3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterochelin esterase
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
4U6VH 2CDFB 2RCSL 2I9LB 3GHBL 4OGXL 1SEBB 3GSVB 1TZHB 1FGVH 2XZQL 4OCLC 1MVUB 3HUJF 4X6CF 5CGTA 4C54A 5FF6A 4H77A 3R1GL 3H2IA 1I9JL 1RZJL 2FX8L 3GKWL 3IU3A 3L3DA 3D18B 4M61B 5DRWB 1T5XB 3IURA 1BBJA 4GW1A 5E8EB 4C83A 3DMMC 3T65B 3G9TA 2ICWB 3OKEA 2GY5A 3TCLB 1GGCL 1EIBA 4PJ5E 3SKNB 2L0DA 1XZDA 4YNYA 3WKNA 4B53A 1KGCD 1QIKA 5ICXB 1XGYL 1WBZB 3I6GB 4PB0L 1IAKB 4MDIB 5CJQH 4X7FC 3SPVA 1EVTC 4YIQA 1DQQA 4R96A 4J7RA 2IQAB 3KG5A 4PSUA 4JKMA 4O00A 5FDYA 4WGVB 1MPAH 3FNBA 4M0MA 1NX9A 5JA9A 5JO5A 2FECI 4DTCA 4POUB 3RX8A 1OP3K 1VPOH 4N0FA 5L2JA 5CIPA 4YHPB 3ZKXB 3U4BH 3ARTA 3I2IA 4XZUB 3D39B 4U1NA 2X40A 3FQRA 2BY3A 1NPUA 3C5ZD 5CSBA 1I85A 5ALFA 1JWSA 1IM3B 2WTMA 4X00A 5DVKA 3UUEA 5T3XH 1AGFA 3MZTA 1G9EA 2BUCA 4TSCH 4R3SA 1OGAE 2GT9B 4L8DA 1F4HA 4KPHH 4RMSA 3WS6A 1KJVA 2RIPA 2F5AH 2WQRA 3VWKA 2J7LA 2BVOA 3HMXL 4U6HA 2RIKA 4Z9KB 1TETH 1ZLVH 5B8CA 2FL5A 3CLEH 3MRLA 3ET9F 3H9HB 4S0XA 1QQDB 3BQUD 5EOTA 4YXLH 3OG6B 2CKBB 3VG9B 3ARDB 1JKMA 2W59A 4OM1L 4Z0BH 5ALNA 1FDLL 3QQ9C 4JDVA 1UYWL 2DBLH 2HYMA 3KXFB 4P5TB 4K9EC 4NNYB 4WFHD 5FHAH 3P4MB 4WDIB 5D9SA 1XRLA 1SCKA 2YD4A 4FXLA 1QFWL 1LZLA 3WJJA 1DBJH 1QLFA 1TZIA 1Q1JH 4ODXB 1IGML 4PJXB 1MAHA 1RQ5A 1RHFA 3W0WE 4EI5D 3DLQR 2CB9A 3PG2A 3FB8A 3S4SG 4MA1C 2ILLA 5J1AB 4R4BA 2X1PA 5I2IB 4O2EB 4I5BA 3CFBB 2Y6UA 2VDMH 4QNPF 4FFWC 1WHSA 2GK2A 3GMNA 2W91A 4PJ5A 1CUAA 1NC4A 2YWZA 4LCIH 3JV6A 1FVEA 1V7ML 4IBLT 4WVRA 1MJUL 4GKZB 5FECB 4XHQA 5AJHA 3I6ZA 4PRPE 4U1HB 3DURA 4S1RH 3P73B 5FA4A 2G2RA 2AV7B 3GBNH 3WIFB 1QE3A 1A6PA 2ICEA 3C2AL 2OLDA 1QFOA 3D0LB 4ZXBB 3WKCA 4CVZA 5KSAA 1UOOA 3Q1SH 1TCBA 4Z7VF 1PW3A 4RGOH 5K9KB 3MRGB 4QRUB 4Q6YA 1CUIA 2ENYA 3WWCA 3EYSH 2X4RA 3GB7A 4YHZH 4K9EL 2DQTL 4UBNA 1DUZA 4JKWA 3VXNB 3WK6A 4PV8A 4DLNA 3OKOB 5JARA 4EY4A 2BSSB 5FYLE 3I6KB 4LSVL 4JAMB 1I6WA 2B5IB 5BRZE 1OGAA 4UILL 2I24N 4RZCA 3IFLH 2NX5B 5DS8B 4OZHB 1MFNA 4FBLA 2YN3A 3OKMA 4WW1A 2C58A 3MUZ1 2HA6A 1M7IA 3S34L 4XAKE 1KN4L 3WN5C 5GZND 5EU6D 2RONA 2HA1A 4OFPA 1K4YA 1MCCA 1B41A 4QZVA 3VDAA 1RSFA 3BMVA 4H5SA 4NSKB 4RGNE 4Z7NE 2OAEA 2B0SH 3CPLA 4MD0A 4Y4KB 5HHOD 1JL8A 4MQXC 1MELA 5FOJA 2ZNXA 4IRJD 3PJSA 1VSCA 1RU9H 3I2GA 5D93B 3EQ7A 1X4XA 3QUMA 3AZQA 2IANB 2J3QA 2PXYB 2UYLB 1H5BA 3ULUD 5IVDA 2HT2C 3KWWA 1J0IA 2GUOB 7FABL 3A6BH 5GGUB 4HIXL 1FVDB 1U95A 4ZSOB 5I8KL 5GS0C 4KKLC 3PWVA 4ODUA 2LV4A 4G9FD 4X7EC 3RLIA 5EPMA 1KJMB 3NCEB 1TNNA 2WIJA 2VQ1A 4Y19D 3SCMC 1KB9J 3NFNB 3GSXA 3IFNL 2D7PA 3SE8L 2HIHA 3MFFA 3X11A 1YNLH 2AAVA 2IG2L 3BH8B 1UFOA 5GGTL 2WFLB 4TQEL 4XRCB 1CEXA 4I18C 2AXGB 2ADFH 1XF4B 1IKNC 3C6SA 3EF3A 1A3LL 1AC0A 1VXRA 2FJFB 2XUDA 3QO0B 2FD6H 5IM7A 4PJBE 2HLFD 2J3DA 1SHMA 1UKQA 4BUGA 3PP4L 3WXWH 3IAPA 4KQ4L 5CD5D 4JFEB 1X6NA 3DO7B 1NJ9B 1G7MB 3R41A 2EKSB 1QSFD 1BBDL 3ECBA 1QYGL 1W8OA 1CL7L 4TOYL 4LSTL 3FYUB 2VATA 2GFBB 3STZA 5BRZA 3QR2A 5CJ5A 5FYJE 5HHMB 2H3NA 5GS0L 1IGJA 4QHUB 4B84A 2JELL 5DJYB 3L1HA 1W6RA 5HQ3B 3KPMA 5DI8B 2C9AA 3PV6A 1B0RA 5DRXB 5CBAA 3EGSB 3JWOH 3FO2A 1F8TL 4Y7DA 2VC2L 5GQBA 3MGOA 2YKLL 1DLHB 3BP5A 4TSBH 5J1SC 1ZE3C 5FUCC 2EDDA 5D1XC 4GG6B 4M6NH 5KVFH 3MRKA 4ZTOH 4Y4HD 5KVEH 4MXQD 2XFXB 1M7DB 3L1OH 5E6IB 5HHPB 4JFDB 1SBSL 2NY7H 1N7ML 2E7LA 3WWDA 1I3RA 4YR6A 4GI1A 1HILA 4FFVD 3WIIL 1CUGA 4FG6C 2O93L 2A0LC 2XWBB 2KDGA 3CSYA 4O58L 1XH3A 5A2KH 2AEIT 3CSBA 3SDAC 3U6RB 2IPTL 3C6YA 5F6IB 1FCGA 3BGMB 1J1OH 3GA7A 2YD5A 4MJ3A 4U1JA 3DHMA 3QUZA 3LIIA 3QXDA 3EYOB 1IMJA 3BSZH 4YPJA 3W9EB 2PSJA 5A43C 1MCEA 3L95A 1B0GA 3O6LL 5HYJA 1BIIA 3UO1H 4TVPD 2WHQA 3R0NA 2XUKA 1OCWH 3OAZK 4E42B 2W0FB 5DQ9B 3FAXA 3MLRL 4PJBA 3VH8A 4HKJB 2OL3H 3MLSL 1RUML 2YPLB 4L4VB 4Q9QH 3PABB 1BPVA 1TVHA 3QXAA 1DFBH 1PD6A 1BVKB 3BYYA 4POZC 1IC1A 2J4FA 1YEFH 5DEFB 5EA0H 2H9GA 5FKAB 1DL7H 2VIRB 3O9WC 1DX4A 1NDMA 3I3DA 1ZLUH 2J8HA 2OL3B 3S7GA 1YEKL 4M1DL 5DK0A 3RWEB 2AGJH 4XPBH 3HPJA 3SKOA 3KYMA 3NCCB 1IUPA 5GIRB 5HSFA 4GRWF 1R24A 1EDQA 2HFGH 5I1JL 2R1YA 4YHLL 1T2NA 1X44A 4E41B 2HFJA 1NMAL 3PL6D 4K7PH 5GISL 1IAIH 3S3PA 4UBMA 4Y2VA 5BZDB 4UUQA 4OU5A 5D6DA 4N5EC 1M71B 1ZI6A 3OAYK 1JHTB 3GSNH 4YDVB 3OGCB 1CCZA 4ZAKA 2WIFA 1Z0NA 1KCRL 4U0RB 3O3BB 4UTBH 3BD4A 5D71L 3MJ9H 1T0PB 3SDXA 4FZ8L 4D0DB 1ETZB 1FIEA 4PSCA 5CGYD 2QQNL 1G9NH 3GSNB 2YRLA 3MXVL 3P0VH 4EA6A 3D85D 1T3FB 1HHGB 4E0RB 2XQIA 1A9EA 4ZS6C 2Y36H 3WNOA 4MWSA 3UTSB 2H32A 4PJ9A 2R2BB 1O7VA 3L9RB 4FMFA 3ALPA 4P3WA 5EB9A 1RP1A 2Y4SA 1KN2L 3SDDB 5F7EH 5JZBA 2VABA 1KLGA 4PP2A 3QQ3A 5DJ8B 1D5XB 5LWYH 1SJHA 1YEEL 1XR9B 3B6SA 2HN7B 2XTJC 4K71C 4WW2C 4JGJA 3AB0C 4HXBL 5AHXA 3P77A 1H3XA 5MI0C 4Y4FD 4ELKA 5LCVL 4O2CA 2VO5A 2H1PH 2I25N 1YJDC 3QIUB 4K8RH 5IVKA 3CXDH 2C7BA 1T80A 1BQHB 2XACC 4LKCB 1G66A 4ODSH 1GYAA 3D1MC 1FG9C 4RA0C 2O61A 3KYKL 3MNVB 1AX9A 3ILQD 3ARBA 1JGEB 15C8H 1ZT4A 3MOBH 4TUKH 4X7SL 5E1HB 3ES6A 4KFZC 3ROLA 1MT3A 4GG8B 1I85C 2WIIA 3ULVD 1WC7B 4WHYG 3WIHA 4N90E 3P0YH 1JI3A 2DJUA 4Z0XA 1UK7A 4O4YH 4UQ3B 5IF0A 4BDTA 1A8QA 2GYUA 5JOPD 4EY6A 3H42H 3VWKC 1FL6A 5K33A 4G8FB 5B8CC 2MNUA 1F3JB 6YASA 4G5ZH 1CQZA 1AR2A 3F62A 5IP4A 4ZPVB 5J11B 2BVEA 4N9GB 4YDJA 3L3JA 1K4CB 2M8XA 5DD0L 4B0PA 1HKFA 2X1WL 5K93A 5DHYB 1RUKL 1YJDL 1D6EA 5C0AE 2I78A 2W0PA 3TH3T 4U1GC 3HC3L 5T5FH 4AG4L 4P4KC 1G7IB 4Y2RA 1UVQA 3VMPA 2JJWA 1G7JB 3FMGL 5BCAA 2C1PB 2BC4B 1C4XA 1T04B 4YBLC 2APVA 4X98A 2IALB 5KZCD 4KACA 2GBIA 4LHUA 4P59L 1EDDA 3QHFH 3C08L 3O6MH 4DVRL 3LKPA 3S9DB 1AFVL 2J88H 3VXRD 4PGEB 5CH5A 2CRYA 4OCXH 2VXTL 3T0AA 3QWRA 2AJBA 4BH7A 2QJWA 1QHOA 3HR6A 1QPPA 1RV6X 4X6EA 4DYHA 2JEZA 3BIKB 5L7XL 1XGUA 5CXUA 3CFKA 3HE6A 3BPCB 3GUTA 2R29L 4JY5H 1RZ7H 2XE4A 3Q3GB 1A1OA 1VXOA 2OAGA 1XF2B 4JZNA 1WZ1H 3S37H 2AJDA 1A7QL 1WBXB 2EE6A 4G8EB 4JB9L 1G7LB 5CJXC 2GW5A 1AJ7L 3ARZA 5JDSB 5KVMC 1A7OH 4X94A 3VFGL 3V6FA 2DQGH 5T33H 3SKJH 2C4FU 1KCSH 3VRJB 1YNTB 3T2NH 1P5VA 2ADGA 1P4LB 4ZG1A 3RBGA 4PJ7A 4LVHC 1BWMA 4YWGL 5ETUA 4ZV7A 2DM2A 2E27H 3V5KA 3JYHA 2AJZA 5B3JE 1JV5B 1MCPL 3U7YH 1MCWM 5F6HI 2DTMH 4I2XE 4CVXB 5M94B 4K3HA 5I19H 2HA4A 5ALZA 1UZ8B 1OW0A 1Q0XL 1ODTC 3OR7A 1NLBH 1BJMA 2F53D 4G4JA 1MHEB 1KPVA 1EGJH 4KJQD 4NHUB 5AAWA 4UDTB 1LE9A 3BPOC 4PRHB 5I1HL 3HZKA 2E7BA 2ESVB 2OZ4H 1BQLH 3VXPB 2XMBA 2OK0H 3LSOA 2LU3A 4AL8H 3R0VA 5C0AA 5A3IC 2BJMH 3AM8A 3VFUA 3K74B 5J6HA 4IMKC 2YPKB 3H6JA 4P23B 4NQDA 1RURL 5DZOA 3G6JE 5CUSH 4PRID 2J3SA 1MJ8L 5ACMA 4M7KL 4NO2A 5E2VL 2NYYC 5E6ZA 4AZ8A 2R15A 3QPXL 1AKJA 1K6QL 4C4KO 2HA0A 2VLLA 2IX9A 3WEXA 1J5OL 1C1EL 2NPLX 1CFTB 2EEDA 2D03H 1MI5D 4FQIH 5E8NB 1AGYA 4P57B 4DM7A 3DWTA 1G4HA 2LAAA 4ITVA 5FUZH 1WB6A 2VDKL 3DVIA 4KI5D 3RTQB 4PG9B 3ARXA 3LRHA 3HS0B 3NCJH 3LKNB 4GXUM 3CCHA 4ODWA 5AZ2L 1X2EA 3V1LA 1FVCB 1J0HA 2JJSA 3O0RL 5C0BD 4B41A 5HHNB 2A1WH 5CGMA 4Y9SA 2P45B 3L3OB 1A6AA 4G6JL 4YX2H 4DZBA 2NXZC 1ACJA 2HU8A 3OPMA 1FNEB 4OSUH 1NGXA 2WLZA 4LPUA 4XBPA 4Y2JA 2RHWA 1J7VR 1QBMH 1DDHB 4YXHL 1H2YA 4F7PA 1K4DB 3ZKNC 3LHPL 5HGDA 2ITCA 5EIVA 1A6UL 2BDNL 4U3CA 3QPCA 3JWDH 4QEKA 5E00A 5IW6B 1LO3L 3BZ4A 3KPLA 5K9OA 1GGVA 1NKOA 4LSRL 1MCDA 1ZLWH 5ICYB 3CH8A 3ZTJG 1GGBL 3SO3C 1R3HA 5JXEC 5C0RH 5ALQA 4ZPTB 1JGLL 4J6RH 3EAKA 3OPZL 1QRNA 4EN3A 5BMFH 5IJKA 1CDUA 4WEBH 4TTDC 2A9NL 4MWTA 5F9AC 1OAYL 3LN4B 4JO2L 5IH7A 3C6ZA 1NFDE 2Z93A 4CN6A 1RY7B 4JPVH 5IV2A 4G9DB 4R8WL 3L7FB 1XFDA 4R26L 3U48A 3EOYG 4UNTA 2CLZA 2KQMA 1YPZA 4M7LH 1UEYA 5GS3A 1KELL 3TN0A 2EE3A 4BZ1H 1QSVA 1MN6A 4GW4A 4UOW1 5CBKA 4GAGL 3G6JA 4JFHD 2H7CA 4AO7A 1GVIA 1HXMB 2PYEB 1XGPA 4X6DA 2BK8A 4HPYH 2BNQD 2WUBH 5C2UB 2DOCA 3J7HA 1Q0ZA 2VLJE 5E94A 4LIQH 3P9MB 3B3QA 3DCNA 2O2IA 1T22B 3QRGL 4QY8A 3MRQA 1PAMA 3L3GA 3DD5A 3MA9H 5TPWL 2LTQB 3QUZC 1P4BL 2V7HB 4AQDA 3SBWC 4A6YH 4AQOA 3GMQB 5JORA 4Z7UB 1A4KA 1T89C 4K3JL 5MEND 4KKBD 5E24E 3ZE1F 1JJIA 4NMWA 4IRZL 1RIVL 4HC1A 1QBLL 5IVXF 5AD0B 2BRQA 3HLAB 1A1NB 3BZFA 5HDBE 4MNQA 4A6YB 2VLKE 4OTXH 3UDWC 4YJZL 3LQAC 5EC1B 3DVNA 3FCXA 4H18A 3ZV7A 1A8UA 1HH6A 5ERWA 2IADA 3I3EA 4NUGL 1N8SA 2RR3A 2CJUH 5IHUL 2GBGA 1E6OH 4KK6C 1NCCL 1XR8A 2G75A 4IM8A 1JRHI 2RCSH 3G5ZA 3HHRB 4OGXH 2EIDA 4PGCA 1U8PB 3AUVA 3H7BA 4RA3A 2CRMA 1XIWA 2XZQH 2JGEA 4PJ5D 2NY2D 5L2KB 1NC4D 1UM4L 2Y5TA 4DNPA 4NCC2 3FO1A 1I9JH 1RZJH 2FX8H 3GKWH 4U6YA 4WI2A 4Y16B 5DC4B 4F9PA 5KSBF 3JTTB 4QLOA 2PUQT 3HB3D 5CD3B 1ZGLP 3QDGB 2ICES 1LD9A 4X6CE 1GGCH 4PUBL 1UWXH 1RK1A 4XNXL 3IUMA 1ZVHA 3NZHL 1DVFC 2EDQA 2FCBA 4ZRDA 1QLRA 3BMWA 4Q7DA 3R06B 1IARB 2X4QA 5KSAD 1C7IA 4PLOB 4X6BB 1XGYH 4PQEA 4CIAA 1Q83A 3R3VA 4PB0H 3CVHA 3U4AA 3RZCB 2KUTA 1AP2A 4MAUL 1A9BB 1YDPB 2D3VA 5ALMA 1OSPL 4QTHA 3TBSB 1ZHBB 3ARPA 3JBG7 4OLEA 3BP6B 2BFNA 1U8KB 2XMGA 2W92A 2WANA 3QNXA 2ZCLL 4CUCA 2GSGB 3T0EA 3NPZB 1N5RA 3LQAL 1X5JA 2FHCA 1JPSL 1SEQL 2VLJA 4I77H 3ZT7A 4ZFGL 2PM8A 1LE5B 1OGAD 2H2SC 3GMRA 4LLMA 4KVNL 5E4JA 4LQFL 1QFMA 3STXA 4PLKD 1CGXA 2WW8A 2C4FT 2A73A 3FFDA 4BQ8A 4B7IA 2EECA 2WSLA 2X4OA 3MJ7B 2Y5EA 1GZPA 3MRJA 1OXMA 1XEDA 1UJ3B 4Z18A 1ZJ4A 3HMXH 3L3HB 1NGPL 4PJIB 5B4MC 1KTLA 5ACZB 4NKOA 3LN9A 4OZIE 1OARL 2GJ6B 1ZK9A 4QXUL 4OM1H 1DJSA 2VLKA 1FDLH 4D9JA 1F0PA 4FQQB 1UYWH 2V9QA 1I1AC 3HRZB 3W0WD 1YB6A 4OGAC 2Y2VA 3DMMB 5AM2A 1QFWH 3IJYB 1B2WL 3KLHC 3DUHA 1P0MA 3MRBB 1V3JA 1IGMH 3VMOA 2BKLA 4G80A 3MV7B 2DM7A 2N4IA 4I1NB 1XZ0B 1KFAL 2N7BA 3IU4L 1X5HA 3OL2A 2GAZB 1BU8A 4ODVH 4KKAD 4CG1A 2OJEA 4PRPD 5L8LB 1SY6A 4A16A 4FFYL 5D5MB 3S8WA 4JKKA 5I8OL 1JHLH 1DN0B 1V7MH 1NSNL 1MJUH 3C5JB 5IKCB 3WLWD 1WZLA 4JFFD 1KT2A 3BJMA 3UJIL 4U7MA 4F15C 2XMQA 1ES0B 3DIFA 4U7KA 4D8PB 5EHZA 4HH9B 2JB6A 5KS9F 3V7AG 1F00I 5FGBA 1AO7B 3B9EA 3NOIA 3QEQE 4AM0B 5DDHA 3SX4A 3EUUA 4P2RA 3UAJD 3GI9L 3ETBF 5T5NF 3RNQB 3BKYL 2GIYA 5FYLD 2VAAA 5JZSA 5EC2A 4ORGB 4C55A 2IQ9L 3FN0L 4K9EH 2DQTH 5BRZD 2ZOKA 3DV6A 4PRDA 3VXUE 3EJYC 3MNWA 2AERT 2WUCH 4GKOA 5ITFB 9CGTA 3AZOA 4ZUUB 4M43L 5AZEL 2R1XB 3G5XB 4XAKD 4LU5L 4LSVH 4JEGB 4XNUL 4YGAB 1NUGA 1U42A 1P7KA 4UILH 3RDTC 3GMLA 4RGND 4X91A 1NEZG 4QXGL 1ND0B 4AY0A 4WUUE 2LVCA 4DUVA 3G9AB 5DJ5A 3U36B 3S34H 1KN4H 1S7RA 4YHIA 5GJTH 4OZIA 4TN9A 1QOZA 2BGNA 4MA1B 1GGTA 2H8PA 1EAJA 2X4UB 5D7LE 2JB5L 3G0GA 5MEPB 2CDEA 3STLA 4FXKB 5AIBA 4NQCB 4I3FA 3IYLW 2DYPB 3JSSA 1FC2D 5HVWA 3X17A 5FYKU 3IKCB 3QWQB 2PU5A 5HD8D 7FABH 4QYOA 4HIXH 4NKMB 4EVNA 4OFYA 1N3NA 3IDXL 2O2GA 1BAFL 1D5MA 1FFEA 3E6HB 2YR3A 3IFNH 3SE8H 3MV9B 1EUTA 3D48R 4HWEL 2HFFB 3LCRA 3FB6B 4JHWL 2PBLA 1AD9B 4YGVA 2IG2H 2EYSA 2EZ0D 3LZFL 1LEKB 5TH2A 2DR0A 5AM0A 3GSUA 4LLQA 4TQEH 4HH8A 4JQXC 2DQEL 4P5KB 3S35L 2YMXL 1CD1A 1AGCB 4ZOBA 3VFTA 3QEQA 3N1GC 1A3LH 3NA9L 2QSCL 3OB8A 2VKXA 1S7XB 3WYRA 1Z9LA 1ZHLB 5GGQL 3O4JA 1A0QL 1FC1A 3PP4H 3BEVB 1YA8A 3FTGB 4KQ4H 4BZ2L 1ZJ5A 2WP3O 4MJ5B 3MV8E 3NOXA 1MH5A 1DQML 4Q82A 4AEIL 4EI5C 5HF8A 3WN5B 4UHDA 1BBDH 2FJHA 2IGFL 1HI6A 3MROB 1QYGH 1LDSA 2OSLB 1WWAX 1CL7H 3PP3K 5D2NE 1TCRB 3E3QC 1IVLA 5IK3B 4TOYH 1UT6A 3AJAA 2AV1B 4UBDD 2B1HL 1XAUA 4JPWL 4UINL 1IGYA 4H0CA 5GS0H 3SDCA 1A64A 5LJYH 2JELH 4WUUA 2FX9L 4KROC 4JM4L 2L7UA 1BZ7A 3LP5A 2JJSC 3RWHB 3IUNA 4X9FA 2AXFA 1ZTXL 1F8TH 4P2CG 2VTFA 2VC2H 2EYTA 2ITDA 2YKLH 5IBLD 2X05A 2YEZB 3QDJB 5DZNA 4Z78B 1EVEA 2BOBB 1BWWA 3QH3A 5F1OB 5DYYA 5HHVH 3SCMB 2AJYL 4PJ9D 4BSJA 2DAVA 1S7UA 3G04B 1HSBA 5I17A 1SBSH 1N7MH 2WQ8A 1ZSDA 3Q48A 3HZMA 1EXUA 4WHDA 1UG9A 3QEGL 4JRYE 3WIIH 4I18B 3L5XL 1ZA3B 3FLAA 1MCKA 1IILE 1ZT7B 4O58H 4F60A 2OQVA 2WHPB 2PTUA 5L0QC 2IPTH 2JBWA 2UWEE 1KIUA 2YC1B 2E3VA 3WSQL 2OQJB 4FQ1L 4JFXA 4JN1L 4KHXL 1BFOB 4RFOL 3U79A 3IT8D 4WI7A 1INDL 2AQ2A 2Q3AA 1FJ2A 3M07A 4YDIL 2DLGA 4NUJA 1EEZA 2G5BB 3RKSA 4F57L 3ARBD 3UP1A 2I60L 3MLRH 4IRJC 3DJ9A 3TN0C 2PKDA 4J3JA 4P4RB 5DJCA 3MLSH 1RUMH 3NZ8B 4MX7A 2C5FA 1YMME 3MA7B 5GS1A 3KYNA 1QFUL 5IMOB 4XI5C 1UH4A 5EGNA 4PSDA 5D2NA 3DUUA 3JW8A 5F72S 3F7PC 4H25A 1YEKH 4M1DH 5DSCB 1KTKE 5IMKA 3HZVB 5IHZA 2A6JA 3B83A 5EIIB 3BP4A 5D1XB 4JDTL 5I1JH 1I1FB 3OHXA 1WSST 2DKSA 3QEHA 4YHLH 5C8JA 1C5DB 1T7WA 4GKSB 1NMAH 1IT9L 5GISH 4E5XA 2VLRE 3ZTNL 2QZPA 3DETC 2HWZL 1K8QA 3AXLA 3STUA 5CW2A 1YQ2A 2OR7A 4GRWE 2LVEA 2QQKL 3LB6C 5F4ZA 2R0KL 3D3VB 4BFGA 1KCRH 4XPTL 1GOGA 2IPUK 4GBXD 5D71H 3TBWA 3SDAB 4FZ8H 5DJ0B 3RWIB 2HTLC 2FO4B 5CZXD 4WV1A 4XP6L 2X2YA 3VG0L 4HEME 2QQNH 5CD5C 2XV6B 4MB3A 4Z49A 4LHUD 3KNBA 2FJGA 4P2QD 1FFQA 4JRYA 2CXKA 2HADA 2ZJ7A 3MR9B 3EYFB 1KN2H 2P5WA 4LCCC 4J8RB 2UWEA 1M6OA 1LQSR 1MCRA 2QQLL 3RGVD 3HE6D 1JYVA 1YEEH 2XOTA 1VOTA 1MCJA 1FL3B 3FOBA 2ERJC 4HXBH 4L4TB 3UTZB 5JOEA 3K9BA 3QWOB 3FN9A 3QEUA 4ZUWB 4BFBD 5YASA 4CVWA 5LCVH 4F7MB 1ZKAA 4XP4L 3QQNA 5AI5A 3O9WB 5IW1A 3CXHJ 4MS8C 4M7LT 1U8LA 2PO6A 2IBGA 4R7DA 3V0WL 2QOEA 1WUNT 2HVJA 1H9VA 3KYKH 1DUYA 2IFFL 3CDYA 3IXAB 4G8GE 1XZFA 3NIFE 5FO9B 1YMMA 4N90D 5F89B 1IGTA 3DRTB 4FNLL 4TRPL 3T0EC 4FFVC 1TTFA 4L29B 4OF8A 4X7SH 2ARJA 3PWPB 1YSCA 4J0HA 1CGTA 3OJDB 4PJGE 5CTAA 1ED3A 3HNVL 3UZVB 1YR2A 3KPPB 1PV1A 5D96C 4XP9L 5EDXA 4D9RD 2V2TB 4G42A 3MRHA 3GMOA 2C0PA 4HMEA 4P48A 4PRAA 1YEJL 4OCRL 2MJWA 2VLRA 5J3HC 5DTJA 2WKWA 1P7QA 1PYWB 1LP9A 1KJ3L 2R11A 1MX1A 2G5TA 5C0AD 2Q7NA 4XXDA 2BSTA 5KW9L 1WM1A 2Y7QB 1EX9A 4HFWA 5TFSH 3RNKB 3VKFA 2VLME 3IU3B 5DD0H 3L3DB 4WU5B 3NIDF 5C0JA 3ICVA 1CIUA 5DT1H 1PBYA 3H3BC 3WYDA 4GW1B 5AI9A 4P9ML 5KSUA 2XZZA 4UAOC 4IOIA 1RUKH 3DV4B 1YJDH 4K71B 2XTJB 3OKEB 4WW2B 3HC3H 3O3DA 4AG4H 3GSQA 3AB0B 4HV8A 4JJ5A 4EUSA 1NEZA 3FMGH 4UHFA 5MI0B 1AXIB 3B5GA 4M4PA 3WKEA 3QJHA 4U4BA 1M05B 2RB8A 1BQUA 1MJ5A 3ZO0A 4WFKA 1GAFH 3TZVC 4P59H 5ID0A 1SYSA 3C08H 4GKNB 4MXVF 4DVRH 4Y2YA 1AFVH 3PL6C 5HYSB 3S36X 1R3JA 2XIDA 1I7TB 5JO5B 2MMXA 2NW2B 1CGWA 1UB5A 2UV3A 3QISA 4LQ1A 1S9XB 1QLWA 3UMTA 5SWZE 1A3RL 5L7XH 3K1KC 3TJEL 4N0FB 5L2JB 3DPBA 3HI1A 2WU4A 4HIHA 1ZWIA 4U1NB 4HS3B 1UCBL 5FGBC 5AKIA 4LRNH 4AMZA 2DS4A 1QA9A 4TULL 1A7QH 5CWSB 2HA7A 4JB9H 4TVPL 4BRSA 1AJ7H 1AGFB 1OT2A 4M8VA 3CX5K 4MA7L 3VFGH 1ZGCA 4HUMB 4N1HB 4Z95L 1EH9A 1KJVB 4NYLB 4H8WC 1EMTL 4OLYH 5JIHA 1BGXL 3VWKB 5D3KA 2BVOB 4KZEL 5B8CB 1F11A 4PJGA 5A2IH 4EN3D 3K7UA 1WBYB 4HUXB 1U3HC 4JDVB 1EHXA 2DLFL 2WFMA 3OB0K 5BOZG 3QA3A 1Q0XH 1N0XH 1T0MA 4P08A 2IH1A 4PY8I 4U1GB 5F88B 4P4KB 3IIIA 5B39G 3AAZA 3MRIA 1AXSA 1TZIB 3KPTA 3BZDA 1JN6A 2WQZA 1U3YA 1YY9D 4J0CA 1VGEL 1FQ9C 4KK5D 1OM3L 5I1HH 1JGUL 3FB5A 3RVXD 4YBLB 3VRLE 1GPKA 4HZGA 3DOHA 1ULVA 2BSRB 2DQUL 4IHOB 2PNDA 4XMKL 5FXMA 4RCAA 4Q9CA 4R0LA 3G0IA 5E8DL 1FVEB 3NPSC 1RURH 4ARAA 1GKLA 3K8MA 1MJ8H 2DN7A 3B5TA 3HG1B 5E2VH 1RULL 3MODL 3QPXH 3VFRB 2G2RB 2GYSA 5C07A 1J5OH 5FO8A 4H8WL 1JF5A 1C1EH 1WAAF 2AKRB 5FGCE 5IFAL 2EYRA 2ICEB 4PJEF 4FOLA 1UB6A 4GOSA 5CP7A 2FZ3A 4CVZB 4X4XA 5ALXA 1PKQA 4HHAB 1Q9OA 2VDKH 3RI5F 3HC7A 2ED7A 5SWZA 2V2XA 4L3EB 1CFSB 3BOVA 3RY4A 3JUYA 5AZ2H 3AIKA 2XRAL 2VZVA 1DUZB 3O3AA 1ACLA 3O0RH 3I2KA 3RAJL 1V3LA 2XQYK 4LVHB 3A2NA 2HKHL 5EULV 3LKRA 4G6JH 3S88L 3Q8WA 2MWCA 1X7QA 5EZLA 3W9DB 4HKZB 4RZCB 4XGZB 3KLDA 5F9OL 1MX9A 4WW1B 4YXHH 1P6FA 1RVFL 1CUFA 2P44B 3LHPH 1A6UH 2BDNH 3VFWB 3BPOB 4FNMA 5H37G 2WIDA 1LO3H 3HAEH 5J4MA 1J8HA 1KIQA 4H5SB 1TVBA 4JN2A 4LSRH 1ONQA 1GGBH 4M00A 4MD0B 4X9GA 3QQ4A 5ID1A 1JGLH 1LNUA 2FGZA 3SDCC 2HJKB 1ZEAL 3OPZH 5EO0A 3ME0A 3BUYA 1MFEH 3QUMB 4RWHA 5A6VA 2CRIA 3HAEB 2WM2A 2A9NH 4LF3B 3VGDA 4F2MB 4QE3A 1OAYH 2IF7A 4JO2H 5T5NG 3KWWB 3LQZA 2FX7L 1U95B 4N8CH 3TIDA 4L1HA 4R8WH 1TQHA 4R26H 2Q8BH 2ORBL 4LCYA 2FWOA 3QB7C 1XROA 1A7PL 1UJTA 2C0QA 5CH8A 4RAUB 1EHNA 1KELH 4DCQB 3GSXB 4PRBA 4NZJA 4AH2A 4FMPA 2JCCF 4GAGH 5CEZH 1DEEB 2IPUG 4ZFOL 3FZUD 4K7PX 1U0QA 5E1AB 1H3GA 2BVPB 1PFCA 1B4RA 3REWA 3KPQA 3TFKC 1MJJA 3QRGH 3BRGC 1Z5LA 4KKCD 2PSDA 5TPWH 2NXZB 3LN5B 1P4BH 2KPNA 1QOKA 3GIVB 4TNWF 2VLKD 3H3PL 5C08B 2XICA 1PEZA 4K3JH 4F0JA 4IRZH 5I1EL 1QBLH 4UNVA 1ZS8B 1OB1B 3P4OB 4LBEB 3DBXB 1DSFL 4L8CA 3ECBB 1FNFA 4K23L 1YEIL 3S97C 3V5DA 1C7JA 1N1MA 1WIPA 3HMWL 3QZWG 3STZB 2XMZA 3QUXA 2DFPA 3SO3B 2MHAB 4NUGH 4KQ3H 3DKRA 1NCCH 3EKCA 1HZHL 5GS1C 1NC2D 4RBPH 4JFYA 1DTEA 2BNRE 3AMLA 1E8MA 2HM7A 4MVBD 3WL8A 2W07A 3WKML 3FO2B 2QRUA 4G6AD 3U9UB 5AIAA 1S9YA 3TVMC 5DD5L 3VXOB 4GXVL 4Y1AA 4HWBA 3MRKB 1FFPB 3DX6A 3T4AA 4PUBH 3NZHH 4I4CA 1J11A 4PNZA 4BP9A 3MRDB 1A7UA 1HILB 3G6DL 3VCLB 2BCKA 5EU4B 3RPIA 5E4TA 1I7UA 1CG9B 1JTTA 4LVNC 4MAUH 3GJFH 1FO0A 1S8DB 1ZD4A 2VXSL 2IAMD 4JQIL 4HZLA 3IS1X 1ZI9A 4U1JB 4F7EA 1MWAL 2BSED 3QUZB 1D5ZA 2NLJA 3STBA 4LK4A 2ZCLH 3GJFB 3LQAH 1MHCB 1JPSH 3L95B 1SEQH 1OP5H 4KJYA 3CH1A 5HYJB 1ZANL 4BBZA 5EO9A 1EHLL 4KVNH 4LQFH 5DJAB 2WNGA 4UFPA 3JWNC 1EA5A 3GM0A 2VH5L 4BK4A 1PFQA 1I7RA 3SQBA 4FFZL 2C4XA 1P4IL 3VH8B 4HUVA 4YO0A 1EI9A 4PW0A 3GFFA 3LMJL 3H9SB 1JK8A 4I3RH 2PCPB 1JPGB 4OIIL 3MREA 5F9WC 1HIML 2K1MA 4X8JB 3Q5TA 1TVHB 3OURA 1LGYA 3K3QA 4KJPC 5T1MB 3V6BR 4N0UA 1W72A 2XY2A 4LHJB 1WHTA 4HCRL 1NGPH 1QO3A 3GZKA 1QO9A 3ULSA 2HKFL 4ZUSB 5FA3A 2P49B 1DT5A 1OARH 3ULUF 2HJFA 4QXUH 5FO7B 2R0ZL 5D70L 2NY5C 3HPJB 1BREA 3TT1L 3FFCB 1R24B 4OQ1A 3RI5K 3VA2C 3O4OC 3THML 5IMMA 1FFRA 4KRYA 1B2WH 4JM2A 5E5RB 3HNSL 4PJDF 5F93C 3B4NA 1UXSA 1DVFB 2BNRA 2FNBA 4PPTA 5BV7C 1HWGB 5GRUL 1I9EA 4U1IA 1C7TA 1KFAH 3IU4H 1GC1C 1ZI8A 2J6EA 1T4KA 4HUWA 4HS8H 3BXPA 4GXNA 4FFYH 3D39E 4KV5E 2DQFA 5I8OH 5IROC 4F9LA 1NSNH 3QEQD 4HK0B 4L8BA 1PY9A 3BAEH 1A9EB 2QJDA 5IB1B 4Y2PA 4EZMA 4QO1A 4M62L 2H32B 1CXKA 4FLMA 2AK1L 4ZQKB 1ORSB 1J9CT 3QUKA 3SOBL 4DKFL 3D5EA 4WFGE 1KLGB 3BP7B 3QQ3B 1QHPA 4PP2B 5EBGA 3GI9H 3VXUD 2HU7A 3WKAA 3NGBC 3VWJA 4Y8AA 5L6YL 4ISVA 3OSKA 3P77B 1NANI 4WI8A 5J06A 2IQ9H 3FN0H 3KXFE 4KDTA 3H19A 3MTRA 3AZPA 4LLUB 1PEWA 1UZAA 4I0PC 2CDFA 2I9LA 4HIIB 5I0ZA 3BIAX 4M43H 5AZEH 1SEBA 2EXYD 1RMFL 1TZHA 3GSVA 4LU5H 4PJXE 1NLDL 4XNUH 1MVUA 5BV7L 4KWUA 2FBOJ 5M7QA 3MLPA 1PX4A 4J3SA 1I1AB 4RAVA 2NZ9C 5AI8A 3D18A 2CGRL 1X2BA 3N06B 1GC1L 4QXGH 3VD3A 2VITB 1ZT4B 5D7LD 2ICWA 2Z31D 3TCLA 3SKNA 2YZ8A 4EY8A 1A8JH 4X92A 1N5AB 4JHAL 3D7RA 1BCRA 4C6HA 4Y7MA 4D9LL 4CCWA 4DKEL 2WIIB 3CZJA 3EDKA 1EEQA 1H0DB 3BPNC 2JB5H 3QIWD 1IAKA 4MDIA 4Z0XB 2P43B 2XQYG 2EIBA 5HY9B 1MTZA 1B90A 5IF0B 5MP6L 4NQXA 2IQAA 1N6QL 2GY7B 3WUWB 1FL6B 3OXSA 4OBSA 4F15B 4PLKC 5L9DL 3PIQB 3STWA 2IBZX 4YHPA 4XZUA 4QF1A 1YYLL 1BAFH 4YFEA 4QT5B 4KAJA 1FAIL 5D7SL 3CN9A 2QHLA 4KMLB 1IM3A 1LPNA 4MCYB 1V7NH 4JHWH 1GOFA 1TZGH 4LGSB 1IAIM 3MRNB 4GQ9L 2ED8A 3N9GL 4HRXA 2DQEH 1XZAA 1AGDB 1JTPA 3VFSB 2NX5E 1SBBA 2YMXH 3MC0A 4OZHE 3WFZA 1AC6A 3MV8D 3VGAC 3NA9H 2QSCH 3OKLA 4LRIA 1U2EA 1QQDA 4X85A 3ARDA 4R0LC 5GGQH 3X3GL 1A0QH 3RDTB 4M1GH 2FEDD 3KXFA 4P5TA 4NNYA 4BZ2H 3P4MA 1DQMH 3WNKA 2HT3C 4WDIA 5HPMA 4AEIH 2IGFH 3RL2B 2WIKA 1ZD2P 2IANE 4FQJH 3ZDYE 4EBQL 4H7HA 4PJXA 4ODXA 2ZJFA 1FLRL 1JU4A 2HMID 3LD8C 1H8SA 4LASL 2FR4B 1HINL 2B1HH 1BQHG 3O2VL 5ALGA 4ZSOE 4JPWH 1A2YB 5DGRA 4UINH 2GTZB 1MU0A 5EUOB 2PKYX 3V6FB 5D7JC 5I2IA 3WQHA 1P0QA 3O6FC 4O2EA 5F70A 3CFBA 2FX9H 1HBJA 3MBXL 2ADGB 2EEAA 3QIBC 1XZKA 4JM4H 4M9PA 4BYHA 4PJ7B 1ZTXH 4GKZA 5FECA 5KN5B 2YRPA 3C6LD 5F7FA 1TXKA 3ZI7A 2AJZB 2F19L 3C8KB 3P73A 3T8XB 4JRYD 1OD9A 2AV7A 1NBZB 2AJYH 3C2SA 5C0CB 3BDYL 5GXBB 3QBTB 3OR7B 3D0LA 4ZXBA 1S9WB 2RJMA 3ZYZA 5FYJU 2DLEA 3C09C 1U93A 2Y23A 3QEGH 5LZ8A 4QRUA 4H7FA 3OGOE 3L5XH 1NANH 3PGDB 1QFHA 1W76A 1B9ZA 4JFEE 3DSNA 3VXNA 4AIZB 1IM9D 5HHQA 2MCPL 3FVTA 3W5NA 3OKOA 3CN7A 3OZ9L 3LSOB 4HJGB 3VGGA 2FLBT 1GQSA 2UZIL 3R8BB 4K55A 1CI5A 2BSSA 4QXWA 4WEMB 3WSQH 4FQ1H 1I8MB 2EE9A 4JAMA 4KHXH 4X5XB 4ACPA 2NXYD 4IRSC 4NQDB 1UA6H 1A8SA 2PO6D 2NX5A 5HHME 5DS8A 4OZHA 4PJAF 4YDIH 1KNOB 3DUSB 4EI5B 1AKJB 1QPXA 1KTDA 2VLLB 5CZKA 4F57H 1YMMD 5D3ZA 3W5MA 4AN0A 2I60H 5CEXA 4ONFL 4J3WA 1OY3B 2P8PB 3L7EB 4I48A 5I6XC 1OTTD 3ULVF 1W52X 3FWHA 4XPFL 3WLAA 3W39B 3MBED 4IS6B 4Y4KA 1RUAL 3QZUA 4KROB 4ODWB 1QFUH 5ALUA 3CCHB 4KDWA 5FYLL 2IANA 4JFDE 4LPCA 4OLZL 1EJ6A 3RVWD 3ZKMD 1HLGA 1P7QD 3FQTB 1WB4A 2ZPKL 1UCTA 5GGUA 1A6AB 4ZSOA 4DZBB 4JDTH 1CLYH 1T83C 1H3PH 2AJXL 4XBPB 1KJMA 3OKKB 1MPXA 1JMZA 2ZUQC 5B38G 4DNQA 1IT9H 4IIQA 2HP4A 3ZTNH 2HWZH 4F7PB 3NFNA 3QMMA 5A40E 4KE6A 5JATA 3FN3A 3SKUD 3VE0A 4HGWB 5JMRA 3BH8A 2QQKH 2BRRL 4XPTH 5K9OB 3BZ4B 3KPLB 2AXGA 3GEWB 3T0BA 3QUXC 1T66D 5H94A 5L0QB 4IOFC 3E8UH 1AE6L 1XF4A 3S96A 1R3HB 4XP6H 3VG0H 4HG4J 4MYSA 1QRNB 1BM3L 5TE6H 5EU6B 2Q7YB 3DRQA 2PU7A 2R9HC 1FSSA 2UY6A 4H7DA 2YPLE 4L4VE 1ZAGA 1A4JB 4TUOA 3SWWA 1WWWX 3DO7A 5IV2B 3FONB 1UOPA 2EKSA 1IRAY 5DNWA 2QQLH 5JOFB 3ZYIA 3OJMB 1JNJA 2CLZB 3QP3A 2Y25A 1YPZB 4IRJB 3TN0B 3O4LD 1IQWL 3FYUA 2GFBA 4OQTL 4WI9A 5ISMA 5F21B 4X6DB 1XGPB 3H18A 3MVEA 4XNMA 4QHUA 4RQQB 3ZE2E 3AINA 3S5LB 4G8GD 2FSEB 3QXUA 4XP4H 5DJYA 4E41E 5E94B 5HYQB 4BQBA 3MFGB 2HU5A 4H1LH 4HS9A 4LIPD 1P5UA 5DI8A 2FUKA 3H17A 4U1MA 3GIZL 5DRXA 3PDCA 1C5BL 3EGSA 1U36A 2Z8RA 4Y19B 5KBYA 3L3GB 4DFHA 2VJCA 5FM4A 1HNFA 1DLHA 4CVUA 2A38A 1K85A 5BQ7A 3HI4A 2HJLB 5JADA 1FV1A 4GG6A 4H1LB 4FNLH 5K59E 4TRPH 1X70A 4NO0D 2XFXA 1M7DA 3X14B 1EPFA 3HTLX 4JFDA 4LMQE 3FQUB 2FDBP 4MNQB 2YWYA 5CP3H 3HNVH 1KYOJ 3L1JA 2PETA 4PP1C 4F3FA 3T3MF 4XIIA 4XP9H 5ALWA 2XWBA 3UTSE 1XLUA 4M48L 1YEJH 1E4JA 4OCRH 3U6RA 3BISA 4J23A 2VLMD 1XR8B 4OZ4B 3BGMA 5I8CA 2K7QA 2QR0B 4MYWB 1KJ3H 3MRMB 2IH3B 3G5ZB 3H7BB 2DMCA 3IRPX 3WHE0 4XC1H 5T4EA 3EYOA 4EEEA 5KW9H 1BF8A 2CUTA 3W9EA 5DZLA 2Y5TB 5FDFA 2CJPA 4OKVB 1CU4L 4LCCB 3BUTA 3GK8L 1KCVL 3VXTA 4P9MH 4L4JA 2VJDA 3KHOA 1G7QB 2W0FA 2XA3A 1DQDL 4JM2C 2ERJB 4GECA 2OTUA 2W9DH 3V48A 5SWSD 3NIDE 4HKJA 2V2WB 4LSPL 3NTCH 1OF2B 5LAXB 4L4VA 4DAGL 1DEDA 5DURD 5K3DA 2JJTA 3PABA 3U7WH 4KI5F 2RQ8A 1BVKA 2ZUVA 3OG4B 4R90L 2YUWA 5SWZD 5DEFA 4PJ8D 2DKMA 1AP2B 1H8OA 2VIRA 2D0FA 1IQDB 2A77L 4QTHB 2OL3A 4N0CD 3V6OC 3BKJL 3RWEA 4F9LC 2D9QB 5L8KB 4WCVA 1A3RH 3T0EB 3TJEH 4E41A 4LYEA 1JNNL 4S1QH 3GMRB 1RWQA 2ZOLB 3HLKA 1UCBH 2EE2A 1W75A 5IB4B 4AX4A 4KMTL 1JHTA 1Z6JT 4YDVA 3OGCA 4TVPH 5D96B 3TP4A 3H0CA 3PE9A 3SGKC 3O3BA 1GZPB 4NHCL 4Z95H 2EDKA 5ALBL 1CXFA 5DHXB 1EMTH 1JPST 3RVVC 1BGXH 4KDTC 1D7FA 3P2TA 3KPRB 3SGJA 4KZEH 4KK8C 1KTLB 5E4IA 1VFBA 4LLAA 5ENWB 1D9KD 1T3FA 4E0RA 1U8QB 4LHEA 2JGIA 3VFOB 2YXMA 3V6ZA 4GH7B 4WO4D 2DLFH 5CEYB 2DM3A 1MAML 1F45A 1GSMA 3F12A 3LY6A 3T0DA 4UAOB 3PWLB 3QT2A 3SDDA 1VDGA 2DQDH 4CDGC 1FORL 1D5XA 3IAQA 3UBXI 1XR9A 4G4GA 1SY6H 2HN7A 4Q74A 3RY6A 1VGEH 1JGUH 4G80B 3LLCA 1LBTA 5D2LB 3WA6A 2HFEA 1U65A 5L8JB 2DQUH 4K3EH 1LDPL 3I02A 3TZVB 1EERB 3RHWK 3QIUA 3H2GA 1F3RB 1ZT1B 2HTKC 3PL6B 2YD1A 5E8DH 2HH0L 1HQ4A 5IJVB 4FQXD 2K9UA 3ZT5A 1JJFA 1WTLA 5AKEA 1S7QB 1J0KA 4C89A 1S78C 3DIFB 3MODH 1JGEA 3W11C 4EB0A 1R9NA 3PNWB 1U6AH 3JVGA 5AKJA 1MIML 1QNZL 4H8WH 1GT6A 3KOOA 5HI4C 3QG6A 5AYQA 4LXIA 1DLFL 4GG8A 1LPSA 3WFDL 4BTVA 1WC7A 4HUUA 4U49A 2VAAB 5EC2B 3S2ZA 4UQ3A 4M3KB 2XRAH 1QIGA 1JJBA 2ZOKB 2YASA 4TVSa 1JPFB 3RAJH 3BD5A 2X9YA 1HH9A 2HKHH 3MNWB 3SEPA 4QRPA 4PG2C 4S10A 4G8FA 5DWDA 5HGAB 1BFVH 1CF8L 5ALJA 1F3JA 1F6WA 4PJFB 1LNSA 4PRHE 5C09A 1U3HB 3S88H 4JANA 4KH2A 4N9GA 1K4CA 3CU7A 5INCB 5DD1L 4ZS7L 3ROOB 1ZOIA 3PFCA 2ESVE 4BE9A 1NKRA 3DI3B 3ZHDA 4UT9L 3IDIB 4J0JA 2Y07L 1RVFH 5DHYA 2P7TA 5I8EB 3TA3A 2Z8SA 1S7RB 4YHIB 2CO6B 1R50A 1K8DA 4LLDA 2OGZA 3B2VL 4QLAA 1G7JA 4UPDA 2C1PA 4WIQA 2H8PB 3MJGX 1T04A 2IWGA 1V5JA 2PW1A 4LPWA 4EKXA 3VDBA 1U4NA 4U1KA 4JO1L 5EFZA 5E2IA 5C0FB 1T7VA 3NPSB 1KULA 4K6KA 1ORWA 5E4YA 4MD4A 3MCKB 4C4YA 2FX7H 4QYOB 3RKDD 5LKNA 2VXQL 3D9AL 3RWCB 4MDJA 3BIKA 4EVNB 4EUPG 4LP4A 5IWLC 4OCSL 4BK5A 4JFPA 2ORBH 3Q6GL 2WBJA 3Q3GA 1A7PH 3T2OA 1OAUL 5IB2A 1XF2A 2D0GA 1NUNB 3IDGB 5DLPA 1GXSA 4JO4L 1G7LA 2BZDA 1QFWM 4BVJA 4WTZG 5L88L 5JDSA 2EYSB 2Z4QA 4HMDA 1K5PA 4LL9A 2OCLA 5CT8A 4JGMA 4BYMA 3VFTB 4ZFOB 4DNFA 4ZUVA 2Q76A 3GKZA 4XVUD 3BGFC 12E8L 1NMCC 5CHNB 2XXCB 2VNCA 3J8F7 1WV7T 2ZUSA 1HEZB 2QL1A 3H3PH 4CVXA 4HVTA 1MH5B 5C86A 1UZ8A 5I1EH 3O6KL 1FFCA 1DSFH 1MHEA 3RVTC 4HXGA 2GZRA 1YEIH 2WU3A 3EDJA 5FEBA 4PRHA 3HMWH 2ID5A 2BNRD 3LIPA 3U46B 3UC0L 5C2BL 1IGYB 3SDCB 4JVPA 4Q3LA 5F7DA 3VXPA 1HZHH 1EGJA 4L9LA 4LCWB 1I9IL 1WGOA 1BZ7B 2H1IA 3C70A 4P9HL 2DIAA 3O3EB 1KPUB 5FM5M 2AXFB 3WKMH 5HI5C 1YNKL 2OZ4A 4QNNA 4L1DA 2W9EL 2GQHA 2NMSA 2PYEE 4JPKL 5DD5H 4K3DL 5JD6A 3MNZB 1E0OB 4ROTA 4QWWC 3I50L 4NS4A 5LIPA 1OAZL 2QXTA 5E8NA 4GMTH 1U92B 2P47B 1S7UB 4IIQC 3BDBA 2J4WL 3I85A 4RE6A 1BD2A 3SY0B 5ESVA 1EXUB 3G6DH 3VWJD 2YK1L 5A7GA 4Z7UE 1CUBA 3DYPA 4PG9A 4I0KA 4LXGA 3LKNA 4M93C 4KI1A 3HRHA 2DKUA 1FVCA 1TJIH 4NC1E 4GUPA 1Q94B 4HD9A 1G1CA 2VXSH 3EJZD 2YH2A 2AK4B 4JQIH 5DNVA 5JZ9A 1MWAH 3L3OA 4W4OA 1HN1A 4LOUD 4NM4L 2J8UB 5FYKE 4J4PD 4OZFH 1R3IL 3JTSA 2J4CA 4XH2B 4NUJB 1ZANH 1DDHA 2FLRT 4Z7NF 1NAML 4N5IX 1CUCA 4MJIB 5GGRY 1EHLH 1K4DA 1MWAB 3BDVA 1DQLL 1BEEA 1BIHA 2VH5H 4XWOC 4E14A 4QA9A 4OZFB 3G8YA 4DOHB 4NOFA 1P4IH 5L2KE 5DJCB 2FIKB 1V3KA 3LMJH 4ODTH 4OIIH 3Q6FA 4OLWH 4MX7B 4YHKL 5ANMB 3VGEA 5ICYA 1HIMH 3VFVA 4RMUA 3S36L 1DWOA 4ZPTA 5GS1B 4EI6A 3KYNB 4Y5VC 1JWMA 1HHJB 4HCRH 5CAYB 3QDGE 4BATA 1KXVC 2HKFH 4KJWD 1XRQA 3DUUB 4WFJA 4WY8A 1C5CL 3EQ9A 2OCGA 3DNMA 2YS4A 4AEHL 1MI5B 3LN4A 2R0ZH 1HYRC 3EYQD 1K8IA 2WMPA 5D70H 4JRWA 3TVMB 2FECL 1U58B 5KOVC 3TT1H 4BQ9A 5IHZB 1J87A 2A6JB 2R4SH 1FJ1A 3QDHA 1E3QA 4G9DA 1VFOA 2QADC 3OHXB 3THMH 5D7IB 4NZZA 1FE8L 2YD8A 5E9DB 1L7AA 3HNSH 1ZLSL 2YPVH 3LKSB 3D39D 2CK0L 3LDBC 3RUGB 5GRUH 5EU7E 3C87A 1IUOA 1HXMA 3IF1A 4LVNB 3E1F1 4PJBF 3H1AA 3IGAB 3P9MA 1DINA 1H2ZA 4GWLA 5I15L 2NNAB 4J03A 4V2CB 1AQLA 3QUYA 2D0HA 4N8VG 3KNBB 4NFDA 4WFGD 3K8KA 3BF8A 2EXWD 2XLBA 5SYNA 2V7HA 1NGZB 4M62H 3GMQA 1EH5A 5H3HA 3ARDD 1ERNA 4Z7UA 3T3PE 2V9ZA 3D2BA 4P9NA 5T1DL 1VZ2A 3KXFD 2WLYA 4P5TD 2AK1H 3HLAA 4PJIE 4J3UA 4L5FL 3SOBH 4DKFH 3ZWQA 4BZZA 5ALRA 3U2SA 2L4OA 3OKNB 1M1SA 4A6YA 5JW4R 5L6YH 2GJ6E 4MD5A 5AM1A 2DB8A 5EC1A 5F9WB 3SKMA 1OAXL 3DARA 1HQRB 1AR1C 2KL6A 5FPQA 3HSSA 3P3YA 5EO1A 4E11A 3WJLA 3KS0H 3SDXF 1RMFH 1U8PA 2Z35B 1U8LB 5I74C 1NLDH 2YD7A 5BV7H 3RU8L 5L2KA 3MV7E 4R7DB 1MFBL 4WEUD 4Y16A 3D6GA 2J8OA 3TO4A 3JTTA 2CGRH 4MWFA 1GC1H 3O4OB 5CD3A 1IGIL 4RISL 2QS9A 1IGTB 4YH6A 5D5ME 3QDGA 3QPQC 4GRMB 5BV7B 4JHAH 2EC9U 3SJVA 5AKKA 4N8DA 4NC0B 1MHPL 3ISWA 4ZXBD 4D9LH 4DKEH 4Z8FL 5A16B 2ATKA 4X6BA 4PS4L 4YHML 3RZCA 2DWEB 5SX4I 4NZRL 4N0YL 1AO7E 1YDPA 5GRZA 5MP6H 5E2WL 1EO7A 3TBSA 4NN7C 1ZHBA 5FUOL 1N6QH 1LP9B 3CIQA 3BP6A 3CD4A 1IFHL 1CFQB 1U8KA 2BSTB 2ZG3A 5L9DH 3P30H 4HFWB 1UQSA 1YYLH 5EZOL 1DBBL 3MRFB 2NX5D 1FAIH 2VR9A 3VD5A 5LBSL 5D7SH 2AEQL 1FNSH 2OMBA 3NGBB 3QBJA 5I1AB 1KSRA 2ACEA 1EX0A 2A6KB 1UENA 3D4LA 2Z8ZA 1BS9A 1EVQA 3MJ7A 3RY6C 4GQ9H 3N9GH 4RIRA 1G84A 4DMHA 4FTWA 1JHKL 3ABZA 4S0TD 2JJUA 3MX0A 4PV7A 4I0PB 1INEH 3H9ZA 4LAJH 3EYVA 4RMTA 4NBZB 4TNVK 1S9KC 3L3HA 3IVMA 3NGMA 4PJIA 4Y4KD 5ACZA 2V96A 3UYOD 2GJ6A 1YASA 2IAND 2PXYD 4FQQA 1Q0YL 2C1OB 1UB5B 3K46A 3N0PB 4MJ6B 3HMXA 2WBWB 1CR9L 2BOCB 4NQCE 3HI1B 3IJYA 1ZWIB 4MLIA 4OZGB 3D87B 5GHWL 3MRBA 3AU1A 1YAHA 1OLLA 1QA9B 3ZZ1A 3MV7A 1CQKA 4LASH 1XZ0A 3BPNB 3ILPB 3O2VH 5I16A 1Y18A 2GAZA 1FPTL 4AMKL 3MUJA 4KTDH 3CFJB 1NDGB 5BOPA 2DL9A 5D5MA 4F8QA 1KJ2L 4WTZA 1DN0A 2R0WL 1CIJA 3MV9E 3C5JA 4X83A 5IKCA 1WIOA 1XZIA 5SWQB 1FFAA 4D8PA 2F19H 4J3XA 1K5NB 5CMAA 4HH9A 4S2SB 5DTFB 4FHZA 3VJKA 3CCCA 4PLJC 1AO7A 3BDYH 2QMQA 1SVZA 2V6HA 4JFED 3M3DA 3EZ8A 3TA3C 2BP3A 3RNQA 2F74B 2NY6C 3DVGB 3O45A 1CICC 1UWGL 3IJHB 1DANT 5EOCJ 4BELD 5ALKA 1S3KL 4H88L 4ORGA 2AEPL 3HXKA 4ELMB 4FABL 3VGAB 5BZWB 2MCPH 5HHMD 1J8KA 3OZ9H 5F8QC 2UZIH 3O3UN 3U30C 2R1XA 3GJFK 3O8XD 3G5XA 1HYSD 4R0LB 2JJVA 1K2DA 5K5EA 1T6VN 5IGXL 1CUEA 4G1FA 1ND0A 5C07B 1C08A 3U36A 2VAJA 1UK9A 4Q9RL 5FO8B 1GCFA 3QIWC 2KH2B 4XT1C 4ONFH 4R97C 2WBJC 4XVCA 1DQTA 4RFNC 5CP7B 3LD8B 3YASA 5E6ID 2XMDA 3HI6H 4QHLA 4FRWA 4X4XB 5FP0A 4JFDD 3HC0B 2XKNB 1PKQB 5JW4M 1VLQA 4BZWA 4XPFH 5D7JB 3O6FB 3QDJE 5K3FA 5DRNA 4JFFB 1RUAH 5MEPA 3IBTA 4FXKA 3HZYB 1KXQE 5SX4H 3QIBB 4FFWA 2DYPA 3CK0L 3FQWB 5ESAB 2ZYRA 3T1FB 4LGPB 4WU7B 4WRLA 1C7SA 3AMKA 3BIWA 3IKCA 1F13A 3MGTB 2WV3A 2ZPKH 3LKRB 4G3YL 5F7NC 3TV3L 2YSSB 5HZGA 3C9NA 4LPYA 4NDMB 2AJXH 4W68A 3QFJA 2XA8L 4BVKA 1SMAA 1E28B 2ADIB 4X5WB 4AMYA 2XWTA 1MFCL 3E6HA 3P2MA 1T21B 1NCAL 2HFFA 3C09B 3UEZA 1AD9A 4IJ3B 4P3DA 1LEKA 1N6VA 1R4ZA 4G8DA 3A6CH 2E7CA 3WDJA 2Y1KA 1J8HB 1KIQB 4P5KA 5JALA 3B5EA 1ONQB 2PTVA 1AE6H 1CGUA 2YPLD 4L4VD 4C01A 3QQ4B 5ID1B 1KLUB 5C0ND 3STVA 1LNUB 5GGSB 4XXCC 1MLCA 4JG0H 3BUYB 4X9IA 1BM3H 4L9LC 5LZ2A 5GGTA 1S7XA 3KPOB 4HJ0C 3JWEA 4MYDA 4IRSB 3UJTL 3OMZA 3VA6A 2ZG1A 4F33A 1ZHLA 3IFPB 3R0MA 3BEVA 5EOCL 5EIAA 4QOKB 1W0WB 1F4YH 2KZWA 5KWJA 2VZOA 1KG0B 1SCIA 2Y2UA 4S0SD 3WN5A 4JVUA 4X3CA 2KQNA 3BN9D 3MROA 5EORH 2OSLA 2CR6A 4E41D 1TCRA 5IK3A 2P8LB 2AV1A 1IQWH 2JTDA 4PB9L 2XLCA 5I6XB 3C8HA 4OQTH 4S11A 3P4NA 3NIGF 1MNUL 3P11L 4RGMC 1FNGB 5FUCE 2VKWA 4QHNA 1FYTB 3V4UL 2I5YL 1LEIB 1G9ML 3EYUH 5DLML 5B3JF 3ORJA 1XLVA 3WK9A 1Z68A 3KPQB 1QR1A 4AT6A 3H04A 1C5BH 4NRZA 2JE8A 4N1CA 4BQ6A 1JMXA 1ZGLB 2OYPA 2R8BA 3D3VE 2P48B 2YEZA 3QDJA 4D0CB 3H9YA 2BOBA 4Z78A 3QMVA 2ZUQB 4NPYB 5DO2D 2EC9T 4Q9BA 3UTSD 3B8SA 4O5LH 1URLA 4L8CB 4JZOB 3SDDD 1MY5A 1UM6L 3WMSA 2PUJA 3TYGL 1PZUB 3ANSA 3G0CA 3U1SL 1PLGL 4I18A 2D9CA 3QUXB 5JDJA 1FFNB 3VXQB 1ZT7A 3PWUB 3K6KA 3G6JF 4J3TA 5HXMA 1S9VA 3DL7A 2YC1A 1NCNA 4PLNC 1ADQL 4R4ND 3ZL4L 3QIUD 4HWBH 4G7VL 4YBQD 1BFOA 4L4TE 3B8YA 4CRPA 1I3UA 1UK8A 2XKUA 3I3BA 3P0GB 3GK8H 4M03A 4P92A 5DJDB 5MERB 4Y1AB 3IDYC 4K8RD 1G7HB 1F5WA 1XRRA 1DQDH 2E7HA 5LGKA 4P4RA 5F9JA 2EH8L 4DAGH 2O5ZL 1NUFA 3FCTB 3NZ8A 4Q0XL 5EBWA 3HAEG 3HJUA 5LGJB 5H35A 3RPIB 3RVWC 1I7UB 3MA7A 3SE4C 5F6HJ 4R90H 5IMOA 1T2XA 3IS0X 5LGHL 4G8BA 4RWYL 2A77H 2XKSA 3PWPE 1BE0A 2APBA 2DWDA 5DSCA 3BKJH 3FQXB 4W9RA 2ZUYA 3GRWL 3QUYC 4XCCL 4F7EB 3M45A 4RRPA 3O4GA 3WV0A 3KPSE 4NO5B 4UIMA 2ADJB 2JF0A 2CBGA 4KAFA 1I1FA 1JNNH 4GKSA 4V1DE 4KJYB 5J6GA 1BCSA 1K6EA 3DNKA 4KRPC 4PGDB 3RIFF 3IXTA 2A83A 2DHCA 4KMTH 3MZGB 4ZXFA 4GRLD 4CU7A 3D3VA 4HUVB 4YO0B 3OKDB 1Z9OA 4M9OA 5ALBH 3SDAA 5DJ0A 3S4SB 5CBEB 5D1QC 2QT9A 2FO4A 1JNLL 2IPKB 4N0UB 3VXMB 1NFDF 3B2UC 1QO3B 5CJOH 2FBJL 2XTJE 3DI2B 4XVTH 3WJLC 1CDYA 3S35X 3QVMA 1PKOA 4UBKA 4HEPG 2HJFB 1LO5B 1BVLB 4QTIL 1B3JA 2IMMA 3SGDH 1VERA 1EK3A 4NZDA 1MAMH 1FG2A 1WWBX 4YASA 4UU9A 1HSAB 3TO4C 2C4HA 1REIA 4J8RA 3GBSA 2J6EH 4JEIA 2OLEA 4LEOA 1FORH 4JM2B 1AC5A 2RGSA 1UEMA 3LVEA 4BSWB 1FL3A 1UC6A 4FQLL 4O9HL 4L4TA 3DX7A 1R5IB 5IQ7H 3QWOA 1R0AL 5D8JH 1F4AA 4ZUWA 3U9PL 4P46A 2B4KA 2P4AB 1T4KB 1LDPH 4XVJL 5GRJL 4F7MA 4Z7WB 3WIBA 3O9WA 3G08A 2GITB 4H7EA 1OL0A 1CQWA 4OSEA 4YBHA 2HH0H 1HCFX 1F3DJ 1H15A 1KXTB 2A9ML 3CUPB 3PQYB 4YHNA 3IXAA 5HDBF 1DU4A 2B2XL 2DJSA 5F89A 3DRTA 4LKOA 2HLAA 3BH9B 1MIMH 4TUJB 1QNZH 4L29A 2X4NA 3KAAA 1KCUH 3AREC 4ETWA 1PDKA 5IVNA 3D0KA 2H2PD 1DLFH 2AQ3A 3WZLA 5EUKB 2ZG2A 3DYMA 1EAPB 4GMSL 1GL4B 4NFBA 3KPPA 5J1TC 4ISVB 4P2QB 1A47A 3WL5A 2V2TA 2WWMC 4PRHD 2ATPA 1MCQA 5IQ9B 2NR6C 1WT5A 4EHBA 1NGWA 1WCBB 4J3VA 2ESVD 4AXBA 5KS9A 4FN0A 1PYWA 3BT2H 2NY4D 2UY7A 3NACL 5DQDL 1CF8H 5A7HA 1NBVL 4Y2DC 2OPHA 4G9EA 2VXUH 2Y7QA 3RZWA 1QSED 3RNKA 4P23D 1P84J 5DD1H 4ZS7H 4RAVB 5ILTL 4WU5A 1OTUC 3VH8G 1L6ZA 2DDQL 4HXFB 2Y07H 3PUIA 1A1MA 3DV4A 4OB6A 4WW2A 2PF6A 4HGMA 4G6FB 3TJHD 4BKLA 3MMEA 4HF5H 2CLVA 3B2VH 3FAKA 4I3SL 3HG1E 2BGRA 4AJ0A 1HDMB 4X99A 1M05A 2IIVA 2UVFA 1UXOA 5DRZB 2VJAA 4MA3A 5FUMA 3PGFL 5EBMB 1YN7B 4YEFA 4JO1H 4GKNA 3RTQD 3QITA 4NQXB 4I8DA 5HYSA 3ED1A 5E70A 3OXSB 1I7TA 2NW2A 3G0DA 5TE7L 3QI9D 3N1MC 4Q6IC 1S9XA 4GHWA 2VXQH 2HL6A 3D9AH 4APQA 3MRRA 3CLFL 4Y2TA 1M7XA 4GAYB 4L3EE 4GLRI 1JZ7A 3TGXA 4OCSH 4X4ZA 2Q0XA 4QF1B 3Q6GH 1ORQA 4XMLL 4HS3A 4N8SA 1OAUH 5D1ZC 2OXEA 1UH3A 5C9KA 3WL9B 2DD8L 5CWSA 2PR4L 4JO4H 3UTQB 4UI2A 3QO1B 2ZSHA 2BXZA 4LVOC 5L88H 1F2XK 4OZIF 3WO3B 2UUDH 3FBWA 4BAGA 4NYLA 2WHRA 3TESA 2D7TL 2WUEA 2G9HB 4WO4C 1CV2A 2F58L 3OKLB 2XUOA 2BVYA 1E27B 2I03A 1BOYA 3OF6D 12E8H 3A67L 3LS5H 5CLWA 3CZFA 1WBYA 5IMLB 4HUXA 5HVGB 1S5HA 3EDEA 5I9IA 1QR4A 5HI3D 5HPMB 3O6KH 4JR9L 5JQ6H 1DTUA 3H8NA 2XQGA 5F88A 4P4KA 3QG7L 2EDHA 2Z0BA 3F7YB 3RY5A 5DK2B 1RIUL 2DQJL 3MRPB 3DXAB 3UC0H 4C56B 2V5RA 4Z5RB 5C2BH 7YASA 2BSRA 4OD0A 4IHOA 3LEVL 4FQXC 1VEMA 2PYED 8FABB 3UXFA 2QR5A 1EDEA 5LXGL 2VQTA 1XCTB 1YEHH 3CC5B 4NM8L 5F97E 1QFPA 3RIFK 1YNKH 2P24B 3HG1A 5TF0A 2JGJA 3VMNA 5I1IL 2X5XA 3G9UA 4EBBA 3HRPA 4ENED 3VFRA 5HK8A 4I13B 3RWFB 1AHWC 5AH0A 5GZOD 3I50H 4XCYB 1IKFL 4KK9C 5I71C 2AKRA 4ZREA 1OAZH 1FAKT 5CEZE 5CJXA 2J4WH 5JPNB 4I2XB 3BJ91 4UB0H 3T2QA 2NW3B 3O2DL 4HHAA 1U93B 5JZ7D 3PDGA 2YK1H 4L3EA 3WUWG 4ZV9A 1F6LL 1JF1B 1CFSA 5IFHL 2AJLI 1EZVY 5C08E 2WP3T 1QEWA 4ZUTA 5FYKD 3F7RA 1OP3H 3LV3B 5HHQB 1JRHL 4OBRA 4IMLA 1H23A 2ZJ6A 4HFUL 3WHXB 3BGFB 1J05B 3C60C 1NMCB 2B20A 3MPCA 3WXVL 1T4MA 4U2FA 3ELAT 4FWBA 4NM4H 4MQLA 1QSZA 5F7YC 1R3IH 3W9DA 1WF5A 4HKZA 3DGGA 5L2KD 4XGZA 5CKGA 1MQKH 5JNYA 3NWOA 4HIJB 4Y16D 1NAMH 3BKMH 1KTDB 1Q8MA 1JYNA 2EO1A 5LLSA 4X95A 1F4WL 5EZIL 1DQLH 3VFWA 4DVBB 5CEXB 3CXHK 2VMFA 3QDGD 4PJHA 5FGSA 5DFVC 4QHMB 1MCHA 2H6PB 4LHUG 3UTOA 3WWEA 1BLNA 4I48B 3ZLUA 4ZNEE 1AH1A 4YHKH 1NAMB 3OKYA 1F4XL 3S36H 2Q8AL 1EV2E 2CMRL 2HJKA 1MVFA 1FZOB 4IMKA 3HAEA 2RI6A 4LF3A 4F2MA 1C5CH 1G42A 4OJFL 4AEHH 3ZE0E 1L7QA 1CD8A 4PBXA 3X13A 2GEEA 3BX7C 4U2CA 2Y6SC 2VJBA 1FE8H 4IIQB 1ZLSH 4RAUA 5JW4N 4DCQA 2M2DA 2NY1D 4NJ9L 5LZ9A 4M7JL 3VE0B 2PL5A 1DEEA 3AGVA 4NJAL 1XRMA 4M93B 4N0RA 4XHJC 5E1AA 5H94B 3S96B 4ONGH 5HYJE 2BVPA 3Q5OA 1RFDL 2APFA 2CDGB 4KRMB 1XZMA 1FH5L 1YB7A 1UM5L 2VN4A 3LN5A 3HFML 3DRQB 4MGXA 5HVFB 3RP1A 2GJ6D 3GIVA 3H9SE 5C08A 4OCZA 3ALWA 4KTYA 4TUOB 5T1DH 3FSGA 2X4PB 3E4DA 1GOHA 1ZS8A 1OB1A 3P4OA 3Q5YA 4KGLA 4LBEA 4NT6B 3DBXA 5DGQA 4L5FH 5C6WH 4B82A 3DMMD 2MQCA 4DW2L 3ARVA 4JJHA 1AMNA 4P0DA 4WWKA 2NY0C 4MHHG 3NUZA 1OAXH 4M8QB 5JXEA 3FFCE 2MHAA 3MV7D 4Y5VB 4XNMB 2E6PA 3MLUL 3TLRA 4QRRA 1KB5L 2PW2B 1MIEL 1A22B 4RNRB 2OGTA 4ZNCD 4U1MB 5FV2A 1XRPA 5E5MB 4L9DA 1JCKA 1MFBH 4OT1L 3U9UA 4ZNEA 5HFNA 3LH2L 3HACA 3VXOA 2QADB 5BQ7B 1FV1B 3RIAF 1IGIH 3SDXE 3W9BA 4IO0A 1FFPA 1KV3A 4OV5A 3LDBB 2ICCA 4X90A 5DYOB 2PTTB 2WIMA 4DGVL 1AO7D 1T7ZA 2NTSP 2CQVA 3MRDA 2UWEF 3OXRB 5EZJA 4CL7A 1MHPH 4Z8FH 2EH7L 3VCLA 1TTUA 5DJZB 5EU4A 3NH7L 4F3FB 1O6GA 4DIUA 4YHMH 4WI5A 2VQ6A 1CG9A 5E2TL 1GPOL 4NZRH 3VD7A 2D4FA 3T4YB 1S8DA 2I26N 4N0YH 4J4PC 4DJMA 2WLSA 3L3KB 5I8CB 5EN2A 4LAQL 5FUOH 1SM3H 4YUEH 3WLBB 4KTEL 3RL1B 1I9RL 3IAGC 1IFHH 2YBRB 5K3CA 3SBWA 5K9QI 1QD0A 2X1QA 2X41A 1T89A 3GJFA 3QQ9D 4LSDA 1TCAA 1U8EA 1MHCA 4PJCB 5EZOH 1DBBH 3VXTB 1WWCA 2A6DA 1VE7A 3RVUC 1CT8B 5LBSH 5F7UA 5DJAA 1XGQA 2AEQH 1FSKC 3OWEA 3EJJX 1NCBH 4LFHG 3IDMB 3UDWA 2AJSL 2OTUB 3B9KC 5DMKB 3HUJB 3H9SA 1CLCA 2PCPA 1JPGA 1JHKH 4X8JA 3F97A 5IUSA 5T1MA 3DGCR 3UPRB 4P46C 5IBTL 1JFRA 3WJ1A 4ZUSA 5I74B 4NQCD 5FV4A 5DWUL 4FFWD 3ARSA 1YECL 3DTXB 1BF2A 5FO7A 2Z8WC 1KTRL 3ZHKA 3F67A 4FP8L 4PRNB 5AUMA 1Q0YH 1LP9F 1JGDA 5I66B 4BRZA 3FFCA 1Y6NR 1OCEA 1CR9H 3BKCL 4JCMA 2MKWA 1VB9A 1A21A 1DVFA 5D7KE 5GHWH 4XBGA 3D3NA 2YUZA 2A74B 1HKHA 2BMKA 4QEGA 1S7VA 5I1LB 5DQJB 3MV9D 3SN6N 4OLVL 1FPTH 3W82A 4AMKH 1FN4B 4BSVB 1AGBB 5F7LB 5C0IB 4HWNA 2CO7B 4TPKA 1KJ2H 4NN7B 1WT5C 2QSQA 5EH1A 4H1LG 3AC0A 1T2QL 4L72A 3BRFA 2R0WH 3QHZH 1VFBB 4HK0A 1VESA 2ZUXA 2XY1A 3BXNB 3U0PB 4QWMA 5HGGS 5IB1A 1OTSC 3K2UL 3MLWL 1WK0A 3V6ZB 1YQVL 1U3ZA 4JY4A 4RMWA 3MLVL 3G5YB 5HYEA 1KJ2B 3BL8A 3WL6A 3F12B 4QRQA 5ALDA 3AY4C 1ZVYA 4NCC1 4ZQKA 1ORSA 2OI9C 3U1TA 3BP7A 4BDSA 4Z77B 5JHDA 4HBCL 32C2B 4HQQL 1UWGH 1KC5L 2XQKA 1THTA 1S3KH 4H88H 4WCYL 2HFEB 5HGBB 3KJ4C 4FABH 4LLUA 5JPMB 3I02B 4J1UB 2CKMA 4MQXD 3SDYH 1IBGL 3NIFF 1HHIB 4HIIA 1MHHA 1YEGL 4S1DC 4BE4A 1HQ4B 1IGCL 3BIBX 3JUZA 1I1AA 5IGXH 2C26A 2V7NB 1LO2L 5EOQH 1IZ8A 4PJGF 4BCCA 5GS0D 2BVTA 5DJ6A 4APQC 3R3WA 4KKLD 2VITA 1ZXQA 3QDJD 4YAQB 4Q9RH 3HE7A 1CUVA 2H26A 2ZYIA 4U1LB 2CKBL 2Z3WA 3ZTJH 3RGHA 3SCMD 1N5AA 2F8XC 4PJ7E 3MV11 3QG6B 5C0EB 2XQJA 1T1WA 1H0DA 4HUUB 3OG9A 1TETL 2WG1A 2BNUB 3CLEL 1CGSL 4YXLL 3TYFB 5HY9A 1DBMH 3TH4T 3SGEI 2X76A 4H7IA 5C0CE 4MCZB 4FNGA 1WAAA 1HH9B 4QRPB 4PJEA 3WUWA 4J12A 2X7LA 4X6FA 3TV3H 4GW3A 5JAPA 5C09B 3ARFC 3PIQA 4JANB 4Z7VB 1BECA 4PTTB 3U0TA 1BJ8A 2GSIB 1N64L 4CU6A 4HXEB 2EDFA 2F54B 2XA8H 1Q1JL 4QT5A 2BHYA 1MFCH 2P7TB 2YA0A 3TA3B 2WWKO 2ZSWA 2NY6B 4MCYA 3G6AB 5E95B 5F96L 1K8DB 1CICB 4LLDB 4Q05A 1F42A 3DYOA 3MRNA 1F58L 4NQDE 3CDGB 5F1NB 1S7SA 3I9GL 2VDML 1AGDA 1OHQA 3VFSA 2VWEC 3SHSA 1JI2A 2PW1B 3NA4A 3RIAK 5E6YA 4U1KB 3U30B 3E3QE 1Y7IA 1BHGA 5D7LB 5ALSA 5AAMA 5FCUL 3UJTH 2JIXB 5JAOA 2A6IB 1NH6A 3S3SA 3M82A 4MD4B 5EOCH 3RDTA 5KWIA 3IETB 1ACYH 4MDJB 3I2JA 3E2HC 2E9WA 5D1XD 4JFPB 3QIWB 2VDLL 3RL2A 4R97B 2WBJB 2PYFA 4RFNB 2DBJA 5IB2B 1OPGL 3L3IB 4PB9H 1F90L 3EYSL 4DGYL 1RZIA 1P9MC 2EDNA 5GRYA 2FR4A 3TBTA 1MNUH 3P11H 1JU3A 1A2YA 2Z4QB 2GTZA 5EUOA 2HT4D 2N1KA 3V4UH 2XMCA 2I5YH 1G9MH 3D3VD 4FG6D 5EFIB 3IUQA 5E2JA 5A1AA 5AWNH 4KXZI 5EWIL 2AEWA 5GRXG 3SDAD 3NIGE 3QYCA 3OC0A 2DF3A 3QDMB 5KN5A 4OCYL 4ZUVB 2Q76B 5JIPA 4I4WB 4KJXA 2H7YA 4QCIA 4L3CB 3C8KA 3T8XA 4ZTPL 2X42A 1NBZA 3AFIA 5C0CA 3VRLF 3I2HA 3V0VA 1U91B 1S9WA 2DHDA 2FJ0A 1QRNE 1UM6H 4CMHC 1YAJA 1CGVA 3H7LA 5EU6E 3ARGC 3U1SH 2V5YA 5C3LD 1PLGH 4JQXA 5DMGC 1W4LA 2APTA 4KUCD 4LDOB 3PGDA 3O8XC 4NRYB 1HYSC 4M4RA 3R3XA 5JUEH 4AIZA 5F7DB 4POZD 4ZYKB 2GBFA 2EC8A 4HJGA 3WZMA 4L9LB 3E6FB 2MPAL 3V52L 3VVMA 1YPZE 3O9WD 1PQZB 4G7VH 1I8MA 1Q9KA 4JRXB 4X5XA 1O5DT 2BVQA 2JLLA 3FCYA 4UTAL 2D2OA 2XWJB 4X6DE 3C6BA 4XCNA 5CSZB 1KNOA 3DUSA 4MJ4A 4EI5A 5JR1H 4BA8A 2OR8A 3PI6A 3ZHLA 4JKPL 4B83A 3KXPA 1GZQB 3LOWA 3S6CA 1O6FA 1BZ9B 3IRZA 5J57B 3C8DA 2P8PA 3L7EA 3MQIA 2P8SA 4N5ED 1BD2B 4BAZA 2EH8H 3PWPD 4RGMB 5ESVB 3G9ZA 2O5ZH 4HPOL 3W39A 3UZQA 4IS6A 4M02A 4ODHL 5I8PA 1T6WA 4LDEB 1UWCA 1VA4A 3KPSD 3PICA 4G9GA 4LEXL 4KYVA 4OB5L 3V95A 4N1EA 4RWYH 4U1SB 4V1DD 4NNXB 1TJHL 4GUPB 4PY8J 1LPPA 3I6LE 4MNQE 3FQTA 3GRWH 4XCCH 1EK1A 3M8OH 2CD0A 1JJUA 4ZS6D 3IJSA 4Y2SA 4MNHA 3JTSB 4WY5A 5IVIA 1AQKL 4B0OA 3OKKA 1XZCA 3I6MA 2Z92B 4OFVA 2ZJSL 4Y5YC 4GLBA 4WDQA 3MRCA 2AP2A 4HDIB 4WHTA 4HLZG 1H3UA 3X12A 5JIKA 4HGWA 5IB3B 2WTNA 3G9XA 4X6XA 4U6TA 1X5YA 1WCQA 4PF1A 4WWKC 4YZFF 5JMOC 3MXWL 3Q6FB 3VFVB 2ZZUT 1JNLH 2DRUA 2EICA 1U2CA 4EI6B 1JWMB 1Z0MA 1R6VA 2D5LA 2FBJH 5FV1L 3VW3H 2R2EA 4V2IA 4XC3L 5EU6A 2Q7YA 1WVZA 3V7MA 4QTIH 1K8IB 1OVZA 1RK0A 4UIKL 5BVJA 2VR5A 4O08A 1A4JA 3KLAB 1OSZA 1KEML 4S1SL 1FJ1B 3FONA 3IDYB 2F15A 3IDAA 5JOFA 4GRWH 3AROA 1H8NA 4Q34A 2WM0A 4IRJA 5K9QG 4AENB 4O9HH 4QXTB 4W6YB 1R0AH 2BJHA 4R2GC 3PDDA 4FHBD 3IF1B 3U9PH 1N4XL 1IE5A 1I1YA 4RQQA 5GRJH 3T0EE 3W2TA 3S5LA 2FSEA 2XN9B 4P5MA 5HYQA 5DTIA 4G8CA 5BS0B 3VWKD 1BOGB 2VE6B 4PJDA 4Y19A 3QUYB 1C12B 3UO1L 4IQ4A 1L6XA 2B2XH 2HJLA 4H1LA 4HX1A 1ITCA 5LVEA 1TK3A 4KRPB 1GXEA 3KPRE 3V1KA 5DMIL 4N5UA 3X14A 4G7YL 1E4XI 2FEEI 4TVPE 1J06A 5ALEA 1W0VB 3U2SB 1CK0L 3FQUA 3IDJB 1GGIL 4GMSH 5B22A 4P4KD 2RFXB 4JM2F 4MD5B 4DEPC 5EA0L 5C71A 5I1KL 5T1KB 1EB8A 3SKMB 4XTRD 5D1QB 2AGJL 4OZ4A 2QR0A 5EO1B 3MRMA 4Y8DC 5CP3A 2IH3A 1OILA 3SK0A 3GHBH 1J0ZA 5DQDH 4K07A 1YUHB 1NBVH 3MJ8B 1PSKL 4X4YA 5C8ZA 3R1GH 3O4LB 1IAIL 5D2LE 4OKVA 4C87A 4LCCA 3TO4B 3X3FL 1V8HA 3HG1D 4MWFB 1JZ2A 3RWDB 3GSNL 2Z5GA 5JW5A 4PGBB 1G7QA 3W81A 4OAWB 5JW4Q 2MOVA 5ALPA 1JGVL 1XGTB 1DE4B 3MJ9L 5H2BB 3HN3A 3SJVB 4XWGL 3CSPA 2V2WA 5LAXA 1OF2A 4I3SH 4XX1A 4ZO6A 4PR5B 2QUBA 2ATKB 3UYRL 1JZ8A 3QM1A 3HCVB 5F1IA 1UGNA 5ISZB 4MA8L 4L3ED 3PGFH 2G5RA 1IQDA 4FS0A 4D3CL 4L9AA 4EXKA 2ROQA 2X09A 1NCDL 4P2RE 1XZHA 3EFFA 2W0LA 4NKQB 4W70A 5TE7H 2GTWB 3CLFH 2H9YA 1PY4A 4EQ3A 4FFVA 4GRLC 2ZKHL 1UQSB 3AREB 1OGTB 2EDCA 1KPRB 5I1DA 2ZOLA 3PDOA 5IB4A 1J86A 1FL5B 2X4SA 1W0YT 2DD8H 2PR4H 5IG7B 1UACL 4OYLA 4YDLC 5LZ5A 4PJFE 1F3DH 4ZO9A 4KE7A 1KF9B 4K8RL 5TDOB 2W60B 4RIRB 3F7VA 5EBLB 2Y9RT 4EXPX 1B0WA 3SE3C 2D7TH 2MQ3A 1AXTL 1B6UA 4U2ZA 1JPTL 3EYVB 3KPRA 5HYIA 2V97A 4HS6A 1E4WL 2F58H 4FKBA 3O95A 5A3ID 5ENWA 4Y2DB 1H3WM 1U8QA 3A67H 3PGCB 3VFOA 3ESBA 4NVRA 4JG1L 4P2OC 4TUKL 3U4EB 5CEYA 5SWSB 2D7MA 1JUFB 4Z7QE 2NYYD 3PWLA 2YN5A 3B9DA 4OIBA 3F58L 5ESRA 1OOAA 3QG7H 3P0YL 4K7PY 3HE7C 2B39A 3AU1B 4MAYC 4KV5F 4TSAL 1RIUH 2DQJH 5KANG 1JNHA 5D2LA 1FLTX 4Z7OE 5I16B 4DKAA 1EHAA 3VFPA 1Y18B 5C6TL 3LEVH 3P4LA 3TZVA 3KJ6L 2R2HB 2HG5B 4UHHA 2B4CC 5FHBL 5LXGH 4NM8H 1ZT1A 3PL6A 3QRFM 5ALHA 5IJVA 4Q6IB 5CEZD 2HFKA 5I1IH 1HHHA 1S7QA 4JREC 4ETYA 2NXZD 1OP9A 5CMAB 3ZDZF 43C9A 3PNWA 4DN3L 1XQVA 2O7RA 3O4HA 5IVOA 2Y1VA 4M0FA 4OIAA 4UT7L 5D1ZB 1UZ6E 3C2AH 3FSGD 1MQ8A 3ZKND 1QLEL 4HG4K 1J88A 4LVOB 3O2DH 1W8NA 2XG5A 4RGYA 2NY4C 3D85A 3O45B 1R3DA 1EUUA 3KGRA 4PJXF 4DK3A 5IFHH 2D7OA 1EFXB 1A6VL 1XCQB 4JZJC 2J88L 4KY1L 4WO4B 5LKAA 3GO1L 1JPFA 2RAMA 1RZKC 2GK0A 1B4JL 5JXED 1JRHH 4ZDHA 4HFUH 5HGAA 1XRNA 2LFGA 5DMYA 4PJFA 3WXVH 3GFUA 4TTDD 1K2DB