1TEGA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 A and 1.96 A resolution, respectively.
rcsb
source organism Spinacia oleracea
molecule tags Photosynthesis
molecule keywords Plastocyanin, chloroplast
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tegA00
4GYBA 3CVCA 5F7AA 4FA7B 4Q8BA 4AX3A 4KOBA 5B1BB 3C75A 1GY1A 2VM4A 4NAJA 3NJLA 4K9JA 4A2HA 1JOIA 1XB8A 1N70A 5I6PA 2EINB 3ZIYA 1J9SA 2IDSA 2MRYA 1RCYA 4BXVA 1VLXA 1KBWA 3NSYA 2QPEB 4KNUA 4N4YB 3QJRB 1BQRA 3QJUB 2DV6A 4Q89A 2ZWNA 3SBRA 1NICA 3FQYA 2XVBA 1E67A 2TSAA 2HXAA 1ZPUA 2FQDA 1A4AA 2YAOA 1PY0A 1V54B 3EHBB 7PCYA 1NIDA 1KCBA 1ASPA 4CSPA 8PAZA 3IN2A 3HEIB 5I26A 1PLBA 3NP3A 3H4HA 3HB3B 4DP6X 4JKNA 5I6OA 2DWTA 2WO2B 1FA4A 2YARA 2IWFA 1QLEB 5A7EA 2XX1A 4F7KA 1J9QA 2Q5BA 2FJSA 3PXLA 4HIPA 4KO7A 1V10A 2FT8A 3QJQB 2YAHA 1OCZB 4YSRA 2IAAC 2BZCA 5E9NA 4GP5B 1ET8A 1EZLA 3GYRA 3NP4A 1AZUA 1WA0X 2HRHA 4L0PB 2R7EA 4BK5C 1NINA 2PP8A 2HX8A 9PCYA 3TU6A 4HCGA 4F2EA 1M56B 2MTAA 1QNIA 3PAZA 1BXUA 5F7BA 2PPAA 4JHUA 1UATA 2UX7A 2XV2A 1PLAA 3KW8A 4DP1X 1ZIBA 1OCCB 2W88A 3ASNB 3UACA 5B7FA 1PF3A 2PPFA 2BW5A 2PPEA 3X1NA 4UAHA 2RACA 1KBVA 4NERA 2A3TA 3NYKA 2YAPA 1ETJA 3JTBA 1SNRA 1WAEA 1A4CA 2BO0A 4AKOA 4BDVA 4DP7X 1AG6A 4X4KA 4DP2X 6PAZA 3WG7B 1E5YA 4PCYA 2EIJB 4W1TA 3T6XA 4DPAX 4P5SA 2B3IA 4A66A 3QJTB 1OOWA 1IUZA 3OD3A 1SFHA 5AFAA 2I7SA 5D4JA 3CVBA 3PLYA 3QJVB 1A65A 1M57B 1JERA 1URIA 2H47C 3TBCA 1DYZA 4A2DA 4A2EA 4AKQA 3FU7A 5B1JC 1AOZA 3FYIB 1CYXA 4E9QA 2PCFA 4BWWA 2R7EB 1W8EA 3IEAA 3ZX1A 2WSDA 1TEGA 1JXGA 3NJJA 2FQEA 4E9XA 5B7EA 2Y1AA 5TK2A 1SHWA 1AS8A 4YSPA 4YSOA 3CG8A 3N55A 2DY2A 3AG1B 3X2QB 4YSSA 2J5WA 3T9WA 5B3SB 4DP0X 5I6NA 2PPDA 5B7MA 2YAQA 4MFHA 2J55A 1JVOA 4YL4A 1NTDA 1T5KA 2GI0A 1AIZA 1BEXA 1JZFA 3FPXA 4F2FA 1PLCA 1OE3A 3V9CA 5B1KA 1AACA 1DZ0A 1CURA 2GC7C 1GS7A 1SFDA 1PZCA 1XB6A 5IY5B 1KV7A 3EF4A 1SHXA 1X9UA 3FT0A 1EHKB 2GIMA 3CDZA 5FC9A 1NPNA 2GB2A 3NJMA 2OCCB 2X87A 2OJ1A 1F56A 3EH4B 3FU8A 2VM3A 2N0MA 1YLBB 1AS7A 2IH8A 4NB7A 1E5ZA 2FT6A 1ZDQA 1BQKA 1GS6X 4HCIA 4A2FA 2EIKB 1J9TA 1MDAA 3RYMA 1TKWA 4G70B 4GXFA 2FNWA 1RKRA 3TBBA 2VSMB 1L9PA 1ZV2A 3WIAA 2IDUA 2GHZA 2PP7A 5TK4A 4HZ1A 1PZAA 2XXFA 4JHVA 2FQFA 5I5IA 1J5CA 1KCWA 1GR7A 1HFUA 3FS9A 4DP4X 4N8UA 2FWLB 5B1JA 3ZDWA 3FPYA 4E9WA 1BYOA 5AZUA 1JZJA 2CUAA 2QPDB 3S3BB 2XYBA 3IE9A 3WI9A 4AI7A 2BP8A 2VW4A 5I6MA 2AVFA 2UXVA 1PCSA 3OMNB 4W9ZA 2Q9OA 2H3XC 3ABKB 1KDJA 4ENZA 1TEFA 5I6LA 4BDVB 4PAZA 1AR1B 2HZHA 2BZ7A 5D4IA 2IDFA 1V55B 3S3CB 3X1GA 4DPCX 1ZIAA 1GSKA 2LLNA 3FSZA 4KNSA 4DP8X 2QT6A 1ZDSA 1L9RA 2GC4C 2VW7A 4KO5A 4A67A 3CDZB 1J9RA 1SF3A 4GY4A 4BWUA 4GP8B 2IWKA 2EILB 3PAUA 1ASOA 3FU9A 3X1FA 2DYRB 4M4RB 4A2GA 2ZXWB 3IBOA 3FSWA 2YAFA 3FYEB 1BXAA 3WNJA 1CUOA 3JT2A 5B1AB 2PPCA 2IDQA 2VMJA 3N2JA 1MZZA 3D12B 4YSDA 2VN3A 1J5DA 1PMYA 1I53A 3PPSA 2YAMA 2H5UA 3H4FA 4DP9X 3OMAB 1JVLA 5D4HA 3SQRA 5LDUA 3WKPA 1FFTB 3BVDB 1GS8A 3AG3B 1SDDB 4E9RA 1NZRA 2E86A 1L9QA 3EH5B 1WA2X 2W8CA 3FSVA 3V9EA 4TXVB 2I85A 1OCRB 2CJ3A 4YSAA 5EHFA 2BHFA 2CCWA 3H56A 3DTUB 1AANA 1AZCA 2DYSB 1CC3A 1MG3C 2AZAA 1JZIA 4G71B 3CZUB 2X88A 1AZNA 3KW7A 4HHWA 1PNDA 1JZHA 1NIEA 2JKWA 6PCYA 4ZK8A 1MG2C 3NJGA 1SF5A 2DWSA 2B08A 3ABMB 3CVDA 3X1BA 2P80D 3GDCA 4YVNA 2HX9A 2BP0A 2EIMB 3TASA 1BAWA 1AQ8A 2TSBA 3PAVA 3T71A 1NIBA 4QKTA 4KNTA 2AANA 4E9TA 1R1CA 4E9VA 4AZUA 3TA4D 1HAWA 3ERXA 7PAZA 1L9SA 1W6LA 4BXSV 3EH3B 1OCOB 2BW4A 3ASOB 1ILSA 4G72B 1HAUA 4WKXA 4YVUA 1CYWA 3NSFA 3WKQA 5I28A 3G5WA 3AZUA 1WS8A 1AZRA 2XX0A 3WNIA 2JFCA 3ABGA 2NRDA 1IKOP 1FWXA 2YXVA 2BP8B 3UADA 3AG4B 1B3IA 3AW5A 2YXWA 2J57A 3FQ2A 2XLLA 1E65A 3ABLB 3ZBMA 1GW0A 2HLEB 2P80A 3AG2B 1IBYA 3T6VA 4YSCA 3FSAA 4EF3A 4HALA 3UABA 2Y69B 2OV0A 3T6WA 1M9WA 3SBPA 1KDIA 2XV0A 1ASQA 2QDVA 4DPBX 1BQ5A 1W6WA 1L9OA 1L9TA 2HRGA 4AKPA 2AZUA 4KO9A 4DP5X 4CSZA 1OV8A 2BWDA 2XUWA 3NSDA 4YSTA 3DKHA 2UXFA 1WS7A 4YSEA 4QLWA 1JXFA 3FQ1A 2CBPA 3NJFA 3UAEA 1OE2A 3OQRA 1OF0A 2ZONA 4FAAB 3OM3B 4HCFA 2VSKB 2GSMB 1SJMA 4KO6A 1X9RA 2AFNA 1KGYE 2YQBA 3MX0B 4E9YA 1A4BA 1NIAA 2PP9A 3DIVA 3NSCA 2UX6A 5ANHA 2JXMA 3U25A 2GBAA 4HAKA 2UXGA 1TU2A 1SDDA 2XU9A 4P5RA 1MZYA 4M3HA 1BXVA 2IWEA 1NWOA 1AAJA 2CALA 1NDTA 3OMIB 3X1EA 4KOCA 3QPKA 4G7QB 1ET5A 1JZGA 3NJKA 1A3ZA 4YSQA 2WO3B 1JXDA 3QQXA 1PNCA 1OE1A 1RZPA 3NJIA 2VW6A 1AG0A 1BYPA 1PZBA 2PLTA 2FTAA 4YSUA 3NJHA 5I5JA 1WA1X 2YAEA 3S8FB 1ET7A 3NT0A 1QHQA 4WTQA 1KYAA 4E9SA 3PCYA 3S8GB 3L45A 1NPJA 4HHGA 1ID2A 2XXGA 2XV3A 3UAAA 2FQGA 5I6KA 1GYCA 4UF7C 3QJSB 4BWTA 4G7SB 2ZOOA 2J56A 3AY2A 3NJNA 1E30A 1N68A 3MBWB 3T6ZA 2UXTA 1IBZA 1ADWA 3UGEA 2FT7A 2PCYA 1A8ZA 3GXUB 2BP0B 1NIFA 4GP4B 5I5MA 3SBQA 4G7RB 4A68A 1AS6A 3BQVA 2XWZA 2HX7A 2IH9A 1ILUA 2I7OA 5PCYA 5AKRA 5PAZA 4UANA 1JZEA 2BWIA 1AZBA 1RZQA 1NWPA 1GY2A 1IC0A 3IN0A 4RH4A 1XMEB 2IDTA 3FU7B 2CAKA 3S3DB 2QDWA 1XB3A 1PAZA
chains in the Genus database with same CATH superfamily
3P11L 1T1WB 4KKLD 1RK1A 1TUPA 3TBSA 5K69A 3NJLA 1R46A 3EBHA 3RNQB 4XZUA 3FONB 1JIBA 1OGSA 2EINB 4MNHA 5IF0A 1E4XI 4ZDHB 1IC7L 2ICES 4KRMB 4M43H 4H0HB 4MD4B 4G8GA 1QVOB 5DHYA 1MVFA 3K2MC 1H8NA 4Q2ZA 5T1DL 4BCYA 1RMFH 2ZWNA 3O2VL 2H9GA 5GS0D 3BPCB 1HH9A 2IG2H 3VFGH 2CXGA 2LV4A 2I07B 2TSAA 1JDDA 2F7OA 3FT4A 2WXNA 3CVHH 2VC2L 2BNUA 4YHLH 1Z1WA 3Q7JA 5H37G 3HZYB 5INCA 4J12A 5IVNA 1VFOA 4NQQA 1U8MB 2YJQA 4AWJC 1PLBA 4Q6KA 5MEPA 4DP6X 3S5LG 3WIIH 1JUFB 4I4WA 1RUPH 2Y9RT 3EYOA 5T3ZL 4NO3A 5JORA 3FH8A 4MZIA 2Q5BA 1OALA 4GAGH 4MAZA 2WKLA 4RGNB 3KE0A 1XEDA 1DVQA 3B6SA 1IEBA 1TJIH 3DSNA 1A1NA 3LB6D 2HVBA 4HIPA 3BKCL 3KBHE 4MDIB 4OLVL 2VOTA 3B34A 4YSRA 5KSAB 3TA3A 1CGTA 3DSFH 3LH9A 1KGXA 1RURH 4GP5B 3UBXG 1EXGA 4L8SC 3VA6A 3VSVA 5JXEC 5HVFB 1FYTB 3NIGE 1T6WA 3ZYJA 2D4DA 2ICEC 4L1BA 4DF9A 2COVD 5E4EB 3HZKA 3V4PA 1AIFB 1BYNA 4F1ZA 1D5ZB 4FQXB 3ZMRA 3FO2B 3BSHA 5DVOA 1S9KC 4FEMA 2L7UA 2NY0D 4NO0A 5K9KA 3D85D 5MEQA 3MRMB 1ZGLA 1R75A 2P28B 4EQ3A 5I16A 2DQDL 3UYRL 5HYJB 2P3YA 1G9MH 4W9KC 5FKAA 3S0PA 3I50L 1KCUL 4WKZA 4DOHB 1ETJA 4I1PA 3GUFA 4N2CA 4PRBA 4JQXA 4ZX4A 4XTRC 2P5WA 3MJWA 4PV1C 1LGVA 1YMMB 4IKNA 4JANA 1KFGA 3MXWH 1DN0B 3QS3A 1WH0A 2B3IA 1AGEA 1NGPL 4ZS7H 5IQ7H 5MEOB 5LBSL 2LLLA 3O45A 4J8RB 4ZPVA 3OD3A 1SFHA 4X6CB 3UJIL 3VU1A 5AB0A 1OTTD 2QMKA 3WFDH 2H47C 1JERA 1FCCA 3PNRB 4NP9A 4FQIL 3L95A 1CU4L 2OLDA 4JRYD 3QDMB 2OMUA 3BN3B 4AKQA 4ZW6A 4Z23A 1MI5B 4CAGA 4FJYA 2EDRA 3VXQA 4HXAH 4LSVH 4ICWA 1XZWA 2NZIA 2JIXB 3TBYB 1IV8A 5AW4B 3ZPDA 1SJEA 5F71A 3U7AA 4X9FA 4YHNB 4Y5YC 2JQMA 3N1MC 1AD9A 1OAQH 1QBAA 4FG6D 3QEUA 3ME0B 4K4KA 2G2NA 4Y19B 5C8JA 1XCWA 2HLAA 4XBPA 3IXTA 3IFOA 3OAYH 1NPUA 4Q56A 4YBQD 3M1BB 1QEXA 2HKAA 3FFOA 1P7HL 3BEVA 3R18A 3CG8A 3E0GA 5FUCC 2J5WA 4A6YB 5F8QC 1A6AB 2X0WA 3X12A 5KYYA 3V4UH 4I9XA 2JELH 4D3CH 1KG0A 4WEEA 2AXJA 4MJIE 4MFHA 5E9DD 4FZ8H 5JR1L 4CVXB 5I1CH 5DHVB 4FL4B 2GIYA 2F7RA 4F2FA 3TM6A 3F6IA 5CS7A 4JM4H 3MOAH 1ZT1B 5JPNA 4IOIA 4ZOCA 1KXHA 4BFIA 1SFDA 1DBBL 4HXBL 4G6KH 3QIUA 2JQAA 3QRGH 4UUJA 3DPBB 4DEPC 1E9OA 1EHLL 1U8QB 4LCYB 3HNSH 3H2QA 2Y7NA 3T65B 4MHHI 2OJ1A 1F56A 2HVKB 4Y5XB 1I1CA 5A6LA 2N0MA 2DI8A 2OJZH 4KVCL 4MRCA 5HVHB 5J06A 1FNSL 1MRDL 4WWKA 3HN3A 2HKFL 4EOWH 1P7QA 4HCRH 4Y5VC 1V3MA 3ZKXC 3D4CA 1V7NH 4XB3A 5ETUA 5G55A 5IGXL 1NAKH 1O5PA 4OFYD 1NMCB 2FZ3B 4PP1C 2E3VA 2NXYB 2YA2A 4JUTA 4NKDB 4P46B 1WBYB 4HF5H 4R2GC 4R0LA 4Y2DC 5C07D 1E5CA 1T1XA 4Y2OB 3KLDA 1IC1A 1IIKA 3IMVA 5FYKE 4UDTA 5AOMA 2R4RL 5D2NB 5BW7A 2GUOA 5CCGE 1JWUB 4NRYB 2ZYHA 5D9SA 3EBAA 1C12B 4UDUA 1YQ2A 1E4XH 4HLZH 3S3BB 4K3GA 3WELA 4S2SA 4KV5E 2AKRB 3WY2A 3LAFA 3GXFA 3D06A 2OZ4L 4S2SB 5EN2A 1QFPA 1SYSB 1N7MH 5FKAB 5DQJA 4X6CF 2CLVA 5IFHH 4BZ1L 4P5MA 2QKSA 3LS4H 1TEFA 5C0BD 3OG6B 3FO1A 4YGVB 2X2IA 1W72H 4XP6H 1XGUB 3FH5A 2EUXA 5ISZA 2WUCH 1PZSA 3ULUL 3X1GA 2WXLA 3QK0A 2NSMA 1CLYL 4P46A 5FYLH 4UB0L 4ZPVB 3WNPA 5JIDA 3VD0A 4FNRA 4QXUL 1PS3A 1UXLA 2NY6D 3HZKB 1WC7A 2AITA 4RQQA 2NXZD 1BECA 1WFTA 3TPKA 3R4DA 1IM9B 1Q1JL 3EO9H 4O58H 1CIUA 1BQHG 2OMTB 4RDQG 3RLSA 5LGYA 4U7KA 1R47A 2R9HD 2NZ9D 3T3PF 3KWWB 2VMJA 4PRNB 5FHAH 2EH8L 4LPXA 3KL3A 4U1SB 5GGSY 4AK1A 2ARJQ 1F4YH 5T5FL 4MNQE 3DXAB 4DEPB 3F8UB 3RZCB 4JO8A 3F05A 5I9QC 4Q52A 4FA6A 1EEZA 4LGRB 2D9QB 3BVTA 5EZLB 1U8JA 3UG3A 3V6OA 2DW5A 1ORQA 5L0QC 3S96A 2BPBA 2D9CA 4UTCA 4CA4A 5D2LF 1KIQB 1FNSH 1PYWB 2G9HA 1H15A 4PJHA 2G9HB 4AL8H 4BUGA 5GGTH 3HC0B 4JFHE 3O9WB 4A7SA 4M61A 3MUGA 1EFXD 2ATPB 3AS0A 4NPYB 3CHRA 4XMLL 1MFVA 5EBMA 4RZCB 4XN5A 1JZIA 1TJMA 2P8MB 4TL4A 1FE8H 4ZX6A 4HHWA 4AC2A 4IK7A 3LHAA 2XY1A 4U1SA 4LSPL 3OKLA 5DC2A 1OM9A 5C09E 3SO3B 3LQAL 5A1AA 4WW2C 1VFAB 5F0LB 3CU7A 2R4SL 1H9DA 1AD9B 4HFUH 5AVSB 2GTWB 5C0CB 4M93B 2JKLA 4TLSA 4ETQB 2DBLH 3BD5A 3L2NA 2ZF9A 4GBXA 1ZV9A 3KLQA 3L3GB 4PS3A 4AM0A 3UP6A 1VIWA 5ERWA 5GGRB 3HAEH 3GJEB 3ZT6A 5KYWB 1C9SA 4IBWA 2R23B 4G6MH 3W9EB 3K6FA 4YPGB 1QFWL 5ACZB 3G6DH 4KFZC 3UZEA 2PXYD 3F7PC 1CFMA 1WRFA 4F27A 2EDHA 3QA3B 2H26A 1DVUA 5KWYC 3PJNA 4G7VL 1AZRA 2XX0A 4XNXH 3MLPA 1XIWB 4FYTA 3MNWA 3IDXL 4RRPG 3IRCA 5D7JD 4XPGH 5CJ5A 3C2SA 4HAGA 3K2IA 2CUHA 2YXWA 2V2XA 2ROXA 3BP6A 1ODUA 3IDMA 3CIQA 1NM4A 4OCWH 4PTTA 2ADFH 4Y2DD 3QWRD 3WO3B 3SBPA 1MW3A 1ZLSL 2IQ9H 3E2HB 4W70A 1S7RB 4TSBH 2J8HA 2QVFB 4LASH 4LLQB 3NCWA 5HDWA 3V4PL 4PY8I 4DP5X 5T3XE 5IVXB 1I8KB 4LCWB 3QC5X 1OKEA 4OSUL 1VFAA 3CX2A 2GFBA 4XP4L 2XRAH 4RAVA 4A2LA 1JXFA 1QZNA 3APMA 3QG7L 5DQ9B 2A2QT 4Z7QB 1KT2A 1GA2A 3MRLB 4L3CA 3HJEA 4IBYA 3L9RB 2NNFA 2XN2A 1OF0A 3HG1E 4NQCD 2CMRH 1ZKAA 2HPOA 4QRQB 1UYWL 4JPWL 1OGAD 2EYRA 5CJOH 5GGQL 1NGQH 2BVPA 3MROB 2H0JA 1TVHA 1AY1L 3MRFA 4MJ5A 4AYID 5JHLH 1FNHA 1CTMA 1F4AA 1OF2B 2N7SA 4E36A 2NSXA 2PP9A 4JFQB 1I9JL 4OLZH 4BFKA 5INDB 1MFDL 4JR9H 4XC1L 1NBZA 3RE0A 5SWQB 4GKZA 2CKBL 4LDOB 3RZCC 4WGVB 3WY4A 8CGTA 1FV1B 2MOGA 1T1YB 2YQ3A 1QX1A 4HWEL 5IESH 5GRJH 2E27H 4FG2A 1C08A 1HINH 4YQXH 2BHYA 3QQXA 5DQDH 5FGCB 4HK0A 3S96B 1NCAH 4D9QD 4AMKL 5G5DB 3K2UH 1N8ZB 5JW5B 4ZAKC 5EO0B 1XH2A 4TSAL 3TN0A 1QHQA 1RL1A 2UY7B 5CN2A 1URLA 3MODH 1IAOB 3MLWH 4V1DB 5E94B 3KPLB 3V2AR 1GYCA 3BRFA 5C0AA 5BVPL 3RTQC 2ZOOA 1CQYA 3NA9H 5AW7B 4EZMA 4XVTH 2H0PA 1OTTC 2XVLA 1KB3A 4ETQA 2YOCA 3GT6A 3KAAA 3QDJA 3WE6B 2I24N 1OP5H 4PJEE 3ULSB 1LK2B 1ZA6B 1IC5H 3ECBA 3AS2A 1ILUA 1NCNA 3UBGA 3V5HA 1A6VH 1YEHH 2P5WD 2JJWA 3ABZA 3IYLW 5FK9A 3LN5B 4DVRH 3U6XS 1AZBA 2AJ3A 3PDOB 4N9GA 2GVYA 2ADGB 4N9GB 5LUMA 2AK4D 3LH8A 4IU2A 4X0NA 4M7ZC 5DEJA 5D1QE 4JZJB 1YJDC 3FDWA 1TYRA 4HS3B 4IKJA 2ZX8A 3EYUL 2IBZX 2MCG1 4Q8BA 3SOBH 4G8EB 3CFMA 3FU3A 1IKNA 2E74C 2X2HA 3KD4A 5AAWC 5GGQH 5IEHA 5FFGA 4K5LA 2MCPL 3CZGA 1XB8A 2NY0C 2AJXL 2VABB 3A24A 1P2CA 5F0MB 3BD4A 1J9SA 1YHPA 5DK2A 3VGDA 1DANT 1VLXA 2O5ZL 4GLRH 2QPEB 2W65B 3VRLF 4XPTL 3WFCL 1MFDH 4JR9L 5CMAB 1NICA 3L3OB 2E8YA 1M9SA 5DFVD 5GRYA 1F41A 1IAOA 4HJSA 3S34L 2RTTA 1A64A 1M3JA 1UUNA 4IBLT 4N0FB 1YNKH 4GUPB 4P07A 3FQXB 1KB5L 4YDIL 3MV8A 3PY9A 4FADA 1ECYA 4ZW3A 1WDAA 2I60L 4Z3FA 4YDKH 3S4SG 1X9QA 1U8LB 5C1MB 4GKNA 3IAGC 5C08D 3CFBA 1U8LA 3CXHK 3F7LA 3UG5A 4OD1H 3VXMA 2F5AH 1UADC 4HUWA 2CGRH 1WT5C 5C6PB 1KELH 3SGDI 2BVTA 4G6AD 1BXXA 2C1OA 2F58L 2YPLD 1EDQA 4YXKL 3QFDB 1BZ7A 2CO7A 1KXVA 1ZLWH 1KIUA 4QCIB 2CO7B 4CSTA 1CK0L 4TVPD 3DHMA 4F9LC 2DLIA 2OULB 1RUAH 1VZHA 1VAHA 2DMGA 3H54A 2C3VA 2VLRE 5GS0C 3LN5A 3REVA 1IGIH 2C34A 3FQRA 5KTEL 2WQSA 5DD1L 2JVUA 1DL7L 4WY7L 4UM9D 2PPAA 2OMZA 5IEKB 2A6JB 2Z92A 4M4RA 3VXUA 1TQSA 3UACA 4AV5A 5LBGA 1CGUA 3HLAA 1P9MC 1JZ6A 3A67L 1P5UB 4G5ZH 5JW4Q 1XSJA 2H8PA 3X1NA 4XZUB 4ZBJA 1MCOL 4OVVA 4FFZL 3NYKA 3VXUE 4YDLB 4Y19A 3BP5B 3LZOA 3ZDZE 5IJBC 2YAPA 5EU4B 3PP4H 4L1SA 5F6HI 5D7KE 2VDQL 1BLIA 2VN5A 2OBGA 3U6XA 4JFOA 3U6RB 4MNQD 4P5SA 3ZE0B 4A66A 1W91A 3QJTB 2FAUA 3B2DC 2OA9A 4J8QA 4I77H 5AW6B 5ADPH 4YN3A 2R0ZH 4ZO9A 1IGJA 1CCZA 3BISA 1YA5A 1M57B 3UYOD 4U2YA 1MREH 3VXNA 3AGVA 4TN9A 5C0NC 3FFCA 4J3UA 4XB8A 4EI5A 4U1HB 3QRBA 5KG9B 1F3JB 1FL3B 4OBSA 5GZOC 3BKJL 1HX0A 2WXQA 3E8UH 1P5UA 1OSEA 1V3LA 2A83B 2Q20A 4P4RA 4X4ME 3TYFB 4J3OC 1SVZA 3V8OA 3BQUA 5ALBH 4FX5A 1E50A 3GKWL 3QFDA 3HMXH 2YK1L 3O3BB 1IFHL 5HVGB 2AV1B 1CLVA 2IH3B 4ODHL 1F90L 5TK2A 1R34A 3CE1A 5DJ6A 1IAIH 5D96C 1USQA 1DE4A 2DQUH 1LMKA 4PSRA 4U33A 5IBUG 3H3PH 2CDEA 4YSSA 5IHZB 3QXDB 4RBPH 1WWAX 1Z9MA 1FFOA 1DDHB 1CXKA 3OGOE 4P2QD 4IU3A 2QJDA 3HFFA 5DJAA 1MCWW 3S48A 1L9NA 4H25A 4AUYA 5B4MD 5D71H 1U33A 1MCPH 2HH0L 2VMDA 4XNQB 2EVHA 1RUAL 4DKTA 4YHNA 1HJCA 1JL8A 2VQ1B 4XNZB 5CEZL 2ZSVB 3ESMA 5T1MB 2IPKA 2VDOL 2VQ1A 2YD9A 1NAML 1LM8V 2NW3A 3WSQL 3TO4A 3E7JA 2YMXL 3V9FA 2A7BA 3S35L 4OKVA 4QWWC 2DQ6A 2EKSB 3FT0A 3KPQB 4RMTA 5BO0D 1KCKA 3GM0A 4I2XB 1JDCA 4I4WB 2GJ6D 3BVNB 5FFOA 3STLB 4PREB 1YLBB 3RI5K 3FUIA 3O6FC 3FUDA 3FO1B 4YGVA 5BUPA 1NGWA 3L8QA 2HMIC 2ADJA 2EIKB 4PV9A 2YUZA 3VXTB 4JANB 5D7IF 5I76A 4G70B 3WIHL 1M7DA 2NYKA 3N1QC 4E9LA 3OC8A 1BWMA 1MFAL 4NZUH 3WEAA 5EORH 3MREA 2JTDA 1OGAE 4K55A 1YEDB 5E8OB 1MCDA 4CJ0A 4I0PA 2ZG2A 5ADOL 2YPVH 2ED7A 1IM9A 3OPZL 4N8VB 2R69H 4B9KC 2P8PA 4ANXA 1UHVA 5LBSA 1AQKH 1YEWA 4X6DE 3FH7A 3PL6D 3L3GA 4J4PD 1QHPA 4AM0B 5IROD 1UM5H 2UVEA 5AZUA 1A5FH 3EUUA 4Z3IA 3E8UL 3DUHA 3D87B 1FGVH 1OSZB 4C47A 2QHRH 4LKXA 1OM3L 3ISYA 3K8KA 1CDYA 3MJ9H 3RVWD 1I7RA 1NFDA 3E3QE 5FOJA 3MNZB 2DKMA 1Q8MA 3BP5A 3PWLB 1XAKA 3HN8A 4P23C 3LHPL 3IPBA 3WD5L 3FUFA 2BM3A 3LEVL 2AXGA 2F08A 4J3OG 4DKFH 3BEWB 2NY5H 4X99B 3UO8B 1IGMH 4X7DC 1PD0A 2AK1L 5E4IA 3FQRB 3UPRA 4JY5L 4ADGA 3UZEC 3QIBB 1SXAA 4O51A 4APXB 3S37H 2ADJB 4OY9A 4M4RB 1Y7VA 3VXUB 2ZXWB 3ZHDA 1RV6X 2XKNB 4MA8L 1G4MA 2BC4B 1CUOA 3C5ZC 3RHWK 1LE5A 4QJ3B 1DVSA 2Y2WA 1BQUA 4YSDA 3R06A 4POZC 4KFMA 1PMYA 1FZMB 5IJDC 4HU2A 2G3NA 5CHNA 5TE4L 3VXTA 1OPOA 2YAMA 3H4FA 2AQ2A 5D1ZI 5F9WC 4O02A 4XP9L 3VFSB 2R2HA 1FH2A 5J1SC 2CNZA 1V3KA 3ARRA 4WNSA 5HJ3A 3O6KL 4QRQA 4ECNA 1ZE3C 1MFMA 2WIIB 2P5WE 2E4FA 1EZVY 1H5BB 1YAZA 5CJXC 3P9LA 1SDDB 1WC7B 4RQQB 4WO4C 1TZ8A 1D5XA 5IMLA 1WA2X 1DO6A 2JI1A 2AHIA 2W8CA 6TAAA 2ZKYA 4AQAB 2FGWH 2K9FB 1OAKH 3C8HA 1LEGB 5KVFL 2KS0A 3H56A 3JT0A 1EO7A 3WNLA 1HYSD 3N85L 4ODVL 1BFVH 4AEHL 2AXGB 4RSVA 1N5YH 1YEIL 2W9DH 4LCIH 2JJUA 4XMXA 3RNKB 1AZNA 4JO2H 2OM5A 1PNDA 4AEEA 4R7XA 5CNHA 3R06B 4HUUB 4L29A 4P3CH 3ZE2E 4HKBB 2NY4D 2QQLH 1HHHB 4EN3D 3KPNB 1GZQA 2IJ0C 3TT3L 4Y1AE 1EGJL 1NFAA 2Z93A 3N42B 5LQBL 1UUSA 5FXCH 4GQRA 5KVDH 3TVMB 4X7TB 4I87A 4K3HA 3ERXA 1Y6MR 3UTSD 3UFIA 5HYSA 3HG3A 4RMVA 3BVVA 1HOCA 2A6DB 4WKXA 3VNYA 4RBPK 3WKQA 1QA9A 2QHLA 3D39D 4AEFA 3I9AA 1NLBL 5AD0A 1YG9A 3WJLA 4V1DE 3ABGA 1P4BH 2AK1H 4JKKA 3F7QA 5HDOA 5CBAA 2D7TL 3M8OH 3NEEA 2GTWA 1U8HA 3QUZA 3BT2L 2ZX7A 3NCEB 5BXFA 3MV8D 3QQ9D 4ZPTB 3AG2B 3S3JA 1N0LA 2OR8A 4AVJA 2VDNL 5FYKH 3HBZA 2HT2D 4EF3A 2XPZA 1HQRA 1WIOA 4HALA 4AQEB 2F74B 3P77B 1M9WA 2YD2A 1S3KH 3C5JA 4LVHB 4XC3H 3TN0D 4ADIA 3CVHL 2WZ6A 3PWLA 2E7LC 4U3SA 1W6WA 5BV7C 1J1OL 3SO3C 5HYSB 5J7CC 4LHUD 4HK0B 4OIBA 5IUSA 1CL7L 1LO4L 4YSEA 3K6SB 2CBPA 1UA3A 4C59B 3QWOA 1G94A 3QUMH 4DIXA 1GMIA 5J9PB 3KGSA 3KNBB 5DUMH 3MLVL 3HR5A 1U95A 3EJRA 2QR0B 3HG1D 1F18A 4IEFB 4WHTA 3MUGB 1ZJAA 2N4IA 1SYVB 4OVUA 2NDGA 1YMME 3PFUA 5ES4B 1TYJA 4IK6A 2EABA 2HB0A 3VFUA 3N85H 3DOHA 1WBZA 4E9YA 5L0QB 3S98A 2YC1A 3LRHA 2R8SL 2YWYA 2CM5A 2I26N 4MA7L 2YSSA 1COBA 2PYEA 4ZTPL 4Z7QE 4JKLA 3VXPB 3EJPA 4OD2B 5A40E 4YAQB 1BBJB 1BXVA 1DEEB 2YGNA 2KZBA 2AEOA 2BCKA 5ICUA 3X1EA 4F7MB 3OR6A 4CVZB 1JGVH 4HG4K 4HPHA 1H3WM 3EGXB 4YK4B 1I8MA 5FUZH 1J88A 4XNMB 1FVEB 4RWHA 1EDYA 1M1SA 2EDOA 3O2DA 4H0GA 4LSQL 3CQFA 1FYTD 5CLTA 2LE9A 3A4FA 2FTAA 3FU6A 3L3OC 1GC1C 2K0RA 2DLEA 5KZCB 5EIIG 1S7WB 1KCSH 1PLGH 3HI1A 1SYSA 2NY0B 4GRLA 3DA0A 5IEHB 4HPYH 5GZNC 1ITCA 4LLQA 2YKLL 3QO0A 3Q8CA 3QJZA 4BWTA 1JFQL 3KGTA 1WZLA 2J56A 3MRQB 3OJ2C 1J8HD 2JKIS 4JS7A 2AEQL 2W0FB 2DBJA 3CZSA 4X8XA 5KVGH 4LLMB 2AQ3A 4ZMWA 4XMKL 2BP0B 5DUBB 4PJCA 4HXAL 4ZX5A 3OXRB 3IJ9A 1C5BL 4P4KC 1OARH 3SD2A 4UT9L 1JPSL 1CFSB 1YMMD 4YPGA 4QY8A 3IJHA 4TTDD 3AAZA 5T1KA 5KN5B 1GY2A 1HHKA 1NAMB 1ZGLP 2G3ZA 4HKXB 4NQVA 3RL2A 2BHUA 1NKRA 1QI4A 3EOBA 3WUZA 4LAJH 2Y07L 3LD8B 3EDDA 4FA7B 3CMOL 1IGJB 4XNXL 2XQYK 5JIIA 2CIKB 4Z95H 5E2TL 4XPHH 3VJ6A 2A9MH 1P7KA 5FLUA 5IFJB 1GIGL 1NMAL 1WZKA 2JMRA 1VFMA 3C2AH 2RA1A 3LD8C 3HZ3A 3MUY1 2FJFB 5EO9B 4UNTA 5ITBL 1WSST 1NFDF 5CWSA 4Y19D 1DJSA 4AL8C 3OKEB 2OL3A 1FO0L 3M17A 3POCA 4D9LH 5FW7A 3B8SA 3ZTEA 1TZOA 3WEXA 4K5NA 1A4AA 3MLYL 2VXTL 4PD4K 3UCRA 4ILDA 4APQB 2EKJA 4XODA 3LRLA 4LCCB 1KCBA 2H8PB 1PX8A 3KR3H 4AYGA 2NZ1A 4LPTA 4AW4A 4CGUB 1WAAF 3IN2A 2W07B 4LF3B 4MJJA 5FGSA 1W9XA 3HR5B 4Q74A 5DJDB 3TS8A 2YARA 1GRWA 2J1KA 4GXUM 2H45A 4M48L 1XSKA 2WVTA 4CILA 3WKML 2H7WA 1S7VB 1TNNA 1BQLH 5TF1H 2CM6A 1YPZF 2ROYA 1BHGA 2OW7A 1VESA 2OR9H 3L7FB 1U8NB 2O5XL 3BFWA 3SCMA 2DM4A 4HPYL 4M6ML 3SEPA 2HRHA 1PFCA 5IK3B 5L2KE 1F4WL 3FQXA 4ZMAT 3ATEA 5HYJE 4AGPA 3CFTA 4QHLB 2CHDA 1AXSA 2ENJA 5HHVL 4F2EA 2VDPH 3LMJH 4J3SA 2B1HH 5E8DH 5DMIL 3GPEA 1NC4D 4OJAA 4JM2D 1JF1A 4NCC1 3SJVB 3QXVA 5D1XA 4UNUA 1KEGL 1JZ5A 3TTSA 1UQSB 5I71B 3VJ6B 1W72B 2CDFA 5EIVA 1UTDA 3DBSA 1JSYA 4NN6B 1Z3RA 1E7VA 1YEEL 3N0AA 4ALAC 4F9PA 1YCSA 4XMUA 4MJ2A 2NX5D 4FKKA 1WAEA 3FHQA 1DCLA 2ZUSA 3SY0B 2RBLA 2EO1A 3PWNA 3ESNA 4ZFZA 2Y07H 3ULUH 3SE4C 4WVRA 1O9ZA 5F2FA 4P4KD 4OGAC 2P5PA 2QQNL 4Y9FA 2VABA 3P0GB 4IDJL 5HGDB 1RULH 5BZZA 4MXVE 5LGHH 4XN9A 1CLZH 2RALA 3QCUL 3VACA 3NDYE 2WQVA 5ITBH 3M1OA 1OWRM 4YFDB 5E9DA 2V17H 1JGLL 2QMJA 1F13A 1V05A 5C9JB 1FC1A 1FO0H 1JV5B 1Y1DA 2N7AA 3SJVA 1E4KC 1XF1A 2EC9U 2R7EB 1JNLL 1I31A 4APQC 4FI7A 2X6AA 3LVTA 1F6LL 3FN0H 1A02N 1JK8A 2AJSL 4LVHC 3D0VB 3U9PH 4NWUL 3NJJA 1DQLH 1JK9A 2ZXCA 3UAJC 1X44A 1CPUA 3CVIL 2P42B 3UX9B 3DURB 3KXFB 4M48H 4QHLA 3N41B 4YGAB 1M05A 5FA3A 3TO2A 2E47A 1JRHH 2DRUA 1S9VB 4FNQA 5I6NA 4Y1AD 3O0RH 6FABL 4J1UB 2HT3C 1M7UA 4XGZB 3CN2A 3LKPA 3WUWA 5JNYA 3DXAD 3O9WC 5KANG 1T5KA 2CIIA 2JKXA 2X2UA 2Q87A 1FNGA 4LBEA 2CBOA 3TBVA 4ZMYA 1OSYA 5CGTA 2RHEA 2R2HB 1DQIA 4JFZH 1GS7A 2B15A 2C3XA 4JFEB 1A6AA 1XB6A 3Q1SH 1GYAA 1KV7A 3L54A 5E5MB 4R9HA 2VJXA 4K7PY 2DBLL 1QBMH 5C0DA 1WAAE 4BKTC 3GIZH 3NJMA 2X87A 1KCVL 3EH4B 3BE1L 3WS3B 1EPFA 4JMXA 4JFSA 3JUZA 4LOUC 3TBTA 4TUOA 3GI8L 2A4CA 2CJUH 5DT1L 3CFEA 1RJLB 3KYKH 1RUKH 2NW2B 3DJ9A 2BNQD 3GMMB 3KLLA 1J9TA 4JFOB 5D8JL 3WJMB 1ZVNA 4DQOH 2C1PA 1PX4A 5T5NF 1JK9B 1QWHA 2NQCA 1OD9A 3C60D 3MTRA 3P9WB 1TZGH 4NYLB 5FK9B 3IU3A 3WFHB 4DK5A 5C0JB 1K4DB 1CICC 2KHAA 2VZVA 4FA8A 1I8IA 1Q9LA 3OKEA 2H32B 5TK4A 1ZLVH 4R97C 4ALAH 1C16B 4LEXH 4D9RE 3N0PB 1E27A 5ABZA 4N8UA 5EH1A 1DE4B 4JG0L 1IAMA 5F7LB 1A1MB 5FYLD 4TPRH 4BINA 2LTQC 1JZ3A 1E40A 4XAKD 4NQSA 3SKMB 1ETZB 3MLUH 2L0DA 1YJDH 4GKSB 3RRQA 3W2DL 4DZBA 1XGRA 3OKNA 1M2OA 4MXQD 1PCSA 5E9DE 1DDTA 4GMTL 2Q9OA 4G9DA 1Z5LB 3FUJA 3KPOB 3MA7B 5IOKA 1LO3H 2DI9A 5I6LA 3NABH 3HS0A 5C2BL 1IKNC 5AAWA 2WNKA 3QG7H 1GKOA 1BQHA 4KTEH 3VFMB 3MUHL 2OMWB 4ZZKA 2EIEA 3V8CA 2XFGB 4IOSD 1SUJA 5EOQL 1L7TL 4FXKB 4I2XE 4N5EC 5F9AC 2AQTA 1J9RA 4AYFB 1PDKB 4GY4A 4BWUA 2ZE0A 1ZTMA 4KC3B 4IKIA 3ZE1E 3RNKA 5JW3L 1Q9WB 4KRPB 1TZHA 4E0RA 4LLUB 4FQIH 4LCWD 3WJLC 2YQGA 2ZSVA 3H0TB 4YUEH 4DGIH 2X6CA 4OLUH 5HI3C 1I9EA 3OKDA 1MZZA 4HJJL 4JJ5B 4LCYA 2GG1A 5CEYA 3NCJL 4A04A 1HYSC 1AGDA 4NQCB 4MA1C 4YDMA 7FABL 5BUAA 1DVYA 3FB5B 2HJKB 3EDEA 4FF9A 1J5OH 3MHZA 3VXRE 4E41D 1I9RL 4MMZA 5C9KA 2CGYA 5I1IL 3QXDA 3L5WA 1EVUA 4MDIA 4WO4D 3BHBB 1NCAL 3L5IA 3HBQA 4BRVA 4FQJH 4AQAA 5AZ2L 3FUKA 4L4VE 1HT6A 2WKOF 3G5YA 3H3PL 4H25B 2XPYA 4WEBL 3L4WA 4RGMB 2X2JA 5EOTB 3KPPA 5EA0H 2G3MA 3D9AL 2BHFA 2ZOLA 4DUVA 2CLZA 2P7TB 1MCJA 4WDIA 4PUBH 2OK0L 4LQ1A 3RZCA 3OHMB 4K8RH 5J13C 4L8DA 2NQDA 5CHNB 4N0UE 1O7VA 4MNGB 2ITDB 4JM4L 4ATWA 2NY5C 1NIEA 4OH2A 2JKWA 2FB4H 1OHQA 3VD7A 1I1RA 4QYOA 5D1XD 4BKSC 4B3EA 4X7FC 2P26A 1RUML 5E2JA 5ANME 3X1BA 4YVNA 3T71A 2JCCA 3DRQA 4X9YA 1SQ2N 1U6AL 2Z7UA 4WI5A 3AM8A 2IFGA 5AVXB 5TDOA 3TA4D 4KVNH 4BJLA 3VXNB 2XXMB 3G3LA 5E00A 3BEWA 5E00B 4MCZA 3NVQA 4RESB 3U82B 1SJEB 4Y7OC 5IQLA 5KVEL 2FL5B 3HI5H 3F5WB 5AAMC 3RVWC 4QAWA 1NDMB 5AL8A 3ZKND 3WNIA 2CDGA 1ADQA 5ECGA 3UJJL 4JY4A 1RZJC 3CZNA 3SQBA 2FH8A 5F97E 2BP8B 2VLME 4UQEA 5IROC 1KLFB 4XXCA 2NR6D 2G0KA 3PREA 3SE4A 1INDL 4F80A 5C09D 4FLHA 4JDEB 4YHZH 1CD0A 1UGKA 3CHSA 1CVRA 3LZNA 5DWUH 3KH4A 4XXWA 3OGCB 1TTBA 1TOXA 2E6PA 3PGFH 2Y69B 3KLAB 1DBJL 5BZXA 2H26B 2VN4A 4TNVF 2OZ4H 3GZOA 3MV9A 3UBXB 4NKDA 4R5VA 4AGQA 2ZJSH 1AKJD 5H4ZA 1PKQE 2LQRA 2PXYA 3C5ZB 4ODSH 3DGCR 4EKJA 2FEDC 1Z9SB 2N59A 4POYA 2R39A 1J8HA 1SMDA 2GYSA 3GFUA 4LVEA 2O6CA 4XP6L 3DGGA 3HNVL 5DMKB 4YO0B 3M88A 3TO4B 4NLHA 4PJAF 1SYVA 1BJ1H 1BD2D 4OV5B 4OLYH 5BOJA 2ENQA 3KYNA 3QPXH 4ATTA 5T8IA 1A7BA 5IQMA 4XCNB 1UVQA 4YZFF 1S7SA 5I19H 3N40P 1A6UL 1DJHA 4RRPM 4LE8A 5DJ0A 5J3HD 4M1CD 4L1DA 4ZUUB 3V0AC 4AH2A 3EO9L 4O58L 4ZUUA 2XBDA 4RGNC 4KMLB 2QEJA 2BS9A 2DWYA 1YY8B 3SYOA 4YAQA 1C1EH 3CLFH 4NBXB 5CUSH 4O02B 2MCAA 4Y2NA 3VWJB 5I75C 4TOYL 1J5IA 1H3VA 1S6NA 1HI6A 5HJ3B 3BAWA 2E76C 1SGKA 4NC2B 2Z8RA 4XP1L 4L3AA 3BUBA 2K6WA 3ARYA 2FR4A 1U21A 1RPQA 2X4NB 2YPLB 3CUPB 3H7BB 3V10A 4D0BB 1JXDA 5GJSL 2PYEE 4DH2A 1RJYB 2C26A 2FHFA 4M7JL 1DDHA 4ZNEA 3NACL 2BP5M 3LN4B 1R3IH 1RUPL 4JNXA 2VLKD 1UOWA 1W0VB 3SB3A 3ZYZA 2R29H 2ZXBA 1JZ7A 4H8WL 3INOA 1ZA3B 3Q01A 1KYAA 5KVFH 3S8GB 2CLVB 3A22A 1YDPB 5JYLA 3EJUA 1RURL 4ODVH 1WD8A 4KROC 5ECJE 1MJ7H 4FFVC 3X3GH 4XN7A 4BH7A 3NJNA 1GL4B 4OM1L 2FJFA 3OZKA 1ED3B 2M8XA 3O8XA 3CH1B 3GINA 1UT2A 2WXMA 1EEYB 3RDTA 2Z93B 3AGWA 3SKJL 2AGJH 4Q6IC 5LWYH 2BRQA 3VH8G 1KB9J 4G9FB 4NGHL 3FTZA 4P8QA 3V55A 4Y9GA 3BAJA 3HMWL 2Y36H 2DQDH 5T5FA 3N06B 4QOKD 4G8GE 2YOAA 4BHUI 2CO3A 3VVWA 3TFBA 1D5BB 1MJUH 3D33A 3SGDH 2J2ZB 1FSKC 4PW4A 3CHQA 2C4FU 1KFAH 5HHPA 5SWSD 1E8WA 1DSYA 2E7MA 3QCTH 4JPIB 3OWRA 5HGBA 1TQWA 3TGXA 5I19L 1GHFH 4BRJA 4F93B 3ARGB 4BEIA 3KGRA 2QTEA 1WV7T 3HZVB 5LCVH 3EH2A 3E1ZA 2V7NA 1KBWA 2CK0H 1AO7B 2VDRH 4HS8H 4M7ZB 4AG4L 2IOMA 1VGEL 5FYKL 3FQYA 4DKEL 4ACPA 2DLFH 3QFGA 4QMEA 2HXAA 3NCYS 4DZ8A 2A74B 2XKSA 1LO2L 5F7UA 2LT9A 4M6NH 7PCYA 1OGPA 1KXTA 4UOW0 4ANUA 4E42B 4HEME 3U46A 1T0MA 1UCBL 3EFOA 2J7LA 1S9VA 4YWGH 4ZSOE 4K9EC 2X09A 2RH0A 1KY6A 3Q6GH 3QDAA 2ZAGA 5DHMC 4UTAH 2IWFA 2LVEA 3IETB 5AW2B 3C6LA 3RWDA 4PLOB 1UXSB 1URZA 4XCNA 1NDGA 2FT8A 3WIHH 3KL0A 1KTDB 4UT6A 4M62H 3W38A 4P2AA 2VJ8A 3NP4A 3W3BA 5E8PA 2VUKA 4L0PB 4BK5C 5E1IA 3T4YB 3MBED 4Z7WA 2GFBB 4PJ9B 2VN7A 3AREC 5AENA 1M56B 2MTAA 3D7PA 4G8AC 4NHUA 3X14A 3PAZA 1BXUA 2XICA 4XX1G 4AQ8C 1WIPA 4HIJA 4IKKA 4JFDE 2EEDA 4AQ1B 1SXZA 1XXFC 2WXHA 2AXFA 5CN1A 3BQUD 2QHRL 1TYEB 2WQXA 5DU7A 3HS0C 2X4QA 4H1LB 2SEBA 4JE0A 3WCYA 3JTTB 3QA3A 2W9LA 4ZMTA 3EW3B 1JGUL 1U58A 3UC0L 4NKMB 3WTXA 4L5FL 1MJUL 1AP2A 4FOMA 4CN6A 3TJEH 4FI6A 2EE2A 4BELD 1EH9A 1SUHA 3QUKB 3HJ0A 5FHBL 1T21A 5CILH 2APVA 2Y7QA 3SJVE 3IGAA 1FH5H 1D5MA 3QFJA 5ID0A 3D18A 5IZ7A 3NPSC 3VFWA 3U1SH 1AQDB 5TDNA 1BM3H 4CC4A 3MLZH 2Z31B 2HVKA 1CE1H 3O8XD 5I1DA 2Z31A 3ZRFC 4DVBB 1Q94A 2CK0L 3RGVA 5F3FA 5FYJD 4OLEA 5EU4A 2XG4A 4XMKH 3RDTD 2CE6A 3BUDA 3D0LA 3FU7A 1HS6A 3MJ7A 3IFNH 2YLKA 4NQXA 5C0BA 1TQCB 2F15A 1TSHA 3V4LA 4AZ8A 2GBVA 3TA3D 4JLRB 5KN5A 3IEAA 2QELA 3RVTC 1A6WH 5G4MA 3LQAC 4XP9H 3NDZE 2FIKA 3CDYA 4ZAKD 4HIJB 3QIBD 4U3CA 4LQFL 5C0GA 4WW2B 1NCGA 4WCYL 5D2NA 2XWTA 3GC3A 4NQEE 5TFSL 4ZO7A 3KBPA 1EBAA 4D7PA 5D7LB 4AYEC 3IPEA 4HJ1A 2CQVA 1DFXA 1TTGA 2ALAA 3F7RA 4MYPA 1GIGH 1NMAH 3DSFL 5EU7C 3K3QA 4B9JA 3C87A 3KWVA 5H94B 1X5ZA 1XR9A 1BEXA 3X13B 3WDIA 1HTYA 3EYVB 4GW5B 1UZ8A 4ZRGA 1CMOA 5I8KH 1U92A 4IDLA 4D9QE 3QDME 3MQIA 1B0IA 4B41A 5DSCB 4HJ0D 1KBPA 3VX1A 4KZDH 1Y6KR 1EGJH 1EHKB 2GIMA 1SOXA 1XF2B 1U3HB 5JXAL 3IDGA 5HI4C 2W65A 4PJFB 5TDNB 4BFJA 3GJFB 1UWYA 2Y25A 2XIIA 4P2QA 5IWLC 1ZDQA 1GS6X 2XWEA 3JV4B 4DEWA 5GS3A 4TNEA 1BQLL 3WHXA 4P3DB 2O5XH 4K3EL 1HKLL 2XV6B 1ZGLM 1ZV2A 1HHGB 3E8VA 3OLGA 3LH2H 4G6FB 1MEXH 5B39A 5J11C 5KS9A 5L8KB 5C6TL 4JZJA 2I32A 4L9LB 3CXDH 5L2JA 3EOAA 3ET9F 1BM3L 1FZJB 3SN6N 5FO7B 3ARDD 2ARJB 2FWLB 5KSBB 4WY7H 5C9JA 1LP9B 2EUZA 1OOAA 1BYOA 4Z76A 3TV3L 4LSVL 4X4XB 5EO1B 1WGOA 1CLOL 5F9JA 3QEGH 3RWGB 3WI9A 4HVBA 4P0DA 4AI7A 3T4AC 1OGTB 1J05A 3STZB 2WV3A 1WG3A 2E7BA 1XCTA 2PN5A 2H3XC 5HGAB 4OFDA 32C2B 4LHUA 3BXNA 2LU4A 4XWOC 4NUMA 4ENZA 3EBIA 2VDQH 1Y0LB 4XMWA 3LCYA 4X9HA 2IDFA 2APSA 2DJMA 2BIHA 3MYZA 4PJGA 4NX0A 1TJXA 1ZWIA 2KC0A 3BO8B 2IPUK 4PJCE 5A3IC 1S46A 1AQDA 5EU6B 1J18A 2AERT 4U49A 2F53A 4FQCL 1M7XA 4NUGL 4HUWB 4J4PA 1MFUA 1WHPA 3OV6A 1X6LA 5E8EB 4ERSH 3ZKXB 3TBTB 1KN2H 4MAUH 4AV0A 5INCB 1BGXL 3WNJA 5JIQA 1FN4B 2OMNA 4YDNA 3NRPA 3K4AA 1WF5A 2ADFL 4U0RC 5H2BB 5FO8A 4ZMOA 4WV1B 5L4IA 1QABA 3BN9C 3JV6B 4QO1A 1X9LA 3KM2A 3JTTA 2V9TA 2V0AA 5EEVA 2NXYD 3WLBA 1U8OA 3FB7B 4DP9X 3HMXL 2WWKT 2QTVA 1ZK9A 4EXPX 5FUZL 3F7YB 3EOYG 1FV1A 3LKSA 3X11A 2VT0A 3G5ZB 3LN9A 3X11B 4M7KH 5IVXF 4IQHA 4WK4B 1NZRA 2AMUA 2Q86A 3ZZSA 1OAXH 3CU1A 5I1EH 1PAMA 5C09A 5AVYB 4J1UA 1T03L 3IJ8A 4LOEA 4EDXB 2CJ3A 2WD0A 1B2YA 1KCSL 1PLGL 5C86A 4U31A 1SMOA 1DLHA 1G6RA 3DHUA 4G1MA 4HIQA 1V27A 4ONHA 2AZAA 4ZUVA 2YN3A 3V0DA 7TAAA 4NOBA 3EADA 1AGDB 2QGBA 1U93A 3O3DA 5C0BB 4RAHA 2NZ9C 5HI5C 4HA1A 1IL1B 2HUEA 3VGGA 1TMQA 2RCSL 3QJOA 1ZSDB 5KAQG 2DWSA 2NXZC 2X6MA 3TTYA 4BH8A 1JPGA 2NY6C 1FFOB 1FZKA 2DQFA 2FDBP 1BLNA 2UZYA 3AC0A 3RWIA 3ZSSA 1JS4A 5ICXA 1PDKA 4G42B 3HA0A 2NXZB 4XO4A 1ZT4A 1F45A 4AQOA 3GJFH 1W6LA 2YBRA 1HILA 4GAJL 5H4YA 1VGKA 5DT1H 5F89B 4LSTH 3UC2A 4OCLC 4PS8A 3DECA 3TF4A 2CRZA 1KTJA 3AZUA 1MFBH 1TCMA 3HPJA 5EZJA 1WFMA 5FYLL 3SQBB 2KBGA 1AI1L 2E59A 2FWOB 3ALXA 4FE9A 3Q1EA 4U1HA 2VLJA 3GK8L 2WLKA 5FO7A 2HJLB 5D1QA 4G5AA 4KXAA 1MXGA 2X0VA 5FYJL 4ALAL 5CZXC 2NY3D 1GW0A 5HHNB 2EYSB 5ISZE 5K59E 5I1GL 1IBYA 2X41A 1UM5L 3ZTJG 2EXSA 4TUJA 4TPRL 1RERA 2F7IA 2R2EB 4KK5D 4L18A 3UABA 1HEJC 4U6VL 1L3WA 2DTMH 3B2MA 4G9FE 5EU7E 4Z7OE 4OZHE 3FCTB 3H53A 1BBDH 1FRGH 1NEZB 2X9YA 3GRGA 3ILDA 4K8RC 2W81C 4GG6E 4L8CA 2ZT9C 4UQ2A 3KPLA 3QHZL 2DQEL 3MRGA 1G7LB 3NIFF 4TRPL 5DS8B 3B2VH 3QZWA 3DKHA 3FULA 5E0FA 2DIAA 4OD3H 3WMQA 3GSOB 1T2XA 5CLWA 2VXQL 1LVEA 1Z32X 2PWFA 5K5YA 3EDJA 1XMWA 4B9YA 1NBQA 2MQ0A 2NUPA 2E9GA 1IX2A 4XBGB 5E5LA 3UTQB 1X9RA 2F5BL 4KJPD 1FFNB 4WDIB 4QXTA 3SCMD 3RY6A 5IMMA 1Z9PA 2AJUH 3BIAX 3MX0B 2FVNA 2VH5H 1KACB 2YUVA 4PRPB 1YN6A 4G80A 4X6BB 1KJ2L 1KYFA 3SBWA 3K72A 1D9KC 2OTUA 3C08H 5F7EH 1R5IB 3VFGL 1P4LB 1QSFE 2IANB 2V8MA 3QZMA 3DK0A 5DZVA 3SSGA 1NWOA 5K93A 1FL5B 4KMQA 1BIHA 2NY7H 2QR0A 3STLA 4NENA 2VIRA 4AEIH 2WVUA 3CSYA 4X4ZA 1JZGA 3L4XA 1UD8A 2F9BT 1GCYA 2Q1EA 4BUHA 2I9TB 5DVPA 3VFUB 1RI8A 1MHHB 3EYFB 2E9IA 2WWNA 4GSQA 4OTXH 4LU5H 3SKOB 4CRPA 5I2IB 1SXSA 5IR1A 1RJCA 3MLSL 5SV3A 1UT9A 3LDBB 3SGJA 2PR4L 3WGUB 1J1PH 2KQMA 4FG6C 1XAUA 2QL1A 1NDMA 3PCYA 5L88L 3GHPA 3ZDYB 2WZAA 3L45A 1WK0A 2R2EA 4QRRE 4HHGA 5DS8A 5GXBB 2BS8A 1KBBA 4M8QB 1BZ8A 1QWNA 2FQGA 3IPFA 1FVDA 2IIJA 5F93C 3CBKB 3C8KA 3GIVA 3A0OA 1SPDA 2XJLA 5SX5K 1MRFH 2ZYIA 1N68A 5C08B 1BFTA 3TZVA 2EE9A 1BPLB 2FB4L 4XCCL 3DGGB 2QQLL 3GXUB 3HNTH 2XTSA 3GSNB 4WIQA 1IBGH 1KTLA 1OAYH 4FNSA 5A2AA 1QW9A 1NOAA 5GGUA 3N1FC 1R5VA 5DLMH 3VMPA 4YHYB 4MSWA 4O4YL 3TEZA 5IMOB 1OT2A 1S9YB 3HHMA 2YBRB 4N6QA 2IMMA 3F00A 3MRCB 4NWUH 1G7QA 5IG7A 5K9QG 4XCEA 5DRWA 5E8NB 1UEMA 4R7LA 4IRZL 3VI4B 3P73A 1M53A 5MEQB 1OY3B 1GZQB 2EC9T 4LSUH 3SYQA 3ZKQD 5B1BB 3FOMA 3MXWL 3JBG7 4NAJA 3DV4A 4S1QL 3DXAE 1P7QB 3FUHA 3P30L 2PNDA 5DJ2B 3BRGC 3ARXA 3ZHLA 3T4YA 3LEXB 3NPZB 3B7YA 1BX2A 5C08E 4OJCA 4RX4A 1H3PL 1QSED 2DV6A 4Z0BL 1U41A 1OGAA 1EHNA 4FXTA 1TNMA 3VSTA 4HDIA 4W81A 1WIUA 3CJJA 3C6EA 4BFIB 2L04A 1L7IL 2JKJA 2IPKB 2R51A 3P69A 4BQ9A 4CW1B 2V3EA 4ODSL 3WDJA 4XHQA 4JKNA 1ZHKA 4JZOB 1KSRA 1FA4A 3RWCA 4QYOB 3E9TA 5DO8A 4AYFA 4KTGA 2EC8A 2XX1A 3DV4B 3ZN6A 2HRPL 5AW1B 3G04B 1S7SB 4Y16A 3F7VB 1T0NB 3WNKA 2NLJA 1V10A 2AJYL 5JUEL 5JQHC 2E6QA 4JFED 4OUUB 4GMSH 1FFRA 2ZXGA 1R6VA 4EJ1C 5IHLB 2ATAA 2DB8A 1ML0A 4PN6A 1S8DB 2IADB 4LOVA 3ZE1B 2ZP0T 2LLGA 1UWEL 3OLDA 1D6VH 3OBAA 2G75B 5JO5B 2I5YH 3O11B 4EUPG 4ZW5A 3Q8EA 25C8L 4M5TA 2A1WH 8FABA 3B7TA 3MROA 4K9EH 3B8YA 5KBMA 4DAGL 4KGLA 2OMTA 3PWPA 5LXVA 3L2LA 1FLRH 3S35H 2ZUYA 3MKKA 4OCXL 3AMLA 5BV7B 4GUQA 3QP3A 3VXQB 4F8NA 1HZHL 3JTSB 4KKLC 1Q4NX 1ACZA 2JIXA 3DVGB 3S3PA 3QIWA 2DQTL 5EZIL 3MACH 4G2AA 4LL1A 4K23H 4WI3A 2NUTA 1GW6A 1UZGA 3FUMA 4LFHD 4GSDH 1ZANH 4JHWH 1OTUC 5DJZB 5FWQA 2ZG1A 3U4AA 5B3JF 4OZHB 5IGXH 4K94C 5IROA 5C92A 3O41B 2ZWYA 5DD3H 4F7PB 1WT5A 3AQZA 4M8VA 1MAMH 3LXCA 2HJFB 3SY6A 3QHFH 1TTCA 2K8MA 3HB3D 1U91A 2P24A 2WXIA 5EO1A 4FFYA 4XCYA 3KH3A 5KVGL 2OFQA 4NN7C 4JG1L 3TBCA 1TZAA 4OJYA 1DUYA 4A2DA 1G6RL 3O6LL 1JG9A 3FT1A 3AACA 1O5DT 3G6JE 3RKDC 3QG6B 4FABL 3ZLQC 1N64L 3ZDZF 1XH1A 3SHSA 5JLZA 4B0MB 3QO0B 4FQXC 4H8PA 1O9WA 4GQ9L 3EJTA 4KKPA 1F1AA 3MN8A 3B9KC 1I9RH 1TTRA 4R4BA 5I1IH 1X7SA 3KYAA 4BKLA 4OD1L 1HE8A 3O2DL 5BOZG 3WFEL 3RWJB 4W4NA 1BDYA 1WBXB 1EX0A 3PL6B 2D7MA 3JV4A 4TNWK 1CVSC 2EEFA 1ZGLB 2DY2A 4NWTH 1TCRA 2WGXA 4PV8A 1A8JH 2YA0A 5E6SB 2WXPA 3DK2A 2WM0A 4JFEE 1EJOL 4Z7OF 5HSFA 4NZRL 1JPST 4WWKD 1NCDH 2OYMA 2A6KB 5LGJA 2HCZX 1MFCH 4DOHE 3FB6B 4Y8DC 1OL0A 5BRZB 1P6AB 4NDMB 25C8H 4Q4IA 4BZ2L 3IKCA 5CP3H 3HLKA 3MLXH 4JRLA 5DJYA 5MERA 4K9EL 1E2VA 3ZTNL 2X3BA 3DX8A 1PFOA 5DHDA 4I3SH 4J27A 1LO2H 1X5KA 3HUJE 2XWTB 3JVGA 4XXCC 5E70A 3WS6C 3SDDB 1FDLL 3ARBC 3ILQC 3GMLB 3MRNA 2CK2A 1JYNA 3AB0B 4UV7L 3HRPA 1YNTA 1P6WA 1AS7A 3QS2A 2IH8A 4GSRA 5T3XH 1QR1A 3WKMH 3RZWA 3T2QA 1M1XA 4MAYC 4BIKA 4ZTOH 1JP5A 4X8CA 5L7XL 3QRFM 2XIBA 1RKRA 3ME0A 3WXVL 1X5YA 3ZYIA 1FCGA 2XWDA 1BFVL 5EU6A 5I17B 1C8QA 4U7MA 2PP7A 2Z91A 1CFVH 1D5BA 1SBBA 2GK2A 3GS7A 3OAUH 2QKIB 4F15B 1J5CA 3U4EB 2K70A 2AJ3B 5ICXB 5MENA 5HYQA 3D34A 4YHZL 2Q76B 5IFJA 5E8DL 4KI5C 1DQQA 1T6BX 2FLBT 3D2TA 3EJZC 1ZLUK 3US0A 1QNZL 1UT1A 4PLKD 4PW9A 3FAWA 1OGTA 4P23A 4KQ4L 3BC9A 1RLWA 1IE4A 5TE6L 4Z6AT 3LIZH 3UO1H 1B2WH 3QIWD 4EBQL 3V5KB 2Y6TE 4H8VA 2OI9B 4OF3A 4E5XA 3T0BA 1WUZA 1AMYA 2ZXEB 3KYOA 4QXGH 2WSKA 3UAFA 2DLTA 4R90L 5I30H 4CMHC 2HA1A 3IMUA 3GXTA 4KROB 3HLAB 3RY6C 4DGVL 4K73A 4F7EB 2A77H 3RFRA 3AXLA 3OF6A 5FYKU 2WTRB 3DO7B 1R3LA 1MNNA 2ILLA 1IAKA 1UASA 3FTXA 5GS2D 5EO0A 3GO1L 3QR1A 1D2PA 5DJ8A 3PAUA 5IHBA 1EFXA 5HDBE 1KXQA 3UTSB 4LCCA 1RHHB 5D72H 4BSWB 1UWGH 2Z4TA 5TPWL 3D12B 3GHEL 4XAKE 3MRJB 1KPVA 5KAQF 4P3DA 2TAAA 3D39B 2ZCHL 3F3HA 1BD2B 2YMXH 3L4UA 5L4FA 2H5UA 4X0KB 2H9GB 4NBZB 3VFTA 3OKYA 2K78A 3JWDC 4YHML 1FFTB 3BWSA 2AK4E 3BVDB 3AITA 3CSGA 2JKNA 1TTAA 1IRAY 4I13B 3BIBX 1Q9KA 4KAQL 4LVOB 1GGTA 3I3BA 3F58H 5CM1A 4PJ7A 1CZ8L 1F00I 4S1RL 2HFEA 2YD0A 1B0RB 1Z66A 4YNYA 5CSBA 5J4MA 5I1KL 4WUUE 1F11B 3VUAA 2X44D 5DJ6B 2OTWA 4P49A 5AALA 5IJKC 4G43B 32C2A 4LHUB 1RD6A 3QCVL 3DVIA 3QARA 1VCBC 4HT1L 3KPSD 6PCYA 2EYSA 2CJTA 3S6CA 3JQOB 1R3LB 4W6XB 2ZKWA 3CFNA 3CN3A 3V4VH 3G08A 3ARBB 1HIMH 2BVYA 3HG1A 3MUJA 1GGIL 1BAWA 1NCCL 4YIQA 4WLCA 3OKKA 4CNIA 1BFSA 1IAKB 3L5JA 1DFBL 2J6WA 2L8AA 3NTCL 5F89A 5AYUH 1UJ3A 3ENEA 1M4KA 3ZJAA 1RUKL 4G72B 1CDUA 4HCRL 4YVUA 2J8UE 5F0JB 1QO3A 3QIWC 1QKZL 2VSDA 3GEWB 1KJMB 4Q9QH 1I1AC 2W59A 4PJ5E 4MQXD 2JFCA 3L5XL 4LSSH 1IGTB 3H9HA 2DF3A 3EJZD 4XO9A 2CO2A 3GHBL 3U4EA 1B3IA 2X4PA 1I3RA 1RFDL 4DQAA 3IDUA 3U2SB 2MJWA 4UIKL 4QOKB 3ZBMA 4FGMA 1FNEB 1AGEB 3HTLX 5KSUB 4C8XA 1X5XA 1HESA 4FNUA 3BLBA 3L3JB 5CINH 4MA1B 4L23A 1RIUH 1KXVC 1XCTB 4KJQC 2D3VA 4NQCE 2Y06H 4HGKC 3LQZB 3ZUCA 4AOFA 4IHOA 3GMOA 5J6HB 1X5GA 5I1AA 3RA7H 5LNDA 3O4LE 2OMZB 2OKMA 3ARGD 4MXWH 4P04A 4EUPA 4DKAA 3VD3A 1NGXA 1CGWA 2AEPL 1FZOA 5EF2A 1S7XA 4UM8B 3JWNG 3K5SA 5CF3A 4RMQA 4KK6D 5F88B 5HDQL 4RGMC 3MSPA 2ZKHL 3MYJA 3V6ZA 3C2AL 3SPGA 2K1MA 5JDSB 4KV5F 2H1LM 3IKKA 3VFNA 5DUJA 2CA4A 2NPLX 1A4BA 4OKVB 3L08A 2XTJC 4LPYA 2ESVD 3JV6A 4ACTA 5H2BA 5FO8B 3CFBB 2BSCA 2W9EH 1J86A 5ITFB 1UACH 2HKHL 4M5ZH 1HE7A 2OI9C 1MY5A 4X8JB 2XWJB 1DJGA 3VM7A 1YNLL 2F68X 3TWCL 5AB9A 5C0FB 5MI0C 2IWEA 3KCPA 1PPIA 4WU7B 1IJNA 2FJHB 7FABH 5IKCA 5JHMA 5ESAB 4JFXB 5LQBH 4I5BB 4NKOA 3IU4H 4I5BA 2UY6B 5BO1L 4HSQA 2H32H 5ICYB 3HE7C 1I3RB 3DROA 1YMHB 4BCZA 2AQQA 4L5FH 4ZUWB 2FYVA 2E7LA 3B9KD 3UTOA 4IBUA 5GGTL 1G6VK 1U8KB 4PRPA 3NT0A 1AC6A 4X6BA 4ZD3H 5D7LE 4M1DH 4HIHA 3FOMB 2HWZL 2IBZY 5E6IB 2HG5A 4KY1H 1C8PA 1HSAB 4G8EA 3VFMA 4MD4A 3QQ3A 3KPSA 3KLAA 5FKPB 2XFXB 1G9NH 1UM6L 1G43A 1A8ZA 2VDNH 3BESR 4ZFFA 2ICCA 3HG1B 4GP4B 1JNJA 2PO6D 4MD0A 4PJBF 4CU7A 4Y2OA 1KBKA 1CN4A 3B3IA 4PJ8D 3U7WL 2HX7A 5DFTA 1N5AB 3TYGH 2AEWA 2HFGL 2FATH 3QUXA 1WUNT 2C9QA 3WAJA 2EDLA 3BGFC 3P0VH 3HC3L 4BZ2A 1L5GA 4NJ9H 4AGMA 2CO6A 3S35X 2P4AB 1GJUA 1K9TA 1X5MA 4PTUA 3O8XB 1GGYA 1TPXC 4MQ7A 3ZW3A 3N43F 5C08A 2K7QA 1IBHA 3I6LD 3P3UA 5F7AA 1TIUA 4N8CL 4IOFD 1MJJB 1E0OB 2X4PB 4JM2B 4PGCB 3T0AA 1U2YA 1LYQA 3KHOA 3SJVD 2Y24A 4F8LA 4WAFA 3TJHD 5EF3A 3WTTA 4M7LL 3PIQB 4PV9B 4JY6B 1JF6A 2A6DA 5BRZE 3MREB 2V4LA 2V3DA 2RIKA 1KCRH 5CJQH 2HG5B 2WBJB 2WUBH 1JNLH 2VIRB 1F8TL 1NKOA 4D0BA 3VB9A 5D7LD 1U8KA 4AE1A 5K9OB 2M26A 2HYMA 1ADQH 5F7HA 2YK1H 2WMPA 4UQIM 1DSWA 1FLTX 3HRZA 3VQMA 4DTGL 3TJPA 2XI9A 2DQJH 3B2PA 4KY2A 2J8UA 5BMFL 6CGTA 1PZ2A 4HETA 4YE0A 1FBIL 2OSWA 3DXAA 2OP4H 4C56A 2ODHA 4N1CA 5DCCA 2HLFC 2XPGA 4QXTB 3ARWA 3PPEA 3ILEA 3CQQA 4XO3A 1U8JB 3O0RL 1NC4A 3EOTL 5KJRL 3GYRA 1KLGB 5JHLL 1WA0X 4XPBL 2EXYD 5DRXB 5E56A 2GHWB 2A9CA 1T4WA 3ZT5A 4R7NB 1U8CA 3BVXA 1L6XA 4LLYA 1U3HD 4U4IA 3LKNB 2K7PA 2PR9A 1EDHA 4NN6C 2H6PB 1IM3D 3L95B 2VDOH 3KHQA 5IB4A 5I71C 3KXFD 2VTFA 1UATA 3CHPA 3DJRA 5D7KD 4G59C 3I6LE 3GSNH 3KYNB 2XWBA 4U05A 5E24E 2Z35A 9CGTA 1QLEH 2QV4A 5GRJL 1SVBA 2WXFA 3DNKA 3VG9B 3QSKB 2VRKA 3PV7A 4LU5L 4XCEB 2EP6A 4JDTL 3KS0H 4I0PB 1OEZW 1U8HB 5I17A 5F1OB 3ARDB 1HK6A 2KT6A 3MV9B 4PPTA 2R2CA 4NRZA 4IRZA 4RA3A 4DQOL 1CG9A 4I48A 6PAZA 2V2WA 3GZKA 1M7IB 3UPAA 1QTSA 2N01B 2V2WB 4HEPA 2G3XA 2PCFB 4ISVB 4M4PA 3VXOB 1F4XH 1KJ3H 1A3RL 1WEJL 4ZT1A 2QSQA 4H26A 4NUGH 2WANA 4TUKH 3JUYA 4XCYB 4NT6A 3PLYA 4ERSL 1CDJA 4RCAA 5CCKH 5KYXB 1KTLB 1EJ6A 5FUCE 5D7EA 5LB1A 3V0IA 2VCOA 4PGEA 1GYVA 4L3ED 3BFOA 3HI1B 2DI7A 4HKZA 5IB3A 3LEYL 3QJHA 3TPUA 3QNXA 2ZPKL 2A9NH 3WEBA 1F8TH 3CC5B 2AQRA 2W1NA 3HMWH 3VQ2C 3SDCC 2XN1A 3D07A 3G5VA 5L9DL 2YR3A 4Y9EA 3BZDA 1UXSA 2J73A 3APDA 3Q48A 1DR9A 5IVZB 5AW0B 2G0LA 1KULA 2WW8A 2CNYA 3FO9A 3B5GA 5I8CA 1RSFA 1T03H 3VXRA 3VFRB 1S7TB 5EOQH 1YO4A 2OR9L 1GPOL 1R3JA 4QF1B 1AXIB 4HV8B 5HHQA 3QZPA 2WVSA 2J55A 4NKIH 3V79C 1IC7H 2PW2B 4OZFB 1NTDA 4O5LL 2C3GA 4L1LA 2GI0A 1PSKL 2PW2A 1ORQB 1D9KD 3HE6A 3JVGC 3K80A 4OZFA 4P5KA 3OQ3B 5T1DH 2RAMA 1KB5B 4PJHB 3IMSA 3WKYA 1YYLL 2XQYA 1A22B 1AR1D 4B7IA 3E6HA 4XPFH 2F1EA 4HJJH 1X7QB 2WXRA 2BNUB 3LMJL 1MHPL 3KLKA 5E2VH 4FJ6A 3RUGF 4PSPA 1JYVA 5D7LA 4ODXB 2WBJC 3S3SA 3QIBA 4YHLL 4LDLB 1CDGA 1FNFA 3INUH 3MJGX 4Z7VE 2FX9L 1OO2A 1NM9A 1XTMA 1U91B 3IGLA 1ZTXL 4CVWA 1S5IH 4GAJH 2EDKA 2Y6SD 2FT6A 4HCIA 1E9QB 3CC5A 3SYAA 1QFWH 1UZ8B 3IMRA 3QAQA 3RTQB 4CSSA 2NNRA 5C70A 1T1ZB 1A7OL 4HKZB 1SBSH 3TBBA 3UDWA 2VSMB 3RU8H 4X99A 1DVFC 4CDHA 4ZXBC 2F7PA 3GK8H 3GSWB 4KK5C 2J5LB 1CXFA 4E41B 5BRQA 1CLZL 3BZFA 4AT6A 1JE6A 1NOFA 2QGDA 1DL7H 1IBDA 4PJ8A 5AWNL 3EXLA 2W80C 1WBXA 1QLFA 2B9AA 1R3KB 1JZDC 3X17A 4EUPH 2Y5QA 3LEYH 4QJ5B 1UCTA 1NL0L 4DN3L 1AYOA 1HOCB 2ICWB 3N3EA 4L8BB 4I3GA 4JFFE 4ANWA 3CFCH 4QTIH 3OZ9L 1HYRC 1DTUA 4ELME 3N44F 3HAEB 3OMNB 4FFWC 3GEFA 3KYOB 2VR9A 4JFDA 1LXMA 4QXVA 2GUOB 3PP4L 1FZJA 4WTWA 1J7VR 2NCEA 2WP3O 2X4UA 4L1HA 5T5NG 3M1CA 2QT6A 1QBBA 1WAAA 4AITA 2MPAH 5I1LB 2CDFB 2VW7A 2F5BH 4H8QA 1SEQL 2J4WL 2OXHA 4I77L 5DMGC 1ZHKB 5EEWA 3BT2H 4JRXA 3BPNC 3V52L 3X1FA 4HPOL 3IBOA 5HI5D 3ZL4L 4QNPF 4NIYE 3TONA 1OT1A 4OT1H 3BKML 3Q43A 5HD8D 2YIHA 4HEPG 1H3TA 5AVTB 1YYML 4M56A 3ZMNA 2A73B 1L3NA 3U79A 2N1TE 3BP7A 2KZ1B 1N10A 2ZJSL 5CMAA 1OT4A 4YIQB 3IMTA 4PY7A 4XR8C 5ALBL 5FW8A 3SDAD 2XDHA 3VWKD 3SCMB 5LDUA 2VZ3A 1JNNL 4DESA 3N9GH 4AQ1A 4KKAC 1DVTA 1S5IL 8FABB 1FJ1A 1MW2A 2F53E 2JKSA 1QRNA 5IJKA 4NWTL 1QRNB 1J1PL 3WJJC 3UTZB 2W0PA 1QTPA 3OG4B 4L3FA 3ZE1F 3QPXL 4WV1A 4Z7WB 1JBJA 2HVJA 4X5RA 2PTUA 1RHHA 4WI8A 4BSWA 1V3JA 5IMKB 3PXHA 3DYMA 5SWQA 3BUPA 4FZ8L 2WCPA 3RWEA 1AKJB 5HYIA 3ZTCC 5J5EA 3RIFK 3KNBA 4OZIB 1T7YA 5JHAA 1MJ8H 5AKTA 1KJVA 3EJJX 3KXFE 3IFLL 3TO4D 1O7DE 3BP4A 2O61A 4BQBA 3KJ6L 3L17A 1EO8L 5EO9A 4JRXB 3ZDXE 3C9NA 3RB5A 4RISL 2AF2A 2A5UA 5DEFA 4MX7B 4XO8A 4QRPA 5IVZA 4C54A 1UURA 2XG4B 3QBTB 3PWVA 4HUXA 4N9OB 3NACH 2IPUG 2DEWX 3H9ZA 2ZZUT 1T1WA 3IRPX 5JA9A 4ZUTA 1EUTA 2BW4A 3L81A 4XWOD 5E94A 3ASOB 5ISZB 1ZY9A 2MH4A 4GRWH 4HKXA 4KITB 1MXDA 2Z0UA 2Y7LA 3TV8A 4C57C 2WLJA 1MQ8A 4Z8FL 4KK8D 4IYKA 5JIKA 2J21A 3I6KB 4W93A 2J44A 3GNML 1R24A 4TUOB 3AW5A 2AJVH 4WO4B 4MJ6B 3UL4A 1TZIA 5KSVA 1BZ9B 4GAAA 3ARDC 4Z3GA 2FEEI 3QAZB 5JOPE 2C3VB 1QNZH 1OP4A 3NFSL 2ADGA 4O2FA 4M9PA 3E38A 4MMXA 4QRAA 3NCJH 4N90E 3PP3K 4H20L 1L9OA 2YFOA 1EJ8A 1MCNA 5EU3B 1B0GA 4WUUB 5SWSA 4JDZB 5CGYC 5D2LA 1L0YA 1EXHA 1OHZA 4NZDA 4TNFA 3UTTD 3S8WA 1HQ4A 1K4CB 2IH1B 4OF0A 1HHHA 1GZHC 1I8MB 1W15A 3M46A 3P9MA 5SWSE 5KVMC 4PJ7F 5D1XB 1QSEB 3UJTH 1MVYA 3OQRA 4FAAB 1IMHC 4E41A 4XPHL 5DC9B 1JPTL 4RFNC 4AUUA 1D7CA 1N19A 5DO2C 3HBPA 2R0LL 3NIFE 3PP3H 4KZEH 3MRJA 4L4TA 1G7LA 5ANHA 2JB6B 3MV11 3KPTA 3QUZD 2BERA 4OGQC 1HHJA 1UWGL 5DJDA 5TPWH 3C12A 4DHLA 5F7DB 1A7NL 4OQTH 1YEGH 1QFOA 5KS9F 4Q9BA 3P3YA 4Y5YA 3ZHNA 4XWGH 1C08B 4HD5A 3RUGE 3ZIMA 4WI0A 2WO3B 1NCBH 5F88A 1IZJA 3MACL 4GRWB 2GK0B 2V7NB 5T1LD 3OAZK 4IRSC 1UFGA 3QIBC 4PJ9C 5I5JA 1BVLB 1SN5A 2XN9E 1B88A 4GAGL 4TSCL 1ZHNA 3S8FB 1NCWL 5INDA 4RMUA 3L3JA 3EO0B 4OZ4A 4M03A 4L8SB 1NPJA 1ZANL 2R15A 3L13A 4LHJB 2LW3A 3V5KA 4HCRA 2XV3A 3TA3C 1JF5A 5J6HA 4TLTA 1LNUA 1MAML 3RDTC 1HZLA 1W8OA 5AUMA 1G9MC 1KTBA 4OI9A 4JGJA 3G7TA 4N2BA 5CP7A 3KLHC 2D0HA 3JWOC 4WNQA 5CP7B 1E28A 5GRVK 4GI9A 2F53B 4JAMB 3ARSA 4JRYA 3EYSL 4HKJB 2F8XC 1LWRA 3ECQA 3BQVA 4OLWH 2XYCA 3MRGB 3W11C 1NCCH 2CRIA 5DMYA 2CCVA 1GH7A 4HJEA 1IQDA 2VDLB 1ZPLA 2EDYA 2EADA 4L05A 3VFPB 2BWIA 2UY7A 1J5HA 2D03H 4OZFG 1G9ML 1U93B 1JGUH 3O3DB 1UB5A 5I1JH 1ZHNB 2W91A 4RH4A 3I50H 2BOBA 2XQYG 3O2DH 2APFA 5FECA 4WKZB 3N5AA 1IARB 1PAZA 1JHKH 1KMGA 1JNHA 3SGEI 2EUWA 5IBTH 1MFBL 1JWSB 4KBPA 4OLYL 1EJOH 2VM4A 1G1OA 1CXIA 3C8DA 2X4QB 4H1LA 5F7YC 4Y16D 2A4ZA 4GG6A 1CS6A 2FSEA 5BW7C 3AROA 5D71L 4D8PA 1DJZA 1QEWB 3HC2A 1UWFA 1Y1UA 3ZE2F 4KH2A 1KPRB 1UOLA 3SY0A 2G4EA 2VO8A 4R4FL 1QAWA 5DVNA 1E9PB 3MBEC 3FTWA 2Q8BH 2FD6H 5E5RB 5C0CE 1X5LA 1FRGL 3WDHA 3EHBB 1VDGA 2XCMC 4P5TC 1MIEL 4RRPA 4XNZC 3FBKA 4WWKB 3P4OB 4Q6IB 4OSUH 2D2OA 5CXPA 1ZS2A 2LVCA 4Q6IA 4XH2A 5MI0B 1JPGB 3ZRCC 3MLRL 1CFQA 2VXQH 2IXQB 4PJIE 4ZQKA 4HH8A 1I85C 3QO1B 1J87A 4L1TA 5KOVC 3OAWA 1TVHB 2F19H 1U9KA 2WYZA 4LCVA 4L3EA 3TIEA 3PWPE 3DUUA 3UTPD 2WIIA 3VFNB 4AIZA 2E8ZA 1WCBB 1Z3GH 1EZLA 1R0AL 4N0YH 1FIGL 1AZUA 5I18H 2YGVA 1BIIA 3GS4A 1NINA 4LHUG 3X3GL 4UZUA 4HBCH 4ZTPH 3QEHB 4YDLC 4QHPA 3T2PA 3VYPA 4PJIA 5IFAH 5SWSB 1LILA 1MN4A 2X1XR 5D70L 2WN3A 2UVFA 2OCJA 1OCCB 4WU5B 2ZCKH 3HUJF 3QRGL 1CXHA 2GBTA 5AEAA 1XZ0A 5FCUH 4B9ZA 3I9PA 2AXHA 2W38A 4JEGB 4L2LA 1BF5A 3BE1H 5T1LA 1MCEA 3B9AA 3LHPH 5K1JA 3DIDA 3NPSB 3RGVD 3FUEA 2BSDA 4RWYL 3NJVA 4L8CB 3LX9A 3QE5A 4K7PX 3U6RA 1OPGL 2FBOJ 3EG9B 2F2HA 3PU7A 3W11D 4XVSH 3I75B 1WO2A 3UAJA 3VA2C 3NA9L 3VFOA 2NNXA 3S37L 4KPHL 4ZNEE 3EYQC 4I0KA 1UC6A 2X70B 4K15A 4H7VA 4J5VA 3ETBJ 1ZEAH 2DYPB 1O7SA 3IJYB 5L4MA 1WICA 1RPUA 5CBAB 1YDPA 3HS0B 2VLRD 4KHTH 4IGBB 1LDPL 4JFDB 4KROD 3QI9B 2H1XA 4AQ1C 5L8JB 3S36L 1SXCA 2FATL 5TE4H 3Q06A 3K72B 1KEMH 5TTRA 2GBUA 5LVEA 1LO3L 1NJ9B 1WE5A 1KBGL 1K5NA 2FQEA 2ZSWB 4PJ9D 5ELIA 5B7EA 3G04A 3EO0A 3ZR5A 5C0DB 2LGNA 1KENL 1A1MA 2J20A 1KNOA 1AXTH 2BSSA 4YEEA 1A4KB 3IJSA 3X2QB 1S7TA 3E3QC 2CBTA 5K33A 1RZIB 3FNKA 4JRWA 3L1OH 4Z95L 5E2TH 4OLVH 4U1NB 1JAEA 5TGBB 5C07A 3RI5F 4HG4J 4BFGA 1G7JA 1ZJBA 4UQ3A 4NQCA 4KVPA 4N0YL 1R0AH 2YD1A 1KZYA 2FR4B 2DD8H 1IE5A 2WBJA 1JZFA 3V0HA 4LARL 1N26A 5CD5C 2IQAB 5AL0A 1D5XB 5IMLB 3GMOB 4DT2A 3MV9E 5FHAL 4D9LL 4P5TB 1CFBA 4M1CC 5DO2D 1WCQA 4HJGB 5K1NA 35C8L 3NH7L 4JQIL 3S5LA 3ARUA 2ZCKL 4J7RA 1LQSR 4PP2B 5KS9E 1QASA 4FQ1H 5MP6L 1XGZA 1OCWH 2EDDA 4UT6H 2R56L 2QZQA 2Z31D 2WB7A 2OCCB 2OMYA 4HUNB 5FV1L 3N42F 1QW8A 1VACB 3MRBB 3I2CL 1AYRA 5AZ2H 3HZYA 3FQTA 2F54D 1ETA1 4ODWA 1ZT1A 2CCLA 5JPNB 1KGCE 1FIEA 1T2QL 4L4TE 1P84K 4P05A 2IAMB 1NJ9A 2WBXA 3MRIB 3QISA 4F92B 1FVCA 1UENA 5EG6C 1E9PA 3OF6D 2WPGA 4ZAKB 1NCOA 1XGTB 5GRXG 3MLZL 3SO5A 5K39A 1FGNH 1VENA 3DUSA 4P9HL 4DUWA 2I5YL 3CMGA 4V33A 3BCDA 4KQ3H 3FCGA 4ODTH 2VM9A 3DIFB 1DBAL 3J07A 2JQZA 1OW0A 2VMCA 2Z35B 3MOBL 4PCKA 1MJJA 4NNYB 2B5IC 4H4NA 5GSRB 2A9BA 5DEGA 3SDYL 3SKMA 3P4MB 1I7RB 1RVFH 2OZNA 4KK8C 3SPIA 1KGJA 4NC1C 1MCOH 3QGVA 2R1XB 2UXVA 5DC4B 1B9KA 3NSJA 3P02A 2R0KL 3RTLA 5DA0B 4B9CA 3VU2A 3CLEH 3GSWA 5E1HB 3GB7B 3COOA 1DSFH 1DQDL 1V7MH 2WLLB 1YPZE 4L37B 3CTTA 3B9DA 5TQ2L 1CDIA 1MW1A 2X7LB 2Z4QA 4KNSA 4X80H 3BVWA 4DP8X 1WWCA 1AD0B 2C9RA 5TDOB 1DVFB