 1EBPA 4OZ4B 4JPVL 4ZTPL 1EX0A 3D85D 5E2VL 5E8DL 2X4OB 1QNZH 3ORJA 4IHOA 3UYOD 5KBNC 4QTHA 1N2RA 2EDBA 4LRNL 1F3DJ 3IF1A 4BZ2H 4YK4C 5BS0A 4OZIF 3L3DB 3TO4C 1FYHB 4W6YB 2P5EB 2F58L 4R26H 4V1DA 5C0BD 5I1GH 3J7HA 4JKLA 4IMKA 1AHWA 4KZEH 5I1IL 1NGWA 3IRPX 4KI5E 1NMBL 3OXSB 4F3FB 2CMRH 1KTKE 1BOGB 1RULH 1D5BB 1EEUA 2X1PA 4WI3A 4J1UA 2DL2A 2VDKL 3ULUC 2R0WL 4EUPA 4ZNEE 4OFDA 4Y4FD 1QBBA 1NC2D 1P7KB 2NY4B 3M1BA 1P4BL 4NKOA 1S7SA 4C4KT 3O3AA 2R0LH 1IM3B 5D1XC 1D5IL 2OTWA 1INDH 3HG1D 3JTTB 5D6CB 5JPNA 1MH5B 2DLFH 4ZSOB 5GS1C 3X12B 4MA3B 2NTFB 4GBXC 4NN7C 1B0RA 3RWCA 5GHWL 5GGVY 3SDXE 3TCLA 4LSQL 2YBRB 2VDOL 4UIMB 3DMMA 3CFJB 4NZTL 3OAZK 3CDYA 5HYQA 3RTQD 5IBUB 1EAPA 3QXDB 1GC1H 1MRCL 1T1YA 2OZ4L 1DBAL 1L0YA 4JZJC 4ONHB 1LO4H 1U8OB 5EU5A 3U36B 3C09B 1TIUA 2PYEE 1NCCL 2I27N 4NBYB 5I8EB 4RRPG 1OAYL 3GNMH 3T09A 5LWYL 4Q2ZB 2FATL 1BZ7A 5HXMA 2WUBH 1OAKL 1A1NA 4P2QE 4IBLT 3H42L 1JUFA 4HCRA 2IPUK 4XPBH 4HAFA 1HSAB 5SWSD 2GUOB 3GI8L 5KSAC 5DUMH 3VFGL 4HUWA 4LAJH 5GS0H 1XF4B 4B50A 3O2DA 4WO4B 4D9QD 1J1PL 1N0XL 4Q9CA 4LGRB 2I24N 3P9LA 3TYGL 1YUHA 3VH8G 4G9FA 4YGVB 3GSNH 3TA3B 1K85A 3O6FA 1YPZF 4MCZA 4X7TA 1S5HA 1GVIA 5C07D 1BMGA 4UDUA 1C12B 3MJ7A 4NN6B 3IGAA 2GCYB 1UC6A 3HE6A 2EYSB 2GUOA 5H94B 4CN1A 5C09E 1XIWD 1WAAF 1LK2A 4ALAL 1JUFB 4AENB 4HQQL 1T7XA 1PVHA 1A3LH 2Y7QB 3VWKB 5KTEH 1CFSB 2PCPA 3SDXA 3BSZL 5DJYB 1U8KA 2PYEB 3CVHH 5KAQG 1YPZE 2RB8A 3BZDA 5FYJL 5HI3D 4HWZA 1KTRL 3DURB 4H0HB 4P2OC 4Y4HD 1T1YB 5ID1A 4JY6A 1GPOL 3MRRA 1G9NL 4R0LB 5ALCH 3L5XH 1PSKL 4KRPD 4FQLH 3LQAL 4WW1A 1NGPL 3WLWD 2P44B 3KPLA 3AUVA 1D9KC 3QZWB 4E41A 3A6CL 2EDWA 5JZ7C 4KUCD 5ANMB 3HFML 4TUOA 3CNKA 5E2WH 5GGSY 4PJ7B 4C4KO 2BVOB 3TYFA 2G60L 4K7FA 4X9FA 3HA0A 1F58L 4BH7B 5IG7B 5JLZB 3ROLA 2NX5A 3HPLA 4WW1B 1BD2E 4HFUL 4XNMB 1P7KA 3M1BB 3HR5A 4LPUA 1S5IL 2X89A 4JY6B 1RZGB 2EKSB 5I30L 2H8PB 2ICWI 3V79C 1ZAGA 4EJ1C 1NKOA 2FX7L 1SEBA 4X5XB 3QWQB 1OP5K 1NGZA 3ARTA 3SGDH 2AEPH 4KUZH 1MJ7H 2AK4E 4UUJB 4MXQD 1ZHNB 4XNUH 2PN5A 5DWUL 1ZGLB 2J8UF 4F8TA 4AENA 1M6OB 1A6VH 5FO9A 3HZVA 3QUMB 1NEZG 4JB9L 1RK1A 4TSBH 4OCXH 1NPUA 3OG4B 1WQVT 3I6KA 1NJ9B 4MA7L 4UAOC 1BJ1H 1ACYL 1KN2H 1TTUA 5HVWA 4X6FB 4P5MA 4Y16B 2H45A 3X14A 4X5XA 1A7PH 3QUZB 1FPTH 3WIFB 2H8PA 3FN0H 2XQYK 2F8OA 4KKLC 2QQQA 3FO2B 1VEOA 5E24E 3T3MF 3RY4A 4I0PD 5LKNA 5A3IC 4UTBH 5HHXH 5HYSB 3RBGA 2V17L 2E27L 2L7JA 1YY9D 5EBGA 2JK5B 3CDFA 3QRGH 4WEMB 5CMAB 5TDOA 2CIIB 4K9EH 1CFQA 2EDFA 4YXHH 1FC2D 2OR7A 3RAJH 1FORL 1RZFH 5HGDB 4G6JL 1U8JA 2DI9A 4YZFE 5T5FL 3BISA 4P2RB 3DI2B 3KPMA 3DTXA 1UM6L 4W68A 3EGSB 1F90L 1BD2B 5HYFA 2G75A 2ZSWA 5BV7H 3WXWL 4KJWC 2NY5C 2D4DA 3B2VH 3RJDA 4LSRL 4LCUB 1T0PB 4X7SH 4QT5B 4LPYA 3GSXB 5IVZB 1CFQB 2YUXA 2X4QB 1KTLA 4HKBA 3LN4B 3RIAF 3W39A 3HZYB 1HHGB 3MRLB 1UVQA 4TSBL 4ERSH 1VFMA 3DX7B 4GAFB 1VA9A 1TCRA 2N4IA 1I7TB 1MUJB 1CZ8L 1FQ9C 3GMOA 3O2DL 2H6PA 4YNYA 3B8SA 5FHAL 4YHNA 3IDJA 5E08H 3FHQA 3EHBC 2NW3B 4PGBA 1MHPL 3V8CA 3GEWB 3IDYB 3MGOA 4LHQB 3IFOA 2IANE 2CDEA 5FYLL 4HJJH 1ZVSB 4DGIL 4XCEB 1UEYA 1FAKT 4PUBL 1J05A 4C83B 4R7NB 3VU2A 2I9LB 1CLCA 1G9MH 5L7XL 1I8MB 1Q0XL 1QSFD 1GXEA 3QCUH 4I18C 5D7IF 4DJMA 4XP1L 5IW3A 3GMPB 2WBJB 4RISH 3C6LD 3P4MA 1YYML 4DVBB 3SJVD 3JV5A 4HK0A 3DV4A 3RL2B 3VD5A 4MB4A 3S3SA 1KLGA 5I1LB 3NA9L 4N68A 3SKNA 4OUOA 1OLLA 4KRPC 3OJVC 2YSSA 2V5TA 4TYUA 3FQNB 2R4RL 4LK4A 4WWKC 4I0PC 5IGXH 5ADOH 1EFQA 3S5LA 1TZHB 2OJEB 3NTCL 5DJ8A 4DN3H 3BMWA 1WWAX 1FLTX 4ZS6C 2G5BB 5IBUG 2Z4QB 3V6ZA 2R15A 4HXAL 3AXLB 4MGXA 4P3DA 4P2QB 1RZIB 3IS0X 3NPSC 5I0DA 2V9TA 2EIZA 1RVFH 2R4SL 4BK4A 2OMBA 2I5YH 1AR2A 2DQHL 3BWAB 5ERWA 2DKUA 1MREL 2DRUA 3QPXH 2P43B 3VWKA 1RHHA 2AS5M 5TDPA 5BVJB 3TBVB 3MMEB 4UQ3A 3C9NA 4MWFB 3SDXB 4F7EA 2WAHA 2XTJD 1C5DB 2EEAA 2EYRB 3TFKD 1J10A 1A8JH 4YBLB 3JV0A 1J1PH 3MCLL 4B7LA 1ROWA 3EYVA 2HVKB 2OX5A 3FONB 4PYHA 5B4MD 1PGRB 4YX2H 4MX7B 4X6DA 2Z35B 2IF7A 5DJZA 5CILL 2VL4A 4PJ9A 4OUUA 1T6VN 3ZO0A 5IMOB 1OW0C 4XVSH 4P9HH 2BRQA 5CIPA 4XNXH 1JWMA 1MWAL 3IVKA 2IG2H 3P3YA 4AEIH 3AROA 4A6YL 2FX9L 4NZJA 4WHCA 3LN4A 4NQDE 1JF6A 1XGRA 5EZLB 5J9PA 1BGXL 1UM5H 2P5EE 2Y5TA 3MO1B 1FL6B 1CD9B 4W70A 4LL9A 5I71C 4EN3C 2NY3D 1IBGL 1YDPA 1NGQL 1MFCH 5GSRA 1IEHA 4IJ3C 3HLAA 2ZOLA 4JQXC 2OXHA 4XXCA 5AYQA 2MPAH 3MNVA 5I18L 5T3XL 4F9LC 4NQSA 3U1SH 3ULVD 1WAAE 2EE3A 3U4BH 1Z5LA 3D6GA 1LP9E 1NKRA 1JHLL 2VDLL 3MOBL 4YAQA 5E1AA 5SWQA 3S35L 2PO6D 1Z9SA 1TJIH 4HW6A 3CFDA 4HEME 1I7UA 1LNUA 4ETYA 1CDUA 4GAJL 4LSTL 4P4KB 4K7PY 4LEXH 1KPUB 1OY3B 5J1AB 5DDHA 4BZ1L 5MENB 1QFWH 5CJ5A 4MNGA 5DD3H 1MCIA 3PGCB 1EBAA 1NBVL 3D85A 1CS6A 3MLVH 4OLUH 3WUWB 4JHWH 5ESVB 4RMQA 2H1PL 3PWPB 5IFHL 4Z7OE 1AGBB 3MTRA 3KYOB 1MWAH 3MLXH 4UOW0 4X4YB 1REIA 4R4FH 3NAAH 3TNMA 2VOTA 3MFGB 5ISZD 5I1JH 5HHQA 4LVOC 2MKLC 3OJDB 4K55A 3TBYB 4DZ8B 3L3DA 1EHXA 2W65A 5BS0E 1UGNA 3FAXA 1BJ8A 1KJVB 4JZOB 4QRUB 5BVPL 3RJQB 4K3DH 1BX2A 6CGTA 2NY2B 5E94A 4U1NA 4UV7L 3OAUL 4U7MA 2GJ6D 2FGWH 5CGYD 1NFIA 3OTTA 5TH2B 4NRYA 4CMHC 1SJXA 3ZTNH 5GGUB 3LQZA 3WE6A 4D8PB 2AI0L 1C1EH 2WWMD 2DMCA 1AQKL 2GK0A 3L6FA 2AV1A 3EDEA 2PO6B 2X41A 3MLUH 3MV01 4UT9L 5C08A 1OWWA 3VXSE 4JRYA 5HHPB 4BQCA 2W59A 1IEAB 1EHAA 4KVCL 5C92A 1G0YR 1BAFL 3EO9L 2B1AL 4FQIH 4U1LB 3OKNA 4O5LL 3MYJB 4R0LC 4P59H 5HHMB 3L3OB 4KDVA 2C3GA 5FA4A 2R23B 4KJYB 5I8KH 4LCYB 5CUSH 3L1OL 3TBSA 1J7VR 1MFBL 2PNDA 5C3LD 5LQBH 3G9AB 2D7MA 1FIGL 4NM4H 5FDWB 3RVUD 3QUZC 1NCWL 3TO4D 5CGYC 5FM8A 4FQ1H 4JN1L 1QKZL 2MQCA 2UWEA 2BNUB 3WDJA 1IM9A 2PYEA 3QG7H 5E6IC 5GJTH 5EU4B 4LAQL 4Y4HA 3C5ZD 3WD5L 4EVNA 4HFWA 1O5DT 5CD5D 5J1TC 4NO3A 3M17A 1KC5H 1WEJH 5DC9B 3ZYJA 3CLEL 1YN7B 5JOEA 1Q0YL 1A9BB 3GSUA 1U6AL 3MOAH 3HAEG 1T1XB 4NZRL 2HG5B 3F65A 3O6FB 4MCZB 2P1YA 4RGNB 4X7TB 4MNQD 1AD0B 3L7FB 5BZDB 5KG9A 3M07A 1KCVH 4MD0B 5C0CB 1ZGLP 2VLJD 1WSST 3TZVA 4DZBA 1K4CA 4NQCA 2W60B 3AREB 4HBQA 3RX5A 1MFEL 3HMWL 2BOBA 4Z76A 3B4NA 2EC9T 5CBAB 4X4ZA 1N5YH 2NY0D 5MEQB 3CVIL 3MACH 1BM3L 3UJTH 4O2EA 1BVKA 5CZXC 4FP8H 2GTWB 3S8WA 3ZYOA 4KXZI 4MJIB 4ZFOB 1SYSB 2QTEA 1P5UA 3ZE2E 1WTGT 4XPGL 1E4XI 3MBEA 3W9EA 5I66A 4H88H 4Y5XC 1CL7H 3KYMA 4LU5L 1B6UA 3RWCB 2EDHA 2H3NA 1J5OH 2ZUXA 5ANMA 2F5AH 2ZOKB 4JQVA 2AJVL 4PB0L 2EIEA 1EA9C 1S78D 1X6LA 2IAND 4WEBH 5KSAB 3LDBB 4PP1D 1VKXB 4L3EE 3CFEA 1DANT 4QTIH 4JCMA 3BIAX 4RA0C 1IQDB 1IZJA 3WDIA 1FIEA 1D5BA 4ZDHA 1RUAH 5D1ZD 2F15A 2ZG1A 1HXYA 3BQUD 2FL5A 1B4RA 3I02B 4OM0L 1J05B 1FPTL 4L4VB 5AZEH 2PXYC 2EXYD 2VITB 2MCPL 5L8LB 1T7WA 3V5DB 3O0RL 5ESQA 1IL1A 4NO0B 2R1WA 4X6BB 1G7QB 2DYPD 3MGTA 4O58L 3P0VH 4M62H 5EOTA 2H2PC 4CVWA 1LEGB 4WV1C 25C8H 1I1AB 4XBPB 4M7JH 5IP4A 3OKDA 2A38A 1Q94B 2V2WB 4OF3A 4LHUG 1WK0A 3OKLA 4XNUL 5MEQA 2I26N 3U0TB 1U8MB 5IW1A 4KMTH 1KELH 1G7JB 1OAZH 1QSVA 3FT2A 4IRSC 4JPIB 5I1CL 4S1RL 4Z5RB 2DM7A 5E8PA 4G7YH 1U58B 4XC1L 1D9KB 4W6XB 5HDBF 1GZQA 4MJ5B 3WIHA 2HMIC 2I25N 4PBXA 1JZ4A 4PJGA 4X9BA 3WFEH 1G7LB 1WBXB 2YRZA 1FVEB 2WIIB 4J7RA 1J0IA 4XNQA 1U3JA 4U1MB 2W0KA 5EUKA 1HINL 3ALWA 1MCOH 32C2B 4JJHA 3BYTA 3MLRL 2VLRE 2Q87A 2R0KL 2BFVL 3ZDXE 1F4WL 2HT3D 4DEPB 3NFSH 3MR9B 3O3BB 1CIUA 4PR5A 4CMMB 2ESVE 3TIEB 3T3PE 4M5ZH 2HFEB 2IBGA 1DDHA 1FG2A 3D18B 4K2UH 2ARJA 2X10A 1N7ML 3OGOE 1V7ML 4AL8L 1EXUB 4QRRE 2F54A 1RUKH 2UUDH 5D71H 1I9JH 3O3AB 5FYLE 5MERA 2PW2A 1DQQB 2R23A 1QYGH 4H5SB 1Q9WA 1L0XA 2F9BT 3I75B 4NO2B 4HH8A 1MVFA 2NY3B 4G9DA 3LB6D 1FZMA 3HRZA 4TPRH 1TXKA 5C0DA 4J4PA 3GRWL 2GK0B 3DXAE 1ZT4B 4O5LH 1BJMA 4NC0B 2NNAA 1S9WB 4MVBC 4KV5F 3KPRA 1W0VB 4NRXA 4OFYA 5I1HL 1PKQE 4RWYH 4GOSA 2WUCH 1T03L 4OQ1A 4NRYB 1M6OA 4LSDA 1UQSB 4YH6A 4JDZA 3SGJC 5L6YH 4UV4H 1JNLL 1IKFL 1UA6L 2C26A 3ALPA 5E8OA 2V9RA 1DBKL 3IJSA 4UOJA 1OPGH 2BNRA 3VXRA 3A6BL 3HC4L 1FE8L 3EO0B 1HQRB 3G6JB 1JWSA 3U30C 2C7UA 4RMWA 5KOVC 3NPZB 5F96L 3PQYA 4XCYB 3F7RA 3AFLA 2R1XB 3RY6C 1G7MB 3OJDA 1OAKH 3HR5B 4DZ8A 2VLJA 3K2UL 2JB6B 2ZUQC 4CADA 3L95B 2XN9E 4MD5A 2QADB 1KC5L 5K9KB 1OAYH 1L4IA 3CFDB 4M6NL 3UXFA 1ETZB 1I1RA 4L5FL 4PJEE 3TN0A 2A9MH 4HC1A 4HIJA 3HC3L 2HVJA 4H8WL 4KK9D 1SQ2N 1Z5LB 1XCQA 4K94L 1QA9B 4CBPA 2RHEA 4N5ED 5MENA 5DUBB 4RFOL 1Y6NR 4LHUA 4HIIA 1NBVH 4CN4A 2FB4H 1FZJA 5DRZB 3FT3B 4QNPF 5MHSD 1RFDL 1WLHA 2PUQT 3P4OA 4XC3H 1SVZA 3MLSH 3MFFB 1SY6L 1M1SA 2FJHB 5TFSH 3BQUC 3QIWB 3FB5B 1ZWIB 3S34L 5KVGH 3FB8B 2EICA 5FOJA 4YQXH 3UTSD 3KYKH 2ZUVA 2EEDA 5MP6L 2X70B 3MNVB 4JRXE 5DD0L 5TQ0H 1J0HA 5FA3B 5F7FA 5F96H 5HGBA 5ACMA 3FO9B 2X4SB 5A2JH 4L8SA 1MCJA 3DVNB 3QUXD 5DYOA 3TIDB 4JG0L 1FNEB 5DJ0A 2MPAL 4UB0H 3C60D 2N7AA 4HG4J 2V7NA 3FO0H 2F8VA 4OFKA 2EYTB 4D3CH 4RQQB 1JYWA 3WNLA 2XG5A 3OKYA 4KY1H 4EDXA 1A7RH 5EU7E 5EZLA 5C0RH 4HJGB 5E2VH 1PKQB 3O81A 3CH1A 4P5TB 5CSZA 5EIIB 1XGQB 3GRWH 2MFNA 4OZGF 2LTQC 1W72H 8FABA 3SGDI 5JW4Q 4OZIA 4WCYH 4L8CA 1C5CL 5BXFB 2EH7H 3KXFD 2P24B 2XZAL 3OKDB 5L9DH 5IVXB 3ARGD 1CXFA 1WAAA 1RIVH 3U30B 3GGWB 2J7LA 1G7QA 1OAZL 3RX8A 1DQLL 4G6KL 5ETUB 1YYLH 5BCAA 3AU1A 2IFFH 2J12B 4WTZG 5BOZG 2JIXA 3HUJA 4YHLL 1NLBH 3SDAD 3V95A 4XHJC 4KGJA 1RUQL 3FB5A 1IGCL 1HIMH 2XQYG 3JXAA 4KPHL 1F3RB 3C5SB 4UT6L 3VGEA 1UKTA 3RZCB 3SCMB 4K8RL 1MIEL 4QGTA 4M7LH 1G9NC 2DWDB 2V2TB 2BY2A 4Z7VB 4WWKA 4LMQE 2FJFB 3HC4H 3KLAB 1RHFA 5AUMA 7FABL 2BSRA 1TQBB 4GLRH 2F54E 4L8BB 5IB1A 1NEZA 1IEBB 1I8KB 3KXFE 3OZ9L 4ODUB 3KPNA 4Y1AD 2A73A 3KPOA 3TVMC 5ACLA 2NY4D 1Q9OB 3GRWA 5SX4I 3FQXA 3KWWB 3SE3A 2P5ED 4XCEA 4JFOA 3V4VH 3ES6B 3H9SD 3QEQE 1NBQA 3IKCA 4LLDB 1K8IA 1DBJL 3VXPB 5FYKU 4QHMB 5ENWA 4UMGA 4AT6A 4AEIL 4QTHB 4OCWH 1HEZB 2FIKB 1NBYA 4PV8A 1JZ7A 1JFQL 1KCSH 3GHBL 3GMOB 2GITB 1FBIH 2BY1A 5INCA 2ESVD 2VERN 2YUWA 2QSVA 2XFXA 5EUOA 5AZEL 1MRFH 3VFTB 4HLZG 4LGPB 1PQZB 1VESA 3H3PH 3VXUE 5F3BA 2HWZL 3PL6A 5JO5B 1G0DA 1JK8A 3EYQC 3OWEA 1CF8H 3PWNB 5F1IA 2VLKE 3QB7C 5HVGB 1JNNL 4GRMA 2VXVH 5CS7A 2OTUB 4J3SA 3PQYD 4YNYB 4MNHB 3TT1H 2FIRT 1FNGB 3MRCA 3VDBA 4PRIE 1BF2A 3VGGA 1UWXK 3QI9C 4OLVH 4X99B 2VZTA 4D9LH 1NCBL 4PRNB 3QIBD 4L3EB 5FHAH 1H5BB 3MBXL 3NGBB 4EIGB 4X98B 1HHGA 3DIFA 1FV1B 2ID5A 1P2CB 3HS0A 4GXVL 5IROC 3U7WL 4G43B 3C08H 5JXAH 1HCFX 2XKSA 1ES0A 4XB8A 1ZWIA 2ADFL 4N0YL 3VWJD 4RGOH 1H0DA 3JWDL 2XZZA 3HR6A 4KMTL 1FSKC 1N8ZB 3LEVL 5CMAA 4PBWD 5BO1H 4LQ1A 4CAGA 4TQEL 3DIFB 4M1GL 3FZUD 3QI9A 2YD4A 4ZFZA 4YDJB 5HYSG 4NNPH 1R0AH 5GZND 1BM3H 1WZMA 1KJ2B 1DQJA 1Q38A 2NY5L 1I75A 1U3HA 2EIDA 1U93A 4S2SB 3D0LB 3O0RH 1ZLUK 1QRKA 2NXYC 5C08B 2GJ6E 4ODVL 3WEXB 1HH9B 4IRSA 2E7LA 2PXYB 2UZXB 3HI1B 4P46A 5CUSL 5TPWL 1U41A 2W9LA 4MAYB 4GRMB 4P59L 1A3RL 5C09D 1JHKH 3RWHB 5EULV 1WT5A 1WV7T 3RWGA 4YE4H 3F6IA 5T3XD 5FGSA 1IGTB 1U6AH 2J8UA 4PJIB 5JIPA 2AK1H 2IFGA 3GIZH 3QUMH 1JHKL 4MZ3A 4PGCA 1A7OL 3L3JB 3LEYL 2HN7B 3RVUC 4MAUH 3Q3GA 1EJ6A 4Q6IC 5T1LA 15C8H 5DR5L 4K8RH 4OZGA 5JDSB 4Q58C 5SWZD 1K8IB 2B4CL 4P3WA 5BV7C 4OI7A 4JFDD 5C0EA 2DIJA 4RWHA 1Z3GH 1I8LC 2EH8H 1AY1H 3NIDE 4OFVA 3RVXC 1NGYA 4M1GH 1I3VA 3HUJE 5HHNB 4DVRL 5C2UB 1U95A 2DLIA 4PYGA 2V2XB 4IRJD 5F97E 3A0OA 2D3VA 4LCWA 1MAMH 1YYLL 1I1CA 3UJTL 5LGJA 4WWKB 4HS8L 3F58L 1S7VA 3CVIH 1JN6A 1RIVL 2BVUA 1X5YA 2AP2A 3S3JA 5CLTA 1UZ6E 5IT2L 1RI8A 1GIGL 4JR9L 4FFYL 2A6KB 2PW1B 3U6RA 1AC0A 1HKFA 2JJTA 5CJOL 4HSQA 5IHBA 1HH6A 5DK3A 2ZG3A 5LBSL 3F62A 2XYCA 5I2IA 2A0LC 4HKZB 3IJHB 2JB5H 5IIEB 1KG0B 1FAIL 1H3PL 4MJIA 4ZFOA 3UTSB 3VFMB 1EHLH 5IW6B 1QSFE 5E2UL 1U8QB 2ENSA 4ODSH 3VG0L 1KTDA 4MNQB 1D9KD 2FH6A 3SPVB 4X8XA 3OXRB 3U4EB 1DLHB 5C0AE 4RFEB 5C0NC 1ZE3C 3NN8A 3JWNC 3WD5H 5D8JH 2WQRA 4GG8A 4H25B 5JXEA 5EU7C 4N0UA 4HPOH 4YLQT 1IC1A 2GY7B 5JW3H 1HSAA 5KVEH 2E7BA 3WHXB 4ZPVB 1BP3B 2Z8SA 4EOWH 3U0PA 1H3WM 4L4VD 4PGDB 5DK2A 4MQTB 2BCKB 2EZ0C 4PJ8C 3LKOA 2FEEL 3GDBA 2AJYH 4X8JA 4Z8FL 1FJ1B 3L5IA 5D2LA 4PTUB 3IU3A 5E7FA 5KSVA 3LDBC 1R3LA 3TYGH 4ONHA 1S5IH 5C71A 1I9JL 5JORA 1CDCA 3MRQA 5I8CA 2CLZB 1RZJH 1LO5A 2D31A 3KYNA 4E5XA 2YD5A 3QO1B 1MLCA 3MNZB 1HH6B 4UDTA 3P73A 4LDEB 2DBJA 4U6XA 3S36H 5CP3H 2PW1A 3U6RB 1AGDA 2FZ3A 4Q74A 5TE7H 1LEKB 4G8EB 4N5EC 1YJDL 1NSNH 1BWMA 3QHFL 2LQRA 4NKOB 3H9ZA 4AQ1B 3QIBA 2JB5L 1NGQH 1OVZA 1AR1D 1IBGH 4YHLH 3IJYA 4J1UB 4KK8D 1FNFA 2IFFL 1T5XB 5AYUH 2Y06H 5F7WC 4BQ9A 3VXME 3WIIH 4BH8A 1IKFH 1DN2A 1UA6H 3VCLA 1I8IB 1SBSH 4WHTA 2XRAH 4JR9H 3IETA 4HJ0C 4WUKL 4NRZB 4JPKL 1HOCA 2YHGA 3ZKXB 3RQ3A 3U9UA 4RBPK 4KMQA 4EI5A 2AXGB 4KRNA 3QXAA 4I2XA 4JFPA 1DUYB 5C86A 4DQOH 4IRZL 4PRHB 1KULA 2L7UA 1MAJA 4IOFD 3MJ8B 4L9DA 2GEEA 3BOVA 4XX1G 3SE4A 3HB3C 5HGAB 5DJAB 3KJ4C 2HLFD 3EJYC 3NA9H 1HI6A 4EI5B 1P5VA 5JIKA 3QNZA 4PJHE 4AL8H 5HDOA 3RDTC 3CUPA 3MRMB 4GKNA 4MAYA 2P5EA 4WU5A 4Z0XA 4N8CH 1K4CB 4POZD 4XBEL 4CKVX 4I2XB 2F53A 4JFHE 5EN2B 1HILA 1IC7H 1ND0B 2NNAB 1T83A 3D85B 2YPLD 4MA1C 1WBZB 4Y2DA 2D0HA 3QQ9C 3QQNA 1R3HA 3NCEB 4IDLA 2Q6WB 2CH8A 4FQ2L 4NQVA 3Q5TA 2CKBB 3WFEL 3KLHD 2H2SD 1KLFA 3MREB 1QLEL 3BZEA 1GC1L 4U33A 1CYGA 3TIEA 4PR5B 1KIQB 2CKBL 3UPCA 3MV9E 4U6YB 3BKJL 1RZ7L 5GISH 1MCHA 3LKNB 3CFBA 4Z7WF 4Y1AB 5IHZA 1P2CA 3HS0B 3QDGE 3UDWA 1MJUL 3AU1B 3MRKB 1R3HB 2QSQA 1I1AD 1YYMH 4HKJA 4QHKJ 4Y5YA 5DD6B 1MAML 2LV4A 4M6NH 5D1QD 4GBXD 4YZFF 2O61B 5FYKL 2Y23A 2HVJB 3G5VB 3LSOB 4FABH 5T1DL 5L7XH 2BXYA 2QQLH 4OGXH 2VDKH 2PO6A 4M7LT 3OL2A 4QF1A 1JHTB 2H2SC 2GJ6A 1L6XA 3QAZC 3DETC 3QNYA 5EIIA 1XGYH 3P11H 4YBQD 1DN0B 3CZJA 3SDCC 5EN2A 4ONOA 3JV6B 4U6TA 4J6RL 1Z6JT 3K4DA 4OGAC 4NNXB 2BNQD 3WN5C 3UPRB 4GKNB 1MCCA 3CUPB 1PQZA 3MRMA 4Y88A 3RP1A 2IQAB 1CZ8H 5JMOC 1AGCB 1GOGA 3WJJA 5ADPL 4JG1H 1H3XA 2FO4B 1X5XA 3I6GA 5KZCB 1QACA 4XVUD 1CF8L 3UTSA 4XRCA 3VFMA 3EIFA 1NBYB 3D3VE 4UBDC 4NZUH 2VN4A 1VHPA 3HZVB 1G7HB 4GXUN 2C1PB 4EIZC 3NCJH 3O11A 1ZVYA 3KGRA 1QSEB 3WS6A 3VWJA 5DMIL 1QSED 3MJ9L 3KS0J 1KSRA 4J3TA 1VEMA 2X7LB 4CVXA 5BVJA 4JVPA 1P4LB 4Y5VB 5H2BA 5J0BA 5KW9L 4M9PA 1MCPH 1FVDB 2NY1D 3AS3A 3RI5F 4JY5L 2DQTH 1SJEA 3K1KC 1ZHBB 2DBLL 1N7MH 2X4PA 3BH9B 3S88H 5BQ7A 1MVUB 4LCWE 3A6OA 3D2UB 5MERB 5BO1L 1TNMA 5A16B 4I0CC 1ITCA 2GT9B 2GJZA 5DVLA 5TGBB 3TH2T 2YEZB 1IGJB 1T83C 3HCVB 4PRPA 1U2CA 1FP5A 2Y4SA 2WBJD 4YXHL 5BZWB 5F6IB 3MBEC 1CDIA 4LCWB 4G8GD 4GS7B 5FYLH 2PF6A 3N1QC 4Q6IB 1Z2KA 1EGJH 4Z7QF 4ZO6A 2BP3A 5KANG 1MF2H 3HTLX 3UAJC 3LIZL 1S7XB 1M71B 2DI8A 5EO1B 1ONQB 5I8OH 3IFLL 3WNPA 3BPLC 4XH2A 5GGRB 1NMAL 3JV4B 3EYSH 1LO5B 3NIGF 2KPNA 4PJ5E 1T3FB 4JREB 3FMGH 3DYOA 1ZT1A 2IJ0C 4TOYL 4YHYB 1QSEE 4DVBA 3OX8B 1N5AA 5B39G 3OAUH 4P49A 2P5WD 2Z31B 5CZVL 2NXYB 4X8JB 2V5RA 4M43H 3PHOB 5E8EB 5SWZE 1F6FB 1A6VL 5SV4A 3TJHD 3MUGB 2VABB 3SBWA 4M00A 4LSRH 1SMAA 4KGLA 2C3WA 1N4XH 4CVZA 1UH3A 2BOBB 1A7NH 1I85A 4QHLB 3WFZA 1TVHA 3C6SA 4GKSA 3GHBH 4FZEL 4Z7NF 3HRZB 2QL1A 5KSBF 2WMPA 2XTJB 2IAMA 3G5VA 1YUHB 4Y19E 1TPXC 5F7HA 4IRSB 1AXTH 1IAOA 3HNTL 3WEXA 1NC4A 4KQ4H 3RUGF 1TZIA 3KS0H 1QFUH 1G0XA 4PJ7F 3D9AL 4XCCL 1YMHB 1ZSDB 4Y1AE 4NQXA 5GGTA 3FO9A 3KAAA 2X1QA 2JJTC 3Q1SH 3PGFL 3S3PA 1L6ZA 2D9CA 2YMXL 1KIQA 2IPUG 2K7QA 3DARA 3V7AG 3QBTB 5ANME 12E8H 2AJXL 3CFBB 3SOBH 4LLMB 5C0AD 1F42A 3K8LA 5FF6B 1F5WA 2O93L 1MSPA 3QHTC 5B38G 4FQXB 1X5GA 5SWSB 1DQDH 4U1JA 3MJ6A 3QEQD 5I1DB 1I7RB 2ARJQ 4NQXB 5CJ8A 4W81A 5FYJE 4KVNH 3HG1B 3TPKA 4KRMB 4XMKL 5FKPA 5GS2D 4HWUA 3KYKL 1MFCL 2NX5E 3CFJA 1D5ZA 1JZ6A 4L1HA 2Z8RA 5BVPH 1P6AB 3I6LE 5HY9A 5BRZA 1KLUA 5CD3B 3MRCB 3RTQB 5DMYA 1QBLL 1N64H 1HWGB 1UM5L 4XPHL 1KPVA 1AHWC 3PABA 3WE6B 2P7TB 2Y72A 4ZFGL 4I5BA 3UZQA 2ZWLT 3OHXB 1K6QH 5IB2A 4PV8B 4H8WH 5CILH 1PKOA 1NFDF 3W5MA 2Q7YA 5D93C 1I1FA 3ARED 4HAGA 4WVRA 3VFGH 3EO1A 3GBNL 1KG0A 3GI8H 4MJID 4Y5YC 3HZKB 3IJHA 1T5WB 4Z77A 1JYNA 4WGWB 3HFMH 2BZDA 1MJ8L 2K9UA 4MA8H 1JPST 3TJHC 1UM4H 1CLZL 3T77B 2CMRL 3ZT5A 1PX3A 1F97A 2NY7L 1AQDA 1G7IA 4IOIA 2WZPD 2EDTA 4PGJA 3SY0A 1U93B 4S2SA 1MUJA 1JGDB 1I7TA 2ATKB 4L8DB 5DXWA 5F44A 4J3WA 3QIBB 4L3ED 2A77L 4ODWA 3VXMB 5CEZD 1MY7A 2OZ4H 2NZ9D 1F6AB 4PG9A 1NCDH 2DJ4A 5ILTL 4NO3B 5HYIA 1TZGL 2NXYD 3HC0A 1IGJA 2IGFH 4PRPB 5EOQL 5EBWA 4NC1E 3WUWG 3HE7D 3NACH 4MJ6A 1EIBA 3I3BA 5KTEL 2A9NL 4D0CA 1WIUA 3E2HB 2C3HA 4CVXB 1VPOL 3VFNA 2BY0A 3VXOB 1DDHB 3T3PF 4EI5C 2R0LL 2UZIL 3MRQB 5I8CB 2H9GB 3NCCB 5EZOH 4DCQB 3EZ8A 5JDSA 1KJMA 1CL7I 4W4NA 5DD1L 5D6DA 5KSVB 4WWKD 1MCQA 4ODHH 4XHJD 1CLZH 2ICWJ 3QIWC 1RUKL 3GSNA 5D71L 4CU7A 5L2KE 2VH5L 4MLSA 5E5RB 3CX5K 3CXHK 3ARGA 3WFCH 5JW4M 4M6MH 3UTZB 3V0VA 3B9DA 4P2QD 3QULB 1WBXA 4LCCC 1R24B 1UXWA 4MJ5A 1KGCE 2A83A 1F4XL 4YDLC 1XAUA 1RUMH 3UCRA 4HS3B 4P5TA 5CSZB 2VDNH 3L3KA 2JIXD 3RTQC 4HG4K 1JP5A 1NUDA 3HNVH 1GZPB 4QHLA 4XVJL 3CVHB 3QCVH 3O3EB 3LMJL 5C0AB 5T3ZH 1S7WA 3EYFA 4XTRD 4XMLL 1VDGA 4U1NB 5ICZA 2VN7A 3A6BH 1PZUB 2YD9A 3MLYH 1J0KA 4ZS7H 2GK2A 4X4ME 1ZLUH 5I0ZA 4NSKA 5CEZH 5IKCB 2GI7A 4K07A 4ZFZB 4S0SD 1RK1B 3JUYA 1ED3A 4LSQH 4PJXE 5DJ6B 2IGFL 1A3QA 5EOQH 4HKZA 4OD1H 1EPFA 5K93A 3CPLB 4Z7UE 5ILTH 3DLQR 3CFCH 3DO7B 4MXWH 1QFOA 4BSVA 1PZ5B 4WU7B 1FFNA 1JPTL 5J89A 1RK0A 4Y1AA 2FL5B 7CGTA 1RY7B 5ITBL 4Q6IA 4DGVH 4I4WA 2WSKA 5B21A 1CLYH 3RA7L 3U36A 3WS3B 3DYPA 3DUUA 3B9KD 4N0FA 3ULSA 3PGFH 4ZS6D 4ENEC 4XCNA 4JJ5B 5IF0A 1FFOB 5GS1A 4XP1H 3V4PH 3QEHA 2Z8VC 2DD8L 5JW4R 5HHPA 1X7QB 4RIRB 1J86A 2FCBA 1E4JA 1MCEA 4LKCA 4JEGB 3MLPA 3SY0B 1BREA 4POUB 4ZD3L 2JIXB 3HUJB 5DMGC 4ZFGH 1R3KB 3MCKA 4K8RC 1BQLH 2AV7B 4CADB 4FN0A 3ZMRA 4V2BA 3ZE1F 4Z18A 4R0LA 3UTOA 3HLAB 5JA9A 1C5BH 1J0JA 4OF5A 4JO4L 1Z9LA 1QZ1A 5GS2H 4HUVA 1CQYA 4S11A 1YDPB 4F3FA 3VXTB 1KIRA 1K4DA 2EECA 1QSZA 2FSEB 3U7AA 2H26A 4MA7H 5D2LF 2DQIL 5DTFB 4YWGL 1BFTA 1MLBB 4XVSL 2GAZA 1MCWM 4Z7QE 3ARGC 3SE9H 1M7XA 3QIUA 1U3ZA 5D5MA 5J13C 3PABB 4NP4L 5C08E 1B9ZA 1I4FA 1LGVA 3UJIL 5HY9B 3U9PH 3M45A 4M7JL 4Y19A 2H6PB 4LIQL 4MX7A 3MCLH 4X6DB 2D03L 1JHTA 4WFGD 5KVFH 5IR1B 4KJQD 4Y2DC 2DQJL 4DN4H 2LE9A 3I6LD 3TH4T 5K59E 2QLVB 4MXVE 4WV1A 1NCUA 2YWYA 3D48R 5GS1B 2YRLA 4NCC2 5J1AA 4OIAA 1OM3H 4PRHD 4XCNB 5IF0B 1Q9WB 1BQUA 1AKJA 5DEZA 4TN9A 4F7EB 3RHWK 4FXKA 2CQVA 3LZFL 2E6QA 4R6UA 3VA6A 5J11B 2X4QA 3T3ME 1FZKB 3D69B 3QHZH 1AGDB 2FZ3B 1WVZA 1DEEB 1BQHA 3N50A 1N59B 5FECA 5DC0A 1SJHB 3BUYA 3LRGA 4PJAE 3NVQA 2YKLH 3CSGA 3QDJB 1ZTXH 1JIBA 2A6KA 2E9JA 3QIUD 3O9WA 2IALB 1BFOA 3CPLA 4ZUVB 3MV8E 4QCIA 5L8JB 4XP9H 3CJJA 2P24A 2UVEA 4P2RA 2JJSA 2O5XH 1YNLH 2YKLL 4M43L 1HILB 3WSQL 3PNWB 5CZVH 3GB7B 5B38B 1ND0A 1U8JB 1FNGA 1KB9J 3BH8A 2SEBA 3K2MC 1X5KA 4L4TD 3DJ9A 4NDMB 3QEQA 1NMCC 3O9WC 3IU4H 1F02I 2X4TA 4JO3L 4KUZL 43CAA 4IDJL 3VGFA 4UINH 3QCUL 3MUGA 1QTYT 1E6OH 1TJGL 4YHYC 3QQ3A 4LSPL 5INCB 5ICXA 4XTRC 2A1WL 2OJZH 5CP7B 3RVXD 1EFXB 4PJDB 5I1EL 2FLRT 1A7QH 3QIUC 3LH2H 2WINA 3ZHKA 3UJJH 2DQJH 2GITA 3V5HA 1U3HC 3U4EA 5EO9A 3LHPH 5ISZB 1N0LA 4AH2B 2Y6SD 3JWOL 2MSPA 4OF0A 3HUJF 4XAWL 4F9LA 4OJFL 3FN9A 4UNVA 3RNQB 1T3FA 1WC7A 3MV8D 5K9JL 1LMKA 4JQXA 5EFIB 3T2NL 5IQ9A 5FV1L 3N0PB 3TBTB 4F57H 4F9PA 5KJRL 1NEZB 1LO2L 2Z93B 1CICB 4RAUA 5T5NG 4QRQB 1U36A 3GMQB 3MRIA 4P4KD 4WDIB 1MY5A 5L0QC 3VXSA 5ALCL 3MQIA 4JJ5A 3NABL 5E99L 1UACL 3T0AA 1ZTXL 4R4FL 1LP9F 4U7SA 2JF1A 3P0YL 2WK2A 1Q9LA 4QYOB 4L8DA 1HN1A 5I73C 4X9HA 3SN6N 4PJCE 4E41B 4BZ1H 2ZJSH 4DKEH 4OZGB 4YJZL 5IB5A 2BSTB 3EO1B 4GBXA 2V17H 1TJIL 4WUUE 1AO7E 4PJ5A 3RA7H 2B0SL 5D7KD 1EVTC 5IMKB 3O4LB 1Y0LB 2AI0H 4UNUA 4GT7A 2J4WL 4FABL 2FECI 5AG8A 5I1IH 5IB2B 2Y7QA 3UJIH 4JDZB 2EDLA 3GI9H 5C9JB 4J2XA 1P1ZB 3MRJB 2DQGH 3IDNB 3WHXA 1INQA 4Z5RA 4G8GB 4Z95L 5IVXF 3MNWB 2BNRE 3VXRE 1DFBH 4C57C 1SM3L 2D9QB 4HPYL 3P40A 2EO1A 3SDAC 2CGRL 2FHBA 4EDXB 3JSSA 1RMFL 5BRZD 3O4LA 1UZ8A 4L8SB 2HVKA 4K71B 4TTGA 1NCAL 2AEPL 1UB6A 2W9DH 2Y06L 4Y5YB 2WLZA 1BGXH 5FM5M 1KJ2A 5F7DB 3F7QA 2KUTA 1FLRH 3BP5A 4WO4A 4L4VA 2AERT 4NGHH 4ZOCA 5DI8B 4KZDH 2NY0B 5CIPH 3ULUD 3VI3F 4UIKH 4FRWA 4IOFC 3SE8H 5BMFL 3UMTA 4OQTH 4O2CA 2DLFL 2XY2A 3W82A 1PYWA 3RY6A 4XPTL 5HHOD 3ZT7A 1Q9LB 1L7IH 4MQXD 4HIIB 3RWFB 5INDB 3TPUA 4UZGA 5EU5B 3MREA 4LSUH 1H5BA 3LS4L 2BX5A 5I8EA 4JREC 2Q6WA 4Z78B 3ZSSA 4HF5L 3EYOB 1DVFD 1CLYL 1F6AA 1NGPH 1DLFL 2RCSH 3T0EA 1AKJD 3QCTH 4FQJH 3TN0B 3L5XL 4ZAKA 2NTSP 4H0IA 2DTMH 3C8HA 3ARDC 2P47B 3W0WB 4AMKH 2DTSA 2XACC 3D9AH 4XCCH 5IK3A 1FFRA 3QA3A 4CNIB 1IM3A 2Y36L 2NTFA 4PJEB 3CK0H 3BPCB 5D6CA 5BOPA 1HHJB 1ADQH 4I9WE 4Z0XB 4ZYKA 2QSCH 4I1NB 1ZANH 3FQRA 3PIQA 1RIUL 1UCBL 5T1MA 4JANA 4PRBA 1TZGH 2P8LB 1JWSB 4PJBA 3DMMD 4XXDA 5EBLB 4XCYA 3E8UL 4OM1L 5MI0B 1NCAH 3OSKA 4X6BA 3OXSA 4EXPX 2R4RH 3STBA 4TNVF 2Q8BH 3TM6A 1PG7L 1PY9A 1WZKA 3KLHC 1PD6A 2DJSA 3N9GH 3SDXF 4XAKE 4HF5H 4HEPG 3THMH 2VB5A 4R97C 4YPGA 4D0DA 3OAYK 5F9AC 3IDJB 4MD0A 5EOCJ 2ADJB 3O6KL 3WYRA 5C8JB 4GKZA 5F9DC 3J8F7 1D5ZB 4AIOA 1IMHC 3GM8A 3NCYP 4NKIH 4QF1B 3QEGH 3D25A 3T0XA 3DXAB 5FIEA 2J2ZA 4HK3J 2ITCA 3U82B 1ZOXA 4L8BA 5IB1B 3L5WA 3SKMB 2PW2B 4BSJA 1EERB 5CSGA 1FN4A 2FATH 4JFYA 5DZNA 2GJZB 5TGBA 3WIHH 1WCQA 4Z7UF 3PV6A 2CPCA 2DQCL 2MKWA 4Y89A 5AD0A 1YMMB 4D9RD 4MA1B 5K33A 2BVOA 2YD6A 3BYYA 5E1AB 2A1WH 3PG2A 2FBJH 1MLCB 3MNZA 3EDDA 4X9GA 5SV3A 4Z8FH 4RCAA 5ALBL 5LCVH 4LLMA 3VXQA 1IM9D 2ZUQB 3DVGA 4ODXB 2G9HB 3BE1H 1IM9B 4NM8H 3ULVE 3C87A 1ZVHA 3OB8A 5EU6A 2HT3C 4LKXA 3UBXA 1UWGL 4JN2B 1BVZA 4OLZH 4YHOH 3OKNB 5DSCB 4NT6B 2MNUA 4JM2D 5IVXA 1DEDA 4HWZB 1JYVA 1ZGLM 1S7RB 5GSRB 2ERJB 1U8KB 2BJMH 3LEYH 4RRPA 3AS1A 4PJIF 3SO3C 1UG9A 1FJ1A 4Z76B 5K9OA 1UENA 4QRPD 3O6MH 1ZLSL 2AK1L 1EZVX 3E3QE 3ZDZE 2IPKA 4JHZA 2ZUYA 4XP5H 3IGAB 2IMNA 3IAPA 5IVOA 3PWLA 4R90H 2IWGA 1KCKA 1XH3B 1DLHA 1CU4H 4GAGL 3IDMB 1QFUL 5ISZE 3WIFA 1MCFA 1RZFL 4RGMB 4P3CH 1HYRC 2V9QA 3MJ9A 3V7AE 3CH8A 5EOTB 4Y7MA 1G1YA 4LLDA 3ZSTA 3TESA 5C0BE 4KTYA 3QUXB 4PD4J 3MA7B 4PJ9C 1JGUL 5E95B 4LP4A 1S7QA 4IDJH 5BZWA 2VC2L 2KQNA 5SX5H 1TETH 2DB8A 3MUHL 4KJQC 5I6XB 2OMNA 4YXKL 5A16A 2YPKA 3LRSA 3L7EB 1XCTA 2WV3A 4XMKH 4BUHA 4KVNL 3ZDXF 5LVEA 5DWUH 3RPKA 4KJWD 2VDML 4TTDC 3VWKC 5IBLD 5LGKA 3N1FC 1Q8MA 1DCLA 3HE7A 4JO4H 3MV9A 4N5UA 4CJ1A 4TUOB 2CDFB 4FQ2H 4BH7A 2YPLA 3R8BB 4XXCC 4P9MH 1Z9MA 4EQ2A 1OB1A 5DA0B 1DQMH 1LDSA 4F7PA 1RD6A 5DFVC 3FQNA 4NQSB 3W11C 3T65A 3MBEB 4HZAA 3NIFE 3DHMA 3L3JA 4OCNC 3EJZD 2VAAB 5E9DB 1XCTB 4QHNA 1C7SA 3V4PL 5JQHC 5J6HB 2VXTH 3EO0A 3IU4L 4MJIE 5JHDD 3CSYB 4G6FB 5D2LB 3RBSA 3QFDA 1J8HE 5CEXA 2DM4A 2FGZA 3ARFC 1Y6KR 2DDQL 1DN0A 4NYLA 2OR8A 3CVHA 4YC2B 1JZ2A 1MHCA 4XMPL 3W9DA 1HK6A 5D9SB 5C0CE 2OK0L 4JPIA 3KNBB 1Q1JH 3V4VL 5IMMA 5SX4H 2R69L 1E27A 1L0QA 3L3IA 4APQA 3HE6B 1AIFA 3BPNC 4LPTA 4Q9BA 1ZLVK 4YWGH 4X80H 3TWCL 3X17A 4CW1A 3BZ4A 4R2GD 5J57B 2QSCL 3SPVA 1NAMA 3FFCA 4GRLD 4RMRA 4HKJB 4F15B 3AGVA 4GLRI 5C6TH 4HX1B 4NM8L 5C0GB 2D7TL 5CEZL 1T2QH 3O2WL 2OTPA 3EYVB 1KB9K 1AGFB 3MGTB 5D7SL 4OIIL 5E6YA 1M05B 3IFLH 5KSBA 1JNHB 5C3TA 1CFNA 5E8NA 2FX7H 4HGWA 2AGJH 1JGEB 4IJ3B 4BFEA 5I2IB 4RNRB 1S78C 2UWEB 1CICC 3HNSH 1G6RH 1VADB 4G6MH 4OV5B 4NQVB 2D03H 4PG2A 3NCBB 3FT4A 3B43A 5HHME 1DQTA 3IDXH 4HJ0D 5CJXA 1RZKC 1FV1A 4NKIL 1ACZA 5KN5B 5JHDB 1J1OH 5E2WL 5L2KD 3MRGB 4M6ML 3MXVL 4XPBL 4S1DC 2VH5H 3DXAA 1HHIA 1MCPL 3PWNA 1JFQH 3GUTB 3JTTA 1MCWW 1FYTB 4MNHA 3T1FA 4HWBH 3U0PB 4LLYB 4C54A 1FLRL 1LO3H 1NFDE 3P4NB 1CE6B 3HMXL 3PL6B 1E6JH 4RZCA 4Z7UB 2YSSB 4LSSH 2P45B 4QXGH 1KCRL 4OUUB 3GMNB 3CC5B 4OLXL 2WW8A 2NY4C 1BX2B 1QLRA 1RMFH 1I1FB 4QHUB 1A6UH 1A4JB 4XWGH 1BVKB 2I9LA 3STLB 3EDFA 5E5UB 3P0GB 1SM3H 5IROA 2CDGB 4HQQH 4JVWA 3IKCB 1NCDL 4WUUA 1T1WA 2Q76B 5HGGS 3KWWA 3HE7C 1T7YA 2GHWB 3MXWH 5IW6A 4WHTB 4EUPH 3TN0C 3N1GC 1GGYA 2VR9A 5CEYB 5C6PB 5E6ZA 2XPGB 4KAQH 1Y18A 3OKOB 1H8NA 5T5NF 4JZJB 4LSVH 2M26A 5E2UH 1RULL 3WLBB 2D7OA 1TTFA 1A1OA 1A0QL 1J11A 1NC2A 3C09C 5MENE 1YEFL 3WNNA 5B3JE 2VMFA 3D0LA 5D70H 3EYOA 4WI9A 4LEOB 3RWIB 1GRWA 4PRIA 5L2KB 3IDGA 1TVBB 1K6QL 2Z92B 4K7FB 4OGAD 4JFXA 4U6XB 4PJ7A 4J3VA 1U8IB 3B8YA 1IAMA 5JLZA 4HXBL 3S36X 1UJ3A 2C1OA 5EU4A 4XPFH 4NHCL 5IHUH 3IS1X 1B88A 3LD8C 3ARYA 3RVWC 1A5FL 4HULB 3H7LA 4LGSB 4B5EA 4G43A 4ISVA 2X6MA 3QDMA 4NHUA 1FL5B 5IB4B 5B39A 4HDIB 2FEDC 1LDPH 4XVJH 5F88A 1IAII 3PXHA 2I60H 4OZFH 4YHKH 4ENED 1UJ3C 1UT9A 3I6GB 5HYJD 2BDNH 1T1ZA 1VFBB 4Z95H 1IC7L 4LVNB 2A77H 4HUUB 4OIBA 1KXVC 3X3GL 4LPVA 2IAMB 5KZCD 2DQUL 5GZNC 5I75B 4QNPE 4ELKB 1FE8H 4XNYL 4MAUL 4OZIB 1NQBA 4DW2H 4AJ0A 4HMEA 2D7PA 4FNLH 1YEFH 4WFGE 4JRYD 3MYZA 5DHXB 2VLLA 2DJUA 3LHPL 3H2WA 1FGNH 3T4AB 2R1YB 4F7MB 4KAQL 4MNQA 4P46D 5F7MC 4JGUA 2V6HA 5FKAB 4YHIA 3PHOA 1BZQK 4P9HC 1L9NA 4WI2A 5FHBH 5GSVB 3FQTA 2R8SH 5FM4A 2R1WB 3AC0A 1T1XA 2BVPB 3M17B 4AT6B 1YEEL 3QUYB 3VXPA 4KTEH 3WJLC 2VLJE 3HNTH 1AXTL 2VL5B 4LCIH 5B8CC 3ECBA 2ADGB 1ZT7A 1CFVH 4JHAL 4LFHD 1A1NB 5E0QA 5IHZB 1ZGLA 1RAMA 1JF5A 5IQ7H 1R0AL 3MRPA 4J3OC 2JELH 5DO2C 4YR6B 1KENH 1OD9A 1JF1A 5HPMA 2ZCHL 1H3VA 2YPVH 3PWPA 4JFED 1L7TL 3BWUC 4MDIB 2AABL 1MQKH 3UAJD 2NYYD 3DBXB 5LGHL 1X5AA 5DS8B 4HDIA 1LO2H 3HC0B 2D0FA 1XCQB 1NGYB 3DMMB 2GSIB 1EEQA 4X99A 5IWLA 3MLZH 4NWTL 3FMGL 3MA9H 4UIMA 2R2BA 5I66B 3MBXH 3TGXA 4Y5VA 3GIVB 1NCBH 3KYMB 3ULVF 3QUXC 3GMRA 4G6ML 2CUHA 3F6LA 1QRNA 1T03H 4MSWA 1T5WA 4Z77B 1IGFL 1MJJA 1BOGA 4G3YL 3I2CH 3SDYL 1VSCA 2EXWC 4PD4K 5CKAA 1QBLH 1E6OL 1TJGH 3BW9B 4KQ4L 4BQ8A 3KG5A 4LVNC 1FNSL 2AXFB 3S88L 3AREA 3MA7A 5GGTL 2F74A 3O8XC 4AEHH 2IANB 3K0WA 1R5VA 2VQTA 1MRDH 2DYPB 2VIRB 1FBIL 1CLOH 2HTLC 1Q9KA 3MOQA 4AY0A 3MODL 4KU1A 4MQXC 5FCUL 4GW5A 1FZMB 2XKNB 4Y5XA 3HI1A 3IF1B 2GCYA 4P46B 1H15A 1AD9A 5C07A 4ONFL 1A4JA 1RUPL 1S5HB 1DP0A 4JQIL 1T5XA 1OW0A 1KB5B 3DGGB 3UBXG 4MD4A 3PJSB 4Z7WE 1X4XA 2CUIA 2DIAA 3K4ZA 1IGYB 5D7JB 3RRQA 2VNCA 2W9EL 4NQDD 4WTZA 1UVQB 4QTIL 4UQ2B 4F7CB 4GKOA 1YNTB 4U3XA 7FABH 3O3BA 4R3SB 4NQDA 5E4EB 5I1KH 5FECB 4KHXH 5IJKC 3LKNA 2ZPKH 1YNKL 1HHIB 2CRMA 5DQDL 3ZE2F 4DAGH 2ICWA 1MIEH 2CSPA 4I3RH 2OBGA 4KJYA 4M02A 1AO7D 2XNAB 1YN6A 1MCDA 4JN2A 5IHLB 1GGIL 2Z91A 4K8RD 1Z9OA 4HS8H 2QQLL 4OGXL 5CINH 5FGBC 3BPNB 1HHKA 5D7LD 5CBEA 3GK8H 3CMOH 2AW2A 1FH5H 1NBZA 1CFSA 2PCPB 2EH8L 5KS9B 3B6SB 1Z3GL 25C8L 2DBLH 4YEEA 5MI0C 1YNTA 3KPSD 1OF2A 3OKMA 4FXKB 3P0VL 1UWEL 2BC4B 2P46B 1JGLL 4OFIA 5DFVD 1CGTA 2WANA 5H37G 5TDOB 4U1SB 5I15L 5C7XL 4K9EC 3W11D 5BRZE 1XGQA 2HLAB 4JKPL 3BQUA 3K81A 3WNMA 4IMLA 1KJ3H 2Q8AH 4FQPA 4E42B 4XVTH 1FGVH 3KHQA 1WTLA 4PS4H 3QPQD 4OSUL 2ZPKL 2PXYD 2R1XA 2V5MA 4KRPB 1XF3A 1MCRA 3AS2A 4KDTA 4KQ3L 4GQ9L 2HJFB 1TENA 2D0GA 4PJ8D 1KB5A