1TEGA

Crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
VEVLLGGGDGSLAFLPGDFSVASGEEIVFCNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGECYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plastocyanin, chloroplast
publication title Novel Disulfide Bonds Effect the Thermostability of Plastocyanin. Crystal structures of the triple plastocyanin mutant G8D/K30C/T69C and the double plastocyanin mutant K30C/T69C from spinach at 1.90 A and 1.96 A resolution, respectively.
rcsb
source organism Spinacia oleracea
molecule tags Photosynthesis
total genus 24
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1tegA00
3NJIA 5A7EA 1L9PA 3ZX1A 4E9TA 3FQ1A 2ZWNA 1ZIBA 2XV0A 4YSRA 4E9XA 1OCZB 2XLLA 1PY0A 3SBRA 4KO5A 1SDDB 2GBAA 1AS6A 1ET7A 2VM3A 1NIAA 1NIFA 3PAZA 3FQ2A 2HXAA 1W6WA 3EH3B 1N70A 3V9CA 3CVDA 4GY4A 2VW7A 2YAHA 2VW4A 1L9TA 2BWDA 2XU9A 1GS7A 3ABMB 3CDZA 2YAEA 4YSTA 1PLCA 1HAWA 3PXLA 3S8GB 1OCOB 4DP1X 1MG2C 1B3IA 3KW8A 1E65A 4A2HA 4BK5C 3IN2A 1SJMA 2BW5A 1GSKA 3FSAA 3CG8A 4M4RB 3QPKA 4HAKA 1UATA 2BHFA 1ASOA 1J5DA 3X1GA 3WG7B 2VN3A 4JHVA 1ZV2A 5AZUA 1E5YA 3FYIB 1KCWA 1DZ0A 3MX0B 1M57B 4YSAA 1AZCA 5FC9A 3PCYA 1WS8A 1VLXA 1XB8A 5PAZA 1ILUA 3FSZA 3NJHA 1PZAA 4A68A 4W9ZA 1HFUA 1AZRA 4DP4X 5B7MA 1RCYA 3NT0A 1NIDA 3X1EA 3AG3B 5D4JA 1QHQA 1KCBA 2BP0B 2WO2B 1ZDSA 3ABGA 5D4IA 3MBWB 2W88A 1AS8A 6PAZA 2UXGA 1JXFA 2IDUA 1J9TA 1AZNA 4YSSA 4E9RA 1ET5A 1BXVA 3NSCA 1MDAA 3GDCA 1M56B 4E9VA 3EF4A 4G7QB 1IKOP 2PPEA 1BAWA 5B7EA 2YQBA 4Q8BA 1X9RA 1M9WA 1DYZA 3UABA 3ZDWA 2HZHA 1JZHA 1JZJA 2UX7A 3AZUA 3V9EA 1ADWA 2PP9A 2VM4A 2ZXWB 1W8EA 1PZBA 3FT0A 5I5JA 2DYSB 4TXVB 5I6KA 1I53A 2VW6A 2P80A 1TEGA 2GIMA 2PPCA 4MFHA 5I26A 2FQEA 4P5SA 3T6XA 4G70B 1SF3A 2R7EA 1GY1A 3T6VA 4HHGA 3FU7B 4A2EA 2GC7C 1NIEA 4ZK8A 4DP5X 1TKWA 2EIMB 3WI9A 2FQGA 5PCYA 1IC0A 4KO9A 1CURA 2JFCA 1FA4A 3FSWA 4YL4A 3PLYA 3ZIYA 1XMEB 1OE3A 4X4KA 1GY2A 1JZGA 4YVUA 2ZONA 1BQ5A 3BVDB 1W6LA 3NP4A 3X2QB 3T6ZA 4M3HA 4F2FA 2FT7A 1RZQA 2OV0A 4NERA 1A4BA 1BYPA 1MZYA 2I7SA 3WNJA 1A8ZA 3N2JA 2P80D 2YAFA 4YSEA 1T5KA 2HX7A 4F7KA 4DP7X 1PCSA 1PF3A 3AY2A 3NP3A 1AG0A 3IN0A 4PCYA 3AG1B 3FU9A 2GI0A 4KO6A 5I6MA 1IBZA 3CDZB 4DP8X 1RKRA 2OJ1A 4HIPA 1NWPA 4DP2X 4G7SB 3OD3A 1IBYA 1NINA 4YSDA 2J57A 1AG6A 5AFAA 2GSMB 3T71A 4DP6X 2Q5BA 1BYOA 1AIZA 1SF5A 3H4HA 2CAKA 4HCFA 3X1FA 2PP8A 4CSZA 2BZCA 5EHFA 1SHXA 1WA0X 4YSQA 4JHUA 2H5UA 3WKPA 1FFTB 1OOWA 1SFHA 2PLTA 4BDVB 2GB2A 3UACA 1NZRA 1OE2A 3QJQB 3X1NA 1CUOA 5TK2A 1GS6X 1RZPA 4JKNA 3NJKA 2CJ3A 1NTDA 5B1JA 1SDDA 2NRDA 1F56A 2PPAA 2AVFA 1AR1B 2Y1AA 3SBPA 1CC3A 3FPYA 2YXWA 3T6WA 2FWLB 3IE9A 4DPCX 1EHKB 1PLBA 3ASNB 4K9JA 3FPXA 2MRYA 9PCYA 1E67A 3S3BB 1J9RA 4A2FA 4DP0X 2TSBA 3S3CB 2EILB 1PZCA 2UXVA 3FU8A 3NJMA 5TK4A 2IWFA 3CVCA 4N8UA 3PAVA 4BXSV 1MG3C 1ZIAA 3QJRB 4F2EA 1N68A 5AKRA 2CBPA 3CZUB 4AKQA 3N55A 4WTQA 1KDIA 5B3SB 2QT6A 2IWKA 3T9WA 1PAZA 3H56A 4HHWA 3ABKB 4PAZA 2YAMA 2YAOA 3FYEB 5B1BB 1JZIA 2BP0A 1EZLA 3OMAB 1AANA 1JXDA 4KNSA 5E9NA 4DPBX 2XV3A 2XWZA 2DWTA 2IDTA 1V54B 2JXMA 3H4FA 3TU6A 2PP7A 2XVBA 4GXFA 3FQYA 2AZAA 2CUAA 1AOZA 4AKPA 2UXTA 2BW4A 3UAEA 2Y69B 2HRGA 4KO7A 1ILSA 1A3ZA 3ZBMA 2UX6A 3FS9A 3FSVA 5ANHA 4BWUA 3WKQA 1NWOA 4E9WA 2VSMB 4CSPA 1ET8A 1E30A 2IDQA 4KNTA 2XXFA 3HB3B 2LLNA 3WNIA 2GHZA 3ERXA 4BWWA 2FT6A 3TBCA 4AZUA 2RACA 3DTUB 1OF0A 3CVBA 3TA4D 3G5WA 3SQRA 3UAAA 2HX8A 4N4YB 1R1CA 3OQRA 2FJSA 1KGYE 2WSDA 3NSDA 3DKHA 1QLEB 3QJSB 4P5RA 3AW5A 2QDWA 2IDSA 5I28A 1HAUA 2HLEB 3FU7A 2TSAA 4BXVA 1WS7A 2EIJB 2FQDA 2DV6A 3EH4B 4AI7A 4NAJA 3RYMA 2YAQA 3X1BA 2BP8A 5F7AA 4EF3A 5I6LA 4L0PB 3PPSA 4YVNA 2BO0A 4E9YA 2EIKB 2AFNA 5B7FA 1GW0A 1X9UA 2IWEA 2Q9OA 2VSKB 3QQXA 2I85A 1OV8A 1ZDQA 2XV2A 1J5CA 4FAAB 1J9SA 2X87A 3WIAA 5I6OA 2XX0A 3SBQA 3AG4B 4A2GA 1FWXA 1KYAA 2YXVA 1JVOA 3NSYA 3GYRA 1BQKA 1SNRA 1NIBA 3QJVB 4HCIA 4Q89A 1JVLA 4E9SA 2PCFA 2VMJA 1YLBB 2JKWA 4RH4A 3BQVA 1JERA 1KV7A 1NDTA 3NSFA 3NJFA 3JTBA 5IY5B 4YSCA 2IDFA 4GP8B 3AG2B 1ETJA 4A67A 1ID2A 1V55B 4AX3A 1E5ZA 2ZOOA 2B08A 1L9OA 2I7OA 4HCGA 4BWTA 2J55A 3NJJA 3C75A 3IBOA 1AQ8A 5I6NA 2J56A 4UAHA 1ASPA 2FT8A 3HEIB 1JZEA 3ASOB 1KDJA 2PPFA 4KNUA 1BEXA 2HRHA 4G71B 1JZFA 5I5IA 1XB3A 3IEAA 1OE1A 4BDVA 5D4HA 4GP5B 1ZPUA 4HZ1A 1GR7A 2YARA 2J5WA 5LDUA 3JT2A 1A4CA 1IUZA 4QLWA 1PNDA 3ABLB 1CYXA 2XXGA 1BXUA 1MZZA 3TASA 4E9QA 1SFDA 2AANA 2W8CA 2A3TA 4DPAX 3D12B 2EINB 2IH9A 2QPDB 3EH5B 3NJLA 3UGEA 2PPDA 7PCYA 1TU2A 3QJUB 1NPJA 3QJTB 4HALA 1QNIA 1JXGA 3NJGA 1V10A 2HX9A 1CYWA 3OM3B 2OCCB 1L9QA 2DWSA 1AACA 2R7EB 8PAZA 2AZUA 1AZUA 5B1JC 1PNCA 1SHWA 2DYRB 1PMYA 2N0MA 1WA1X 1L9RA 2GC4C 2IH8A 1GS8A 3GXUB 3DIVA 1PLAA 1XB6A 2E86A 4YSOA 3OMNB 1TEFA 1GYCA 3KW7A 5B1AB 2XUWA 3U25A 2YAPA 3S8FB 4WKXA 4KOCA 4FA7B 4YSPA 4YSUA 1A4AA 1BQRA 3S3DB 2QDVA 2FTAA 1WA2X 2CCWA 6PCYA 1KBWA 1L9SA 2XX1A 1J9QA 2XYBA 4KOBA 4QKTA 4UF7C 5F7BA 4NB7A 3EHBB 1AAJA 4G7RB 3NYKA 7PAZA 1A65A 3PAUA 2H47C 4A2DA 4ENZA 2B3IA 4DP9X 2BP8B 3OMIB 4W1TA 2H3XC 2PCYA 1BXAA 1OCCB 1OCRB 1NICA 1URIA 5B1KA 4UANA 1AZBA 3TBBA 1KBVA 4AKOA 2IAAC 2QPEB 2BZ7A 1AS7A 2MTAA 4GYBA 2FQFA 3NJNA 3UADA 2WO3B 1NPNA 2CALA 4G72B 4A66A 2FNWA 4GP4B 1ASQA 1JOIA 1WAEA 3L45A 2X88A 5I6PA 2UXFA 5I5MA 2DY2A 2BWIA
chains in the Genus database with same CATH superfamily
2C9VA 3ARYA 4QXUL 3A6OA 3LQAH 4DVBB 4H40A 4ISVA 3FTXA 4XH2B 3CHOA 2LW3A 3QZOA 4N86A 4U1GB 3V4UH 2DQGH 1UB5A 5GS2D 4JKLA 3T4YA 3U9UA 4R5XA 4IK7A 3BP7A 3SJVA 2YAHA 5BJTB 3BEWB 1ZHNA 5FIEA 4AVJA 3B5HA 3EJTA 1IC7H 3BUPA 5CXPA 1IEBB 1HAWA 1MCCA 1Z3GL 3UBXG 2NW2B 4LSRH 2W38A 3VD2A 3G5XB 3HNVL 2R2HA 3SE9L 3L1OH 4ODUB 3VFVA 1PKQE 4WW2C 5B21A 4XTRC 4BZ2A 3QFDA 2VC2L 5D1ZC 2Q7YA 2APFA 5SX4H 3V0WH 1ZSDB 4WFFD 1QPXA 2ZG3A 4FLQA 4X8CA 3O2DH 1WGOA 4P0DA 5EDXA 4CU7A 1Y18B 2UZPA 4RFNB 4B41A 3VGGA 3QO1B 5E94A 1BAFH 2GCYA 1WC7B 5HXMA 1K4CB 1GTNA 1PZAA 1YY8B 1EO8H 4JFDE 5IV2A 4HS8L 3FCUB 3MLRL 4MJIB 3CPLB 1H3UA 3X1EA 5C6PB 4J8RB 4BQCA 3C9NB 1ZXQA 3CSPA 1A7QL 1W72B 2W0FA 3I2CL 3MBWB 2CE6A 1JPSH 3OXRA 4OFVA 3P0VL 3NCFB 3VQ2C 4YSSA 4M93B 2WN3A 5AAWC 1TQBB 3L4CA 1ET5A 1F4HA 2LFEA 4ORGB 4PGCB 3M1BB 4XOAA 4Y5XC 3WN5C 2WD0A 2R69L 4XNUH 4ODBD 4NSKB 1RAMA 3ZY7A 2XY1A 3QZWB 5C07D 1XH0A 3ZTJH 2N7SA 4HLJA 4MMXA 4P2QB 1A0QH 2XWBA 4Q6IC 2Z6FA 5D2LB 5EC2A 5GJTH 4GQQA 5D7KE 2W80C 3V0JA 4MA8L 3V5HB 4AYSA 3BKJH 3IT8D 2CKBH 2CUIA 3X3FH 3IAPA 3ZKXB 1QR1A 3CLWA 2VIRA 4FNLL 1ZD6A 2V9TA 5DTFB 1J9CT 1H5BB 1GZPB 1QFUH 4OZIE 3FCBA 3K0WA 3KJ6H 2YK1H 4PMEA 2MHAB 3PXJA 4PJ5B 4XAKD 3E9TA 4XI5D 2B7DT 2HT3D 1LO2L 4Y2OB 3RY6C 1B90A 5JHDA 5L2JB 2FQEA 2FATH 4DUXA 4YIQA 2JTDA 5EBLA 3CHSA 1E40A 3G6JA 1NCAL 2VISA 4PVNA 1S5IL 3JWNH 4I7ZC 1QSFE 3MNWA 1UEMA 4PP2A 1U41A 4HPYH 3I6GB 3RZCB 4LEOB 3ULUD 1S7RA 3ILQD 3HHRB 5BV7L 2BRQA 1TENA 1ACXA 3KAAA 5DI8A 3RILA 1GYVA 1V3LA 2B1HH 3KPRB 1XCQA 3BJLA 1MCOH 2RD0A 3B2DC 4GG6F 2NXYB 1OE3A 5I1GH 2MMXA 3LRHA 5IESH 1WHPA 3BVDB 3TJHD 3VXMB 1XH1A 1PD1A 4LKXB 4PM1A 2ZX8A 3SPVB 5DMYA 3RVTC 3V4VB 5HI5C 1I7ZB 2VC2B 5L0QB 3SDAC 2ZJSL 5A6MA 4C8XA 5IBLD 4NHCL 4P2QE 4OFYA 1J0KA 2R2CA 3CBJB 1BYPA 5D2LE 5TF1H 5IIEB 4OLEA 1YA5A 2W91A 1HHHA 2BNQA 4OCWL 4PB0H 3KHOA 2R2BB 3T65A 2Z91A 5JHDD 3PABB 2F74B 5FF6A 4KO6A 5CGTA 1JNNH 4XPGL 3EYQD 4JO1H 4G59C 4KTDL 4OCNC 3MGOB 4TULL 1CT8A 3PNWA 1JWSA 2GBTA 3FB6B 2ROYA 4I4WA 4M7LL 1ZKAA 3ZGHA 3VWKA 1MAKA 1V5JA 2PR4L 1I3GH 2WQWA 3O6MH 4X6DF 4Z7WF 3M17B 2AXJA 4F15C 4YSQA 3IDMB 4C58B 2NY3B 3EGDA 4PJBA 4U1SB 2OMBA 1MFAH 2B9AA 2PLTA 1CDYA 3KPRE 5JOFB 2HRPH 3O4LB 1FL3B 2ZUUA 2ALAA 2BFVL 4YR6B 1WJ3A 1ZHBB 2NNAB 5C9JA 1HNGA 2QTEA 4OFYD 2OR9L 1MNUL 3QIWD 3VJ6A 2VR8A 5GGTA 2PPAA 2FJGA 4N6RA 2BNQD 2NY0B 3FFCD 5JIMA 1WFNA 1MHEB 5BUAA 1H19A 1AO7E 2IGTA 3FPXA 3TT1H 1UH3A 3TA3D 1Q9KB 3S3BB 4PGEB 2VERA 4QHLA 1ITCA 1KC5L 4NRXB 5F7YC 2EIBA 5B39G 4K5MA 2CRIA 4PJDE 3KBPA 4DEUA 4EDXA 1JG9A 5EA0H 3HMXL 4EE2A 3C6LB 4NQXB 5BMFH 1TQUA 1A7NH 1OSEA 2CPCA 4DZ8A 4PSPA 3Q2WA 4GQRA 3QEQA 5BV7B 4IDLA 1IT9L 3DHUA 2O5XH 5D7IF 1HDMB 3C5JA 4AKQA 3NFPB 4PJXF 4QD2E 4OKVB 3VGBA 1ZVHA 3O41A 1UKSA 2JK5B 2NX5D 1WUZA 3FYEB 4PRHD 4M6NH 4JZOB 3OMAB 4YDIL 3O4LE 3CIAA 5A2BA 3GRBA 1NFAA 4DPBX 5HGGS 4RMUA 2BIQA 4ZUSB 1O7VA 3S37L 4GKSB 4E42A 1XCTA 15C8H 4WFGE 1X5HA 5CCGE 1J10A 1CXHA 4PJGB 1HEJC 2DQIH 5M94B 25C8L 1WFIA 3MI6A 4IRJA 4NJAH 2G9HA 1V27A 4WEEA 1K85A 3T0EA 1EXHA 1A3ZA 2ZP0T 3ZBMA 3BUDA 2C9RA 2HVJB 3E7JA 1A6UH 3BAEL 1BHGA 4UV7H 4KKBD 3ARBB 5IROA 1XF5A 3QEHA 5DEFA 5BVJB 3QEQD 4UQ3B 3FO1A 4FKHA 2IDQA 2F1AA 3VWJD 3OHMB 4LGSB 1R5IA 5G2NA 4PMFA 1HOCA 4BGLA 2FT6A 2WTRA 1QR4A 2WSPA 3O3EB 3CDFA 2NY1D 5DUBA 3IVKB 3Q9QA 5I16B 1E6JL 3D30A 1MLBB 1CU4H 3NSDA 3RTLA 3VFTB 1D7BA 1Z9PA 4EIBA 5IR1B 4L9LB 3BWUC 3L4ZA 2CBOA 4PLKD 4FADA 1TVBA 3FN0H 5I28A 1YEWA 4C56E 4QJ4B 1TZGH 1FL6A 3L4YA 2XIBA 5F6HI 2DQEH 2YC1A 3MJ7B 3MUHL 1QKZL 2HG5A 4YK4B 4OLXH 4P9HC 3V0DA 4EF3A 1BVKA 4Y4HB 2VDNL 1NFDF 5I6LA 4FLOA 1FFOB 5E99H 2AJXH 3VDBA 2MH4A 2RR3A 3H9ZA 5D6CB 4PJGE 5C0DB 3U4BH 4IBWA 4LZKA 2J2ZA 5AG8A 1T2XA 1HTYA 3X3GH 2ERJC 4KJYA 4DOHB 5F0MB 1EXGA 3OGCA 6FABH 5DYFA 1XR8B 2TRYA 4KI5E 2XA8H 4LCCA 5I2IB 3FCTB 4OVUA 4MXVE 1KYAA 5DSCB 1SN2A 5GJSL 1NIBA 4UT6A 1JVLA 1ZT4A 4QYOB 1JNHB 4NQCB 1FUNA 5IMLB 3MRLB 3L2LA 2DQFB 4J2QA 4LF3A 4NUGL 3ZMEA 3TBSA 4UDUA 4CBZA 5CGYC 1OCWH 2ITCA 1J0ZA 2EQDA 3NPSB 1R6VA 1Z0MA 4JCLA 4QHKJ 1XD0A 4EZJA 1T5XA 4RNRB 4DJMA 4C4BA 5JXAL 2DBLL 1JN6A 3NK4A 4LRNL 1N5AA 4GRWB 1DBKH 1JZEA 4L2LA 3MNZA 3HPJB 1BFSA 1EBPA 1HHIA 4QTHB 2HVKA 1CVSC 3T09A 4S1DC 4AEEA 4FQ1L 1GJUA 2HRHA 3OF6D 4K8RH 3UG5A 3DYPA 4UIMA 2A73A 5CHNA 3UH8A 1J1XL 2OL3A 2HJKA 4NO5A 1YEIH 4A7UA 3RWJA 1XIWC 2YLHA 1CD0A 5TQ2L 2J5WA 1NFIA 3THML 1A3QA 1GRWA 4HUXB 5C8JA 5HVWA 3N41B 1BXUA 1M2VA 1QFWI 3PGDB 4GQ9H 4E9QA 5BOPA 4DOHE 4XMKL 4GW5B 2YD7A 5F7MC 3G3LA 1F6AA 4OF8A 5EU6B 4NQCE 7PCYA 4M6OL 5DHYB 4RWYL 5I19H 4WEBL 1QNIA 4UT9H 3NJGA 5JQ6L 1F4XH 3FW6A 3P73B 4GXVL 1K8IA 1L9QA 2OCCB 5D2LF 4BKTC 4ZX4A 2R7EB 4FABL 4BBWA 5CZVH 4H0IA 4J2XA 4OIIL 2CO2A 1MCDA 1OLLA 3QIUB 5AAMA 5GRXG 4MLSA 3NABL 2OK0L 3QAZC 4YDKH 2VDNB 5F44A 4GRWE 3VSTA 3WY3A 4BZ1A 2ARWA 2H6UA 1BFOA 2JB5H 1C7TA 1GGUA 1S7SA 2B4CH 3GSWA 3HS9A 4JRFA 4FXGB 5GGSY 4WDIB 3SYPA 5I1EH 4Z8FH 4OI8A 5I66A 4AQ1C 3BZFB 2VRKA 2IIJA 3FQTB 3K74B 1YYML 3PWJA 4FNPA 5E8OB 1VGKB 4PS4H 5EOQH 2LU7A 1RUKL 4JFPB 3SY0A 3CDYA 1L9SA 4HSAC 5CUSH 1FNEB 3M6DA 4XVUD 1UA6H 1CGVA 1XTLA 4KY1H 4KHXH 4L0ZA 3GMOB 4JO8A 4AQAB 5HI3C 2WXPA 3Q2VA 1V3JA 2EUVA 1BW8A 2DF3A 3TNNB 4OFQA 6TAAA 8FABB 3HG5A 2WGNB 4XNYH 5EU6E 1LD9B 2WCPA 4TLUA 4LPYA 2VLLB 3VRLE 2A9MH 4P2CG 5KG9B 3IPBA 4YFLI 1OCRB 3OX8B 5CP3H 2Z92A 5INCB 2IV8A 1XXFC 4IHOA 5FA3A 2MCG1 3IDGB 2VUKA 5JXEC 5IB3B 2MTAA 3VM5A 2DBJA 1AZVA 1WITA 5JW3L 3WHXA 2FR4A 1KJMA 4NZTL 4BGDA 5I6PA 3A6CH 1GMEA 3QDMA 5MENE 4OBSA 1PDKA 3MLTB 5CCHE 2YMXL 4LLQA 1UENA 1BOGB 3NGBC 4EVNA 1OSZA 1KXVA 2WW8A 3Q43A 2F5AL 1CFSA 2QTVA 5A1AA 5L88H 4XMVA 3V10A 2JCCB 1I4FA 4WTWA 1NIFA 2DD8L 3KYNA 4EUPH 5I17A 4BFRA 4JO3H 1L5GA 2R1WA 4WW1A 4Y4KC 2B39A 5CINH 3JSSA 2OMNA 3DV4B 4YAQA 43C9B 4WWKA 4ZFOA 1HKLL 2GJ6D 4XNXL 3CFKB 1DQMH 3MA7A 1JPFB 4HIEB 3KW8A 4NOBA 2VDPL 4K94H 5E1AB 2X1WL 3VFGL 4A2HA 4BK5C 2OYLA 3QZPA 2OTUB 3N91A 1WWBX 2X5PA 3SQBA 3T8VA 3VQMA 1HXMA 3QXDB 4JZNA 2VITB 3NH7H 3Q3GB 2AEQH 3HHSA 3OKMA 1BZOA 3D2UD 4JHVA 4BEIA 1PIGA 3GSNA 1AD0A 1WWAX 3FB5B 5FEBA 3QDMD 1EEZB 1F6LL 1TYJA 5CN2A 3CMOL 5FC9A 3U9PL 3LDBC 4G1MA 5PAZA 5B3NA 3K46A 1CFQA 4A7VA 4NP4L 3LEYH 4FZEL 3BDYH 1CLYH 4XAWL 3EOAA 2R0LH 1FPTL 1I7RA 2P8MA 4MCNA 4OGQC 1AJ7H 3SDDA 1I1RA 3MLYL 4V1DD 5B7MA 1UCBL 5EFIA 4M02A 1V7NL 1RVFL 5H4YA 4PR5A 5DK0A 4QRUA 3HKZA 5AQ0A 2EVGA 5IM7A 2JCCE 2ZNWA 3IE4A 4WWKD 3J27A 1IKNA 4NZDA 2R39A 3A6BH 2CZNA 1UURA 2HWZH 2VDLL 4N5ED 2HFGH 1TJGL 3D06A 4PI2A 1SMAA 5GIRB 1OWRM 1OARH 5B7EA 5K1JA 1G9EA 2V17L 4ICXA 2GW5A 5IVZB 1MEXL 3STLA 5I23A 2FIKB 2X4QA 2F9BT 1WZKA 2B14A 4AYGA 3N42B 5IMKB 3D3VE 4P3DA 4PJGF 5EC1A 3PWPA 5GSVA 3MLPA 4MAUL 3VSQA 4A55A 2K3HA 5AYQA 2EH8H 2ENPA 3BZDA 4DW2H 5KBKA 1KJ2H 3RB7A 3SDDD 4MXVF 4UTCA 5C0CB 2OMYB 1ZLUK 3INOA 1TOXA 1ZGLM 4OCYL 2HUHA 2JIXB 5JDSA 4FJZA 4HEPA 5E7FA 3SOBL 1K5NB 1KF9B 4N0CC 4F1SA 1D5XB 1SJHB 2IGFH 3WSQL 2IAMB 4Y1SA 2HA1A 3WI9A 3FQXA 5JZ7C 3TP4A 5CSGA 4Z77A 2H3NB 2KS0A 1IC5H 4W9EC 1FAKT 4YL4A 5DYOA 4YBLC 5JHAA 1MWAH 1UKQA 1XMEB 2VDPB 3LH2L 4RMRA 1KEML 3FB8A 1BQ5A 3JTSB 3T6ZA 4LMQE 4XE0A 1GGCH 4ODTH 3JYCA 5LJYH 3ZQ9A 4MKTA 3PWPD 2FYVA 4K7PH 4AJVA 4I3RL 2ADIA 1E4XI 1MDTA 4Y9EA 5HHXL 4AIZA 4G9DA 1O9ZA 1RUPH 1J11A 2YZ1A 1N0LB 3CVIH 1AC0A 4HJJL 4XNMA 5F9OH 4AY0A 1T5KA 3N44F 2G3NA 4JFFA 1Z5LB 3PJNA 4J6RH 3U7YH 1LE5A 4ODHH 4Y9BA 1T7WA 4QDGA 4HS6A 5FWQA 2BY1A 2GI0A 3MMEB 3CK0L 3NBNA 12E8L 1HEHC 5C0FA 4ZUTB 1WEJL 3RFZA 2Z4QB 4FNRA 3CFNA 5CJXA 2XTSA 4ABWA 3TH3T 3T71A 3PDOA 3F5WB 1OZTG 1OM9A 4X80L 3VXTA 2PYEB 3I3EA 1HK6A 3QRFM 1D9KA 2VDLB 4XP9L 4J3OD 3SBWC 5B3JE 4ANUA 1CBVL 4XXCA 1JFQH 1IAII 4QHNA 1B0GB 4WKZB 4A6YL 4LLMA 2D8KA 4JPIA 4TSCH 4L48A 4BELD 3QJQB 3P4OB 3M86A 1CUOA 4OGAC 3MTRA 4HMCA 3RI5K 2FHFA 3PWNA 1QLEL 1T2QH 5J1AA 4URKA 2XWJA 1NTDA 2BVOB 4QOKB 5J9PA 1C16B 1IGTB 2A5UA 4GQPH 5I8KL 5DD3H 4GBXC 3ZTNL 1O7SA 2C1OA 2XJKA 1W0VA 4KROB 2QVKA 4JRYB 4PJFA 3ARDC 4X2UA 1U91B 4HIXH 1EHKB 4X98A 5CBAB 2H6OA 3PY9A 2I07A 1P1ZB 5JOPE 1N64H 2ZUXA 4ABVA 3HR6A 1C1EH 2NY2B 1P4LB 4DQAA 1JI1A 3ET9F 3MRPA 3CSYB 4YPJA 2FYYB 3PL6D 1B4LA 1A5FH 1ERNA 3N41F 4DERA 2C9SA 4HS3B 1RHFA 3K4DA 4APXA 1T5WA 4HCRA 1HYSD 4MD4B 1TJMA 2W92A 3UJTL 4DUWA 4ES8A 1D9KD 2DICA 3EFOA 4FCHA 5K9QG 3KMDA 3AU0A 2DWXA 2CJTA 2NZ1A 1C9SA 3VRLF 3OR7A 4K73A 2P28B 4A7QA 3FZUC 4GG8B 1NLBL 2W65B 3BH8B 1T03L 1T7VA 4M56A 2PNDA 4OLYL 5K59F 1PAZA 1XVSA 2HMIC 4X8JA 3ARRA 3IMBA 4ECNA 3GUTB 1BIHA 1I7TB 5E00B 5DQDL 3BVTA 2WBJA 1DJSA 3L5WA 5ADPH 1EZLA 3Q05A 1RUAL 3OV6A 5FM8A 5ERWB 4ELMA 5LKNA 3HLKA 4QOKE 2PP7A 2GT9A 4RCAA 5F8RC 1BZ7A 4ZUVB 1VACB 4BJLA 2X4UB 1PEZA 1FZJB 1EEUA 4GIOA 1O5PA 4CW1B 3E8VA 3P11H 3P30H 4UT7L 3FTUA 5AKTA 1QHOA 2G9KA 1YECH 3X14B 5DGQA 1UH4A 4JN2A 5FO9B 3AREB 3GHPA 1J0YA 2Z34A 2GK0A 4PRIB 3QULB 5EZIH 3M07A 3JV4A 1G84A 2J21A 3TBCA 5CGMA 3NIGB 1BWWA 4U33A 1KLGB 1NQBA 3VVVA 1OM3H 3FTGB 4ZW3A 1I9EA 4HGWA 4A6YB 2GJPA 5IVXB 2WBJD 4IJ3C 3ZXAC 1A3RH 1QLEB 5DD6B 4WO4C 2ZQKA 2AI0L 3IU3B 3MRQA 2AP2A 4I77H 4TLKA 3CZFB 3PREA 4G11A 5FK9B 3I6KA 4BXVA 5BNXD 1MCPL 1XSJA 2NUPB 2P52A 5DFVD 4B5EA 5A3IC 4OJYA 5FUOL 4ATWA 1OP4A 1KACB 2N3JA 4N2AA 1NEUA 3SKMA 3MFGB 4AGNA 2AITA 2NYYC 2VMDA 1Y0LA 3WFBH 3WIHA 1I75A 3IK2A 2JCCF 4MDIA 3EOBA 4DWHA 1KB5H 1SXBA 4B3EA 4YXKH 2CDEB 2FCBA 2RQ8A 5HYIA 3LRMA 2ZZUT 2MKWA 3GLZA 5ABDE 2WXIA 1BQKA 4EI5C 5DJ2A 4M8UA 1I9RL 5FM4A 4A38A 5DRXA 2C1PA 1BREA 1RJYA 4JKPL 3B37A 4PRIE 4UB0L 3JTTA 4AGLA 5G4MA 2BSED 1OT4A 4I0PC 1FZOB 1ETJA 3I6LE 3NIGE 1YYLH 2RHEA 1TZAA 5CJQH 1JK8A 5JIQA 3KH3A 2YOAA 2ZOOA 2ZTBA 3CXHK 4QRQB 3QUXC 3OAUH 3Q5OA 2F8OA 1NBYA 3VGAB 1TPXB 1BPLB 1SDYA 3WFHA 2ZAIA 1ES0B 3DVIA 5F1IA 5IVXE 2YPLD 3MN8A 3U82B 3LZLA 4UAHA 4ANXA 3LNDA 4L8BA 4YXHL 4JHZA 5EZJA 3ZE0B 4QRAA 2YRBA 4POZC 2CXGA 1FAIH 4M5YH 5ECGA 1HCZA 1WFMA 3R06B 4XPTL 5JUEL 4FE9A 5DVOA 5J6HA 3QYNA 2VDOL 1L0XA 3KR3L 3RDTB 4AV5A 5I5IA 3O3AB 2RH0A 2IQ9L 3GLEA 3QE5A 2UY7B 4OZ4A 5DDHB 4NM8L 3LV3B 1HCFX 3JUZA 4ODXB 2PTUA 3AU1B 4XMWA 5F7FA 4QLWA 3V0HA 4ELKA 4Q9RL 3TIEA 3VI3B 4DKFH 3KLHC 1EX0A 4MVBD 5FYJU 3QFJD 1GW6A 5CWSA 2Y06H 3U0TB 1ECZA 4ODSH 1SBSH 1M71A 3U2IA 3NN8A 1H8LA 1NCOA 4MD5B 4G1EB 5JR1H 5EWIL 5BO1L 2IG2L 1JYNA 3UYRH 3KXFB 3DO7B 3JUYA 2FBRA 1THAA 2JQMA 4U2YA 1BGXH 1CL7I 4PJCB 4A7TA 3C08H 3SHSA 1J05A 1CDCA 1SYVA 2X4OA 5KJ4A 3N42F 5DS8B 1NDGA 1WFTA 4CU6A 1PMYA 3EFDH 3APFA 1L9RA 2VDMH 2QGBA 4WHTB 2XNAB 5T1MB 1L4IA 2ICWJ 4L29B 4WUKL 5IK3A 3P9LB 4L5FH 1XB6A 4GSXA 4NKQB 4KPHL 3LIZL 4F8LA 1GYCA 1ZVSB 2YPVL 1RFDL 1JGEB 3CC5A 3WJJA 4YQXL 4UTAH 2WY3B 2AQPA 5ACLA 2GAZA 4JO4L 4MMYA 5IVOA 4KBPA 1QQDA 1DANU 4WKXA 5ITBL 1PPIA 4HOXA 3HNTH 2HTLD 1SBBA 1ZWIB 5SX4I 3ARUA 3TIDB 4X50A 1XSOA 2Z1KA 1CK0L 1P1VA 2XBTA 5KVEH 1IM9A 3BSZH 1N59B 5B3JF 1T66D 3TZVD 1AGBA 3AGWA 4XGZB 3VI3E 4AQ8A 2BSCA 1QUNB 2QKIB 3EHBB 3KCPA 4OQTH 3HOGA 4DKTA 4OBRA 3RP1A 4ENZA 4Z7VB 5BO0D 2B3IA 2CIKB 4IBSA 3KPNB 3KVQA 4AMKL 5HJ3B 1G1CA 4ACPA 3KXFE 2WP3T 1FNLA 3NZ8B 4HC1H 4PJCE 4CKVX 2NY4B 5TE6L 3ZHNA 1TJXA 3KGSA 4HWZA 1H9VA 4YHIB 1VSCA 3GSQB 3GBEA 3RAJH 1Q1JL 4A66A 1ZLWK 4X9GA 3BT2H 2FEEI 3LKNB 3MRIB 1LP9A 2VDOB 3CAFA 1O6VA 3L45A 5EO9B 5GRJL 4AENA 4BINA 5BPPA 3MJGX 1G0DA 3UMNA 2VZUA 3ALWA 5DQ9B 5DRZA 4D8PA 1TTAA 3ZU8A 2DWEB 4C55A 2EVIA 1F90L 3HBZA 4PP1C 4KXZH 2B8OT 2JCWA 3SBRA 4Z3GA 4OGYH 1YNTF 1XCWA 1EFXD 2WP3O 2JMRA 4JZJA 3D7PA 2Y6TE 3L4WA 3U7WL 2X40A 1T20B 2DQCL 3ATAA 3QORB 4C57C 3PV6A 5DJ6A 1L9TA 2B9BA 3MOBH 1YQVH 1KCSH 4MXWL 1UM4H 4H20L 1A1OB 1E65A 2RA1A 5D1QB 3D39A 1TTRA 4Z7VE 3BLPX 3CG8A 1SY6L 2XQBH 3BVNB 3MLXH 1C5DA 1CLCA 2BJML 1ZPLA 1NUGA 3APDA 3VW3L 3TBVA 2A1WH 3IDXL 2OMZB 1IGFH 3MAWA 2O5ZH 3TPUA 1DZ0A 4PRPB 5LCVL 1QFHA 1QG3A 3LXBA 3AWEA 3MZTA 4O02L 2DQUH 2XWDA 2HN7B 32C2B 3HZKB 3PJSB 2X2IA 2VN6A 3BAIA 3RWGA 1TZIB 4F2MA 5GS0C 1H15A 2Z7UA 1IFGA 2FSDA 1AZRA 3WGUB 5LBSH 1T4KA 1XGZA 3AG3B 5D4JA 3SDYH 2OSLA 5FYKH 4U2ZA 1B88A 1ZDSA 5D4IA 4KUCD 1YPZE 3ZT6A 2EKSA 1GKOA 2UY6A 3D69A 1JHLH 1FBIH 3DX9A 3HLAB 3SYAA 3BIKA 4GMSL 4P4KC 2FUTA 2EP6A 3D39D 3NEOA 4NKDB 4JFOB 4QO1B 1ESOA 4G7QB 3VXOB 1MVFA 3UTSB 4PTUB 5GS1C 3V4UL 4Q8BA 3NCJH 3AT8A 1JZ5A 4PWGA 3UGXA 3B6SA 5KJ7E 2DKSA 4MS8D 2GABA 4Y19B 4IRSD 5CSZA 2UX7A 3WAJA 4F7PA 2DMGA 4EI6A 2NLJA 1I1FB 1MN4A 2I24N 1UWEH 2P7TB 2BC4A 3JVGC 1VEPA 3MODL 4UMGA 4G80A 5I6KA 5AVXB 2Q2LA 2YKLL 4R7VA 3ZUNC 4X8GA 3GLDA 5DURD 4GAYB 3L7EB 4PRPE 4NKIL 3GMNA 2YZ8A 4EBQL 4P5SA 2DYPD 3V0VB 5L9DL 1FVDA 3EG9B 5DFWH 5F72S 5IOKA 4UQBA 4OB5H 4EQ3A 1DUZA 3MBXL 1F1GA 1HSBA 2Y07L 2FLBT 3GIZH 1JFHA 4XXDA 1Y07A 2NY6D 2IPTL 3NIGF 4MNQA 3D0LA 3MXVL 4I9WD 1AXSB 2FBJL 4OUOA 4TPRL 3IJ9A 1YEDA 2JFCA 4HKBA 4JHAL 5FB8A 1EAQA 4MB1A 3ZIYA 1QTYT 4UINL 3BKML 5KS9B 1H6UA 5CIPB 5L4MA 1B0IA 5LBGA 4F8QA 2XN9D 4G8GB 3UTSE 5CBEB 1I9JH 3NDZE 5F7DA 2ZD0A 4LVOC 5EO1A 4GSDL 1T1XA 1RV6X 4WFEE 5JMOC 4Y19E 1HI6A 1JHTA 5F1NB 4O02B 2FLRT 5I6XB 2OMTA 3LRSA 2EEXA 5IB5A 3ESMA 4YJZL 2GKIA 2H2SD 1AY1H 3CHRA 1ZJBA 4S0TD 3B2UD 1KTDB 2F1BA 3BUYA 4IRZH 5SWZB 1HJBC 2IGLA 1M2OA 1U95A 5CLTA 2ZCKH 3CUPB 4TQHA 3OKDA 1QABA 1PZSA 4DP6X 4XCEB 3ZKSD 1SF5A 5FA4B 3RJDA 4CVZB 1GCFA 4NQDB 2BZCA 2VRAA 1X5LA 3ZL1A 2OJZH 4RISL 2P49B 4NO0A 1A25A 3HG1A 3CBKB 4Q9QL 3H54A 2IANB 3K4ZA 3FXIC 1H8SA 4L8SC 2GSIA 4FXKA 1IMHC 3ZE1B 3L16A 3RA7L 5TK2A 5FCUL 1SMDA 2WQAA 2FWSA 5L2KB 3DGGA 1CGUA 3ZE0F 3QFGA 3PDGA 5KS9E 5GGRB 2Y6SD 1R0AL 2IMMA 2WAQA 4XPHH 4P49A 1U3NA 3BVXA 2V37A 4G8GE 4CDHA 1FL5A 1WCBA 3CDGA 2XRAH 1E4WH 4W9CC 4PJHF 4DPCX 3ASNB 1DSWA 2FHCA 4K2UH 4KJPD 3TEUA 4LDCA 2FGWH 4G7VH 2CWRA 2DQTH 1SJEA 5JDJA 2TSBA 2FJFB 3OWRA 4O2FA 4XRCB 3HVNA 5SWZE 4F58H 5JIPA 2AV7A 3W5MA 2E7CA 3BAKA 3DX6A 4R4ND 2KI6A 1LILA 2X53A 3UTTB 4MWFA 2WWKT 4RA0C 1AHWA 4NWUH 3SPJA 4O4YH 5HY9B 2BX5A 2JF1A 4NO0D 3MGTA 2P5WB 5GZNA 1U8PA 3CZLA 3HG1D 2A4ZA 3MX0A 3WO4C 2PO6C 4NQDE 2PCPB 2H2PC 2LGNA 3BD4A 3MV7A 2HKHL 2NY5C 2WKLA 1ZT1A 4PJCF 5IHBA 4IEFB 2X42A 2EDYA 3JWDL 3GBMH 1NCCL 4P23C 4ZZKA 3KPLA 2P5EB 3S2AA 2YRZA 3NACH 3GXFA 3ZE1E 3ROOA 3WY4A 3DI2B 2AXWA 3B9DA 1QBLH 5L2KE 4I3SL 3KCWA 4K8RD 3LHPH 3HI5L 3E6HB 1JJUA 1LNUB 3ZL2A 4P9HH 3DURB 3TVMA 1YQ2A 1S7VA 3GSOB 1U36A 4KDWA 4U1NA 4CVXB 4DUVA 4MA1B 5EN2B 4CNIB 1P4IH 1MCIA 4AJWA 3RURA 2BIMA 3L7FA 2YJLA 4P2AA 3AADB 4BK4A 1U3HA 1ONQA 1HL8A 1E30A 3QNZA 2G5BA 5T1LB 1GYWA 3WNIA 2LLNA 4RDQG 1EEQA 2WNGA 4BWWA 2E6PA 1RSFA 1WBZA 4Z7VF 1TQCB 4J6IA 4AIXA 4P4RB 4C4KO 4OJEH 1F4YH 2YA0A 3C5ZC 4XMPL 4JFQA 4HBCL 2P5WE 1BX2A 1M6OA 3P77B 3S35H 3TWYA 3WEXB 3IXAB 3ZTDC 2HKAA 3IWVA 4GMTH 1Z9SA 3IMUA 1KG0A 4KQ4H 1EJFA 4S10A 2AC0A 5HHOD 2VZ1A 5T3ZH 1MFNA 2NY7H 5DHXB 3GRWL 1HAUA 4FN0A 4WY7L 3QAQA 1U8HB 2YSSA 5L4JA 4PS8A 1G7QA 4FX5A 4XCFL 2V2TA 4HWBL 1LHZA 4QT5B 3S88H 3AM8A 5IMOA 2D3LA 2P42B 5KEZA 4K23L 1ZTMA 1ZDQA 1U3HD 3LPFA 3LAFA 5LGJA 4N68A 4U05A 3RGVC 5LAPA 1ZGLA 1XGYL 3FOLA 4ZNEA 2D7NA 2JI1A 2EE6A 3RVVD 1MSPA 4BFIA 3VMPA 3VXSA 4PG2C 3ZRFC 2MQ3A 4Y2DC 1MIEH 4XP4L 3K6FA 5CEXA 4E9SA 1EH9A 4FGMA 5L8LB 5TDNA 2WWMC 4KK9D 2X1PA 1CICA 4LOVA 3B9AA 2BRRL 2J8UA 4QJ3B 5DS2A 3UX9B 1G1OA 2RJMA 5IJVA 1YYCA 3AAZA 1ID2A 2CR3A 4XZ4A 1E5ZA 5AWNH 3UZVA 1OW0C 2ZYSA 4NNYA 2F58H 3C75A 1DFBL 5E6IA 1AQ8A 1FZMA 2ZKYA 2R1XA 3B9KB 4JN1H 2NZ9D 2IH1A 1HH9A 5C0GA 2IF7A 1E5CA 1QSED 3NIDB 3IDIB 4YXLL 2UWEF 3QJHB 4QRTB 3WUZA 5GGSA 5IW1B 2HT2C 3TC9A 1SVCP 5AVUB 3IFLL 4U1HB 4JM2C 4LEXH 1MRCH 4KRMB 4R2GB 3S0PA 1B0RA 4Y9GA 5DJ0A 2AXGA 3UZEA 1IQDA 4TTDD 4RQQB 1P84J 4WU5B 1KB9K 1MI5E 5H2BB 5HGHA 2WPGA 2YO3A 1CICD 3LZOA 1QD0A 1QA9B 2VLRD 4F57L 2CGRH 4N2HA 5EPMB 3QW9A 3GBNL 2CHXA 5MHSE 2B20A 1G9NC 1SHSA 5BXFB 1AHKA 5D7JA 1ODAA 1V05A 4DAGH 2XZZA 4NQTA 1FV1B 3EUDA 3BRFA 1QLRA 3FSOA 5F9JB 5J3HD 2XVGA 2VJ0A 1FRGL 3QR2A 5I74C 2XZAH 5C0AA 3VTMA 5KW9H 2ZUQB 1P2CA 5E2UH 4BE5A 2VH5L 4KKLC 4GRLB 4E5XA 3WLWC 2ZXEB 3ARGC 2WNWA 2SEBB 3QUKA 2HH0H 1R3JB 3DX7B 4AEFA 1KJ2A 1E3FA 3KW7A 1OGAB 2WGXA 3NIDE 1PJWA 2M8XA 1KLFB 5ESQA 4YHNB 2F7PA 4KXAA 2WLLB 4IW4C 1MF2L 5HHNA 2FSEA 1J48A 4PTTB 2KH2B 3E6FA 3QQ4B 2D31A 1RK1A 2J4WH 4BK8A 3O45A 5AVZB 3HS0B 4PWKA 2LAGB 4JPWH 2W0KA 2BOCB 5F0PB 4AYID 4FC3E 3WJMB 3AITA 2AK1H 1JDDA 4KFMA 5IQMA 1X3DA 3KJ4B 7PAZA 3KPSA 5HHPA 1MWAA 2Z7WA 4A2DA 4IMKC 4F24A 5KS9F 1BQUA 4DP9X 4PV1C 3JXAA 3W0WB 5EUKA 4JG0L 2ESVE 4NKMA 1S9YB 5H37H 3CQPA 1CXIA 1U3YA 4JUTA 5EU5B 1JV5A 5C0AD 1NOFA 1DBJL 4NYLB 4X4MA 1AZBA 4CADA 2EYSB 3LS4L 4APQD 3VD5A 2E47A 1W91A 2YGQA 3HZYA 2HKFL 1M6UA 1OAQH 2VGLM 2VZVA 1KWGA 3A21A 4L8CA 1UT1A 2DQDL 2N4IA 4OGZA 4CMHB 5I5MA 2CRZA 4I48B 1HHJA 4X7SL 3EYFA 1XWVA 4PFEA 5DUPL 4E9TA 1OGAE 2JH2A 2GTZB 5D71L 2XFXB 2XLLA 2ZKHH 3NVQA 1FYHB 1AE6L 3Q1SH 3QI9A 4NRZB 4DQOH 1PKQA 2WXRA 3MUGA 1BVLA 5I1KL 2MOVA 1FYTB 1KN4L 1LO0H 4G5ZL 4N3TA 4OF6A 1CXKA 4WZ9A 3FCSA 5GSRA 1WZLA 2ZOKB 2VO8A 2YBRB 2E6QA 3FFDB 3KPSD 4PVBA 4HF5L 4ZW7A 2BWDA 3I02B 5KVDL 3Q6GH 3O8XD 3WTWA 2ZX6A 1OIOA 4LSTL 4ZAKA 3ZHKA 4DP1X 3ZE1F 3EXJA 5I1JH 5L7XH 2BHYA 2G2RB 5KVFL 3H7BA 5EIIB 5AG9A 4GSQA 3W0WE 5HVHB 5D1XA 5TE7H 1I85C 1RUML 4OD3L 1ZE3C 2Q2EB 4EQ2A 2YUZA 4JFSA 3BIAX 2R27A 1JMZA 3QQ3A 5ISZA 1THCA 1GTFA 5D55A 3W2DH 1O9VA 1NC4B 3MCG1 3GI9H 4FHBD 4AH2A 1G7MB 2BVPB 2FRGP 5ESVB 3AUVA 4R97B 3UOAB 1FCGA 4UYPA 3OSKA 3MRHA 3QI9D 3P02A 1K3ZA 4NXSA 3CFCL 4QHMA 1X44A 4LCIH 2OXHA 3LEVH 4FFVD 3DPBB 3PGFL 3R7QA 4F37F 2WO2B 1TNMA 1EHNA 2O61A 2NQCA 3FB7B 4HSCX 4L1BA 4OD2B 3TWCL 3GB7A 2YRPA 1OB0A 2L8AA 3AB0B 4FQXB 1F00I 1CPUA 1FYTE 2ZCHL 3SO5A 1UZ8A 4K9EL 5LXVA 1YJDC 3ARFD 2ZOLB 5T1DH 4KK5C 4Y89A 4XO8A 2X4TB 4U3CA 4E9VA 3FUNA 5C0ND 4HUWB 4FQCL 4M6MH 1U8QA 3CVHH 5BS0B 4W4OA 2GI7A 1ZJAA 3QUYC 2YQBA 3OKKB 1N3NA 1S9VB 4PW9A 4EN3D 4M1GH 1GJWA 5T3XL 1MXDA 2BSSB 2F54E 3G5VA 3IU4L 4BFEA 5FDWA 1XF4B 3I9PA 5JORA 3TNMB 4Y5VB 1BIIA 1FNSL 3GBLA 4H26B 1W8EA 5E1QA 3EYVB 3FT4A 1Q94A 1LO5A 1D6EB 4QHUB 1DDHB 4ZMZA 4PGDB 3QNXB 3RI5F 3FBQA 3FH5A 3VXNB 2FO4B 3QJZA 2R15A 2MNUA 4MFHA 4MLIA 4PJ6A 3HC2A 4PRBA 1JWUA 4BUQA 4R90L 1GA2A 4Q2ZB 4NQUA 3TYFA 1VRSA 1JTTA 2WQXA 1E4KA 5DU7A 3RZWA 1T89A 2D7TL 3L3KB 4UUJB 5I18L 1R47A 5I0VA 2A83A 4H7VA 2F68X 3D87B 5DMIH 5AOKA 4MD0B 3FHAA 3U4EA 4MKMA 1BFVL 4MZRA 1NDMA 5KBDA 4DN4L 3ULUC 2BOBB 1HCVA 3ILQC 2Q10A 4RFEA 4MNHB 3T1WA 4XOEA 1HXYA 4X8XA 5IB4B 5BS0E 1RZIA 1UQSB 2OMVA 3KH4A 2UZYB 1A4BA 2D7QA 2VLJA 3O6FB 4L4VA 1I9IH 1KCVL 2MQGA 2ATPB 2K4AA 2PTTA 1UGNA 1WBYA 4FL4B 4J28A 4L4TA 4PJ8D 4NO3B 4IOSA 2I60L 3FUFA 4OV5A 5DJDA 1IM3D 5IBLC 1NSNH 3RVXC 1JHKH 3HBPA 4XVTH 3O4OB 5JW5B 2FL5A 5I6MA 4OM1H 5E9DB 3HW7A 3L2NA 4M8RA 4FFTA 2FJUB 1CLVA 2IO5A 5HP5A 4YHZH 1DVFA 3G7TA 3EDFA 1LVEA 5I1IL 1RZGB 2DOCA 3BN9D 1HL4A 4QY8B 3DIFA 3EYQC 1SHXA 1EMTH 4D7BA 3O6LH 1WA0X 4PV8A 5JHLH 5L6YL 2X1OA 2Y5EA 3FRPA 5DT1L 1MHCB 3OG6B 1KIPA 4O58H 4PGBA 1CE1L 4J3TA 3L5JA 4S11A 1M7DA 4JY6B 1EJ8A 1Z7JA 3QQDB 5E8PA 1OE2A 3FT1A 2GEQA 1MFBL 2VLJD 1YUHA 4S2SB 3GLAA 2Q8AH 1JZ3A 3F01A 5EV7A 1HHKB 1RJLA 4C83A 1V3KA 4IOSD 1ZS2A 4JCWA 1HH6B 1KT2B 1VFBA 2AJ3B 2CLZA 2ZKXA 3BQUB 2YXWA 3QC6X 5DK2B 3M1OA 3QIWC 3U1SH 3DSNA 3QDJA 3VGFA 4D9RE 3ULVF 5D7LD 4UM9B 2OI9C 1VESA 3BVVA 1JF1A 1KIUA 5JIKA 3GTTA 4Z0BH 4TSBH 3FO0L 3T2NL 3WIFB 4XC3H 5IB2B 4A2FA 2VXTL 2AK4D 2X4RA 2AEPL 4ZOCA 5KYYA 3FF7A 4R7DA 3RPBA 3GXDA 2NT1A 1QVOB 4XZUB 3K7UA 5E9DE 1FORL 4GS7C 5E24E 4BZ2L 3TA3C 4KKAC 3F85A 2XN1A 3ZMRA 1J8HD 1NMBH 3QUGA 3PAVA 4YDLB 3BGMB 2HVBA 4IK6A 1UB6B 4G8EA 4LPUA 2ZWSA 4KK8D 4PREA 1OP9A 1ZLVH 2ZNXA 2CBPA 4EIUA 5IJDC 4JFZL 1WFOA 1KXQA 3BP6B 5SWSB 1XXDC 3G6AB 3GIVB 1MHPH 5F97E 4F9PA 2YGPA 1AOHA 4FRWA 1A9EB 2QQLL 4O5LH 1AXTH 2IPUK 3GM8A 5B8CB 4AEIL 1W0WA 4NNPH 3DA0A 3QXTA 5T3XE 4N90E 5LHDA 2BY3A 3QDGB 2F19H 2R83A 4K7FB 2X44D 3NFNA 4XO5A 1AOZA 4KRPB 3VFRA 4TNFA 4JBSA 3KPPA 4UTBH 4KZDH 3KVPA 1IQWL 3DUUA 1OAUL 4FG6D 5IUSA 3D48R 1UWXH 3IBEA 2VDQB 4AQEA 2CK0H 2YPKA 2CUMA 1EHAA 4CSPA 3FONB 3UPRB 3IGFA 1EAPA 3MNVB 4WQOA 4C56A 4N0UB 1T1WA 4FI7A 4TUKL 2NY2C 4OQTA 4YHYC 4JFHE 4JAMA 4YE0A 3UZQB 4KJWD 3LNHA 4HIHB 4LPVA 3VWJC 4PH8A 4YO0B 5IJCC 5GXBB 2ICWA 4JJ5B 1P7KB 1U8MA 2WINA 2ORBH 2W07A 4Z95H 1KGYE 4ISVB 3P3TA 4JG5A 4HC1A 5CR8A 5SWSE 5JIDA 1T0MA 4WW2A 1J1OL 2H32H 2NY1C 5D1ZA 2HLEB 1UB5B 5J89A 1EV2E 3U46A 1WS7A 3T4YB 2O6EA 3U9UB 3OPZL 2X2YA 3SJVB 3BP7B 3RYMA 1ZHNB 2YAQA 3HN8A 3OKEA 3KVDD 5SX5H 1KZYA 4TL4A 2AFNA 1KN2H 1FO0B 4O2EA 1Q1PA 5HHQB 2DJMA 4MQSB 2XV2A 1KSRA 1DBBH 1MQKL 2OS7A 2R2HB 4WI2A 1RI8A 5DHVA 4WNQA 3VFVB 4OD1H 2XTLA 2UZIL 3QFDB 4UU9A 2Q7YB 1BF5A 1LDPH 3CFMA 3CH1A 2DTML 2YD0A 3S2CA 2VMEA 4YHKL 1BPVA 2APVA 2EXWC 3DHMA 3MU3A 1IB5A 5E94B 4N0UE 4B5ZA 2X38A 2GCYB 4WFFE 3VD0A 5AAWA 2HFTA 1QWHA 3WN5A 1AMYA 1XV8A 3WOVA 1FC2D 1KV3A 1U8LA 1QPPA 4E41A 5IV2B 4XTRD 5D1ZD 4ZSOB 1LQSR 4LARL 4TRPH 3SEPA 4Q6IA 5HHVL 4Y7MA 3P3SA 2W0FB 5JLZA 4MA7H 2O26U 3FT9A 1RZJL 2R51A 3EW3B 2ZUYA 3OXRB 3QUMB 1F18A 4XOBA 1HWGB 1PFOA 4UQEA 3SJVE 2AGJH 2ICWI 2Y4SA 3BMVA 3U2SA 2V3FA 3BAJA 1ZANL 3ISYA 2C5DC 5DLMH 4PJEA 1CDJA 5D72H 1TSHA 3RY6A 4KTGA 2WOYA 1J5OH 3IGLA 1TITA 1BZEA 4MMXB 5D1ZI 5DQJA 2XWBB 1NFKA 1WDAA 2L7UA 3REVA 2V4LA 5EC2B 2EVFA 4LSQL 3C2SA 4PBWD 1U33A 2V0AA 3OR6A 5GGTL 4KHTH 1EJ6A 4G6MH 4IDJH 2L0DA 4TOYL 2VIRB 1QR1B 3UGEA 4KVCH 4L37A 4E41D 3BUQA 4JQIA 4AT6A 4P46C 4LSPH 1JSYA 3P0YH 4RFOH 1INEL 1RULH 4KXZI 3PQYD 5JHDB 2HX9A 4U1LA 4J4PD 4H8WL 1FVEB 4YIQB 4NLHA 5EBLB 1DSYA 3E0GA 3SDAA 3G6JB 2Q86A 3K72A 1SHWA 2DYRB 2VISB 3GHEH 4IQHA 3MNWB 2ICEC 2P5PA 1EVUA 3EJZC 4PP2B 3DBXA 5TPWH 3DIVA 1TDQA 1S7RB 5AOMA 1KBBA 4Q74A 1INDL 2BSRA 5ILTH 4YSOA 5DI8B 1TTGA 4HJIA 3TYGL 1N26A 1XCQB 2NTFA 3KE0A 3RVWD 3INUH 5KSBF 3SKNA 3VTTA 3FTWA 3H3BC 3ZKND 3BE1H 4FLHA 2VL4A 4TQEL 4WHCA 5FYKD 4U6VH 1LO4L 1BQRA 4YNYA 4PUBH 4LSVH 3EBGA 3WTSA 2B2XH 1U58A 2GTWA 3HHMA 4K3DL 3VE0A 2G2NA 1IVLA 3LNGA 5BUGA 4KOBA 2QADB 1IAMA 1WHOA 2O4EA 4HD5A 3ZVVA 1A14L 3MRMA 2G30A 2J1WA 1OAXH 2DKUA 4QXVA 1DLFH 1R5VA 2BNQB 1A65A 2KLSA 1IE4A 1NCUA 3RBGA 4I9XA 3T65B 2KKQA 2Z91B 5FF6B 4XVUC 3OMIB 5MENA 3SDAD 4GINA 4NZRH 1CT8B 1BQHG 1N4XL 1YN6A 1WLHA 4WF7A 5JHDE 3ELAT 3PNWB 2WHVA 4I4WB 3ZR5A 2AQRA 1MJ7L 3D25A 3FT2A 4KRNA 3VWKB 1CIUA 4ZTPH 1I1AD 3CSFA 2HJLA 3G6JE 3UADA 2DQHL 1I8LA 2A6JA 3HFFA 4M8VA 4JE0A 5AVVB 3QPQD 1ZRUA 4YLBA 4IRZA 4I18C 5FR3A 3EGDB 4PJBB 5F93C 5K9KA 4AV4A 2BWIA 1MCKA 2EEBA 3OAYK 4DVRH 1HINL 1D5RA 4X0NA 4ZO7A 5DJCA 5JQIB 2ZWNA 2E9JA 3B34A 5T8IA 2XV0A 3GSXA 2Y5TA 4NAQA 1GGBH 5DGRA 4NZJA 1AS6A 1N8OE 2VZOA 4WJ5A 1BEYL 1KPVA 4A7GF 2FJGB 3AQYA 4L8DA 1F42A 4N6RB 3NZUA 2CHZA 2BHZA 1HL5A 4P9ML 5DK3A 1PLCA 1G43A 3PXLA 1MREL 1OCOB 2VJ8A 4OLUL 3W9DA 1JIBA 1XH3A 35C8L 2R0KL 4YPGA 2BNQE 3O2WH 1U8KA 4FFZA 4QHLB 3WXVH 4ADJA 2ZX9A 1Q72H 5EBWA 3FFCE 4TMPA 1DR9A 3NESA 4EDXB 1WK0A 2BHFA 1XL4A 3DLQR 1KPRA 3WEBA 3E3QE 4AGPA 4UT6L 2VQTA 4XE5B 5G5DA 3C5JB 2OZNA 3L3DA 3VFPA 3MKKA 5CJBA 1RIUL 2QFPA 1WS8A 2DLHA 4OIBA 2D2OA 4A68A 4PJBE 4P5MA 2RBLA 3FUHA 2WXJA 3O41B 4DGYH 4LEBA 2HAZA 1PBYA 2EC9T 1CTMA 2F61A 1YNKH 1S2EA 3QO0A 4HJ1A 5CN1A 1BFTA 1NCBH 1XCTB 4HKZA 2MSPA 1WSST 2K70A 1KELH 3VD3A 3UTZA 1JPGA 2WUBH 4E9RA 4IRJB 3WNOA 2LOEA 5FOBA 4LGRB 4HXAL 2G9HB 4LO9A 1T1YA 3T0EB 2OL3L 3BI9X 4LL1A 1A3LH 4DGWC 4EOWH 1W72H 1XF5B 4PN6A 5LGHL 3UABA 3E2HC 5CLZA 3FO1B 3ZK0A 4LVNC 3C60D 2NYKA 1ADWA 1R5IB 2E59A 1TLKA 1GIGH 1LXMA 3LVEA 4EZLA 4HOMA 1HOCB 1PZBA 2WTRB 3L3IA 3MJ9H 3HRZA 3QEQE 1SLXA 3HVDA 5DS1A 1G7PA 5DUBB 5KBMA 4YHOH 4N2CA 2XG5A 4WTZG 1OEZW 2BDNL 4LCUA 3VSUA 3FJTA 2XZCL 5AZ2L 5I26A 5C9KA 2P45B 4LPXA 4RDBA 4V33A 2K0RA 2FGZA 4WVRA 3GDBA 3B1UA 2X70B 1TVBB 5CEYA 3MLSH 4URTB 2A6DB 1FL6B 2X12A 5KZCB 5BRZA 1QEWB 2ENQA 2YC1B 3BPOB 4JANA 3GNML 4AIEA 5PCYA 2HG5B 1P69B 3EGXA 1BVKB 1WGVA 4Y9FA 1JZ8A 4BZ1L 4JMNA 2HTKC 2OMXA 2H1PH 1CDGA 1GKEA 1YY9D 2FX7L 2J2ZB 2HP4A 4M43H 1FJ1A 4XHQA 3T0AA 4YZFE 2FT7A 4KJYB 4X6CA 3OGCB 3T0EE 1GL4B 3WFDL 3B9EA 4QNPE 4LCCB 3SDCD 5J11C 4FHJA 1LGVA 1NGXA 3KWTA 1Z3GH 3CFQA 5LDSA 1AGDB 3V52L 4K7PX 3SKJL 5KYNA 2HX7A 4EIGB 4ALAC 1N0XL 4LF3B 3PHQA 4UDUB 3SE9H 1ZK5A 4Y16D 2ITCB 1AG0A 3V4VH 2VC2H 1XIWA 1P5UC 4FS0A 1T5XB 2V2XA 4P2OC 4G43B 2Z35B 4YX2L 3ARQA 1JN6B 1N5AB 1CI3M 3MNZB 5JPMC 1HHIB 3TV3L 2HVKB 2I32A 1KBGL 3O81A 2X4NA 5EIIG 4HS8H 4UIMB 2A73B 5ETUA 2DLFL 3ZUCA 1Q90A 4GB9A 2OL3B 5AEAA 3WKPA 4NO5B 2GB2A 5T3ZD 3RWJB 3I2CH 1NFIB 2IBBA 4LDLB 5E1IA 5C8JB 4RMSA 4N8VG 2APXA 3IDUA 3FTZA 4J3OC 1M2VB 1AP2A 3V2AR 3P0VH 2IPKA 3KZ8A 3W82A 3ZLQC 1FN4B 2WCGA 5F71A 4S1DD 5KSAD 5I1DB 1VJSA 1NUDA 3IDJA 3NTCH 3LS5L 2R69H 4M03A 4ZODA 1F6AB 1PKOA 3V5KA 4K9JA 3KGTA 3WNLA 2YMTA 1ZA6B 4D0DB 4NRYA 3NSXA 4JRLA 2AAAA 5C09D 4ZFOL 5LXGH 1J9RA 4AQ1A 3HCVA 2WYHA 4OJFL 4NQQA 4MA8H 1K8IB 4PRNA 5ICYA 1PGRB 2IVFC 3K2UL 2VKWA 2GFBA 4FNLH 1TVHA 4HLZG 4BXSV 2Z31C 3GJFA 3GHBL 3PL6C 1T2JA 3GSNL 1LO2H 1MFMA 3GQFA 2APBA 3PWVA 4N2FA 1BFOB 3VFSA 1N5YL 1NM9A 4UMSA 3VI4A 1IVTA 1S7SB 3GSWB 5AL8A 1H8OA 1RERA 4ETQA 3BGFC 1NCAH 1XGUA 1S5IH 3EJUA 2QSCL 3G6JF 3Q0HA 3PWJB 5IF0A 4GW1B 2AMGA 1WP6A 4G3YL 5B1BB 3SY0B 2EO9A 1IRAY 4LCWA 4MX7A 5JXEA 5FV1L 1F0LA 2XBDA 4PHZA 1VEOA 2BSTA 1VHPA 3QCTH 3FQYA 1IGCL 1E4XL 3LIUA 4AIOA 5FKPA 5E5UB 3ZTEA 1XQ4A 1BJ8A 2A6KA 4RZCA 5F7EL 2ZJSH 3O0LA 3TOPA 5T1KA 1UKTA 2Y1ZA 4M1DL 2H1LM 1E2ZA 4IHOB 5FA3B 3T04D 2HLAA 3L3OB 5K33A 3LZRA 4OCWH 2QVTA 2G75A 5E08L 3HB3B 4M5TA 5GRUL 3WHXB 5HI3D 2OBGA 5C6TL 1KJMB 4Y4KA 5IHLB 3GGWA 3QT2A 2WLJA 4XPGH 3V6OC 2X3BA 4KTDH 3QDMB 4L3ED 3SQRA 5F3BA 3QJOA 1Q9OA 4N4YB 3BW9A 1PDKB 4M7LH 4BK5A 4LLQB 4EVNB 4NT6A 4MA3A 4JPVH 1IAIL 1OSZB 1UM5L 1NM4A 4MQTB 1FLRL 3RWIA 4XNDA 1CFSB 4UDTA 2WM0A 3W1ZA 1I4FB 4ZUWA 3HJ0A 4G9FD 1NC2D 2MIZA 3KYNB 4OZHA 5I17B 1FHGA 2NDGA 2WBJC 4RLDA 1L5GB 4XNQA 2R1WB 4WW1B 2C9XA 1ODUA 3B8SA 4WK0B 5IEHB 1S9KC 2EECA 4YAQB 2QSQA 4XO9A 4ZFOB 1DFXA 2BFVH 3MA7B 3ILEA 4P5TD 3I3BA 1GW0A 2IWEA 4XVSL 1J1PL 5T1KD 3VO0A 3JT0A 2OR9H 5DFVC 1KENL 1OV8A 3OBAA 1A64A 5FHBL 4DGUA 1Z1WA 3SQBB 1HXMB 4JZNB 3W11D 4GO9A 2F53D 3HHSB 3IMVA 3QJVB 3OKMB 3GSNB 1AD0B 2KPNA 2WVVA 2O72A 4P06A 1QATA 5FFOA 3T0WA 5IY5B 1KC5H 4JNXA 4G1MB 3N04A 1LLAA 2IXQA 2GSGA 1CFQB 3HMXH 5T5NF 4FG0A 1VFAA 1XGTA 4S1RH 3EOAB 1ZAGA 3MRRA 1O75A 1I7RB 2P8MB 2IDCA 3QDME 3SKUD 2CPUA 3F7PC 2J55A 5EFIB 1N6UA 1IT9H 4LHUG 4WSKA 3GMMA 4DH2A 3EYUL 4PR5B 5DK0B 1TQCC 3IDYC 2FT8A 3OAZH 2YQGA 4MCMA 3RX9A 3ASOB 4RGMC 3KL3A 4Y1AD 5IM7B 1I3VA 3NEXA 1HSAA 1HQRA 4JR9H 3LN4B 1KDJA 4AEHL 4AZ8A 2K7PA 1IGJA 3MRBA 4HZAA 1AI1L 1BEXA 2DH2A 3ETSA 5CSBA 4RBPH 5JA8B 4G71B 4C47A 5D4HA 1X5GA 4YDIH 3KWUA 1P53A 2DKMA 1BM3L 2G0LA 3U0WL 3STLB 3LQAC 1URZA 2X4QB 5CFAA 5I8CA 3C09C 2NMSA 4PG9A 2EE2A 3CC1A 5J6GA 2EH7L 2Q8BL 1BAGA 4P3DB 5EC1B 3PWPB 5GSVB 1XTMA 2CIIB 3VA2C 2QELA 2QPDB 3WD5L 4Z3JA 4YZFF 4QMEA 3P9MA 3BAEH 4MVBC 2NTSP 3CFDA 4QNPF 4OJAA 8CGTA 1I3UA 2R23A 5K1VA 1MLCB 1YEJL 4JUSA 4F7CA 4PCKA 3VCLB 4IS6A 2WVTA 5JDSB 2QHRH 3T8MA 1JZ7A 4HCRL 3DTDA 2A38A 3SY6A 5DEGA 4WUUD 1ZCRA 3OL2A 2UV3A 1SLWA 3VTAA 1J5IA 3FQXB 1E6JH 1S9XB 4B9KC 4WGKA 4LK4A 4LLAA 3PP3K 4Z77B 5DYOB 5A2JH 3B8YA 1B9ZA 3H6AA 2AXFA 2YAPA 5E4AA 1DJXA 3LKQA 1AHMA 4JM4L 3FB8B 3KBEA 1AQKL 2ZXCA 1IAOA 3N06B 3FO9A 5EOCJ 1QKZH 4I13B 2QDVA 3IJHA 2FH8A 3POHA 4X5WA 1LO3H 2VDNH 2ADIB 3MYJA 3H42L 1YEGL 4G9DB 2CA4A 1ZT7A 2MCPL 2HTLC 1KGWA 4XNMB 3GTVA 4D9QD 4X6EA 4R2GC 3PWPE 4S1SL 4JFFB 1LE5B 3SBWA 1OAYL 4HS6B 1S78D 5M95B 3TZVC 4W1TA 2H3XC 4G6JL 5F6IB 5GJSH 3GO1L 4NPYA 3I74A 5CGBA 3B2PA 5C0FB 3CLEL 3R0NA 1OF2A 5T5FL 5A2AA 4LXFA 4GBXA 1BBJA 4NUGH 3PDOB 4Z7OB 3VXTB 3HC0A 4M6AA 3T3ME 3ARDA 1D9KB 3OKOA 4GAGL 3SCMC 1JOIA 1SRDA 3TONA 5LVEA 4QHNB 5JXAH 2DBLH 2K78A 4LLMB 5A2KH 3DSFL 4JPIB 2J8OA 4LRNH 2AJVH 4E9XA 3L4VA 3WN6A 3PWNB 5DC0A 5J1AB 2XWJB 4YLCA 5J9PB 4IMLB 4FQ1H 1IE5A 4XCCL 2C1OB 3U83A 3TO4D 3SDXA 3V9CA 1J1XH 1W0VB 3JWNC 2ITDA 4PJFB 5FHAH 4RSVA 3IFOA 1OHZA 5TQ2H 4X98B 1CYGA 2I07B 1N9PA 2YAEA 3ARTA 5D93B 3THMH 3ZO0A 1YG9A 3MFFA 5E2WH 3BT2L 4FQJL 5BOJA 3MRPB 2BW5A 5J1TC 4YFLF 3WIHL 3DVNA 5E4EB 3H3PH 4APXB 2ADGA 1CL7L 1T5WB 3KWXA 1A6ZA 5DA4A 3EFOB 3EJJX 4ODWA 4XX1E 5HHMD 4M6OH 1VA9A 4RWYH 5K1NA 1YPZA 2WQUA 4NC1E 4H13C 4Z7OE 5ITFA 5EO0A 3OR7B 3VD7A 5JQ6H 3Q8BA 4NC2B 4GXVH 4NAMA 4JRXA 1SHMA 5MEQA 2X2HA 1CD8A 2EC9U 1TCRA 1AC6A 5H4ZA 4X8JB 3NABH 2OK0H 3CN2A 3L5WB 1QHQA 4XMLH 3TN0D 3D18A 5I1LA 2YLKA 4ZT1A 4M5ZH 3S98A 1W8NA 1ORQB 4ELMB 1NL0L 1MFUA 2GT9B 4L23A 6PAZA 3AUWB 5CD3A 1BCIA 1CGSL 2LLGA 4HUKB 4UNIA 3S96A 1YYMH 1B2WH 3ULSA 4PJFE 4BSWA 4HJUA 4JB9L 3DDGA 1A1MA 1RUKH 4CAGA 4CMMA 2G0KA 4HG4J 2HMID 1X9LA 5C0BA 3D0VA 3RIFK 4L1TA 1KXHA 2CJUL 1EQWA 5K9OA 4WO4A 1X9RA 2WXMA 4JN2B 2DMHA 1YAZA 3ZDWA 4YHPA 2HZHA 3AZUA 2BMKA 4P2YA 3VNZA 1JPSL 3JV4B 1T3FA 2DYSB 3C8DA 2WBWB 4IRSC 3T8XA 3BAYA 2FEEL 4HGWB 4OIAA 4CJ0A 3EZ8A 4B9JA 5IFHL 2KZ1B 2Z3FA 3D05A 4CC4C 4JFUA 4OGXL 5BVPL 5JW3H 1VCAA 3MRQB 1HE7A 4XVJL 5GJTL 2BIOA 3I6KB 4Z76B 4EI5A 4KUZH 4M61A 4NN7B 1A02N 3DROA 1U21A 3R4DA 4F1ZA 3X3FL 2DMKA 1CURA 4ELME 5LGKA 3VQ1C 3QWOA 2YMXH 1F02I 2EDHA 3SKMB 3VB9A 1QFUL 3CFEA 3FT3A 4I0PA 3MSPA 2F5AH 3K81A 2YK1L 3MCKA 4MYPA 4G6FD 2NY6C 3AS3A 4WO4D 2N1TE 4YVUA 4N1EA 3DPDA 3QUXA 4M3HA 3EOBB 1A7PL 3NIFB 4IGBC 2FX8L 4PQXA 3K5RA 3BGAA 1U6AL 5DJ2B 5LO7A 3EJQA 5HYJA 2C1PB 1RJYB 2J5LC 1T21A 2VDPH 2BIPA 3JTTB 4XP1L 2YGVA 4GG6A 1G4RA 2AJYL 1K4DA 3AY2A 2NW3A 1FE8H 3BH4A 1K6QH 3WIIH 5I1GL 1JK8B 4UZGA 1IBZA 2OMWA 5J56B 3ETTA 1DBAL 2OJ1A 4X5LA 3WFHB 2H2SC 2N0KA 4EI5D 3B2UC 3KLAA 4L8BB 4N2KA 3U9PH 5EZJB 4KKRA 4AUYA 5TF1L 5KSUB 5K5YA 2CO4A 1QACA 2PXYB 3GMLA 3B7TA 4NP4H 4XAWH 4B9PA 4I0PD 4HUVA 4LOFA 2D4DA 5J6HB 3MREA 2VN5A 2NXZD 4R7NA 1OOWA 1F4AA 1RVFH 4TVSa 3VXPA 3BPLB 4JO1L 5LG6A 4MXQD 1QFOA 1BZ8A 1QBML 4ELKB 1JTOA 3AQZA 3TIEB 4POZD 3WNMA 5IHUL 4X6DA 4R5VA 5F88A 5F6HJ 5CWSB 2VDLH 5HYJD 3UBHA 1M71B 1F2XK 1U4EA 3B5GA 3NIFE 2H1XA 3NN8B 5KYUA 5IVNA 4P2RA 2LABA 3FPYA 3GINA 3QXAA 3VFWA 2Z65C 2JJTC 2Y6SC 4WSJA 2V17H 1FHNA 3UTPE 3OB0H 3ILPA 3KPOA 4DP0X 1J05B 3LKSA 1SYVB 2X4OB 3BWSA 5F9WB 3OWEA 5EU7C 3IGKA 4ZZFA 4KJPC 1OSYA 4JDEA 3FU8A 3NJMA 2EADA 3HC4L 3LVTA 2GHWB 2J8HA 1E6OL 5E5MA 3QEUA 4HV8A 5IK3B 3BWZA 1JE6A 3QJRB 4FA8A 3VFNB 3B2XA 4R4NC 4OF5A 1GOHA 3CC5B 4OCYH 2GAZB 3J8F7 3QG6A 5TFSH 4MMYB 1QZ1A 3SOBH 4OLWL 5B3SB 1QQDB 3DGDA 5HTSA 4R4BB 2E4FA 4HHWA 4P48A 1PU0A 1OTTD 1DLHA 5FV2A 1IM9B 3ML8A 1M7IA 4P2RD 4LP5A 2DWTA 1QHPA 3NFSL 1AGBB 2VR7A 3ZYOA 3LH2H 4EKJA 1NMCB 2BHUA 4TVUA 3KCPB 1KEMH 5LN4A 4CUCA 3VDCA 1ZHLA 5A2CA 5F1SA 1DVQA 4K4KA 3Q48A 4WCYL 4LKCA 4HZLB 4TYUA 2MFNA 1Q0XL 2WB7A 5FDYA 3SE8H 1BSIA 3WKQA 2B5IB 4HJJH 3QXVA 1DQQB 4HWZB 5GGUB 2PF6A 4GO6B 3CK0H 12E8H 1LP9B 2DQIL 4JPKL 1OVZA 4AENB 4X4YA 3F04A 2W9LA 4NJAL 4XB7A 1A4JB 1KPUA 3MACL 1WEJH 1NJ9A 4XN7A 1G9HA 4GT7A 2ZKMX 1R1CA 4QLRA 5DRZB 4D8PB 1MVUA 5CJOH 1IBDA 3N5AA 1A6UL 1FF5A 2K8QA 1FFQA 3FUDA 4X80H 4E68A 4XP9H 3JVFC 4JZJB 2EDEA 1CBVH 1G6RA 5DFTA 4NAJA 3PV6B 4IHBA 5DJ6B 4G42A 4A6YH 3K71A 5ALCL 1INQA 5AB9A 1ND0A 1UUNA 1C8PA 4AC2A 1QFPA 5IJBC 1QLEH 2W94A 3H9SA 5EOTA 2PW2A 3JZYA 2IH3B 4OLVH 3BPNB 3D39B 4PP1D 5DF0A 5I8KH 1J5CA 3LKRA 4M29A 1C5DB 3U6XS 3FN0L 3NSYA 3IPEA 1F97A 2BWQA 4KRPC 2DQEL 4YHLL 2VMJA 4M48L 3TBVB 1B0WA 1MCLA 1NFDA 3ES6B 3KYKL 3TPUB 4B97A 4OLXL 1S46A 3C6SA 1FGNH 1IARB 3OC5A 3TBYA 5D2NB 5LQBL 2O5NA 1UADC 1OWWA 4P4KA 1QYGL 3EJPA 3AG2B 1F3DJ 4XH2A 3RWGB 3UROR 3HI6L 1BQHA 1LP9E 2VUYA 3U4BL 3QHFH 5AUMA 4F2MB 1H15B 1KCRL 3UBFA 3UJTH 4A1RA 5GS1A 4BWTA 3S36H 1S7TB 1T4KB 4HHAB 2NCMA 4F5CA 2OSLB 2XA8L 3RL2A 1ASPA 1XMWA 4TNWF 4PYGA 3DX1A 5FPIA 1TIUA 1IJNA 4UIKL 5TE4L 3JVGA 3BFOA 4DPRA 4OLYH 2UY6B 3DX9B 4Y1TA 2RGSA 5J06A 1DQVA 4NPJA 3HE6C 2EXSA 3BIKB 3M45A 3H9SD 2VOTA 5DQDH 2NZ9C 1DE4A 3IEAA 4XX5A 4HKJA 2R2EA 3D4GA 4L18A 1D2PA 1RUAH 4QXTA 2WKOF 4D0BA 5C92A 2EUZA 2A6IA 2O6CA 4H0HB 4RAHA 2J1YA 3B6SB 3D39E 2QZQA 2D0HA 3N1QC 4JFDD 5CSZB 4F7PB 4EI6B 3KPMA 4L1SA 1F3DH 2BC4B 4N22A 1SN0A 3FHQA 4OI7A 5CCJA 2QR0A 2AEWA 4G80B 4KV5E 2BSDA 3RHWF 5EZLA 2EKJA 3OPUA 3FUEA 1OAZH 1WPCA 1EUTA 4K8RL 1TU2A 3F05A 4XC1L 4MRCA 1JTPA 1W72A 3Q44A 4F2ME 1FVDB 4K94C 2RALA 4MMZC 1DUZB 3MXWL 2VNCA 1HSBB 1Z3RA 4LLVB 4N0RA 2LAAA 4F8TA 2ARJQ 2JKTM 3LRKA 3U48A 1CIDA 4MNQB 3CE1A 3ZT5A 3D0LB 3ZIMA 1PD0A 2E86A 5J3HC 5D7KD 4BFKA 1YEDB 3L13A 4N0FA 1NKRA 2MPAL 1GC1L 1UYWH 4U49A 3QG7H 4QTIL 5ESAA 3IB4A 1EJOL 1JPTH 1F3JA 1F41A 1MCPH 3IJEA 2DEWX 5I73B 3QHTC 5F7DB 3U30C 3DC0A 2MTPA 4PRAA 4QKTA 1HI6B 5AZEL 4PJ5A 2NDFA 2OMTB 1A47A 3LRSB 4JY4A 4MJID 4OT1L 5IB5B 1OP5H 3A4FA 5GRVK 2JB5L 2B4CL 2X0UA 3BUYB 3FAWA 4B3VA 1U95B 4Z8FL 1WT5C 5FGCE 4L8SA 2PCYA 1MRFH 3LN5A 3NIFF 3OKDB 1NICA 1I9RH 4GNKB 1G7JA 4N2EA 1F4WL 3QB7C 2QPEB 5LLIC 2WYTA 4JKPH 4X7FC 4UB0H 3VYOA 3MV8B 2YOCA 2OAAA 5ANMA 1UA6L 1J87A 4PJ7A 4WTZA 3CN4A 3LD8C 4KY1L 5F89A 4N26A 4ZRGA 4HX1A 4NO0B 2IPUG 2N1KA 2WUCL 3HG1B 5FW7A 3V4VA 4APQC 1SOQA 3TCXA 3ECQA 2FE0A 1AKJA 2JV6A 4WTXA 3RWDA 2GSIB 3QUZC 4X9HA 2EDXA 4CL7A 3QJFA 3DGGB 4KO5A 1R4XA 4XPTH 5JUEH 1VADA 5D7SL 2OXGA 1JRHH 3L9YA 4PJ5D 4Q6KA 2VDOH 1QX1A 1FL5B 4U0RB 2IQ9H 3CDGB 1Q38A 4NM8H 3ABMB 2N7AA 1NA8A 2PO6A 3A6CL 2Y2WA 4B9ZA 5E51A 3KDMA 3TBWA 1NKGA 1SJEB 2LU5A 4P23A 1Z0NA 4OQ1A 4O2FB 2AV7B 3PGCA 1A21A 3O8XC 2J72A 3ZYIA 3LRLA 3DX6B 2WZPA 3KPQA 4GUQA 5AYTA 2IEPA 4L1HA 1J5DA 4MWFB 5BO1H 2IG2H 1AHWB 2AEIT 4JO3L 4U7KA 3VXMD 5JNYA 5AZUA 5I0WA 1IV8A 1U8PB 3MX0B 5C6WH 1AZCA 2ATAA 4YGVA 3MV7B 1AKJD 1QFWM 1V8HA 1ZT1B 3OB8A 2A7BA 4YWGL 3HC3L 3TF4A 1T7YA 2Q6WA 3HG1E 3ECBA 3KPLB 3BKYL 4UOQA 4R5TA 4AE0A 2A4EA 4WUKH 1DDTA 2IWGA 3J07A 4CBPA 1UOVA 5B4MD 3C8KA 4KPHH 1ECYA 3ROOB 3LIZH 1G1KA 1KY6A 1MHEA 2YPVH 1RFDH 3U6XA 4JO4H 3MLZL 3RNQA 5C08B 1J18A 5ITBH 3L81A 3HNSH 3WHE0 2MPVA 5GZOC 1A6PA 1SXAA 3C5ZA 3TVMB 1S7VB 4HEPG 4EAEA 3MLVL 2TRHA 4N8VA 4U1NB 1BECA 2VR4A 1CLYL 3BKCL 1MCWM 2R0LL 3OHXC 3L7FB 2WZPD 3RJQB 1U3HB 1M9WA 2G60H 4PJAF 2NY3D 1HDMA 1ONQB 3ARFC 5TDPA 1FP5A 3QNZB 2G5BB 2Y7OA 5C0NC 1Z9OA 2W9EL 3O4LD 2M26A 2DIBA 3FT0A 5IFJA 1WBZB 5DXWA 2A0LD 4OFDA 3NAAL 3BVWA 4AMKH 2XKSA 1B6DA 1A2YA 4EN3C 3GMQA 2CRYA 4JFQB 1M6OB 4M62L 4PYHA 4PBXA 4PW4A 3BUTA 5TE6H 3MV7E 3PWLA 5HDLA 1Z9SB 1OQOA 2E5EA 2O5YL 4ZUSA 1SJXA 3RGVA 1D5IH 4WJKB 7CGTA 1P7HL 1KULA 1P7QA 4FXTA 4PG2A 5MI0C 2CRMA 4HWUA 4Y2DA 5GRJH 3P3RA 5E8NA 4H8QA 2YSSB 4Z7NB 3H2QA 1G7QB 2V2TB 1IC0A 3C5ZD 3QHZL 5ID0A 2VWEE 1BLNA 5IMOB 2EH8L 1RPQA 4LFHD 1F90H 4XX1G 1KJ2L 5I8OL 3L17A 1OZUA 5DZAA 1RHHA 5LGJB 1OW0A 3FOLB 4LGPB 4BFIB 1RZQA 2DQCH 3NA9L 3VXSB 1BZDA 1QI3A 4W93A 3VG9B 4FI6A 3O3EA 1EZUA 2IGFL 3F62A 3MKGA 3DVFA 3ZDYB 4AYFA 4FTVA 4M7ZB 4H20H 1CICB 2J8UB 4ZOBA 4DEPB 3VFTA 3LTVA 1SY6H 1CZ8L 5IJVB 1J12A 1MWAL 2MWCA 3AAZB 3R4RA 4HK3N 3FU9A 5CIPH 2BJMH 4JM2A 5DJXA 2EC8A 3RGVD 1AMXA 3HZVA 4TQPA 2BS9A 3UZVB 4PJ8C 3DI3B 2C7UA 4NNYB 1BYNA 1E8YA 3JYBA 1GGCL 4FQQA 4RGNB 4ODTL 3IDXH 5E6IB 4KV5F 1FZMB 4PI0A 1R3HA 5LCVH 4O02H 2R1XB 2WWMD 1I7UA 2IADA 2IH1B 1HH9B 3SYOA 1LMIA 1BBDL 5C0GB 3Q8FA 2YIHA 5C0DA 2VB5A 3CVIL 5F9OL 3D5OF 3ARBD 4W4NA 4Z7NE 1I31A 2WXOA 5GGSB 3OJ2C 5B1CA 3WUWA 3OKYA 4X6BA 4AGMA 1USZA 3LMJL 4Y8DC 4DZBA 2GJZA 5KVGH 2CR0A 1B0RB 5DJ0B 5DJZB 2AXGB 1GS6X 3JV5A 4XHJD 3DUHA 5F7NC 3GFUA 5INDB 4C54A 3O9WC 5FLVA 5HGHB 3IKKA 3ESUF 4ZNEE 4GMSH 1TO5A 2YWYA 1BM7A 3I9IA 3ARGA 1KYDA 4Q56A 2HT2D 3T6WA 1XGQB 1PLBA 3ZDYE 1FGVH 5D7JB 1JFQL 2J8UE 3H9HA 2CO6A 3W39A 1FSKC 1PZCA 2VABA 3MODH 3E38A 5I82A 5C0AB 2IWFA 5DD3L 1P2CB 3CVCA 4RGNE 3DDFA 2YKLH 3UJJH 4LSDA 5I75B 4E5XB 3UL4A 4XXWC 3H53A 1B9KA 3L9RA 3QUKB 5HYSG 4HIXL 1JZDC 2BCMA 5AKRA 1KJ2B 1N64L 3IJ7A 3F2LA 4IMKA 3S97C 5L9DH 1C1EL 5ESQB 3SGEH 4X9IA 2X09A 1ACCA 2AJUL 3MBXH 2Y07H 5HHNB 2FSEB 4KK8C 3Q5YA 3E6FB 2IPTH 2NNFA 1JZIA 3MXVH 3O45B 4KNSA 1WIOA 2FBJH 3AS1A 4LL9A 4KKLD 2F18A 4JFTA 4S1QH 3BCFA 5HI4C 3WLWD 3ARGD 5BZWA 2JXMA 2YXMA 4UINH 3BKMH 3GKWH 3H3KA 4GUPA 3KPSB 1S6NA 2BW4A 1MWAB 3P73A 1TKWB 2BLFA 2R0WL 2OJEA 1E9QB 4MDRA 4Q14A 3WNNA 5EUKB 4NKMB 3AMLA 5LG1A 4GSDH 1JV5B 5BQDA 3VXRA 4BUHA 3V0FA