4PG9B

Mhc class i in complex with sendai virus nucleoprotein peptide fapgnypal
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title The first step of peptide selection in antigen presentation by MHC class I molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 13
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pg9B00
3MV01 3D39D 5DMKB 4N0UA 4JFHE 1ZHLA 4HWNA 1XGTB 3NIFF 2YD9A 2M26A 4WU7B 3U36B 5IW6B 3GSUB 1H3TA 4RBPK 4QTHA 3VRLF 5DJCA 5T3ZD 1R5WB 4JY6B 2FO1A 3VE0A 1MFEL 2VQUA 2BVPB 3ZMRA 2EE2A 2FJGA 3IDNB 3LH2L 3F5WB 2AS5M 2C4FT 3OKMA 4PJXA 1MCRA 1S7QA 3D2UB 3RWIB 1INQA 2XQBH 3EIFA 2H45A 3OPZL 1JBJA 4JPWH 4RMVA 5DC0A 4MQ7B 3H42L 1HH6B 1JWSA 3EJYD 2J4WH 1TVBA 5DD3L 5SWSE 4L4VA 5DJZA 1RVFL 1SY6L 4F7TB 3S37X 3B3IB 4LVHB 4NN7B 2IBBA 3UJTL 3VXPA 2H3NA 4GJTB 1FG2A 2FX8L 2DLEA 2W91A 3V9FA 5C6TL 2ZUSA 1TJHL 4KQ4L 1D5IL 2YRLA 3B9KB 4JO2H 3VXOA 4OI7A 4DKFH 1O7VA 4XC3H 4PREB 1DEEB 2MKLC 1QQDB 2VAJA 1VEMA 5SX4I 5C0EB 2FR4B 1OAZH 5B39G 3MRRB 3MBXH 1I8IB 3LAFA 3O4OB 4J1UA 4XNMB 3IDYB 1BFTA 2YUWA 3MO1A 4Q2ZB 3ARTA 3OX8B 1DLHB 5EU6D 5ITFB 2R29L 3VWKA 1NANH 4NKDB 4BFGA 2VR4A 1OSZB 1KELH 4ORZC 4YE4L 3WSQH 3NMEA 2AP2A 4IRZL 3DVGB 4G8GD 4LPXA 2QV2A 4PRBB 4KKLC 5ITBH 2W9DH 2WSKA 3GBML 4XVSL 3V79C 1B88A 2BCKB 1I1AB 1TJGL 5D1XC 5C7XL 4MSWA 3IRZA 4NFDA 1MJ8L 2OJEB 1ZA6B 3O6LH 1RJZA 1UM4H 3CPLB 3UCRA 5BRZD 2IBGA 5DQJA 1YY9D 5HHVH 4K7FA 3GDBA 4HH9A 1DEDA 3KYKH 2BY2A 1CFBA 2Q3AA 4P5TA 3QIWC 3V8CA 4UUJB 2R1XB 4PV9A 4L3CB 2XN9E 1TPXC 1MCQA 4YHML 2UYLB 3BWAA 2EDNA 4M61B 4PRHA 3GSNA 2FHCA 1ZT4A 1KJ3H 3I6KB 4MD0A 1KBGH 1EPFA 3WFZA 3MGOA 1FJ1B 4OZIB 4OQTA 4QKXB 1QFHA 4JAMA 5D6DA 3N1FC 5DD1L 1WBZB 1P7HL 1FLRH 5B8CB 4OZGF 1JGVH 3O6ML 1KCLA 4NO5A 4N8PA 1G9EA 1NQBA 4WI5A 4LLVA 5SWSB 1S9YB 4M7LT 4V2CB 3F7RA 2DYPA 1U8MB 5DJAA 2EDWA 5FECB 1IGYA 4JPVL 5DA4A 1RPQA 5T5NG 5SWQA 5ESVA 3TO4B 3OKNA 5EDXA 3SCMB 4D0DA 5C08E 3ZYJA 2EDTA 3TYFB 4HX1A 5JHDB 2QJDA 5L9DH 1S9XA 4XPHH 4EN3B 2I9LB 4ZFZB 5IB1A 3QEUA 4JKPH 2FH6A 2ITCB 1T89A 2YBRA 4P4KB 2GHWB 4XPAL 2G2RB 1MCPL 4JJHA 3ZO0A 3PE9A 4DUWA 4XP1H 3SEPA 2VAAA 2H32B 2R9HD 2FD6L 8CGTA 2AEPL 4ERSL 1SYVA 1WWCA 5IW3A 5F71A 4ODWA 2IANA 3RVXD 5AZEH 2OSLA 1YZZA 3SKMB 1L7IH 2NY1C 4RFNC 3GK8H 5I19H 2V2TA 4JM2F 3DX9A 4K94L 5F7DB 1FZKB 4Q6IC 3FO2B 4JHWL 3G5ZA 4ORGA 2IPKB 2X4QB 5IB4A 2CKBB 2EIDA 1YNTB 2QADC 4N0FB 3TC9A 4KTYA 4XPTH 1AFVH 1FNEA 1A7QH 3E6FA 3E8UH 4M1GH 1J5OL 4NNXA 3TFKD 3VXNA 4GRWF 4XVTL 4Y4FD 5A2FA 5BV7H 1CI5A 3L95B 1NDMA 3TLRA 4YC2C 4PJ7E 3QG7H 1BVKA 3CVHB 2C4XA 2XN9B 3UYOD 1J8HD 5HGGS 1B0RB 3P4OA 2P47B 1IT9H 1MCWW 1DR9A 5HD8C 1MAML 3D39B 3WEXA 5GSRA 4K3HA 5KZCD 4YXHL 4MA1C 1A14H 1DFBL 1G6RL 5C0AA 2AEQH 3DOSA 3NCFB 3ULUC 3MRPA 2AI0H 3MLYL 1FN4A 2ZCLH 1D5ZA 4R4BB 1BWWA 1TDQA 1TQCB 3LDBB 3TF7C 2KPNA 5DJXA 5TQ2H 4N5UA 3WN5C 1XIWD 2HTLC 2VDNH 1NUDA 4OSUH 4TVPH 5J1SC 4P9HL 4OQTL 3ULVC 2HG5B 4ZFFA 3N1QC 3E6HA 5CP7A 1HCFX 1TJIH 3RIAF 3T0WA 4RRPA 3G5VA 5DUPH 3JWOC 5C2BL 3B4NA 1SJHA 1CK0L 3CK0L 4NZTH 4Z7WB 3FT2A 2ORBL 1W0WA 3EJJX 5DUBA 3CC5A 3K3QA 4JO3L 3PXHA 2X4TA 3LKNA 1Q38A 5I1GH 3TWCL 4RFEB 3GSWA 3I9GH 1FPTL 1DQQA 4YEFA 1DE4B 5JPMB 3CMOL 1AGCA 1MOEA 4RGOH 1MI5E 1YEIH 1X6NA 4YNYA 3HA0A 3HE7A 2MQCA 3Q5YA 3HE6D 4U1KB 4TRPH 1RK0B 3KXFD 3L7FA 1FFPA 4MXVE 5GRVL 1NFIA 1E4KC 4X6FA 1MPAH 5D4QA 3D0VA 3MRJB 3VXUD 5F7EH 3JV4B 5ILTL 5I30L 3GMPB 5EU6B 3N0PB 3IJYA 5GRYA 1M7DA 3EO0B 3OB0K 1CXHA 2HA1A 1KTKE 2KKQA 2KQMA 4G8GB 1W72H 1HOCB 2FGWL 5KVDL 3MLVL 5LXGL 3VFOA 4HS6B 2JTDA 1T7VA 2VLRD 1ACYL 3L3GA 4WHTA 1RUMH 2ZZUT 4HUUA 3QQ4A 1MHCA 4RWYH 5JXEA 4FFVC 3VGDA 1IGCH 1NCUA 1IGTB 1RUAL 3P0VH 5I66A 1XF2A 3REVB 3UZQA 2EYTB 1C16B 2Z31D 5BRZB 1EFXA 3BD4A 4PJ5A 2DM7A 4JHBA 5IT2L 5EU4A 1IAOA 5DO2C 4B7LA 3QUZD 4LEXL 3KPRA 1BZ9A 5DTFB 1IC7L 1NFKA 1WBYB 4LSPH 4PV8A 1IM9A 5DD6B 4HDIA 1IKFH 3QXAB 5IBUG 1KGCD 3P9MB 4QLRA 4JFFD 1MF2L 3VDBA 1E4WL 1NEUA 2EIBA 2IGFL 2AJUH 1C7TA 2AV7A 5J6GB 4UILH 5FO9A 2ATKB 2VDKL 1MCBA 3MBEC 4IOFC 1LDSA 4ZUTB 4JDTL 2F5BH 5ALBH 4OFDA 2J8OA 2ESVD 5JUEH 4XMPL 2R2EB 4H5SA 1N4XL 3MRKA 2GUOA 4LSQL 2EYRA 3RKDD 4BKLA 1OWRM 1TLKA 2XZAL 2CDEB 3BKML 3KR3L 2J3SA 4PBXA 3HMXA 2Z92A 1RK1A 3TPUA 1I9JL 2PXYC 1F11A 4EVNB 2Y6SD 1QACA 4FP8L 4OKVB 4YDJA 1U91A 3QRGH 4GRLC 4ZS6D 1KCKA 4U0RB 1YEKH 4EBQL 3ULUH 2VQ1B 4OLVH 2E5EA 3CD4A 1A47A 5EZIL 3Q5TA 3TESA 1GVIA 3MUZ1 3TM6A 1J88A 2AQ2A 3JTTB 1MH5A 1UEYA 4EKXA 3EYOB 1VFBB 3RUGB 3WNPA 4MWFA 4AEHL 1GIGH 2BSSB 3L5XH 1CTOA 4L3EA 4WW2B 1FNSL 5K59E 5DQ9A 3L3DB 3PJSA 1DL7H 5DFTA 3VXUE 1KF9B 4L4VD 4EOWL 1CLYH 2CIIB 4ODUA 3C9NA 3NPSC 4W6WB 4YK4B 3MLXH 3STZA 3LEVH 4OIAA 5AWNH 4MD4A 5E2UH 3T2NL 1IKNC 4I18B 4QRSA 4I77L 1EHXA 1WF5A 1IGFL 5KSVB 3GGWA 4Y4FB 5CJXA 2FJFA 1AP2A 2GTZA 1VADA 43C9B 1J0ZA 1F02I 2BXYA 1MJJB 4HKZA 1BFVL 1J8HB 4UB0H 2PW1A 3LRSA 4LLQA 1DVFC 4YDLB 3K2UL 5KZCB 3OR7B 4NHUB 2OL3A 3MJ9H 3NZ8B 3V5DB 4ZXBC 3SOBH 1QSVA 4GAFB 3VWKD 1RV6X 3KPPA 4FQHB 2BMKB 1X5HA 4JQVA 4Y5XB 4QRQA 1RMFH 3GI8L 4G80A 2YPKB 5D2NC 4JFFE 4L29A 1UC6A 5HVHB 1NMCC 1ZVSA 1BZQK 2VDQL 4ZSOB 1XIWB 3WL9B 5FOBA 4LDEB 5TPWL 3SJVA 3RIAK 3QO0B 1H9VA 5TFSL 2W65A 4X0KB 2QTEA 4XNXL 1H15B 5C0GA 1MNUL 3VFRA 1G0YR 4YFDB 5IMKA 2EDBA 4OCRH 1TZIB 4NHCH 4BUGA 5HPMA 4P5TD 1R3HB 4A2MA 5ISZA 1MCDA 3OR6B 1ONQA 3MODL 4PRHD 3NZHH 2MFNA 2XY1A 3L5IA 2NYYC 3JZ7A 3PF2A 2P4AB 5AUMA 4NQTA 1T1WB 2XZCH 4JGMA 1NC4A 2WIMA 2XI9A 4NRYB 1T22A 3WFHB 3RNQB 5IGXL 2ADJA 4LPUA 7CGTA 3UYRH 5HXMA 3MJ6A 3HE6B 4Q7DA 3KXFB 4KH2A 5EO0B 4DZ8B 4PLNC 2MKWA 1H3PH 4WFFD 4KTDH 3VXUB 1LILA 1HSBA 1I3RA 3LRHA 1RJCA 4I48B 2Q76B 3LEYL 2EEAA 2DYPD 4QHLB 2EKJA 4YR6B 4K23H 3IT8D 1P7KA 4P9ML 2DQJL 3NCYS 2EH7H 5EU7E 3RI5K 3DRTA 2LAAA 2D4FA 4KRPD 4X6EA 1U58B 5JDSB 3NFSL 4P2QA 1MFCH 2DD8L 4UT7L 2VLRB 1KT2B 5C0ND 1XR9B 3RA7L 1CXIA 1KIRB 3RY5A 2APVA 2IALB 1H5BC 4HWBH 2ED8A 5IMOB 1NPUA 1FFNA 3CLEL 5T5FH 3DUUB 1CFSA 4Y1AA 1YDPB 2C5DC 2Z31B 4NJAH 2QQLL 3A6CH 2WBJA 3MNVB 5ADPL 5HSFA 5KSAA 3QUZB 2C1OB 1BBJB 2IAND 4LPTA 2M8XA 4MNHB 1G7JA 3QDMA 1ZTXH 4MVBC 3FQUA 3RZCA 4WY7H 3S3JA 2VZ3A 2ZG1A 4JFFB 4X7SL 5IFJB 1Z3GH 2AEWA 4J3TA 2AQ3A 3QDGD 5K9OB 4GMSH 2OL3L 5GRZA 1BVZA 2B1HL 3G5XA 3PXJA 3CX2A 3PV6A 3QEGL 3WFEL 3CDFA 4M43L 4GAGH 1UENA 3NN8B 3R4DA 3VGBA 5I0DA 4MLSA 4LU5L 3RWGB 4EI6B 4HFWA 1XF5A 3ARWA 4UT9L 5JPNB 2ESVB 3WNKA 1RFDH 3D18A 1PDKA 3QWOB 3S37H 2W92A 2AXHA 3WUWB 3ARFC 4HG4K 3JV5A 4NO3A 5HJ3A 1UZ8B 1V3JA 4KK8D 3G9AB 3TO2B 2ZPKH 4N0UB 1ZHLB 3P11L 1FAKT 2DLFH 3ZDXE 1XZ0A 4ODVH 1FGNH 5C0AD 3VXSB 3QEHA 5F96L 3KJ4C 4ZDHA 1B4JH 4XWGL 3MRCA 4QTHB 4MNGA 2Y07L 5DJCB 4DKAA 3VE0B 5FA3A 4ZOBA 2FJGB 3IAPA 1JUFA 4WEUD 3CVIL 3QUMH 2A77L 4YBLC 2EDOA 1HQRA 3OKMB 4PJXB 1S7QB 5LAXA 5HYQA 1INQB 1T03L 3QUXA 2COQA 2Y23A 1JWSB 2R69H 3BH9A 1TVBB 3FO1A 4L4VB 5DJZB 3Q6GL 2ICWJ 4MXQC 4F80A 1Z9OA 4FQ2L 4XB7A 2IF7A 1MREH 3I50H 3VXPB 1NMAH 1MCFA 2H3NB 4JLRA 3N1GC 1J86A 1DLFH 1FG2B 4M6AA 2Z0BA 3G6JE 1G1YA 1QLEL 2BY0A 1KV3A 2HRPL 5CEZH 3VXOB 3NCJH 4HIEA 3OKOA 5E2WH 3TJEL 3KS0J 3HE7D 2Q86A 3AREB 4MJIA 1QOKA 4CADA 4LCUA 3P3YA 2DQUL 2X5PA 5EC2A 4RGMC 4NJ9H 4J1UB 1CVRA 4CVUA 2DIBA 3MO1B 4ZUSA 1IBGH 4RFOL 4P2RE 4IDLA 5MI0B 2GKIA 4I4WA 1MCNA 1ZOXA 2IANE 3VWKB 3WFDH 2FNBA 1NAKL 4HXBH 3QXTA 2OP4H 5TDPA 2UVFA 4AL8L 4P2CG 1A7NH 2D7NA 5F21B 3BOVA 3A67L 5HGAA 2R4SL 4ZUWA 5DHYA 1MQ8A 3BPCA 1GGIL 2FWOA 3N85L 5JXED 3GJEA 3DHJA 4MSWB 1A21A 4KAQH 1N64H 2WBKA 3WO4C 2JJSC 2LFGA 3T0EA 1BM3H 1RJZB 2HT4C 4PB0L 3SE9L 5DQJB 1EFXD 1G0DA 4K7FB 4OZGA 4PJ5D 4QGTA 4HH9B 3ULVF 4P5TB 3PP3H 3KPRD 2Z4QA 4PV9B 4HSQA 3H9HA 1INDL 1JN6A 1MCJA 4PFEA 2B2XL 1YECL 3BWAB 1ZWIA 4PRHB 1IM9D 4FTVA 3GSNB 1G7HA 1H3XA 1ZT4B 3BWUC 3GKZA 3PGFL 4MD0B 3SGKC 2CK2A 3HMWH 4RIRA 1I1YA 3MGOB 2EYSA 3EO1A 4JAMB 2CUIA 5KJRL 1RIHL 3WYRA 4BZYA 4HPYH 3WJJC 2FBJL 3VMNA 4BA8A 1QRKA 1F58H 3CFEA 5EIVA 4L3AA 1GZPA 4NO5B 3T1FA 4WNQA 3FFDA 1NGYB 4MD5A 4LLVB 3U82B 4G6KH 1B2WL 4PRPE 3SY0A 4TNVF 2Y9RT 1QYGH 1WV7T 4DTGH 2DYPB 4Z7VE 5DJAB 1I3GL 4JR9L 3F7VA 3ILPA 3QUYA 1J0IA 4WWKA 1KEGL 1IGYB 1NSNL 4X7EC 3H7BA 5IK3B 5SWQB 4NO2A 5ESVB 3BDXA 3G08A 4KRPB 5EZLA 3OKNB 5CFHA 5LKNA 4D0DB 3B43A 3QDAA 3BMWA 5JMRA 1T7YA 5AZ2L 4M62L 4HX1B 1WCBA 2NY4D 1S9XB 5IB1B 3QEUB 2J2ZA 4HGWA 4HKXA 2YBRB 2WLZA 5I1EL 1CZ8H 4G8FA 3GO1L 2VAAB 4XAWH 4JFXA 1T2QL 1DSFH 3DUHA 5JO5A 2OX5A 4WI3A 1SYVB 5FOJA 5EG6C 4ODWB 2IANB 3DGCR 2OSLB 4PJFE 3T4YA 4MAYC 4ALAL 4F9LC 4L3ED 3WNMA 2V2TB 4JRXA 3DX9B 3UBXA 3C6LA 5KVFH 2YOCA 1U3HC 3QDGB 5FV2A 3ARBC 1UWGL 3G5ZB 1YUHA 4ORGB 5E00A 2F19L 2RFXA 3RAJL 2E6QA 5IB4B 1A6WL 2CXKA 4U3HA 2B5IB 4HT1H 4PJAA 1FNEB 1Z5LA 4YHYB 5EPMA 3E6FB 3GHEH 2VL4A 5DD5L 3T65B 4NNXB 1AGBA 3VXNB 5KSBE 4OZFG 1NDMB 1SEQH 3AB0B 1BVKB 2DS4A 1JHKH 3QCVL 3HC3H 3P4OB 1V7NL 3WEXB 5GSRB 4NO0A 4UQ2A 2X4UA 3ZDZF 3SDAC 2XTJD 5C0AB 3INUL 4KKBC 4FXLA 3MRPB 1FN4B 1WAAE 3EJZD 4L8SA 5C09E 3WUZA 1D5ZB 2GK0A 4Y4HA 4XCFH 1OTUD 5JHLH 5JZ7D 4LCWA 4PPTA 5DJXB 1OCWH 2YR3A 4M93C 4OCWL 1WCQA 3SJVD 3DGGA 2V9RA 5CD5D 1RIUH 1X4XA 4ZFFB 3E6HB 4LQ1A 1WUNT 5CP7B 3G5VB 2HT3C 5IBLC 3F7QA 1SJHB 1E6JH 3T4AA 3FT2B 1W0WB 2X6MA 1EEZA 5ISZD 5DUBB 3CC5B 3VDAA 1QR4A 2X4TB 3LKNB 1MWAH 3GSWB 2WNGA 1NL0L 1DQQB 1NC4D 1QKZH 1VACA 5TF0A 5L0QB 2NXZC 5IP4A 3O0RL 1J1OL 3A6BH 4V2BA 2IQ9L 4GW5A 1AGCB 3N1PC 3U30B 1WFTA 4YNYB 5IQ7H 3HE7B 2KDGA 4ELMF 1JI2A 4KK5D 5FDYA 1CLCA 1KJ2H 3L7FB 1FFPB 1NFIB 4GSDL 4RQQA 4X6FB 3MA9H 3D0VB 3WS6A 3GSVA 4RMWA 2Q8BH 1GHFH 1MCWM 4M4PA 2DQIL 3IJYB 3T3PE 5BO1L 2IAMA 1M7DB 1G9ML 4L3EE 4U6XA 3RVVC 1VFMA 1KENH 2JJTA 1DN2A 4NNPL 4UZGA 3IU4H 2OBGA 1LO3H 4P2QD 5FYJL 5HDOA 5TE4H 3VFOB 4KI5D 1OB1A 4PLOB 5HHXH 1YYLL 4U6VL 3L3GB 4QXGL 4WHTB 4HUUB 3QQ4B 2YK1H 4XC1L 1MHCB 3EAKA 1T83A 3O6KH 4LSUL 3ZE1F 4Y1AD 5I66B 3O3BA 1XF2B 4M9OA 2MWCA 1EFXB 2WBJD 3NVQA 4G6FD 4PJ5B 5I9QC 4KRNA 2VLKA 3S5LG 5EU4B 1IAOB 4OFIA 5KSAD 1XGQA 2JB5L 3HZMA 3KPRB 1BZ9B 1J10A 1LDPL 3QDMD 2BFVH 4ENED 4WI6A 5ECJE 3RZCD 1EGJH 4PV8B 1IM9B 1EHNA 2BP3A 4HDIB 5LBSH 2I9TA 1NBQA 1SM3L 1IGJA 1ZKAA 1N8ZA 4HIXH 2HLAA 1A6AA 2AV7B 1J12A 3UO1L 2IMMA 4DEPC 5FO9B 1I7ZA 3UBXI 2A6JA 5E8OB 5B3JE 1TETL 2AAVA 1U8LA 3EOBA 3PWUA 5HYJA 4PJHE 1SVZA 5FYLH 4TNVK 1JI1A 3EOYG 3QFJE 4ZOAA 4E42A 4LRNL 2XY2A 2BNQA 3U7WH 2EE9A 4J3WA 4H5SB 4DN3H 3MRHA 2GUOB 3MRKB 2EYRB 4BKLB 1EV2E 1XF3A 2XXMB 2UZIL 3EOAA 3FT4A 2Z92B 1RK1B 3CLFL 3TPUB 3LMJL 4PJIE 2MMXA 1F11B 5CZXC 4GKOA 4JDZA 1JTTA 1S7TB 4K7PX 4ODSL 4YDJB 1U91B 1X44A 4ZQKA 2ZG2A 1OAKL 2RCSL 1SMOA 2NY4B 1HCVA 5TH2A 1ZLSL 4R8WL 4X7FC 1F2QA 1KCUL 5E5UB 4U1JA 4B53A 1MRCL 4MAUL 4JFPA 5J12B 4NQDA 4IRSA 2OTPA 5IEKB 2ZCKH 1MH5B 4HIHA 3X11A 3JWDC 4XB8A 3PWLA 3QUXD 4HBQA 4MWFB 2IADA 3TA3A 4L3EB 4NQUA 4QHNA 4HKJA 5DQ9B 3PJSB 4U1GC 2NR6C 2XYCA 5IUSA 2AXFA 5IROC 3LQAC 3GSOA 3TJHD 2R1YA 3C9NB 4ODUB 2QBWA 4XP6H 5AD0A 1JGEA 1U3YA 3STZB 2W0FA 1HYSD 4MD4B 3IJHA 4U05A 2XQBL 35C8H 4QRSB 1JL8A 4KXZH 4JPWL 2NW2A 3N9GH 5DFVD 1P7QA 2VWEC 1DUYA 3GGWB 2VUYA 2FJFB 1AP2B 2GTZB 1NBYA 1Y6NR 4Y19A 1VADB 4MJID 4WFHD 1IRAY 4HKZB 2PW1B 3K1DA 3LRSB 3CJJA 3TEUA 2OL3B 3NGBB 1MFNA 5DQDH 1KTRL 1MRDH 1U8KB 3ZKSD 2XTJB 1A64A 1A7RH 1NEZG 1GXEA 3UROR 4JO2L 3KPPB 4DKFL 2AJVH 2A9MH 4XC3L 1ZXQA 3S35X 4LMQI 4QRQB 4WW1A 3EO9H 3FN9A 4NC0B 4G80B 1OAZL 3MCG1 4L29B 2OYPA 4M7JH 5HI4D 3MBXL 5IVXF 5LVEA 1ZVSB 5DMJB 5FOBB 4NN5B 3SJVB 2GQHA 2W65B 5D7JC 3CZFA 5EB9A 1GYAA 2WW8A 3VFRB 2HJLA 4MS8C 5IMKB 3T0ED 4QTIH 1KELL 3WSQL 3MXWH 2NY3C 1IEAA 2OR8A 3DIFA 5ICYA 5HPMB 5EFIA 5ISZB 5ITBL 1ONQB 2W9DL 1OY3B 3IKKA 4FTVD 5FGCB 5AUMB 4N0RA 1KLFA 1NC4B 1T22B 3O6LL 3MOAH 1R3KA 1UM4L 4KK9C 2ADJB 3WHE0 5HHVL 4P0DA 5IEHA 3BMVA 3KYKL 1D3CA 3MJ8A 1WTGT 3SE3A 3FRUA 5HHOB 3DSFH 2EXWC 5HYFA 4L5FL 1A7PH 1KJ3L 4MMZC 1TTFA 4NOFA 1NANI 3NCBB 1KBGL 1HSBB 5IWLC 4F37F 2ZG3A 3JSSA 5MEQA 4XPGH 1YYMH 2NY5C 5EBGA 2GY7B 3QUYD 5DJDA 4WWKD 2WV3A 4M03A 4GFTB 1FLRL 5CCKH 5D1XA 3DRTB 4IIQC 4X6EB 1CD8A 1JGVL 4P2QB 4YHZH 4ZPTA 1C7SA 1X5IA 2WINA 1UM6H 1ES0A 3C5SA 4HUKB 3BUTA 4IRJA 4OBRA 3QIWA 1YN6A 1CFNA 1FFNB 3NOIA 1CFSB 4WUUA 4QYOA 4Y1AB 2B8OT 2DBLH 3MLZH 1FAIH 2WBJB 4I0KA 2H41A 4X7TA 1DQDH 4WHYG 5KSAB 4BQ6A 1AQDA 3JWDH 1G7JB 1G0XA 3QDMB 5L9DL 4XPHL 3FQUB 3RZCB 4TSBH 5L88L 2DAVA 5IHLB 4JRXD 5DFWH 3C6LD 4JKPL 3PDDA 5FYJD 4YJZL 12E8H 3BRGC 1OF2A 2KUTA 3G5XB 3PV6B 4XP1L 4YAQA 3MLRH 4BZ2H 3HNVH 1M4KA 1QSZA 3V5HA 2EZ0C 3P30H 4M6OH 1II4E 5AZEL 5DHVH 1U8OA 3ALWA 4HFWB 1L7IL 1XF5B 5J1AA 3GK8L 5I19L 3HUJE 4PJBA 3CSPA 4NQCE 1W72A 3D18B 3D5OF 1IVLA 3JV6A 1HNGA 3T2OA 1H3GA 4QF1A 5E7FA 4NO3B 1AR2A 5HJ3B 2ZOLA 1UACH 3T0EE 2DF3A 4Z7NF 4NO0D 5FYJU 4O58H 4XPTL 1AFVL 2R39A 5J13C 5KW9H 1XZ0B 1A7QL 4LF3A 4X4XA 3E8UL 4M1GL 4ZDHB 1UKSA 1QHOA 4OLZH 2JLLA 3MRCB 3TBWA 5BV7L 4MNGB 5FIEA 1F45A 2NY7H 3LIZH 4FTVE 5FA3B 3QG7L 5CSBA 3GFUA 5DXWA 4LCWD 3V0WH 1TQCC 1JUFB 1IT9L 3QHTC 4KHTH 3STBA 5FF6A 5LAXB 2YKLH 4Q6IA 3DVNA 1A14L 3FN0H 3CU1A 1RZ8A 3QUXB 2AI0L 3PP3K 4KKCC 3GMNA 2ZCLL 1YEGH 3U7YH 4A6YH 3BH9B 2LU4A 3FO1B 5L7XH 3X3GH 4Y16C 3QBTB 4JN1H 5TQ2L 4C56A 2VDNL 3Q5OA 2QSQA 5C9JA 4OSUL 4TVPL 1VKXA 2EECA 2E9JA 3UTTA 4JLRB 2JELH 1TJIL 5DUPL 3V6FA 3DO3A 1RJLA 1GCFA 1GSMA 2JJWA 4HIEB 3OKOB 4XPBH 4QGYA 5L2KA 3OHXA 3OXRA 5CIPH 4NZTL 3LRGA 2Q86B 5GPRA 5B22A 4MJIB 5DRWA 2HP4A 4XBPA 3Q1SH 4LCUB 2YA0A 4R4NC 1OTSC 1BHGA 4POZC 5EC2B 3WKMH 4M5YH 2BVOA 3KDMA 5I1GL 1W0VA 1OGTA 2MPAH 3I9GL 4J3VA 5ACZA 2L0DA 4FXKA 2VLLA 3CH1A 4I4WB 3WN5A 4PTTA 5EULV 2IAMD 1CFVH 4RGOL 1YEIL 2YD2A 2NY5H 3OF6A 5TDPB 4PJCF 4TRPL 5JQHC 1NGPH 2VUOA 5HGAB 4ZUWB 5DHYB 2C3VA 1MPAL 4RCAA 3BPCB 2FWOB 5F7EL 1S78D 3GJEB 2DTMH 4CN1A 3PWNA 4PJAE 4UV4H 1GRWA 2DOCA 4X6DE 3T0EB 4ACPA 3LQZA 1YMMA 4OZGB 2RQ8A 1PZ5A 2Z35A 3FO0H 2CMRH 1MCCA 2VLKD 2ZCHH 2VXSH 1W72L 2Z4QB 2YZ1A 3H9HB 4CL7A 1JN6B 4UAOB 1RUML 1ZWIB 3MUHL 4M1CD 1VPOH 4FTVB 4RWYL 4UNVA 1G7HB 1IGCL 4HZLA 1BEYH 4OUOA 5T3XH 3ORJA 4RIRB 5ID1A 1I1YB 3BFOA 3P0VL 2EYSB 4JRYE 4I5BA 3MJ9A 1DBAH 4ONHA 3BPLC 3C2SA 4BSVA 5JW4Q 4ZOEA 3GEWB 5HYJD 1Y18A 3HG1A 2ED9A 3NA4A 1GZPB 3T1FB 4F37K 4LSPL 4WNQB 1IKFL 1XCQB 1KB5H 3FFDB 4R2GC 4MD5B 5IBUB 2YRZA 2BNQD 3SY0B 2UWEE 1ZGLP 2AJUL 2OR9H 1ZMYA 1AD9A 5JR1H 1MCLA 3F7VB 3ILPB 3QUYB 1CL7H 4WWKB 2QSTA 5SV3A 4OZHE 3H7BB 4L8DA 4NO2B 5EZLB 2B20A 3G08B 1GPOH 3BYYA 2LQRA 2F5BL 3BJLA 5DVKA 3E2HB 5ALBL 4LK4A 5C0RH 1UJ3C 5CLWA 1WCBB 5IMLA 5JUEL 2UVEA 2VLJA 3KHQA 4HGWB 4HKXB 4OF6A 4WI7A 4DGIH 4NQDD 1CGVA 2B1AH 4G8FB 2DM2A 1P9MC 4LLWA 2ADGA 2H6PA 4FQPA 4IRSD 3SDXE 4W6XB 4JFXB 15C8H 1CGWA 2R9HC 5JO5B 5DRNA 2B39A 5MHSD 1KCVH 3QRGL 3QXWA 3CMGA 3TA3D 1YEKL 4GRWB 3T4YB 3MBEA 1A9EA 3ULUL 4OLVL 1JGDA 4JRXB 3UBXB 3C6LB 4GLRH 4LMQE 5E99H 3U79A 1PX3A 4Z77A 4RAVB 5BZDA 1YUHB 5E00B 4HMDA 1CXFA 2RFXB 2DQGH 1XGUA 3VH8G 1EUTA 4FA8A 4PJAB 1Z5LB 5EPMB 1GIGL 1QVOA 4LSTL 3L5XL 1P7QD 3G5YA 4LLMA 1MVFA 3QDJA 3I75A 1AGBB 2FHBA 2PXYA 3TFKC 1DL7L 3KAAA 3QIBC 2EDFA 4Y4FC 1CLYL 4Y19D 3HNTH 4ZFOA 4HEME 2IJ0C 3IDIA 4GRLA 2AV1A 3MLXL 5LJYH 3LEVL 5AWNL 5E2UL 5IG7A 4HWBA 5CHNA 4NO0B 3QNZA 4EDXA 2X4UB 2EDHA 5FO7A 4L9DA 3U7AA 1VFUA 4L8SB 2XWBA 2GK0B 4XGZA 4DKDC 5IFAH 2FATL 4LCWB 3T0VA 2HWZH 2IWGA 4UB0L 1C1EH 4PRIA 1XIWC 3DGGB 3V95A 2GK2A 5EBLA 2OJZH 3BAEH 3MJ9L 4JQXC 5EUKA 3SOBL 4BH7A 5HYJE 4GUPA 4CU6A 1NEZA 1H3WM 1BZ7A 3HZVA 2QLVB 1RMFL 2VC2H 1IKNA 5E03A 4ELMA 5BCAA 3T4AB 1EEZB 4XMLH 3P0YH 4DOHE 3TH2T 1O5DT 4I3SL 4O2CA 1FL6B 2CUMA 1VACB 4Y2OA 4WVRA 5TDNA 4GW5B 4G7VH 4OCRL 1OOAA 2NQCA 4LLDA 4NHCL 4O2EA 2HN7A 2BZDA 3VG9B 4ISVA 4ZXBA 3F65A 4R97C 3NZHL 4RQQB 3HS0A 3ZKMC 5D2NA 3GSVB 3FQRA 2XZCL 3QUMA 4TVPD 4M8QA 3NIDF 2IAMB 3C8DA 3UYRL 4U6XB 3KG5A 1FLTX 2K1MA 5D1XD 5I8KH 1JPGA 1R0AH 2BSTA 3KS0H 4XPFH 2FRGP 1X7QA 1OB1B 3OQ3B 1H3PL 4JANA 5AG9A 5C92A 4KTDL 2HYMA 4IRJD 4S0TD 2FL5A 1RZFH 3QIWD 4I9WE 3DV4A 1UM5H 1WIUA 5IFHH 1KPUA 3ZL4H 4WUUD 4K23L 2RR3A 3O3BB 1RSFA 3BJ91 5ANME 3VRJA 4K7PH 1U6AH 1IM3A 2X42A 3IFNL 2EH7L 1IAIM 2VLKB 4IDJL 1XGQB 1MFCL 3HZMB 2EC9U 3QUZC 3IU3A 5BS0A 4ZFOL 3HI5H 4U0QB 4FQJH 4WGVB 3UAJC 2MQ0A 4NPYA 1SYSA 2I9TB 4HWBL 3RPIA 5T5FL 5JW4R 1N8ZB 3WLBA 3CFKA 2HLAB 1A6AB 4NQEE 5ESAA 4X83A 3P77A 4NJAL 1I7ZB 3A6CL 2A6JB 5BQ7A 4UDUA 3EOBB 1QSFE 3PWUB 5HYJB 3NABH 3C60A 3HAEH 4L4TA 3JVGA 1ZTXL 4D0CA 3WDIA 4WY7L 4HUMB 4OZIF 3EYVA 4E42B 1Z3GL 1EA9C 1U42A 2BNQB 4ZO9A 4GMSL 3VGFA 1N3NA 3MRHB 4LPYA 1FBIH 1XF3B 4GAGL 1NAMH 3EOAB 5A2LH 5IW1A 4DOHB 3FT4B 2ZUQB 2E9BA 2GAZA 2Q20A 1H5BA 4JDZB 5C0FA 1DQLH 2XRAH 4ZQKB 2O5ZH 3S34H 1RFDL 1JGLH 5TH2B 4OTXH 3AU1A 4U1JB 4JFPB 4HLZH 4J3OC 4H0IA 3JXAA 1JZ7A 1K3ZA 4POYA 4NQDB 4BUHA 4OF3A 2NY1D 4DJMA 2JCCA 3UJIH 3OJDA 2ZPKL 4IRSB 4P4RA 5TDOA 1CBVH 4HIHB 3X11B 4CMHB 2ICEA 4ODVL 1FGNL 3PWLB 1B4JL 4PJEA 2IADB 5F7NC 3TA3B 4QHNB 3MGAA 4HKJB 2QADD 1NFDE 5EU7C 2AXFB 4TVPE 4C56D 3GSOB 2R1YB 4GS7B 3QUML 5AD0B 1JGEB 2B0SH 1X6LA 3BISA 3G6AA 3IKCA 2W0FB 3ZZ1A 4ETQA 3IJHB 4ELKA 1V5JA 1UG9A 1A7OH 3UTTD 4U6YA 1FVCA 3QHFH 3ARFA 4PTUA 2NW2B 4DFIA 3OV6A 5HD8D 1P7QB 3LH2H 2K7QA 4YHKH 1DUYB 5L2KD 3MROA 5DHXB 1NBYB 2HVJA 4Y19B 5E8PA 3FJTA 1RD6A 3O11A 4X9IA 1H8SA 2APWA 4HHAA 5CZKA 3ULUD 3BN9C 3I50L 1MREL 4K94C 1NMAL 3W0WA 1DLFL 4GBXC 3MUJA 4G9FE 2HTLD 3IS0X 5CEZL 1PLGH 1W2KT 3NCJL 5D7LE 5E2WL 4WW1B 5GXBB 3ULVD 4KY1H 2GT9A 3OF6D 4G9DA 2PCPA 1QO3A 3WO3B 2RGSA 3UX9B 3BEWA 3EUUA 4MX7A 1BQHG 5BXFA 4NJ9L 1FE8H 4YX2H 4KC3B 5HDQH 3QNXA 1IBGL 1P53A 4MQXC 1XAUA 2YA2A 3CZFB 3V52H 1XGRA 3GMLA 5GGSY 5C1MB 2F15A 5SX5K 3WFDL 2HJLB 1KSRA 1FGVH 4HXBL 1YMMD 2OP4L 4QWWC 4PJBE 1LEGA 1A7NL 1IEAB 3IFLH 3DIFB 5ICYB 5EFIB 1L0QA 2NX5E 4BQ8A 5CJQH 4E41E 3ME0A 4D9QD 5E56A 2VN4A 1ITBB 4KAQL 1N64L 3MA7A 4NKOA 5M95B 1R3KB 1BM3L 4Z7WF 4P9HC 3SE4C 1H3UA 5IEHB 2YPVH 4Q9CA 4NZJA 5DEZA 1A1MA 4KMLB 3MJ8B 3HG1D 2BNUA 2XKSA 4PJDA 3UTZA 4H20H 1MJUH 4R3SA 3FRUB 4LIQH 2ZNWA 4N0YH 4QHKI 5B4MC 3HMWL 4O9HH 3VGAC 5MEQB 2CO6B 1YJDC 5DJDB 2AJSH 1E4XH 3U6RA 4HPYL 5D1XB 4FFVD 4FABH 1F58L 2YD5A 3TV3H 4DWHA 3ROLA 2QSVA 4ZPTB 1Y0LA 2JJSA 2WINB 1ES0B 3C5SB 3GJFH 1RAMA 4IRJB 4G6KL 3GI9H 4EZMA 2VLJD 5DO2D 1QYGL 3QIWB 5FGRA 4DTGL 2Z8VC 1YN6B 1CFNB 3MUGA 5A1AA 1TPXB 4WUUB 4QYOB 1T89C 1MWAA 1CVSC 4JFYA 2GSGA 4N9GA 3QCTH 4X7TB 5L2KE 2BC4A 1LE5A 2NW3A 4KI1A 3LN9A 3SGKA 5IIEA 3PGDA 1AQDB 1FRGH 5GSVA 2D7MA 4LNVA 3MBED 4IOFD 4NFBA 3WJJA 3OKDA 5FYKH 4BFEA 1OF2B 1CZ8L 4J6RH 4YAQB 2D7TH 3QXUA 4XAWL 2P46B 4MCYA 2BVYA 5F7WC 5C0IA 2V5SA 3VI3F 1DSFL 3V5HB 5J6HA 1U8IA 1X4ZA 5FM5M 2HJFA 1U8OB 2ZUYA 3QQ3A 5J1AB 3H3BC 3QDJD 4OFYA 1HHJA 4WJ5A 3WHXA 2DB8A 2PXYD 2MHAA 4PJBB 1W72B 5KVFL 1A02N 3JV6B 2H9GA 3BUYA 4ZODA 1UJTA 4QF1B 3AB0C 4GRLD 2DMKA 4AIXA 4KDTC 2ZOLB 4NYLA 4HT1L 2GIYA 3GSRA 4LF3B 4X4XB 4CVZA 1MRFH 3GHEL 1G1CA 1S8DA 3TBWB 1SEQL 1X5AA 2ERJC 5J11C 3DJ9A 1LQSR 1EGJA 3HC3L 3K2MC 4NCC2 2NY1B 1OGAA 4KMQA 4PRID 4MAYA 4RFNB 4CUCA 4F9LA 4XRCB 4UOJA 4NBZB 4Q6IB 3DVNB 1U3HA 4J3XA 3ARBA 1RZ8B 5CINH 3HG1E 5CSZA 5SWZA 1T5XB 3S3PA 3GMNB 3WKNA 4MXVF 5KVGH 2QADB 5CGTA 4D9LH 5JHLL 5GJSH 1OCWL 4C56B 1T1XA 5C9JB 1RIUL 5FCUH 1VKXB 3U0TA 1BQUA 3IDXH 1ZANH 4FS0A 4L9LC 4YC2B 3UTTB 5B38G 5E4IA 5HGBA 4KJQC 2BHUA 2J7LA 3VXMA 3V6FB 4OCYH 5ADOH 1RJLB 1JNHA 3HB3C 4DVRH 2FLBT 5L2KB 1E6JL 3OHXB 1BREA 2ZUWA 3V6BR 4MA1B 4ZXBD 5DRWB 3SDAA 3VFNA 5FKPA 5GRXG 1MLCA 5EO1B 3RPKA 2MSPA 2BVOB 2ZSWA 1W0VB 1MWAL 3O2WH 1OGTB 1ZT1A 3OKLA 1QKZL 5KTEH 4XTRC 1A1OA 2VLLB 3CH1B 3WN5B 4PTTB 3A6BL 3LD8C 1OSPH 1PGRB 2F54A 5IQ7L 2ZOKA 1YJDH 1ZVHA 5D5ME 1KJ2L 2GYSA 1DANU 4JG1H 2C3VB 3MA9L 1T0PB 2Q8BL 1GHFL 3FFCA 3T2PA 3TT1H 3PWNB 1F97A 4HWEH 1M7XA 1EJ6A 1KENL 3LQZB 1YMMB 2YWZA 3SKNA 2NYYD 1PZ5B 2Z35B 1V7MH 3IU4L 1LO3L 2DMCA 3G04A 5I18H 2A83A 5TE4L 5BS0D 5HHXL 4Y8AA 1KN4H 3R0MA 1GAFH 2YK1L 4CU7A 3O6KL 2ZKHH 4HZLB 1RZJC 5ID1B 1AGDA 1CLZH 4WHCA 5GGUA 4F33A 1EIBA 4I5BB 3P4LA 4ONHB 5DI8A 4R4FH 3MCLH 4BSVB 1Y18B 4RDQG 4UINH 5DJ8A 4L4TD 2BFVL 5JDJA 4PRIE 1UQSA 1A4JA 5LBSL 4Z0XA 1NMBH 1J0KA 1EEYA 3VFUA 1AD9B 4LEXH 2I5YH 3GZKA 2PTTA 4D3CH 3E3QE 5CD3A 4L8DB 2R2HA 3RGVC 5K59F 5FYLL 3RX7A 5H94A 4P49A 5I74C 3U9PH 5BOZG 2EKSA 5IMLB 3BDYH 3U9UB 4CJ1A 5FCSH 5CKAA 1MHEA 3U7WL 2VLJB 1T0MA 4TUJA 4DN3L 5I8OH 3WLWC 1U8JA 4LPCA 1QR1A 1IAMA 4MVBD 1MCHA 4I2XE 4LLWB 2ADGB 2H6PB 1V3KA 4ODTH 4QXUH 5DRNB 1Q9LA 5D1ZC 1P2CA 1P84K 4WGWB 3EKCA 3MBEB 1A9EB 1JGDB 2VE6A 2I60H 2VMFA 4WFEE 4HPOH 4Z77B 5H2BA 5BZDB 3ALPA 1F42A 4URTB 3WCYA 1FIEA 2QKIA 2ZCKL 3CAFA 1XGUB 3LY6A 4GG6E 3ARFD 1QVOB 1K85A 1T5WA 5D2LE 4RNRA 3G5YB 4LLMB 3QDJB 4MJ2A 3ULSA 3I75B 1U8PA 2PXYB 3PWJA 5L8LB 3TT3H 5JA8B 4ZFOB 3S7GA 1F4AA 1UXWA 4XP6L 4C54A 3IDIB 4GRLB 2AV1B 3S96A 4YBQC 5CHNB 35C8L 3W0WD 3X13A 3QNZB 4EDXB 5SV4A 4TTDC 4WTWA 5FO7B 3N9GL 5CEZE 5BS0E 4ZS7H 5JW3H 4RAHA 1YPZE 3EFFA 1LO4H 1KLGA 2XWBB 3C09C 2DMBA 3PG2A 3HAEG 1P5VA 4XGZB 3GB7A 1X5ZA 4OFPA 4S1DC 4PJGA 1R3IH 1IQDA 1ZA3A 4PRIB 5E9DA 5EBLB 3VCLA 2NY2C 5CEYA 5EUKB 4TQEH 2A6KA 5DQDL 1MRDL 3VXRE 5IROA 4BH7B 4PLKC 1A7RL 4GUPB 4MXQD 3NPSB 1NEZB 1BZ7B 3HZVB 2AJVL 2A9ML 4EUPA 3EO9L 1BLNA 4ELMB 5DHVA 4S1RH 4M7JL 3AM8C 1QFUH 5F97E 3RBGA 5HPOA 4WHDA 3MLTB 1WIPA 4KXZI 4HLZG 3EFDH 5AAMA 3BP5A 2HMIC 3OB8A 1Y6KR 5IVZA 2YN3A 2E6PA 4O2CB 3P9WB 4U1SA 5E24E 1BBDH 3L5HA 4KHXH 5TDNB 1L9NA 3PQYA 4QTIL 1RZJH 3FOLA 3GHBH 4K8RC 1IC1A 5E8NA 3MXWL 4LLDB 4O2EB 2DQCH 2HN7B 3O81A 3ES6A 1YEJH 1B0GA 2PO6C 3DI2B 4ZXBB 4GXUN 4KU1A 4N8VA 2H8PA 5JIPA 4KMTL 1G9NC 1DTUA 3HS0B 1GOGA 1WISA 3BZ4A 5D2NB 3FQRB 5C71A 3NCMA 3QUMB 1XEDA 3MRDA 4M8QB 1U3ZA 1NMCB 2VLME 3MOAL 1A3LH 5GGVH 4G43A 2ITDA 3FHQA 3QXVA 3V6OC 1OLZA 4PJEE 4P3WA 1VA9A 3MODH 1SBBA 4FZEH 5D7JA 1JPGB 1QA9A 2BSTB 1JPFA 1U93A 4A6YA 5EOCJ 5EORH 4M9PA 3DSFL 4J3SA 1X7QB 1Z2KA 4JANB 3HCVA 2HT4D 4H0HB 5I8EA 1A7PL 1UEMA 3V6ZA 4QOKE 4M6NH 2APTA 4X6CE 2FL5B 4X5XA 5CBAA 1VEPA 5E2TH 1FFOB 3DV4B 1SQ2N 1YYML 4XPGL 1KPUB 3X14A 3BW9A 4YIQA 3VRJB 1NUFA 4U49A 1IM3B 5CCKL 4ZO7A 1YQVH 1G7PA 1MFDH 4I3RL 3IU3B 4YHZL 5BS0B 5I15H 1UM6L 5CIPA 3ARPA 3T08A 3PWPE 4G8IA 4NPYB 1SYSB 3QI9C 1S5HA 3RPIB 1ADQH 4I13B 3WLBB 3ZYOA 3CFKB 3KPLA 3ZDXF 2DBLL 4K7PY 5ESAB 4BZ1H 3P77B 2CD0A 3MLZL 1FAIL 4RISH 4WTZG 1DQDL 1N6VA 3AXLA 3MRLA 5BQ7B 5IWLA 4UDUB 5F9JA 5FDWA 3MRGA 3JWDL 4L4TB 2EO9A 4TSBL 4OFYD 4D0CB 4EIZC 3EYVB 1FZMA 12E8L 2QQLH 4IIQA 1N3NB 3L3OA 1QNZH 3F7YA 3BO8A 1S7UA 5MEPA 1MLBA 5IW1B 1FNHA 3MLRL 2F58H 4BZ2L 3HNVL 2GAZB 4GG8A 3P30L 4M6OL 4ZNEE 5JOPE 1H5BB 4HAFA 1U3JA 4OLWH 2CJUH 4XNQA 5C0FB 4OIBA 4XNYH 3NIGE 5ALCH 4Z9KB 3AU1B 4DGVH 3SO3C 4H1LA 4UQ3B 1QFWM 3RVWD 5J7CC 4M7LH 5HI5C 4LU5H 2BSED 1HHHA 1OGAD 1UACL 2JCCB 4MAYD 4RA3A 3G6JF 4UMGA 3OJDB 1Z0NA 1DANT 3H0TA 4O58L 4P4RB 1U2HA 2YD6A 5TDOB 5KW9L 2ICEB 1U3HD 1CXKA 3ARBD 3LSOA 4UTBL 5SWZD 4OLZL 3Q6FA 4PJEB 1ZK9A 5BVPH 3MRMA 3LIZL 2BNRB 2NY7L 4L8CA 2O5YH 1IC4L 3R1GH 4I0PC 3V0WL 4K2UH 1KB5A 3UJJH 3TJHC 2DLGA 3HZKA 4KHTL 5IHUH 3G6AB 3IKCB 2YKLL 4ETQB 2OTWA 4ELKB 3FN0L 4U6YB 5EZOH 1FVCB 1QSEE 4P99A 5GISH 3ARFB 3VXMD 5I1AA 4PTUB 1YEGL 4PG9A 3U7YL 5T1KA 4A6YL 5L7XL 3X3GL 3MROB 4K8RH 2HVJB 4JN1L 4N90E 5E8PB 3SDAD 1C5CH 3O11B 1T03H 1AXIB 4G8EA 4HHAB 5F70A 1LO5A 5FUOH 4V1DE 3W0WB 2JELL 1G9NH 3TH4T 5FK9A 1KYOK 4ZUVA 4UI2A 3RWDA 4YBLB 4XPBL 2J6EA 2F54D 2GT9B 4G9DB 2PCPB 3GJFK 1QO3B 5E5RB 2IFFH 3BEWB 3Q1SL 4MX7B 5I73C 4IS6A 3V7AG 2HT3D 3WKML 5BXFB 4M5YL 4KUCF 2P5EE 4R0LC 1J9CT 3QNXB 5IBLD 4XMKH 2MPAL 3HZYA 2D2OA 3FFCD 3FZUC 1XGRB 3GMLB 4Y16A 2WWMD 3I85A 2V7NB 5C08A 1CFVL 4IEFB 4H26A 2NY5L 1JRHH 4YUEH 2BY1A 3T0EC 1D5MA 2F53E 1LEGB 4G6AC 4B50A 1E6OH 4J8RA 1NGPL 2NXZD 5GGRY 2W0KA 1IGMH 4Z7VF 3LKPA 2FSEA 3FT3A 4CBPA 1CYGA 2DTML 2QHLA 4PBVC 4DKEH 3O3UN 2Y4SA 3MA7B 4UV4L 4NKOB 3PNWA 1Q9WA 1AQKH 4RGMB 1ZEAH 3FO0L 3RBSA 2CMRL 2ZCHL 4S1QH 2VXSL 1A1MB 1EBPA 1OHQA 2BNUB 3LS5H 4PJDB 3UTZB 4JREC 4R3SB 1HWGB 1VPOL 1AHWC 3RVVD 2E7HA 3ZHLA 1BEYL 5T3XL 5FUCE 3ZE0F 2Y25A 4YHOH 3LN5A 2VDOH 1HXYA 1DBAL 3U6RB 3TVMC 5LQBH 1T4KA 4XXCC 2WZPD 4GKZA 3DX6A 4DQOL 5J56B 4PJ7A 5FYLE 4XHJD 1K2DA 3ROLB 1DQTA 4OLUH 3WO4B 1Y0LB 1KB5L 3AROA 2EO1A 5DD0H 2OR9L 5CKGA 3UZVB 1RIHH 3K7UA 2FBJH 3OAZH 3MUGB 5JR1L 1XMWA 1CL7L 2BVQB 1MWAB 3QHZH 3ARYA 3FONA 4JFYB 2GSGB 3BPOC 2YMXH 4N9GB 2N1KA 2VISA 1T7ZA 2BC4B 1JZ6A 1GPOL 2NW3B 1OAUH 5KSBF 5IIEB 3PGDB 2DQEH 5C0RL 2XFXA 5GSVB 1G9MC 4N1EA 3UEZA 4KDWA 3KYMB 1CDGA 2CLRA 3OKDB 1GGCH 4KKAC 4DGIL 4R7NA 1S7WA 2ICWA 3RGHA 2B1AL 1ZLWH 1UB6A 4MCYB 5C0IB 15C8L 1OTTC 2EE3A 1WAAF 3LKSA 4LKCA 1U8IB 5J6HB 5ESQA 5MERA 2HJFB 1KCVL 4N5EC 3CVHH 4Y5VC 5T1LA 4PS4H 3QQ3B 3WHXB 1HHJB 4WJ5B 5CJBA 1TIUA 4LDOB 4H25A 2MHAB 5CZXD 1F6AA 3CFCH 5E99L 2H9GB 2R0ZH 5E4EC 2JKXA 3BUYB 1OL0A 1UJ3A 2DQGL 1ZE3C 1MI5A 3S4SA 4NYLB 3GSRB 4CVZB 3T0BA 2LV4A 2E7CA 1UWGH 1S8DB 1P9MA 1CG9A 4NWTH 4Y4HC 2E9IA 3HNTL 2FH8A 3E1F1 2V5MA 2VSCA 3QEQD 1QLFA 1G7MA 4TULH 1OGAB 5E9DD 4MAYB 2B4CC 3RKPA 3MRIA 4F57H 4TTGA 2NR6D 4P5MA 5GRVK 1U3HB 3L3KA 3ARBB 5J89A 3FN3A 1QBMH 5CSZB 4GLRI 5SWZB 5HVFB 4AYFA 3CX5J 1HK6A 1Z9SA 5MENE 3HAEA 5IFAL 1PG7W 3MOBH 3EHBC 2HWZL 2HLFC 1CIUA 1T1XB 3EYUH 3GKWH 3QYCA 4J4PC 1C1EL 3S97C 3EYQC 1ZLUH 2OJZL 3MLUH 2XZQH 3T3PF 4DFHA 3BAEL 3DVIA 3U0TB 5EBWA 3QIBA 1NGXA 1ZSDA 5HGBB 4U1MA 1NAMA 5F1NA 3VXMB 2BVUA 3PQYD 4YXLH 5FKAB 1JNHB 2VC2L 4C55A 2NZ9C 1XH3B 1CQYA 1PKQA 1SVCP 3SDAB 4D9RD 1HDMA 3VFNB 5FKPB 4XMLL 1MLCB 1P4LA 3VXTA 1R3JA 4YQXH 2ZSWB 4MA8H 1PY4A 4WFGD 1ZT1B 3GM8A 3OKLB 2DIJA 1CN4A 1PY9A 1A1OB 4F8TA 4FQ1H 3W11C 4GOSA 4M93B 3W9DA 4JFOA 4G7VL 5D7IE 4JFEE 2X9XA 1VEOA 2F54B 2ZOKB 4JQXA 5D7JD 2O5XH 4JG0H 3AS0A 4K9EC 1K4CA 1M6OA 3FAXA 1N0XH 4MS8D 4Z76A 4X9BA 1IAIH 2NY3D 5C0CE 3FFCB 1OARH 5DSCA 5B3JF 1T83C 4PJHF 4JHZA 5F88A 4JFDE 3SKNB 5I8KL 2D0FA 4CMMA 1ZS8B 1R0AL 3OZ9H 1ZGLM 3G04B 1I9EA 4XPFL 2BVEA 2NXZB 2A83B 2C7UA 2ILLA 4KK9D 1SJXA 2ATPA 2RHEA 4OGXH 1RZFL 4BK4A 5IFHL 3BIAX 4DN4H 4PJIF 1AGDB 4X8JA 5GGUB 1BECA 4F33B 4K7PL 1U6AL 1J0JA 2EXWD 4MYWB 5DI8B 1A0QH 5EUOA 1PZUB 2ICWI 4XI5C 5DJ8B 3HI5L 4PJGE 1DBJH 4FQJL 3PP4H 3K8MA 2YPLA 1UQSB 1A4JB 5E9DE 3OGCA 2D9QB 4R9HA 4Z0XB 1T20A 3HPLA 3OXSA 1Z0MA 3QFDA 5GGRA 1EEYB 5DRXA 3VFUB 2EIEA 3PL6C 4G7YH 3MJ7A 3R0NA 1KEMH 1LP9A 2PTTB 1AH1A 2C3WA 4LNRA 3B2UC 1WBXA 3F12A 5CD3B 1RU9H 2R2HB 5KSUA 2L7JA 3NABL 3L6FA 1JPSH 3SGEH 3CSGA 5H94B 4KRLB 1PVHA 3ETBF 5HDBF 2EKSB 3LQMA 1MHEB 5I9QB 2OZ4H 1URLA 1T0MB 5CS7A 4TUJB 2AK4E 3CCHA 4Z7QF 3S36H 1FBIL 1J1XH 1NAML 1U8JB 3PQYE 1QR1B 5CBEA 4NZUH 5T3XD 1N5AA 3VFWA 4JCMA 2B4CH 5CJ8A 1DQLL 3BSZH 1Q9LB 1P2CB 4OI8A 2XRAL 2O5ZL 3S34L 4DEPB 1JGLL 4LSSH 4OTXL 1EAPA 1HINH 2VE6B 2VKWA 4CJ0A 2EZ0D 4M7KH 1CF8H 2X4SA 5H2BB 4HKBA 4NQSA 4LP5A 5T5NF 3UJIL 3SDDC 1XF4A 2R0KH 4OM0H 1T66C 4NBXB 2QKIB 1CBVL 1RY7B 1CGSH 1J18A 1FFRA 3FAWA 1WFNA 1IEBA 4K3DH 1T5WB 4RNRB 5T1KD 3ULSB 4HAGA 1U8PB 3PWJB 3D85A 1GGBH 1UXWB 4BFBD 1J1PH 3GJFA 1NDGB 3VD4A 2B0SL 1XT5A 3S96B 1A7OL 3FB5A 3X13B 4PGZA 3QHFL 3QRFM 3UYPA 3RWFA 3ZLQC 5F9OH 4XBGA 3EFFB 1DCLA 4YHKL 1KLGB 3DRQA 2FIRT 3DV6A 3GB7B 3HR5A 3QEQB 4PJGB 5I6XC 1IQDB 2Q7YA 3DARA 3RHWF 5TE6H 3C2AH 4K9EH 4KKCD 3STLA 1YEHH 3VCLB 2QSCH 2WLYA 4CVXA 5CEYB 4U1GB 3HR6A 3RWCA 2A6KB 3C08H 4KVNH 4Y16D 3F62A 3FB8A 4D94A 4TSAH 1RQ5A 3S88H 5C08D 1PLGL 4LARH 3BKYH 4BFIA 4EUPB 4KY1L 1BLNB 3NTCH 3PGCA 5DHVB 5IJVA 3B9DA 4QT5A 5F89A 5C3TA 1FE8L 1AR1C 4DK3A 5I71C 4YX2L 5ID0A 5HDQL 5BV7C 1JF5A 3BP5B 4X9FA 4QRRA 3V52L 2X1OA 5IVZB 2UY7A 2XOTA 4NT6A 4MCZA 1E27A 4U1SB 3K4DA 3PQYB 1FGVL 4R4ND 1OTSD 4POZD 3ALXA 3FOLB 5E8NB 2JJVA 4C57C 3IFLL 4FG6C 4GBXA 4HH8A 3AMLA 3ES6B 1B0GB 1LE9A 3EYSH 4AENA 4N8VB 4M48H 5CJQL 2H8PB 1OAYL 3SE3C 4F58H 3BZ4B 1IEHA 5T3XE 5E2VH 5I1DA 3MRDB 5E1HB 3NFNA 4G43B 2ITDB 1D7FA 5GGTH 3FO9A 2YPVL 4XAKE 4S1SH 5D7JB 1U2CA 5E6IC 1QA9B 1JPFB 1BD2E 1U93B 1MJUL 2DWEA 4H20L 4A6YB 5GZOC 4LIQL 3HCVB 4N0YL 5I8EB 3V6ZB 4U3CA 2NY3B 1AD0A 4IRJC 4O9HL 4X5XB 1G6RA 5CBAB 5GGVY 1GGUA 1HH9A 3X14B 2BOBA 4XNZC 2AJSL 1E4XL 4N1HB 4YIQB 2KZ1B 4PLJC 4GXVH 3UPCA 4FABL 1G7PB 2JB6A 4L5FH 1JF1A 3TV3L 1HIMH 3LV3A 5CIPB 3SE4A 2DJSA 3GI9L 3IDGA 4G8IB 4ZAKC 3UTSE 1S5HB 3QXDA 4CRPA 3LKRA 3KPLB 4HV8A 2R8SH 3QCTL 4R2GD 1I75A 3AXLB 5A40E 1N26A 3MRLB 2AXGA 4FQIH 5FDWB 5F9JB 1FRGL 3MRGB 4LSRH 5T1LD 4LSVH 2VYRE 3MV7A 1FZMB 1ORQA 5FYKL 1E4XI 3KLSA 4IIQB 4OD1H 5HVWA 3L3OB 3F7YB 3G6JA 3MC0A 4LDLB 4J6RL 2D7TL 1FNLA 1S7UB 5MEPB 1MLBB 5IB5A 3I6LD 1MI5D 1BF2A 3ZTJH 4GG8B 4YHIA 5L88H 4XNQB 3U2SA 3U46A 1MIMH 2MJWA 4N68A 2FEDC 2WQRA 3GIZH 3HRZA 4H1LB 4P2RA 4YGAB 4LOUC 5KAQG 1T80A 2W38A 1HHHB 1T2JA 5I75C 2CRMA 3EGSA 3H0TB 4NKIH 3WXVH 2PETA 3CDYA 2OK0H 5GJTH 4UNTA 4NWUH 1MRFL 4PY7A 3LSOB 1N6UA 4QXWA 2G5BA 4M3KB 4B7IA 3Q6FB 1OWWA 3MRQA 5JIIA 4TSCH 3MRMB 1U95A 4L8CB 2EXYC 3TCLA 4FZ8L 1Q0XH 3OSKA 5LG1A 1KB5B 3HZKB 4Y2DC 2DLIA 2P24A 2OTWB 3QIBD 4HJ0C 5CINL 1BP3B 5I1AB 4KDTA 5HHME 2H1PH 3BGAA 4PG9B 5T1KB 5KVGL 1UADC 4D9LL 1F5WA 3MMEA 4IMKC 5GJSL 5J13B 1JE6A 4MXWH 1I9RH 4G8EB 4PJAF 1FDLH 1LO5B 1Z6JT 5FCUL 3IDXL 1ZANL 1PAMA 5BVJA 5JW4N 4WI8A 4OCYL 5ADOL 5FK9B 4ZUVB 1CLOL 1RURH 5E8DH 3RWDB 3SKOA 4Z7OE 4DVRL 2J5LC 1NGQL 5HYIA 3SKUD 3RHWK 3ZT7A 4WO4C 5GRJH 5I1IH 1S7XA 4PRPA 1TTUA 4ZO6A 3AMKA 4DCQA 5C0BA 4Z7VA 4IS6B 5B3NA 3OAZK 2P8PA 3O2WL 3HZYB 5KTEL 4Y16B 3C6SA 4KROC 2W0PA 4JVUA 5C08B 1OSPL 4H26B 2ZP0T 3MLWH 1I85C 4OFVA 3ZHKA 1YJDL 1D5MB 3GSNH 4L9LA 4PGDB 4R6UA 4J8RB 2PR4H 1CGTA 2VXUH 5LWYL 1QBBA 2APBA 4JG1L 4X99A 3LKPB 2FSEB 1MCOH 2W9LA 3FT3B 2RB8A 3I6LE 2LVEA 3ABZA 4HWUA 3TT1L 4F7MA 1BX2A 4OZHF 3VFGH 4HWEL 1KTDA 3PNWB 2VRAA 5DF0A 4PJFA 5D8JH 3ZKMD 1CD9B 1NCCH 1V7ML 2UUDH 3FKUS 5D7SH 5I18L 1PQZA 4TNWF 1MJ7H 1KN4L 3UDWC 1GAFL 2YPLD 4YO0A 1RHHA 4M00A 4YWGL 2ZKHL 1I9IH 3SDXF 3DUSA 1NBZA 3LN5B 4NC1E 1CLZL 5GHWH 1A2YA 3MJGX 1HXYB 3HNSH 2XWJA 1JV5A 1T4KB 3RI5F 4R4FL 2J8UE 3MCLL 5KSBA 5CILL 4GKZB 4PJ7B 4UINL 3R8BB 1K2DB 4UT6H 4WU5A 5HYEA 1NMBL 3VFTA 5C70A 2YZ8A 1MAKA 2D31A 2EDRA 2LAGB 4ZPVA 4MMXC 4PD4J 4WEBH 2I5YL 3KYOA 4OZFH 3KPMA 3FONB 4D3CL 1WAAA 5C09A 3UAJD 5IBTH 4LHUA 2FECL 2VISB 1TQBC 1PKQE 3KYAA 5DGRA 3M8OH 2APFA 3U9PL 2J88H 2XFXB 3BDYL 5F93C 5EOCH 3BPLB 4LFHG 1ZLUK 2CLRB 2I26N 4R7NB 1S7WB 3BPNC 2ICWB 5I8OL 5DGQA 1UB6B 5T1DH 4ODTL 4R2GB 4QXUL 2V5RA 3LKSB 4LKCB 5ESQB 1F90H 5MERB 3DETC 4MNQA 2OTUA 4LAJH 5T1LB 5CGYC 3A0OA 3AAZA 3WNOA 1BFOA 2I60L 5A3IC 3GBLA 4H25B 5FUZH 1IE5A 1JYNA 3ECBA 3NCCB 3RGVA 3D85D 5JORA 4HPOL 5I2IA 2VDLL 3RNKA 2FECI 2F9BT 4Q6YA 1UJ3B 1KTLA 1MI5B 5E94A 3S4SB 3V4VH 1V8HA 3QZWG 3OAYH 3NBNA 3TT3L 1CG9B 4JO1H 3BDBA 1NCAH 5A2IH 2APXA 4JY4B 5D1ZA 2EH8H 1QLFB 1G7MB 1C8PA 3GMMA 4H0GA 5FM8A 5FYKD 1ADQA 3MRIB 3ARVA 4LSTH 1C12A 4P5MB 4U1NA 5EUOE 3L3KB 1T6VN 5GQBA 4ZS7L 5JW3L 4NUGH 3ARDC 1LO4L 3MV11 2YPLE 4Z0BH 3QJHA 2ZJSH 5L8KB 1RJYA 3E3QC 3HAEB 3SO5A 4LCCC 1JK8A 4U1IA 1R3IL 2HVKA 2CDFB 3BIBX 3NFPA 4U6HA 3I6GA 5DMYA 3U1SH 3KLDA 4OGAC 1TENA 1LP9E 3QAZB 1FO0H 4QRRD 5EBWB 4TQEL 5DJ0A 3QIBB 1NGXB 1ZSDB 5HHQA 4ONGH 1NAMB 2GSIA 4JE4B 4U1MB 5F1NB 3WXWH 5A2JH 2W9EH 2FATH 3BN9D 3KLHC 1BF8A 1SJVA 3BGFC 4D2NA 4S1RL 1F3DJ 1QFUL 1PKQB 4GBXD 5D9SA 1HDMB 5F7MC 4PJ9C 2V2XA 3UC0H 1P4LB 3VXTB 2MTPA 3EFDL 1R3JB 4JFZH 5F3HA 2GJ6E 1CGYA 1L9MA 1PSKH 2CRYA 1YQ2A 1BBDL 3Q0HA 4KHXL 4PJHA 5B39A 2VL5A 1RZJL 3GHBL 4G3YH 3W9DB 2IH1A 4JFOB 1S7SA 2HFTA 1WSST 2DQCL 3QFJA 4MQXD 1KCRH 1YEJL 4HULB 1J8KA 3J8F7 3LVEA 4I3SH 4RX4A 1K4CB 1M6OB 4LIQE 5BZWA 2HH0H 4RAUA 4Z76B 4QWWD 5KOVC 4NRXA 4PJIA 3AM8A 3OJ2C 5DSCB 1A3LL 5GGVL 4HBCH 4X9GA 3MX0A 4NNYA 5F88B 3JTSA 2A9NH 4FZEL 3OAUH 4CMMB 4Y89A 1UWXH 4JEGB 5J8OA 5EORL 2C7UB 4BSJA 1HZHH 4MGXA 3P9LA 3UPRA 4M6NL 3OKEA 2ATPB 3M1BA 5E2TL 2PO6A 5M7QA 4UTAH 1QG3A 1A3QA 3W9EA 5A2KH 1JPST 4R97B 5DK0A 3QUKA 4TNWK 4FQQA 1YQVL 5EUOB 1MFDL 5B4MD 3M07A 5I15L 1HHIA 3L3JA 4LAQH 3V6OA 2XG4A 3C60C 3JVGC 3HMXH 4YPJA 3OGCB 5FYKE 3MV7D 4K71C 1D9KC 3RDTC 2OJEA 1ADQL 1T20B 3CZJA 3HPLB 3IFNH 3OXSB 3QFDB 5GGRB 5DRXB 1KXQE 3EZ8A 3DYOA 4IDJH 3N50A 3MJ7B 3LPGA 4BZ1L 4RISL 2HTKC 1LP9B 2P42B 3RJQB 1CIDA 4LNRB 3F12B 1WBXB 5KSUB 3O3AA 1QFWH 4KVCH 1P6AB 3VXQA 3L6FB 1NFDF 4Z78A 2RBLA 2A1WH 5ABDE 4D8PA 3V7AE 4GW1A 4QRRE 2UZYB 4P2RD 4P57A 4ESKA 1QNZL 3CCHB 3TNMA 4YHPA 3O4LA 5CBEB 2F58L 2VZUA 1Q9KA 1N5AB 1YEFH 2AEIT 3VFWB 3FQWA 3QI9A 2CJUL 4OLWL 5F7LB 4XNYL 1N6QH 1BVLA 4AQOA 4L4JA 4Q0XH 2W60A 5ALCL 1W8NA 4CDGC 1EAPB 4RGNE 1REIA 4XT1C 4DGVL 4JZJC 5HGDA 4M7LL 1R5VA 2X4SB 1EJOH 2YUZA 4HKBB 4NQSB 2FLRT 3GIVA 1A4KA 1XF4B 1C5DA 3K4ZA 4GMTH 3BRFA 3DMMC 4UNUA 1OVZA 4QHUA 5KS9E 1IEBB 5BVPL 1TZGH 1BIIA 2NZIA 2O5YL 3R1GL 3B8SA 3D85B 5JXAH 4K2UL 4PUBH 3SBWC 3UJJL 4KUCD 3GJFB 1KULA 3RVTC 4N1CA 5IHUL 1S5IH 4LASH 5FO8A 3FB5B 4MA3A 5EZOL 1JYWA 5GISL 2RJMA 4PJBF 3RWFB 4AH2A 4M7ZC 4XP9H 2Q87A 4XBGB 4K8RL 3DRQB 25C8H 1GOHA 3DV6B 3HR5B 1C5CL 4PRPD 5DR5H 5GS0C 5C0BD 2Z9TA 2Q7YB 1EO8H 4N0FA 5FUOL 1DBKH 3L1OH 2V17H 1G9NL 4CVXB 1LK3H 4I0PA 3RWCB 1GOFA 2Z93A 1U8QA 3FB8B 3MV8A 3RZWA 4JVWA 3ZTJG 2EDLA 5F7YC 3UZEA 2ZUTA 3MV7E 3BGMA 3PGCB 5IJVB 4FXGA 2FJHA 2DQHH 2IFFL 4KJQD 4NCC1 4QT5B 5F89B 4XX1G 5CEXA 4ZG1A 4JKMA 3HB3D 5ID0B 4Y4KC 4XMKL 3FMGH 4QRRB 2MNUA 5HI3D 3BT2H 4NT6B 1HKLH 4MCZB 1E27B 1NLDH 4CNIA 3GNMH 2ZUUA 3BE1H 2AJ3A 1JRHL 4YUEL 1E6OL 4GBXB 1LE9B 4XTRD 1CE6A 2AK1H 3F58H 1EVUA 1IGML 1NCWH 2JIXA 4LHJB 3VI4F 4WHYH 1WGOA 4HWZA 3SDYH 3SQOL 1X9QA 1HN1A 4DKEL 5I1DB 2NXYC 5KG9A 3NFNB 3VU2A 4K3GA 1AQKL 1R6VA 1ZEAL 2R0WH 1DUZA 4R0LA 3FO9B 5HHPA 3HUJA 3HRPA 3I3DA 4S1QL 4BQCA 4NQCA 3ULUF 1WWAX 3X3FH 3DVFA 3LS5L 3EDKA 1VFOA 3TBVA 2DWEB 5J06A 2WWKT 2DKMA 2DLHA 1AD0B 1JRHI 2DWDA 5FM5O 1G6RB 4YHOL 4NKMA 1IJ9A 2VDOL 2K3TA 2BOBB 2WWKO 5LQBL 1T3FA 4APQC 5C09D 1SJEA 1NCTA 4LHUD 4OF5A 2JB6B 1JF1B 1T7XA 4H88L 1HHKA 4FQXA 4OLUL 2IPUG 2DLTA 3RL1A 2DN7A 3C87A 4NKQB 3LV3B 1ZAGA 5FB8A 1WVZA 4JZNA 5DD0L 3IDGB 4LEOA 2X05A 3D0LA 3ZKNC 3QXDB 2QQQA 3TN0C 3LKRB 4LGPB 3B83A 3QHZL 4HV8B 2YMXL 1AHWA 2AXGB 2C4FU 1OAUL 4EIGB 3GMQA 3VGAB 4MNQD 2DQEL 1SBSH 2BRQA 5C0BE 4AZ8A 2O26U 1ZLVH 3TVMA 4XXCA 3MV7B 1IGTA 1ORQB 1GGCL 3RGVD 2WIIA 1VDGA 4JM2C 5BRZA 3G6JB 1A8JH 3SE8H 2CIKA 5IB5B 5ICXA 5GGQH 3GSQA 4YHIB 3TP4A 1LK2A 3U2SB 3CVHL 3U46B 1Y6MR 4PJCE 4OLYH 4PS4L 3WLWD 3FB7A 3KHOA 2R23A 3MR9A 3CFCL 4PY8J 3C5ZC 2R0ZL 3HRZB 3RWEA 4P2RB 5EU3A 4MLIA 5D1ZD 3RVWC 2VZSA 4RMQA 1IILE 5GS0H 5FEBA 2XQYG 3EGSB 5E1AA 1KJMA 1X4YA 4PY7B 5FUCC 3CFBA 4XP5H 3QZWA 1XR8A 2FZ3A 1FP5A 2G5BB 4JN2A 4N0CC 4O5LH 3MRQB 4U6TA 2NNAA 1U95B 4NWTL 2E27H 3TCLB 5BW7C 4B41A 4TULL 4Y5VA 4YGVA 4ETYA 5GIRA 3S8WA 4I8DA 1OM3H 4X6DA 4F57L 4JO4H 1L0XA 1BMGA 2P24B 1AE6H 3OB0H 1GC1C 3VFMA 2X09A 2UUDK 1QBML 2E8ZA 2ARJQ 5D5MF 4W68A 3ARRA 1AJ7H 4FFYH 4YBQD 1RZKH 1ND0A 3MMEB 1T21A 3MOBL 3F7PC 2V9TA 4TTDD 3EYUL 3GKWL 3CXHJ 3RWHA 4JRYA 3MLUL 2XZQL 3NCYP 2OZ4A 7FABH 4F2MA 1AC6A 5GZNC 5JLZA 2N4IA 5BVJB 2ERJB 4S1DD 5J11B 3JUZA 4XCEA 4YXLL 3IDUA 2E7BA 5GS1C 3SKOB 1FYTE 1IGIH 1G84A 4PP2A 2BK8A 2NY2D 3QFJD 3DHMA 5F1IA 1I1CA 4PRPB 2UWEA 4FOMA 1P1ZA 4PLKD 4HD9A 4RX4D 5C0BB 4Z7VB 4DCQB 1O0VA 4YQXL 5C07E 3ZKXB 4MA8L 2P8PB 3DWTA 5EC1A 4JHAH 4OZHA 3DXAE 3KJ6H 3C6SB 2ADFH 4FQ1L 3MACH 4J4PA 3BD5A 1Q0YH 4MNQE 5I76A 2WWMC 5D71H 4TUKH 2HMID 5T33H 2O5XL 4L9LB 4JG0L 2HKHL 3BESR 1MCSA 5AEAA 1N0XL 4X99B 2P43B 4K8RD 1IAIL 3QIUC 3SDXA 1CDYA 4RRPG 2C3HA 1OARL 4Z7UE 2PO6D 4F7MB 1BX2B 1U36A 2BMKA 1T1YA 4LP4A 1KTDB 4I1NB 4FN0A 4PJFB 3ISWA 4P3CH 4CAGA 3OZ9L 4YFEA 1PQZB 5C0JA 1RIVH 3QO0A 3WIIH 1PEZA 3G6DH 2FHFA 3LD8B 4YO0B 1RHHB 4OGXL 5DT1H 3EW3B 1TVDA 4DN4L 3DUSB 1NBZB 1JTOA 3HI6H 1A2YB 1BQSA 2XWJB 3H9SE 3QCUH 1A0QL 1PG7X 5KSBB 2MQ3A 1K6QH 5EOQH 3P4NA 1IAII 3UTQA 1DBJL 1UA6H 4XHJC 3PP4L 1TMCB 2OMBA 4WU5B 3K81A 4JQIH 4YDKH 3VFTB 4KK6C 2D31B 2ARJA 2VTFA 4ZPVB 1FH5H 1CICC 5LGHH 4G7YL 1NLBH 3IDJA 1KEML 3O4LD 4XNUH 1KXVC 3KYOB 4GRWH 3KPMB 2R2CA 5C09B 1RU9L 4LHUB 4EEEA 1ED3A 3QI9D 1JPSL 2LE9A 2ZUVA 2BJMH 2E3VA 4P59H 2DJ4A 2OZ4L 5IHZA 3HPJA 3WJLC 2MCPH 1FVDA 3FRPG 3S36L 1J1XL 5I1CL 4Q9BA 4NZUL 4WV1C 1FIGH 1JNLH 5C2UB 1YPZF 2B4CL 4X4ZA 3BSZL 4MJ6A 5GGTA 4MNQB 2OTUB 1GC1H 3PL6A 2G75A 4LSSL 3AAZB 1S3KH 2NY6C 5DJYA 5BJTA 1HINL 1BFOB 4WCYH 4M7KL 3ECBB 4YZFE 1A5FH 3RGVB 3TBTA 1CF8L 5JORB 3V0AC 5I2IB 1LD9A 2BOCA 3RNKB 4EDWH 5I74B 2R0KL 4OM0L 3SGEI 2FB4H 1QRNA 1KTLB 5E94B 1CGSL 2D7QA 5JNYA 5IM7A 3BKCH 5HI5D 1CE1H 3EDJA 4K3DL 1U92A 1DBBH 1F4WH 4KTEH 1GGBL 1J1PL 1AY1H 5D1ZB 5C3LD 3H3KA 5AAWA 3GMMB 2IPTH 5DA0B 2IH3A 4QNPF 1C12B 1K5NA 2VDPH 1WITA 2AABH 4I0PD 1HHGA 4U1NB 5DEFA 3MV8D 5F9OL 1NC2A 3ZE2F 1UWXK 3O3EA 3SDDA 2WUCH 3V6OE 3QA3A 4PB9H 3MCKA 5J0BA 1A7BA 3QJHB 1RJYB 2JCCF 2IFGA 1JK8B 2Q7NA 4U1IB 1KLUA 1YY8A 2HVKB 3NFPB 3SGJC 3CU7A 4YHNA 4U6HB 3I6GB 3TO2A 4L1HA 5TE6L 4F8QA 3C2AL 4K9EL 1JHTA 2VO5A 1YEHL 3IVKA 5ANMA 2X7LA 2QSCL 4OT1H 2HFFA 4PJEF 5DJ0B 3C08L 3VXSA 4KVNL 3SGDH 3AS3A 4TSAL 5HHQB 2GSIB 3S88L 4LARL 3BKYL 1SMAA 1F8TH 4HGKC 3NTCL 4LLQB 4OCSH 4X8XA 4OZIE 5D9SB 5F9WC 4NUJA 4X6CF 3DROA 2V2XB 4KJWC 5TE7H 2JIXD 4PIRF 2P49B 4NQEA 3O4LE 1YNKH 5F3HB 1X5KA 3C09B 3K8KA 1WZMA 3LN4A 5KN5A 3EYFA 1QSFA 1T0NA 4PJHB 5B39B 2VL5B 2XWTA 2V9QA 4QCIA 2IH1B 5D7KE 1XGYL 4K3EH 2NY2B 1S7SB 3QFJB 4NQCD 1AO7A 4Q97A 3FZUD 3EYSL 2O61A 3FB6A 4M48L 5C0GB 4F58L 5BZWB 2D0HA 4J12A 4RAUB 1B90A 3MTRA 2F8XC 4NRXB 4G6AD 4PJIB 2VERN 5E2VL 2BXZA 3FOMA 4NFCA 1AI1H 2CGRH 4M3JA 3MOQA 5JHDE 4HFUL 3BZEA 5GGTL 5J1TC 4NNYB 4OGYH 3JTSB 3AREA 4S1SL 4KMTH 1KB9J 3GRWH 5JW5A 4C83A 3K1KC 4FQXD 1Q9OA 4G6MH 4B0MM 1F4YL 3P9LB 3UPRB 4UOW1 3OKEB 3M1BB 4AJ0A 2PO6B 3RVUC 1B9ZA 3W9EB 2AJZA 1IC5H 4KGLA 5F8RC 5DK0B 2Y06H 4MQTB 4X98A 4GXVL 3QUKB 4LRIA 4DW2L 4FQQB 3NIGF 1HIML 1NFDA 1FORH 1HHIB 1I3RB 3L3JB 2IG2H 2E8YA 1MSPA 1S9VA 3TVMD 5F6IC 4U7MA 2AJYH 4LFHD 2ENYA 1P7KB 4WRLA 2CXGA 2NPLX 2IQAA 5E6IA 3SDCC 3MV8E 4EQ3A 4U2YA 2R8SL 4I3RH 1X5LA 1E4JA 4PJDF 1KFAH 5A43C 1G7LA 4FQIL 3O3AB 2IEPA 5HVGB 1Q8MA 3VXQB 5A16A 4LSRL 4Z78B 2BERA 3D39E 1CDJA 4D8PB 4ZOCA 4GW1B 4LSVL 3IRPX 4G6FB 4EI5C 4OD1L 4P57B 1FVEA 2FX7H 3VWJC 4G9FA 2GTWA 3TIDA 1HXMA 4YHPB 3TNMB 3O4LB 3K74B 4ZTPH 5T3ZE 4PP1C 1TNNA 5D7LA 4OCNC 1Q9KB 3O8XC 3AY4C 3FQWB 3QI9B 4ZAKA 1MIML 4KKAD 1BVLB 1NGYA 4L1DA 4BSWA 4HJGA 2W60B 2VNCA 1UWEH 2DI7A 1J11A 3GM0A 1OTTD 3GIZL 5HGDB 4N5ED 1R5VB 1CT8A 5B21A 4GKSA 1Q72L 2N7BA 3GIVB 5IK3A 4JPIA 1S9WA 1A4KB 2ED7A 1C5DB 3M17A 3WXVL 4NKIL 4Z7WE 1JZ2A 2OK0L 2LU3A 5GJTL 2X1WL 2VB5A 1HYRC 2VR9A 4NWUL 3CX5K 4DAGH 4QHUB 2NX5A 43CAA 1GL4B 1FNFA 4TSCL 4E41A 32C2A 4GW4A 1BIIB 1AKJA 3LHPH 4MHHG 3ET9F 4LVNC 2WQ8A 1Q0XL 2HRLA 3T3ME 3TYGH 5F6HJ 1RUKH 3QPQC 2J8HA 3QEHB 4QEGA 4JRYD 4UTBH 1TFHA 2Z8RA 1KPVA 3UP1A 1YC8A 5FO8B 3SO3B 4Y4HD 4MA3B 3W81A 3D9AH 4OZFA 1IC4H 3V4PH 4AH2B 3LPFA 4HIIA 5I8CA 2H1PL 1HI6A 1HQRB 3QDGA 5EU6E 4R90H 2CRIA 4MXWL 5HYQB 1I9RL 4QRTA 1FDLL 1KN2H 2A38A 4G8GE 4I0PB 2Z93B 3EHBD 1U8QB 2HLFD 3T65A 1KG0A 2VZVA 3MV8B 1RURL 4J4PD 2G9HA 5E8DL 3T0DA 1FL5A 3EYQD 4Y2DA 3BZFA 1WT5A 2JF1A 5GRJL 2Y7QA 5I1IL 3BGMB 4FXGB 5IR1A 2FJHB 2PN5A 1BWMA 3UXFA 2CUHA 3PHSA 5BRZE 5CEXB 1Q94A 3BZDA 2NZ9D 2P48B 4IMKA 3DLQR 3ILQC 3O9WC 3U4AA 3CXDH 4HF5H 1JNNH 3MSPA 3VI3E 5MEOA 3MXVH 5K33A 4CNIB 2AJ3B 4LVOC 3MLWL 4CADB 3D87B 5K9KA 3GSNL 1ZLVK 2D4DA 4MB4A 4ZUSB 2KQNA 2PR4L 2VXUL 1CE6B 4X4MA 3W11D 2JIXB 3OKKA 1MCOL 2XPGA 4XHQA 1OAQH 4JPKH 2YN5A 4HWZB 3WDJA 4WO4A 4JZOA 3VFGL 3BN3B 5KG9B 5I73B 1EHLH 1T7WA 2XA3A 1DUZB 4NN6C 5D8JL 4R0LB 5HHPB 3HUJB 3TIEA 1FNAA 2YD8A 1NCCL 4NQCB 5D7SL 1DQMH 5H35A 5IMMA 1FFQA 3RQ3A 1MJ7L 1AGEA 1F3DH 3TBVB 3PABA 1I85A 5GRUH 1CS6A 1I9IL 2DWDB 3SQBA 4NKMB 2SEBA 4C59B 2O93L 1EVTC 4KV5E 3U83A 1FO0A 2F5AH 5GHWL 1K9TA 3HNSL 3BHBA 3RTQC 3RU8H 1T3FB 5HGHA 3VDCA 1LO2H 3WE6A 1SJEB 1LO0H 1DJSA 2C3XA 5CJOH 4NZRH 4XXDA 1HHKB 4FQXB 4S10A 4UT6L 3RL1B 2Z91A 5EN2A 1YEDA 3EO1B 3QR2A 1AXTH 5FB8B 4JZNB 4LEOB 3RUGE 5E6YA 1BGXH 1CDHA 3D0LB 3H3PH 1BIHA 4XI5D 3S5LA 4WEBL 4M02A 1MY5A 3KNBA 4DQOH 3CFEB 4JREB 3UDWA 5F8QC 2ARWA 3OMZA 3GUTA 2D0GA 1AHWB 5LGKA 1HILA 5IBTL 2XKNA 4IJ3C 1MCEA 1QPXA 1L6ZA 3GMQB 3M8OL 2J88L 4XVUC 2Y1VA 3O2VH 3PL6D 4JJ5A 3TVMB 5EOCL 2I07A 3B2UD 4TOYL 3FRPA 2WIIB 3VMPA 1VGEH 4Q9QH 5DEGA 4AY0A 1EBAA 2E9WA 5T1DL 1QRND 2CIKB 4PRDA 3QQNA 2R1WA 5ICXB 3UPAA 3GSQB 1VFAA 1F90L 1LK2B 2R4RH 1J8HE 5T1MA 2KH2B 3FB7B 2YXFA 3NH7H 3BPOB 5FUZL 2R23B 3MR9B 3RWEB 5EU3B 3BKJH 3I02A 5E8OA 3K0WA 3GMRA 5DWUH 3CNKA 5E1AB 1S7RA 1KJMB 5D5MA 3V4VL 4ZSOE 4PBWD 1EO7A 1QP1A 3CFBB 1E0OB 1WEJH 1NC2D 1XR8B 2FZ3B 3QZWB 4JN2B 4NC1C 4YDVA 1KACB 3RWJA 2CRZA 3SDDD 3X12A 3ZDYF 1T66D 2CK0H 2NNAB 5EIIA 5DVOA 1F3JA 4HMEA 4JO1L 1NCAL 1FC2D 3HI1A 2EH8L 4I9WD 1MCKA 2PKDA 5CGMA 4Y5VB 4YGVB 2QHRH 5GIRB 4QRUA 4X6DB 5I1JH 2VXTH 1S7TA 1F2XK 3QAZC 3VXSD 4HIJA 5D7IF 4U33A 3VFMB 4PGEA 2M2DA 4JY5H 5E4EB 3D25A 4NUGL 4HCRH 3UBXG 4LLYA 5FGBC 4IBLT 3O3DA 4Z0BL 5DK2A 2ZJSL 2LU7A 5HDLA 1ND0B 1IMHC 1T21B 4G6JH 4HUWA 4UQ2B 5L6YH 3RWHB 3U1SL 4MDIA 5IEKA 4JRYB 4NBYB 4NQED 1FO0L 2Y5EA 4F2MB 3THMH 3ULVH 4HW6A 5JLZB 5MP6H 4Y4HB 3RX8A 3KXFE