1TEGA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Plastocyanin, chloroplast
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 A and 1.96 A resolution, respectively.
rcsb
source organism Spinacia oleracea
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tegA00
1KCBA 4G72B 4YL4A 1WAEA 2ZXWB 3QJRB 5F7AA 1GS7A 1CYWA 3X1BA 2XV2A 1OF0A 3RYMA 2BZ7A 3NJGA 1W6WA 2FTAA 1JZIA 4DP8X 1ET7A 2QDWA 1GS6X 2W8CA 1L9SA 4GYBA 1SF3A 3PAZA 3DTUB 1BQRA 1FWXA 3NJJA 4G70B 4KNSA 1M56B 1YLBB 3X2QB 4CSZA 3H4HA 1A65A 3NSCA 1NIEA 1NINA 1SF5A 1SHWA 1JZHA 1ETJA 1AZNA 4HIPA 2WSDA 3FPXA 1AZUA 1M57B 3UAAA 4UF7C 5B1JA 1AZCA 3U25A 1X9UA 2AZUA 1I53A 3IE9A 3WKPA 3T6WA 4GP5B 1OCOB 4UANA 2XX0A 3EH5B 3ABKB 2PPEA 2CAKA 2ZOOA 2I85A 3TASA 3OD3A 1UATA 1IKOP 3DKHA 1WS7A 3UACA 3FSZA 2UX7A 4YSTA 1GY2A 2I7OA 2N0MA 1E5YA 1OE1A 3HB3B 5EHFA 4E9VA 4QLWA 1QLEB 3FQYA 4P5SA 1PZBA 2QDVA 1GS8A 4ENZA 2TSBA 4MFHA 3TA4D 3BVDB 4NB7A 1ILSA 2XLLA 3D12B 4BWTA 2TSAA 3CVBA 3S3DB 2FT8A 3MBWB 1M9WA 4X4KA 4DPBX 2X87A 1OCCB 4WKXA 3DIVA 4JHUA 3ABLB 5I5JA 2UXTA 3H56A 1KDIA 4YVNA 1PLCA 2PPFA 2HXAA 3PLYA 3HEIB 1BYPA 2RACA 2CCWA 3UGEA 2XYBA 3SQRA 1AS8A 1JZFA 2ZONA 1V55B 2CUAA 2IDTA 5I6MA 4DP9X 1L9PA 1RKRA 1GY1A 1EZLA 4YSAA 1JZGA 4NERA 4F2EA 2AFNA 3ERXA 2YAHA 3ZBMA 1GW0A 5F7BA 2OCCB 4FAAB 1E30A 3T6ZA 4A66A 1N68A 4PAZA 1BEXA 2B3IA 1AG0A 4YSEA 3X1NA 4YSDA 3TBCA 2PLTA 2BHFA 1ADWA 1ILUA 2FQDA 2QPEB 1FA4A 4CSPA 2ZWNA 2IDQA 5I26A 1XB3A 3TBBA 1PMYA 2BWIA 3S3BB 1JZJA 2QT6A 4BDVB 4HCIA 4E9XA 3WNIA 2HX8A 2GI0A 4GP8B 2JFCA 1MZYA 3V9EA 5E9NA 1BXVA 1SNRA 2GIMA 3WI9A 3CVCA 2J56A 5TK4A 6PCYA 1JZEA 3CDZA 1R1CA 2PP9A 1SDDA 2E86A 1AACA 3ABMB 5TK2A 2YAFA 2BP8A 3FU8A 5AKRA 5PAZA 4WTQA 2HLEB 1A3ZA 3AG2B 4KOCA 2AZAA 3KW8A 2Y69B 1J9RA 4W1TA 2VSMB 2Y1AA 5B1AB 4HCGA 3QPKA 1A4AA 7PCYA 4UAHA 1MG2C 4A2DA 2MRYA 3NJNA 1PNCA 4N8UA 1NIFA 1OV8A 5I6OA 3UADA 4F2FA 1HAWA 2WO2B 3IN0A 2CJ3A 2BO0A 3N55A 2FWLB 1PZCA 5B3SB 1BXUA 4EF3A 4E9RA 3ASOB 1OOWA 1ZPUA 4KNTA 2YAOA 3ZDWA 4GY4A 2R7EA 1J5CA 1NIBA 4PCYA 3X1EA 1TKWA 5LDUA 1MZZA 2UXVA 3WKQA 4AKOA 1W8EA 3SBRA 2FQFA 5B1BB 2DYSB 2YAQA 1V54B 4RH4A 6PAZA 1KYAA 4HAKA 1L9TA 3SBPA 1KV7A 2DWSA 1PLBA 4KO5A 2DY2A 2FQEA 1AOZA 4Q89A 2J5WA 5IY5B 1E67A 4YVUA 2A3TA 4G7SB 1XMEB 2IWKA 2H47C 1OE3A 4AX3A 3AG4B 1NZRA 2P80D 3MX0B 4DPCX 9PCYA 2EILB 3OMAB 1L9OA 2FQGA 4JKNA 1AIZA 3EH4B 3SBQA 3PAUA 2Q9OA 4BWWA 4TXVB 4E9TA 5I28A 3UAEA 4BXSV 1NDTA 2DYRB 2XV3A 1E5ZA 5B7FA 4A2FA 1ET8A 1OCZB 2EINB 4AZUA 3V9CA 1X9RA 5FC9A 8PAZA 3QJQB 3WIAA 5PCYA 2BW4A 4DP5X 3S8GB 1A4CA 1L9RA 4G7RB 3N2JA 1T5KA 4BK5C 1QHQA 1CC3A 1FFTB 3T6XA 1KDJA 1HFUA 2Q5BA 2MTAA 4HHWA 1ASQA 4E9YA 2XXGA 1BYOA 5B1KA 4F7KA 2GC4C 1V10A 4YSSA 5A7EA 2VSKB 3FU7A 3FSVA 4G71B 3AZUA 1URIA 3AW5A 3OMIB 4ZK8A 4HALA 2IDFA 4W9ZA 2OJ1A 2JXMA 4BWUA 4AKPA 1BQ5A 2XVBA 1NIAA 3NJIA 3PCYA 1TEFA 3GYRA 5I6LA 4KO6A 2YXWA 2BP0A 3NJHA 3QJVB 4KO7A 3FT0A 4E9WA 1AZBA 2PPAA 3T9WA 2PPCA 1BQKA 2VN3A 1CYXA 2YARA 1J9SA 4A2EA 4KO9A 2UX6A 1GSKA 1WS8A 3EH3B 3ABGA 1DZ0A 2B08A 2VM4A 1E65A 5B7MA 3CDZB 3KW7A 2PCYA 2HRHA 1AQ8A 1AS6A 1SDDB 1ID2A 3QJTB 1JXFA 2X88A 2PP7A 2VW7A 7PAZA 2HZHA 1IBZA 2BP8B 2VM3A 5AZUA 5I5MA 2GC7C 3JTBA 4A2GA 1HAUA 1GYCA 3QQXA 2YAEA 1JXDA 3NSFA 1AS7A 1SFDA 1KGYE 2VW4A 3UABA 2IDSA 1N70A 1A8ZA 2AVFA 3S3CB 2HX9A 2XXFA 1CURA 2IH8A 1JOIA 4DP0X 3C75A 3CVDA 3NJFA 3OQRA 3G5WA 3AG3B 4E9SA 2R7EB 3EF4A 1ASPA 2EIMB 1KBVA 2DV6A 1W6LA 1AR1B 1RZQA 1JERA 1PNDA 3EHBB 1PF3A 2GBAA 1TEGA 4FA7B 1PZAA 1KCWA 3S8FB 2GB2A 3AG1B 1WA0X 2YQBA 2IWFA 2EIJB 1JVLA 3X1FA 1VLXA 5I6NA 1GR7A 2IH9A 1SFHA 4JHVA 1JVOA 2CALA 4YSRA 4DP4X 2DWTA 1PCSA 1SJMA 1A4BA 2AANA 1EHKB 2GHZA 4GP4B 1ZV2A 4YSQA 4L0PB 4DP7X 5D4JA 2HX7A 2H3XC 3IBOA 1PY0A 5B1JC 4GXFA 1RCYA 5D4IA 1J9TA 1XB6A 2I7SA 2YAPA 2OV0A 1BAWA 1ZIAA 1DYZA 1ZDSA 1NIDA 2BW5A 4KNUA 4DP1X 3ASNB 1IBYA 1MDAA 4DP2X 1TU2A 3X1GA 2WO3B 1MG3C 4BXVA 1WA2X 1L9QA 4HHGA 2BWDA 3ZX1A 1AANA 5I6KA 2UXFA 2EIKB 4A68A 2J55A 1IC0A 5B7EA 3TU6A 1SHXA 1NTDA 2PP8A 4DPAX 2LLNA 3PPSA 4YSOA 2W88A 3T71A 4HCFA 2HRGA 2XX1A 4G7QB 1CUOA 1AAJA 4E9QA 1NPNA 2JKWA 1OE2A 4AI7A 3WNJA 4M4RB 3PAVA 3NSDA 2QPDB 4DP6X 5I5IA 4N4YB 3FU7B 1IUZA 3T6VA 2VMJA 3H4FA 2GSMB 1JXGA 3IEAA 3PXLA 3GXUB 4NAJA 3FYIB 3JT2A 3NJLA 3AY2A 4Q8BA 1ZDQA 2YAMA 5AFAA 2IWEA 3WG7B 2H5UA 1WA1X 1QNIA 3CZUB 2BP0B 3FU9A 1B3IA 1NWOA 3FSWA 1J5DA 3OM3B 2J57A 3NSYA 1KBWA 1OCRB 1AZRA 5D4HA 4HZ1A 2FT6A 3ZIYA 2XU9A 1PAZA 2PPDA 2XWZA 3NJMA 3L45A 3BQVA 4YSPA 2NRDA 1J9QA 1NICA 4A2HA 4YSUA 2IAAC 2FT7A 1NWPA 2IDUA 1BXAA 1PLAA 3FSAA 3FS9A 4AKQA 1AG6A 1F56A 3OMNB 4BDVA 2UXGA 3IN2A 2FNWA 4QKTA 5I6PA 4KOBA 1ASOA 2BZCA 1NPJA 3FYEB 4M3HA 1RZPA 3GDCA 2CBPA 3NT0A 3NP4A 4YSCA 1ET5A 2YXVA 4P5RA 1XB8A 2P80A 2VW6A 1ZIBA 2PCFA 3CG8A 3NJKA 3NP3A 3QJUB 3FQ1A 4A67A 3FQ2A 2XV0A 3NYKA 5ANHA 4K9JA 2FJSA 3QJSB 3FPYA 2XUWA
chains in the Genus database with same CATH superfamily
3KPPA 3APNA 3RVXC 3BKYH 3APMA 1ORQB 2F5AH 4G9FB 3VX1A 3BE1L 5EEYA 1W0WB 5EC1B 3W1ZA 1OF0A 2ZAGA 3WE6B 5E8PB 4CMMB 4ZMNA 4JRXD 5IGXH 2OK0H 1USQA 5C6TL 3EOYG 3KYOB 1FJ1A 1BZEA 5K39A 1AKPA 3TZVC 4FHKA 2AITA 3OKMA 1PJ9A 3MAWA 3ULVF 4UOW0 4LU5H 2XPYA 1E0OB 3VXNA 1L6ZA 5DK0A 3BISA 1BM3H 4Z7UE 2UZIL 1IO4C 4KRLB 5HDRA 5F9OH 1XO8A 3N44B 1N8ZA 3WFBL 3MLTB 1IL1B 3B2UC 4Z7WF 3D85D 2NY1D 1SYVA 3SHSA 3L3IA 1KN4H 2PPEA 4Z23A 1NMBL 1JNNH 3LZFL 2NDGA 4GMTH 1IKOP 3RX9A 4LEOB 5C2BL 4YSTA 3A4FA 4Y9BA 2NY2C 3MNZA 2K9UA 3BUYB 5EHFA 4E9VA 1SOQA 4YE0A 1PSKL 4DGWC 4H2CA 5AZ2H 4UMGA 4X8JB 4WTZA 1PZBA 4GAAA 2EVFA 4AQOA 2YGOA 4DVBA 2G9KA 3BVDB 4M7LT 5EZOL 5AB2A 1NGXB 3SOBH 2JKIS 2VUKA 1AHWA 2X4TA 3RWCB 4FNSA 4FNRA 3TF7C 1SDAB 1X5HA 4ELMB 4LOVA 5BV7C 4UT6L 4XVTL 3BI9X 4AVJA 1RUKH 1CLYL 4WJG3 1RPUA 3Q8CA 3ULVL 3PIQA 4JPKH 3NJVA 3ECBB 3QHFL 1ZKAA 3VFOB 2XA8L 5CGYC 2OCFD 2XN0A 2Y36L 1U8CA 2ADJB 4U2ZA 2E6JA 1J1PH 3MR9A 3S37X 1FFOA 3RUGA 4N2FA 1L9PA 3LZLA 4EUPG 3BZEB 1UJ3C 4JDEA 1VFMA 4XHJD 3I6LE 2BRRL 4N0UB 4U05A 2WXGA 4F37K 3AQXA 4PJFE 1T04A 1F8TL 1A6ZB 2AK1H 2A2QT 6TAAA 4L4TA 4QYOA 2P8PB 1XSIA 3TH3T 1KLFA 2XG4B 5JO5B 2EIDA 3O2WL 5J6GB 4JG0H 2VR4A 1N6VA 3FRUA 4JANB 1HHGA 5FHBH 4KK9C 5E5UB 4UQBA 3D39E 2XPGA 3V4UH 2QPEB 1WH0A 2X0WA 4HSCX 3U4KA 4BQ8A 1RHFA 4WK2B 1DQJA 5IIEA 1D6EB 2ZWNA 3RVWD 4XX5A 4TLTA 3DX9B 2DMGA 2JVUA 4LBEB 3RURA 1PMYA 5DVLA 3QEGH 4GT7A 4JAMA 3BD4A 2GQHA 3FJTA 3GT6A 3P73B 4RGOL 2Q6WB 2A9ML 4NHCH 4J3BA 4ANUA 3ZL4H 5EBLA 3TEXA 4LSPL 3TVMB 1K72A 5CP7A 4L9LA 3FO9A 2WW8A 5AAWA 2X3BA 2XQBL 4OM0L 3HRZC 1LK2B 3CCHB 2EDNA 6PCYA 1OGTA 2H6OA 1YNKH 4LCUB 1KELL 1LEKA 3MOAH 1T1YA 1XL6A 2DEWX 4NOFA 3CAFA 3FQNB 4DEPC 4LLDA 4KMLB 4WEUD 4WSGA 4AXWA 3BH9B 4FNLH 1XGTB 1PQZB 2BFGA 2BSRA 3PWUA 3LKOB 1OSZA 4HFWB 1Z5LA 4N8UA 4NWUH 3ESMA 1G7QA 1C5DB 2UWEA 3C6LB 1JRHH 1ZS2A 2BPBA 3D08A 4QT5B 1MLCA 2H2PC 3GKWH 4OZIE 3CFCH 5TF0A 5EUKA 5JOPD 3UPRB 4KX7A 5T3XH 3JSSA 4Y7MA 2V3DA 1DJWA 1IU1A 3OKDB 5FUCC 3SQOH 5IHWA 3GZQA 3FTVA 2WWKT 3RNKA 4HS8L 4NEHB 4R7NA 5HGHB 3VFRB 5IMKB 1X5GA 2O5YH 1GOHA 3T4YB 5L9DL 4M5ZH 2DTMH 4QHKI 3SODB 3KPSA 4AQAA 1SN0A 5MEPA 1HK6A 3C60A 1PPIA 5ELIA 4Z18A 1IKFL 1SEQL 3NZHL 3GGWA 1IC7H 4P4RB 1KCVH 3KLHC 5EC2A 4RMBA 5FB8A 5J1SC 5C09A 5I9QC 2IMMA 1DJGA 3KPLA 3MXVL 3QO1A 4NQQA 3S8WA 1BHGA 3ZR6A 5D2NE 4AK1A 3D4YA 4JY4B 5C7XL 2YPLA 1PKOA 3HZVA 3GHBL 1KEML 4MJJA 2L7QA 3MDJA 4YDKH 4TULH 4PJGA 3RWEA 3U4BH 4GEJA 1OM9A 3EH4B 4U1KB 1MFCL 1DLFH 4L3FA 3UYRL 3ARWA 5CN2A 1J86A 4M62L 1ZD6A 1KC5H 4WKZB 3WHE1 4LSSH 4DHLA 3JUZA 2XZQH 5ESQA 3UC2A 1MFDL 2X9YA 2CRMA 5I8KL 5B7FA 4NQCE 2VQ1B 3RVXD 1S9YB 4NUJB 1FNSH 4AZUA 3N85L 2CA3A 4KZDH 2APVA 3OR6A 4WU7B 4Z5RB 1RZGA 1KENL 1QFPA 4HIEB 4N0FB 1J5OL 2FATH 1H8SA 4X9IA 4YDVA 5DD6A 1ZLVK 3T6XA 4UDTA 4KVNH 3C6LD 2AV1B 2IC2A 4YXKH 1EUUA 2XTSA 1WBYB 2BIPA 4XWOC 4YHZH 3I50L 5IROA 4S2SA 2DQJL 5KJRH 1A7PL 3HPJA 4JRXA 2C7UA 3FU7A 3TEYA 4UNIA 4I13B 2YKLH 1G7JB 3QZWA 4OF8A 4BELD 4G7YL 2JWYA 3A4EA 3CN4A 1KPUA 3RP1A 3QQ9C 5FXCH 1QUPA 2ZX7A 4WI7A 4EIBA 4XBEH 1R6VA 1RJLA 2XVBA 5CEZD 5ECGA 2VDQH 5I6LA 4F15C 5KYXB 4RRPA 4WI4A 3UH8A 2BIIA 3VTTA 3RPBA 2CHXA 1J5HA 1U41A 3HHSA 4TUKL 5D1XB 3U82B 4Z3JA 3NCBB 2FLMA 5EZLB 3KPQA 4D0DB 5E5RB 5KW9L 4TVPE 1YEIH 1NMCC 2DM4A 1H6FA 5EO9A 3N40F 2H1PL 4PWKA 3VWJC 5JIDA 3UAJC 3ME0B 4KZEH 3QR0A 2L04A 2YGVA 3ARSA 2YEVB 3SY0A 3VJ6A 1NDGB 3CTTA 2C3XA 1QSEB 5LGHH 2HZHA 3HZKB 3DX2A 4OD1L 3HI6H 4OD2A 5AZUA 3D5OF 3PHQA 2OA9A 4AENB 3CMOL 1E4XI 4AJVA 1IBFA 1KGCE 1Z3RA 2HN7A 1N6QL 5CGYD 2WBKA 1KNOB 2FRGP 4OZHF 2VKXA 3UABA 1F41A 2OSLB 4UINH 5E2TL 1J8KA 1YNTA 3PP3H 4M6NH 3LN4B 3RX5A 3CSFA 5DK2B 5IT2H 2HX9A 4UQ9A 2VSCA 4MA8H 3EXLA 4XPHL 3PXHA 2ESVE 1ORQA 4G9FA 2WQSA 3CV5A 5EC1A 1G9EA 3UZQA 3B2PA 4LFHG 3LEYH 3WE6A 2WYZA 5E8PA 4OVVA 4W9KC 5DDHA 1RZJH 4CC1A 2DRUA 1AC0A 1UD4A 3KYOA 3OR7B 4GBXC 5CJBA 2QGDA 2UY7B 4FA7B 2ALWA 1YDPB 4G1MB 2BNQD 3IGAA 3IDGB 4M1GH 1IC1A 1XQ4A 4O02L 4ZUSB 4O58L 3QE5A 3ULUH 3CE1A 2CDGB 2JQAA 5JYMA 5DT1H 1PCSA 3H6AA 1DBKL 1GMIA 3IE4A 2I9TB 3IRCA 4P06A 4Y19D 3MLTA 3NMEA 1PDKB 1ZV2A 1IL1A 3ZOAA 4Z7QB 5I71B 3I2CH 4P3WA 3NZUA 1T5WA 3L4ZA 1CD1B 5D71L 2I7SA 1GZQB 5EU6E 1AJ7L 2FAUA 4LEOA 1NUDA 2VDMH 4R8WH 4XPBL 5EA0H 1NIDA 1XF1A 4HZLB 3O6KH 4L23A 3NSJA 2H8PB 4A1RA 4RGNE 5I1JL 2F1AA 3J27A 1VZIA 4ODXB 5FAAA 1CFBA 4BXVA 4HHGA 1AANA 1NGXA 3ZUCA 1T1WB 2J8HA 3O2DA 2RFXB 3RWCA 5E8EB 2EDHA 2UY6B 5DO2D 1MW1A 5IJKA 4ELMA 2AQ3A 3EJUA 3C08H 4NKMB 4E9QA 2AQQA 5F1KC 2Q7AA 3KEDA 2H2PD 15C8L 5EMYA 3WNKA 4OF6A 1A6TB 4KK8D 3ECBA 1YSOA 5J1AA 2R0ZL 3AXLB 3VFOA 2ZXAA 2CK0L 4PJBB 4L3EB 1L4IA 1S7TB 2ADJA 2B2XH 4MCNA 3EJQA 4LPWA 4UTBL 3SPHA 4FG2A 5IBUG 2PYEE 5J9PB 1CF8H 3DRTB 3MOQA 4UAOB 1GPOL 4C54A 4QTIH 3BZEA 1JXGA 2DQMA 2R69A 4U6VL 4PIBA 4MZIA 4N0UA 3K2IA 2KLRA 2CR0A 1A6ZA 2F8OA 5K9KB 4F7MB 2BP0B 2DS4A 2V2WB 3KLHD 1KBGL 2XG4A 4RAVB 4Z7WE 4NZTL 3FQRB 5DVPA 3QUYC 5JO5A 1P84K 2X40A 4JCLA 1T89C 5AZEH 5AENA 1ITCA 5I73B 4JANA 3DA0A 5D4HA 4W9JC 3HPLA 2O5XL 3ISWA 3LIZA 4L2LA 1P4BH 1ZMYA 3M7OA 4MKTA 2DQHL 2MCPH 4FQQB 4WLCA 3LS5L 5ESAB 4WHYH 3DX9A 3IDUA 4Q9RL 5AW4B 2FD6L 4D3CL 1YYLL 4K23H 4LGPB 4BQ9A 3UAFA 4DT2A 1F56A 1CLZH 3U7WH 3U4EB 5HYSG 4GLRI 4UV4L 3AGWA 1IX2A 3P73A 2HRPH 1H9DA 2Y7NA 1Q0XH 2Q6WA 4BFJA 3I74A 4XOCA 4YBHA 3QH3A 5LN8A 3N43B 3QBTB 3VSQA 3O2DH 4M8RA 4JB9H 2NTFB 1O6SB 1LK2A 3FQ1A 4X6CB 3CCHA 4KY1H 2W0FB 2NNRA 3VFMB 4TLSA 4LCUA 4WJKB 5FKAA 3O0RL 5L6YL 3C5SA 2WQ8A 2FJSA 3QJSB 2Q8BH 3ZUNC 1SMAA 3A6OA 3FQNA 3GZKA 1MI5E 4AVIA 3P69A 5HJGA 1WAEA 2ZXEB 2VDLL 1F58H 4XWOD 3QJRB 5F89B 1HDMA 3BH9A 3BSZL 1XGTA 1TNMA 1INQB 1M2OA 1E8YA 2AQRA 3RYMA 2XWXA 4L3ED 5DC0A 2WKLA 1KF9B 2FWOB 2QVMA 2R69H 2VLJD 1UB6B 3LKOA 3FKUS 5A2JH 2LU3A 3D09A 1C5DA 4EZMA 4PRHE 3C6LA 4HBQA 3QQ9D 4M7LH 4I77L 4YDLC 3F00A 4QT5A 1SF3A 5ALCH 1XH0A 2CZNA 4F1ZA 3VSUA 2WXNA 3UPRA 1QVOB 1UKQA 5D1QB 2CM6A 2OTPA 1WFJA 4LO9A 1FHNA 1CU4L 1G7MB 7FABL 3K6NA 3OKDA 2A74C 3LIZH 4XVJL 2CKBL 5J8OA 5DJAB 1T21B 3VFRA 5IMKA 3K4ZA 1NGPH 2KPWA 1AZCA 2R0WH 3S0PA 3T4YA 4PYGA 1RHHB 2XX0A 4H8QA 2NNXA 1NCBH 4MNGB 3VWJD 4TRPH 4P4RA 2CPUA 1UATA 1QASA 3DNKA 4NP9A 2FBJL 4K71C 2IH3B 3GZOA 3NIGB 3A6CL 5KSBA 2K8QA 2ZPKL 3HB3B 3FUMA 1VADB 5LGJA 3OJDB 3VG0L 3AREB 2B9AA 1MCQA 3KPRE 4JY4A 2VRKA 3CSTA 1I9JH 4ZMVA 3DVFA 1BZ7B 1SJEB 1QTSA 1G5AA 3A6BL 5ADPL 5EU7E 1AHKA 4P2RE 4M1DH 1E8XA 1BBDL 4WKZA 1BQSA 4P2QD 2HB0A 4J28A 4BYHA 5KS9A 1DJZA 3B9AA 5FWQA 2VQ1A 5FA4B 1S9YA 2C7FA 5DZPA 4UV7H 5CEXB 2WWKO 2HXAA 3PLYA 3UC0L 4IOIB 4G6JH 1LTXA 3LYRA 4WU7A 3SQRA 4ZNEE 4Z3IA 3CVHL 4GBXD 4HIEA 5HGBB 4B97A 5ID1B 2WGXA 1CDYA 2MH4A 1D9KC 1ODUA 5F70A 4ZUVB 1WBYA 5FCSH 2Z92B 1RLBA 5AOMA 4JFOA 5HI5C 3WMPA 5SWZD 4FTVE 5D1QD 5AUMB 4XB7A 2W80C 1N0XL 1B0WA 4MMXB 5EWIH 3TBCA 1UQSB 5F7YC 1VKXB 1MHPH 3CDYA 4BUGA 1CR9H 5CEZH 2BNQA 1HHKB 4WGVB 4I0PB 2JLLA 4JJ5B 4ZTPL 1J8HB 2YD6A 4C4KO 5EU4B 4FQCH 1XCQB 3LD8B 3M1OA 1FI8C 4J12A 2WUBL 3SB3A 1JZJA 4Y2OB 2D03H 2GI0A 5FYLL 3VXSD 4B9ZA 1MRCH 4QHUA 4D0DA 4DNLA 3HB3D 2WWMC 3MLXL 1BXVA 1U2HA 1WFMA 4AW4A 4XPAH 3VGBA 4EN3B 3DTDA 3REWB 2A73B 5KANG 1E5AA 3OXSB 5IP4A 5J57B 3N9GH 3H55A 2OYMA 1IGML 2ZCHH 1EEQA 3ME0A 2O93L 5BPPA 1K3IA 4M5SA 5IKCB 3RL1A 1LP9F 1NDGA 3WNNA 5SWSE 2KBGA 3HZKA 5D7IF 4K3EH 1DQLH 2OFQA 1OAQH 5E8OB 2J8UF 4AENA 4BKTC 1KULA 1QUNB 1FNLA 4KDVA 5AKTA 2EUWA 4WW2C 2F7OA 1MIEH 1KNOA 4UAHA 5A43C 2NXZC 4D0CB 1D2PA 1KWGA 2D4DA 2OSLA 4YXHH 4EOWL 3FBKA 4M3JA 4XC3H 5CSZB 2VDOL 3FUIA 1DDHB 4W6XB 5T3ZD 3BT2L 3LN4A 5C3LD 1GYUA 4UM8B 2FVNA 3FZUC 5DK2A 5B3SB 3HLKA 4D0BB 3UTTB 1JYWA 1T4WA 1W8OA 2RIKA 1VZHA 1CXIA 4AV4A 2WQVA 5HDQH 3S98A 3WTSA 3GSRB 1IEBB 4L8SC 4NAMA 5TFSL 4HV8B 5CNHA 3X1EA 1A7QL 5E4EB 2UY7A 2R0LH 3HMXA 1YDPA 4JCMA 4UCFA 1AD9B 4UIMB 5HI4C 3SDXB 4Q9QL 3IDGA 1WJ3A 3MROB 4I0PD 3CQFA 1J8HD 1EEZA 3RWDA 3JWNE 4ZUSA 1KV7A 4C55A 1DJHA 3LVEA 5E7FA 2GY7B 5EBGA 5I1EL 1QWNA 1K6QH 3CHPA 1PDKA 1QW9A 2GTZB 4MQXC 4OGAC 3P77B 2GSIA 3IJ8A 3AMLA 3F6IA 4KUZH 4LSVL 1HTYA 1P53A 1DO6A 3VXPB 5I15L 3LJ3A 3DX1A 1CD1A 4Z7VA 1GOFA 3UERA 4DKAA 1GZQA 2DH2A 1KGWA 2Z8SA 1KB5B 4H0GA 4GIPD 1X5YA 2CDFB 2QTVA 1CDIA 3FMGH 5FCUL 1YN7A 1LD9A 1CXHA 4R5TA 3MBXH 1U95B 1NOFA 3KWVA 3LRHA 2CSPA 4HZLA 4OZHE 4Y4KB 2DYRB 3P11H 4CRPA 1T1XB 2H8PA 4L18A 3EO9H 5BUAA 1OCZB 4RIRB 2JJWA 4AC4A 5FC9A 1SDYA 1T1WA 3L4CA 2BC4B 2GW5A 2RFXA 2Z0UA 4A6YL 2WWNA 5E8EA 3HZ3A 2UY6A 5CUSH 4I3GA 1AKJD 4KH2A 3TFBA 1T5KA 4BK5C 4ILDA 4UILL 4NKMA 2DMBA 1CVRA 4KKAD 4BHUI 1HX0A 2W94A 4OU3A 3WXWL 1A6TA 2B59B 2B5IC 3AXLA 4QF1B 4L3EA 2FHCA 1BGXH 1GGIL 2CWRA 2VLJA 3ZJAA 3BPLB 3CZJA 5D7LD 4HMDA 4OLUL 3SOTA 3REVB 2XA3A 2X70B 3DRTA 3HMXH 5LNEA 3MRLB 4JHZA 4HJJL 3SDAB 4F8QA 2WLYA 2UZPA 3SCMB 5HDWA 1EDQA 3CXHJ 1OTSC 5IB2B 4U1NB 2ERJB 3NJIA 2EDJA 4TM9A 1I7TB 1E2ZA 1NCDL 1UWXH 3S3SA 2VDPH 3QAZC 4F7MA 5CD5C 2BP0A 2V2WA 3QJVB 4RAVA 3FQRA 2B0SL 3LKQB 1JGDB 2XG5B 3RVUD 1HINH 2CBMA 3QXDB 3T0DA 3MNVB 5CHNB 1V7ML 3N1FC 3PP3K 4XXCC 3UFIA 5HYJE 4GQ9H 5LDSA 4Z95L 1PKQE 3VWJA 5LBSL 5ESAA 5G2NA 2B08A 1UWEL 4XNBA 3VFUB 2ARJQ 2HRHA 4WEBH 1AS6A 4MTMA 1U3ZA 3V7AE 4G6FD 1OZTG 3ZXAC 1IBGH 2IVFC 3P2BA 4Y4KD 3VNYA 2G4GA 5I1DB 3G6JB 1EGJA 3TONA 2NTFA 1HXKA 4FERA 4X6CA 3MKGA 4HK3J 5AVQB 5I8OH 5B3JE 5IG7B 2W0FA 3VFMA 4HUMB 5D7EA 3KLDA 3S3PA 1MFEH 1SBBA 5F6IB 1BJ1H 4LVOB 1ML0A 1R0AH 3MV9E 5EB9A 4JY6B 4Y5YB 4JK0D 2IBBA 4PREB 5HDOA 3D69B 4HIHB 1LO0H 1JOIA 3CVDA 3DUUB 2IGLA 3N0AA 5E6UB 1INQA 3HG4A 1R5VB 3UCRA 2WXRA 4GBXA 1OGSA 2FWOA 4HC1A 3WKMH 1UB6A 4LL4A 4G8EB 1AR1B 3RL2B 3MTXA 4CUCA 2Y07H 3F7YB 3SDAD 4K9EH 3JV5A 1JE6A 1KY6A 2FB4H 3H2QA 5DS2A 5SWZA 1CLOL 1QVOA 4HUUB 5D1QA 3RY6C 1B9KA 5IBTH 5C07B 3BFOA 1G7MA 2CLZB 4PBXA 5IFAL 1EHKB 5DJAA 5EIIB 1FPTL 1KYOJ 1T21A 3V6OA 1YQ2A 4M61B 3E6FB 4YMPA 5LQBL 4EIZC 2CR3A 1C5BL 4UWQB 2Q8AL 4LIQE 3Q5TA 4XP9L 3EYUH 3Q8AA 4MNGA 4Q74A 2OR8A 1IFGA 1Y18B 1HT6A 3VXSA 2ODHA 4J8RB 2CH8A 2QV4A 1PD6A 2VRAA 3ARFC 3BAEL 3MQIA 4WEEA 1DO5A 1VADA 4TVUA 3ASNB 1EGJH 4DP2X 4ELDA 4NLAA 1EFQA 4I7ZC 2XN9B 4PY7B 5TE6H 3IJYA 2CRZA 4GW5B 2YQGA 4HF5H 5D2LB 2OCJA 2BERA 3MX0A 4A68A 4NCC2 1NBQA 1BZ7A 3B9EA 1CTOA 4XAWL 3G5ZB 4NIKB 3MBED 5TJWK 3FZUD 3EH1A 3QUML 4P04A 5C86A 1TZIB 2W9DL 4EKXA 1A66A 4C8XA 3SGJC 3MRPB 3OG6B 3M86A 4R7DB 3PS6A 5FA4A 1RD6A 5DJ8B 4V11A 2A77L 1FE8H 4FFYA 3JWOL 3MUUA 3CFKA 5CEYB 4ONFH 3EUUA 2DPKA 4NO3A 3CUPB 1NCWH 5HGBA 1I8AA 4NQUA 4F9PA 2YBRB 3QYCA 5ID1A 5FLUA 1P7KB 4GSXA 3S37H 4ZUVA 3RDTC 4O5LH 3CIQA 3K1DA 3GMRB 4IMKC 3KJ4C 3S4SA 2GSGB 2Z92A 5T1LB 2NX5E 1T89A 2OSWA 2YEQA 5AUMA 5E4IA 1FGNL 1UQSA 5JUEL 5EU3B 4YBLC 1VKXA 1FO0A 4HIXL 1BVNT 1HHKA 4P5TB 5EF3A 4I0PA 4JJ5A 3U1PA 1J8HA 5G55A 1NDMB 2NRDA 4P8QA 1S7VA 5EU4A 1XCQA 4IBSA 3UG4A 4A7UA 3MV11 1JZDC 1CDBA 2IDUA 2DLFL 1BXAA 4GAJL 3FCSB 3TO4B 1CBVH 4Y2OA 5FECB 1AG6A 4X80H 1BREA 4LVNB 5I6PA 5F3FA 5IT2L 1A2YA 4KOBA 2LQRA 1JPTH 1TJIL 2ORBL 1BZ8A 3FN0L 1RZPA 4WAFA 1WQVT 2D8KA 4K8RL 3LH2L 4U1HB 4WTZG 2XRAH 2FIKA 5J6HB 3REWA 2MTPA 3QDME 1MAJA 2A73A 4MJHA 5CJOL 5FYLE 2Q86A 3T0BA 1KLGB 1IGJB 4ZO6A 1YZZA 4P05A 3QYMA 3HNTH 3MCYA 4IDLA 4MWFB 3PP4L 3SJVD 3NYKA 2WNGA 5IKCA 3Q1SH 3PV6A 1MLBB 1U8OA 2ZG1A 1KN2H 3PY9A 1TTGA 4L4VD 5E8OA 1M9SA 1IVLA 3FW6A 4G72B 2Q10A 3BD5A 4MJ2A 1QUNA 3MXWH 4FFYH 1LE9A 3FUEA 4XWGH 1EHLH 4WV1C 1BVKB 3R1GH 4IKLA 5F7AA 5T3ZH 5D5MB 4D0CA 5HHQB 3ZDYB 3MI6A 2P5WD 2K70A 3NCJH 5CSZA 1QSFE 1W6WA 2OR9H 4DQOL 3KPTA 1M3JA 6FABL 1AQMA 3DIDA 5MP6L 3TNNA 3GSXB 5DMKB 2ED8A 1OTSD 2AGJH 5I1HL 3CFDB 4FA6A 1SYSB 3DTUB 4FFVC 4BRJA 4PG2A 1E6JH 4XMLH 4XPGL 3ARPA 4YC2B 1QSVA 4UQ3B 4XMKH 5KSAC 5D7LA 5T1LD 4TNEA 3GSRA 4HV8A 4RZCB 3O3EA 1QFWL 4HIPA 1UM4H 4PJDF 2P5ED 2TRYA 4AC2A 4F2ME 2NSXA 1AD9A 1CQYA 1YEJH 2VMDA 2ZNWA 1NCAL 3GNMH 3MROA 4UIMA 2X1QA 5BS0E 4DWHA 2CAKA 2F9BT 4DOHB 5FM8A 2CIIA 1PY4A 4DETA 1CXLA 4NGHH 1Z9SB 2AXGB 1T7XA 2MCMA 3TO4D 1J1XL 3GMLB 3SY6A 1Y6KR 1IZKA 3AY4C 3FQYA 4MAUH 3LB6D 2AK4D 3CX2A 3P77A 3AABA 2EDTA 1LP9E 4MFHA 4FQ1H 3RB5A 1AYOA 3QUZB 5D7IE 2X2JA 3WAKA 4D9RD 4HIJB 2VZSA 1FRGL 3TPUB 2J8UE 1DSFL 1QBBA 3T0WA 2Q7NA 4DPBX 3MRFB 2AKRB 1IAIL 2ZX6A 4N8PA 1R17A 1MFNA 2UXTA 1QTYT 4Y4KA 3MRCA 3PFUA 1T1XA 4ZMLA 3VD1A 2OBGA 3FUNA 5DCCA 5I1CH 1CE1H 4OR1A 4QEGA 5E2VH 4Y16B 4RIRA 1N12A 2EVGA 1ZEAH 1IMHC 3D50A 3L5JA 3U7YH 1FFPB 4WO4B 1QTPA 1ZT7B 3MRBB 2BC4A 5A16B 5JHDE 4KKPA 3HS0C 1F3RB 3F7KA 3NFSH 4QKXB 2FYYB 3LKRB 4PRBB 1P1VA 2YD5A 1IE4A 3QPXH 4YSAA 1VZGA 3RU8H 4AL8C 3GUTA 3ZZLA 3W0WE 3RAJL 4A66A 1F3DH 2VLRB 5CJ8A 2Y4SA 3PWPB 1KV3A 4XN8A 4AYEC 4UZUA 3REVA 4I89A 2X70A 1YCSA 3NIFF 3MRLA 3SDAA 3FTWA 1DEEB 2H3KA 2N1TE 2FQDA 3SCMA 1M6OA 4ZAKC 1WFOA 1Q1JH 4U1NA 1UGNA 3KGTA 3HCVB 5D6DA 2EC9U 3KYNB 4JMNA 4AQ1B 4Z7AA 4H88L 3FUJA 4J6RH 1BZDA 4PJCF 5GJSL 3HC4H 2FCBA 5HHMB 3WNIA 2EE6A 3LKQA 1JGDA 5AVRB 2GJ6E 2XG5A 1IFRA 3QXDA 1YPZB 3LNGA 1EZSA 3MNVA 5E9NA 1QLFB 2GIMA 2V33A 3WI9A 5C1MB 1J18A 5FO9B 4QRPB 4KFMA 4G1EB 4K07A 3OC8A 3PGDB 1NEZG 3VFUA 2ENYA 1Q9LB 3QUZD 5E4AA 2MKWA 1YQVL 4MYPA 3CMGA 5DO8A 3R8BB 3S5LB 2I24N 1UB5B 1CGSH 4YE4H 4HU2A 1W15A 2JIXD 5FA3B 2ZT9C 3VXUB 2X0VA 2AZAA 5I6XB 3SO3C 5I1DA 3K72B 4FLOA 4C56B 4F80A 1OAKL 4Q6KA 1KPRB 3GTNA 4P5MB 4G8GD 1X7SA 4JJOA 2Y72A 5KBNC 2LGNA 3MBEA 2PW1A 1PG7X 2ZIDA 3GSNB 4OJYA 2FUQA 1A14L 1BOGB 2J3SA 4ACTA 4JY6A 4Y5YA 5LLIC 5BZXA 4PREA 5DJ6B 5AB0A 3D69A 4HIHA 5L2JB 3RDTD 1BVNP 3DUUA 2E5EA 4RSYA 2EEXA 4X83A 4XR8C 2K7PA 2VC2L 4A38A 1R5VA 3HA0A 4P9HH 1ND0B 3IJSB 4TN9A 2M8XA 5CGMA 5LO7A 3QZWG 1B2YA 3RL2A 1Z5YD 5AVXB 1MCWW 3HKFA 3QORC 2YAQA 2NOYA 3F7YA 2C3HA 2HH0L 5IUSA 1WDAA 4NLHA 3U6RB 4DESA 5ABZA 3IYLW 4XNUL 1BEYL 3SZKC 3MLRL 5FV2A 5I1KL 3D05A 4IQHA 4ZFGH 4C58B 2CLZA 2GI7A 2W07B 2JK5A 2K1MA 3LEXB 4LNRB 5EIIA 5JR1L 1XGYH 4M61A 3E6FA 4QRPD 3CPLA 3QQ4A 4FABH 2DW5A 1AXTL 3E3QE 1RY7B 3DGGA 4J8RA 5J13C 1MWAL 3SBQA 4BEIA 2V5SA 1CFQB 5HYIA 3GRWA 3IGKA 4TF4A 5AOLA 4MCMA 1B4JL 1MCBA 2EDMA 2XN9A 3QUKB 4GW5A 4ZOAA 5D2LA 5K1VA 3SJVA 1XGZA 3BGFC 3BPCB 3ETBF 3GS7A 4ANXA 2OKMA 4C56D 2JB6B 5L0QB 2EUXA 1GCFA 1F5WA 2R9HC 1A1OB 2DBLH 2B1AL 2F8IA 1UWXK 2HT3C 32C2B 4L4VA 5F7LB 1HYSC 4KUCF 1E6OL 4JPSA 4ATWA 1CL7I 3CIAA 1DBBH 3PHSA 1TZIA 4B6ZA 4FFVD 1WT5C 3MRPA 1ASQA 3MCKA 4PWGA 3BAWA 4F7KA 2EDRA 4RGNC 3S3JA 4Z9KB 4LHUB 5CEYA 4E0RB 3O8XC 4O51A 2DQ6A 2MQCA 3G04B 4Y8DC 4HT1L 5DUJA 3MUY1 1OAUH 2R1XB 5I16B 3FTGA 1P7KA 4D9LH 3G7TA 3QQ3B 4D9QE 2FSEB 2X41A 3GMRA 4GI9A 1HSBB 2RQEA 5JDJA 3WN5C 5JORB 3F05A 2GSGA 1ZLDA 5T1LA 4KO6A 3ZE1F 1FCGA 5SWQB 2YN5A 4KRPC 3I9PA 3UTPD 1TZGH 3KVPA 3S2AA 2P5EA 4JQXC 4KHXL 2VN3A 1JP5A 5JHBA 5EU3A 2JKTM 4YDJA 4XXCA 4CW1B 2YGPA 3QW9A 4P5TA 1XL4A 3A67H 3X11B 2J5LB 3ULVC 4JRYE 1NDMA 1IZJA 1A7NH 4K3HA 2F7RA 3NFPA 1DZ0A 1I9RL 3ZU8A 2QADC 3TO4A 3L95B 3FCSA 4JO2H 3HBGA 4WHYG 1T2JA 4WUKL 3GRWH 3G9VA 1TTUA 2AK4A 3QC6X 3VB9A 3VGAB 5I5MA 1YN6B 2A9DA 4U1HA 5GRVK 5AW7B 4L8DB 4PQXA 5J6HA 1JXDA 4PP2B 4YFLI 4PS4L 1FAIH 2NZIA 4ZSOB 4ALAL 1F4YL 2EDOA 4LVEA 3U48A 2P52A 2CJUH 4Y1AD 5ALBL 4W9FC 4YK4B 1MLBA 5TPWH 3D2UB 4R4NC 4HFUL 1SVBA 3ZTEA 2WNWA 2DQDL 4KVCH 5FK9A 3CH1B 5AVWB 3K2UL 3DI2B 4CMHC 3KXFB 1YMME 3N6YA 1EMTH 1YEWA 4YPGB 3WTTA 1RZFL 5D5MA 5I2IA 1I8LA 5HHQA 5JIKA 4ZMXA 2HKFL 4MAYC 3PJNA 2SODB 3EHBB 1TYJA 3HFFA 5DMKA 3SE3C 1PZAA 3QCVL 4ZAKD 5E4OA 3SE9H 3MUZ1 1SYSA 1NAMB 3VYPA 4UQ3A 1VLXA 7TAAA 2EH8H 4NXKA 2H0JA 5I6NA 4JHVA 3LNDA 4XO8A 3IKCA 5CBAA 1U3HC 4Z0BH 5FUZL 4N2BA 4RZCA 3BN3B 1HWGB 5DYOB 1ZANH 4HKZB 5E99H 3SDDC 4JFTA 3UX9B 1ZA3A 3OKOA 1ERNA 3V5KB 1EWHA 1SXAA 4EKJA 5DU7A 5JZ7D 1PY0A 1NCTA 2X2UA 4K7PL 1JYXA 3AQYA 5F7HA 4I2XA 3MSPA 3IGLA 2BVEA 1A0QL 2AXGA 2DIJA 3EYFB 3GMLA 1JGUH 3H2PA 3BGMA 2BJML 2X6CA 2OI9C 1HKFA 1XXFC 1KIPB 3B8SA 4GI8A 4LKXB 5JW4Q 4BZ1L 3T1FB 5DGQA 1B90A 3Q8BA 4YX2L 2EYRB 3CXDL 2FSDA 1H3GA 4YHYC 4FLSA 1WA2X 4Z77A 5L4FA 3MJ9L 2N7AA 5ETUB 3QUZA 1U9KA 3QGVA 1ZPLA 4HIJA 3TPUA 1NTDA 3HS8A 4UOJA 3FU6A 3T71A 2HRGA 2AJVH 2JIXA 5AVSB 4N5EC 4K94L 4YL9A 3SGJA 3Q8EA 3D2UD 1AE6L 3FT4B 1X3DA 3CDGB 3WNJA 4Y16A 3PFQA 5FGCE 1K4DB 2MMXA 4KAQH 1FFPA 4FL4C 1IEAB 1ZT7A 3MRBA 5A16A 3F62A 3JWDH 2I5YL 4KMTL 2C1PB 2FYYA 2VLKB 3T0EE 1TJXA 3AAZB 4PRBA 4U1SB 1XGUA 4HIIB 2F1EA 5FYJU 1DSYA 5KVDL 5J3HC 1GGTA 3EHBD 4A63A 2OL3L 1HQ4B 4IMKA 2K78A 4ZODA 1ONQA 3O6LL 1WWCA 4MB5A 4JPVL 1UG9A 1KMGA 5JHLL 1REIA 4J3OF 4PJDE 5AFAA 3BVTA 2HA1A 3IU4L 1K85A 4MNQB 4ZUWB 3GPSA 4U3CA 2AC0A 2NQCA 2J57A 4Z7OF 2J7LA 2F54D 3CN3A 3KM2A 4ZW3A 4PJEF 2NSQA 5A3ID 1DEEA 4JZJB 4ONOA 2XWZA 2C9PA 1ZLWH 3QRLA 4NM8H 3EBHA 3HCVA 4OCRH 1NICA 3KYNA 1A6VL 1PLAA 1C8QA 4ICWA 3QDAA 2BZCA 3KE0A 4KTDH 3FUKA 4Y88A 1YPZA 4ZO9A 1EO8H 3FQTB 3TA3C 4CDGC 3ULAB 2LAGB 5FO9A 4QRPA 4POUB 1QBLL 1ZIBA 2PKDA 1HQRB 3VWKB 3PGDA 2NUTB 4A7QA 4IBLT 1FCCA 1Q9LA 1ZT1B 2R9HD 1CXKA 1TR7A 4RFNC 3QNFA 5I0WA 1H3XA 4M43L 1OAYH 2OLDA 3S5LA 1UB5A 1BDYA 3CLFH 3BO8B 4NZRH 4XNMB 5FA3A 2NY0B 1LO2H 2Q3AA 1XIWC 3R7QA 1Z9NA 1D6VH 2AEIT 4I3SH 4C56A 1KPRA 4ZZKA 1KYOK 2EDQA 1DQKA 3E9TA 1OB1B 1XGQB 3H9SB 1WUNT 1BJMA 2F53E 2G75B 1JNHB 2VLKD 3MUJA 3WS6C 2KYIA 4NQSB 5DJ6A 2VL5B 3D7PA 5L2JA 4JG1H 1ZHBB 4ZQKB 3THML 4LCIH 2NY2B 5CILH 1OKEA 4XN4A 3ARBC 4XP4H 1GRWA 4PB9L 3VXMD 5GZOC 2Z8RA 2OR7A 2IV8A 4KRPD 5IHZB 1ND0A 3IJSA 3OJ2C 5F8RC 3IPBA 2YC1B 4BCXA 4U1MB 3VI3A 1CBJA 1U93B 3IE9A 2AZUA 3BPNC 4PJCE 3LKNA 5I74C 3ZW3A 3U6RA 4UANA 2P3YA 1JFHA 3U9UB 2Z93B 3DKHA 2LTQB 4N0CC 1GY2A 1NC2B 3VXOB 1JHKH 2F7QA 1OE1A 3GIZH 1KTDB 1UZGA 3BKYL 1BFTA 3LEXA 4LNRA 2F5AL 3D3VD 2LOEA 4XCNB 2LVCA 1R3KB 2ATPB 3IM1A 1RLWA 5IB5B 5IGXL 2OK0L 3C5ZB 4NN7B 4ODUB 2P8MB 3VWKD 1DN0A 2ZD0A 5A2BA 4N8VB 1CFQA 4QXWA 8CGTA 5H94B 5F1IB 4PFEA 1Q94B 1CT8A 3MRGB 4LU5L 4JJHA 5L4IA 4NT6A 1BM3L 2NY0D 4EZLA 3QUKA 5F9OL 4F57H 3BPCA 5CR1A 2XTJE 3TTYA 5DQDL 1A1OA 4MAZA 1W8NA 5CIPB 2D3VA 32C2A 4LCCC 1MRDH 3RWFB 4X6FB 4YHKH 4DN4H 1JNNL 4N20A 4GMTL 1I3GH 4XP5L 3U2IA 2X2HA 5F97E 4JFFE 1BOYA 1NMAH 3BZ4A 3B43A 3H6JA 4FAAB 4MS6A 1KZQA 3OHXC 2FNBA 3K80A 3HAEA 1H3TA 3ZSSA 5AZ2L 1EAQA 4YIQB 1SOSA 5DFVD 4GKLA 2PLTA 4TYUA 4FHBD 4XNDA 2R1XA 3L4VA 2ISDA 5I16A 3IS0X 1NGWA 4JLRB 5JQ6H 1SQMA 2F1BA 1N18A 3SOBL 1GGCL 2WCSA 4CVZB 2DWYA 3QQ3A 1CFTB 2FSEA 4IDJH 4MRBA 1HSBA 5IB4B 1IBHA 2IDQA 4MJ4A 3ZDZB 2BWIA 1S78C 3QEHA 5SWQA 5DLLA 3TIDB 1JG9A 1AXIB 1RUKL 2HX8A 3FT3B 4XCEB 3SE4A 4HK3N 4JPKL 4P46C 5I1IH 1NC2D 1XMWA 2VLMD 4CW1A 4BH8B 3V9EA 3X11A 3GLAA 3OL2A 2BVYA 4MZ3A 5AW0B 2Z1PA 3NTCH 4PWEA 4YZWA 3L95A 1HCFX 2EXYC 1WD9A 1JI1A 1O75A 3EYSH 1JF1B 3QJHA 4MDIB 5E00B 3UCQA 5DMJB 4N5ED 2AK1L 1YN6A 5AKRA 4HWUA 5HVWA 4L8DA 4B9IA 4LMQI 3TN0B 4CADB 5KS9B 2Y1AA 5DURB 3Q0HA 5IVZB 3RUGF 2XV6B 3SYAA 4JG0L 1I1CA 1N2RB 3NJNA 4MJIE 4OLZH 4ZSOA 1ORSB 5FHBL 4BQBA 3V4UL 2QLVB 1P4LA 1PNCA 2K8MA 3EDJA 5HJ3A 3H2WA 3IN0A 4OF3A 2J21A 3D2UA 2FEDD 3OGCB 5J3HD 1CE6A 4E9RA 3CH1A 4G11A 2AAVA 1TZ8A 2Z91A 3ASOB 4J4PC 3CVIH 1FV1B 4XO9A 3U2SA 3HAEH 4G6AC 3QEGL 3WOVA 4OFKA 4YPGA 2R1WA 3HIZA 5C6WH 1EZVX 4KNTA 3I02B 3W56A 1JK8B 2P49B 4PCYA 3K8KA 3ZL4L 3P3YA 4N2AA 5TF1H 4AUJA 1P5UB 3BXNA 1W9XA 3ZE1E 1V54B 4RAHA 1PZ5A 2WM0A 1JTPA 4F9LC 3GXTA 2IOIA 3SBPA 1NAMA 2ZUXA 3EADA 4TTDC 5GS1B 1YNKL 4AGNA 3M45A 2PTTB 4BA8A 3MOAL 2F54A 2WXIA 1EJOH 4J8QA 4YVUA 1CI5A 3UTZA 3ES6B 5DYOA 5IV2B 2P43B 2C9XA 4XGZA 4G7SB 3MRNB 1KB9K 3B8YA 5KAQF 1RURH 2IWKA 4FNLL 3QSKB 3TA3D 3V5KA 2JQZA 3MV7B 1OTTC 2EYSB 3L7EA 1OLLA 1GKEA 3KL5A 5F88A 2FUTA 4FKEA 4NWUL 5F6HI 2KZ1B 1JRHL 2F5BL 3EYFA 4OCMC 3RIFK 3KYAA 4ZFFB 1HHHA 1KTLA 4X5XB 1KTJA 2YD2A 3CFCL 4ELKA 4CJ1A 4LKXA 1G4RA 3T2LA 3TP4A 2EYRA 4MQ7B 3ATFA 4P5KB 2YSSA 4ZS6C 3S96B 5DMIH 4XI5D 1SJHB 4NPKA 3SDYH 5HPMB 1QRND 5A6IA 1PBYA 5DURD 1JF6A 5ETUA 5PCYA 2VOTA 4X99B 1XD1A 1FYTE 3D4CA 1MF2H 2BXYA 4RGMB 4DP5X 1OQOA 2O5YL 5IQOA 3SGDI 2R2HB 4M5ZL 2DTML 4B9JA 1QHQA 3MJ8B 4L1TA 3ZZ1A 1HFUA 3WIIH 1IC7L 4R97B 1E27B 1KCVL 4HHWA 4HEMA 5JA8B 3FT4A 3OV6A 1NFDB 4E9YA 4Q2ZB 1C5CH 4LQ1A 1KCLA 3IT8D 4R5XA 2J1YA 5A7EA 1IEAA 2AEOA 4KHTH 1X5XA 2HCZX 3AZUA 4GAYB 4RFEB 5D96B 4ZFOB 3N42F 1NEPA 2C1PA 2VLKA 1UM6H 4U1SA 4AIZB 3KR3H 1NAMH 2W92A 4HIIA 3U1SH 2BVQA 3P3TA 3WN5A 2WLZA 2GUOB 3EGXA 4YDKL 4TULL 4V1DE 3U4BL 3VXMA 4DO5A 3HG1D 3D4ZA 3E8VA 2YXWA 3P9MB 1DLFL 5FKPA 4MNQA 4ZUWA 3WEXA 1KC5L 1O7SA 4LSSL 2XZQL 3T9WA 3ECWA 1R5IA 1FH2A 2WLJA 4FFTA 2WJ5A 1YEHH 4M93B 1FNSL 4JZJA 2QMKA 3APCA 4APQC 1JZ8A 1LNUB 3N04A 4PJGF 1FAKT 4QXTB 4Y9CA 1TQTA 4LOFA 4KFZC 3NN8B 4WWKB 5DRXB 3VSTA 2FATL 5EFIB 3V0GA 4KVNL 4E9LA 5B39A 4DPRA 2X88A 4YXKL 2BY1A 3T1WA 3WEAA 3D3VA 2ZF9A 4I4WA 1SJXA 4ZRGA 1GGBH 4YHZL 3FQTA 1EX0A 4PJAF 5HVHB 1FUNA 5KJRL 5E6SB 5IMOB 2YAEA 1TTRA 2H2SC 5F0LB 2YKLL 1MXDA 1NGZB 3VWKA 2BMKB 2NUTA 2GUYA 2BNRB 2AJZA 1ZT1A 3FFCE 3FB6B 3WD5H 3QFDB 1T6BX 4N6RA 1UVQB 5E8DH 4X8GA 3S3CB 4XBEL 5DEZA 4J3WA 4JFEB 2VDQL 4OLVH 4XNMA 3IJEB 2QQLH 3P54A 2QL1A 3U2JA 3BIAX 3L7FB 4U31A 5BW7C 3M1BA 1A3QA 1E28B 1RZ8B 5E5LA 2DV6A 1OB1A 1QEWA 1XGQA 3H9SA 2A4CA 4PSPA 4LARH 1YEIL 4IU3B 3TIEB 4P07A 3UMNA 1V5JA 5K59F 1NCUA 1PNDA 2G75A 3UYPA 1PF3A 4HCRA 5FWRA 1JNHA 5AYQA 1NJ9A 3Q3GA 5CLXA 1CCZA 3LOWA 3UDWA 5HHVH 1ZHBA 1GCYA 4Z7OE 4KZEL 4PJEE 2ZG2A 5LGHL 4QWWC 1R0AL 1S78D 2IH9A 3HI6L 2ZP9A 3DHPA 3QIUB 1JVOA 1PZDA 4S11A 5IHZA 1ZK9A 2YC1A 4A04A 2WLMA 4QRRB 3BAJA 4P46D 4YDIH 4YN3A 3BUDA 3P1VA 3MFFA 4DGIH 3EXJA 4UNUA 5D4JA 4BQ6A 1U93A 4OF5A 4W4OA 3RGVC 4OZ4B 4UINL 1HHIB 2ZAIA 1PIGA 4LF3B 1RCYA 3C8KB 2IANB 4M6NL 4WFHE 1WZKA 2Z93A 2EXYD 1R3HA 1P7BA 4A55A 3KPOB 1NC2A 1RSFA 5TDNB 4K3JH 4MA8L 4LK4A 1KTDA 1HH6B 5EEXA 3RKDC 1I1AC 1E8ZA 2H0EA 1BD2D 4XCNA 5IEKB 3K81A 1YNTF 3LEYL 4ZMPA 1R3KA 2ATPA 1N26A 5IB5A 2Y1ZA 1RZJL 1SRDA 3C5ZA 4B7IA 4ODUA 3UO1H 2P8MA 4IIQA 2Z4QB 2ED9A 3MGTB 4JFHD 5T1KB 1FGVH 3BH4A 3E2HB 3RJQB 2EVIA 4N8VA 1JZ6A 1G0YR 5H94A 1ZA6B 5F1IA 2AQPA 1AMXA 1Q94A 1W0YT 3MPCA 4L05A 4PGCB 4FGMA 5E08H 2VAAB 2Y7LA 4XVOA 3FTZA 4NUGH 4G6AD 3UJJL 5DT1L 2QPDB 4M1CD 1ZLWK 2Q1EA 3T6VA 3DSFH 4QHPA 2YA0A 4HCRH 1BP3B 3I2CL 5CIPA 3QPQD 2JNZA 2VJXA 3RWFA 1ZHNB 2QV2A 2OTWB 5C0CB 3R7RA 5K93A 3BFQG 1ID5I 3QDGE 1OWRM 3AY2A 3N44F 1OP9A 4OSUH 5L2KD 2HLFD 4YR6A 2VDML 2H5UA 4R8WL 1MCSA 3DJ9A 5HJDA 5JW3H 3O6KL 1JYNA 2PTVA 2YSTA 4YIQA 5KVEH 3QIUD 3UG5A 5AOKA 1RV6X 2VUYA 4QRRD 2PPDA 5ISZE 4JLRA 4CVZA 4GUPA 3EOAB 4PLJD 3AS1A 5IR1B 1CFTA 2Q3XA 3K0WA 1OTTD 4HJUA 5IB4A 1A22B 1NWPA 1N10A 4QOKE 5TH2B 3C08L 1AO7E 1CIDA 1A7RH 2EVHA 1U91B 2FX7H 3EYVB 4XCEA 2ED6A 1BG1A 2B4CH 2ZWYA 4QKTA 5I24A 4ORZC 3ZMRA 4X6DB 4M3HA 3ZVVA 2BVPA 1D7CA 1JTOA 5DHDA 5FYJH 1DUYB 3RLSA 3T0XA 4BH8A 1RZ7L 2BRQA 4IBWA 3BP6B 4P5RA 3TT1H 2B2XL 1OZUA 3GBDA 3QXUA 4ZS6D 2A5UA 1F00I 4A7SA 5HDBB 1WRFA 3NJKA 1CF8L 3M7FB 3QJUB 4LGRB 4OW6A 4N90E 2FJUB 3CU7A 1I1FB 1JF1A 4MDIA 3GSWB 4NXSA 4GS7C 3V0IA 5T1KD 3KWUA 2DQGH 2YZ1A 1M4KA 4LAQH 2EEFA 3SE6A 3BP4B 3FN3A 3G08A 3TN0A 4CADA 4HU8A 4LCWE 4K7FB 1QRNA 3FB8B 5D1ZC 2A1WH 5IVZA 5GGUB 1RJYA 1NA8A 5AZEL 1OP3H 4F8OA 5ABDE 1AZZC 4L0YA 1N2RA 1KBBA 1THAA 4LEXH 5CIPH 3APFA 4PI0A 4U1GC 1ORSA 5H4YA 1HESA 4BIKA 1P4BL 4WNJA 3GJEB 3R19A 5KSVB 4DERA 3B9KC 2MCPL 3EDDA 2IQAA 3VB8A 1EZUA 4LPCA 3H7BB 3PHAA 2OMWB 2DLIA 2J88H 4K23L 5IOKA 2ZKYA 5C0CD 1FV1A 3U7WL 4KNSA 3VFGH 2K6ZA 4PJ8D 2IDCA 2ZCKH 3X2QB 2APTA 4YHLH 5IVXB 1ITBB 5AW9B 3I02A 2HRPL 1JK8A 1TUPA 4ONHB 5KYYA 1KG0B 3TT3H 3I3BA 1MVFA 4UU9B 2WSDA 1P5UA 4I1RA 3O2DL 4APQD 2PO6C 2ZF8A 4JB9L 3WFHB 4IW4C 1OW0C 4KY1L 3HG1A 5E23A 5T8IA 4ZG1A 5LUMA 2WTPA 3NRQA 5AAMA 3CFTA 2PTTA 3BUBA 4FI6A 4KQ4H 4X6BB 4N2LA 3UTOA 2Q8BL 3RB7A 4LASH 4KWUA 5IV2A 3BVUA 1F58L 4NN5C 1NANI 3V9FA 2P8LA 3UROR 3BDYH 2UYLB 3QUHA 4OBSA 1W91A 1UA7A 2DBJA 2EYSA 2R69L 4GMSH 4F3FB 3AUWB 1KCUH 2AMUA 5E0FA 4M7LL 4AEEA 3UO8B 4NKOB 5FEBA 1BW8A 3L81A 5JIMA 4AH2B 1FIGH 5ALCL 4ZFFA 3DYPA 3HMWH 3F65A 5KVGH 3MV01 5DFWH 2IFGA 1U21A 2VR9A 3D34A 4LDCA 4MQ7A 2AHIA 4P5KA 3ROLB 3CNKA 3S96A 3W11C 4LRIC 1SJHA 3C8DA 3FH5A 4NZFA 5HPMA 3LIZL 1LEIA 2X7LB 3V0EA 5GJSH 2YRLA 3VRLF 2D7PA 2Y23A 4NM4H 3IDNB 4X42A 4X99A 3UZVB 2OX5B 5FIEA 1NGPL 4LCCA 2R0WL 3KWWB 3LQAH 5I6MA 3E3QC 2K7QA 1E90A 5DEFA 1F11A 5M94B 2EYTB 1NCBL 3G6DH 1VGKA 1XVSA 1AGDB 4TRPL 3Q01A 1E27A 4NNYA 2YPKB 4FXGB 1VAHA 5LKNA 1NFDA 4AV5A 4Z7IA 4XCFH 1K4CA 3PWNB 2MPAH 1S7RA 2AQ2A 2IAMC 3TLRA 3NQKA 4RFEA 4ZFOA 1E43A 4ZPVB 4LB8A 3F84A 1HOCB 4AIZA 4DF9A 5C0EA 5I19H 3B7YA 3W37A 1BA9A 2CUHA 2KT6A 1FG2A 3IAPA 3QXAB 25C8H 3RGVD 1H8OA 4JKMA 5KSBF 3FH8A 5KYUB 3J8F7 3PL6B 5DC2A 2WINB 3LNFA 4M1DL 1PS3A 3P9MA 1SHSA 1F3JA 4BDVB 1TTFA 1E3XA 3B34A 3MNDA 4P46A 3RHWK 1JPST 5KVFE 1RMFH 4N2OA 3X14B 4UV7L 2J2ZA 5EIIG 5G5DB 3VW3H 1I1AD 4MASA 3U46A 5KN5A 3Q6GH 3GM0A 4G6JL 4AT6B 1A9VA 1WC7B 1XR9A 4QXTA 3NPSC 1TJGH 2PCFB 5EIVA 3JWOC 3NN8A 5DRXA 4L4JA 1S7UB 3U4AA 5EFIA 1DQQB 5FO7B 5GSVB 2YAFA 1BD2A 5PAZA 1YMHA 1GTNA 1U8IA 2O30A 5IMOA 3KDMA 2Y5QA 1NGZA 1RUMH 5EWIL 2BMKA 3GDBA 1MHPL 1CR9L 2R0KL 3FB6A 3QFDA 5CEZL 2QPFA 3UTSD 4N5UA 4HW6A 3FFDA 4RMSA 1ZGLB 4FQCL 3SBWC 2BO0A 4WFFD 5H4ZA 4JFEA 3PV7A 4ADIA 1MW2A 4EF3A 4XT1C 3TESA 2DEXX 3OKKB 3US0A 3U36A 2UUDH 2DKUA 2C3VA 4UT7H 3VQ1C 2D03L 3L7FA 3MLYH 3DX8B 1MRCL 1RZ8A 3TIEA 4ZQTA 2X9WA 4XPAL 3HG2A 4K8RC 1CICB 3I9AA 4F9LA 1YEGH 3LRMA 3N9GL 2ZCHL 2EE0A 4Y1TA 4CSSA 4RWHA 4M9PA 2YPLE 5C0AE 4IRSC 4KKZA 4FZEL 1DQLL 4K3EL 3QIUA 3UYOD 4DK3A 1OAQL 4PJGE 2ADFH 4QRRA 1XTLA 4GJTB 1MHHB 2A3TA 3LZRA 5AW5B 3OZ9H 5INDA 1XMEB 4FG6D 5GGRA 1MIEL 2JMRA 1F45A 2H47C 3R06B 3PDOB 3DV4A 4NFDA 3HHRB 2YD7A 4OZ4A 5T5FA 1HHIA 3UXFA 2Q7YA 4LF3A 3DX0A 2IANA 2XC8A 1NOAA 3LQZB 3QDJD 4PJAE 3OAUH 3MRQB 2RHEA 3KPOA 4JKNA 5TDNA 1HNFA 4XPFH 5LWYL 4QJ4B 5KBLA 3UAEA 5HDQL 3DYMA 1EXHA 3TBYB 3T04D 4XODA 3CHXA 1E5ZA 2P42B 3QEQB 1OK8A 2AEWA 2QR0B 3AFLA 1UWYA 2IPTH 5D1ZD 4MD0B 4O2CB 2EDDA 3Q5YA 4EVNA 3EYQC 4HUVB 1N0LA 4JRXE 2CKBA 2ZJSL 1YEDA 2R0LL 2Z4QA 2UZYA 5HP5A 3JYCA 3MGTA 3IBEA 4FN0A 5T1KA 5IWLC 3A4AA 1CXFA 2ZUTA 4AUUA 1N64H 1ZA6A 1OSPL 2KZWA 4AG4H 4PGCA 1T22B 2VAAA 3STZB 2AABH 3E80A 1RK0B 2KDGA 2FX8H 5FFOA 5ICXB 2XZCH 2V7NB 3K6OA 4HGKC 3UBGA 5K59E 1K6QL 3F7PC 3TH4T 3PQYB 4FFWD 2HFEB 4G71B 3TXAA 1HCYA 1Z6JT 4JREB 2G5UA 2Y6SC 4HEPA 4KUZL 2NY4B 2WLLA 1FIEA 4FX5A 3TFKC 3BMWA 1ZHNA 2OTWA 1JFQL 2PO6D 5C0CA 2Y24A 2D7OA 4PJ8A 4N3UA 3TTSA 1BQ5A 1GW6A 3L13A 2ZP0T 1VCAA 3JTSB 4ZDHB 1TQWA 3FMGL 3FO2A 3VH8A 4N3TA 2VZTA 3OKNB 3MBXL 5IQ7L 2IGFH 1MJ8H 4IU2B 1TETH 1CFMA 2VZ1A 3P11L 4CGUB 2OYPA 4LMQE 3QWQB 4TLUA 4FZ8H 3IMRA 4Z7VF 1KGUA 4XBPB 5T5FH 5E8NB 1MUJB 5CO1A 3A24A 1FL5B 1IE5A 3OLEA 3VE0B 5IR1A 1HKLH 1VFOA 5CUSL 5CP3A 1QHPA 5JXEC 5TH2A 3ZY7A 3GXPA 4MMZC 1U91A 3BLPX 3FQXB 3NCMA 4A39A 4AZ8B 1JXFA 5C92A 2C1OB 1MAML 3VTMA 4X6DA 1EZVY 1DUYA 4TVSa 1NBCA 3CFMA 3IAQA 1OSEA 2R2EB 3PWJA 1BGXL 5IEHB 4TNVF 3N41B 3W11D 1LM8V 3EOTH 5J56B 4LDEB 4QPEA 3HMXL 3L3OB 2B20A 3MJ6A 4GINA 4JFXB 5GRWA 1KXVC 1UXSB 3EJYD 4G8AC 4ZNCD 5BO1H 2FO1A 1I1FA 1VFAA 1OLZA 3QNYA 2X4QB 3FCTB 1JNJA 2VDPL 3KH4A 2VQTA 1J11A 4URTB 4K7FA 3FB8A 1P0SE 1YUKB 4E9SA 3D48R 4OVUA 2DWDB 1HINL 3KNBB 2IAMD 2OSYA 2ODIA 3GJEA 3QR2A 5KSVA 1S7WB 2XZAH 1H5BC 1XXDC 2NY4D 4TPRH 5EOCH 1TEGA 2OMWA 3TWCH 1VEOA 1FFNB 3V52H 1ZGLP 1JWMB 1OO2A 4WEBL 5IVXA 1QLEL 2EXWD 1U8LA 5JW4N 2R23B 1S6NA 2CALA 1IBGL 2DYPB 2FWSA 1KG0A 3S88H 3MODH 2AANA 1FNGB 5HPOA 3RX8A 2A6KB 4MDJB 2HX7A 1OAJA 2P26A 3WFHA 5I8OL 3CZKA 2KHAA 3GINA 5CP3H 4PTTA 4Z3EA 1EIBA 4KXZI 3CK0H 2D7MA 3B7RL 1MFEL 4X6BA 3MA9H 4L8CA 4WI3A 4XX1E 2OV0A 1B4RA 4IRZA 2EAEA 3WMQA 1LO0L 3O3DB 3TS8A 2G2RA 3IJHB 3P0YH 2EDXA 1NUNB 2BSDA 2J73A 2UYLA 3IETA 1T0PB 2PNDA 5GRVL 4JHWH 3WKML 4F3FA 1MREH 1JWSB 4CVXB 5B7EA 2Y07L 2DLGA 2LLNA 4K9EL 5K9JH 3F8UB 4AH2A 4KX8A 1JV5B 3S5LG 1CUOA 1U3JA 2FB4L 1OQXA 2CLRB 3ZDXF 4O4YH 3FT2B 2HLAB 1KWKA 1VSCA 4N0UE 4TNWK 3ROLA 5E2UH 5IBTL 5JOPE 3FUFA 1F0LA 1II4E 1T3FB 4FADA 4KQ0A 1JN6A 3M46A 2H1LM 5F7MC 3A23A 3UTSA 1YEFH 3UZVA 2OX5A 5AB1A 3VRIB 5ITFA 1CD8A 2EYTA 2Y2YA 3EYUL 4JO8A 2DL2A 4F27A 1AGDA 3JT2A 3HUJE 1TQCC 2E59A 3LH8A 3Q2LA 2YPKA 4FXGA 1ZDQA 4JR9H 2X1OA 3WGVB 2OMXA 1FL6A 1FFRA 4WI5A 3PWNA 2JTDA 4IRSD 2R1YB 2ZOLB 2BVUA 3LXUX 1EGJL 1P6AB 4Y5XC 2DYPD 4ZPVA 4ZUUA 1CZ8H 1QBAA 1HOCA 4EEEA 3D39B 5TE6L 5KZCB 3VXTB 1PAZA 3ZQ9A 4HF5L 4ADJA 3QXAA 4J1UB 4YSPA 3D4GA 3IF1B 3PJLA 5KYUA 3PL6A 1OP4A 2WINA 3UOAB 4IRZH 1KJMB 3FSAA 4PM1A 3OMNB 3QIBD 4BDVA 3H3KA 1OP3K 5BVJB 3D9AL 1F6LL 3IN2A 4UQCA 4MLSA 4WTWA 3US9A 3GDCA 3NP4A 5G5DA 1FE8L 5LCVA 3ALPA 4HC1L 2XIDA 1OHQA 2WIIA 4WI0B 3PREA 4M8UA 1LWRA 4AT6A 4DSYA 2AJSH 5D70H 4W9GC 2PCFA 4ONFL 4BUQA 2ZUYA 4JM4H 2W38A 3NOIA 1NCWL 1S7UA 3BEVB 3EJRA 1OK0A 5E1AB 1X5MA 1J7VR 5F9DC 5FO7A 3S37L 2DIAA 3ZT6A 5GSVA 3VRLE 1DQMH 1OP5H 4XNYH 4PJ9C 2WK2A 2XXMB 3R0MA 2BCMA 2XV2A 3RFZA 3S6CA 1AFVH 2BZ7A 3QIWD 2AV7B 2Y6SD 1D5BB 3I75B 4PLKC 1JUFB 3TFKD 1WGVA 5HI3D 4UI2A 4MCYB 2V37A 1CBVL 4N2MA 4N0YH 1VPOH 4X80L 1M56B 2VN5A 3DX8A 1JPTL 3MYZA 4X4MA 4NS0A 1PTZA 3ZHLA 4HHAB 1MY7A 2ZQKA 3PXJA 4LHUG 4ZW7A 4BH7B 3F01A 4Q97A 2XRAL 1AZNA 3JUYA 4X7CC 2PO6A 5KSBE 3H3PH 1JF5A 2OMTB 2IG2H 5LAPA 1OW0A 4QGYA 5KZCD 3IPFA 1I53A 5C9JA 3HNTL 2JE8A 4XVSH 4PCTA 5I0XA 3Q1SL 4BM7A 4E68A 2I85A 3OD3A 1KN2L 4XN2A 1OARH 2E74C 4YQXH 3M07A 5HBBA 1H6UA 5C08D 2I7OA 2X6MA 2MIZA 2W60B 1MHHA 3MXWL 4FFYL 5LCVH 5CINH 3ZQWA 4JZOB 4XWGL 1EHLL 2J72A 3R1GL 5T3ZL 4WEMB 5D2NB 1XH2A 5BZWB 3R06A 3PDOA 2R4RH 3NCJL 3TA4D 4G59C 2GBVA 2OR9L 3C2AH 2CD0A 4IKNA 3O81A 3LQZA 2FT8A 3MRQA 2AGJL 4EDXA 3VFSB 4KRMB 1G84A 3FHQA 1E6JL 4XMLL 1QFUH 4XMKL 3TBYA 4MXQC 3QP3A 4KKBC 3WHXB 5FM5M 4KKCC 2QR0A 3P4NB 1BFOB 4MD0A 4O2CA 1YY9D 2WSPA 1UM4L 3HTLX 2RACA 3BRDA 4HUVA 3VD2A 2IALB 4MMYB 1YEJL 1EJ8A 3S34H 3GNML 1GY1A 2ZWSA 3EBIA 4XP6H 4ZYKB 2BNQE 4XNZB 1AIFA 4HMCA 1T22A 4NGHL 1GH7A 3B9DA 1RK0A 5ICXA 2V7NA 3M1CA 3NESA 5MI0C 4MAUL 4JKPH 2HFEA 4FQXC 1CXEA 4Y19E 1TJMA 2XNAA 3KPMB 1KXQE 2X4UB 3ARUA 2VKWA 4FQ1L 1LJMA 3BAYA 2F18A 2I60H 3WEMA 1FORH 1IGCH 1PFCA 1N67A 1DVFB 1P5VB 3DUSA 4P3DA 5FYKD 3U0PA 4E9XA 2EZ0C 3BP5B 3ARGC 4RLDA 5KVMC 4KRNA 2AS5M 1DVSA 3SO3B 5I1CL 2Y7QB 4LVHC 4AQEB 5E2VL 4XBPA 1ZEAL 5E8NA 1MUJA 3U7YL 4RWYH 3BAKA 3EJTA 2V9QA 2B77A 5D72L 4KQ3H 4X6EA 1JSYA 1IIKA 2WZ0A 3NFSL 2WXHA 2BH0A 3NA9H 1A9BB 1YVLA 4PRPE 2WQRA 3QPXL 2NY7H 4AZ8A 3IMTA 3RU8L 1IGYB 1TIUA 5GPRA 3ZYJA 2B39A 5TK2A 4QRTB 4YHPB 1A3ZA 3F7RA 2VABA 2GAZB 3KW8A 2XKSA 2VSMB 5IEHA 1HEZB 3RA7H 4EIUA 1KPVA 1EFXB 4JN2B 2CRIA 2FO4B 1L7TH 3L3OA 4JFXA 5FUCE 3GMOB 3TH2T 1UXSA 5JPNC 1Q1JL 1SEBB 2X4QA 2AJYL 3CZFB 3FCTA 1SLUA 3Q7JA 5EUOB 4J6RL 2ESVB 3HC4L 2Y0SA 4LLWA 5J5EA 2X09A 1AR2A 3T6QC 4URKA 3AJ7A 1U8JA 3KNBA 5J11B 4I88A 1ZY9A 1F4HA 1MZZA 4UNTA 5I0ZA 4KITB 2B14A 1S7WA 3WIHA 5CFAA 5INCB 3FUDA 3WTYA 4RH4A 5KJ4A 1FFNA 3T0VA 2HJLB 1XZ0A 1JWMA 4IRSA 4W6WB 2ZWKA 1O5DT 4Z7VE 2Y7OA 4Q0XH 1E7VA 1CGSL 1DVFD 2DYPA 2XN1A 2MNUA 4JM2B 4Q89A 3K5SA 4YE4L 3AB0C 5IF0B 3WTVA 1FNGA 1GA2A 5MEQB 3LIUA 2A6KA 5JHMA 4MDJA 2ROXA 1DTUA 5I75C 3QWRD 3AG4B 3BH8B 4C4BA 2DMKA 3CHSA 3QIBA 3VGGA 4EPSA 2FQGA 3Q13A 2F0CA 2Q9OA 4I9XA 3O3DA 4TXVB 1ZXKA 5D7JC 3IJHA 4PRNB 2ZKHL 3SGEH 3WNPA 2X6BA 5HHOE 3QJXA 4A2FA 1M1XB 3N5AA 4P9HL 2UV3A 3F12B 2EINB 1Z3GH 3V9CA 1KGCD 3WIAA 1JWSA 2YOAA 4P2OC 4DH2A 4L3EE 4CVXA 2VLJE 1U4FA 4FQPA 1XH3A 1ZJAA 4YUEH 1A4CA 2KUTA 4O2EA 5F96H 2EABA 2Y7MA 2ZUSA 2DIBA 4XCYB 4EI6B 3OKEA 5TQ2H 4F92B 1TT6A 1MNUH 2CLRA 4X7SH 3FT2A 3GMPA 1AQHA 2XTLA 2Q5BA 2Y6TE 4OJFH 4C4UA 3LXAA 1VENA 4ZFGL 1T3FA 3F7VB 1U8NB 5ITBH 1U33A 2G5BA 2WZ5A 3QIWA 2KH2B 1ADQA 2PYEB 2G4EA 2WBWB 3WIHH 3TBVB 1ETB1 1T83C 1XGYL 5AD0A 3VRIA 4DO6A 1MCPH 2V5MA 1WBXA 4TUJB 4NBXB 3ZTDC 3TWYA 2E7BA 4FABL 2JJSA 3BWAA 4I3RH 1QP1A 4OAWB 3I6KB 3EAKA 3BFWA 3HW7A 1TEFA 3P2TA 4Z7WB 5D55A 2G9HB 1ZXQA 1MCHA 1AZBA 2VXTH 4NZUH 3D39A 3VXTA 4PGJA 2YLKA 8FABB 5CU9A 4J1UA 3IF1A 2QVTA 4EQ3A 5ERWA 2FK9A 1CDCA 1J0JA 1KJMA 4MMZA 3RJDA 5A2FA 2QMJA 2XVGA 1XAUA 2VCOA 5BVJA 2X12A 1DBBL 1NLBL 1ZLSH 4P2QE 2VM3A 3T4AC 4Q4EA 1RK7A 4MXQD 2C4FU 5EBWB 4IGBB 1HAUA 2EP6A 4WI0A 5JNYB 2W95A 3QQXA 3ZTCC 3MRDB 4H8VA 4EZJA 4H2AA 5J06A 1KXVA 3KYKH 4KTEH 2Y2TA 2X1PA 4GAGH 4OFDA 1OAUL 3ZDXE 3BEVA 2BSSB 4D9LL 1OPOA 2NR6C 2WNKA 3NCWA 4N8VG 1MI5B 2VZVA 3BHBB 1IBBA 3NJFA 1OTUC 1ADQH 1TZGL 4KK5C 4PRID 3G5WA 5SWZE 4UQEA 3BP7B 2O72A 4OF0A 1ES0A 2K0RA 4IHOA 3OGOE 4WFED 3FOLB 3A67L 1H5BA 1D5BA 3J2PA 1A7NL 3I75A 1JUFA 5A2AA 2X9ZA 5KTEH 3VAEA 3NH7L 1N8OE 1S9WB 1CDHA 3I3DA 4MCYA 1KCWA 3MV8B 1RJCA 4JO2L 4KKLD 2WQUA 2IWFA 3GRWL 2AAAA 3FCGA 2GKIA 5L7XH 1SFHA 5DMGC 4BH7A 2WBXA 3ARGD 3VXSE 5FW6A 1HZLA 4OJDH 3KLQA 2DQCH 3MLZH 4WNQB 1CGUA 1IAOB 4DAGH 2OMTA 3II3A 1Q0YH 3B3IB 1FAIL 1MDTA 1I7ZB 4JE4B 2B16A 2HVBA 3LPWA 2CJUL 3LDBC 1XB6A 5TPWL 1YY8B 2HWZL 3WJLA 4KVCL 4HBCH 1WFIA 5FHAH 1QZNA 2W60A 3DPDA 3GXNA 4B5EA 1JZ3A 2OW7A 4MSWA 4JZOA 1EMTL 1FH5H 1ZTXH 5D2NA 1YEEH 1IGIH 2KZKA 3CHRA 1WIOA 2PCPB 2NZ9D 2C4FT 4NRYB 4Y4FC 3LX9A 1IC0A 4OTXH 1Z5HA 3PPSA 3ZYIA 4L48A 5T3ZE 4LAJH 3SE9L 5FGRA 3VFSA 4PV9B 2V5YA 5CZRA 1DVXA 1S4IA 2XCMC 2EH8L 4FHJA 1CK0H 3WHXA 1A3RH 5GGSB 4Z0BL 1BFOA 1NBZB 2NLJB 2WYHA 5E99L 1ZANL 5TQ0H 4Z6AT 4LSTH 4MMYA 4X4XB 1UENA 4HIQA 4JGNA 1AVAA 1FF5A 4ZYKA 1ULVA 1IAKA 1J1OH 2X5PA 4HJ1A 2BOCA 5DJCA 3MV8D 3S7GA 2J25A 3DX6A 2AJXH 2IWEA 4GG6F 3MRMB 4NN6C 5CF3A 3FU9A 1MQKH 2H9GB 4WSJA 5I23A 1KBWA 4RDQG 1KIQA 5KG9B 3QNXB 5JW4M 4KV5F 3QQDA 3GMMB 4XE5B 5B21A 3SYOA 2WQWA 5GGTA 1DJYA 1DVFA 1P5VA 1QPPA 2AJVL 3FS9A 1E8WA 1OP5K 2GFBB 3BP5A 4E2OA 1A7OH 4MS8D 3SZ6A 3HC0B 1GZPB 5D7JD 1D7FA 2BOBB 2Y7QA 3AROA 3LV3B 4O2FB 3RZCB 4YSCA 4HWNA 3QWRA 4KAQL 3P3RA 1G5GA 3LHAA 1UZ8B 1MSPA 5E0QA 3ZE0B 3JWDL 1DFXA 2GTWB 3VD5A 3NP3A 4P2OD 2X28A 1A9BA 3CX5J 5AAWC 5E7BA 2NSMA 2GT9B 4K9JA 1SVZA 5SWSB 4C83B 1Y6NR 1XF3A 2YHGA 3O4LD 3ULSB 2WXMA 2Z64C 4QRTA 4YHPA 1JS4A 5KWYC 3HJ0A 2GAZA 1NCNA 5FX3A 4YL4A 1UWGH 1X5IA 1EFXA 4I0CC 4JN2A 1W16A 1GS7A 1CFNB 1DL7H 5D7LE 3COOA 3GMOA 3O41A 5T5NG 2QLYA 3X12B 1Y0LB 4NM8L 2IF7A 1Q72H 1O9VA 4OCRL 2YD3A 2EE2A 1SEBA 1XV8A 2Q0ZX 5L88H 3CZFA 1GS6X 1EAJA 5EUOA 3DVNA 1UZ6E 1FWXA 4KTDL 1DUZB 2V8MA 2QVKA 1JZHA 3QA3B 3VXRD 1I3RA 4M48H 2ATKB 5E51A 5INCA 1WZAA 3UAAA 5B1JA 4HMEA 2DM2A 4JPQA 3WKPA 5GGTH 1XF2B 2HJLA 3GRGA 5CU5A 4Q6IB 1YPZF 3EO0B 1OAYL 1L0XA 2L3BA 3C60C 3CLFL 3OX8B 4JM2A 4ACPA 4FXKB 4NZRL 2UX7A 3NIDF 3IJ7A 4KKNA 1LO2L 2WXOA 4L3CB 1XX9C 3MRRB 4MQSB 3KAAA 1D6VL 4ISVB 3RPKA 4I3SL 4FD0A 3FOMB 3VG9C 3ESNA 1MQ8A 2WVTA 3BH8A 1KACB 4GO8A 1VGEH 3BW9B 1WWWX 2OZ4A 1KTRL 2PABA 4NKDA 4OD3H 4KJQC 3MBWB 2OPCA 4X4KA 4E5XB 4JG1L 5EOQH 4OZHB 2NXYB 3QUXC 1J0HA 3T0AA 4PVLA 4QXVA 4LCIL 5CILL 1KDIA 3IJ9A 4XP4L 1RP9A 1FLRH 1OTUD 1QG3A 3F12A 2I32A 1BECA 2PPFA 4KK5D 3BQUB 2ZONA 4P0DA 2YFNA 2H1XA 3HI5H 5E2WH 4PGBB 1JZGA 2YRBA 2O6FA 1GGYA 4Y8AA 5E24E 2YAHA 4U7SA 3SKMB 4XP1H 3T65B 3VI3F 3T6ZA 1U8NA 2XQ0A 4PAZA 1JHKL 3HG0A 4AMWA 3GIZL 5DUPH 4P3CH 2CXKA 3DDGA 4NQDE 1NH6A 5IROC 3DWTA 2VUOA 3QDHA 1L3WA 4TUJA 2BY2A 1TYEB 2X42A 2ZUQC 1E2WA 4Z3FA 2BIQA 5DZLA 3QJZA 2NY6B 4RAUB 4NQEB 5J12C 2E4FA 5GGSY 2C8NA 1RZJC 3I6KA 4MYWB 2FBOJ 2NUPB 2RR3A 1KCSH 5E6IB 3TBBA 2DJUA 3AM8A 2J4WH 3ARGA 4W93A 4QO1A 3MU3A 3GIVB 1XF4B 5AB9A 1B88A 1OGAD 1ROWA 2HVJB 3ULUC 4M5TA 2ZXGA 3ARTA 4AGPA 5HYJB 2YO3A 2ZOTA 1PKQB 2KI6A 4F57L 3KLKA 4WWPA 4BSVB 5TDOA 5TK4A 1PD0A 5C6PB 2NY1C 2OZ4H 4UDUA 1FN4B 2K9FB 4MA1B 1MRDL 4Y4FD 3QT2A 3L2LA 4YHKL 3S36H 3TJHC 4DN4L 3ZN6A 1I3GL 4Y1SA 5GIRB 2P47B 3ABMB 4HUCA 1NMAL 3F2LA 1XSOA 1SXCA 3IDJA 4LRNH 3C5JA 1L6XA 5EBWA 3RHWF 4Z3GA 5IW1A 1XBRA 4WFGD 5EBMB 4NDMB 3IDMB 3MRDA 2IOMA 4JO1H 2IO5A 5JPNA 1CS6A 2B9BA 2BSSA 4GUOA 2E27H 5JQ6L 5I8EB 4DUWA 5DFAA 4AJWA 2Z31C 3E6HB 2CJ3A 3PWLB 3HLAA 1MI5A 1JHTA 2QELA 1OM3H 4JQIA 3BHBA 2XWJB 2O61B 1IJNA 1IAMA 2X6AA 1CI3M 2YAOA 3BP7A 4N9GB 5I1IL 4OCNC 1YYMH 2OMZB 4KK6D 4L4TD 2Y36H 2E0PA 4HEPG 4YBQC 2Z7UA 3NTCL 1D5XB 2VYRE 4U1LB 2FQFA 2DEYX 4JFYB 5T3XD 1TVBB 4EXKA 5B4MC 5DVKA 5DK3A 2XETA 2Y3AA 3MV8A 4TL5A 3S97C 1R4XA 2NY6D 2E9GA 3EYSL