3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
b'LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterochelin esterase
molecule tags Hydrolase
source organism Shigella flexneri 2a str. 2457t
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
4ODUB 1IT9L 1F58L 2ICCA 4I4CA 1WAAE 4I0PD 3FRUB 2XZAH 5AZ2L 3MRLA 1F3JA 4XCYA 4FNLH 4YDVB 5F7LB 5KJRH 3LB6D 3IFNL 3LSOB 4ZO7A 4RPCA 1S7XA 1ZT4A 3HI6H 3L3DA 1MFAL 2FWOB 3B9DA 4I5BB 3WDHA 4X80L 5IWLC 2BP3A 3ABZA 4PV8B 5C71A 5EZOL 4L3WA 1QYGH 4L9LA 2R23B 1TCRA 4LCIL 1BIIB 5K3FA 3VFPA 1U95A 4LNRB 4G6JH 2EH7L 4JVUA 3ZSSA 4KMTH 2GUOB 3OX8B 4PJGE 1WTLA 1ZI8A 2NY2D 1UM6H 2WQZA 4EY5A 2VKWA 1T4MA 3GBLA 1I9IH 4J3SA 1Q83A 1ZJ5A 2WJ4A 5L2JB 3MXVL 1FRGL 5EO0B 4ZI5A 4U0RC 2NY4B 3K1DA 4HBCL 4OKDA 3D4LA 1D5XA 4HG4J 4NO0A 1LHZA 3LRSB 3Q1SH 4DVBB 4YHPB 5TH2B 1MCCA 3HZOA 1T2XA 2Z9TA 3HC3H 3DUHA 3C6LA 5C0ND 1IC5H 1L7IL 3P9LA 2YD4A 5FAAA 3TBYA 3UPRB 4NCDA 4B85A 4HVTA 3AU1B 1MJ7L 2FJ0A 3R3WA 3PGFH 4JDZB 2RBLA 2YRZA 1VKXA 2YEZA 2IQ9L 1WIUA 2EYRA 1ULVA 2MHAB 1EEQA 4CIAA 2Y07H 1XRMA 2V6HA 3V6OC 4HLJA 1BZ7B 1Z9SA 4MAUL 1BFTA 3MRKB 1IGFH 3S88H 2CRMA 4K94H 4NYLA 1GGBH 5T1KB 5D2NC 2XQKA 2BFNA 2C3VB 1QNZH 2NZ9C 3JV5A 5LQBL 1MCEA 1FNLA 4UBNA 5KG9A 3LY6A 1S3KL 2C4FT 2VWEE 4U6YB 1UM5L 3TJMA 4MQ7A 4WU7B 4K3DL 1QZ3A 1FSSA 1IEAB 1BP3B 1KCVH 1YMME 1P7QB 3AS1A 1SCIA 1CVRA 3JWDL 2E7CA 3QUXB 4L3ED 2Y1KA 1O0VA 3FT4A 1XROA 4WVRA 5CEYA 1UC6A 4PGDA 2EDTA 1AGDB 4AB1A 1MQKL 1SJHB 2NY5C 3OKLB 4K3EH 1JNLH 1HI6B 3HS0B 3HZVB 4NM4L 5TFSL 1IL1B 1QZ1A 3TIEA 1BAFL 1RJCA 3U1TA 4HW6A 3TESA 4KRPD 1DBJH 4OCMC 5FA4A 3ILSA 5DRNB 1BBDH 4E15A 1HHJA 2R4RH 5EORL 2W0LA 3DX6A 1BOGB 5HTSA 1QUNA 5I19H 2FZ3A 4I8DA 4RMQA 4EDWL 1W4LA 2DL9A 1EI9A 3HI5H 5A40E 3DXAD 3A6BH 2BHUA 4LHUB 1U9KA 2PUJA 2YMXH 1S5HA 5SYNA 4BH8B 4G80A 4QE3A 2V9TA 3RWHB 4E5XB 2X44D 4U1LA 4MD5A 3NOXA 2P8LB 4F2MA 4NRZA 4QTIL 4FLEA 4JFOB 1I85A 3QO0A 5HK9A 5IMMB 5CSZA 3HNSH 3IKCA 4EY4A 3PABA 1T21B 5JPMB 1NAMH 4FP8H 3MLSL 4P23D 3SDAC 4LVEA 4OIIH 1G7PA 3ICWA 4Y4KC 4QNNA 5CLWA 3H0TB 4UFPA 2OZ4H 4QXGL 3MODL 3MRJA 4Y2DD 1A6AA 3S5LB 3E6FA 5BZWA 2WIDA 4O08A 5KSAA 4W6YB 4PJBF 3HLKA 3NWOA 4WFHD 4NOBA 2IQ9H 4QHKI 2Y6UA 1JP5A 4K5QA 1OAYH 2ZOLB 1F0PA 1P1ZB 2YRPA 5LWYH 1MCOL 1AQKL 3INUH 4LGSB 3SE9H 5JXAL 1CL7I 2RAUA 5INDA 5TE6L 4K94L 3QXDA 2ZUUA 2D7NA 4OF5A 1A6UH 4GRLA 1EHNA 1A6TA 1RZKC 2HKHL 4ZUTA 2VIRB 1MIEL 4F0JA 4PJHE 1DQYA 5FP0A 4Q74A 4X6DE 5K3EA 3KPMB 1T2QL 4JZOB 5F9WB 4NWUL 1QKZH 3OB8A 1R5WB 3UTSE 4MWFB 1VA9A 2A38A 3VFRA 4WWKC 5F3BA 2D3VA 1AC5A 4P46C 4JO4H 3FFDA 3VA6A 4RA0C 1CGSH 1VA4A 4JN1L 1PFCA 4Z0XB 5CXUA 4LPCA 2OL3B 5DJDA 3S3JA 1NSNL 3W5NA 2CXGA 2DTML 5A71A 4Q9CA 4DFIA 2IQAA 3H7BB 4WNQA 1T1WA 4FQXD 4KK9C 3QQ4A 3SQOL 2H2PC 5A6VA 3RGVA 5EU5A 3DUSA 3ZKQD 1IMHC 4TVPH 3V48A 3TBVA 3FWHA 2B61A 4FFVA 5I1GL 4JZJB 4KDTC 1ZGLM 5GS2H 4Y16A 2XN9E 3F7VA 4WJ5B 1FV1A 3C45A 3OC0A 5IF0B 2EH8L 4BH7A 3FYUB 1XIWB 1TLKA 4UT6H 3MRMA 5ALYA 3ARDB 1S7SB 4Z76A 2HJFB 1EERB 3MYZA 3T08A 4RMWA 5D7LB 4LLWB 4AMKL 2XKUA 3L95B 1GGVA 1ETHA 1ITBB 2G5BA 3JVGA 1KTLB 2IAND 1MEXL 4AM0B 2MQCA 1YNKH 4JO1L 1C7SA 4P93A 4R3SB 3A6ZA 4RNRB 2R0LH 4V2CB 5D1XD 5CEZE 3DUSB 3HFML 4XZUB 1PY4A 1W72A 4URTB 3O41B 3FONB 2NPLX 3ARUA 3C6SA 3VFNA 5FYKL 1XF5B 3O9WD 3ETBF 1JYNA 3EYVB 4BSVB 3NCYS 5HBBA 1DCLA 3IXTA 2AEPH 5HYSG 1XT5A 3RA7L 3QUYA 1KEMH 2EE9A 3P77B 4HUVA 4L1DA 4GXNA 4OZIF 2AVGA 4UIKH 4AZ8A 4PLKC 2F53E 2AEPL 3MGTA 5DGRA 2O5YL 3LS4L 3EO9H 5GISH 5KVDL 5IJVB 3H9SA 5I71B 4I3SL 2A6DA 3OHXB 4NRXA 1MWAL 3MUJA 1X6LA 1NUNB 1U3ZA 1CDHA 1YECL 1A22B 4MNGA 1LK3L 5K9KA 5HGAB 2WILA 1AR1D 3QUZA 1YEFL 5CT4A 1CGUA 3MV9E 3MUZ1 4XXDB 4DUVA 4XMLH 1LK3H 4QRPD 4X4YB 2DQHH 3LZFH 4MS8D 5IQ7H 3CMGA 3CU7A 2ORBL 3QFJE 2MNUA 2CEKA 4WUUA 5E94A 5FXCH 3BOVA 4F7TA 5JUEL 4LHEA 1HIML 4M9PA 1OCWH 1W72H 1T21A 3GUTA 4Y2UA 4WFGD 4ZUUB 3AAZA 3OMZA 3QNYA 5T1LD 1OSPH 4MGXA 1L7AA 2UZYB 2VF2A 5FF6B 3WKBA 2B5IC 4KYVA 4W9RA 1WGOA 1HNGA 3K80A 3SY0A 1X5FA 4JNCA 1BEYH 1CDBA 5LGKA 1PKQA 3IUJA 3VVLA 1MNUL 3EBLA 1HDMB 3TGXA 4RMUA 3MZTA 4DKFL 4RX4A 5BOZG 3W05A 4H1LB 1OP3H 4QGYA 3SGEH 1ORQB 1JHLL 5JOFA 3H3BC 2Z0BA 3MRPA 1J1OH 4M03A 4C56B 4BBZA 1OGAB 2GJ6A 5ACMA 4XWGH 4PTTB 2GITA 5F9JB 4ODHL 5CSGA 2VISB 2VMFA 1YAJA 4J3OC 3ZL4L 3LKPA 4JHAH 5GGRB 1JMYA 4I0CC 3AVEA 1H8OA 3IVKA 2HH0H 3RJQB 4YHLL 2Q1EA 4J12A 1RJLA 4E41E 5J6HA 4AO6A 4PRIB 3EW3B 4ETQB 2C1PB 1RUKH 1TJHH 5ICYA 3QI9C 4XX1E 5GSRA 3TWCH 1C7TA 1DUYB 4PJDA 1CBVH 5KTEH 2QHRL 2EDAA 1EFXD 3HPJA 2IG2H 4OCYH 4OI7A 3N9GH 4X5XB 3SJVE 5CEXA 3DV6A 5JALA 1FFBA 5H35B 3REVA 2P5EA 5IESL 3BZ4A 1NGWB 3REWB 5ALWA 2Q7YB 1ZV5A 2DLHA 1FNAA 2XUIA 2YD7A 2HKFL 3STXA 4PJCF 3CFDB 2RAMA 1X2BA 4R2GD 2ZZUT 3QWOB 4FTVE 1L6ZA 2FECI 3ZLUA 1CGSL 4JEIA 1MCQA 3PV7A 3I2CL 1AXTH 2D31A 5D1ZA 2K9UA 1Y0LB 5ALBH 1RUQL 3DVGA 5D6OA 4PJ5D 1ETZB 3FRPA 3QULB 1A2YB 4M43H 3SDXB 1RULH 1ZSDB 3S3SA 1LEKA 4FLMA 2MQ0A 1C1EH 1FVEA 3PV6B 5HGBA 4DVBA 4JLRB 1DT5A 4QTHB 1MO2A 1RAMA 3QNZA 3VXSA 1FYTB 2P8SA 2ADIB 4UILL 3GHEL 1EXUA 2M1KA 3GNML 1FE8L 2NY0D 1SYVB 1GGUA 4UB0L 1KC5H 1WB6A 4JM2A 3OX8A 2YN3A 4PD4K 5C8ZA 3MJ7B 4KK6C 2X1XR 3BSZL 3VMNA 5DD5L 5C0BB 2VZOA 5C09E 3G08A 1LO4L 2ZYRA 2CSPA 4JPVH 2GBGA 3G6JF 4L8BB 1GC1H 4JM2C 1AY1L 4Y19B 4HIJA 4HSQA 4MWTA 3CDGB 2P5WD 3RY6A 2B4KA 1PZUB 5JW5B 1ADQA 3HUJA 2DQCL 3KVQA 3LSOA 5GGTA 1QRND 4K7PL 1MIMH 4ZOBA 4NZZA 1I3RA 2NY3B 3BT2L 2NQCA 4G8GB 4LNVA 4NO2A 1S7QA 1WC7B 1RVFH 1MCWM 3F6LA 1CLYH 5CXXA 5EZIH 3TO4D 1KBGL 4ELME 3BZFB 4NO2B 2YKLH 5GGSA 4ZFZB 5EU6E 4LCUA 4GUPA 2I07B 1CLYL 4QTIH 1MY7A 2LVEA 2NXZD 4KKBD 4HJGA 2OR8A 3DMMC 3KLAB 1GC1L 4HK0B 5J13C 1XGRA 4WHTB 4Q82A 1FL5A 1MHEA 3LKQA 1VEOA 1TJHL 5HDLA 2DQCH 4Y2TA 3G5XA 2DD8H 1H8NA 3WNLA 4U6HB 5AI6A 2D4FA 1OLLA 2JGIA 2O93L 2FECL 4GEGA 1XQVA 5CP3A 4MJ3A 5DSCA 3MLRH 1J11A 2AKRB 3QO1B 3VXTA 1JV5A 5I73C 4G4JA 1LP9E 2QL1A 1RIHH 4XWGL 1R24B 3LHPL 4UQ3A 1WLHA 3G5YB 4K3EL 5E6IB 3DO7A 2J4FA 3VRJB 3BGFC 4UPDA 1DX6A 4NPYA 1ZT7A 3VFUB 3RLIA 4WFIA 1CGYA 5ALZA 1WIPA 4MA3A 2XKNB 2OR9L 1QQDB 5HSFA 1A6ZA 4MAUH 1FCCA 2VN4A 4JHZA 1F45A 1NC2B 3BN9D 4NRYA 3OG9A 1TCMA 1FVDB 4PRHA 4X7DC 1YMMD 2VJDA 5F9DC 1E4KC 2AXEA 5DK3A 3CSPA 2ESVB 5LQBH 2R0KL 3ARFB 3ILPB 2ARJQ 4R2GB 4YNYB 3FQRB 1B6GA 3VDXA 1W72L 2NY5L 1WIOA 4YX2L 4OCYL 5EIIB 3NCEB 2WFZA 1DZBA 3E6HB 3T4YA 4YQXH 5LCVL 2OCGA 1T3FB 3IJHA 4MB3A 3DS8A 3MXVH 1T66D 1NCWL 2JE8A 4N0UB 5J12B 5DQJA 1PX3A 1KTDB 4U6VL 4UDTA 4YHLH 1EB9A 4ZXBA 5JDSA 4MDJA 3WFHB 4KZEL 4X9GA 1CN4A 2V7NA 4N5ED 1U8NA 1SEBB 3FMGL 4M62H 5DS8A 5J3JA 3C6XA 1D9KC 2W9DL 5A43C 4K55A 3IDYC 5SV4A 8FABB 3VFSA 3WEXB 2QQLH 2OJEB 3RIAK 1EUUA 1UZAA 5L8JB 3O3EB 4JAMA 3M07A 2XQIA 1HKFA 3O0RH 2ZUQB 2BAGA 2O2IA 3T1FA 4YBQC 5HHOE 3D3VA 1FGVH 1XLUA 5C0IA 4HXBH 3VRLE 3I28A 1KIQA 4UBJA 4JZJC 1ISPA 5CD5C 5E9DA 4V2IA 4ZTPH 3PF8A 3MRPB 3WNMA 3OG6B 4NBZB 1DBAL 2IMNA 35C8H 1M7XA 3BIKB 3IFLH 1EV2E 5D7LE 1DQDH 3UBXB 5ACZB 1TVHB 2WFLA 7YASA 5E5RB 2GJ6E 2P8MA 2UV3A 4P2YA 4PJDE 3AIKA 4H18A 1HOCB 4OZ4B 2VXUH 4NP4H 1MCPH 3ANTA 1Q72L 4LRIC 1K4DB 4MQMA 4PS4H 3SWWA 2WWMD 1A88A 2VDQL 3P0YL 1NAMA 1AI1H 2H32B 2ENYA 4CVUA 5AG8A 5D7SL 1YEIH 1PAMA 3GHBH 5KW9H 4PF1A 1ACYH 4PJ5A 3VXRD 4Z5RB 1A6PA 2GJJA 1ZWIB 3CXHJ 4Y2DC 4F7TB 1AD9B 3NA9H 1F97A 1JPTL 4J7AA 3VXRB 1KJ2A 4IDJL 3VGFA 1F13A 4IBLT 4G8EB 1OSZA 5HHVL 4I13B 2AV7B 1EVTC 1VPOH 5HK8A 1DQZA 3RBSA 3C8KA 4OB6A 3OWEA 4OZGE 5AEAA 4WO4A 5ISMA 1K2DA 1MFNA 2GIYA 3VFVB 5GS1B 5KVDH 5ALOA 4R97C 5FA3A 5HYJE 2WG1A 3RDTC 4OD1H 4BRSA 4J23A 5EO1B 4HS6A 2WLYA 4NQSA 5MP6H 4N1EA 5AKEA 4KDTA 4JY6B 5DYOA 4PRNA 3K2UH 4HRYA 2ZWLT 1L6XA 4TQEH 5CUSH 2CK0H 4JFXA 1I1AB 3GEWB 1DFBH 1HQDA 4LEOA 4BSVA 1I1CA 3WS6A 3WEXA 4LMQE 2Y7QB 1J5OH 2HVKB 2A9NH 1XF2B 4KTEL 4DCQA 2V7NB 5DS8B 4OGAD 5JDSB 5GPRA 1XKLA 3MCKA 2R0LL 4M7ZC 4P59L 1GGIL 3VKFA 3Q6FB 3KHOA 4A2MA 1JCKA 1KJ2H 4RFEB 2JJSC 1JF6A 3IFPA 3EYFB 3QUKB 4F7CB 4R3SA 2G5PA 3J7HA 3O4GA 5SWQA 2OM5A 4BQ6A 2Z91A 4NZTL 4AM0A 4PY7A 2B1AH 1RZKH 3KSRA 1S9VB 1YNKL 1CF8L 5FM4A 4BYMA 5FIEA 3EFDL 2VDKL 2XQFA 3F97A 4PRHB 3QJHB 1PSKH 4HTAA 1LBTA 5DYTA 4LGRB 4KZDH 4H25A 2XQBL 5E8NB 4DTGH 15C8L 3IVMA 2BSED 4JANA 1TITA 2OTUA 3WA6A 1ZGLA 4ITVA 1H3XA 5TQ0H 1P9MC 2HADA 1GQSA 4HUWA 2VLKE 4IRJA 4Y1AA 2IQAB 4Z77B 3MUNA 4RAUA 3FQTA 1OTSD 3EDJA 3V95A 2JK5B 4WDRA 1KELL 3QH3B 4GMTL 2OL3A 5FUZL 3BGMA 5GJTH 4Z0XA 1G6RH 1RZGB 4XC3H 4U1NA 2VZUA 3QO1A 4NFBA 2OZ4A 4O51A 2C9AA 2QQLL 4NQCB 4MWFA 3S37L 4WW2F 4D94A 4MB4A 5IBUG 1PKQE 1WB5A 4U6HA 2CMFA 1TPXC 3ZLQC 3IETB 4PB0L 3TC9A 3L1IA 3RWGA 1AKNA 2C3WA 4PB9L 1HBJA 4FTWA 3NH7H 3S35H 4HJJL 1A0QL 4XPAH 2JJTA 1NCWH 3GIVA 3TH4T 2XUFA 3KLAA 1IZ7A 4GKSA 3NPSB 3SCMC 4XPFH 1R5VB 1RZFL 4OGXL 2WHPB 3OTQA 3PWVA 4OV6F 2UY7A 4GUPB 3QDGE 4UBKA 4NQEE 4LVHB 1H2XA 3QHFL 4E11A 1CXIA 3LEYH 1SYSA 3MLUH 3B5HA 5CMAB 4Z7UF 4QNPE 2AJ8A 5YASA 3O6MH 5EZJA 2APTA 3MRDB 1QRNA 4ODXB 1KN4L 3TVMA 5FCUH 2X4NA 1G0YR 3WIHA 3Q5TA 1S9WB 1JGLH 3MLUL 3PQYD 5E6YA 1JRHI 1INEL 2FYYB 4ZTOH 3X13A 4ZYKB 5CSZB 4DSAA 1IAOB 2A1WL 3ARPA 3IDJB 4OZFA 1H0DB 4D0BA 3WHXA 2G2RA 1QSVA 4GAYA 4NT6A 5CINL 4FQ1L 2IAMD 2WSKA 3RHWF 2W9LA 1Z5LA 1HZHH 1W6RA 4J0CA 4KY1H 4Q58C 5I76A 4QT5A 3U83A 4POUB 4WW1A 3C5ZB 5E2UL 1BQHB 3QEQA 4NNYB 2HFEB 5CKAA 2BVPA 1ODCA 1Q72H 3ZKXC 1EK3A 4JFDA 4TSAH 1ORSB 1MNQA 1LO0H 4YDKL 4X6CF 3S35X 1FC2D 3U7WH 2DYPD 5JIIA 1ODSA 4RE6A 1Z9MA 2E6PA 5DRNA 2D7TL 3THMH 4UU9B 1LE9A 1EGJH 4XNYL 2JTDA 2XNAA 3L3HA 2FATL 3FCXA 4KRPC 5E08L 4GW5B 1JZ6A 1VACA 4HUUA 4JGMA 4L3EA 3EHBC 4WWKA 2PO6C 3WS3B 5LAXA 4NQEA 2CJUH 3U9PH 3L3JA 2DIJA 4P4KB 1ORVA 1MI5E 1N2RB 1RK0B 3V5HB 1IAIH 4A2LA 1JF1A 3BGAA 3FKUS 3W2TA 1MCLA 3EO0A 4KZDL 4BVLA 3VU2A 1CVSC 4HZAA 3CFDA 2VDLL 4RGOH 4CG3A 1TDQA 3LEVL 2RI6A 1GGBL 3H2HA 1H2WA 1LP9F 4HKZA 5EU4B 1PY9A 1YY9D 4ALAL 1OWWA 4MAYD 1EHYA 1YB6A 3WL8A 1NX9A 5H35A 2QR5A 1DSFH 4ZSOA 2ROQA 4KI1A 4JREC 3PHOB 3ARVA 3ZYJA 3GBML 5I1IL 2IPTH 2VYRE 3UJIH 3D2AA 1J0HA 2A77H 2UWEF 5GSVA 3CH8A 2GSGA 4PRIE 4E9LA 3IDIA 4ROTA 4FTVD 1T22B 2QZPA 4GG6A 4P4KA 2A9MH 3L3JB 1XGPB 3HC0A 3O6FC 43CAB 2OCKA 2E7MA 1KB9K 1U92B 4AN0A 2VAAA 4JFQB 1QACA 3ALXA 3LKPB 1SM3H 2ECFA 3RX5A 4QF1B 3KPTA 5L7XH 3JYHA 5CWSB 1EO7A 3LP5A 3R0NA 5I0ZA 2E6JA 4PTTA 3RQ3A 4GHWA 1MAJA 2BFVH 5F21B 4G8CA 3MVEA 5HY9B 1D7FA 3L7EA 3BWXA 2WWKO 4N5IX 3HB3C 2J6EA 4PJHA 3VGAB 2Q87A 3PHQA 1AR1C 3MGOB 3AZOA 4KROB 3ZE1F 1P6AB 4AG4L 1UWCA 4XBEH 3SY0B 4H0IA 4R4BB 1MPAL 4CG2A 2AJSH 4N0CC 4DW2L 2XMSA 4X6DF 1G7MA 1CDYA 3AAZB 3GRWA 2NLJB 4Y4HB 1A3LH 4MJ4A 4YDVA 4MWSA 1S9WA 2FO4A 4Y2VA 4UIMA 5E2JA 3ZT5A 4D8PA 2WIGA 3TVMB 4KK8D 3CFIC 4FNLL 1A3LL 4EJ1C 1SYSB 5ESQA 2E9IA 4KROC 4GI1A 5A2GA 2DQHL 4FQXA 5FOBA 5ID1B 2X4QB 5K9KB 2YN5A 4F33B 5C0DB 1F8TH 2YOCA 1ZI9A 1AC6A 2GTWA 4QKXB 1R9NA 5IHZA 1KJ3L 5TDNA 4KAFA 4X7BA 3VXOB 3OJ2C 4Q34A 4GKOA 3N1MC 3ZI7A 2G5TA 3PWJB 1W8NA 3SKMA 2AJYL 2NY3C 1F2QA 5SWSB 2QQNH 4P5MA 2HT3C 1UOPA 3IETA 4KUCD 3V5DB 5ICZA 4V1DD 2W9EL 5DD1H 4J7RA 3RIFK 1HQRA 4K3JH 1I9RH 4NQCA 4LCWB 1RHHA 2VTFA 1MRDL 4PRPA 3A2MA 3UPCA 3N2ZB 3T2NH 3WNPA 3BI9X 2E7HA 4WGWB 3QCUL 3HE6A 1MAKA 3A67L 4P9NA 4KE6A 4QA9A 4BCDA 2I25N 5BVJB 3KYMA 3NFNA 4R8WL 4WEBH 3RP1A 5AJHA 2W92A 4F80A 4MA1C 5D1XB 2RCSH 4TVKA 3MRCB 1FFPA 4QRRB 3HZYA 4NKDB 4ELMA 3QEUB 3IRZA 4XVUC 2A6KA 5FO7A 1MSPA 1LGVA 2BKLA 1GL4B 3PWLB 1S7RB 4IRSB 3IT8D 1OQXA 3Q3GA 1LPNA 5JATA 1EMTH 5D7LA 2PCPB 3RM3A 3OKKB 1XZDA 1BN7A 5EOTB 5AM1A 2FX5A 4NO3B 3ZKND 4RGOL 3ZTJH 5I1LB 2NY6B 3BP4B 3MRNA 4DEPC 5BOPA 1YQ2A 3ARYA 1Q0RA 4O9HL 2AXFB 1C8PA 1DSFL 4OTXL 3AY4C 25C8H 4XJVA 3MRFA 5DNVA 2VT7A 3QRFM 2ZG3A 1T1YB 3ZDZE 5E6ID 4KQ3L 4M6MH 4Z6AT 3NACH 3UC0L 2X4UA 4GG8A 2I60H 3P0VH 4X5LA 4QXTA 3S96B 3PHSA 3O0RL 3C43A 1FFNA 1IAIL 1Q9OB 5IHBA 3LHPH 3T3PF 1G9NH 5IG7A 4Y0GA 5AKGA 2ADGB 3IJYA 3CSYB 4KUZH 3QA3A 4YHKL 4ZPTB 3V6OE 3JV4A 1FZOA 4XTRC 1PQZB 3WWCA 1T7WA 4ELMF 1Q9WB 1RI8A 1P2CB 3SGKC 5C8JB 3GMLA 2K7QA 2V2WB 1XH3A 3R3XA 4ZXBC 1NCTA 4G43B 4Z8FL 4WFFD 1M6OB 1OILA 2VIRA 3WNOA 1MFEH 2BGRA 5BO1H 5JHDD 2A77L 1HXMB 3KR3H 3O4LD 3WI7A 4UT7H 3BRDA 3DSFH 1GYAA 4RMVA 1LLFA 1MIEH 5I17B 3QM1A 3WCYA 1LPAB 1X5XA 4EKXA 3DIFA 3CMOL 3MRQB 2ZSVB 5DD0H 3VXMB 2Q86B 4JFZH 2VERN 4XPHH 4G9DB 1JGLL 3ZKMD 2NTFA 5E56A 3ISWA 2H6PB 5SX4H 2FHCA 1TZIB 2AV7A 2WUFA 2C4HA 4MXWH 2XA8L 4HIIA 4FQQB 3TA3D 2NXZB 4JZNB 1SEQL 1PD6A 5I30L 1NJ9B 3WIHL 1E3QA 5JPMA 3U1SL 2AJXL 1CGXA 1I1RA 2VLKA 4Y1AE 2FBOJ 1AO7B 4X6UA 3QPXL 2BXYA 2WUEA 5HYIA 3GMMA 3FAWA 4PRDB 3E2HB 1IC4H 2KQNA 4G8DA 4WU5A 1R4ZA 2D7PA 3B2VH 4LRIA 4ENED 4LHUA 3QPAA 2YPKB 1JI2A 1IM9B 3Q48A 3QMVA 1YPZA 1ED3B 3EYOA 4YDLB 3ULVC 2GFBB 3O2WH 5JHDB 3DRTB 1EPFA 5I1DA 1MT3A 2FATH 1NMBH 5K3BA 1BM3L 3DSFL 5SX4I 1GH7A 3IDMA 3IAPA 1A14H 3L3KA 3RVTC 3LQZA 3D3VB 5CJXC 1ZVYA 3KAAA 1UA6L 1P53A 4R4ND 4O4YL 1JHTA 2DM4A 3EGSA 4IRSC 1IGTB 3X12B 4YR6A 4N0FA 1JN6B 1P69B 1NFKA 4NZUH 2YPLE 1CUAA 4U3HA 4ZFOL 2AERT 1CK0H 1ZHKB 5BV7H 4JREB 3G0IA 1WBYA 4ZSOE 3LD8C 4LAQH 1P7QA 4UDTB 1G7IA 2ACEA 5DQJB 4I9WD 1UGNA 3KYKH 3KNBA 4MJIB 3MFGB 6FABL 4PJXE 2C3HA 4KMQA 1F4HA 3JWOH 3A6CH 4CL7A 2C3VA 1MVUB 4LLVB 4B81A 4K8RC 3LN5B 1DDHA 4G8GD 2OCLA 1JZ2A 3WO3B 5C0GB 3IURA 1T20A 3QAZB 4Q9QL 4DM7A 2EYRB 4UOW1 1TETL 4JDZA 4NSKA 2HA1A 1HILA 1NC2A 4NRYB 1HSAA 1LO4H 3VXQB 1HKLL 1CUEA 1ZT7B 3VFUA 3T8XB 4YHPA 5TH2A 2FR4B 4I18B 5C0CA 1G6RL 1WAAA 2CMRL 5I19L 1RUAL 4XVJH 2I5YH 1VADB 4TSBL 1GPKA 4X98A 3FSGA 1G6RA 3DMMD 4XCFH 3VISA 2OS7A 4WW2C 3QHZL 2VXSH 2W65B 3MV8D 4AENA 2PTTB 2HA4A 1UK6A 5CBEB 5HPOA 5CJQH 2BY3A 5CILH 1FN4B 1QYGL 2F54B 4XP5H 2MCG1 5HF9A 5AO9A 4IRJC 1P4LA 4JJ5A 4QLAA 5LZ2A 2BUBA 1M7DA 5GJTL 4Q97A 4RWYL 1C08B 3RVXD 4K2AA 4Z7VA 4JY4A 1UH3A 2DJUA 1Y7IA 1RFDH 2L0DA 4GXUM 2NY6D 3OKNA 5CGTA 4HPYH 1JMXA 3WUWA 4WHTA 2IF7A 2ZOKB 4IRZH 4OCWH 4X6CA 5LZ8A 1LDSA 3VI3E 5KVGH 1BHGA 3HNVL 1VPOL 3KPOB 3FBWA 4OZIA 1ZHLB 2X8BA 3GRWL 2CRZA 3MRLB 4BAZA 1KYOJ 5ALNA 4NJAL 1LDPL 4OQTL 4YHZL 1IGFL 2QVBA 3IFOB 1FQ9C 5ALPA 1PVHA 3CLFH 3H9ZA 3O9VA 1BGXH 4S0TD 2IFFH 3WFBL 3UTOA 3SGDI 2Y1VA 3GHBL 3K2MC 4WUKL 2DQDL 3DTXB 3TNNB 2XMBA 2HT3D 1M7DB 4HWEL 2OK0H 4X94A 4X99A 3T3PE 3RVWC 1FIGH 1MHHB 3MNVA 1BFVH 3GMNB 1QHPA 1U3HC 4L9LC 3T0EC 1FN4A 2F54A 3LDBB 1K8IA 5IWLA 4QRPA 3K2IA 2W9EH 3CDGA 5KVEH 3HE6C 3DX8A 5B38B 2IGFL 4OZIB 3KPOA 5J06A 2VLRE 4JHWH 1CZ8L 3C9NB 4PP2A 3MV01 1UM6L 4C58B 4OZGB 4PS4L 3TT1L 5DD3H 1ZJ4A 2PW1A 4GAGH 4N1HB 4KDVA 4IJ3C 1HN1A 4AZ0A 5KSVB 5JZSA 1I3UA 5GIRB 2RIKA 1CE1L 4KEAA 1KLGA 4YWGL 4MVBC 3VXSB 4QHMB 4BTLA 2PXYC 4RWHA 1RK1B 2ATPB 1X7QA 3HI6L 2X4RB 9CGTA 3RU8L 2PTTA 4YZFF 1U58A 3BPNB 1GAFL 5F7KC 2F5BH 2IPUG 4HC1H 5D1ZB 4KACA 1OAQL 1UJTA 3QXAA 4EI5A 4YHYB 1JZ3A 1OOAA 3VJMA 3T8XA 2CIKB 1OTTC 2K3TA 3CVIH 5FYKU 3SDDB 3KPRD 1IGCL 3TBSB 3SPVA 5HQ3B 2F53A 2YHGA 1BQSA 2XT1B 4ZMAT 1IFHH 1MN6A 5D7IF 3OXRB 1HSAB 5BZDB 1HILB 5B38G 4BC0A 4YFEA 3MA7B 4G5ZL 1R3IL 3VD5A 1OD7A 1JVKA 4ZV9A 4X5XA 1NMCC 4Q7DA 1TNMA 3KPNB 2DQEL 4JM2F 4P5KB 35C8L 4W81A 1E66A 5C0GA 3VFGL 1T03L 1DUYA 1N8ZB 1DDHB 4NJAH 5JMRA 5GS0C 2Q76B 2ILLA 1ZA6A 4YBQD 5BMFL 4HS8H 4X0KB 4ZWNA 4JCLA 1RJLB 4N0RA 5KVGL 5I73B 5ID0B 2X4PA 1I8KA 1I1YA 2EH8H 4S0XA 3FB5B 3GSQB 5DJ6B 4C83B 5M94B 4P5TA 4C01A 1J05A 4HX1A 4H7FA 4JE4B 2APBA 5ENWB 2XWBA 5FHBL 3S97C 4R26L 5IGXH 1HK6A 1KU0A 2EDRA 1ONQB 2HLAA 4XBGB 5IW6B 4GKNA 4Z7NF 1MY5A 4QWWA 4OB5L 2VZ3A 3KPRE 3IGAA 4PGCA 3UX9B 4QHLB 3O4OB 4MCZB 1X5AA 3QIWB 4P2QD 4RGMC 3Q6GH 4EUPH 1I7RA 3HR5B 2H3NB 2Z8ZA 3QHZH 4JZNA 4QGTA 5AUMA 3GBNH 1IQDA 2XTJE 3HRZB 3ORJA 5HYJB 3J8F7 1YNTB 1NU6A 1QSED 1HHHB 3O6LH 2R0ZH 2OCIA 1X5IA 4GH7B 4EY8A 3ES6B 1IEBA 3T0EB 2ONCA 1U3HB 2R1YB 3OR7A 4HGWA 3U9UA 4D2NA 2K1MA 3P4NB 2W0FB 4Z7WA 4N8VA 1EEYA 3I6ZA 4LLDA 5T3XL 4XNQA 4KHTL 1P4BH 4WU5B 5ALRA 4IMKC 5I8KL 3HLAA 4ARBA 1R3KA 4PG2C 1L4IA 1KEGL 1HXMA 2L4OA 4OD0A 4JR9H 1MI5A 3L5WB 4JFEE 4MXVF 1Q0ZA 3FHQA 2WFMA 5IFJA 3H8NA 2JB5H 2B1HH 4Y2DB 5D7IA 4Y2XA 5BV7L 2V5MA 2BK8A 3AINA 1LO0L 1UB5B 4XB8A 3WLWD 5D2LF 5JIKA 2VATA 4X91A 3V4UL 1XZGA 4P46A 1U6AH 2EDXA 3T4AA 3D85D 4F7MA 2UZ0A 4XVUD 3H9SB 1AE6L 4N90E 5IJVA 1O6FA 1CUDA 2CQVA 2ITCB 4GG8B 5CS7A 3O9MA 4NHCL 4NHUB 1L0XA 4QRTB 2LTQC 3SJVD 5ALGA 1H8SA 3QPQC 4LVOB 2Z92A 4AEFA 3DXAE 3DXAB 5DRXB 5A7HA 1UJ3C 1NLDL 4DMCA 3C6BA 4UHCA 2UZIL 2BDNH 5ISZD 1DE4A 5I1JL 2DWDA 3T52A 3I75A 3H9SD 4LVNB 5E4YA 4PJGA 2WIKA 1UKBA 3B2VL 1CUSA 2XUKA 1LGYA 3LKRA 2IPKB 4DGQA 2VLJE 5DJCA 2PXYB 3NPZB 4EBQH 3QDMD 4ZPTA 3IDUA 4HS3B 3I2CH 1Q9OA 4POZD 4RNRA 1J0ZA 3D9AL 1EAJA 2A6KB 5FO7B 1CFNB 4EBBA 4TTDC 4APQA 5HGHA 5HI3D 2X89D 2XI4A 3JVGC 5BXFA 2X5PA 4WCVA 1T1YA 2J12B 5E99H 2HFFA 4QHKJ 5DMYA 5DZNA 1RZ7L 3S36X 4FNGA 4ONGL 3U0TB 3HE6B 5EPMB 3ULUL 3RWIA 4OFYD 5KTEL 1XIWA 3CMOH 2WUGA 3QEQD 1FV1B 2EICA 4JN2B 2LU3A 5DD5H 5D2NB 5DGQA 2Q20A 1GKKA 5IESH 1BIHA 1A64A 1H3PL 4PGBA 4HJJH 4XPAL 5KANI 4S0SD 5E2TL 3V79C 1MAHA 3RGVC 2WIFA 4IOFC 5FOJA 5C08D 3GSWB 1S7RA 3H2WA 4NHUA 4QRTA 1PV1A 4OCRL 4WNQB 1KELH 4GMTH 2B4CH 5HGHB 1P4IH 3WIOA 4NKOA 3WMSA 5IFAH 3VCLA 1MRFL 4MHHI 4QOKE 4DKAA 4TPKA 5ESAA 5ALQA 2DI9A 2X4QA 3R3YA 5FOBB 1ZMYA 4AEIH 3BUTA 4DNPA 5D7IB 3DARA 1OAXL 3KPMA 5AKYA 3RGHA 2E7BA 5INCA 1CTOA 3I75B 2DAVA 1E4WH 5TQ0L 5L2KE 4J0HA 3L5WA 1RPQA 5IFHL 4GRLB 4HKJB 1UEMA 3F58H 4RDQG 3DXAA 3BH8B 4X6EB 5DRXA 5E00B 2B1AL 5MERA 5F7EH 1BBJB 3MLTB 4P5MB 5HVWA 5SWSA 3V2AR 1MCDA 5LKRA 1RZ8B 3GSXA 2P47B 3HR6A 3U46B 4HV8A 3IDXH 3VD9A 2GYVA 3P4NA 5E7FA 1G7QA 1U8LB 4PJHF 1CLOL 4LARL 4RMTA 4U1HB 3KPSA 4PJ7E 1UK7A 4WO4C 2GTWB 5HYJA 3SOBH 1HCVA 3MRRA 3PHQB 4JKKA 4QRSB 1F11A 4JFFA 5HD8D 4ZNCD 2VB5A 1H2YA 2R0ZL 3LKSB 3W0WB 5IFJB 5AIBA 4XAKE 3BP5A 3RTQB 2HA7A 5I7UA 2GY7B 5D2LA 4P57A 4YHIA 4JFOA 2IAMC 4XVTL 4LLMB 2XUPA 4JFED 5DUBB 1QR4A 2RB8A 3I3BA 1ONQA 2HLAB 3VMOA 2EIZB 4WI6A 3FO2B 5AP9A 5FYJU 1KIRA 1VLQA 2VQUA 4GAGL 4GT7A 1KXQE 1HHKA 5D5MF 4M6NH 3T0AA 1O5DT 1XGPA 2UWEA 5DJAB 2J5LB 3MJGX 3X3GH 4X0KA 4AXBA 4RFNB 3MGOA 1ZOIA 5EOQL 2GYSA 5AUMB 4PJHB 4Y4KB 1LO2H 5T1DH 4UNUA 1NCBH 1NGQL 4R90L 3MV8A 2QUBA 1A7NH 1A7RL 5DO2D 2GBFA 4QOKA 4RFOH 4OD3H 3RIFF 4OFDA 3AS0A 4NZRL 4PGDB 5DMJB 3BDXA 2XZAL 3GFUA 4DK6A 2FO1A 1QFWL 1U92A 2CIKA 2WU4A 5I1HL 3PL6B 5AHXA 4J0JA 2BRRH 4HIXH 1NGZA 1BFVL 2X4PB 1OTUD 5C0AE 5HHXL 5ALMA 4P4KC 5KG9B 4GG6B 1QPPA 3U30B 1ZA6B 1QRKA 3RWEB 5IK3A 3VFTB 2F8XC 4JPWH 3LMJL 4HPYL 3D3NA 1A7PH 1P7KB 1DBAH 2F5AL 3IFLL 4P5KA 4WI8A 3EO9L 5DHVA 3F96A 5F3HA 1UB6A 5HDOA 3CFCL 1WM1A 3R1GL 2FEEL 1YA4A 4WGVB 4OCXH 3BD3A 5FDWB 3JTTA 1K3IA 3TBYB 2R2BA 2HFEA 4S1QH 3RAJH 4DUXA 3SPVB 4PJXB 3QI9B 2ARWA 2VAJA 4QT5B 4Y4KD 1QVOA 4KI5D 3PWPA 4UBIA 1IGMH 5EO0A 1KTRL 5LKNA 4QEKA 1QFWM 2JIXD 5EUOF 2MKWA 3WHXB 1NPUA 7CGTA 1T1XB 3P11H 4UV7L 5I1CL 3RA7H 3H2JA 3WS3A 3VG9B 2X2YA 2DTMH 2WBJA 2NY1D 2QOEA 2J88L 2X1QA 4BK4A 1ZA3A 1ES0B 4N0YH 2X4NB 4L4TE 3VXNB 2VLRA 3ARBB 4XNUH 4YX2H 3LH2L 4C4KO 3BF8A 3S37X 1ZHNB 3V5KA 4OM1H 3X14B 1CIDA 3QFJA 1A9BA 2CPCA 3OQ3B 4S1RL 1DANT 1MCWW 4AT6B 3HACA 2R8SH 4K8RD 5DMKB 4U0RB 1WHSA 4J0GA 5GGTL 4ORGB 1EJOH 3BHBA 2Q0XA 1N7MH 5ADOH 5AKXA 3STWA 4JHBA 4HEME 1IUOA 1IAOA 1AQKH 4K7FB 4L4TB 3RL2B 1PG7X 1NUFA 2FYYA 3AM8A 3B8SA 2Z8RA 1I6WA 3WWDA 4G8IB 2NTSP 5I9QC 3ZE0E 2W60A 4LCCC 1X5YA 4RGNC 2X09A 4OF6A 4EHBA 1P4LB 4JJ5B 1YEGL 1QRNB 4ODXA 4PRPE 1CICD 5EUOA 2H7CA 4LXGA 3FOMA 2H9GA 3MRHB 5KSUB 1CUGA 3MREA 3P73A 4DNQA 4XP4H 4K7PH 4U6TA 3DETD 4NWUH 3QH3A 3E0XA 2OMNA 2WJ6A 1AXSA 3AREC 3QCTH 1MRFH 3RPKA 3PWVB 3ME0A 4HJ0C 3GKWH 3D3VD 3EKCA 2BCKB 2VDOL 5SX5H 5EHQA 1TFHA 5ALXA 4LSSH 2UZIH 3T0EE 1A3RH 2B4CL 5DWUH 3W39B 1UM4L 1SBSL 1FZKB 3MV7A 5E8NA 4TSCL 3V6BR 4IDLA 4NC0B 3ZT7A 2J3SA 2CDFA 4CIBA 4BJLA 4TTDD 3RNKA 4NFCA 1XEDA 1C08A 4XCCL 3LIPA 4FFZL 4RRPA 1KSRA 3KXFE 4CCYB 1KENL 4NQXB 2JGLA 5ILTH 2UZXB 5GS0H 5IEHA 2DFPA 1CFSB 4ONFH 4XWGA 5EDXA 4TNWK 4BA8A 2DQTH 5IVHA 5SWQB 4EOWH 2XZZA 2PYED 1UKSA 2AQ3A 3CUPB 1AE6H 3FL7A 2EE2A 3FB8A 4NZJA 4FHZA 4AO8A 1S9KC 3G0GA 2OTUB 5MI0B 3SDCB 3TO2A 5C6TL 1YUHB 4F9PA 3S88L 5I30H 4HIHA 4NC1C 2ADFH 2QSCH 3KJ6H 4EBQL 3TRDA 4WI2A 5AK6A 1NU8A 1OVZA 1FZMB 4NN7C 1EFXB 1MF2L 2MPAL 4HG4K 5C0BD 4JFXB 3KYAA 2OI9C 5FB8A 5ADOL 4MXVE 5TGBA 5FHAL 3LQZB 5E4JA 1WFNA 1MVUA 4P3DA 4KHTH 5CZVL 1WQVT 3HC4H 4NWTH 4F21A 4HWUA 5IB3A 5E8PB 5BVPH 5C2BL 3KNBB 5HYJD 2F19H 1MVFA 3AZQA 4X7EC 4J4PC 1U8OB 4R7DA 2PL5A 3FVRA 2GBIA 3MRBA 5HHQA 4EVNA 1UYWH 2VJAA 1WBYB 4N8CH 1RJZA 3FZUD 1BBDL 1IGML 1KPRA 4GG6F 5DD6B 4KMLB 5F44A 3FN0H 4BKLA 4XH2B 4H5SA 3LV3B 3STTA 2VLKB 4ISVA 4P5TC 2FNBA 1EDQA 4M0FA 3GI8L 4Y89A 1KJ2B 2Z8VC 2QQQA 1MFAH 2B8OT 3TNMA 3KLSA 2Y06L 1KGCE 1OAZL 1VHPA 1RHFA 3FZUC 1JWSA 4Z5RA 4G8FB 2R29L 2XMGA 1LP9A 5DQ9A 3QPDA 4XMPL 1BVLA 5GRJH 4BFBD 1CYGA 3CN9A 4HCRL 3H19A 1CD1B 3C2AH 3AS2A 2FJFB 2GZSA 4G9DA 3WLAA 2FB4H 5FA3B 3CVHL 3LQAC 4OJFH 4U1GC 1HH6A 4PUBH 5IW3A 3VXUA 4PRDA 3KLHD 5H94A 5GGTH 3HCVB 1ZIYA 1D6VH 4JO2H 2Z8SA 4R8WH 5DQ9B 2ZSHA 2VTVA 2XMQA 4RIRA 4OLWH 2WG0A 2Y07L 3I6LD 1NCNA 3JWNC 1XF3A 1HSBA 4ODWA 3TA3A 3VJLA 4RFOL 3TNMB 3FO9A 2HT2D 4HIIB 5F96L 4S11A 5IVXF 3HE7B 4M48L 3IRPX 3WFCL 5D1ZD 3R3UA 5GGQH 5GRYA 3X3HA 2CK0L 3AB0C 1OB1B 1H3UA 3BDYL 1K4DA 4QHUB 3WFHA 5EFIB 3PE6A 4BC1A 3C5SA 3MRQA 4YEEA 5LJYH 3I84A 2IBZY 1OPGH 3K8MA 4PGJA 5LVEA 3R0VA 3WZLA 3QDHA 2VNCA 4CGTA 3VXSD 1K6QL 3V7AE 3Q5YA 1J1IA 2OPHA 3O2VL 5DDHA 4YXLH 4JFYB 1GXSA 4DFHA 5EC1A 5E8PA 1VE6A 1EO8L 3TT1H 1KEML 3UUEA 3AZPA 5IJKA 4HZGA 3T4YB 2QQNL 4FOLA 3D2BA 3BP4A 3FO1B 3BJ91 2DQEH 1U41A 4LCIH 3WXWL 3BRGC 5I1LA 4M7LT 4WFFE 5DJZB 1T5WB 5HHOD 4M6NL 1EFXA 3DVNB 2PCPA 4P3CL 4CU7A 4ONOA 3MNWA 2KZ1B 5LKAA 1IZKA 1JTTA 2IALA 3PWLA 2PU5A 5D6DC 2QJRA 5B3NA 4LLAA 1XFPA 2PUQT 4D9QD 3UMJA 4S10A 4BCBA 1LD9A 2IANB 4M7JH 4F37K 3B5TA 3TO2B 5D93C 2CUTA 1R3HB 3HG1E 3ZE1E 2BVUA 1EVEA 5E8OA 5AD0B 5LZ4A 3DO7B 4HMCA 1NBQA 3VFOB 1BCSA 5BVJA 5CIPA 3OKOA 3WA7A 4R0LA 3O2DH 1EO8H 1WBZA 1RZJH 3CU1A 4W6XB 1DQJA 2B7DT 4OLZL 1MCPL 4P2OC 4P99A 4PRPB 3V6OA 3V0WH 4HPOL 1MHPL 4E0RA 3F7QA 1OPGL 4WW2A 1TIBA 5IBLC 2IFFL 4IS6A 3WFBH 4YDLC 2FHFA 4GAJH 1K5NB 4LARH 5T1MA 2ESVA 3N1GC 3Q3GB 5BWCA 2IANE 3SGJC 4HH9B 3LIZH 2IPUK 3BP7B 1MFBL 3IUQA 4JKPH 3QEUA 1FZKA 4Z7VE 4YC2C 2BSTB 5K33A 3RVVD 4NPYB 5E4EB 5D1XA 5CBAA 3DMMB 1Q9KA 4XBPA 1AKJD 1BRTA 4G8GE 1P0PA 1DN2A 3P40A 4KVNH 4HZLB 1RFDL 3DV4A 5ITBL 2DMKA 1P4IL 5KSBE 1V3JA 3FMGH 2X6MA 1ZD2P 4LCUB 3WFCH 2R4SL 5GGSB 4NQED 3K4AA 1U8QA 3NBNA 1DT3A 5D72L 3BDIA 5AK4A 4J0IA 2F74A 3T3ME 1IM3B 4NBXB 3BWUC 3MRIB 5AK5A 3BN3B 4WV1A 2XT0A 5IR1B 3GJFK 1MAMH 5CIPH 4Y4HA 2P5WE 2ZNWA 2KDGA 1X4ZA 3SKMB 2ZG2A 1WB4A 1G7MB 2VDLH 3I85A 4XPBL 3UTQA 2AJVH 2FD6H 3U4BL 4Y19A 5HZGA 2YPLB 5IMOB 1KLFA 4HJGB 4JFHE 3C2AL 5DMKA 1IMJA 2VH5H 3G08B 1UH4A 5B39A 2MCPH 5AM0A 4BZZA 2E5EA 4FQXB 2PTUA 3BKYL 3QIUC 2FIKB 1N5AB 5MEQB 5JZ7C 4KUCF 4H8WH 2VLKD 3F5WB 1N8SA 3VI4F 3B2UD 2E8YA 4O02L 5DF0A 4H77A 3F58L 3RDTD 1AP2B 4GBXC 2F19L 2DLIA 3D2UB 3GSUA 5CWSA 1NLBL 2OTWB 2R56L 2IITA 1H5BB 1XCQB 3BUYA 3WBDA 1CU4H 2G75B 5IMLB 2DHDA 1A6WH 1JU3A 5DC0A 1A2YA 5JMOC 4EXKA 3DVGB 4OPMA 2BY2A 3CGTA 5AKKA 3QRGH 4L8BA 5LYYA 2KKQA 3KS0H 4XPTH 5FKJA 1AD0B 4OZHF 5ALDA 5HYQB 2WZPD 3SDAD 5HYFA 1AGEA 4LPXA 5C0BA 4FQ2L 4OF3A 4RAHA 2ZJSH 4HAFA 3L7EB 5CAYB 4LPYA 5IH7A 4K2UL 5K9QG 3JTTB 1SYVA 4PG9A 4UOJA 1IC1A 5HF8A 1YN6A 1KLUB 1WT5C 2DBLL 3BVNB 1XR9B 2YKLL 2AK1L 1UB6B 4KV5F 2DLGA 5MHSE 3O6ML 2GKIA 3O8XA 3WUZA 5AM2A 2HIHA 1U6AL 3PF2A 3EO0B 3KYOB 2V5YA 4BK5A 3HC0B 2EE3A 2VQ1A 4P3WA 1C5BL 4AIXA 5B8CC 1IC4L 2JJUA 5F8RC 5T1KD 3E8UH 5D7JD 1WK0A 1VACB 4HUUB 5F89A 5JAPA 4Z7QE 3NGMA 4PLJD 5HFAA 4F58H 4U2YA 4F57H 1QFUL 2YR3A 4NN7B 2A6IB 1NGWA 3CJJA 4QNPF 4Z7UE 4GXUN 4MS8C 3DURB 4ZSOB 3RI5F 4AEHL 1ZLUK 1YN6B 1R88A 2GJ6B 4GS7C 4PG9B 4UAOC 4U1MA 3BGFB 2AK1H 4H1LA 2NX5D 3MUGA 5E6IC 1CDCA 4A6YL 3U7WL 5GSRB 4G3YH 4YPJA 1JGUH 4JFZL 5HYQA 5F7NC 4LHUG 1NCAL 5DI8B 5J6HB 1KXVC 5DJAA 2EIDA 3BH9B 1HHKB 3NIGF 4KY1L 4L4VB 5ELIA 4G7YH 3QUXD 3VD4A 1H5BA 4RQQB 3KPLB 2X05A 2BJML 3QXVA 2IBGA 3L1OH 2AAVA 5DUBA 3IU4H 1MOEA 4UBDD 5AKLA 5FDFA 1NGXB 5IB5A 3MBXH 1GJIA 2IMMA 1BEEA 4ODVH 5D2LB 1AMNA 1G7JB 1BE0A 2EYSB 4GAJL 1SEQH 2WM0A 1CICB 3MOBH 5SYMA 4EY6A 3ZKSD 1S3KH 4U2GA 3VFWB 1KFAH 1B0GA 2EC9U 5E24E 2WLSA 3WL6A 2QM0A 1B3JA 5DRZB 2CUHA 1QNZL 1QIDA 1EUTA 1H3GA 3HA0A 4GKSB 5IMOA 3I1IA 4NT6B 4HKXA 3HYSA 2WLZA 4NRXB 4O5LH 2PSEA 3W9DA 5AICA 3IDJA 1G7QB 2EEDA 3TBTA 5SX5K 4ZYKA 3B5GA 1KIUA 4XPFL 5HI3C 3ZYOA 3BDBA 2XICA 1IT9H 1VFMA 1WWCA 1IILE 3KR3L 3WLWC 2HT4C 1BBJA 3OGCB 1YA5A 2NXYB 4D3CH 5JXED 4RGNB 2HRQA 3K4ZA 2UUDH 2QEJA 3O6LL 4MQXC 4U6XB 3ED1A 4W1SA 4AIOA 1RUPL 2NY1B 2Y9RT 3O6FB 2JELL 5C0NC 3BESR 1ND0A 1CEXA 1XQYA 1UH2A 4YJZL 4AZ3A 2QQKL 3FONA 1BOYA 3IAGC 1OT2A 1J12A 1E6JH 3B12A 2E7LC 1UXSB 1V05A 2C4FU 5BS0E 2RHTA 3FAXA 2VQ6A 5IV2B 1W0WB 3ULUC 1ZGLB 1XLWA 4Y5XA 1QHOA 3GMRA 2VLLB 1HHIA 1TJIH 2X7LB 5D1QB 2WW8A 4DN3L 2NY2B 1T03H 5IKCA 2JIXB 3G6AA 5E2VL 1URLA 3R41A 4HUVB 1FNHA 4XNZB 5JQHC 5F1NA 2CJPA 5DJ0B 4OSEA 1I8IB 2AJCA 4HPOH 4NZDA 5E1AA 5GGQL 4WTWA 5K93A 1B0RA 3ZSTA 5JW3H 1S7SA 4Z76B 3BPLC 1DUZB 4IS6B 2X4TB 2YWZA 1ZIXA 3I2JA 1JNHB 2EDLA 1WCBA 1S9XA 3HKFA 5DUPL 3HFMH 3SDXF 2AXGB 1J07A 5H37H 1QG3A 2XTJD 1MAAA 1E27A 1Q8MA 1T5XA 3ZO0A 2AJZB 1WBZB 4MA7L 4OGYL 5F7YC 4QDUA 5CEZH 5KVEL 3RPIA 2VZTA 4OLWL 3UYRH 2HM7A 4LL9A 1ROWA 4LDOB 3BQUA 1YEIL 5AM3A 2H41A 4LVOC 1BJ1J 1J18A 3RPIB 1LD9B 3MLYH 2WWMC 5FOQA 1NBZA 1QOZA 3EOBB 5T3XE 2AXGA 4DCQB 4FBLA 1JGDA 1BWWA 1I1FA 3TVMD 4BUGA 4KK6D 4KRYA 1TZGH 3V7AG 2JJVA 5DJ2B 5MEPA 4LEOB 2PXYA 1B0RB 4YASA 4Y4HD 1FL3B 1KYOK 3P2TA 1EXWA 1T5WA 4TUKH 4XCEB 1NEUA 2IPKA 5F1NB 1T2JA 5IF0A 3BE8A 3C5JA 3GI9H 4MAYA 1WFOA 3WLBA 4WJ5A 3EOYG 4AMZA 3VH8A 3O45A 4NP4L 2Z91B 5HHNB 4Q1VA 5BOVA 2X7LA 3OB0H 1HKHA 2P8PA 3GMRB 3TV3L 5JW4R 3GM8A 2VABB 5C7XL 1UG9A 1G0DA 4WEUD 2LAAA 4H35A 3H7BA 1ZLSH 3FQWA 1Z9OA 1BX2B 3FJTA 2WTMA 1FFEA 4LU5L 3WJ2A 2CMRH 5D9SA 4UBMA 1FDLH 2HVKA 1XF2A 1GPOL 2VLJB 1WISA 4LPUA 3STYA 5DVMA 1I8MB 3TZVD 2XFXB 1XFDA 2DQDH 1INDL 4Y2RA 3GIZL 4YFLI 2RJMA 1T7XA 3UTTE 1I1AA 4L1HA 4PTUA 4Y2DA 1ZWIA 4OB7A 1FFRA 4P48A 5FHAH 3EDEA 1DWOA 3B83A 4JDTL 4OF8A 4PJBE 3UBXI 3RJDA 3WL9A 4HWEH 4F2MB 2OK0L 1JPGA 5CD3A 3FFCD 3ARQA 3R40A 3GBMH 1JT2A 5I15L 1RP1A 3QDGA 1FG2B 3BPOC 1ACZA 1R3JA 5E5MA 3BPOB 1W2KT 1RMFL 4FMPA 3SBWC 4JG0L 3AGVA 2EZ0D 1HOCA 4OZ4A 2DQFA 3CXDL 2NY7L 2R1YA 4JRXA 2OZ4L 4N9GA 4QXGH 5EWIL 4K71C 1JRHL 3QUML 3GRWH 2DSNA 2V98A 3BEWB 4O2EA 1YNTA 3CVHH 1QE3A 1JWSB 4FHBD 2XUQA 2E3JA 2H3NA 1FO0H 1I7RB 5IB1A 3W04A 4JN1H 4Z7UB 3LQAH 5EBWB 5HDQH 2BSSA 1L7TH 1P84K 4M7KH 4MCZA 5IMMA 1GOFA 4WFGE 4QXUH 2I5YL 4TSBH 3OKLA 4XH2A 4HGKC 4FFZH 5DK2B 3DEAA 3EQ8A 1NAMB 1UA6H 4TOYH 4DK3A 4OM0H 4C56E 1U8NB 4BH8A 3GKZA 1EX0A 4HMEA 3MGAA 2DQUL 4EUSA 3C5ZD 1FORH 3HMXL 1G7HA 3DUUA 3FB5A 3U2SB 5AM4A 4J0DA 4L8SB 2FZ3B 3DJYA 2AXJA 2GJ6D 2ZUXA 3DX6B 1DR9A 5I1EH 1QFWI 2JB6A 1L0YA 2HRPL 3HE6D 4LKCB 3UO1H 3CK0L 1U8EA 3KOOA 4XGZB 5EU3B 2QUAA 1QA9B 1W76A 5ALKA 3P9MA 5CZVH 4LPWA 4GOSA 1E28A 1EZVY 1XF4A 3TCLB 2NW3B 4APQD 3QYJA 3A0OA 2XWTA 2R9HD 4MNQD 4WWID 2B1HL 3HB3D 1DEEB 2GYUA 5D71L 4EOWL 1A7OH 3HG1B 3P4MA 4H7KA 3U30C 4FFYL 3G5YA 1WZMA 4HT1H 2HA6A 3IUMA 4YFLF 3U48A 4OT1H 4G6AD 1U3HD 3BKCH 1BVKA 1U2HA 3TN0D 4M4PA 2XA8H 1SOMA 3MV7D 3W9EA 3WN5A 3PGCB 2D7TH 4W4NA 3THML 3ILPA 2GUOA 3GMQA 4DGVH 2MHAA 3MOQA 5LZ5A 3GNMH 2IH3B 3TH2T 1A02N 4Z78B 1DLHB 2EXWC 2DYPB 3MLRL 5TF1L 1DQMH 3DI3B 4UUQA 4KAQL 4OGXH 1JE6A 2XTJC 1QQDA 5CT6A 2XKNA 3ULUD 4MA3B 2F54E 1EDBA 4UV4L 2WP3O 3EJJX 4NM4H 1QPXA 1M1SA 3QWRA 1LBSA 3F8SA 5F7DA 4ZREA 2SEBA 3D2UA 3GSUB 3O3BA 5D6CA 4XWOD 2E27H 4XMKL 4OT1L 4WENB 3ULSA 4P2RB 3RBGA 3WWEA 1A6VL 5DT1L 5DSCB 4HFWA 2QXTA 3GMNA 1N5AA 4CN1A 2YA2A 3MNVB 1J1XL 3D39A 4GRWE 4R4NC 2MMXA 3SK0A 4GXVH 4XPBH 2GSIB 1G1YA 2YPLD 2PO6D 4KQ3H 4M6ML 4ZO9A 4DGYL 3ULVF 4LRNH 4RAVA 2V5SA 1IKFL 3ZV7A 3GBNL 3UTQB 1EHXA 3BD4A 1S7XB 1TVBA 1ZT4B 3HE7C 2V9ZA 3ZYZA 4IOIA 4HK0A 2ERJC 1NFDB 2PR4L 3BHBB 4XI5C 2YD2A 3W81A 1NCDH 3NA4A 1XZEA 1NBYA 2EECA 3MJ8B 6YASA 4PB9H 5F8QC 1QIHA 1CLCA 4WDQA 4HLZH 5F88A 1IM3A 3MJ7A 4OU4A 3AILA 2GW5A 3P3YA 4Z7VB 4EZMA 1OARL 3ARBA 4G8GA 4KUZL 4YHKH 3CFEB 5DEZA 3SDYH 4BSJA 4TRPH 3RFZC 1I1AD 3I2GA 4CFSA 4I0KA 1G7LA 4L5FH 1FO0B 3QEHA 2QSQA 5IVDA 1SCQA 1E4XL 1L7TL 1MH5B 3G6DL 1BFOB 5HHMD 4EXPX 4L4JA 4R7NB 4BE9A 2R56H 4D9RE 1G6RB 1KUMA 2NYYC 4X98B 1CE1H 1XCTA 3MACH 3QXTA 4MNHB 3QDJE 4HDIB 5L6YL 4Z7WF 4ZFFB 3U0WH 2IH3A 4HRXA 3VXRE 3TZVC 4DOHB 1X70A 4Q0XL 1V5JA 1K5NA 4H8WL 2C5DC 5C0EA 4E0RB 4GBGA 5LP1A 2Q7YA 5LGJB 3REWA 2IGFH 4G6KL 1A8QA 4MQLA 3R8BB 4QDXA 3ZTNH 3RVTD 5CIPB 1EJ6A 4KE7A 1T1ZB 3DX7B 4XTRD 4WEMB 2DWEA 2QXUA 2XV6B 3MLYL 3BIBX 1VFUA 1DBKL 2OBGA 1XGYH 4OD1L 1FIGL 4P3CH 3ZT6A 1QONA 4PRIA 2NW6A 2I9LA 2PF6A 2PTVA 1KB5L 4MJIA 1IVLA 1CXHA 2R1XB 2H32H 4P59H 3QJFA 3Q5OA 3C8DA 3KDAA 4HGMA 1A8JH 5HHOB 4LK4A 2XWJB 4ZS7L 5DUPH 5HHXH 5IM7B 3GSNL 4XGZA 1KPUA 4BTVA 4NKIH 5F9JA 2GITB 1FJ1B 1IGJB 2VXUL 5KVFH 4O58L 2O26U 4C56A 4LIPD 4W4OC 4FXGA 4N0FB 3SKNB 3S36L 5DJXA 3X12A 3AROA 4WFHE 3BDYH 1MPAH 2YWYA 2UVFA 3CLEH 3H42L 1XZFA 4XX1A 2ATKB 1KG0A 2Q7NA 4R90H 1U4NA 4ETQA 5JW3L 4FFWA 1FP5A 3D0LB 3FB7A 4JRYB 5FYLH 1WEJL 2Z93A 5GGVH 4G1FA 1MNUH 2MKLC 4DGIL 1LEIB 1Q84A 2CD0A 3HE7A 1AJ7L 2MSPA 1NGYA 3MCLH 4PGEB 5EFZA 2C3GA 1MCHA 4PO3X 1KPVA 4JY5L 1MFCL 3B9KA 5DEGB 3B3IB 4NM8L 2OAEA 1N0LA 4U6VH 5BS0A 3P2MA 4AMKH 5FV1L 5D7KD 3KHQA 3BKMH 4WI3A 2X4SB 4ODSL 4BELD 3HNVH 4O2EB 5AKJA 3BP5B 1XZBA 3IIIA 5D7LD 5AM5A 3BX7C 3VI4E 2FJHB 2LAGB 1I1AC 2FX9L 3MRRB 4MNGB 2FBJH 2VAVA 5FYJD 5MENA 1TZIA 4TNVK 4NO5B 1TMCB 5FYLE 4NUGL 2XRAH 4ESKA 2Y6SC 3UAJC 2BRQA 5CT8A 2R2EA 2UWEE 4ZUUA 7FABH 5FFLA 4XVCA 1QGED 4YQXL 3P77A 1AZWA 4EIGB 4U1GB 1ACJA 5K59E 4WUUB 5E94B 1I9JL 3VDBA 4K9EH 1KOAA 2EDQA 2OXHA 1MJ5A 5TF0A 3FLBA 1I8MA 3O4HA 1G5FA 1JYXA 2VLJA 1F02I 1FFCA 3C6SB 5L2KB 5DD6A 5A2IH 3MMEB 1NSNH 3GMLB 4IHOA 4FDMA 4HKBB 4UUJA 4PBVC 2P24B 5ALCL 5HGAA 3FQWB 2BFVL 3JV4B 1BS9A 4NZUL 4XZUA 2DM3A 4NKQB 2F8OA 2CRIA 2VABA 2Y5EA 3G7NA 4O2CA 5ALHA 4QXTB 3S5LG 3STVA 4K3GA 4WUUE 3GZJA 4UV4H 1WPXA 3VH8B 2ADJB 4HUNB 1NKOA 1QSFE 5TGBB 1BM3H 4DNFA 1MJ8L 3QUYB 2WINA 3A2NA 3S4SB 3C5VA 4CVWA 4NNXA 3EOTH 2NX5B 4NGHH 3BRFA 4LYDA 1INEH 4ZTOL 1I1FB 2OP4H 3HRPA 5TE6H 4I19A 4HMDA 5JD6A 1N5MA 2E9JA 2D0FA 4OIIL 1FCGA 2DD8L 3RWIB 4LLUB 2DIBA 4PJ7F 1KN4H 1FL6A 1J1XH 2DM7A 5FDYA 4I9WE 3QQNA 3U4EB 5B3JE 2XPGB 1CK0L 2O5ZH 2C3XA 2W22A 5CTAA 2D4DA 2IEPA 3RK4A 2HYMA 2PW2A 4TVPE 1BCRA 3FT2B 1YY8B 5CEZD 1NL0L 4PRBB 1E27B 1H3WM 2OGZA 2CO6B 4QRRA 2Z35A 3WZMA 4YXHH 4LSRH 4OZFH 1CUYA 1W0VA 2P5EE 1AURA 5CFHA 3H3PH 4LLWA 4BAUA 3N1FC 2HJLB 4NQXA 4G5XA 3QZWA 4ZFOA 3EOTL 1SMOA 2XN9B 5TF1H 2VOTA 4ONFL 3RNKB 3SN6N 3GMOB 1CR9H 1HCFX 3LVEA 1RZFH 3P30H 2QV2A 5IKCB 3A6BL 4JZJA 3Q8WA 1T7YA 3MLZL 2F8VA 2XN9D 1JL8A 3EDDA 4CJ1A 5TPWH 4HWBH 3W06A 1DVFA 3P30L 5INDB 3WDIA 1RWQA 3QYCA 3F65A 3WFDH 4PJCB 3FYTA 3GDBA 3QSKB 3GGWB 3LQAL 3WNKA 2WKWA 4NHCH 1BLNB 1ITCA 4FBMA 4C4YA 4P46B 5CT5A 1CD0A 3S5LA 4PY8J 5C0DA 4DTGL 4XP4L 1R50A 4ZPVA 2P49B 3K6KA 2I60L 3O3UN 5ESQB 1OTSC 2BOBA 2VJCA 4JFFE 4N1CA 1TAHA 3TCXA 4YHNA 1QIEA 3WIBA 2GI7A 3L3GB 2BHYA 2OL3H 5DNUA 5C0RH 1V7NH 3QXDB 4BVJA 4GW1B 2XKSA 5DYWA 4CU6A 4E5XA 1DLFL 3CVHB 4G80B 4D9RD 1S5HB 4D0DB 4LLDB 5KN5A 4MMZC 3V9AA 5DRZA 5DURB 2W0FA 1CPYA 2Y2UA 5A62A 1C4XA 2F15A 3TYFA 1WFUA 1VXOA 4CVZB 4PB0H 4Q9RL 3O4JA 5IJKC 2G60H 1T6WA 1G7JA 5DJ8B 3UTSB 1BOGA 1MRCL 2V2TB 4HWBA 2HRPH 1AHWB 3KPPA 3QG6A 1GAFH 5FA4B 1A4JA 4U1JA 1MX5A 1L7IH 1LK2B 5C3TA 1QIJA 3QIWA 5ESVB 3KG5A 1RZIA 3MZGB 4K8RH 3RWJA 2QSTA 3HZVA 3IGAB 4H1LG 4YWGH 4UHBA 4C4ZA 4UZGA 4S1QL 4OLVH 4J6RH 4TNVF 5C08E 3JW8A 5ENWA 4HK3J 5FYJH 3SE4C 2RGUA 4HIEB 2A83B 4PJXA 1I1YB 4WWKD 1B41A 3CH1B 3E1GA 3EQ7A 3F6IA 2HL6A 4XB7A 1A1MB 1B4JL 3D0VA 4YDJB 2YD1A 3JV0A 4NYLB 2GSGB 2DRUA 3SHSA 5JAHA 4ZQKA 1TCBA 3GI9L 4P4RB 3KLDA 4D9LH 1JRHH 1F4YL 3PHOA 4I0PB 5EHNA 1N5YH 3X3FH 4YDJA 2Z3WA 3MA7A 4ZS7H 2DOCA 2B9VA 1EDEA 5J8OA 3ZKNC 4HKZB 2H8PB 4BFIB 1Z0NA 5GGVY 3FT4B 5T1LB 1AX9A 4TPRH 3QUXA 1Q9LB 3TT3H 5J11B 4NDMA 5C1MB 2F5BL 3WHE1 2MWCA 4OLZH 1OP5H 1U3JA 1O6GA 3FT3A 5T1LA 4U6YA 5CLTA 3TN0C 4EQ3A 1J5OL 2JCCB 3I6KB 4BUHA 1TCCA 1G9MH 4ZFGH 2ARJB 1FAIL 2CK2A 1U58B 4KJPC 4LDEB 4OI8A 4PSCA 4UHEA 1B4JH 3BPCA 4MD0A 4OGZA 3CFJB 3T2NL 4K3HA 2XNAB 1WEJH 2VDQH 1D9KA 2O2GA 1FDLL 3GMPA 4JKPL 2FEDD 2IFGA 5ITFB 1J1OL 2VL5A 4NOFA 3D0VB 1KB5B 1M71A 5FUCE 1VKXB 4Q0XH 5D70H 1FNSL 2VLMD 4MX7A 1ADQH 3C60A 2VDRL 4BATA 3C6LB 1EDDA 2CLRB 5HHMB 1BQHA 3O9WC 4CKVX 1QSFA 1VKHA 3CXHK 2YC1B 1E6OL 4WW1B 1FLRL 3C9NA 4Z7OF 1UENA 2XXMB 4D0DA 4LCYB 4MZ2A 4UIKL 3CVHA 3M8OH 4Y2JA 4PFEA 1PFQA 1IGYA 3QDME 2GYWA 5K9QI 3AXLB 4P57B 5JUEH 5KJRL 1N59A 3FQNB 5T33H 1BMGA 2BOBB 5T4BA 4AQOA 4JEGB 2QADB 3LKSA 1MFDL 4X7SH 3S34L 4X99B 4LNRA 3O3DB 3VWJA 4MB5A 1F6WA 3V4VH 4GQPH 3ARDD 1NDGA 3L5HA 3I6YA 3G6JA 1JTPA 3T0BA 2Z4QB 4OIAA 5KSAD 4NQVA 4S2SA 1MQ8A 4Z7WE 1XZMA 1U8LA 12E8L 1PYWB 3L3IB 2FL5A 3MROB 2HTLC 2R11A 3LN4B 2FSEA 3PJSA 4FQJH 4Y4FC 3MACL 1WWWX 5CH5A 4MQXD 1FZJB 5E2WL 1DVFB 5F9AC 4ONHB 4ODVL 6FABH 2EDOA 1D9KD 5IKXA 3MO1B 3UTTD 4H7JA 3W0WE 1QTRA 1Y7HA 3SQOH 4JY4B 1SM3L 1H23A 5E2IA 4AIZA 3RUGF 4CADA 3N0PB 1R3LA 2NYYD 5A2JH 4NO0D 1JZ8A 3OKEB 4OB8A 5IMKA 1PGRB 4BCCA 4IO0A 1OAXH 5DK0B 4M62L 3DMMA 1BLNA 5CBAB 1FGVL 5FLKA 2BSRA 3L1OL 5K9JH 3EZJB 2X4OB 3CD4A 3I9GL 4KPHL 1M7IA 3EAKA 4PJEF 5FGBA 3F7RA 1YEEL 2KZWA 4A6YH 1QIIA 1ZS8B 4TRPL 3V6ZB 5A3ID 1CI5A 4KKCC 3ILQC 1W52X 4B84A 3MXWL 3MUY1 4IOFD 2PR4H 4C59B 1CXFA 3FQXA 3DKKA 1P9MA 4LCCA 2J4WH 5B4MC 3VGAC 1UVQB 5CJOL 5LCVH 4X6DA 3U4EA 4DLNA 1IKFH 1A4KA 5J1AB 2NY5H 4FXLA 4HUXB 4MA8L 1S7VA 5D6DA 5FGBC 4FTVB 4PJDF 2QBWA 4FQ1H 1DQJB 4FXKA 4ZFOB 3OAUL 3R06B 5DTFB 2NR6D 3DOHA 3WIFA 1NL0H 5EBLA 2I27N 4H20L 1HYSC 1C5BH 4JFHD 4B5EA 4C4KT 5KS9B 1CFJA 1E4KA 3DOIA 5T3ZE 4Y2SA 5DHXB 5I75B 1VESA 1CFQA 3LEVH 3TEJA 2IANA 4Y2QA 3FT2A 32C2B 2DDQH 4RFNC 4F7CA 3IFPB 2Y2VA 1UJ3B 3OKDB 4XNYH 2ZJFA 3MNWB 1EVUA 1HYRC 1O7VA 3PXJA 3ZTJG 3FLAA 3MNZA 2PETA 2XG4A 4X4XB 1LO3L 4HH8A 1FL6B 1FVCB 5IVZB 1ZD5A 2V2XB 1A21A 4L3EE 1GZPA 1QFHA 3RWFB 4HXFB 1U8PB 2UYLA 1A14L 3VD3A 2WAHA 3EGSB 3NIFF 2WINB 4J8RA 2ZUSA 4PQEA 2X40A 2A73A 3BEVB 3OZ9H 3L3KB 5EUKA 2CB9A 2EYTB 3IDMB 4U0QB 1A6UL 1WF5A 5EU7C 5BJTA 3GSRA 3U0PB 3MYJB 4WJLA 1G9MC 2WIJA 4AH2B 2XUGA 3VGDA 2WG2A 1ED3A 3BPLB 1MCBA 1KC5L 1LWRA 4QCIB 3QQ3B 3PQYB 1YMHA 4HJ0D 4KRPB 2GT9B 3QPXH 2A1WH 4LBEB 4IHOB 2GTZA 2FJHA 4Y4FD 3VE0B 4KKLD 1QFUH 2X4SA 3F8UB 4DQOH 1DBBH 4U2EA 1NANH 1MI5B 5IP4A 2BXZA 4PSUA 4BE4A 2J2ZA 4AX4A 1LMKA 1AD9A 2XQBH 2EZ0C 3O4LE 1KCUL 4UDUB 1WJ3A 4LBEA 2ZSWA 3DECA 1DBBL 4MDIA 4LQ1A 1EA9C 2PYEB 2NY7H 4KHXL 2EXYD 4HGWB 4RMSA 5AWNL 1N0XL 1KIPA 1ZHBB 1J10A 1QSEB 5B21A 5ILTL 4ZXFA 1HHHA 4I48A 1RUKL 3OAZK 3BIWA 1ZKAA 4YGVA 1OF2B 2ATKA 3VRIB 1YEEH 2DKUA 4G6ML 2HDWA 4AQ1B 4TOYL 2P8MB 1XZ0B 4K2UH 5DVOA 4DN4L 2ENSA 3SKNA 5T5FH 4J3JA 3QUMB 4QHLA 4R26H 5JYCA 1T2NA 4MSWA 5DEGA 4GKNB 4O2FB 3T1FB 4XBGA 5IW6A 2J8UF 4YO0B 3G02A 4OLXH 2XLCA 4JAMB 4Z8FH 1MQKH 2YYSA 1PEZA 2NY4D 3T0XA 4P5TB 4XNUL 2RHEA 3WS6C 2ADGA 1UACL 4C83A 4KRXA 1CDIA 4R7DB 5DD1L 2Z93B 4UHHA 3GSVA 4Y2OA 5J6GA 2OYPA 32C2A 1REIA 1HWGB 3CPLA 3MV9A 2XY2A 2X4UB 4XVSH 1TQCB 3SO3B 2AEQH 7FABL 4PYGA 1OP9A 2Y5TB 3NFSH 3OAYK 4U1SB 1DBML 1ZLWH 5KS9A 4HS8L 1UWGH 4JB9H 4FG6C 5DA0B 3PP4H 1B9ZA 2BMKB 4GRWH 3KPNA 3G6JE 5IEKB 4B0PA 1N6UA 1T3FA 3IJHB 2HA2A 1CQKA 1U8PA 2UYLB 3O11B 5DTFA 1CFTB 5L88H 2PPLA 1HIMH 3WKAA 1A8UA 4MJ6B 1ZD4A 5LGJA 4LSUH 1EMTL 5I2IA 2HTKC 4NO3A 1KPUB 3AFIA 2VE6A 5IM7A 1CUZA 4M8QA 3RZCB 1J2EA 3HAEA 5J1AA 3SDDD 2VXQL 2Y6SD 1UT9A 3UAJD 3VRLF 3AS3A 1IAIM 4FNMA 1CUXA 1OD9A 3DGGA 1NEZB 2AI0L 1GCFA 4OCXL 1UQSB 2XZCH 4R96B 2Q6WB 1OAUL 3T0WA 4ZNEE 3D59A 1FNEB 3MBED 3C6ZA 3I3EA 4MNHA 1UJ3A 3OKDA 5IIEA 3PGDB 5E5UB 1A6ZB 4MEAA 3DGCR 4LFHG 2PNDA 4UHFA 1ZS8A 4H7HA 4ETWA 3G8YA 4NKDA 4ELMB 5IT2H 1MH5A 1MCFA 3MJ9L 4OFIA 3K2UL 2EKSB 3WKNA 1CFSA 1T1ZA 5E03A 1ZAGA 1ADQL 5D72H 5FYLL 5MENE 4QHMA 2WMPA 1H3VA 3RNQA 3QPCA 4PV9A 2D0HA 2ZUVA 4FTVA 1G9EA 4H88H 3DWTA 4LKXA 1JV5B 3KDMA 4U7SA 4EN3C 1ZVSB 1E0OB 4POZC 4WDIA 1A4KB 5F88B 2JGEA 1DU4A 1K63A 3ESAA 1KTKE 4W1RA 4PGZA 3QUYC 2BCKA 5F6IC 1OTTD 1HEZB 4YBLC 1NBYB 3DX9B 4B7IA 1CE6A 1P7HL 1KJ3H 3H1BA 4WTZG 5B38A 5A2KH 5BQ7A 3RL1B 3PWJA 2LU4A 3GJFA 1JF5A 2N56A 3B4NA 2O2HA 4GMSL 4NQVB 4HAIA 4HWNA 3MREB 4X8JB 5KSUA 1H2ZA 3FOMB 1RU9H 2VSCA 5I9IA 4LP4A 5CRIA 2DICA 1Y37A 4DYHA 4JO1H 1X3DA 3DSNA 4ENEC 4U7KA 5FECB 4XHJD 4JFPB 3VWJB 2QSVA 1YS1X 3RX8A 4FFWC 1TTUA 3P0YH 1NGPH 1J8HB 4BDSA 3RL2A 5AIAA 3C60C 3DYMA 2XTJB 4C88A 3V0AC 3F7PC 2AABH 3RTQD 3W2DL 3WE6A 4D8PB 1ZE3C 5A16B 4D0CA 2EIEA 1ACYL 4XNMA 5GRZA 2A6JA 5C2UB 4XHJC 2FIRT 3TM6A 2YSSA 1YYMH 4E14A 2R29H 1JKMA 5LXGL 2AW2A 1TJIL 2ZOKA 1QOKA 4I2XA 2HN7B 1JPSH 4RWYH 1AGYA 4X6FA 3M8OL 3C60B 3NFSL 2CDEB 2NNAA 1ZHNA 4LOUD 1LO5A 1AUOA 4WHDA 3K81A 5C07B 1NDGB 4NC2B 3MOBL 3H2IA 1KCLA 2GEEA 1BU8A 4KROD 5FGRA 4KR0A 4LSTL 4FQIL 4XP6H 3MUOA 3NZHH 1A7BA 4HFWB 4IMLA 4PG2A 1ES0A 2RHWA 5ALJA 4FKBA 3G9TA 3GJFH 4MD4A 1R1DA 1LPSA 3B9AA 4DWHA 3RWDA 2VJXA 5HF6A 2IBBA 1NCCH 2ARJA 2AK4E 2VZ1A 3JV6B 3QNZB 3DNMA 3MTRA 4PBWD 2XZQH 4F9LC 4LCYA 3FT3B 4JO3L 2C0PA 1AH1A 5ESRA 5BRZE 3SDDC 3X17A 3CZFA 3ESUF 2YC1A 4PRAB 3SDXA 1VE7A 3EYUH 4E46A 4DGVL 5F1OB 1A1OA 2NW3A 3DKRA 2OR7A 2WUDA 4LFHD 3IDIB 3VA2C 1EB8A 2FB4L 5GS3A 5ITFA 3QWOA 4NWTL 3RGVD 4XXCA 2XYCA 4ZQKB 1AC0A 1P7KA 2BVQA 4M5YH 4NJ9L 4ALAH 4YEFA 4MD0B 5DXWA 4KHXH 1WVZA 5IVNA 4JPIB 1BVKB 1QLRA 3JTSB 3SKOB 4Q9QH 3DV6B 2IPTL 3F12B 3RWCB 5B39G 3BISA 4A6YB 5D1QC 2ZNXA 3RY5A 4ERSH 3Q0TA 1F6AA 1GHFL 5CSBA 4OZFG 1MX9A 1FGNL 4MYWB 1ZHKA 5E08H 5CCKH 1GSMA 3UZVB 4G3YL 4QOKB 4YXKL 5LAXB 3WYRA 2QJDA 1RJYB 3WFEL 4I0PA 4YR6B 4I3GA 1MCSA 1CUBA 3JUZA 3BIAX 1LK2A 1RUMH 4MLSA 4Y9SA 1AY1H 1E4JA 4ZD3H 2HKHH 3SJVB 2VXSL 2ZYIA 4QHNA 3KPPB 3QG6B 5E6ZA 2D9CA 4JPVL 3T65A 3MX0A 5FYKD 3CDFA 2ZJ6A 1SY6A 4KJQD 1ORQA 1QKZL 3LKOA 1DWPA 3WJ1A 1B6DA 5EO9B 1SY6L 2DF3A 5AYQA 4XC3L 1IM9A 4XRCA 4TSAL 1OGTB 1H15A 3CFBA 3JWDH 2AQ2A 4GW1A 2O61B 1DBJL 1FG9C 1CVLA 2YD3A 1NLBH 3R3VA 1EGJA 3CFKA 1B88A 5KSAC 1RZIB 2OXGA 2JB5L 1VXRA 3JSSA 3X13B 5J3HD 1R5IA 1PLGL 5ALBL 2ZCLH 3CCHB 4HF5H 4OQ1A 3TFKD 4ZPVB 4JR9L 3I1YA 4QRSA 3LEYL 5ALUA 1AR2A 4YK4B 5KBNC 2V2TA 2WM2A 4UI2A 3JBG7 4IMKA 1KCKA 1JZ7A 3WWPA 2OJZH 4IIQA 4GLBA 4OZHB 4X6XA 4X95A 2Y72A 3GB7A 1HINL 2Q8BH 2Q86A 4OUOA 3HI5L 1CWVA 2RGSA 2X1PA 3QIUD 1RIUL 3HNSL 1F3DJ 4Y4FB 5IBUB 4EUPA 4LXHA 3QUYD 5I1EL 4JFFD 3SDAB 1AGFB 2OTPA 3LH2H 5MERB 5E00A 4Y5YA 2FH8A 5HJ3A 1JPGB 4PJIE 4NNPH 3F98A 4ODTL 4I4WA 4UILH 4XP1L 1BD2E 2YA0A 5HHNA 2APFA 3FOBA 5INCB 2DHCA 3GIZH 3WLBB 4Z7QF 3OPZH 3WSQH 4JFEA 2I24N 1XH3B 5BW7C 4UV7H 2JLLA 4OB5H 5EC2A 1FZOB 4TGLA 4K94C 4M3KB 2BNRB 1HXYB 5DC4B 3TP4A 3QAZC 3QIBA 4PJ5E 1JGDB 2QTEA 3MA9L 5GRUH 3HJUA 2NY6C 2DL2A 3S96A 1B90A 4FQIH 4CJ0A 1XAUA 1KT2B 4ODHH 3SE3A 1BX2A 4GECA 4UNVA 4QY8A 3M1BB 3FQTB 1I3GL 1JZ5A 2Y6VA 4WUUD 4J0KA 4I3RH 1EFQA 2FX8L 1MLBB 1FC1A 1BWMA 4B0OA 4ZAKC 3SGDH 4B41A 1TQCC 3SO3C 5J11C 3EDKA 2DTSA 1TJGH 2P5ED 4XAKD 4NQDB 3MRNB 4Y16D 1KTLA 3V8OA 4PPTA 1S9XB 4K3DH 4FQJL 5T3XD 2LQRA 3EOAA 3L1JA 1ORWA 3MJ9A 4MXWL 3S2ZA 3UMTA 2HJFA 2R1WB 2VC2L 4P23A 1MELA 4ZGBA 2EDDA 2Q3ZA 1IFHL 1T89C 4RMRA 4MA8H 4U2DA 1Q0XL 3EOAB 1NGPL 4YHOL 2LABA 4BH7B 3KXFB 4TUOB 4LSVL 1YPZF 4M5YL 3DI2B 4YAQB 3RKPA 4JY5H 4Y16C 1UKAA 2JEYA 5D1QA 5I75C 4ZOEA 1K4YA 2NY1C 2QR0B 1AO7E 5HHPA 1GIGL 3GZKA 3KPRB 3SGKA 1GPOH 1CUCA 2XPGA 1QFPA 3GA7A 5LGHH 4U2BA 3MCKB 3M1BA 4HKBA 4UUJB 2AJZA 2DQJH 1T5XB 4PRID 1I9RL 1K8DA 2UUDK 4KI5C 2RQ8A 2DJSA 4JRYD 4WEBL 2V17H 3G9UA 2RFXA 3Q1SL 4FLFA 1HH9B 3CLEL 1JNHA 3QIBB 1U8KA 4GLRH 4KVNL 2VLME 1DUZA 1KN2L 2NX5A 3O6FA 1QEWB 3TV3H 4NNXB 4OD3L 3KWWA 5E1AB 3V0WL 3UUFA 4U49A 3LAFA 5J3HC 3C5ZC 5EOCL 1FHGA 3GK8H 2D03L 2Q8AL 3OURA 4PRPD 5JLZA 1I9JH 4Y5YB 4KAAA 1W0WA 1J0YA 1H5BC 4H7EA 5IV2A 3UTTB 5EO1A 3PP3K 2VDRH 3IDNA 1FPTL 1YEKL 3EJZD 2PBLA 4CNIB 1UB5A 4Y7DA 5GS1A 2NY0C 2NW2A 1OSPL 2DQJL 1GT6A 5FYLD 1PEWA 2R2HB 5HYSA 5JO5A 4IIQB 3VXME 2J8UB 5HKBA 1ND0B 5KSAB 3MV9D 1EINA 3A2LA 3ARWA 4BQCA 1D6EA 2C7UA 3VXRA 2ZVDA 1RYYA 3B3IA 4INZA 5KAQF 3B9KB 2EEBA 5DRWB 2DQZA 1CXLA 1G7PB 5CHNA 4QLOA 2E3VA 4XNQB 5AZEL 3NOIA 4FWBA 5J89A 1EEYB 5DHVH 3X3FL 3GK8L 3N1QC 4Q3OA 4L4VA 4U1IA 3GSOB 2IADB 3V1NA 4A5SA 3MLVL 4Q9BA 4IIQC 4N8PA 2B5IB 4HKXB 5MEOB 4QLRA 4JRYA 3SX4A 3OJDA 4HWZA 4IRZL 1LNUA 2GAZB 4HLZG 4M93C 4L29A 4ZUWB 1PZ5A 1E4WL 1H15B 1QO3A 1A9EA 3ZDXF 1OGTA 2JF0A 3H0CA 4PBXA 3HAEG 3VXUE 5FYKH 1VENA 2DI7A 1UCBH 2WHQA 1EBAA 4X7TA 1CICA 3BIKA 2WFLB 4M48H 3K8KA 4C89A 3BL8A 2FX8H