3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Enterochelin esterase
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
5D5ME 4XP6L 3NWOA 3HI5H 5ESRA 4WGWB 4S1SH 1IM3A 5L6YL 2IANB 2WINA 5DJ0A 4NOFA 1D6VL 4J1UB 3GA7A 5E4EB 3BN9C 1CGXA 3PWJA 2O5XH 4C59B 3BQUA 3ARGC 3VG0H 3FN0L 3FB6A 3AIKA 4ZFZA 2NCMA 3ARQA 4L9LB 3CCCA 5IW1A 1UJ3A 4JE4B 1G7PB 1G7MA 4EOWH 3RGVB 3G5ZA 1EJ6A 3LKNA 2JE8A 3VGAC 1GGCH 3O8XC 2CDEA 2CMRH 1OAXH 5AKKA 4LMQI 2XTJE 3TGXA 5B39B 1JTTA 4EY5A 4BFGA 4P9NA 5K3CA 3GHBL 5ICXB 1DT3A 4ZO7A 2EDBA 4UV4L 2AK4D 1S7TA 3G9UA 4JEIA 4KDVA 2P8PB 5BXFA 2H2PC 2NZ9D 2P5EB 4L4TB 5IVIA 4XXCC 4LSUL 4PIRF 1ZK9A 3TBYB 3I75B 2FEDC 4M5YL 5DDHB 5ID1A 1QQDA 1KJ2A 3QDGA 1FZJB 4MNGA 4Q0XH 4F58L 4QNPE 4JDTL 4X9FA 1WCYA 4GLBA 5C0AE 1NBVH 4ELMB 4OSUH 3DUUB 3RA7H 3ZYOA 4Z7OE 2D7TL 4HSQA 3S34L 4XI5D 2C26A 1SYVB 3DECA 4APQD 1OAZH 4P4RA 1Q0YL 4H26A 4KRPB 3R3UA 4L1DA 1BX2B 5C0CA 3KWWB 2OP4H 3U7YL 3L1OH 1CZ8H 2VL5B 4P5KB 1M4KA 1HN1A 2UVEA 1EEQA 5EU6B 3VG9C 3DS8A 1BM3L 1X4ZA 3DMMA 4EY7A 1EHYA 3O6LL 4K07A 5FUOL 1AJ7H 4Z0BL 5FKPB 2GJZA 1R5VB 1C5CL 3O11A 1UKAA 1QYGH 3PWLB 3LKPB 4JFFA 1FG9C 2IGFL 2IAMD 2IADB 5IVXA 2W07A 4UAOC 5MHSE 1Q9KA 2EEAA 4MMZC 2GJ6D 4XGZB 1CIDA 1JTPA 3JV6A 3TBTB 4GXNA 4DFHA 3PWUA 1GZQB 3UZVB 5CGYC 4MQ7A 1U8PA 5AUMA 5LZ7A 1NC4A 4OAWA 3NUZA 5I19H 2VKXA 1CXLA 5KG9B 3O4HA 1NC2D 4R2GD 1AC5A 3H1BA 3NN8B 3UX9B 2WLSA 4R96B 3E8UH 3EHBD 5LXGL 1BFVL 4Y5YA 3MOQA 4I0PC 3AZPA 2HT4C 2R4SH 1UACH 3PI6A 4XP6H 3T08A 1M71B 5HGBA 3BMVA 2JB5L 4Y5VA 4CCYB 1P84K 5FO7A 4EUPA 4YDJA 4ZOCA 1MCWW 5HF5A 5L6YH 2CKMA 5CCKL 1U41A 2VYRE 1D6VH 3LN4B 1S5HB 3OKKB 2E9WA 3OSKA 5C08D 3IJYB 3OJVC 5LBSL 5I16B 3FN0H 5FCUL 1QFPA 3V0VB 1CUSA 1S8DA 5DZNA 2PTTB 4LVEA 1ACJA 4YBQC 3ZZ1A 3HPLA 3SKMA 1A9BA 3SDCA 1WWCA 4P0DA 3IB3A 3QDMB 2BKLA 4P5TA 3QUKA 4HUVA 3FL7A 1IQDA 4OCMC 1KIRA 5FYJL 3VXSD 2ZPKL 3D59A 4LNVA 5H94B 2VLRE 1IGYA 3G7NA 2NLJB 4XCEB 5DRZB 5DJAB 3GFFA 1FZKB 2HJLA 4L8SB 3GHBH 3PDOA 4IDJL 1IC7L 3GMMA 4NRYB 3EZ8A 1KJVA 5ESVA 3S36L 3UMJA 4UV4H 2EO1A 4NFDA 3LDBB 4M00A 2IQAB 4Q2ZA 3VJKA 1JWMB 4HIJB 4LSUH 4NYLB 1MCFA 1YEKL 4UNUA 2PYED 3C5WP 3AUVA 4M5YH 1KB9K 4F58H 1P7QD 2A73B 4G8IA 4JDTH 5DXWA 5FA3A 4D94A 5LKNA 4X8JA 5JARA 4HUKB 4UU9B 2D7TH 1S8OA 4PP1C 3S34H 4PJDF 3TJEL 5EBMB 1Q0YH 5C2BL 4WV1A 2NY2D 4KKNA 2EICA 3MRJA 3MV7D 3QQ9D 1I7TB 3U7YH 5ALQA 4MCYA 1FZOB 2WIIB 5AM0A 3ARBD 1S7SA 1KPRB 5SWZB 2MJWA 1QFOA 1MHCB 1HXYB 2XWJA 5T1KD 3FAWA 1TZHA 4RGMB 3O6LH 5D93B 5FOJA 5BJTA 2J3DA 4YDLB 1AH1A 4Z0BH 3VFUA 1JPTL 2W9EL 1LNSA 1C5CH 3H2KA 3AZOA 4E0RB 2A0LD 3AAZB 32C2B 3D18B 2IGFH 5JMRA 2NR6C 4AT6B 4XP1L 1YY8A 4ZV7A 4Z7WF 1EO5A 3C9NA 1BD2B 1EZVX 2VLJE 2RAUA 1T83C 3MRQB 2XY1A 1XROA 1CE6A 4DGQA 3CXDL 3KPQB 2BVPB 3QUZD 3HI4A 4HWBA 5IV2B 1ORSA 2AV7A 1DLFL 3QULB 3P4NB 1OGTA 3PV6A 5F7YC 3UUFA 4HS9A 3L7FA 5LXGH 3RTQB 1MNQA 1XQWA 1BFVH 4ACPA 4MVBC 3I2CL 5F88A 4Q6IC 3V1MA 1B0RB 3S9DB 3ZE2F 1CGYA 5F7UA 2RHWA 2JB5H 3H3BC 3ZDYE 1C16B 5CCKH 4L8CA 1DANT 2PXYB 2FHCA 2EDNA 3DX8B 1MHEB 5A16B 1XT5A 4ZTPL 5LBSH 2HFGL 5FCUH 2IPKB 2O7RA 2GAZA 2FX5A 1BZ7A 5C92A 3C60A 5FYJH 2ZPKH 4ZPVA 4TNWK 1K5PA 1P0MA 1EEUA 2YXMA 4JRYD 5CLWA 1MWAB 2Q7NA 5IHUL 3QG6B 4IDJH 1IC7H 4IOFD 3S36H 2XTJC 3WNNA 1FVEA 4E42A 4FFWD 3EO0A 43C9A 5B3JE 5CMAA 5LZ4A 25C8L 5T1DL 1D5BB 3VXME 3GIZL 1NH6A 1YEKH 4OQTA 3BP4B 3OHXB 3PE6A 3DOSA 3DETD 2Y23A 5T4HA 3WWPA 3PQYB 4HIHA 3LS5L 4WO4C 1LWRA 4KMTL 1ZIYA 1KIUA 4DN4L 4XCFL 1CN4A 3FB5A 3C5VA 3TJEH 2M2DA 3FNBA 4WCVA 5C2BH 4FTVB 2YUVA 3PL6A 5ECJE 4X6DA 1ZEAL 3UTQA 1S9XA 1LQSR 5A2KH 3O4JA 4X71A 3QI9A 5HQ3A 35C8L 1OARL 4AG4L 2XQGA 3D2AA 4J3OC 4IRJC 1AURA 1D9KB 5B8CC 2FR4A 3OGOE 1JPTH 2W9EH 2CRZA 4ZDHB 1XGUA 2CK0L 1AIFB 4U1HA 2X1WL 3P9LB 4QRPA 1CUZA 5TF1L 4NRXB 4QHNA 3T65B 4XP1H 1SJEA 1FNEB 4NZRL 3TIDA 1NEZG 3FFCE 4V2CB 5ETUA 4HCRL 4XX1E 3UZQA 4YDVB 3GSUA 1JHTB 3UBXB 3ULUE 1EB9A 1FN4B 1AQDB 2HU5A 1CG9B 4F7EA 3CXDH 3RWFA 4LCIL 3ES6A 2DJUA 5E4TA 5I73B 5KANG 3T4UA 4I18B 5EU5A 3RBSA 3NPSB 4YIQB 1DLFH 4MJ2A 4PJ5A 2WWKT 4IRSD 1BFTA 4WU5A 3LCYA 1EB8A 1A7OL 4M6NL 1R3KB 4RBPH 3ALXA 3I2CH 5JIIA 3X14B 3MNZB 4OCSL 4PJHB 3HR5B 1DVFD 3FOLA 4Z7VF 5J3HD 3G6JE 1YSCA 3HYSA 5EZIL 2ARJQ 4LLDB 3SE4C 4QLRA 1P0QA 4ZTPH 5EHNA 5DJ2A 3L7EA 2HFGH 5EO9B 3MLWL 4HK0B 2Q7YB 1EHAA 2H1IA 3RLIA 4CI9A 1OF2B 2UZ0A 2F54E 1Z5LB 2X4RB 3IFOA 2UWEB 1F13A 5I1IL 1IGJB 4OT1L 2ZSWA 1KGCD 2DHEA 2V5RA 5FYKD 2V5SA 1FV1B 3ZKXC 4GOSA 5IHUH 4HJGA 2K3TA 1TCAA 1KPVA 4M5ZL 4ZREA 4LLMB 4MAYC 25C8H 4ISVA 5T1DH 3VE0A 5F7KC 3GIZH 1JPSL 3HAEG 4LFHD 2EYSB 3PFBA 4LPXA 4NDMB 3LS5H 4TUJA 1REIA 4KQ3L 2DLTA 1Q9OB 2YD5A 5E00A 5GS2D 5M7QA 4KMTH 4NQVB 1X6NA 1UB5A 3MLUL 4DN4H 2C58A 2Z31C 4XCFH 1HBJA 4JH0A 3VXUD 5HGHA 5GS0D 2YMXL 1ZWIA 2D0GA 1ZEAH 3PJSA 4HRYA 2N7BA 3HSSA 3H42L 3BQUB 5CLTA 5K3FA 3FB6B 35C8H 1OARH 4EEEA 5TDNA 4EI6B 4AG4H 5D71L 5C07D 3C43A 2V2TB 3MNWB 3G5ZB 4ZYKA 3QNXA 3SDAD 1UKQA 3I3BA 2CK0H 3LKNB 2C4XA 4X97A 3W2TA 3ILQD 1C8PA 5TF1H 5D7JD 3I2IA 5HHOE 2PETA 4NZRH 4CG1A 2DQZA 2A9ML 4HCRH 3TWCL 3HACA 1RAMA 2PCPA 1S7TB 4JY4A 3BDVA 4KZEL 5DMGC 5DSCA 5BXFB 1VFMA 4LCIH 1TIBA 1WWAX 4O02L 2V2XA 2VLMD 2R1YB 3IAQA 5CW2A 1WAAF 4QGTA 2IH1A 1AKNA 1A7OH 4M6NH 1H3WM 4NPYB 1ED3B 3UP1A 2WV3A 1MAAA 4FOMA 4B50A 1OWRM 3RAJL 2WQ8A 5DHVH 4OCSH 3DKRA 4UBOA 4C56A 1QNZL 2PX6A 3GSQB 5EZIH 2FIKA 1JGDA 3CC5A 4WTZA 3AMLA 2X44D 1GKKA 4MJIA 5C6WH 3I6LD 3ABZA 5D7IA 3MLWH 5IHZA 3BWXA 3GRWL 4UNVA 2GJZB 3H1AA 3LPFA 1G7IB 1BVLA 5I1AA 5I1IH 4H1LH 4OT1H 4J3TA 1WCBA 1QD0A 2DLFL 3QUYD 4YHML 5IVXB 2OCIA 2BSTA 4JHWL 3UTZA 3BOVA 1KTKE 4UUJA 4ZAKC 4LXHA 5D1QA 1U8PB 1TITA 3G08A 5AUMB 1PG7W 2CDFA 3MTRA 4M5ZH 4YXLL 5CZKA 3LKQA 1G0XA 4OF5A 2ENSA 3BT2L 1WZMA 1JPSH 5DS8B 4C87A 5T1MB 1D5XA 1Q94B 3KHOA 3OOSA 5HK8A 4G8GB 1JBJA 4KQ3H 3T8XB 3S3JA 3MLUH 1ZLWH 1WFUA 1LE5A 3OPMA 4LKXB 5HGBB 1BREA 2FATL 5EUOE 4EUPB 1FDLL 1FNSL 3QWRA 2YMXH 1A1MB 4YQXL 4TTDC 3IKKA 1LPSA 1JGLL 2X05A 4JPKL 2ECFA 2Q3AA 5GSVA 4ZRDA 3H42H 5ESAA 3G9ZA 1YN6A 5A71A 3SOBL 3C6XA 2QM0A 1RIUL 5D71H 4D9LL 3HPLB 1A9BB 3SDCB 1SVZA 4J8RB 2CZQA 4G4IA 1PKQA 4P5TB 3T4YB 1EHNA 5D2LE 4HIEB 5E95B 3LIZL 1KIRB 3GGWB 3NABL 4PRAB 4ZO8A 5IB2A 5GIRA 1X7QA 3WL9B 4C83A 1J9CT 3IFPA 5CMLA 4KRMB 5DJZB 5SX4I 1FNAA 2A9MH 3QIBA 4WNQB 5J12C 5JHLL 2HJLB 3TWCH 1IM9D 5E56A 3V5KB 3FCXA 1W0VB 3AS0A 3OAZK 2H2SD 5I75C 3A70A 4KZEH 4PRDA 5DQ9B 3MRHA 4NN6C 1UJTA 3O4GA 3DJ9A 3ULUC 4O02H 3SBWC 4UHHA 2R1XB 4UDUB 4NQSA 5FA3B 15C8L 1GC1C 2QQQA 2X8BA 1CL7L 4EJ1C 5K9OB 3RAJH 1H5BA 3CUPA 4WFJA 4WV1B 1BU8A 5D7BA 5I74B 1QNZH 3MRJB 3E3QE 1MNAA 1YQVL 3T0ED 2AK4E 2E8YA 2NY4C 4YK7A 1IGTA 2F53A 4U6YB 4ZPTA 5KS9F 3JWEA 2XG5A 1S9WB 2X09A 3OXSB 4Y8AA 5GZND 4EIZC 1AGCA 2YUZA 2XWJB 4FZ8L 1TZHB 2H26A 3GRWH 4KKCD 3VFUB 2VTVA 4NQUA 3HZOA 1I1FA 4JGMA 4YX2L 4CGTA 4KVNL 1YJDL 3ME0A 2JIXA 3O3BA 2RHEA 2DLFH 3LS4L 4KK6D 4YHMH 3U48A 3WLBB 5CZVL 2VQ1A 4JHWH 5KTEH 3LRSA 2VITA 4YGAB 4YASA 4WJ5A 4D0DB 3UYPA 1RZJL 1OAQL 2V5MA 1CLYL 4R8WL 5DO2D 4YXLH 4Z78A 3JBG7 4HBCH 2AV7B 2OQIA 2OS7A 3L5WA 4F0JA 3OR6A 3BT2H 3OAYH 1MEXL 1OPGL 1ND0A 4PRID 3PV6B 4Y2DC 4GRLD 3KYAA 4S1QL 5C0RL 3FCTA 5AOBA 2QJDA 2H9GA 1TCRA 4KC3B 4ETQA 1JFQL 3HG1D 5ICZA 3I2HA 2AEWA 2GJ6E 3GSXA 1CDUA 2FATH 1FDLH 1KTDA 1FNSH 3RWEA 4YQXH 4BJLA 3S5LA 1CLCA 3WO4B 3ARTA 3VFTA 5L8KB 3IAPA 1JGLH 4JPKH 1AZWA 2NX5A 1HXMA 2ZCKL 3KPOB 4NQDB 5J9PA 3MBEC 2YUXA 5BOPA 5FOQA 2JTDA 4M93C 4GEGA 1B4RA 4PTTA 3SOBH 2P8LB 4HV8A 1RIUH 4D9LH 2COQA 1FC1A 2CPCA 4KAQL 3FO1B 1R5IA 5AIBA 1I8KA 4OLYL 3EYOA 3C60B 3LIZH 1Z0NA 1U8KA 3NABH 5DC4B 2J6EA 5JHDD 5DJ5A 1N4XL 3AU1A 3H0TB 5JHLH 4O9HL 5GGQL 5D96B 5F7MC 1IL1A 1A6TA 4YAQB 5C08E 3HZKA 4PO3X 5JMOC 3C6LD 3QIWA 43C9B 1Q9LB 5CMAB 3VXRA 5D72L 4PYHA 4G8EA 3HZVB 4MQMA 1MCIA 1QOZA 5ISZE 1W0YT 3GELA 4HIHB 4R7DA 1VADB 2BY3A 1JN6B 15C8H 3VXSE 3UPAA 1CICB 1CL7H 1FO0A 1WPXA 3KLAB 4YZFF 3G6AB 4PBXA 4NIKB 5CT4A 3T52A 2ARJB 5AG9A 3J7HA 5AKIA 1H3XA 4K6HA 4X6DB 3LV3B 2ATKA 4RGNE 3RVUD 4JM2F 3UTQB 3STVA 1YQVH 5DNUA 1DUZA 5E6ID 4OLUL 1PFCA 2PYEE 3WA7A 1CIUA 3BD4A 4FZ8H 1SFRA 4QWWD 5H37H 4NT6B 3IU3A 4YX2H 4KVNH 2WK2A 2GK2A 1YJDH 1Y7HA 4OKVB 4EXPX 3LS4H 4QHNB 5CZVH 1SJEB 3TIDB 1J05A 2DQYA 3MV7E 2CMFA 4LSQL 4NQCD 1M7IA 4GECA 1DCLA 1OAQH 1RZJH 3QPAA 3VXPB 3GJEA 1CLYH 3MLPA 1EAPA 2V98A 4Y2RA 1M1SA 5L9DL 5E94A 1MEXH 1OPGH 3SEPA 4Q7DA 4OKDA 3HCVA 4UILL 4S1QH 2XWTA 5C0RH 1RSFA 2ZYRA 1O6FA 1QA9A 4NNXA 1OQOA 1JFQH 3Q6GL 2J5LB 3QWOA 2I25N 5DT1L 1KCRL 3LOWA 1I9EA 5HHME 3RIAF 4AH2B 1RZIA 5F4ZA 1PYWA 4F37F 5DJ2B 2ZCKH 4M0MA 4PGCB 5FXMA 1EH9A 1N5RA 4PJ9D 4OZIA 1EGJL 4KAQH 1EO8L 4N0RA 2YPVL 3IFOB 2X4NA 4OLYH 3WD5L 1DUYB 2GBIA 3AREC 5EBGA 1SJHA 1N4XH 3RHWK 1ZA6A 2X2YA 2Z35A 1XKLA 5BW7A 1ZLUH 1UYWL 4O9HH 5GGQH 1ZS8A 1VCAA 3F7PC 3MMEA 1CDYA 1KPVB 4NO3A 4HKBA 2B4KA 3HE7B 1CVSC 2A74A 3MRPA 5D72H 4ISVB 3BZ4B 5D3ZA 1CUDA 1GQRA 4PBWD 1KYOK 2XLCA 1F5WA 5AOAA 3PIQB 5E00B 3VXTB 1UB5B 1MPAL 3ARGA 2GSGA 1CFNA 3DQZA 1L7QA 1YA8A 4UHEA 1NCNA 3OGCB 4LHUG 5HGHB 2MHAA 4QNNA 4JRYE 1ZWIB 3GNML 2XDWA 5EZLA 4NKOA 5F7DA 4OTXL 3CSGA 2F8XC 5AK4A 5GQBA 1QHOA 4OLUH 3O8XA 1TCMA 1B88A 2BVQA 3QAZC 3E3QC 5K33A 5C8VA 3LIIA 2PSEA 4BSWB 4BBZA 2BRRL 3DRTB 2NZ9C 4WWKD 2WG1A 3MRRB 5C0BD 4M61B 1DL7L 3KYKL 3PP3K 3QNXB 3MGOA 4NCC1 4K7PX 1JTOA 2BVUA 4XXCA 2QHRL 3BPCB 3OB0H 1HHHA 4YHYB 3MUJA 5I76A 1U8JA 4LSQH 4LVHB 4XI5C 4APQC 4FQQA 3ARFA 5ALLA 2GSIA 4ZUSB 5DSCB 5KZCB 5EHQA 4GSDL 5GHWL 3UTTB 1D3CA 2DIJA 2V2XB 4X5XA 4JN2A 5L9DH 2IH1B 2NY5C 3LEXB 1H2WA 2QS9A 2P5WE 4UILH 3Q8WA 3H9SB 2C4FU 3Q6GH 4G6FB 2B61A 1JI2A 4LNRA 3LKRB 4PJXF 4HMDA 5DT1H 4C56B 1KCRH 2IAMC 1LD9B 4XH2B 3WWEA 4U1LA 5FXCH 1OP9A 2FWOB 2G5BA 4M7ZC 5C0GA 1JGDB 3QCVL 5JOFA 5T3XE 3HAEB 5TJWK 5D7IB 3VJLA 3MFFA 1E4JA 1HQRB 1EGJH 3ZT5A 1EO8H 4NRZA 1MIEL 2YPVH 4P2QD 4IH1A 1BVLB 5I1AB 4R2GC 3WD5H 4KRPD 5CIPH 5J11B 3ULVL 3JV4A 1RJZB 2ICWJ 4NN5B 3MCKB 3EHBC 3LB6D 1PV1A 3DXAA 2WFZA 1KJMA 5EU6D 4ZFGL 4UUJB 1UYWH 2AEIT 1U4NA 1A14L 2CDFB 4I0PA 2C3HA 1G9ML 3LKQB 2J2ZA 2YXPX 3V52L 5I1LA 2FSEB 1Q84A 3K8LA 1D5XB 1FP5A 5HYJA 2E9IA 1UK7A 5FYKE 4JVUA 2RONA 5ADOL 1MPAH 1LE5B 3C5JB 5GSRB 2HVJA 3F7QA 3KWJA 4Y2TA 3BP6B 1A6ZA 3GNMH 4JUIA 3LS2A 4OTXH 4KJWD 1KCSL 1VFBA 3CVHB 2F19L 3LKSB 1OAKL 1P69B 3EFDL 5ESAB 4RPCA 2LU3A 3E2HB 4X7TA 2OMNA 1K4DA 2BRRH 4CN4A 4V1DB 1DL7H 3KYKH 2F74A 2BVYA 4QCIA 1QLWA 3ILPB 3VXUE 5IB2B 5GIRB 1X7QB 2QHRH 4C83B 1MLCA 5EBWA 2CQVA 4JFHD 4YWGL 3S37L 5IB3A 3QIBB 3ULSA 1YEDA 3AB0B 4MWSA 1N6UA 3FONA 2NY2C 4JM2D 3QQ9C 5DD3L 1K8IA 3AFLA 4GSDH 3QDJA 5GHWH 3STXA 3U7AA 4DEPC 4ZUUA 3TIEA 1NGWB 1T0NB 3ARBC 4HWZA 3ESBA 1C7TA 3RPIA 4X6EB 3NCYP 4LVOB 2WFLA 5LIPA 1U91A 5A6VA 1RZKC 5LCVL 3CUPB 4M4RA 4QXGL 2A0LC 4PJDE 5F9AC 3LN9A 3MRGA 4OIIL 4JFYB 5F21B 5ALPA 4ZPTB 5J1AA 3WJJC 3QCVH 2YN5A 1LEGA 4HH9B 4E11A 2OTWB 3QJFA 3U46A 2H26B 4RGYA 4XWOD 1HOCB 1MIEH 3QUZC 1I1FB 1T83A 3NCJL 4H7JA 1K9TA 3BXNA 3F7YA 3MLZL 2EEBA 3ULVH 1R24A 3VKFA 1XF3A 3WKML 5IR1A 1P0IA 2ADIB 3LRSB 1K3IA 2VITB 5SWZD 5DRWA 4FS0A 3LQZA 2HA1A 4WJ5B 4ZFGH 4LQFL 4Z7WE 1ULVA 1K5NA 1ZMYA 5FK9A 1A14H 4M1GL 4PJCB 4Q6IA 1H2ZA 1G9MH 1ZIXA 4UHDA 2JCCF 5GGVL 1ZHKB 2YPLA 1MI5A 2CO7B 2LAAA 3OR6B 3V52H 1QIKA 3K8MA 4DZBA 1NMCC 5HPMB 5I1CL 4I2XA 3W0WB 1DR9A 2BFVL 2ZG1A 3FCTB 5D5MA 2E6JA 2H9GB 4B0PA 4ETQB 3FYUB 2RGSA 3BPOB 5ADOH 2MQ0A 4GO6B 1MN6A 5ICZB 5SWSD 1WCQA 4U1KA 5CSGA 2P46B 3GSXB 3EO1A 1K8DA 4LLYB 3ZE2E 1KTDB 2MFNA 3S5LB 3D85D 3N50A 3VFTB 1KCSH 4JRXB 4K71B 5E8EB 4HPOL 2F19H 5JIBA 1OAKH 5LLSA 3EFDH 3RL1A 3MOAL 5J9PB 4L3EB 3WFBL 4IOFC 4PTTB 4FFWC 2B5IB 5DWUL 1R5IB 1I8KB 4JPVL 4LLVA 3T3PF 4WFHD 3KWFA 1U8KB 1RMFL 3DETC 3K74B 4ENED 3D2UD 1RZ8B 5CJQL 4XCNA 4YWGH 4TSCL 2XN9E 3S37H 1K8QA 4QF1A 1A6TB 4WO4A 4ORGA 5JA9A 4JHZA 5JZ7C 2UYLB 4LIQL 3EOAA 4G8EB 5DD3H 4IJ3B 3QMVA 5IFJB 4BZYA 3WWOA 5C0AA 3X11A 1KB5B 5TF0A 1QEWB 3BKJL 4MYSA 1ZXQA 5DUML 1T4KA 1R6VA 4YO0B 1BBJA 1NLDL 1LNUA 2RBLA 5E4IA 5F1NB 4HMCA 3FOMA 1JU4A 3O95A 3UDWC 4HFWA 1KT2B 5ENWA 2VUOA 3MJ9L 4FMKA 4FQLL 5DYOB 5LCVH 2R8BA 1YZZA 2JJVA 4QXGH 4IRJA 4BK5A 4OIIH 5B8CA 4NSKA 1IQWL 4N9GA 1BGXL 3HZYA 2WJ3A 4WVRA 4J3SA 2W92A 3DYOA 1AX9A 3DPBA 4F33A 3MRIA 1RUML 1YPZE 3NCJH 4JFXA 3MLZH 4OF6A 4IRSC 4NZDA 4MHHG 1OTSD 3WKMH 3JUZA 1EA5A 5IKCA 4KH2A 1J86A 4HQQL 2DQEL 4Y19E 5ELIA 8FABA 1SVCP 3WMRA 3PE9A 4H8WL 4U2YA 1EHXA 1M7IB 1S7VA 4LQFH 1ZHLA 4LKCA 1DVFC 3QEUA 1KSRA 4M1GH 4K8RL 1PFQA 1EAPB 1XZJA 4I5BB 5J3HC 3VGEA 1UA6L 5GGVH 2L7JA 4HG4K 5E94B 5I1CH 1B0GA 1QHPA 3HCVB 2BFVH 2XWTB 3ARXA 3SE4A 4R90L 4D9JA 4ONHA 2C3VB 4PYGA 3FZUD 3QWOB 3H0CA 1IAOA 4OPMA 5LGHL 3GI8L 1G9NL 5ADPL 3AIMA 3MV9D 2KPNA 1VACA 3WZMA 1AGYA 4RRPA 4W68A 1RZIB 2FECL 5JPNB 5BRZE 1A8UA 4HPOH 3KS0J 2B7DT 4ZOEA 3VFMA 5LKAA 1PYWB 5J13C 3MOAH 1GPOL 1NAMB 4O5LL 5DYYA 3WFBH 2VXUL 5FF6A 4OZIB 4AQDA 3REVB 1VKHA 1I1AB 5DWUH 5E6YA 4JPVH 2VLRA 3HG1E 4DZ8B 4OF3A 3KHQA 1IFHL 1RMFH 3PXHA 4MAYA 4XNQA 1SJHB 1PKOA 5F3BA 1A22B 2OZ4A 5CJQH 4AIOA 4Z8FL 2Z35B 4YDKL 3F67A 4TSCH 3X12A 3MJ8B 5C70A 3V5DA 1ZS8B 3ARWA 4OZ4A 3WIHL 3MMEB 5GS0C 5FA4A 4CU6A 1ORQA 2A74B 2Z31A 4LIQH 4N5HX 1RWQA 4OFKA 3HUJF 2WUGA 3FHAA 4TRPL 3BKJH 3SE8L 5KVFL 2PO6B 5DUMH 4QDOA 4PRPB 5JTWA 3SGEI 2VLKB 1NLDH 5DUBB 4Y2XA 1I7UA 5JHDE 1CFNB 3UC0L 4UPDA 3E0GA 1KEGL 3SN6N 3SDAC 3MJ9H 4FQLH 4ZUTA 1F45A 1IEHA 5EZLB 3ILQC 5F7DB 4QXWA 5LG1A 1U58A 2VC2L 1A3QA 1RZGA 5D7JC 1IQWH 4OBSA 3VGAB 3TLRA 1CFSA 1BGXH 1LO0L 3O8XB 1RHHA 1Y0LA 1VKXB 1IBGL 1DSFL 1YAJA 2VDLL 4GW4A 1QRND 2JEYA 3RWIA 3QPQD 3DUSA 1QSEB 1RUMH 5FFLA 2NY3D 4KVCL 3IGAA 2EEDA 1UT9A 1DBKL 2JEZA 3U9PL 4O2CA 4WW1A 2VLJA 5EIAA 3AM8C 1HHHB 2DQEH 2GJJA 3NIGF 4HQQH 4U0QB 4YK4B 5IM7B 1U8JB 4H8WH 1LO3L 3E6HB 2GSIB 3SDYL 3SPVB 5ACLA 5YASA 4K8RH 4BH7B 4FN0A 4IMKC 3JV0A 1UA6H 4X5XB 1MJ8L 3X13B 3CN9A 4B53A 5L2JA 1WBZA 1F2QA 3W9EB 3B2VL 5DJCB 1BJ8A 4R90H 5JR1L 4UDTB 4UFOA 4MDIB 1TPXC 3ILSA 3ISWA 4QRQA 4LNRB 1YB6A 5LGHH 1WLHA 3GI8H 1G9NH 2R4RL 5EN2A 3ZT6A 1JYXA 5DURB 5ADPH 3QUYC 1AUOA 3WL7A 4WI2A 1S7UA 4HH8A 2WP3T 1WM1A 5DQJB 2G5BB 2HYMA 5C0GB 1GOHA 1XGTA 5F70A 1GPOH 4GJTB 2BSRA 3HN3A 3I6KA 3QIUB 4O5LH 1ITBB 4UAOB 2VXUH 3RWJA 3HC0B 1R3HB 3TO4D 4J7RA 4EZIA 5IJVA 1BOYA 1IFHH 3VRLE 2HJKA 4LHUB 3FVRA 4C55A 2NW3A 3DXAB 2Z8SA 4Z8FH 4YDKH 4KV5F 5D7LB 3FQRB 3D2BA 3WIHH 5L0QB 4I0PB 3VXMA 2EYTA 3K2IA 4FQHB 4LLWB 5AI9A 1A9EA 3DVNA 1AXTL 3FT3A 3ZKND 1FNHA 4JFQA 2YKLL 4WW2C 2VN7A 4XBPB 3NAAL 1R4ZA 3HMXA 5HYJB 4LAQL 4TRPH 1PW3A 3SE8H 3IETB 5KVFH 2H3NA 2X4QB 1SM3L 4YH6A 3MVEA 1QSFB 1YJDC 1WBYA 3UC0H 1KEGH 1KC5L 1CLEA 1A6ZB 3R3ZA 4G43B 2VQUA 2VC2H 1VFBB 4HAFA 1RK1B 3GSOB 1UB6A 4GBXD 4QHMB 1NANI 2YSSA 4ZV9A 1LO0H 3QWQB 5HI4C 3RY6C 1IBGH 4G8GD 1DSFH 3ESVF 5HKBA 2KZ1B 2H2SC 2VDLH 1W72L 1K4DB 1BJ1J 3BEWA 1EEZB 2QRUA 1VJ5A 3TYFA 1NU8A 3QUML 1FNGA 4X7SL 4KVCH 5TPWL 3FFCA 1DBKH 3U9PH 3QYJA 4XX1A 5ALJA 3WFDL 4H18A 3TYGL 1MX9A 3SBWA 5IB3B 3BJRA 1YEDB 4MD5A 1LO3H 4B0MM 1TLKA 2EC9U 5B4MD 4OZGA 3FONB 3SDYH 4XMLL 1U95B 4NUJA 2LE9A 3QDJB 5BS0D 4QHUA 2JGMA 3OKOA 4ZUUB 3TIEB 1NDGB 4HWZB 4I19A 1MJ8H 4Y16D 3RPIB 2VZTA 1MHPL 1F6LL 1FL5A 1DEDA 5C0BE 5GZNC 5FGBC 5H8DA 1A5FL 3GMQB 3B2VH 2IANE 2DLGA 3O45A 5JR1H 2WFLB 4KKCC 3PUCA 1I8IA 2X4PB 3GZKA 3HS0A 1XCTA 2DYPA 3O6FD 4NZTL 4ZFOA 3VFRB 2R4RH 1FVCA 4KK6C 5I1EL 1T6WA 2O2IA 5DYWA 5HF8A 1HQDA 2F54A 1ES0B 1W8OA 3QJFB 3U46B 5ALSA 3V9AA 2DCMA 1QIHA 1QBBA 1FJ1B 1U92A 5DO2C 4YHZL 4ETWA 4GKNB 1U8MA 4F57L 5IMLA 1AFVL 3BXNB 3SCMD 1J8HA 4KK8D 5D7SL 2I3DA 4QDZA 1XF3B 1YQ2A 1RI8A 4GRLC 2W38A 1L7IL 2AXJA 5DRWB 4XVJL 1J0YA 4Y2DA 1K5NB 4XIIA 3UEZA 3L5IA 4Q6IB 2C9AA 1EDBA 1AXTH 4BDSA 3I6ZA 2WANA 4ELME 5FO9B 2YKLH 3QH3A 3MGTA 3NAAH 1T04A 3CFIC 5F8QC 2Z8XA 4UV7L 2BY1A 5EC2B 1QG3A 2VDPL 1SM3H 4Y2SA 2I9LB 4DKDC 3EBAA 2ED7A 3L3JB 3PDDA 3RP1A 2ZCHL 3IJSA 3MBEA 1CQYA 1BIIB 3EO1B 4OB5L 5EU6E 1KC5H 2VATA 3BF8A 3M83A 4J3VA 1L6XA 1Z9MA 3KAAA 2R69L 4DSAA 4HHAB 2V7HB 4HBQA 4L1HA 1C7IA 4AN0A 1RJYA 4MSWB 5T3ZE 4HXGA 3ZLVA 3W9DB 1W72H 1X6LA 1JYVA 3WFZA 4JKMA 2BERA 1C4XA 3QUMH 4M8QA 4X7SH 1ZAGA 3FRPG 5HHOA 4PV9A 5EPMB 2QHLA 5TPWH 3DX7A 1H3GA 2D7NA 5HVWA 3WFDH 3V95A 5T1LB 2MMXA 3QO0A 3TYGH 1TFHA 2QJRA 4XCNB 4N0UE 4H7FA 4NQDD 3CXHK 3L3IA 2X5PA 3MFGB 4IRZL 4QF1B 3RL2A 5HF9A 3QEHB 1EXUA 1CDIA 4FRWA 4XMLH 1EA9C 5MEQA 3RVUC 1SBSL 5JQ6L 5E6IC 4M48L 3DRQB 5CEXB 5ANMB 3F96A 1CR9L 2Y7QA 1BAFL 4G80B 1EFQA 1MHPH 3VH8A 1G1CA 2CLRA 1A5FH 1ORWA 3L5XL 3CSPA 3Q3GB 5KANI 4QWWC 4HFWB 4PP2B 2Y1KA 5ENWB 1XGPA 4A2MA 3U4BL 4YZFE 4JFHE 4XP9L 2WP3O 4NZTH 4GDMA 1PJAA 3WJ1A 4NSKB 5I1EH 4N9GB 3U0TA 4FQXB 3HZYB 3QDME 5CD3A 2Q1EA 4RFEB 1U3HA 3TCLB 2V9ZA 1INQA 5C09B 1CICD 3BN3B 4YHZH 4F33B 1Q0XL 3MRIB 5JW4Q 4OF8A 4F57H 1UXSA 1IAKA 3ZTJH 4F8QA 1AFVH 4JFXB 4ZODA 2GW5A 5D7SH 1T1YB 4H35A 2WHQA 4LHEA 3OC0A 1OSZA 1L7IH 1XKTA 1A64A 4XVJH 3BYYA 1S7VB 2LVEA 2FO4A 2RB8A 1QTRA 4LLQA 3IDAA 1F0NA 4LKCB 4RBPK 3QEUB 1BVKA 1XF4B 4AO8A 1G6RA 3I6MA 5DMJB 2Y6VA 3D1MC 1E4XL 1OSPL 1IAIL 2OCFD 2XZCL 3S35X 4LVNC 2D0DA 3A67L 1YEIL 5JPMB 4X0KB 2F15A 4UV7H 4PJ9C 1PBYA 2VDPH 4ONHB 5E7BA 3RU8L 4LCWB 5EUOA 1U8QB 2ZCHH 5DD0L 1HHGA 5SWZE 4OB5H 5E8PA 3CGTA 3LMJL 5DNWA 1MAML 3AROA 1JF1A 1OP5H 2R69H 5JNYA 4M4PA 2RQ8A 2JGEA 3AREA 3FFDB 4LEXL 3VFMB 2H7XA 4X7CC 4WFGD 1WIOA 1HPLA 3WHXA 4U1GC 5D2LA 4LLUB 3WNOA 5IMKB 5ESQA 3ZKXB 2XQFA 2IJ0C 4UBJA 2VLRB 1P7KA 4MAYB 4XNQB 5T33L 4K94L 3C5ZD 1IAIM 1ADQA 3SGDI 5F3BB 3TH3T 1I8MB 5JASA 3KPNA 3RJDA 2WM0A 1H3TA 4EQ2A 4OZ4B 4GKSA 4IRZH 5GXBB 3MREB 3MLTA 1ORQB 1KNOA 3ZE1E 3CH1A 2Z31B 2ZUSA 3V7AE 5J06A 1SBSH 3KPLB 2E9BA 1JVKA 4FG6D 5JQ6H 4M48H 5IW3A 2DL2A 4MJ6B 3HB3D 1CR9H 2GI7A 1BAFH 5JW4N 4WFHE 1R88A 3F5WA 1I85C 2J4WL 3BIKB 3L5XH 5DRXB 1CT8B 5DHYA 2FZ3A 4WWKC 3IDJA 1AP2B 3V5HA 3U4BH 2JGLA 2AK4A 4XP9H 1IUPA 3HI1A 3HE7D 1UT6A 1IZKA 5E4EC 4PY8J 3VGHA 2WUEA 2A6JB 3G5YB 1CFSB 2CIKA 3WXWL 1RHHB 2ICEA 1Q72L 2JKXA 4U2BA 1BZ9A 3PWPB 3STBA 2APBA 3D7RA 3QH4A 3KJ6L 2OGTA 4IEFB 5IEKA 3DEAA 1EI9A 4C88A 1Q0XH 1UENA 4IOSD 5DJYB 3IGAB 4XPTL 4J3WA 5AM4A 2LU4A 2VZSA 4P2RD 4O2CB 4WW1B 5H2BB 3W39A 2BY2A 2PSJA 5I9QB 2I24N 2Z8WC 5E4YA 4MXQD 2DIBA 4LBEA 2G5PA 4L29A 2MSPA 3UUEA 1GGUA 1E4XH 1OSPH 1P5VA 1IAIH 1G0DA 2J8UF 5EBLB 2XZCH 5L2JB 3QA3A 3A67H 1YEIH 1AKJB 4ARBA 4FTVE 3ZMRA 4WI6A 1SJXA 4Y2JA 2GJ6A 3CFKB 3RU8H 4BSJA 1DN2A 3DVGA 5DD0H 3P0GB 4QRQB 4DWHA 4MNHA 5DMIL 4KRPC 3C8DA 1UH2A 5EN2B 1Y18B 3BE1L 5HHXL 3LMJH 3LB6C 1FVDA 4PJXE 5CEZL 3UTTD 1S7UB 1MAMH 4MLSA 3AXLB 3RDTD 4Y4HB 3PGDA 3RVVD 4LEXH 1XGTB 3FMGL 3I6KB 2YR3A 5A7GA 4G8DA 3RWJB 5FRDA 3H9SD 5E99L 1QIDA 4ZAKB 2GT9A 1JGUL 4P3DA 1IC1A 2ZSVB 2BOBA 1HZHL 4XBGA 4AMZA 2HJKB 3QNYA 4K94H 5T33H 2K7QA 1FAKT 1QTYT 4LSRL 3DOHA 3MV9E 5C08A 1XGYL 1ZVSA 1AHWB 4JQXC 1CUIA 4OD1L 1U93A 3V4VL 1KIQB 2EDHA 4BELD 1E66A 1CI5A 2EYTB 1HNGA 3VW3L 1J2EA 1XZBA 3B43A 2R8SL 5ISZA 1ZLWK 4I4WB 2BMKB 3E3AA 3KOOA 4R3SB 4KJWC 4PTUA 3VWJB 1WBXA 3RWDB 3U36B 4X5LA 1QZ3A 3VXSA 1BIHA 2C3GA 4PJHE 2W91A 3SDDA 2H3NB 4NC0B 1G66A 2J4WH 5EOTB 4EI5B 4CCWA 2A2QT 3GSNB 2XPGA 4PREA 2HA4A 5DD1L 3FOBA 4N8CL 4OGZA 3ZYJA 5IMMA 2PYEA 2HA2A 3A6ZA 3WXWH 2UWEE 1P7QA 1Q72H 1J0ZA 3RVWD 1XRLA 1QIMA 5F71A 2AXEA 3KJ6H 4YGVA 3BEWB 4JM2C 5J12B 2NQCA 2OR7A 4J7AA 4GRWH 3TYFB 1JYNA 4K6KA 4JR9L 1P4LA 1WWBX 3TNMA 4XPTH 1G4HA 2IH3A 1IGIL 4R26L 5BQ7A 5I75B 3FFCB 4NN6B 2V9QA 3MV7A 2JJWA 4NN7C 3HC4L 5KN5B 1MT3A 2KL6A 1ZSDB 3TH4T 3ARBA 4L8SC 3VXNB 2FRGP 5T1KA 2MCG1 4OZGB 2AV1A 3VFOA 2P45B 4NUJB 4XMPL 3U1SL 1YEEL 1A7QL 1HHJB 2FBJL 4QHUB 1FIEA 1QRNE 1XR9A 5E9DB 3BXPA 1I1YA 4DCQB 3MOBL 3MUY1 5JDSA 4G5ZL 2W0PA 4RSVA 4XWOC 3WJJA 3S7GA 4W4OA 3H19A 4H7KA 3QFDA 2BAGA 5DMIH 3U0WL 3HHRB 3BE1H 3K81A 1VOTA 3WFEL 5HHXH 3QUZA 5CEZH 5T4EA 2WTMA 2PW2A 3L9RA 3SKOB 3DURA 3OMZA 3VJMA 3FMGH 4H1LG 1T66D 4RGMC 1CGWA 4PGZA 2XUGA 1XGRA 1WFTA 1U92B 4Z7NF 1SY6L 3QHFL 4YDLC 1ISPA 5E99H 1HKFA 1U8MB 5HSFA 1JGUH 3JVGC 5IMLB 2WUBL 1RUQL 4ZUVA 1J8HB 2HU7A 4Y2YA 1HZHH 2IITA 2WBJD 1MELA 4N68A 5BV7L 1XZFA 1E4KC 3CK0L 4LSRH 3OAYK 1E0OB 1XGYH 4ZS6D 1B6UA 5E7FA 2GBGA 2ZUXA 4Y2DB 2X4UB 4OD1H 3V4VH 5FECA 1WQVT 5I8KL 1J07A 2R8SH 5C1MB 5CKAA 3AZQA 2CLVA 5DVLA 2BGRA 1XFPA 3BIWA 3KXFD 3MGTB 2JCCE 4M9OA 5J1TC 1F4YL 1AD0B 3LSOB 3ESCA 4Z76A 4XPGL 4JRYA 1MQKL 4KK9D 3IJSB 3MBEB 4M93B 4AZ0A 2OXHA 1F00I 1BN6A 3OV6A 2DF3A 2QSVA 2Z91A 4EVNB 4FFWA 3HKFA 4ENEC 4TVPD 5DD1H 5M95B 4X85A 3D2CA 4G3YL 4N8CH 3L95A 4NM8L 3W0WD 1RJYB 2XIDA 1A8SA 5F7NC 1TETL 3I9GL 3DWTA 3STWA 4PJIF 2OK0L 5E5UB 4XB8A 1CXIA 5DZOA 2DICA 4JR9H 5HHOB 4BH8B 1IGIH 4R26H 1ZT4A 3T3PE 1TNNA 3DX7B 4NFCA 3HC4H 2XT0A 2D31A 4LCCC 2R1WA 5DFTA 4ZQKA 2NY0D 3L3IB 4L3ED 3C6BA 2JLLA 1EXUB 1V7NL 5MEQB 4R7NA 5MP6L 4XMPH 3UDWA 3U1SH 5TDPA 1YEEH 1A7QH 1QSVA 4G8GE 4HJJL 2FBJH 3MQIA 2EIEA 2P5WA 2QL1A 4ODTL 1ERNA 3IUMA 1NQBA 1T3FB 2B8OT 3DIFB 4X7DC 2CLRB 3MOBH 4G5ZH 1M05A 2Y2UA 3FLAA 1XGPB 4F15C 4Y2QA 3QDAA 4LU5L 3TA3B 3U0PB 3U0WH 2HVKA 2DS4A 5EDXA 3IDYB 4P9HC 3REWB 4K9EC 3V0WL 3WFEH 4GRMB 3MV01 3GMPA 4IRSA 2W9DL 4UZGA 1N64L 1XZDA 3B9KD 1A8QA 1MX1A 1CS6A 1INQB 5BCAA 1BWWA 1FSKC 3VFVA 1SY6H 3QHFH 2VQTA 3F8SA 1UXSB 1IAKB 1DVFA 2ERJC 2WUBH 3DVIA 1RUQH 3AUKA 3ARZA 3RWCB 3ZV7A 5IMOB 4PBVC 4WDIA 5BV7H 5CZXD 3S96A 4X3CA 1OSZB 5JW5B 3P9WB 2P7TB 7CGTA 3TBVA 3FZUC 4RGOL 1VFAA 4LLQB 5IK3B 3C2SA 3BZFA 5F97E 4WI8A 5E8NA 1KBGL 3EDFA 1HSBB 2EIZA 4GUPA 5I8KH 3BH9A 1T4MA 1JCKA 2ZUQB 4I18C 3MSPA 5MENB 4HX1B 1A6UL 3SC2A 4ODVL 4HDIA 3RFZC 1AGFA 1PJ9A 4OZHB 1F4YH 2P24A 1E6OL 5EU4A 3EYUL 1CUAA 3BD3A 3QXDA 4XPGH 4X9BA 1MQKH 3NFNA 3RQ3A 1HHGB 2I9TA 5E8PB 5CJOL 3MA9L 1TZIA 2IFGA 2CUTA 5ALEA 4G3YH 1LPNA 1VB9A 3PDCA 5JNYB 4QRTA 3DL4A 4X6BA 2DDQL 3I6GA 4NM8H 2FYYA 2OAGA 5D2LB 1TETH 4WI3A 3I9GH 5ESQB 1ZLUK 4KJYB 2OK0H 1MAKA 3P77B 4LHQB 3MRBA 3VXUA 3DGGA 1M7DB 3STTA 2XY2A 1JJIA 2HA0A 1P7KB 4XWGA 1FPTL 3KYNA 3EUUA 4MXVE 2HLAA 4U05A 4GG6F 3QZWA 3B3QA 1JHLL 2OTPA 3PGCB 3MBXL 3IUNA 1V7NH 1YMMB 5EB9A 4PJBB 3MLTB 4D2NA 1I1AD 1KNOB 5MP6H 3SE3A 3CH1B 3VGDA 1BRTA 2EDOA 4HJJH 4RMTA 5CP7A 3INUL 2YA0A 4ODTH 5J6HA 4V2BA 5D7JA 5GGTA 5F1OB 2RCSL 3O3EA 4ZOAA 1QLRB 2CGRL 3IDJB 4PJDA 3QPQC 1S7XA 3QAZB 4OFPA 5HYIA 1KLFA 4PS4H 2NY3C 4DVBA 1WVZA 3HI1B 1V7ML 4LU5H 4NQDE 5CXUA 3QZUA 3V0WH 2JJSC 5K59F 4ROTA 5H37G 1CDBA 2DMKA 4CL7A 2XQIA 2W9DH 1N64H 3UTSD 2PO6D 3KR3L 4IS6B 2C1OA 2VLKD 3OB0K 3AM8A 4AM0A 2BOCA 4JKLA 1MREL 2CJPA 4OCNC 5D3KA 4KHTL 4APQB 2RI6A 4Q74A 2XI4A 2OCGA 2P8SA 4IMKA 1RHFA 3W39B 4RCAA 4Z7WA 5FAAA 4L3CA 4U6XA 3VI4F 3CIQA 4NC2B 1TVHB 3S6CA 3TNNB 4RGOH 1E8MA 1DE4B 2DM2A 3NIGE 3D25A 2AJUL 4X4YA 4LBEB 2D9QB 4EN3B 3ZDXE 1KBGH 1OHQA 2HLFD 1QSED 1AR1D 2FJFA 3VXKA 1A6UH 1JPST 4ODVH 4I4CA 1MJUL 3GBML 3PHSA 2IAMB 3QUYA 2FHFA 4HXFB 1K6EA 1T1WA 1E6OH 4FXGA 1HKLL 3EYUH 1QR1A 4LPTA 1I8LA 2GQHA 2XICA 1A1NA 5CJOH 3MA9H 4X4ME 1QPPA 3G9VA 2H7CA 4GG8B 4BQ6A 4E41D 1NC2B 1H8NA 4BE4A 5ID0A 3PGDB 2DDQH 2ENYA 4HZLA 1BCSA 2XLBA 2BVOA 7FABL 1H3PL 2UUDH 4ODBD 1QFWI 1BQHA 3KLDA 3B9DA 2Z3WA 2ROQA 3ZL4L 3CSYA 5JD5A 2JK5B 4WI7A 4P3DB 4A6YA 3CFJB 5C86A 3P9MA 5J6GB 2BOBB 3C08L 3MRLB 3DVFA 4ZFFA 1FPTH 2DM7A 3U2SA 2EKSA 4WUKL 1P2CB 3QNYB 2PM8A 3DROA 3K4ZA 4WW2A 1UOQA 1F4WL 3KPMA 5E08L 2G2RA 5CJ8A 1ZVSB 3A6CL 1JHLH 3WEXA 3MBXH 3BDIA 4WFGE 4ODWA 4P4KD 1F4XL 4H0HB 5KVDH 1SCKA 1OLLA 3NFSL 4GBXC 3INUH 4EQ3A 4LHUD 4RMWA 5FV4A 3LAFA 3TBSB 1L4IA 2RCSH 3VJ6A 5D7LD 5E1AA 5JADA 2CGRH 1IM9A 3KXPA 2QXUA 4TULL 3RY6A 1KTLA 3SO5A 1V7MH 4RNCA 2V7NA 4RISL 2L4OA 4P2OB 3M3DA 3YASA 2HFTA 5IMMB 1LP9B 1UXWB 2CH8A 2I60L 3WUWG 3VDAA 2IBZY 4IHOB 4PGDA 3QCTL 3V2AR 3KR3H 5B4MC 3KDAA 1YPZA 1T22A 4OU4A 2EDYA 1NU6A 1MREH 3RIFF 4KHTH 5FKJA 4JB9L 4NNYA 1P4LB 5BZDA 1GRWA 2AJCA 4TUOB 2IH3B 2NY2B 5BQ7B 4Y16C 4Y19A 1QVOA 5FM8A 3MV7B 1RPQA 1QFUL 1Q9WA 4ZS7L 4W9RA 2MWCA 3ARBB 2VAAA 1V3LA 1JK8A 4WY8A 1YCDA 5FGBA 3S37X 5T1KB 2AJUH 3O6FC 2AV1B 3G9AB 5LKRA 1F3JA 1ZT1A 3C6SA 4HC1L 2ORYA 2AERT 5CBAB 2WILA 3SE9L 1MJUH 3GBMH 3PXJA 4P2RE 2XUKA 5C81A 3WNPA 1HKLH 5F9OL 1G7LB 2P42B 1JGEA 4QYOB 1JWUA 4XC1L 5AD0A 2GBCA 3SCMC 1H15A 1RQ5A 3KPRD 4ONFL 4KK8C 4PGBA 5EZJA 2VXTL 3EDJA 3QUZB 3BEVB 1OW0A 3L9RB 3DURB 1I3GL 1CUCA 3CLFL 4R97B 7FABH 1XGRB 5HHVL 1H3PH 1EFXD 3CZFA 3T77B 3CVIL 3HG1A 5HY9B 1YEFL 3ZL4H 1PVHA 1GGBL 4POZD 4Z77B 1MTZA 4YHNA 1XFDA 4ZUVB 2FB4L 3N9GL 4NHCL 3C08H 4PV8A 4WUKH 3UAJD 4X90A 1FYTD 1E8NA 1E27B 1F4WH 1NMCB 5E08H 3UTTE 3A6CH 2YZ1A 3HMWL 5FECB 5FO8A 3BGFC 3MRFB 5BVJA 1U2CA 1F4XH 3QEQD 3IDIA 2CLVB 4P92A 1QO9A 3H9SE 1INDL 1N2RA 3NFSH 4H7IA 4P08A 5JHDA 4JPWL 1CFJA 2DKSA 5GS3A 4YUEL 4JRYB 1U65A 2PUHA 4U0RC 3GJFH 4UFPA 1BQSA 3HZMA 1BHGA 4TULH 1AC6A 1J1IA 4UOJA 4RISH 3BPLC 3BIBX 3L95B 5DQDL 2I60H 4NGHL 3GIVA 3RX7A 3WK7A 2Y72A 1CDGA 3LEYL 1X5IA 3QCTH 4Q1VA 3GKWL 2XUDA 4JG0L 2I26N 1LBSA 4NJ9L 1XQXA 1E5TA 3D5OF 4KE9A 4JB9H 5AKHA 1MX5A 2F8OA 1JPGB 3UJIL 1XEDA 4M03A 4J2XA 4JLRA 3HRHA 4MEAA 3O2DA 1QFUH 4UHCA 2XUHA 1CTNA 2CJUL 2DMCA 4MD0B 5E6IA 5ALHA 4ZS7H 3V6OE 3K2MC 3D48R 3KPPB 4AL8L 5D96C 1JMZA 4MHHI 5AM2A 1NSNL 4R7NB 4QWWA 5TDPB 2JGKA 4X92A 1SYSA 2OJEB 4HC1H 2ZOLA 3ROLB 2H32H 3EOYG 3SE9H 5L7XL 5CSZB 2F5BL 5A7HA 2AXGB 2WTNA 2PU7A 3DNKA 1MF2L 3D0LA 1CICC 1ZA3B 1KYOJ 1JNHB 2OPHA 1HHKA 5F9OH 3G04B 4XC1H 1QFWL 5C9JA 4NHUA 4ONFH 2VXTH 1JL8A 1F58L 2D7MA 1KULA 2OYPA 4V1DE 1I3GH 4IRSB 3SDXB 3CLFH 3N1FC 3PNWB 2ITCA 2GIYA 5AAMA 4JFDB 2AQ3A 5HHVH 1I7ZB 4DAGL 3CVIH 2FEEI 1YEFH 1GGBH 1W75A 5K3AA 3WZLA 3UO1L 2WHPB 2FB4H 3N9GH 4NHCH 3IJHA 1KXTB 4WDIB 4LGPB 2PNDA 3S96B 2HFFB 4FQXD 4AQOA 3CPLA 4Z5RA 1LO4L 3RKDD 4BFEA 3QDHA 2XQJA 1SEBB 3HMWH 4PJ9A 2OGZA 3JV5A 5E8NB 1FH5L 5DMKA 2K9UA 3BH9B 3GMNA 3M17B 4LIPD 1INDH 3WDIA 4AENA 1AXSA 4X95A 1UK8A 1AGFB 2J3SA 1QZ1A 1U8IA 4JPWH 2P24B 4OIBA 4B5EA 4YUEH 4XRCA 2CDGB 3QXDB 5F89B 2J5LC 1PX4A 5J13B 4C4YA 2I9TB 5DEZA 3ICVA 4HGWA 1MY7A 3AY4A 3BGAA 3L5JA 3S97C 1TZIB 2JB6A 5TFSL 4AK1A 1M33A 4OZFA 3C5ZC 2YD9A 1QO7A 1RU9L 1MHHB 2HTKD 4G6AD 3T2NL 5DQDH 3I6GB 4U6HA 5F9WC 4G9DB 4NGHH 4EXKA 1G5FA 1WISA 4HS8L 2QZPA 4PF1A 3OJDA 4WFFD 1FFPB 3LEYH 5IVZA 3KXFE 3GKWH 4JFPA 2B39A 4GBGA 4JG0H 4NQXB 4QHKI 4ZOBA 4MCZA 3HC3H 3EFFA 3MRBB 3VXUB 4FG6C 1WZKA 4JM4L 2BCKA 3LQAC 5TGBA 3UJIH 3HB3C 3KYNB 3I28A 5TDOB 3N06B 2HFJA 2CJUH 4PJCE 2O2GA 3QZWB 5FDYA 2ICWA 4AL8H 1RK0A 2QQLL 5K5EA 3V1NA 5C07B 1JPFA 2XOTA 3W0WE 2A6KA 2E3JA 1NSNH 3HE7C 2UV3A 4AT6A 2Y5TA 3F7VB 4WWKA 4EDXA 2XMDA 4I3RL 5C0BA 5EI5A 4BB0A 3SDAB 1UXOA 3DMMD 3B8SA 4JFEB 5HVHB 3CJJA 3Q1SL 1E89A 1ZTXL 5L7XH 2F5BH 2XZAL 4J1UA 5D7JB 4NZZA 4HEPG 1MF2H 3GDBA 4J23A 5F3HB 4PJDB 5IKXA 3ARUA 1X5AA 2WUFA 4JRXE 4Z95L 1T5WB 5JQHC 1QFWH 5TQ0L 2BSSA 2WIDA 3CDGB 1J12A 4L3EE 3RGVA 4BVLA 3QPXL 8CGTA 4LPCA 3K7UA 3BYTA 3I2JA 1F58H 3KJ4C 5EFIB 5C3TA 4U6TA 4OQ1A 3MLVL 4BKLA 4MXQC 4I13B 4AM0B 5FKAA 5CD5D 4W6WB 5LYYA 2BOCB 4DAGH 4FNLL 5ICXA 4OD3L 1P7HL 2Z4QB 5CAYB 5IVHA 3N1PC 4WTXA 3UO1H 3R3VA 1KJ2L 3TBYA 3I75A 4Z7WB 4HZAA 4L3CB 5DDHA 4YHYC 2B4CL 2EDXA 1FZJA 1GZ7A 3P30L 1YN7B 1LO4H 2CRMA 3PWPD 3A2MA 4ELMA 1TPXB 1FH5H 1SYVA 4QTHB 3RDTC 1YEGL 1BX2A 3KWWA 2JJUA 3NIFF 5KSUA 2J8UE 1T80A 3DV4A 3UROR 4P5KA 4HUNB 5EU6A 4BZWA 4DMCA 3EOBA 1JMKC 3S2ZA 5L88L 1S7WA 2I07B 1FFEA 1BEEA 1R5VA 3QMMA 5TFSH 1RU9H 3LKPA 4UHBA 3T2NH 5KSVA 2IADA 4HS8H 1OAUL 2Z8RA 5CXXA 1BQHB 4PB9L 3ZTNL 4B7IA 3TBTA 2BP3A 4JQXA 2R9HD 1QFMA 4A6YB 2B0SL 4G42A 3HC7A 4JM4H 5J11C 2EH8L 4AIZA 4AEFA 4IOIA 1OTTD 5JO5B 1ZLVH 4N0UA 3TZVD 1D07A 4TSAL 5KG9A 1MCDA 4CN6A 1BMGA 3NN8A 3DYPA 4Y4HD 3WFHA 4R96A 1H23A 5FP0A 2LAGB 1I3RA 4DYHA 2QQLH 2CRYA 2AP2A 3TVMD 1EK3A 3V6OC 4OFVA 4BAGA 4M3KB 1LPMA 4I3RH 5DVKA 4BRSA 4TNVK 1F3RB 1X2EA 5DTJA 5SX5H 3Q1SH 4JQIL 2IQ9H 1ZTXH 3RVWC 2XZAH 1VA5A 4NOBA 3VJ6B 3IJYA 4GW3A 4KMQA 1BBDL 1IM9B 3VD7A 4Z95H 1KTLB 2VT6A 2PTTA 1OWWA 3D0VA 5MEPB 5TQ0H 4JM2A 4JANB 2XKUA 5ALYA 3VWJD 4OZIE 1JJUA 2D4DA 2J8HA 4PJ7B 2H45A 2YEZB 4W1QA 5H94A 4FFZL 3MLVH 3QQ4A 1XH3B 1JV5A 2NLJA 2RHTA 4K3GA 4FNLH 1FZKA 4XNZB 4L8SA 4NRYA 4OD3H 2AW2A 3S4SG 5BZDB 2IQAA 1QVOB 1KJ2H 1JWMA 4HIJA 1YAHA 2ZJFA 3IDUA 3T0EB 3C2AL 1Q9WB 4BYMA 1P4BL 5DK3A 2B4CH 1T1XB 2A73A 4K3HA 2ESVD 3P30H 2YPKB 4DK3A 4UU9A 1UFUA 1KU6A 1IEBB 1F3JB 4PRPE 2FCBA 2VLKE 1U8EA 4FHZA 2ID5A 5GGVY 1DLHB 4O08A 1YEGH 5E6ZA 1T66C 1FZOA 3QYCA 2WIIA 5DRNA 1U8NA 4LVOC 5SWZA 1A2YB 2X9WA 4N8VG 4JJ5B 5CGTA 4Z7VB 4G8CA 1H15B 3EIFA 5L88H 1DDHB 2VERN 4PGBB 5EZJB 2WBJC 3V0AC 4E0RA 3AAZA 1J1PL 5E9DD 2OJZL 4HIIB 1OB1B 2R15A 4PRIB 1QSEE 3AS2A 4ZS6C 1FL6B 1DBML 4GRLB 1OAUH 1A3RL 1E4KA 1P9MA 4ALAL 1R3LA 4PB9H 2PF6A 3H9HA 3HG1B 3ZTNH 2AAVA 2GKIA 3L3OB 1QKZL 3O6ML 2B0SH 4HWBL 1NDMA 1WB5A 2EH8H 2E7LC 3GUUA 2YXFA 4NBXB 2BVPA 5IV2A 2WM2A 4TSAH 3H2GA 1R9NA 4QRUA 3V9FA 3QULA 1WGOA 4KK9C 4P2YA 4E41E 1XQYA 3PL6D 2VE6B 4L3WA 5FB8A 5C6PB 5FO8B 4ODUB 4Q3OA 1B0RA 1BFOB 4EUPH 5BVJB 3IDIB 4RFNB 3R8QA 4CUCA 4J3UA 4RAUB 4JQIH 5JHDB 1XGQB 3DX8A 4G8FB 4HG4J 1IC4L 1MHEA 5F1IB 5A16A 5KSBF 2E3VA 4HKJA 1N8ZB 1BBDH 3HZMB 4HPYL 1MLBB 2IPKA 1JNJA 1ZGCA 3C6LB 3T2OA 4LASL 1VE6A 5JIKA 4K71C 3GIVB 1GPLA 1TVBA 2NY0C 1YUHB 2WJ4A 4FFZH 4P9ML 5DTFB 3QM1A 2EZ0D 2XMZA 5L8LB 1MWAA 3DXAE 4LCCA 2OGSA 3QG6A 4X6UA 1AGEB 2FL5A 2Z9TA 4OQTL 3MUHL 3GSRB 5D7LE 1QIFA 4M0FA 3KDMB 5DFVD 3JWOL 1IC5L 1D5BA 3C2AH 5E6IB 1P4BH 3K4AA 4BM7A 5I66B 3V1LA 4QEGA 1WITA 3RI5K 3BZDA 1G84A 3U6RB 4U1JB 1UQSA 1SOMA 5CIPB 5HYQA 4IJ3C 1ODAA 1SYSB 2NYYD 4FQIL 3T09A 4WFEE 4GAFB 4HKXA 1QSFE 4OUUB 4FTVA 3THML 3DX9A 1XCQA 3B9KC 4FFVD 1VFOA 5DR5L 1LP9F 1NBQA 3CFBA 4OLVL 3WCYA 3NIDF 4NQCB 4HUMB 5CJ5A 4PJXA 2HWZL 1MFAL 1WSST 5LVEA 3MX0A 2GHWB 4ZDHA 3E4DA 5CZXC 4MXDA 3F6LA 3WSQL 3P9LA 1J1PH 3TT3L 2OJZH 5FHBL 4NRXA 4L3AA 3T65A 1DBMH 2UZXB 4ETYA 1A3RH 1FNEA 3W81A 4ALAH 3BRFA 3LY6A 1Q8MA 1JHTA 3UBXA 1FN4A 1QKZH 3O6MH 1AQDA 4HWBH 1FG2B 3TA3D 3HABA 1CG9A 2O93L 2BHYA 2QBWA 3RVXD 3IJHB 3EBLA 5DI8B 3MV9A 2CUHA 3D4LA 4OIAA 2PBLA 1U0QA 4Q3KA 5SWQA 4RFOL 4I18A 4FQ2L 1NJ9B 3C09B 4YIQA 5ERWA 2JELL 1LGVA 4FXLA 4JZJC 1HCVA 1FCGA 5DD5L 3M81A 3LN5B 5HJ3B 5DMKB 2EXWD 3GMNB 4KRYA 2VISB 3HR5A 1XLWA 4AENB 1AXSB 3OXRB 4JQVC 1O6GA 4CMHC 4LLDA 4NQED 1OP5K 1XLUA 5AICA 3MRCA 4XRCB 1VDGA 3U4EB 1IC4H 5E1HB 5EO1A 3I2GA 2BNRD 1FYTE 4E14A 4TOYL 2WQRA 2Q7YA 4HK0A 4U1GB 1XZGA 4HGMA 4HPYH 1OF2A 4JKWA 1RZFL 4MWFB 2X4RA 4LASH 1GT6A 2UWEA 1BN7A 4GH7B 1IGJA 3CU1A 4EBBA 1A6VL 3RY5A 4H0CA 2EDJA 5IVZB 3OPZL 1OGAD 4P9MH 1IGFL 4JFPB 1N8SA 2GITB 1I1AC 2G9HB 2LABA 4OJFL 3ZLUA 5E8OB 5IP4A 1HDMA 1O7SA 2V2WB 4OQTH 4GQ9L 4LLMA 2QSCL 3JWOH 3G5XB 4DK6A 1IC5H 4LSVL 3P4LA 2EEPA 5CWSB 1BWMA 3MJ7A 3O81A 5A7FA 2FNBA 4PLOB 5HI3D 4GG6E 1RK0B 4WHTB 4NQVA 3BO8A 2VJBA 1QRNA 2Y5TB 4WWKB 4EDXB 5C0BB 1OP3H 4FQIH 4N8SA 4MJID 2W0KA 3THMH 1NCAL 5LZ9A 3TM6A 3V6FA 2PO6C 2JJSA 3TT1L 1TXKA 3A6OA 5DR5H 4CG3A 4BTVA 4OLVH 2QQKL 5L2KD 4EI6A 3QO1B 2HWZH 1MFAH 2HKHL 3G0GA 1LPAB 1YMMD 3QFJD 2BSSB 3IDMA 2V2TA 3MNWA 4F8TA 4PJAF 1GH7A 3STLA 2EE2A 1UZAA 4EY8A 5KS9B 3EYVA 5K59E 1F8TL 2W6CX 3WSQH 3WIBA 3VXOA 3TH2T 2X40A 5GRXG 3TT3H 5FHBH 3ZTJG 4BKLB 2VLLB 5FKAB 1TKRA 4EHBA 2HLFC 3G5VB 1FFOA 1AR1C 3BIAX 1QO3B 4Y4FD 2DFPA 1HQ4B 2MQ3A 3UTPD 1X5KA 1NCDL 3LRHA 1T0MB 2ACKA 4RFOH 4YK4C 4FQ2H 4DKEL 3IU4L 4W4NA 3QHZL 2R1YA 4YBLC 2JELH 3KNBA 5IBLD 3VI4E 4NPYA 3HA0A 4Q3LA 1ED3A 5ANME 2XWBB 5DD5H 1FGVL 2BK8A 4NO2B 1IKNC 2JCCA 2I78A 4P2QB 2ILLA 2BFNA 2LTQC 1OTUD 3KGRA 5C7YA 4N9OB 5ICYA 5KSUB 3DV4B 3VDBA 1B41A 3CZJA 3GSQA 1F90L 3MYJB 2AK1L 2OM5A 3EOBB 1VGKA 3JTSB 4YC2C 5E8DL 3SDXF 4DNPA 4TOYH 4HKZB 1S7WB 3I3EA 4EN3D 1NUNB 1RZFH 2P44B 4LP4A 5FYJD 1G7IA 3H2WA 5C09E 1TRHA 3UYRL 2AJLI 1A6VH 5KSVB 1QE3A 3LD8C 5EOCJ 1CYGA 3QIUC 4WENB 3D3NA 5BZWB 5MEOB 3OPZH 5KOVC 3GM0A 4ZD3L 1IGFH 4P4KC 4HD9A 4DQOL 4OJFH 3VWKD 4G42B 4QZVA 4AIZB 4IOIB 4GQ9H 4N0UB 2QSCH 2WIFA 4LSVH 5DS8A 3WFHB 4GBXA 5T1MA 1Q94A 1I3RB 3WLWD 5L0QC 4G8GA 5AWNL 4RA0C 3T8XA 1XF2A 1Q83A 2F53D 5T5NG 4LKXA 5AI0A 4LCWE 3WWCA 2DL9A 2BGNA 1A1MA 1NCAH 4CVXA 2C1PB 3BDXA 3TT1H 3JWDL 4HULB 4AXBA 5SV3A 5K9KB 2QQKH 4DOHB 4U1SA 4JO4L 4LEOA 1XZMA 2HKHH 3D0VB 4H0GA 4J8RA 1UZ8A 4JM2B 3R4DA 4XNMB 3T4YA 4HIEA 1URLA 1ZKAA 5BS0A 1HE7A 2OSLA 1GSMA 4JZNB 3BIXA 3GGWA 4G8BA 4PRAA 1UKBA 4Y16A 4ELKB 5DNVA 4NN7B 3WL9A 3MRDB 5DWDA 3CSBA 3QQ4B 1JV5B 4BZ1L 4BC0A 5DJZA 4WNQA 3KLHD 4TQEL 3FB7A 3V5KA 1OT2A 1W0VA 4LYEA 3O6FA 4H25A 5DQ9A 4P2OD 2FGWL 3TFKD 1LE9A 1NCDH 5CTAA 5F7HA 4DKEH 3IU4H 3QHZH 1LILA 5ALTA 4M7LL 3W04A 2R1XA 4UDUA 2OQJB 3VXQB 2VAXA 1QFHA 1FGVH 5SV4A 4S11A 5K9OA 1NGXB 5JAUA 5CUSL 3SCMA 4S2SB 4BQ8A 3WO3B 4XHQA 5AOCA 1R0AL 4U6YA 1U8NB 5DRNB 3FQNB 1F90H 5FUMA 4KXZI 2AK1H 1S9WA 1FFQA 3OXSA 5F8RC 4POZC 4LXGA 1JJFA 1EINA 1BM3H 5E8DH 2FHBA 4OM0L 5FUOH 2FDBP 3PWPE 1RJLA 3HLKA 3UAJC 4J12A 4M1CD 3UYRH 1FORL 2V9TA 3TESA 4BAZA 3QIWD 3WLBA 1R3LB 3WV0A 3H9HB 4XT1C 4ZD3H 5HYSG 4D0DA 1NGZB 3T2QA 5SWSB 4DQOH 2O61B 1NDMB 1UKTA 2LIPA 1EX9A 4CAGA 5DEFA 3D85B 1N59B 4QRUB 5F6HJ 1I75A 5JOPD 4KYVA 5EIIB 1EDQA 5FB8B 4TVKA 3OKNA 5AWNH 4GKZB 3N85L 3EQ8A 4B7ZA 4PJFB 5EO0B 5JUEL 3S4SB 3D2UB 4HKJB 3K4DA 3JWDH 4GT7A 3KPOA 4NQDA 4X4XB 5EUKB 1DT5A 5I1GL 4JO4H 2P8LA 3FB8A 3OKLB 4Q9QL 2HAZA 3FO1A 3RKPA 5AI4A 2J6EL 2C0QA 1QLFA 1TVBB 2NXZD 3N0TA 2N7AA 3N1MC 1THGA 3H0TA 4BQ9A 4BZ1H 3F6IA 3HEAA 4LCCB 4TQEH 4PJGB 2E7BA 4YAQA 1DQML 2FL5B 3RUGB 4L5FL 4N8VB 4ODSL 4A16A 1Q9LA 2Y1VA 3O3DA 1F4AA 4P46B 3HZVA 2FGWH 4FNMA 4PD4K 3RBGA 4DVRL 2AJSL 1FO0L 1QJ4A 4M7LH 1VADA 1JN6A 3L3KA 1WTLA 3TPUA 1PEZA 1CICA 1UQSB 1U9KA 3VGFA 3KLAA 5HYQB 3G6AA 4U2ZA 1BLNA 4F15B 4UBKA 3MLXL 5CUSH 2ARJA 4HKXB 4MS8C 4R4BA 3DX9B 5C7XL 5DJ6A 1XCQB 1BQLL 3LV3A 5D5MF 4OBRA 1CWVA 1R0AH 1XRMA 5FLKA 1NAKL 3CFBB 1LZKA 5ALCL 4PJ7F 2R39A 1ZGLB 5CBEB 4PJXB 4X4MA 4L8BA 3T04D 3QJHB 3IT8D 4PSUA 3UCRA 1FSKB 4OM0H 4D9RD 2ESVE 4NT6A 4OUKX 4Y5XC 4KU1A 5HHPB 1WOMA 5ALOA 2ERJB 1J0JA 4FQXC 1FORH 4U2FA 4OKVA 4RX4D 3RKDC 3WIIL 2FH8A 4LSDA 2ZVDA 3Q5OA 1WIPA 2XE4A 5DVOA 3U1TA 3VXPA 1BJMA 1UJ3C 3MV9B 3S35L 4OZGE 2QQNL 5FV1L 5SWQB 3ARGD 3VGBA 4K3JL 5ERWB 1T89C 3DHJA 2WSKA 1Y6NR 1LEKB 4KRLB 4JFDD 5E9DE 1FGNL 4WGVB 2HADA 4QNPF 2D7PA 4W63A 2R23A 3N85H 1KEML 2ZSHA 3CXUA 4G6AC 2HTKC 5LAXB 1ACZA 4Z7OF 5JUEH 2PR4L 2N56A 4PRHB 4RAVA 3KPSD 1DQJB 1KV3A 3C5ZA 4AH2A 1JZ8A 3MRCB 2VXSL 5GGRB 4ZXBD 1CL7I 5EO1B 4MJ3A 2AEQL 5CKGA 4PGCA 1IMJA 2X9YA 5FYLL 2OXGA 4Q6YA 4IDLA 4N5IX 5I1GH 1ZANL 4Q9QH 2PW1B 3NCBB 1DUYA 2J6EH 3ZDZF 1NX9A 3ARFD 4PUBL 3ZT7A 1UEYA 4PSDA 4PJEF 2GFBA 1J8HE 1UM4L 3LZFL 1CEXA 1UC6A 1HDMB 4AY0A 1DQMH 1JNLL 2DM3A 5JA8B 4L5FH 4ODSH 4OV5B 3CCHA 1QR4A 1YDPB 3HE7A 5FCSH 5AK6A 3BZ4A 1CUWA 4G1FA 3MJ7B 5FGCE 2IG2L 4DVRH 2AJSH 3JW8A 1FO0H 1XIWD 3PIQA 1TQBB 3VXTA 2FIRT 3BO8B 4MD4A 1JMXA 1QRNB 5HBBA 1NEZA 1HIML 4MQTB 3OGCA 2NY3B 3MLXH 1JKMA 5HYEA 1Z0MA 4P2RA 1BROA 2WNGA 5C7XH 3V6FB 1BQLH 5MERA 2VO5A 1J0KA 4XAKD 3WFCL 4FWBA 5CD5C 1NAKH 4G7YL 4C58B 5ALCH 2EYRA 2SEBA 4RMSA 1WZLA 4YXKL 1KG0B 1WPRA 2C7UA 3DKKA 4BSWA 3VCLA 2YD2A 3IKCB 4MA7L 2Q20A 4N0CD 4E5XA 3FRUB 3OKDB 3DRTA 3IDMB 3F9CA 4B9AA 3MRRA 4F3FB 3W9BA 2HN7A 3STLB 4M61A 3I2KA 2OQVA 1JZ2A 2BXZA 5CURA 2GYSA 3EYVB 4K2UL 4JFED 3VXOB 4Y5VC 2X5XA 3WIIH 3H04A 4MJ5B 3BPCA 1A3LL 3BJLA 3O3AA 1CFTB 4YHLL 5IQ7L 4I9WD 1FFOB 3O9WD 3LRGA 4ZUSA 2WU4A 1JUFA 1IGML 3S35H 3UTTA 2QQNH 3RDTA 5I9QC 2QVBA 4IM8A 4K3JH 1AGDA 1W72B 3KNBB 1G7JA 3LEXA 5DEGB 5DGRA 1ONQB 1XZ0B 3MUGB 1FGNH 3IB4A 3H9SA 5DK2A 2JCCB 3TO4B 3D0KA 1KEMH 2GUOB 4AYFA 3I2FA 1JT2A 3LKRA 4NO0D 4EY6A 5ICYB 3AFIA 1LD9A 2PR4H 4XH2A 3SKNB 3Q48A 2FWOA 1Z6JT 3IDXL 3NIFE 3L3GA 1HHIA 4I48B 2VXSH 2AEQH 2VZVA 4U1IB 3HAEA 1VGKB 5FYLH 4MYDA 2UUDK 1VLQA 1HQRA 1G42A 1OTTC 1ZANH 2YD8A 2E7MA 1LO5A 3TZVC 2FJPA 5I30L 2O26U 1EPFA 4Y4HC 1RJZA 4NO5B 5A1AA 1VFUA 1CXHA 1OAYL 4PRBB 3MCKA 1CGVA 4PUBH 2Q86A 1ODSA 2PYFB 4TYUA 1UM4H 3LZFH 1FFRA 1KLGB 4UMGA 3WKCA 3K8KA 3TVMC 2A6DA 1PQZA 4X7BA 4OFYD 5CT9A 1JNLH 2PTUA 3V6OA 2WQZA 2Q0XA 5IW6B 2C4FT 2X89D 2FSEA 3IRPX 4GBXB 3WUZA 4TTGA 2IG2H 3H7LA 1AHWC 5DC0A 3CX2A 3F8UB 3OJ2C 5MENE 1IJ9A 4YFDB 5I8PA 1VXRA 1I7RA 4KXZH 1XF2B 4N1CA 5HZGA 4OZHE 3C5JA 3F98A 1OGAE 1HIMH 2DJSA 5GSRA 3VWJC 1MAHA 4POYA 4A23A 1N7ML 3BW9B 3BP6A 3WNLA 4CVXB 1KCVL 1ZE3C 4UQ3B 4X00A 3W11D 1WIUA 3CVHA 4UIKL 3X3GL 2FUKA 3K0WA 3LKSA 5CEYB 3WFCH 3ZDYF 4G7YH 3C8HA 2EO9A 4EI5C 2H6PB 3RVTD 2BZDA 2ZUWA 4P48A 4YXKH 1MFDL 3ZKMD 4HJ0D 2A9NL 4U1SB 1ZD5A 1W2KT 4LEOB 3LCRA 4MA7H 1MH5A 1UZ8B 2WLYA 4V1DA 5BS0B 2OSLB 1V8HA 1NGPL 4Y16B 4K2UH 3ILPA 1ROWA 3RNKB 4AEEA 1QSZA 3BH8A 4ODXA 1C1EL 2HT3C 1EZVY 1A3LH 4NKDA 1MI5D 4YHLH 5IQ7H 3FB7B 4Y2PA 2FX9L 1N5AA 3O6FB 4GFTB 4H25B 2WWKO 5E03A 5GJSL 5L2KE 4BUGA 4Q05A 2KZWA 1IGMH 1LE9B 3ULVF 2DHCA 1YMME 3BUYB 3QFJE 4PJBE 1NGWA 1T0NA 3I1IA 5B3JF 1TMCB 4X6EA 5JIHA 3BP7A 4O00A 1A1OB 3MO1B 4WFKA 2H8PB 4WUUB 1SMOA 4BFIA 2Y6SD 4ZUWB 4PGJA 3VRIB 3BL8A 3SCMB 5JATA 5HHQB 4JFYA 3FAXA 2W0LA 5TE6L 1I9RL 3IDXH 1MCLA 5C71A 2R2CA 3UTPE 1LDSA 3I1YA 3C45A 4F7MB 4GAGL 4HH9A 1BEYL 2OTWA 4HXEB 2Z92A 1Z3GL 3HRZB 1HOCA 4P23D 4LQ1A 1RJLB 3R0MA 4OGAD 2BNQB 5ALIA 3KXFA 1T5XB 1OAYH 3SX4A 2CLZB 3PL6C 2G60L 4X91A 2ADIA 1I9IL 4YPJA 5DGQA 3DDUA 2E6QA 4JDVA 3VMOA 3BGFB 2JJTC 4PJCA 2XUIA 5DEFB 4P93A 1VXOA 3ULUF 3H8NA 1ZHKA 5CT6A 1DWOA 4UTAL 3O3UN 2JBWA 5IOPB 4X5WA 5IIEB 2KQNA 5FYJE 2PTVA 5HPMA 3CFDB 5EA0L 3W0WA 5D1XB 4BCCA 2G4LA 5F7LB 1NBZA 3FHQA 4D9QD 3OKNB 4FMFA 3FYUA 4M6ML 5DUPL 5T4BA 4U0RB 1AQLA 1PZ5B 3GJFK 4FLFA 4LLYA 3HUJB 1D5IL 4PW0A 2OLDA 4ZO6A 1N7MH 5LJYH 1EK2A 5KSAB 3BPLB 1G6VK 2PN5A 4F9LC 5HYFA 4JRXA 4KDTA 2EZ0C 5E8EA 4UIKH 3X3GH 2P43B 1UZ6E 1OILA 3P0VL 3G6JF 2Z0BA 5B39G 4L3EA 5KSBE 3L3HB 2OI9C 1MFDH 2A9NH 1DX6A 2IMNA 3FB8B 1RUAL 1E6JL 1ETZB 3HNVL 5DFVC 5ALZA 1QLFB 2HA5A 2QKYA 3WYRA 2OMBA 3MJ6A 1NGPH 2X7LB 2YA1A 2H41A 1RZ8A 3FJTA 1LMKA 4CVWA 1C1EH 4DW2L 2W1NA 3B6SB 2D3VA 3ALWA 1ZHNA 2NYYC 2DJ4A 2AJYL 2FX9H 3DTXB 3NH7L 4P49A 3PF8A 5C0FA 4FMPA 3O3DB 2UY7A 2DIAA 2UYLA 4FZEL 5GJSH 1FSSA 1UVQA 4FFVC 5IFJA 2EE9A 1ZT7A 1KB5A 5K93A 1QEWA 3R1GL 3ESAA 3B9KA 3L3KB 5E2IA 4YO0A 4F7CB 4I0KA 1XQVA 3TPUB 2J1KA 5F1NA 4OB8A 1QGED 1NMBL 1KT2A 4U7KA 1XZCA 1BLNB 4HUXA 3P73B 2J8UA 5DYOA 4JPIA 5HYSB 4R4BB 2NW6A 5DJ6B 1QACA 2Y25A 3D87B 5TE6H 1I9RH 4QKXB 2E7HA 4GAGH 1LP9E 1BEYH 2BDNL 4XPBL 1CUYA 4L8BB 3KYMB 3NIDE 3TA3C 4XBEL 2XUJA 4BP9A 3RVXC 1Z3GH 3P0YL 3IDYC 5AKZA 2D03L 2PUQT 3QB7C 2HTLD 2IX9A 1FFBA 1INEL 2QADB 1QOKA 3VRJA 4Q9BA 1T7ZA 4MB4A 1WHTA 2G60H 5JDJA 1HH6B 1I9IH 2IBBA 1ZICA 1NBYB 2GYVA 2KBGA 2EXWC 5T5FL 1OY3B 4LMQE 4JZJA 4R8WH 4I5BA 1B6GA 2PKYX 2VAJA 1MSPA 3CDCA 5INDB 4HUWA 4UTAH 2IWGA 4GXVL 2DQUL 1WJ3A 3QNZB 3ARYA 4JQVA 5EA0H 4JNCA 4Z18A 4GRWB 3HXKA 4LDLB 5F44A 3OJMB 2C3VA 5IG7B 2R23B 4M6MH 4FQCL 5DUPH 4UT6L 5I1JL 2ZUQC 2A83A 4H7EA 1D5IH 4RAVB 4G9EA 2QKIB 3NACL 3C5ZB 5IVKA 5JPNA 4AMYA 3BKCL 4I0CC 5F9WB 5CH5A 5FYKU 3P0VH 1NAMA 2JIDA 2OAEA 5JOPE 3REVA 1RUAH 1E6JH 1I1AA 3B9EA 3G8YA 3HNVH 3SY0A 2KQMA 3FT2A 4JDZB 1FE8L 3FQXB 4DZ8A 2OZ4L 2B20A 1NL0L 2DWEB 5HI3C 2GFBB 4UT7L 3LQMA 5FDWA 1NCWL 2OLEA 4DW2H 5B3NA 1UCTA 2KDGA 4IMLA 1X44A 3MJ8A 2K7PA 1SC9A 2AJYH 3NH7H 3CCHB 4OCYL 3IUQA 3VMNA 4FZEH 1KCUL 3A2NA 4PJFF 3EJYD 3PFCA 3R1GH 5E2WL 2PO6A 3QPCA 1HI6B 1F11A 4PRPA 5D6OA 2VLKA 2X4SA 5DUBA 4O2EA 4LARL 3MXWL 4MD4B 3BZEA 1NMBH 1NEZB 5B38G 4U4BA 4MAUL 4XZUB 5DF0A 2WJ6A 2QSTA 2BC4B 3GB7B 1VEOA 4P2RB 3QITA 1LLFA 5MERB 1RIVL 1AY1L 5EUOF 3KJ4B 3ROOA 2EYRB 2SEBB 3H6JA 1VKXA 5EHXA 2BDNH 4XPBH 1KLUB 2C7UB 3BWUC 5DD6B 4E5XB 3HLAB 4XBEH 3VCLB 2V6HA 4Y4FC 3VVMA 3P0YH 3ULVD 2DLIA 2HN7B 4GAYB 1J0HA 1IZ8A 1QSEA 2D03H 4PJGF 2NTSP 4U1NB 4PJAE 3QRGL 3RUGF 5AI5A 1INEH 1DQYA 1GOGA 2ADJB 5IBLC 2XMCA 1NUFA 2KUTA 3O3AB 5IM7A 3WI7A 3MPCA 1SMAA 3H18A 3E6HA 5T5FH 1OTUC 3SPVA 4BH7A 4MEBA 3EGSA 1JUFB 2R2HA 1IKNA 3MLSL 4N5ED 2RIPA 1L7TL 3BAEL 4XNYL 4E41A 4YXHL 3RDTB 3X13A 4LLAA 4GXVH 1AGDB 2DQUH 1G7JB 4F7PA 3W9EA 1TENA 1PGRB 5DJCA 3G0CA 2DR0A 3C6ZA 3FQUB 4EN3C 1DQZA 4UDTA 1EVUA 5DK2B 4MDIA 1QBLL 4FQCH 4UT6H 2EE3A 5I1JH 4K7FA 1HSAA 4M6OL 5IESL 3AIOA 3MRMA 5IB5B 1K85A 3NACH 5GS1B 1HHIB 3L3GB 2XMQA 5DQJA 3VD3A 3BKCH 3MLRL 1J88A 3FVTA 5EC1B 4S10A 3VWKC 1NCBL 3QIUA 3HC0A 3SDXE 1R3HA 2Z3ZA 4P4KA 2P49B 3ULUD 3WKEA 1LO5B 3GMOB 4TNVF 4JFDE 1FE8H 1Z9OA 1BEZA 3G9XA 4U3XA 5JORB 2OZ4H 2GZRA 1ZLVK 1NL0H 2WLZA 4LHUA 2Q86B 3D39D 3WLWC 2OR8A 4UT7H 1NCWH 2VAVA 4PJIA 5D7LA 3WS3A 3FQRA 4BAUA 2A6DB 1NCCL 1PQZB 4Y88A 4FQHA 4LLWA 3NOIA 4OCYH 3S88L 2F58L 1B90A 3HMXL 5AYQA 5IHLB 4JY6B 4XBPA 5AO9A 1I3VA 2XQBL 1KCUH 5SX5K 4NC1E 4YX9A 2AJXL 2VB5A 3IETA 2X4QA 5E2WH 4MWTA 1KGCE 1I7RB 2O2HA 4LARH 3MXWH 1QSFA 4FOLA 3B5HA 2VIRB 1J8KA 1MUJB 4OUOA 4X98B 3Q5TA 4MAUH 2F54D 1RV6X 4G43A 2Y2VA <