3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
4PD4K 3VWJB 5DLML 4TNWK 2Y06L 1KULA 1BN6A 1JYWA 4LSVH 1HOCA 5F7EL 5FF6B 4KKNA 5FGCE 3TZVC 1GT6A 4L72A 4YDKH 1QQDA 3GKZA 5HDLA 1SM3H 3U46A 3P2MA 1DQMH 1RURH 3P4NB 4XNYL 5KS9E 2HA1A 4EN3D 2FDBP 1ACLA 2QS9A 4MJ5B 3OF6A 3VRLF 2EYRA 3GUTA 3RJDA 4C59B 4D8PA 4RGOL 4QRRE 4DEPB 4CVUA 5F1NB 2BVQA 2I9LA 3D3VD 1EK3A 3MRKA 3FYUC 4H5SA 3QIWD 3WFHA 3LKNA 4QHMB 1TZHB 4AMYA 1Q72H 3F12B 3L95B 1DL7H 4PJIE 4XMPL 3S88L 1QONA 1U3ZA 1L7RA 1CUCA 3EFFB 3ZE2E 3QCUH 2HRRA 4KK5D 3O2VL 3G04A 2X4SB 3EAKA 1EO8H 4FQHB 3D48R 1QLRB 4FQXA 2DQDL 5BXFA 2Z93B 2I24N 2VT7A 1NCNA 1G7QB 3U7WL 3MNWB 3V2AR 2IPKA 2EDOA 3ARXA 1A6VH 4N8VG 3OGOE 3IUJA 3FAWA 2ESVB 2FIKB 4QHLB 3GUUA 5BS0D 1XIWA 3H0TB 3NAAL 5T3ZE 2ADGA 5DC9B 4YIQA 4YQXL 4NRYB 5KTEH 1U0QA 2EDDA 2EIEA 4XVSH 1NJ9B 5IUSA 3NGMA 1GGIH 2ROQA 1CF8L 1NSNH 5DR5L 4DN3L 1A7PL 1RY7B 5LQBH 2NPLX 1DEDA 5IGXH 5DURD 4OZGA 3GSWB 5LGKA 1BVLB 2D7QA 2MCPL 2O61A 1CT8A 3KWFA 2LVEA 3D7RA 3W82A 4PJ5D 4GRLB 4X4YB 3I2FA 4NQED 1AR2A 2AV1A 3BDXA 4D9LH 4MNHB 1OD9A 2EYTA 4RRPG 3TT3H 1TETL 2ICES 1T5XB 1EEZB 3ME0A 1HI6B 2ERJB 3EYFA 4KR0A 1HQRB 4H0IA 4K3EL 4AG4H 2G5BB 5C1MB 1CUIA 4H7EA 4FXKB 3UMJA 5H2BB 2UWEB 4U6TA 2XA8L 4P4RB 4Y19B 1HHHB 4GQ9L 5CZXC 4MDIA 4MD5B 1NCDH 3JWDL 1YB6A 4MXWH 2R0LL 4C56A 1MIML 2DI8A 2EH8H 3WO3B 4OM0L 2PPLA 3VFPB 5ENWA 5EU6B 3OAYK 3RY5A 5F21B 5EBMB 5GRYA 1JMZA 4LRNL 3BKMH 1T4MA 3WL7A 4P23D 5DZLA 4P23C 3OPMA 4OU4A 5DVMA 1MNUH 3G04B 2BUCA 2LFGA 3NABL 1J0HA 1PX4A 5K3CA 2OZ4H 4FFZL 1TQBC 4QNPF 5IQ9B 4QWWD 5F89A 3P0VL 5DNWA 4KJPD 2WINB 1QKZH 2YKLL 4LK4A 1CV2A 4PJAA 4J12A 2BY2A 4GMSL 5I8OL 1JGLH 5K9OB 5BZDB 4ORGA 4FMFA 3OOSA 1BFOB 1QHOA 4FQJL 5DJYA 4LIQH 3VFOB 4IEFB 4N0CC 4DGVL 5FXCH 1QBBA 4IHOA 2FLBT 4WNQB 3SKNB 3GSUA 5DRZA 1QIEA 4HGKC 5SX5K 1LQSR 5FUZH 3SE8L 3ZTNH 5JR1L 4CN4A 3QIUC 2ZG3A 3I2KA 2BFVH 3IAGC 1X9QA 2J6EL 4NJAL 3HN3A 4XI5D 4HZLB 5EC2B 1P84K 5IKCA 3T2QA 3V4VL 3MRRA 5EUKA 1OTUC 5FYKU 3H19A 3MYZA 4WEUD 4RNCA 1TTFA 4XH2A 1XRNA 2YRPA 5C9JB 2ZCLL 3DQZA 4MQXC 5I74B 4X4YA 3EBLA 4TULH 1OAKL 2Q8BL 3QHZH 3EIOA 4ZUSB 2NCMA 4AIZB 3UYRH 1OF2B 3NPSB 3M17B 5IIEB 5CH3A 5EIAA 3LN5B 5CCKH 1DVFB 5KSAC 3WMSA 2A0LC 5ALXA 1NGPH 2H7YA 4P3DB 2DQUH 5K3BA 4MD0B 4V2BA 3QEHA 1F4HA 2I3DA 4JFHE 4L9AA 4Y2YA 1U58A 5BO1L 3EDFA 2XI9A 5BWCA 4OGYL 3MZGB 4RIRA 1RIUL 1BWWA 4YPVA 1WT5A 1LEIA 1YY8B 5DUBA 5M7QA 3FQWA 4NRYA 1P7HL 5F3BB 3CDCA 3O45B 1CG9A 3HPJA 5JQ6H 3REVB 1BRTA 5JADA 4RFOL 3TA3D 2LU7A 3MYJA 5FGBC 1NFIA 1FH5H 3BKYL 2YPKB 1H5BC 4N9OB 5GGRY 5ITFB 3MRNB 1RK1A 5C81A 5D2NC 1SMOA 1FBIH 1BREA 1GZQB 3BP6B 4WFGD 2QR0B 3VJMA 4HXFB 4GRWE 1A21A 1KCRL 4EOWH 4PJAB 5F1IA 4GRLA 1JGVH 3SGJA 3FSGD 1JUFB 2D31B 3U0WH 2FYYB 1PG7L 2XTJC 3MLUL 4JZOB 3JXAA 1BD2E 2CR3A 5FK9B 5CRIA 4JFDB 5IEKB 3EYUL 4P2OC 5L8JB 2HFGL 1QR1B 5F44A 5D1QB 3IXTA 4HZLA 3EYQC 1T66C 1Z0MA 4J3OC 5DK0A 2I26N 1FG9C 2R56L 1UH2A 1CUFA 3H1AA 5CW2A 5GHWL 2R2BB 4B0MM 1JE6A 2J4WH 3O0RH 3WHXA 1CLYH 4LPWA 4TRPH 4U3HA 1QFUH 2ZP0T 1UWGH 5JIPA 2UUDK 1J1XH 5HYQA 1L4IA 4C83A 3PWPD 3DMMB 5HHOA 4X00A 1XZGA 4PG2A 4EY5A 2FJPA 1RZ7L 3LZFL 5IVXF 4OF3A 3D3VE 4RPCA 5I8CB 4F5ZA 1FGVL 5CMLA 1S7UB 4X5LA 2AJ3B 5KS9A 3ULVL 4G7VH 5DQDH 3H2GA 1BGXH 2YBRB 5D7IE 2R69L 3QEHB 5BCAA 1U2EA 2H32A 2DLFH 5CFHA 5FM5M 4S1QH 4NUGL 4X7SL 4Y8AA 4ODXA 1JI1A 4X6BA 1E6JL 3S36L 2EE3A 3I02B 1FAIH 1AC5A 3LIPA 1UWXH 4CMHB 2ZUYA 2Y07L 2Q20A 1CG9B 3IU3A 3WWOA 1NFIB 7FABL 3MOAL 2LU4A 1QIGA 2HA3A 5MP6L 1V7MH 1AO7B 1MCJA 1RK1B 2BCKB 2CDFA 2WIFA 1HHJB 3V95A 5BV7H 2IAMD 3DX8A 3FT3B 4G8BA 3VD9A 1A7QL 2VWEC 1W4LA 4GBXD 4ETQB 4UMGA 3B5EA 5DVLA 2ZCKH 4DNFA 4ZRDA 4XMKL 1JPST 4Y4KD 2ZUVA 1J8HA 5ELIA 4NM4L 3MLTA 1TKRA 1WBZA 2LV4A 1CXLA 1IAII 4IOIB 3AMLA 5DNVA 1W52X 1X4XA 5FK9A 4WHTA 4IMKC 1PQZA 3HC4L 3UDWC 5IEKA 1KJ2H 4XP4L 2AK4A 1Q9WB 4EDXA 3TP4A 4NYLB 4IJ3B 3VXMD 2IITA 3B6SA 1DVFA 5LAXB 5HHNA 4GXVH 1FYTB 4WI6A 4W4NA 3TZVD 3WHXB 4JFQB 2NY0C 1PKQE 5ALLA 3RL1A 3RX5A 4M5YL 4N0FA 1JNLH 1DVFD 4PJDE 1A6ZB 5FV1L 3Q5OA 5ICZB 4O51B 2WHPB 3VG9C 1I3VA 5I74C 3DMMA 3PQYE 1YY8A 4XZUB 5B3JE 2DWDA 4OAWB 1P2CB 2V98A 2X1PA 1H2ZA 2PSEA 2BOCB 1FV1A 3O45A 4I3RL 2QSVA 4OLZL 4ISVA 4XPTH 3FYUA 1UOQA 4PV7A 1Q9LA 3BIAX 1MEXL 5GIRB 1OP5H 3BRDA 4KKCC 3UYOD 4IOSD 4AENB 2RAUA 2F58L 3BX7C 2VL4A 4MGXA 4YDVB 2ZCHH 4CFSA 1N6VA 2BNRB 4KK8C 5JPMB 3MLYL 3E2HC 4UIKH 4IH1A 4P9HH 4J03A 1CR9H 1KJ2B 4OLWH 2P1YA 2IAMC 2YRLA 3O9VA 4GW4B 3WKDA 1EVTC 3PP3H 1JGUH 5J6HB 3KPPA 2P7TA 3BGFB 4PJIB 5I1HH 2XIDA 1TZIB 4TRPL 1LE9A 3EYQD 3MXWL 2PX6A 2BCKA 1KIRB 2VDQH 1K8IA 4R2GC 1J05A 5CSZB 3MV9A 1VGKA 4NO5B 3KJ6H 2NW3A 2ZUUA 3L3OB 4PJDA 4FFWD 1JV5A 1KSRA 1FFNA 4EY4A 1IMJA 5GGTA 2EECA 4UHBA 4PJ9D 3BIWA 2V7NB 4LSTH 4G6FB 5I17A 1IFHH 1OGTA 5ESAB 4XCYA 1IGJA 5H8DA 5D2LA 1JTOA 2PTTA 3V0WH 1JYXA 5DRXB 3VISA 1BZQK 3GMNA 3L3HA 4CAGA 5EFIA 4I4WA 3ZT6A 3H42L 4PJEE 4CG1A 3AY4C 2W91A 1G0DA 4OB5L 5LAXA 3TNMB 1FVDB 2XMBA 2DOCA 4CJ1A 4KTEH 1GYAA 3VE0A 3VXPA 2H32B 4P2YA 5ESQB 2NNAB 1FFPB 2H8PB 4G42B 4NDMA 2XOTA 1YEFH 4ODXB 2QVBA 3OKDA 4NCC1 2VDPL 4FQ2H 5E4TA 3OB0K 4FABH 4HIHB 3HMWL 3FYUB 4B7ZA 3K7UA 3TFKC 2DM3A 4NT6A 4Y7DA 1RU9L 4G8EB 4ODWB 1RMFH 4LEOB 2HWZL 3QUML 4MVBD 5I1DA 2YD5A 4KUCF 4TULL 5FO9B 5BZWB 2EDKA 5ICXB 4BZ1L 4HIEB 4X7BA 4H1LA 2A6JA 1ORQB 3H9HB 2XMSA 5CHNB 4Y2JA 4M7LT 2BNRA 1UK9A 3BPOC 3ALPA 3KXFE 4D9QD 3C60C 2GK0A 3NH7H 2PU7A 1SQ2N 1G7MA 4GJTB 5IM7B 1AR1D 1YPZA 3BAEL 4MXQD 4ZAKD 4ENEC 1H15A 4J0KA 3BXNB 1H9VA 1QA9B 4JAMA 4LSSH 4NPYA 1Q9WA 3MUNA 4H7HA 1TZIA 1U8KA 1F4AA 1XCTA 4UBJA 4NYLA 5KJRL 2PO6C 2BNUB 1LO2L 4XI5C 2CK0L 1GAFH 1ZGLM 2XUHA 1D6VL 3CCHA 5EN2B 3HFML 2XWBB 3MRJB 5FV2A 3BJLA 3GNMH 3RIFK 2CK2A 2Z31A 2UZIL 1I9RL 1YEHL 2XWTA 1I3GH 3EO0A 2F8VA 4QT5B 4FTVD 3T4AA 5AO9A 1WB4A 2F74B 3I9GH 3O3DB 2VLRB 1WPRA 3TRDA 1QYGH 2HTKC 3E2HB 5DEFB 1CQZA 2XQYG 3QH3B 5D96B 5HYSA 4I48A 1IRAY 1FV1B 2OK0L 3EDJA 1I1FB 4KJYB 3BQUA 1U93A 5FYLH 3C6ZA 1CQYA 5BV7A 1Q9LB 3R0NA 3QEUA 2P8MB 1N8ZA 2J88L 1AHWA 4QRUB 4E0RA 2XNAA 2B4CL 3I6LE 3WBDA 2BXZA 4FDMA 1SEBA 3T1FA 3HZYA 4C57C 1AJ7H 3FQUA 4H20H 1BS9A 3G7NA 1CGSL 3VXUD 1TENA 1QFSA 3QEGH 5JZ7C 4CBPA 3SGEH 3WN5C 5T4EA 5TDPA 1S3KL 1KJ2A 2ITCB 4N5EC 3FZUC 2BGRA 3N06B 4ROTA 1XF2B 1Q0XL 4GW4A 4HJ0C 2CUTA 1MFBH 5I18H 1WAAE 5LQBL 1KCVH 3RTQD 2X4PB 3RQ3A 1DANT 1FYTE 1FCCA 1LK2B 1SEQL 2ICWB 1DBKL 2X9WA 3IKKA 4AEFA 3GMRB 1DQLH 3E3QE 5DWUL 3DKKA 5EOQL 3DMMC 5F6HI 5YASA 4OM1L 5HHPB 3AMKA 4G80A 1CGUA 3PABA 3SJVE 4Q0XL 2AJ8A 1FFNB 4LXIA 1KN2L 3MBEB 5D2NA 2V2XB 2CPCA 5AKJA 3EOYG 2M26A 3PNWA 2V9QA 4LRNH 3VD3A 5I17B 2ESVD 2WAHA 4FQ1L 3HRZA 3HB3D 2Y6SD 1ZLVH 1IJ9A 4OZFA 1A1MA 3MRQA 5E8PA 4PGDB 5IB2B 5L9DH 1HQ4A 4WI8A 5AKGA 4FFZH 3TBSB 2NR6C 4P5MA 5T3ZL 4H77A 4LCIH 5E70A 2AV7B 3NA9L 4ZUTB 1OHQA 2GYSA 3NCFB 3O4LE 3MQIA 4FQCH 3AB0C 3EO0B 3V8CA 4LIQL 4FQJH 1CLZL 5ESQA 2R56H 1FFPA 2H8PA 2EDBA 1KJVB 4NWUH 4KDTC 4NDMB 2RI6A 5TPWH 4J8RA 3H04A 3F8UB 2FHFA 4BFGA 1FFRA 4Z7WE 3QPAA 1KCUH 4HKJB 4RGMC 4QNPE 3KPOA 2OCKA 4HKZB 4XMLL 5CP3H 4LCYB 2WQ8A 3OJDA 5AM3A 1K8DA 4HF5L 3CUPB 3ILSA 5F8RC 2P8MA 4JNCA 4XP1L 4UBMA 1MAHA 3SE9H 3SC2A 3VXMB 4CDHA 1F8TL 3CU1A 1QEWB 2HT2C 1AP2B 3P77B 5CHNA 2O5YH 2IF7A 4K3DL 2FJ0A 4G6KH 3S5LG 3OKEB 4XPBH 3VWKD 4OZFH 1U8LA 1AI1L 3QQ3A 3FQNA 5BRZA 5F7MC 4MEAA 2FX8H 4TUJB 4DKEL 5HPMA 4X92A 5GPRA 4OFKA 4M5ZL 4Z8FH 4NIKB 1F8UA 3CCHB 4YZFE 5EN2A 4UBIA 4FRWA 3HACA 5FCUH 3TBTA 1Y6MR 3IDYB 3MJ9H 1DFBL 1YY9D 4W6WB 4ZSOE 4WU7A 2XWTB 3SDXF 2GJJA 1JVKA 5MEOA 5DJ8A 4CN6A 1FZMA 4C56D 1V3LA 5I9IA 4P4KC 3MO1B 5EU5B 1EXUB 3BEVA 3PWVB 3OKLA 5JAUA 3BUTA 5E8OB 1MELA 4XRCA 3G6AB 1U3HB 2F53E 3D25A 4MZ2A 4XMPH 5JO5B 1HQ4B 3C5JA 2DHDA 2Z3WA 4M7LH 4PJBE 1XQXA 2DLTA 3DCNA 3MXVH 3QEUB 4LVNB 1BVKB 1S9KC 1AHWB 1GVIA 1RK0B 1IGIL 2C3GA 3LKQA 1C5CL 5E94A 1L7TL 4EDWL 1HH6A 4QEGA 1I9IH 1OL0A 2EDRA 1U8IA 3IS1X 2Z5GA 1XGPA 4TTDD 4NZJA 1XH3A 3E6HB 1BWMA 4JRXE 4OCXL 5D93C 4KEAA 3EJZC 3KXFA 4JREB 3DWTA 1I7ZB 2O5XL 2QUBA 1NLBH 4Z7UE 3MGTA 5DUML 5EIVA 2GBGA 1PVHA 5C0CE 2P5WE 4BKLA 2EEDA 3TNNA 3O3AB 2ICWA 3QCTH 1KBGL 4DN3H 7YASA 3B2UC 3PE9A 2Q8AL 3RY6C 4M8QA 4YLQT 1UXWA 1WBYA 3OR6A 1I4FB 2H2PC 2MQ0A 5JXAL 3U30C 2Q87A 1J1PH 3F5WA 3IDXH 1K4CA 5JHDE 3DJYA 4NN5C 4P49A 1UZ6E 3BKML 5ISZD 2IANE 3RBGA 1WFOA 1IUNA 1U8HB 4DUXA 5KWIA 1C16B 4IRJC 4NKMA 2PXYC 4KI5C 3WNPA 1G66A 4PRAA 2XMRA 1G7JA 2VDMH 2Q7NA 2ZKHL 4Q6IC 3IIIA 3WKMH 3E0XA 3ROOB 1ACYL 1RZIB 3VGEA 1V7NH 1XF4A 2XZCL 3PFBA 4QXTA 1YYMH 2ARJB 4GOSA 3QUMH 1WSST 2HWZH 3A0OA 3AC0A 5DJ8B 1FZMB 4XXCA 4K7FB 4J8RB 2EDQA 5CLTA 3WDJA 1T83C 5ESVA 5F9DC 4XRCB 2PYED 1M6OB 1BFSA 3I28A 3TGLA 5I1JL 1I9JL 3SCMD 5EIIB 5JW5A 1U36A 2CKBB 3EGSB 4LKXA 3KLHD 2XKUA 5TPWL 2VDOH 1D9KC 4I2XB 4LU5H 4X99A 2DD8H 1SYSB 3RKPA 5L7XL 3ZI7A 4JZJB 3SE4A 3NIGF 5T1KD 4M9PA 1EX0A 3WIHH 2HN7A 5E7BA 1M7IB 3KXFB 5T1MB 4X6FA 3TVMD 1BE0A 3HLAA 4PJEF 1ZLUH 5FA3B 1LO4L 1ZHKA 1EJ6A 4BZ1H 5FOQA 5HVHB 3GMMB 1E6OH 1TXKA 2PCPB 3OKKA 5FHBH 3C5SA 3O3AA 1MVFA 1RUQL 3DX7B 4BH7B 4ZUVA 4S2SA 4WU7B 1MAML 4BK4A 4LCWA 3C5ZA 3FT4A 1RZJH 2QHRH 4P3WA 1WIOA 5AM1A 2P5EE 4WFED 2DMKA 5MEOB 5A16A 5E08H 2Z3ZA 1X5AA 4LHUG 5I9QB 2AJSL 4LLMA 2IQAB 1P7QB 5FECB 3PHOB 3IVKA 2CGRH 4X6CB 2IPUK 4B9EA 1MLCB 2DI9A 5D3KA 4NFDA 5AWNH 1F3JB 3G0IA 2C4XA 1XQWA 4WDRA 5DC4B 1QNZL 4U1NB 1VZ3A 3CFBA 1EHAA 5HHQA 4KE8A 4HCRA 2GJ6D 5E94B 1WISA 3WEXB 3W2TA 4N68A 5DI8A 4Y2RA 3OKNB 4E46A 3M3DA 3FB6A 4M1DL 8CGTA 4YHYC 1FLTX 5L2KA 5E08L 5CJBA 1DQML 1CE6A 1RURL 1U8QB 4XGZB 5JLZB 5FYLL 5HK9A 4OF0A 4NKQB 3MGTB 4WCYH 1YAJA 1MHCA 1WFNA 3EGSA 3RWIA 3QEQA 1TVBB 4BKLB 4UT7L 4MA7L 4ZO7A 5FM5O 5GSRB 3CH1A 1DBAH 2EXWD 3Q5TA 4D0DB 3FOBA 4Z95H 4J0IA 5JHDD 3H9ZA 2C26A 3MR9B 2RFXA 3WLBA 4RISH 1QTYT 4K7PY 1NCWL 4O2EB 3SBWC 3ILPB 5HGGS 1FNLA 2EEPA 2MCG1 2AS5M 5DMGD 1AFVH 4HAGA 3I50H 2OZ4A 3KXPA 2AK4D 3CNKA 2RHWA 3D3NA 3PXJA 3HLAB 5DJXB 3GUTB 4EB0A 2DKUA 5HI5D 3CFEA 4NCDA 1EA5A 2WQRA 2R0WH 4Z7VE 3AIOA 4FOMA 3CVIH 1G6VK 4PR5B 3IJSA 1HHGB 3AUKA 3STZA 5EHZA 3IDIA 3MRPA 5I1JH 1QO3B 4RISL 3ZMRA 4D9JA 4S2SB 4PIRF 3EFFA 3PHQA 1QIMA 1P7KB 3N1MC 5JXED 1JZ5A 1HKFA 3THML 2ADJA 3BD5A 4X94A 4FQHA 4UQ3B 4LLMB 3RZCC 1RU9H 2WBKA 1EB8A 3BSZL 5ADOH 4DGVH 3G9VA 1Z0NA 2WUCL 3MLVL 1MLCA 1CUAA 3G5ZA 4NM8L 1G42A 3PDOA 4Q58C 4IRSB 3HRPA 1NANI 4CU6A 5K33A 2C5DC 3C6LA 1NDMB 4PS4L 1N0XL 1KTRL 4GMTL 2D0DA 4U2BA 2XFXA 4PB9L 3B4NA 5DEZA 1W72L 3VXSB 1CU4L 1M7IA 2OLDA 2WTMA 1KPUA 5J1SC 1MJ8H 2ZSHA 4HULB 1NGQH 1UB5A 3MLRL 1A3RL 4WFFD 4HH9A 4Y16B 4CCYA 1IILE 4JDZB 1CK0L 3BKJH 4O00A 5F9JA 4H26A 2GBIA 3LN4A 5EBLA 4YNYB 3HYSA 3X13B 1T04A 5DJ2A 2HVKA 4D0DA 3KLDA 3TO4C 5DF0A 4G7YH 4PD4J 3PI6A 4MNHA 1V3JA 3R4DA 3C09B 2RFXB 1T6WA 3ORJA 3G9UA 1OLZA 4GXNA 4O2EA 2NZ9D 2UWEE 2JGFA 3IA2A 3FT4B 3G6DH 3QQ9C 3D3VA 1FNGA 4MJID 4U05A 1VESA 1N8SA 1UH3A 3TBYB 4F0JA 3TT1H 3TJHC 4XPHH 3OF6D 5E9DA 4HBCH 1AI1H 5EA0H 1INQA 5I75B 4HLJA 2CUHA 3QXWA 3UJTH 4L5FL 2NR6D 5HJ3B 5CEZL 5D7BA 4MD5A 4Y2DC 3TCXA 3E8UH 3D2CA 4GBGA 1FBIL 2DHEA 3OB0H 5DUMH 3DKRA 3TVMB 1DTUA 1F13A 4Z6AT 5EO1A 1RZFH 4KI1A 4GAYA 5ITBH 5KAQG 4XC1H 1NAKH 1MH5A 4LLWB 3FONA 3K3QA 3CIQA 1G6RB 4EI5C 3H3BC 2C7UA 3DX9A 4LRIA 5JORA 5JAOA 1IVYA 4BZWA 1H3WM 1GGUA 2AKRA 2PSJA 4JO3L 4HDIA 2WMPA 5CD3B 4WIQA 1EX9A 3O6LH 4XPFH 1A6WL 3ED1A 4MCZA 2JF0A 1JNHA 5CEZE 1C7SA 2J1KA 2DQGH 3PDOB 4XP6L 2XY2A 3NMEA 2B8OT 1J1PL 3CFDA 4CN1A 4QCIB 5CJOL 3DURA 2OGZA 3DHJA 4D3CL 1CDGA 3FBWA 4Q6IA 4P08A 5AM5A 1HEZA 1ZVSA 2NTFA 4P57A 4RDQF 1ZJ5A 4OFYA 2Y36H 1A7UA 1KPUB 1B2WL 1H23A 3O0RL 1G9MC 3QRFM 3QHFH 5FDYA 5GZNC 3H2JA 4ZV9A 4ZUUA 4KKLD 2W0FA 3PDGA 4OQTA 1SCIA 2GTWA 4H1LG 5FYKE 1W0VA 1HL7A 1NCCL 4WEBH 3WHE1 1RUPL 4ZFGL 5ALDA 3SDCB 4EBBA 3X13A 2G5RA 2OP4H 2ZJSL 3G6JE 3D39A 2Y72A 4HMEA 5D5ME 4KI5F 1FP5A 4O5LL 3WFCL 5CT4A 4F2MB 1D7FA 5LBSH 4RE6A 2CQVA 5TH2A 3VXUB 3WCYA 3M17A 4JPKL 15C8L 5IIEA 2AEWA 4NZRL 1MCSA 1ZT1A 3TBYA 3VGBA 2XKNA 1NQBA 3BGFC 3KPSB 5EBGA 3TBWB 4XP1H 5E95B 3MX0A 3SE9L 1U58B 5GISL 3RP1A 1Y6KR 3PL6B 1T89A 4IRSA 1AQLA 2BMKB 1UM5H 4TPRH 3UJJH 3T0EA 4K3DH 3HA0A 1HSBA 3BE8A 5CT9A 3OV6A 1GQSA 3LB6D 3ARED 4TUOB 4M7JH 5GRWA 1JHTA 5CBAA 1UH4A 1UVQA 4IRSD 4MLIA 4PJXA 1N5YH 1GGBL 1D5ZA 2X7LB 2I60H 3VXSA 3TEUA 4JANA 1EHYA 5C08E 1HE7A 4ETYA 3TM6A 3TN0B 3ZYZA 5HVHC 1MVUB 2WG0A 3ARDD 2EE6A 35C8H 1GZQA 4HS8H 1JF6A 3RWCB 5ID1A 4OBRA 1A8JH 1SJEB 1T3FB 5F9OL 3UTZA 3VKFA 2EKSB 2R39A 3MV7A 1R3JA 2M8XA 2P46B 2DTSA 3BDYL 2BVOB 2JCCA 4UFPA 4FTWA 3ILQC 2HMIC 1U8JA 5F7UA 1BQHA 1YEGL 2R8BA 4UTBH 4LKOA 4PGCA 5EIEA 4KK6C 3U82B 4I3SL 2RR3A 4P57B 1SY6A 5JHDB 4FMKA 3MLPA 2DYPA 3M07A 2FX8L 5HFNA 2E9WA 2EYRB 4OGXL 5ALZA 3G6JB 3P4LA 4XNUL 4FNMA 2ICCA 5IHLB 1HXMA 4HWUA 1SCKA 2IGFL 4LSSL 5I2IA 5IR1B 2R29H 1FFOA 2NXZC 1XIWD 2YXFA 1C7IA 1YEGH 1A4KA 4HMDA 4ELME 2D7TL 2QRUA 3JVGC 3T8XA 5JNYB 3MROA 3L6FB 4WEMB 5I1GH 4DLNA 4EIGB 4Z49A 5IQ7L 5INCA 3VGDA 3X12A 2NY1D 3NACL 5CCKL 1C12A 1JU4A 1HKLL 2DQJH 5FOBA 2HFFA 4L8CA 3MFFA 2Z93A 3B2VH 1R3IL 4X5WA 4Q9CA 4HIJB 1K5NA 1CUXA 5F9AC 5B8CB 5D7LD 1SVCP 2BVEA 3MPCA 2G5TA 5AIBA 1NBVL 1LO5B 3QPQD 1RIUH 3A6ZA 4I2XE 5GRJL 4XHJD 3T0XA 1Z9SA 2WILA 4K3JH 2MJWA 4I5BB 4H20L 4DKDC 5GS0C 1Q94A 3INUH 5JTWA 3QQNA 1HWGB 3F7YB 4ZWNA 4GT7A 2PF6A 2ZYRA 3FJTA 1WAAA 1YECH 3KYKL 1XKTA 1MHPL 4PRPD 4OZGB 4JFFB 4URTB 3OKOA 2XT1B 3GMOA 1OSPL 4KUZL 1FSSA 4GG6A 4ETQA 2GTWB 4JFXA 3W11D 4OCZA 1J8HB 3ZKXC 1VADA 4WFJA 3E6FA 4BA8A 5CS7A 3NBNA 3MLTB 5E6YA 3UPCA 2HH0L 3C9NA 3ESUF 4YHYB 4LVNC 1A6UH 1UM4H 1DQDL 1DZBA 5GGUB 5A43C 3MUOA 3UC0H 4NNPH 1HQRA 1R9MA 1I8KA 5GS3A 2G5BA 3OBAA 2IMNA 2XN9B 3D0LB 4B85A 2Y1KA 1KPRA 3I2IA 3B6SB 4HGWA 5TQ0H 4Y5XA 4R90H 3BP7B 4XBGB 2DTMH 3GIVB 1ZT1B 4KHXL 3UZEA 5HHNB 5HDOA 4JYPA 2CLVB 5DTFA 3BH9B 1WIPA 3S34L 5SWSA 4KRYA 5I8OH 1GQRA 2GIYA 2OQVA 1NCDL 3JWDH 4BRSA 3ARBD 1BOGA 2EDAA 3QI9D 1ZKAA 1KYOJ 4KXZI 1BHGA 3B3QA 1EMTH 3R3ZA 1J1OL 4MDJB 4YBHA 3EYSH 2A6IB 4FXGA 5ENWB 5EU6A 5I8EA 1Z3GL 2VAXA 5C08B 1HN1A 4U2FA 4IOFC 3VXRA 4P2RB 4P46A 3RWHB 3DOIA 2PW2B 2WBJC 1LK3L 3VWKB 2KZWA 2Y9RT 2XWJB 3IETB 5FOBB 3CXDL 4L8CB 5KSVB 2K7QA 4J0CA 1OWRM 5C8ZA 2VDPH 4ZUWA 5B8CA 2Z4QB 5AKEA 4EIZC 2C3VA 5K9OA 3PDCA 1ONQA 3RVUC 1I3UA 4NKIH 2BNRE 2ORYA 5I1CL 1JYNA 4XNXL 3QXTA 4ZODA 4U1GC 2XUAA 4JJ5B 2DQCH 2HT4D 4C6HA 3UJTL 4RGMB 1YJDL 2QSCH 4ZO6A 3EJJX 1UJ3C 3KVQA 2WUEA 5DMIH 1OGAA 3CGTA 4FG6C 4BQ8A 3NZHH 3NN8A 1JN6A 1KB5L 1MX9A 3Q6FA 3O2WL 4LMQI 2RAMA 1SM3L 2PSFA 4Y4KA 5C0EB 2V7NA 2VR9A 2W22A 4K6HA 2H26B 3C9NB 4CUCA 1IZ8A 1QRKA 1V3MA 2VE6B 3PUCA 1HYRC 3LB6C 1HK6A 4HJ0D 2PTTB 1A4KB 1JPSH 4I3RH 4LVEA 1JFQL 1MHHB 2ONCA 3IRPX 1MRCL 3BP5B 4YHPB 4JN2A 4HLZH 3KNBB 1EBAA 2EDXA 4PTUB 3W0WE 2OQJB 3QO1B 5K5EA 1BD2B 1NBZB 2F58H 2VDKH 1PY4A 5AM0A 1GKKA 3R8QA 1U91A 1TITA 1J0YA 3BO8A 5ACMA 3SHSA 3L1IA 4ZS6D 1MOEA 3T0DA 1AKJB 1BQSA 1T1XA 4HQQH 4J0JA 3DDUA 5C8JA 2V6HA 5BOPA 1DBML 5JATA 5L88H 5DUBB 2WNGA 4HRYA 1QIJA 2ADIB 1FNEB 3U7WH 3H1BA 2AJXL 5T33H 4DMHA 1ZD5A 4XNMA 5EOTB 3FWHA 4EI6A 2YPKA 4WU5A 3MXWH 25C8H 4RGNC 3ESBA 1KLGB 1H3PH 1U42A 5DR5H 5IMLA 3VGGA 4JKPL 1FNHA 4X4XA 1PSKL 3P9WB 1E4KA 1MSPA 2CDGB 4L29A 4WWKD 3DS8A 1MY5A 1VADB 5L0QB 5FPQA 4DIUA 5D7KD 4P9HL 3WIHA 2NY1B 1K8QA 4V1DD 1N1MA 2WFLA 5ALQA 3VFGH 3I75A 1A7RH 3QUYD 1FLRL 1AGEB 3ARRA 2BVPB 4NC2B 5T1LB 3Q3GA 1NCUA 5GRXG 1UEMA 2MSPA 4QRPA 1I7RA 2NZIA 4FTVB 4WV1C 1B6GA 3VDXA 4GFTB 5JD4A 4OLXL 4ZFOL 3RUGB 3TWCL 1E89A 3W5MA 4FQQB 1E5TA 1AGCA 4XWGL 2WJ6A 5HI4D 1KCRH 4Q3KA 3KPQB 4LKCB 3HR5B 1RZ7H 3LZFH 4APQD 4YGVA 3U0WL 2PUJA 1A3RH 2J8HA 1MLBB 3WIFB 4JFFE 3S8WA 1U92B 3ZL4H 1NUGA 2XUOA 3ARUA 1E4XH 4QRUA 4EUPA 3O6KH 1CN4A 1GXEA 3HG1D 2GJZB 3HNTH 4I1NB 2VMFA 3I6GB 2FNBA 3FQUB 2JB5L 4UINL 1DQTA 1KELH 1G1YA 4UPDA 1U91B 5ANMA 2CUIA 4G7VL 4ZUWB 2IG2L 3MRCB 2HTKD 1ZD4A 1T5WB 5SV3A 5HHXH 2WWMC 1LDPH 2WUBH 4TVKA 3S3JA 2AJBA 1O5DT 2VSCA 3MLRH 3HI6H 2OTUB 2YSSA 1QBAA 2VO5A 4JH0A 1MI5D 4PY7A 1DLFL 2X9YA 1NAML 3HNVL 4O02L 3GSRA 3MJGX 5D7SL 3DXAE 1NCBL 2X2YA 3FT2A 5A7GA 4RWYL 1RJYB 5IMLB 1B41A 1WB5A 1XF5B 4LSUH 3PXHA 4P99A 3RIAK 5A3ID 4Z7OF 1P9MC 2BC4B 1MI5A 4G7YL 5EOCJ 1W72A 1JT2A 3UPRA 4TGLA 5BMFH 3LCYA 1SJHB 4UV7L 4UFOA 3UTTD 3VGAB 4L3ED 4IOIA 2B7DT 2IBGA 4XMKH 5DSCA 2DLFL 1NC2D 3IURA 5HGDB 5J9PA 4M6ML 2WFLB 1R3LA 4O2FB 1KV3A 2RJMA 4PJDF 3UJIL 2XLCA 3TBSA 3OKYA 4JFOA 4R4BA 1T21B 5KZCD 1RHFA 3AJAA 4Y4HB 3HG1A 3QDJE 5DQ9A 4W1PA 4JM4H 3HE6C 3VH8B 3VI4E 4L8SA 4BSWA 3QIWC 2BY0A 4ODSL 2W65B 2VXSH 3RX7A 5GZOC 5FUZL 5JR1H 4OZGF 3WFDH 4HUUA 1ZAGA 4UBDD 3OJDB 3ZLTA 1AO7E 1IVLA 3W39B 3ARBB 5EOTA 3ICVA 4M02A 3SY0B 4L9LC 4WU5B 1T0NA 4HG4K 5ISZE 1DUZB 3WJJC 4YHIB 4AENA 4M1DH 1C5DB 1MFCL 5IVNA 4Y5XC 5FUOH 4B81A 3OR7A 1ZT7B 5FUCE 3NTCL 5JUEH 4DZBA 5GRUH 3FAXA 3OKEA 4G9DB 5GQBA 1QUNA 1EH5A 1A6PA 2MFNA 5TDOA 3UYRL 4PV8A 3QWRD 3FQNB 1A3QA 3AFIA 4O58H 1ACYH 3N1PC 1RV6X 4I19A 3DYMA 43CAA 4IOFD 1I1AC 4NJ9H 4MNGE 3QDMB 4TVPE 5ERWB 3H3PH 2VISB 4KGJA 1K2DA 4YWGL 1J05B 2BY1A 4LAQH 2H41A 2A1WL 1S7QB 1LPNA 2BC4A 4PJDB 1YB7A 1LMKA 2VUOA 2HA5A 5C0RH 4JEGB 4YUEL 3G0GA 4AK1A 2DL9A 4EZIA 4PGEA 4PJHA 1MF2H 2DIAA 3L3HB 1T20A 2DD8L 4OD2B 2B1HL 2VDML 2ZKHH 1Q1JL 1JPFB 1G9NH 3QCVH 5MENB 1E3QA 2F53D 3WS6C 1M71A 1CYGA 1JZ8A 3EJYC 3TEJA 3P9LA 1F5WA 1FZJB 2CJUH 4Y4HA 1FVDA 2CLRB 12E8L 3BYYA 4WW1A 1XGPB 2MPAH 2OR7A 5K93A 1OLLA 1T1ZB 4H0HB 4BSWB 2PXYD 3D1MC 4KI5D 1LNSA 2XZAH 4XP9L 4UDUA 4KTDL 4CDGC 1T5WA 2JKXA 3H2IA 3ULVC 4S1SL 3GA7A 1DWOA 5AI8A 5I1IH 1I9JH 1MCLA 1UACL 3PF9A 4YBQC 3BPLB 3JWOL 4PG9A 1QTIA 2VKXA 1QFOA 4BVLA 1X4ZA 2FWOA 4NHCH 3B3IA 4P23A 5C0IA 4D2NA 3FQTA 2QHRL 1MCKA 1OCWH 4OKDA 3DEAA 4ODHL 3QFJA 3F67A 5BWBA 5ECJE 3OR6B 3Q1SH 2R29L 4H35A 3KR3L 3C87A 1F4XH 4G6JH 2WUGA 1QSEE 1OSZA 1A1NB 4Q05A 3BN3B 3VFWA 2R1XB 1H15B 4OJFH 2VC2H 3BXNA 2QXUA 1UQSA 1RIHH 4G9FD 3KLHC 1ED3A 3QIUA 1FIEA 3MA9H 1K2DB 1TMCB 3ARVA 1G9EA 5I19H 4FS0A 1INEH 3ARDB 5DQ9B 1TTGA 4QKXB 1ZANH 2DQDH 4D0BB 2DQIL 3O4LD 2E9JA 1NGZB 3QI9C 2CIKA 5ESVB 4I48B 1Q0XH 4WI7A 4DUWA 4BM7A 4XPAL 2E8YA 5HDQH 3ES6A 5TE4H 2CKBA 3OB8A 4PP1C 4TSAL 5DHXB 5E8DH 3PDDA 3L3JA 3PGDA 2OXHA 2QKIA 2ERJC 3O3BA 5E1HB 5E8NA 3QT2A 4EQ3A 2ESVE 4RFNC 1A6VL 3MMEA 4YHIA 5GGSY 3VVLA 4ZOEA 2CO7B 5KVDL 5T1KB 2E7CA 3QM1A 4OB8A 1AJ7L 2Z91A 4JO3H 1ZT7A 4LL9A 1F11A 3T4UA 3NGBB 4PJXF 2FJHB 2B4CH 3ESVF 6YASA 2B1AL 2W07A 4C55A 1J0JA 3HPLB 4RAHA 2E8ZA 4X6FB 5HGHB 5MEQA 3O95A 3T3ME 4NQEA 5FFLA 1IUOA 5IW6A 3ZYOA 2LIPA 4R90L 43CAB 5GRUL 4YPJA 4FKBA 4U1HA 5H94B 4KDVA 3I3BA 4MAUL 2IH1B 4HEME 2VISA 4R7DA 4ZSOB 4H88L 3TIEB 1MF2L 2Q8AH 4PUBL 2OAEA 4JHZA 1X5JA 1M7XA 1YNTA 5HHPA 3TYGH 4YAQB 2YD8A 4QDTA 1KN2H 5ALKA 1P7QD 1T7XA 1ZK9A 2OP4L 2VLJA 3PWNA 5L6YH 3I6LD 1P7QA 4V1DB 2I25N 3BZEB 3FOLB 5FGCB 3IT8D 4PJHB 3HE7C 1YNKL 1K6EA 4PJGB 5JW4N 2X41A 5C07E 3AM8C 5MENA 1QLEL 3QH4A 5CURA 2ZVDA 5KVMC 2VQ6A 2AV7A 3E1GA 3BWAA 1XR8B 5DGQA 3PG2A 3MACL 5MEND 4UI2A 2VN4A 2VLME 1K9TA 2R11A 5AP9A 4N90E 4OZIA 2A77H 12E8H 1YCDA 3QDGA 1FL5B 2VR5A 4Z0XB 4RMRA 1YC7A 3WS3B 3CH1B 2R2CA 2HFKA 3MMEB 3S2ZA 3FL7A 2CDEA 4KHTH 4KVCH 3W2DL 4NHUA 3PL6C 1ZMYA 5I30H 1IARB 1GAFL 2YPVL 2F9BT 4X7FC 3O6KL 1MT3A 1RZGB 3HE6D 4F7CA 1PAMA 3JTSB 3RZCB 1OSZB 1A1NA 5FYJE 1MJ7L 3VCLB 1I3GL 5MEQB 1S7TB 1L9NA 3IULA 3WFZA 5GS1B 2G63A 3FFCB 2R1YB 2AXFB 1TCCA 3T4YA 3ZTJG 4OLYL 3O4JA 2G60H 2WZPD 3VVMA 3T2NH 5C0AA 1YMHA 4TUKH 5I8PA 4M4RA 5C09A 1FC1A 1BJMA 3DETC 1YMMA 3CVHB 3TIEA 3JV4B 1NJ9A 3F6LA 4DGIH 4GECA 5D7SH 5GGRA 1VFAA 4OSUL 1Q84A 4DQOH 5F72S 4IDJH 2WTNA 3FMGH 2AEPL 1GC1H 3BEVB 3PWVA 1XRPA 3QXAB 1S78C 5CZKA 1U3HA 3RKSA 2JJTA 5JO5A 1ODAA 3OPZH 1QGED 4MCYB 4N0UE 1FDLL 1YQ2A 2AQ2A 5LP1A 2QKIB 4UT7H 1I1AA 2AV1B 4Y2DD 2P47B 3ABZA 3IVMA 1CFSB 3HMXL 5T1KA 2N4IA 5JMOC 4GI1A 1WCYA 4WY7L 1EEZA 3H9SD 3BAEH 1DQLL 1MCWM 3V6OC 1NAKL 2Y5TB 3ZDXE 5CTAA 4XPTL 1L7IH 2E27H 1UK6A 1B88A 4HH9B 3UAJC 5EHNA 2FBJL 3N1QC 2UWEA 1MCPH 1I1CA 5F9JB 2UZ0A 4B50A 3HZOA 1FL5A 4YNYA 3DYOA 4K94H 2VXUL 5CEZH 5C0FB 4HC1H 3O4LB 1NC4D 2IH1A 2Z92A 3HUJE 4R7DB 3WS6A 5JA8B 4Q34A 4C58B 5LXGH 4NO3B 4M8QB 4QRRB 4B0OA 4YX2L 1DBKH 3H18A 4UHCA 4X0KA 1OTTD 1BCRA 2IFGA 1JGDB 1A0QH 1I8IA 3LKSA 2PM8A 3P9MA 3FHAA 4BB0A 4P48A 2H1IA 2P43B 4V1DA 4LASL 1IGFL 1KN4H 3D18A 4LCWD 3FFCA 3UUEA 5F89B 4DW2L 5J06A 4JM2D 4JGJA 5J0BA 3R3VA 2WANA 1MREH 5DD1H 4KK9D 1KXVC 4IQ4A 4YASA 5ALHA 1QJ4A 2ZOKB 4NC1E 4ZYKA 3EYOB 5BVPH 5KZCB 3A70A 4PJ7E 5IVXB 4OTXL 3BN9D 2Y6UA 2MKWA 4WFHE 4LSTL 4IMLA 5HHXL 3U6RA 4ETWA 1CU4H 4EBQL 1G6RA 4K9EL 2JBWA 5EHQA 4UHHA 1VERA 3BD4A 3MRRB 4Z7QF 5EUKB 3L5HA 3QJHA 4HWZB 4PPTA 3HI6L 4N0CD 1CTOA 2EDHA 3N1GC 1YYLH 3GO1H 3RDTB 1JTPA 4XWOD 2LTQC 5DJDA 2QQLH 4D9RE 4JFPA 5DRWB 1QIFA 1SYSA 2QEJA 3TVMC 5DYTA 1VJ5A 1N6QL 1KJMA 1TDQA 4OQ1A 2VAVA 5TGBB 5CUSH 4AIZA 5ALMA 1KEML 2MMXA 3FTGA 4RMTA 1OF2A 5D1ZC 2NTFB 1RZGA 4F7CB 3UTTB 4UU9B 4JFEA 3R3YA 1UWCA 3CDFA 4U1KB 1EK2A 4M1GH 2Y5TA 1JFQH 1P4IH 2X9XA 4L9DA 3ZE0F 1QIDA 4PJBB 4XNXH 3KLAB 3GHEH 5AIAA 1JRHH 1RVFL 3DYPA 1IE5A 3QMMA 4QXUH 4K55A 5CZXD 3V5HB 3QYCA 5C0DA 2PCPA 3LS4L 1ZA6A 1LD9A 5EU3B 5CGMA 2XMZA 5DURB 1IMHC 4N8VA 1MFNA 3GHBH 2YEZB 4DZ8A 2DSNA 1BLNA 5F3BA 3DTXB 2VH5H 2D03H 4JFFD 5L88L 1RUQH 3CDYA 2WLYA 4NQDD 1BF2A 3D0VA 2IPTL 4PRIE 1HDMA 3K4ZA 4U1LA 3P9MB 1YNLL 1H0DB 2IQAA 3QXAA 1ZHBA 4QLOA 3WWDA 1IL1A 5A6VA 5IBTL 4UNVA 4MEBA 1SBSH 3QZWB 2OSLA 1PJ9A 1JWUB 1TPXB 1DVFC 3IAPA 4OKVA 3BF7A 1GOHA 3LHPH 5E03A 1RIVH 3T0EB 3OAYH 5T4HA 3O4OB 1IEAB 5LLSA 2Y23A 4JZOA 4ZD3L 2FBJH 3EYOA 3AROA 4AO7A 2GAZA 5DRNB 2PTUA 4JFDA 2V9RA 4W4OC 2GFBA 4V1DE 3K81A 4HQQL 5L2KB 1N64H 2DQEH 4NM4H 1ZT4A 1L6ZA 5CIPB 5KVFL 4DGQA 4W81A 1YN7A 2CSPA 3REWB 2BUAA 2WKWA 3KPNA 1WFTA 2JGKA 1MFAL 4GAFB 1AXSA 4MYSA 5HYSG 1YQVL 5ALWA 1PG7W 3HKFA 3CMOL 3HC3H 3TV3H 2GI7A 1NBVH 5DD5L 2WIIA 5DJDB 1R3JB 3DNMA 5K9KA 1QSFE 4KVNL 3RWJA 2WIGA 3KAAA 4X6DF 5HF6A 2E3VA 4GXVL 5CP7B 5TQ0L 4JCMA 1U3HC 5IJVB 2W6CX 2V9TA 2Q86B 4G5ZL 1TVHB 1WFUA 3QPQC 1DQYA 4C4KO 1VFBA 2YHGA 3BGAA 2AJVH 3RWGA 4YDLB 4R2GD 4JLRA 4QE3A 3AINA 1CR6A 1DN0A 2AXJA 2A6DA 4XP5H 2WK2A 5CEYA 4F7PA 4YH6A 2HH0H 1ZTXL 4ERSH 5CJ5A 1IQDB 3V5HA 4E41E 5HF5A 3ZE1E 1W0YT 2NY4C 4X6BB 1FE8H 4KQ3L 1M1SA 4HPOL 5IHBA 3DV6A 3WXWH 1VE6A 2WG1A 1QO3A 5ALYA 1BBDL 1OAYL 3W9DB 1OARH 4KMTL 4ZTPL 2YA2A 2ZJ7A 1J06A 3PE6A 3D0VB 1UWGL 3JWOC 4UQ3A 4L4TB 4LPVA 4JO1H 3QJHB 4HWZA 4LAJH 5GS2H 4JFZH 3W2DH 4KHXH 4K3GA 4X5WB 1KEMH 5JQHC 3MRBA 3G9XA 2BP3A 3ESCA 4UUJA 4OFVA 4NUGH 2RIKA 1ULVA 5CJQL 3U9PH 1AGYA 4AN1A 3MCLL 2FRGP 2OTWB 4JCLA 4Q6YA 4UTAL 3STWA 1ADQH 5EZJB 4A6YB 4C01A 4TQEH 1J1OH 2BXYA 4IRSC 4RAVB 1XLVA 3ULUE 3TCLA 5KSAB 5CIPA 5IH7A 3UBXI 4OIAA 1U41A 1QSEB 4WFIA 3SK0A 2V2WB 3TA3B 1AE6H 4JFQA 3CCCA 4W70A 3FMGL 3QNYA 2GJ6B 3SGDH 4F7TB 3GBNL 1N4XH 5D70L 1E4XI 1CE1H 4X6DB 2ATKA 1RVFH 3SEPA 4EEEA 4WI3A 2O26U 2P8PB 4J6RH 2NY7H 1RD6A 1MJ7H 3R41A 1FRGH 4KROB 4M62L 3RDTD 1HDMB 2YPVH 2D0HA 3BP7A 1ZHBB 4IS6A 4HXGA 5CT8A 4OLYH 5D6DC 4CMMA 4WUKH 3B2VL 3RI5K 3V8OA 4CG2A 4X6XA 4LGPB 4LHEA 4LMQE 4KH2A 1WBXB 4B6GA 2CRIA 4MJ2A 4ELMF 2HRPL 1UZAA 3STUA 1Z9LA 1PYWA 5CD5C 5E2TH 3KPPB 5EDXA 5FIEA 3W9DA 3WIBA 3GB7B 3QISA 5DGRA 4PGZA 1IZKA 5CINL 5T3XD 3VXRB 1FRGL 5EFZA 1KFAL 3VXSD 1KIRA 5C6TH 2I07B 4WW2F 3MJ7A 2AKRB 3GM8A 1EUUA 3EOTH 4UNTA 3T77B 5I1LB 1A02N 4MCZB 4OD0A 3C2SA 1C4XA 3QG6B 1BROA 5GRJH 4G9FB 4JG0L 4MQSB 2APBA 2XICA 5EZJA 4A6YA 3PWUB 3GK8H 5CMAB 5D7JC 5IJVA 5KBNC 5L6YL 1FO0H 3SDXA 2YZ8A 5DNUA 1G1CA 3BE1L 2A9ML 5CJXC 4H25A 1VOTA 1OAQH 4TSBL 3R3XA 3SDAC 4HFUL 4LXGA 2FHCA 3U1TA 1VFUA 1J86A 2DAVA 1KNOA 1U2CA 3IDAA 2W0FB 4EY6A 3EOTL 2YR3A 2V2WA 2A74A 3TA3A 4JKMA 1W0VB 4E14A 1OQXA 3HI5L 1CGWA 5TJWK 3U4AA 2DYPD 5JOPE 4JFYB 4R2GB 4X9BA 4F7TA 4M93C 3O6LL 4B41A 1FQ9C 3DD5A 5D6OA 1D5MA 3TYGL 5SYNA 1E8DA 5IB1A 3HS0B 4I0PA 3O2DH 3WUWA 2YD6A 2CD0A 4QRSA 1DU4A 4I0PD 1QP1A 4NRZA 2JEYA 2BNQB 4FQPA 5TDNA 2HJKA 5E6IA 4H1LB 2X10A 4GW5A 2IWGA 3TBWA 3M1BA 6FABH 2VDLH 3O9WC 3BO8B 4WHYH 2GK0B 5I7UA 4DEPC 1EEYB 2BDNH 4KU1A 2NXYD 4Y7MA 1QSVA 4A6YH 2XRAL 1Q0YL 3HAEA 3QQ9D 1OAKH 3BDYH 4G8GD 2Q8BH 5IM7A 2QHLA 1CFTA 3MV7D 4HF5H 5JAHA 1V05A 4TNWF 4MXQC 3AIMA 1YEDB 4MJ6A 4PJGE 3MRLB 2VZVA 3GMPB 2PYEA 3LKOA 3GSVA 3BH8B 1UVQB 3RWFB 3UJJL 1C1EH 4HX1A 3RTQC 5HHVL 4AMZA 3A6CL 3P40A 4FN0A 1LPMA 4KY1H 3DYVA 2BNUA 2QJRA 1J11A 5JW4R 2NX5B 1DX6A 5C0BE 2CKBH 2NW2A 1QSEA 4GSDL 4YDJB 1Y7HA 3MJ7B 3VXNB 1MO2A 5AOBA 4UAOB 3QRGH 2DMBA 2R0ZL 1E4WH 1QFWH 4OIIL 4BUHA 5LZ7A 5JD6A 4IIQA 4M7KL 3O2VH 2XUQA 2YD3A 5IV2B 4MNQE 5AZEL 1UACH 3BKJL 4N90D 1XRMA 1BQHB 3K8MA 2JB6A 5C08D 1OGAD 2IADA 2YPLE 5B8CC 5FDWB 3WA6A 1P4IL 3I75B 5LVEA 1DUYA 3SDXB 4MQLA 3VGHA 1OTTC 5A2IH 4W4OA 2WLSA 3AAZA 1QO9A 3NZ8A 3LQAH 2XNAB 3CLEL 4JKKA 4PTTA 5FLKA 4QRPB 4QHNA 1GGCH 4LQFH 4YR6A 4D94A 3GJFH 4BDSA 5E5MA 5FAAA 2AGJL 2C4FU 3L3KA 4LP5A 2X70B 3SKMA 4W63A 1J8HD 2X4UA 5F9OH 2PU5A 1FFOB 4LFHD 4K2AA 5CBEA 5HKAA 3C2AL 2QOEA 1IC4H 4XX1A 3NCJL 4YGVB 5F97E 3MROB 5CJOH 1MJ8L 5HYEA 2WW8A 1MLBA 4BZ2L 2X4PA 2WFMA 4L5FH 3ULSA 4N5HX 1T0MA 3S5LB 2WBJD 2RBLA 3U7YH 2E9BA 1LEKA 1SBSL 3AVEA 4ACPA 1TJGH 5I1LA 4XPAH 5E8EA 3OAZK 5EORL 3V4UL 4OUKX 5JZ9A 1DSFL 3FO1A 2ZJ6A 1UK8A 1K4DA 1R4ZA 1HCVA 1LO5A 1GJIA 1HPLA 4JR9L 4YHOL 2R1WB 4GG8A 1FL6A 1LILA 3I3DA 2F54A 1WT5C 2LAAA 4MJ6B 1YA4A 3JW8A 5IGXL 4BCCA 1FZKB 4UQ2A 5IROA 4JM2F 4P5MB 4DKFH 3BP4B 3WE6B 4HPYL 5HYIA 1BM3L 1H5BA 1VEOA 2GZSA 1ORSA 1MFCH 5HHMD 4Q82A 4DCQA 4G8DA 5EU4A 5J89A 4JFXB 4Y1AA 5CEZD 4YPGB 3B5GA 3VFUA 1LP9E 1ZLVK 4PGBA 1QZ3A 3VMOA 1OPGL 4MQMA 1D5MB 1X5GA 1NCCH 4GDMA 4EZMA 4J4PD 1RUPH 3BI9X 4ZFGH 4KKBD 4HKZA 4YJZL 5HGDA 3HS0A 1U3YA 3O8XC 4YE4L 1R3LB 4O2FA 3WUWB 4MAYA 4FLEA 3LP5A 4JHWH 3FRUA 3PV6A 3WXVH 2YMXH 3D2UA 4LLAA 3GFFA 1D5XA 2DDQL 4TPKA 3FO9A 3MRMB 1MRFL 3MJ8A 1JK8B 5ALVA 4AX4A 3T1WA 1RUAH 3C08L 3H2KA 1N5RA 4Q97A 5FUOL 4YR6B 4H18A 3IAQA 4X6CF 4YEFA 4G9FE 5ABDE 2GKIA 2YD1A 2DJ4A 2NXYC 3UXFA 5B39B 5SWZE 3L3KB 3RVWD 2YZ1A 3VW3H 1EJOH 2DLHA 4L3WA 3FFDB 1XR9A 4HVTA 1RFDH 4HK3J 3FQXB 5CGYC 3BJRA 4U2GA 1FO0A 1BU8A 2OR8A 3STYA 4U6HA 1RULH 4YC2C 1CUGA 2PYEB 2GYUA 3D69B 4Z7VF 2XZQH 3MLWL 3ZKQD 3X14A 4F3FB 2PW2A 4RA0C 1N59A 2ZPKH 1T0NB 1VHPA 5BVJB 1LEKB 4PJ7B 4W6XB 3WIHL 2EC9U 1TRHA 2O7VA 4CJ0A 1MHEA 2FJGA 5F6HJ 2ZSVA 4JFDD 1J9CT 1NFDE 5IV2A 1S9XA 4N1HB 3VJ6A 2JIXD 1P84J 1RZ8B 1A88A 1RJLB 4U1MB 1ZICA 3ZDYE 1EHLH 3MLSL 4JREC 5IBUB 3KD2A 2FX7H 3SJVB 4K8RL 3BWXA 5IB5A 3PWPA 5HHOD 2NLJB 1EFXA 3BP4A 4KMQA 1RZJL 2YD4A 4JDTL 2BK8A 1MRDH 4LSUL 4CNIB 4DCQB 3HC4H 2GT9A 3GM0A 5T3XH 5SX5H 5AUMA 3RKDC 3QPCA 3FFCD 4XAWH 2YXPX 1T1YA 3GMQA 2AK1L 4UV7H 1F90H 5BMFL 1KEGL 3R06B 4PJ5B 3ROLB 2VDNH 3KDMA 2JE8A 1HILB 1I8LC 2AXGB 4F9LC 3H9SA 43C9A 4FZEL 1UYWL 1UKAA 1T20B 1FNSH 5F9WC 4P4KB 1CGXA 3VI3F 3W04A 4GRMA 4PJFA 1D5XB 1M71B 3WKEA 1ZGLP 3EDEA 4KACA 1JK8A 4TVPD 3C2AH 2FHBA 4UHFA 1PSKH 1Z2KA 2CLRA 1TNMA 1LO4H 4XT1C 4KC3B 3UTSD 1TQHA 2P49B 5BS0B 4AEIH 1B0GA 1MEXH 3BKYH 2VXSL 4NQVA 3W0WA 4PREA 2J8UA 2Z8VC 3Q2CA 4O4YL 4YX2H 3BESR 2XQFA 3O4GA 4WTZA 2W0PA 1FJ1A 1JJIA 2AK4E 3KPMA 1UM6H 4QDXA 1R24B 3D69A 5JASA 1BJ1H 4P2RE 3MC0A 4FZ8L 2FWOB 5IB3A 4PJ7F 5JW4Q 5AK4A 4LDEB 2DIBA 2VERN 1B3JA 2HFEA 3WIIL 1CFVL 4G8FA 4BYMA 4UV4L 4TOYH 4GBXC 5LWYL 1YDPA 3T3PF 4LLQA 4OUUB 4H1LH 5DS8B 4HPOH 1H8NA 2DQFB 1QLEH 4XWGH 3F65A 2R0WL 3VFWB 1G84A 1RJLA 5IW1B 4V2IA 4L1DA 4GW1B 2BHZA 1QBLH 5EIIA 5JW5B 4PLJC 1YN6A 3MODL 5JXAH 4L3EA 1EFXB 3D85B 3T0WA 2ED8A 3MRMA 2EDWA 5E2UL 2Q6WA 3Q3GB 1A7RL 4JRWA 2OR9H 4KE9A 4HFWB 2O93L 4OB7A 2CLZA 4FTVA 1D5BA 4FHBD 5DJ0A 1WWWX 4UV4H 4YE4H 4QHUA 2ZYIA 4MMXC 4M6NH 5IOPA 2Z31D 3BRGC 1EDQA 2X4TA 3RUGA 7FABH 4HS3A 2PBLA 4MA7H 5LZ4A 2W9DL 1AGCB 1HXYB 4PJ5A 3ROLA 4OCMC 3KDMB 2DM7A 1WQVT 3FFDA 1J0ZA 3I2CL 4JQVC 2GITB 1LEGA 5DJZB 3H9SB 1URLA 5GGTH 2A2QT 4GBXB 5FA3A 5L8LB 4PP2A 1ZE3C 5DFVC 3EQ8A 3RHWF 4Y2XA 1XZ0A 3WNKA 4S1QL 2XDWA 3F98A 5D7LB 3QP3A 1RHHB 3BWUC 2YKLH 3VFGL 1QKZL 3ULUH 3I6GA 3PWJB 4H88H 2CEKA 2L0DA 2L7UA 4EXPX 2ID5A 4LEXH 1BX2B 5KSUA 3C5ZB 4UFNA 1ZD3A 3RGVD 1DE4B 5FUCC 5BS0A 5A16B 2NY0B 4NQVB 2BHUA 3PP4H 4GKNB 1U4NA 3VFRA 1UWEL 4NQEB 1RZ8A 3BL8A 4GUPB 1MCRA 5IK3A 3VFVA 1P6FA 1OWWA 3PUIA 5IMMB 4X6CE 3AREA 4Q2ZB 1XGRB 4IO0A 4X85A 3GKWL 4X7DC 3MGOB 4U1HB 2V5TA 4PRHD 2XG4A 1OVZA 1NH6A 4PO3X 5FCUL 4ODHH 1OCWL 5IP4A 4CNIA 4OZFG 4PBWD 3F7VA 2OLEA 3ZT7A 3FB6B 4PY8J 1T1YB 3GMQB 5H37H 1FVCB 5J56B 5FUMA 1A3LL 5TFSL 4XGZA 4PJ8D 5L2KE 5KREA 1CPYA 1T0PB 2C9AA 1TJGL 2VC2L 4L8DB 3TLRA 1B6UA 4MA1B 4HXAL 4ZS7L 3FOMB 1KGCD 5FA4B 5AG9A 3ESAA 4PJGA 4U1JA 3NVQA 1CUUA 2BJHA 1GCFA 1G9ML 1GIGH 2VR4A 1YA5A 4HFWA 4LLUB 4KK6D 2FIRT 2AW2A 1YY9C 5I30L 1GPOL 5JA9A 2PO6B 5E1AB 4NKDA 3OAUH 5JYCA 3RLIA 3EHBD 1CF8H 1NSNL 1KIUA 2JCCF 4LCCA 2C5GA 3KPRD 2VIRA 2EXYC 3QUZB 3CFEB 2PL5A 3CFCL 2DM4A 4Z0XA 4XIIA 1XGTA 1UG9A 2X05A 4PR5A 1CUSA 3IJSB 2IBBA 2FEDD 5IJKA 5A7FA 1DJSA 1LO3H 3NA9H 3OJMB 4G8FB 4K23L 2O2HA 1S7VB 4Y1AE 2P5WD 1N3NA 5C70A 4X8JB 4BH8B 4JHAL 1MIMH 5DS8A 4JY5L 4PRHA 1WJ3A 3U79A 5K9JH 3EIFA 4AQ1B 3P4MA 2QSTA 3VCLA 1F2QA 5TDOB 3VRJA 3JZ7A 3VFRB 1IM9A 2EO9A 3G0BA 5AEAA 3DIFB 5IMMA 1AKJD 5MERB 3V52L 4JRXD 4S0XA 2W38A 1GZPA 4BQ9A 3U0TA 3TF7C 1FPTH 5I71B 1CI5A 3ZHLA 6FABL 4HIXH 1UFUA 3HTLX 5I15L 1EV2E 5F88A 3KWJA 3WL5A 1D5BB 2XTJB 3ZHDA 3D5OF 5INDA 3H3PL 4ZI5A 1CUBA 4YXKH 4HIIB 4HUNB 5J12B 2GITA 4AXBA 2VLJD 1HNFA 1ORWA 5CZVH 2FECI 4WRLA 5J3HD 1KTDA 1ETHA 4PP2B 1CUJA 4NWTH 2J5LB 3H2WA 2DQTL 4JM2B 3KYMA 2VXTL 4C87A 5D7LA 1CL7I 2V5YA 5KSAD 1D5IH 3FZUD 1QFWI 3ZHKA 4P3CH 4XMLH 3LIIA 4B83A 4WW1B 4K8RC 3GBMH 1MNAA 2P45B 4ZS6C 3WJLC 3CSYB 2EIZB 4NN6C 2I03A 4XP9H 3RNQA 3IBTA 4W1QA 1FNGB 5SWSD 1N5YL 4A5SA 2ZUTA 4RE5A 3VRIA 2W60B 5IESH 3ARZA 1V8HA 4MJIB 4LIQE 4F9LA 4D8PB 2V5MA 4P59L 2R0LH 2RHEA 1HSAB 1VEPA 2GTZB 1XGRA 4WJLA 2WIMA 4GEGA 5EIQA 3D39E 5D5MA 1CZ8H 3B3IB 3DRTA 4P23B 3QUXA 5C0IB 4LF3A 3CX5K 4PLNC 1F3RB 4BP9A 4MS8C 2OJZL 5DJAB 2MQ3A 4JQVA 1N3NB 4P9MH 3QXVA 4NQSB 4DGIL 5EO1B 1E27B 1X6NA 2IPUG 2QADB 5M94B 5F1OB 3BT2L 1JWMB 3V7MA 3PV7A 5FGRA 3DGGB 4S1RL 1DP0A 3M8OH 4J7RA 1J5OL 2GSGA 2UZIH 4ORZC 5EO9B 3QDAA 5DLPA 5FA4A 1N4XL 1D6VH 5C9KA 1T7WA 3ARTA 2FSEA 1BEYL 3QIUB 4QCIA 3T52A 3QFDA 2W0LA 4ZXBD 2Q3ZA 2Y06H 1B4JH 5EOCL 5GGVH 4WTZG 1HEZB 3RGVC 2VLKB 3SO3C 5E1AA 1XT5A 1MQKL 4X6EA 1CEXA 2HVJB 4LCCB 4OZHB 4OYYA 1JWSA 1LNUB 4JZNB 2VJAA 1BVLA 1A7NH 4AQDA 1NAMA 3ES6B 5F1NA 2X4RB 1XLUA 3LS2A 3VJKA 4MA1C 5E99L 3O3UN 4LLDA 4Y2DA 4JFPB 1KFAH 4J3UA 1FL3A 3TPKA 4GWLA 1WWCA 3L7FA 3V0VB 1WIUA 1UJTA 3L3DA 4TYUA 3RWEA 3WL6A 4F57L 1JCKA 4ZNEA 2C3XA 4NZRH 4BH8A 4LQ1A 1FFAA 3WDIA 4FFYH 2JGLA 1NEZA 4CU8A 1E28A 4JG1H 4YHNB 1ZSDA 2E7BA 5ALTA 1J0IA 4LCIL 3C5WP 2QSQA 1Z9OA 3D59A 2CRYA 3V9AA 3KOOA 1W2KT 1G7QA 3MNWA 1SVZA 4BFEA 2NY3D 2YOCA 2H9GB 3SGJC 4UOW1 3TV3L 1ZA6B 2HU8A 2ECFA 5MEPA 3DX6B 4BSVA 4DMCA 1B90A 1PJAA 5DT1H 4QDZA 4E15A 4Z5RA 4WUUB 3MRGA 5DJAA 5B21A 3SOBL 3MLZL 3HZVA 5INDB 3TJEL 1XMWA 3LSOA 4NQXB 1YNTB 3V7AG 5AM2A 3SN6N 3QA3A 4X98A 1CBVH 4G5ZH 4Y2QA 1FPTL 4EQ2A 2B61A 4NZTH 3MV8A 1QRNE 3PWNB 5EC1A 3BZEA 4U49A 1KTDB 3S97C 5EO9A 3QZWA 3SE3C 1T3FA 4M48L 1Z68A 4JM2A 4OD3H 15C8H 3CMOH 3HC3L 2MHAB 2LABA 2Z35B 1BFOA 3WUWG 1MN6A 1CFBA 2EYTB 4Y2OA 1HNGA 3NIDF 4X8XA 3GSUB 5DRZB 1CRLA 3SCMC 2BNQE 3Q48A 5CWSA 3WSQL 1O7VA 5JANA 4K9EC 4JZNA 3REWA 2EO1A 3G6JA 4P9ML 1QIKA 1DT3A 2GTZA 2FUKA 3OTQA 1I7UB 5HXMA 3SKUD 3MGAA 2R4SL 3NCMA 4ZDHA 3QUXB 4JQXC 2E7LC 4G9GA 4K5QA 1D9KA 4K7PX 2Y5EA 1FZOA 2VQ1A 4NHUB 3PP4L 1S7WA 5FYJU 4AO8A 3FB8A 2WWKO 4YHZH 5HD8D 1XZDA 1WZMA 4IBLT 1VFBB 1C12B 3KS0H 4U3XA 3QJFA 1F3DJ 2GSGB 2NY5C 1EHNA 4HUVB 3T4YB 1XFDA 4YBQD 3ARGC 2P24A 3LS4H 2JJVA 3OGCA 4R26H 5M95B 8FABA 1X5XA 2YPLB 1YMMB 3VFOA 4Z5RB 3CXDH 4I5BA 4RMWA 4UILL 3N0PB 4ZD3H 2BCEA 1DLHB 4L4JA 2QZPA 2KH2B 3MV9D 4NQXA 1GGVA 4XBEL 4YEEA 2O2IA 1N0LA 1PG7X 4X6EB 2D7OA 3MV8B 2HVJA 4M3KB 4OZHA 3WJ1A 2ZSWA 4WJ5B 3LY6A 1UCTA 3UTPE 3LEXA 4U2ZA 1RZKL 4UOJA 4KGLA 1JUFA 2D31A 3MRHB 2RGSA 3WD5H 3GGWB 3V0VA 3BQUC 3BIBX 4LARL 1HCFX 5BW7C 5T5NF 3KPSE 3CPLB 5E0QA 4JY4A 4KROC 4JE4B 1BEEA 2EIBA 1JHKL 2QKYA 3WHE0 4JDVB 2QT9A 3DJ9A 1EO8L 3IXTB 1JMXA 2NTSP 3P4OA 5J6GA 4X93A 2K7PA 1XIWC 3ZSTA 4HG4J 5E00B 1DTEA 3HAEH 1UXOA 3WNMA 1Q38A 1MUJB 3FSGA 3ZDYF 4K94L 1I7UA 1L7QA 2ZJSH 2NQCA 2CB9A 5SX4H 4ZDHB 1KB9K 3BRFA 1LEIB 4HAIA 4WUUE 2P5WB 1D9KB 4M8VA 4RGNE 1E4KC 1O0VA 2ATKB 3MRGB 4LARH 4O9HH 1GSMA 5K3FB 2P8PA 5IVZA 2BZDA 4WDIB 1S7WB 5I1AA 3MCG1 4X0KB 4QTHA 2SEBA 4Z7VB 4P9NA 4LNVA 4OZHE 3CK0L 3IKCA 2R2EA 1MCCA 3C43A 5GZND 3GBLA 4RZCA 3O6FC 3B9AA 2GY7B 4QF1B 5TE7H 4DW2H 1JGUL 2DLGA 1OAXH 1MREL 5DK3A 1YZZA 3S34H 4MHHI 5K3AA 3EW3B 3OGCB 1XCQA 1RUML 1ZXQA 3BXPA 3I84A 2XTJD 2LU3A 3VXME 5CUSL 2W9EL 1ZLSH 2C7BA 4G6AD 3IFLL 5D1QA 3K4AA 1NBYA 3FRPG 5LGJB 2NY3B 3C6LD 4N0UA 4HUXB 4RCAA 1FGNL 4X7SH 3LVEA 1EHXA 4OV6F 2RCSH 2ZWLT 4YHLH 3CXUA 4WJ5A 1ZHNA 5DD3L 3T77A 2V5SA 4OF5A 3UCRA 1SCQA 5C0GA 2R2BA 2IEPA 2ADFH 4K71C 4JDTH 1U6AH 1DX4A 4LHJB 4R9HA 3K2MC 3AXLA 4M7ZB 3WSQH 4WFFE 4X6YA 4GKZB 3F12A 4J3XA 5AYUH 3FHQA 1NCAL 3LS5H 3S35L 4B9AA 1KJMB 3C70A 3TJMA 3M8OL 1J5OH 1EDDA 2BERA 3DVNB 3V7AE 1T83A 3IUNA 5I8CA 3UTTA 3AU1B 3K2UH 1MNUL 3VD4A 3WNNA 5E2JA 4OIIH 4X9HA 1JZ3A 4F9PC 5J6GB 1BD2A 1NBZA 1WK0A 4XNZB 4MNQD 5EH1A 1P0PA 3CC5B 1CIDA 1T1XB 5C0DB 4N8CL 3WKBA 4FP8L 2BOBA 3RTQA 3ARPA 8FABB 4HJGA 1P2CA 3T0AA 4QXUL 3TN0C 4FFVD 1BLNB 2VQTA 4KKLC 1A7NL 5T3XL 1KB5H 2UZXB 5K3FA 1BN7A 1Y0LB 2BNQD 4XNMB 3IU3B 3VG9B 2BFVL 4U2DA 2J6EH 5DK2A 4G6FD 1T2XA 2BNQA 4QOKA 5MP6H 5IMOB 4XX1E 1KLGA 5GJTL 2F19L 2ZSWB 5IG7A 3GSWA 4A2LA 1T2JA 3DMMD 4DTCA 4EY7A 2CRMA 1UYWH 5F6IC 3KPLA 1K6QL 2E27L 5C07B 4U3CA 4DQOL 4MLSA 4RA3A 4KRXA 3MBXL 1KG0B 4J1UA 5C7XH 3IYLW 1WBZB 4H8WH 4BELD 3LOWA 3UAJD 4XJVA 1J18A 3FQRB 5J8OA 5EU7C 3LMJH 1U8NB 2O5XH 3CPLA 3CVHH 5LGJA 4JPKH 5DO2C 1AGEA 4M03A 1XZJA 2AEIT 3BJ91 5C71A 4CL7A 5AWNL 4LRIC 2P5EB 4FXKA 3L3OA 3MLZH 3G0DA 3QBTB 4HT1L 1L7IL 4P4RA 4Y19A 1F4YH 5JIHA 3QUYC 3UZQA 3WFBH 5HYJA 1FSKC 4N0FB 1YEIH 3N9GL 3FN9A 5A7HA 4WFGE 3ZKNC 1A6ZA 3AXLB 4QTIH 5ICZA 4DK3A 4V2CB 4FWBA 2DWDB 2P5WA 1DEEB 5F6IB 1DBJH 4PSDA 4O2CA 3DVNA 4ELKA 5IVZB 2E7MA 4WDIA 4APQB 3VU2A 4X9IA 5GXBB 4QTHB 1ZWIB 4AG4L 1HKHA 3IKCB 1AR1C 3QDME 4XCNA 5T5NG 3VDAA 4JPIA 1DN0B 3D2AA 4HIXL 4NQDA 3KJ4C 3VXPB 5HCUA 3CC5A 1RFDL 4PJGF 2NNAA 1IQDA 2J12B 3BVNA 3QDGE 3MRCA 4RX4A 1F00I 2X70A 3RTQB 2X4UB 2HT3D 1B0RB 4R8WH 5DYWA 4KMLB 3ZO0A 4B5EA 1IQWH 2D7MA 2I9TA 2FB4L 3QUYB 4HIHA 5DFVD 5T3XE 1R9NA 1Y0LA 4NT6B 2W59A 3E4DA 3N0TA 4EUPG 3BPNB 5I1DB 3GSOA 1JGLL 2YMXL 1QRNB 1I8MB 5ICXA 4L4TA 3V6FB 2BSSA 4O5LH 1BFVH 5CSZA 3MV9B 4QYOB 1DDHA 3TH3T 5C3TA 2BY3A 5FYJL 1R0AL 1KU6A 4Z8FL 3FO1B 1WB6A 4FBLA 3O8XA 1C08A 5C07A 2FZ3B 2IQ9L 3MV01 3V4PH 3UPRB 1RZJC 5I76A 3BW9B 4HRXA 3KYNB 3OL2A 4ZUSA 1XLWA 4AT6B 2PNDA 4MXWL 5EFIB 1MPAH 3M82A 1U8KB 2B2XH 3R1GL 1Y6NR 2DDQH 3E3QC 2H9YA 3FRPA 2EYSB 1WCBA 2NY4D 1XZIA 3W9BA 5CH8A 3M83A 3SDXE 4OBSA 3P0YH 2EZ0D 2GEEA 5CGTA 5HYJB 3VH8A 3VFUB 2IFFL 2J7LA 5C8XA 4NQCE 3QUXD 3GKWH 2W65A 3CN7A 3I3EA 1RIHL 1GKLA 1KYOK 4HJGB 1T80A 4INZA 3TT1L 1KCSL 1RULL 3SDCC 3DVGB 2G2RB 4ODWA 1LWRA 3LQAL 2OM5A 1ITBB 5BZWA 5IFJA 1ZANL 5IMOA 4LSVL 2F8OA 4XCNB 1C5DA 2NXZD 5GRVL 4PLOB 2BRRL 4HLZG 3W06A 1X5LA 2QQKL 5HI3C 2Z8XA 4IMKA 4Z7UF 5F1IB 3C8HA 1R3HB 4P9HC 4KZEH 4MYDA 5FPPA 3KS0J 2IAND 1SMAA 1T1WB 4MJ4A 4JY5H 4X5XB 1TJHL 3GB7A 4MWFB 3SKJL 3W81A 3C8KA 4RAUA 1I8MA 2FGZA 4J6RL 4OFIA 3D2BA 1ACJA 4ONGL 1K63A 3O6FD 5C0CD 1F58L 3HR6A 3IDMB 2UY6A 2XV6B 3WK6A 3OJVC 2AI0L 4G80B 3PABB 2F74A 4RBPH 1NDGA 4KWUA 3MBEA 3QG6A 4KJQC 1S9XB 3VJ6B 2F5AH 2NYYD 4A16A 5IVOA 3HRZB 1ZHLA 2EDLA 1N5AB 3U7AA 2D0FA 1P69B 1INEL 3RIAF 2NY6D 4GRLC 1U93B 4AT6A 4JG0H 4OD2A 4PY8I 2V5RA 1Q0RA 4FZ8H 5DD5H 1AMNA 3DGCR 4OM1H 2EYSA 1A6WH 3CFJA 3P9LB 4GQPH 3WL9B 4Z7NF 4HSQA 4NFCA 2ZYSA 5C8VA 3G6JF 3O4OC 5KOVC 1F58H 2IAMA 1DBAL 5C6TL 5F96H 2H2PD 4P3CL 4U0RC 1WHTA 1KJVA 3CMGA 5KN5B 3ZDZF 1QSFB 2H3NA 1SBBA 3NFSL 4J4PA 1QBLL 3HRHA 1HILA 2AXGA 2YUWA 1UOOA 5AI4A 1R0AH 2EICA 1U95B 1OSPH 1TAHA 4XCCL 3ZTJH 3UO1L 5D8JH 4Z7UB 4R0LC 3QHFL 3OTTA 5I8KH 4OYLA 2XZQL 3MLWH 4QWMA 5D96C 1WEJL 5AKXA 4MQ7A 1AO7A 4P2CG 4P46D 4JN1H 3V6FA 4NM8H 2V7HB 5E24E 1PKQB 3QUMA 4GW5B 5DUPL 5EBWB 3S96A 3M1BB 5E2WL 1KCUL 3RNKB 2KQNA 1HINH 1MCWW 4QRRD 3VW3L 1B0GB 2AERT 4F33B 1NEZG 4R3SB 5EUOA 4JUIA 3O4HA 3L5JA 3BDBA 3ICWA 2BHYA 2BDNL 3KYNA 4LSDA 5GJSH 4X5XA 3CZFB 4E9LA 2VLKD 3KSRA 4LXHA 3RWFA 2NY5L 4FMPA 3X3FH 2DQHH 4N8CH 1TJIL 4BYHA 5HKBA 4HTAA 5JAPA 4FP8H 5I73B 4MJ3A 2NX5A 2ZZUT 4CI9A 1IBGL 5DZNA 2Y25A 4YDJA 4PRHE 5AI6A 2OYPA 4S1SH 2PW1B 3QIBC 1G6RH 3BGMA 1YDPB 1ZOXA 1DL7L 1NDGB 3IGAA 4WI9A 5BOVA 4KJXA 2C0PA 1ACZA 3G5VB 5E8OA 2CIKB 1SJVA 1TFHA 1F3DH 1NUDA 5IFAH 2BOCA 1F97A 5ACZA 1JJFA 5FDWA 5GGQL 3L1JA 2A6KA 1A6TB 3I6KB 1IGYA 9CGTA 5AYUL 3CJJA 4L0CA 3X3FL 1CD0A 1BVKA 5KJRH 1CS6A 3OAUL 3PGFL 1OILA 4F7MA 4OF7A 1EA9C 2UY7A 3VXMA 3Q8WA 1PLGL 4QHNB 1MRDL 2FEEI 2UYLB 4XX1G 2JGMA 5DJ0B 5CIPH 1F11B 3LMJL 4LEXL 5JPMA 4X6UA 4AH2B 2HG5B 1BBJB 1I85A 2FL5B 4KRMB 3VMNA 4ODSH 1J88A 1E6OL 4Y5VB 5ANME 3OXSA 5C0JB 1AFVL 3CXHJ 4KDWA 5IFAL 3ZE0E 3DUSB 4ZS7H 4ZFZB 3SJVD 1UCBH 3WK8A 2YS4A 4UIKL 2Q3AA 3ULSB 2EH7L 3VI3E 1CD9B 2VZ1A 1VKHA 2OQIA 1YEEL 1FYTD 4LIPD 1LPPA 5HYJE 2HJLB 4JPWL 5E2TL 4OF8A 1CGSH 3S96B 3IDMA 3ZKMC 2WJ3A 4HWEH 1I4FA 5DHVB 4EI5A 4WWKA 1QYGL 2ZNXA 1RWQA 2JGIA 1Q83A 5AG8A 4Z7OE 1FL6B 4CG3A 4XCYB 4UNUA 3CZFA 3N85L 3BUYB 1ZLWK 2PVSA 2G4LA 4WDQA 3AREB 2LE9A 1GRWA 3VXUE 4GO6B 5CEXA 2ENYA 4FLFA 2DQZA 2AEQL 4UDTA 2HYMA 3WL9A 2MKLC 4KE7A 5ALEA 2XUIA 2EXYD 2A1WH 3P73A 2IAMB 4Y1AB 5CXXA 4CIAA 2UZYB 4QA9A 4PGBB 2ENSA 1BIHA 4KRPB 3EZJB 2VAAB 2D2OA 3U0PA 5TF1H 2NX5E 5E6ZA 4OLWL 1CXIA 1IGYB 2NMSA 3F62A 4U1GB 4G8EA 5ILTL 3UTSE 1JFRA 3H9SE 1DLFH 2XZCH 5HI4C 4EKXA 2XUJA 3I50L 1SY6L 5D9SA 2J4FA 4KJPC 4HPYH 4HCRH 4LVHB 4U4BA 1FE8L 5IBLC 5B39A 1KLFA 1FLRH 2DQHL 2HN7B 3JTSA 3T04D 3RZCA 2G9HB 4Y5VA 3KPRB 2VDLL 2XA3A 2C1OB 1VGEL 3W9EB 4WY8A 5GS1A 1X4YA 3HMWH 3ALWA 1OPGH 3WYDA 5IEHA 4OU5A 2K1MA 5IKXA 1XCTB 3QG7L 3QUKA 5BVJA 3A6BH 3C5SB 3O4IA 2XWBA 2YD2A 1LP9B 3IDNB 5GRZA 1S7VA 4ZUVB 1DWPA 5GGRB 2PR4L 4J3WA 1B0WA 5CP3A 1LO2H 5AOAA 4TSCL 3WLWD 1KIQA 4CGTA 3DETD 3TO4D 5DEGA 3BPOB 1L0XA 1UA6L 3EO9H 1I1FA 4JFDE 4N0RA 1A6TA 1Q9KB 3BIXA 4LPXA 3QO0B 3IDJB 1IM3B 3LH2H 4U1NA 4FFVA 2V2TA 3CX5J 1S9WB 2H45A 1F8TH 3WEXA 5HVWA 3CLEH 1UZ8A 5DTJA 2KDGA 2EE2A 5GS0H 4JO4L 3RA7L 5TDPB 3NIFE 3PHSA 5C0JA 3ZLUA 1MWAA 1FC2D 4CADA 2VAAA 2HU7A 43C9B 1WCQA 2VDKL 2CZQA 2AXHA 1ZHKB 3O41A 2VA9A 1CQWA 2IX9A 4KZDL 5IHUH 1CICB 2AJZA 2R8SH 5IT2L 4ZPTB 5H3HA 2EE9A 3WNOA 1FNFA 1KIPA 3U48A 1QRND 4XBEH 3VD5A 4FQXC 3LCRA 2HRPH 1Q8MA 5DC0A 4M9OA 3CSYA 4EI5B 4OD1H 1A9EB 5FHAH 5J1AA 2OBGA 2V2XA 4JZJC 1ES0B 3PP3K 3PNWB 2ATPA 5DJXA 1RZKH 3IJYA 2WU4A 5AI9A 3MUGA 4BFIA 4J3TA 3F7QA 1ISPA 3SOBH 2ICEA 5E8PB 2WIDA 3KPMB 5HBBA 1WPXA 2HRQA 1F3JA 1S9YA 2GHWB 5DT1L 5JIKA 4XXDA 4AEHH 4B7LA 4NSKB 1KT2A 3ZYIA 4KUZH 5HHQB 1NKRA 4ZYKB 2M2DA 1IC1A 3HI1B 3Q6GL 4TNVF 3P73B 4YXHL 4NZTL 4HBQA 5CJ8A 5ICYA 1R5VA 5D7JD 1P7KA 1I3RA 4LBEA 1THTA 4K71B 4RBPK 2ADJB 3RUGF 1F4WL 5CXUA 4CVXA 4NN7C 4NNPL 4L3AA 2AI0H 2YASA 4OGAD 4BQCA 1LLFA 5ALBH 4ZAKC 4ENED 1KJ3L 1JNNH 2B4KA 1A2YA 5DQDL 4X7TB 4Q9RH 1FFQA 5EG6C 1S8OA 5DJCA 4MSWA 5ALSA 4MHHG 1IM3A 3EQ9A 4RFEB 3VFNA 5DRWA 4OLVH 5EUOE 5DFWH 2R9HC 5AD0A 4Y0GA 4L4VD 1QEWA 2CLZB 5CSGA 2XE4A 3NFPB 1UM5L 4TPRL 4Z9KB 1SEQH 1PG7H 1SHMA 1EGJA 3C08H 1JZ4A 2K9UA 1CBVL 5HD8C 3ISWA 3UC0L 2PXYA 1F02I 3K8LA 3X3GL 3L1OH 3V5KB 4UBNA 4NKOA 1JPGA 1S7SA 4PJBA 5CZVL 5HK8A 2OL3A 3SQOL 4C4XA 1JI2A 1VB9A 1H22A 4FNGA 5E6ID 1CICA 3JUZA 3QUKB 2D4DA 1ZVYA 3IDIB 4B80A 1Q0ZA 4M43H 1PBYA 2CUMA 3OXRA 5JW3H 3NFNB 4QRTA 5CD5D 5K59E 1YS2X 3L5WA 4AIOA 1CFQB 3M45A 3SO3B 3PHQB 4HKBA 3RPIA 1DE4A 2CXKA 1EMTL 4HD9A 3R0MA 2XZZA 1QTRA 1NEZB 1OGAE 4N0YH 5K3DA 1AY1L 1AE6L 4GKNA 1F0PA 3GSQB 2ATPB 3I6MA 1I75A 1IL1B 4BFIB 1OY3B 3D25B 4UTBL 5E5RB 2HFTA 5CILL 2CKBL 3LV3B 3K2IA 4DFIA 1B4RA 3VFMB 1BQUA 3IDJA 2ICWI 3MRFA 2V2TB 2X44D 4C4ZA 4L4VA 1TQCB 5C0BD 1EAJA 3CFKA 4S10A 4NN5B 2WBWB 3HZVB 4OPMA 3V4VH 1CUWA 1R5VB 3QA3B 4ONFH 3AS0A 2A9NL 4L4TE 4N0YL 2IGFH 4CVXB 2NY7L 1I7ZA 3IFNH 3U1SL 2R4RL 1KC5H 2GW5A 5EC1B 4CADB 3L3IA 3IB4A 4G8GE 3DPBA 4PJBF 3KPNB 4TQEL 1QSZA 2YK1L 1WGOA 4JY6B 3P11H 2C3HA 1PDKA 4U1JB 3S98A 5IB4A 1T6VN 1T2QH 3NACH 4F58L 3LEVL 4R26L 1LVEA 2HVKB 4HWBH 4JM4L 3DURB 1DT5A 4KZEL 3SDAB 1P53A 1M4KA 1YMMD 3O8XD