3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterochelin esterase
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
2EDFA 4OZGF 1E8MA 3HE7D 5IVXE 1GJIA 4WI4A 4ZXBB 1L7QA 2FB4L 1JBJA 1I8LA 2R4RH 3MROB 4FFVD 2XQKA 5E2WL 3HMXA 2YKLH 4X8JB 5ALTA 4JFFE 2G9HA 3R3YA 1DP0A 4H8WC 4YHIA 4PRDA 4KI5C 4KKCD 2XG4A 4L4TE 2RFXB 4GKNA 4LRIC 4ODWB 4Y2YA 1NDGA 4MDIA 4N8EA 2D7TL 1TK3A 4JNCA 1BBJA 2WJ4A 4OKVA 3WO4C 4KVCH 3O6MH 5D96C 4X9GA 1V3MA 1UC6A 1XGTA 5C07D 2E5EA 5JIIA 3I6GA 1CEXA 1FCGA 2P4AB 3TFKC 3I2JA 4B0MM 3U36B 4G6FD 1R5WB 1FFPA 5FKPB 4JRXB 3QUYC 1AO7B 5D5ME 5D3ZA 1JN6B 4U1SB 3F8SA 1KTLB 4U6HB 2PXYB 2VLLB 4P4KB 5E8OB 4K7FB 4NP4H 4BFIA 1FORL 1I1AC 1TMCB 1RUQL 4GRMB 5DD3L 3TNMA 5IKCB 1TVDA 2QUAA 4Y2DD 4XCFH 3FB5B 3TLRA 2BHYA 1U8NB 2IH3B 3B6SA 3PWPB 5E8EA 2WLSA 1PZ5A 3ZI7A 4UUJA 1T83C 3H42L 1ZVSB 3C6LB 5C0GB 3GBNL 4U6YB 1R3JA 1E66A 4F8TA 2CKMA 3KJ4B 3IB4A 1BVLB 5FKAA 1FGNH 2VXUH 1YY8B 4OM1L 3B8SA 4M43L 2EYTB 1BM3L 1D7FA 4KQ3L 4ONOA 4U2FA 3AAZA 1GQRA 3WN5C 4HK0B 5T4BA 1WITA 3WYDA 3C60C 5HYJB 1UOQA 2BHZA 4PGCA 4BZ1L 5GZNC 4Y4FB 4EBQL 2RB8A 2AK1L 1GRWA 1MVUA 3O3BA 3KLHD 5TH2B 1F13A 3MJGX 4J3XA 4S0XA 2QHLA 1J0KA 4L8BA 3PHOA 5DMIL 2WTMA 1NDMB 1LMKA 4JG0L 4PB0L 5LLSA 5C0IA 3T2PA 1WISA 3GK8L 3RWDB 4HQQL 4LSSH 4UT7L 1MTZA 1UWGH 3MV7B 1KN4H 3VRIA 1MNQA 3LN9A 4PJEB 5DYOB 4K7PX 3OPMA 3HRZA 4P2RA 3CIQA 5KSAC 4PJ7A 5FIEA 4CMHB 1QD0A 1XR9A 5F9OL 3LD8C 1GGUA 3ESBA 3BZFA 1DBJL 2P5EE 3VCLA 5A7FA 2G75A 1GZ7A 3QA3A 1QLRA 3RKPA 5CEXB 1OAXH 4NM4H 3GBMH 3SJVB 2XMQA 4GI1A 5IKXA 4HUNB 4JFDE 4H26B 5A43C 2GSGB 1AGEA 3PP3K 2GYSA 4FG6C 4CJ0A 4B85A 1INQA 1CZ8L 1S9VB 3LB6D 2I07A 3MPCA 4FQCL 4Y1AE 4GJTB 1QFOA 4UBJA 5C8XA 4JRXD 5I71B 1PJ9A 1UZ6F 3U7WL 2R39A 3HYSA 3BEVA 3MRLB 2FBOJ 3CGTA 2VAXA 1KLGA 3O8XA 2O61A 1K5PA 1K4YA 3UMJA 2PXYD 5T5FH 4P4KD 2I25N 3KXFA 3UPRA 2VITB 2ENYA 2ZJ6A 1T1WB 5I8KH 2DKSA 4BYMA 3LHPH 1KFAL 4WENB 4N8CH 3TJMA 3TPUA 4K3EL 1ZTXL 2WILA 3TNNA 3LKQA 4MNQA 4NZRH 5EBLB 4NM8H 1NCAL 4H8WL 1AH1A 1IQDA 3C6LD 4N9OB 4X80H 4B0OA 2F54A 4LVNB 3LZFH 4NHUB 3LKNB 3E8UH 4R97B 5LCVH 2GK2A 1HHGB 1NGQL 3KYMA 3WXVH 3SCMA 4J0CA 3WMRA 4LASH 1NBZB 4G8DA 4ITVA 4JPKL 1BU8A 3L3KB 2GT9A 5A40E 4WY5A 5AOBA 1ZHNB 3HC0A 2Q86A 1HH6B 3QUKB 1RZIA 3VW3H 3G9UA 4WU7A 3LVEA 3RDTA 5DJ0B 3M17A 1ODTC 1MCOL 3VD5A 1MIEL 4Y4FD 2D0DA 4LSVH 2P5WE 1KPVB 3Q5OA 1CI5A 5TQ2L 1KCKA 2IAMD 1X5FA 2PTVA 3CCHA 4HX1B 1CQKA 1J1XL 1VFAB 3CAFA 1K2DA 4DLNA 1VFBA 3BPCA 3DMMB 5IFJA 5JHLH 2DIBA 3HC7A 1WCYA 1VOTA 3AFLA 3HG1B 4JPWH 2G5PA 4XZUA 3IRZA 4HS8L 4PRPB 2AEQL 4AMKH 2OBGA 2ZYHA 2HFFB 4PGBA 3MV7D 1JZ6A 1RUKL 1Y0LB 2D7MA 1QQDA 5DRZA 5M94B 4AK1A 3C5SA 5ADPL 3N06B 5L2KA 3BPOC 4HWBH 1CBVH 2BFVH 2D9QB 3K4DA 5F3HA 1WZ1H 2X7LA 1OP5K 1L7AA 5FUMA 4KAAA 4JDZA 4P23C 5FA4A 1KC5H 4RPCA 5EGNA 2ZKHH 1TITA 3TIDA 4Y7MA 1TCBA 3SJVD 5FA3B 5GS0C 5EUKA 1KSRA 5L2JB 5BS0B 2PCPB 5ALVA 3A6OA 3REVA 5DNWA 4U1KA 3ZKQD 5FUZH 1KPRB 3CDGB 4X6DA 1BGXH 1ZWIA 4WWID 4JGMA 5SWSE 1B0RA 3TO2A 3QEGL 4CN4A 3L3IB 5AK5A 5I0DA 1T5WB 3OAUL 1EXUA 2X4UA 1W0YT 3QIUD 4UTAL 1WFTA 2W0PA 2X89D 4O58L 4X6BB 1VPOH 3LAFA 5JW3H 1UG9A 2HMIC 2GUOA 3UTZA 1BOYA 4YPVA 3VFVA 3TT3H 1XKTA 2NY6B 3NFNA 4H88H 5TFSH 5DVOA 1X6NA 3A67H 2QEJA 6CGTA 4ZODA 2E6PA 2HLAA 3CSBA 1K6EA 4MCZA 5HDQL 3FQNB 1W0WA 3UYOD 4XAKD 3RVWD 3OJDB 4P2OB 5IH7A 4LCCB 5ID0A 3HI6L 3JUZA 4OD1L 3DOSA 5GGUB 2HN7A 3CU1A 4Z78A 2HADA 4X8XA 2H3NB 5E03A 4TULL 4UINL 5ESAA 1DL7H 5JR1L 5DD6B 1OAZH 3MCG1 3AUKA 5K9OB 3Q3GB 2GQHA 2FX8L 4XH2A 3FAKA 2H9GA 4FQXC 4HXAH 1VFOA 5AJHA 1MFEL 4LOUC 1J1IA 2WBKA 1XGQB 1QSZA 5C3TA 5EIAA 3ES6B 1E27B 4MD0B 2JCCF 1S5HB 1FJ2A 4NN5B 3TN0C 5L8JB 5A2KH 1YC8A 4M1GH 5JXEA 2H7CA 5F88A 1LO5A 5HXMA 4Y16C 3W39A 3HG1D 1XF3A 3LKOA 4C83A 2CPCA 3LLCA 4RMWA 4IOIB 4F80A 4PRPD 5ALDA 4AEHL 1C5BL 2CB9A 2AGJL 2R2HA 4Z0BL 2F53B 5DWUH 3IDNB 1L0YA 1RQ5A 2Z3WA 3D6GA 4Y8DC 4YHKL 1DBAL 2GJ6E 2ONCA 1VXRA 3L5IA 3GJFB 3H04A 2NY1D 2UVEA 4YNYB 3CVIL 2B0SH 4F2MB 4G7VL 3IDJB 4KK9D 2Y9RT 3S97C 5A71A 5BS0D 1IGJA 3ECBA 3MRBB 1MN6A 4KRXA 5DJ8A 4IDJL 4WFEE 3QJFA 5HSFA 2RHWA 5DA4A 5KBNC 5IEHA 1CFSA 4YHZH 1UXSB 1G6RH 5E94B 5AM0A 2GY7B 3QFJA 5ALGA 2XN9B 2ZUYA 4H7KA 1P84K 5E8PA 2BXYA 1SY6A 1DWQA 4LLWA 1T4KA 1EFXA 5LGJB 2NZ9D 5FCUL 1JNLH 3WO4B 4Q2ZB 4MGXA 5F9JA 2VXTL 3MV9B 4K3DH 5D96B 5L7XL 2Q7YB 3M8OL 3SK0A 5B22A 2F5AL 2VDRL 2NY6D 5AWNH 2PTUA 4OCSH 4CIAA 2EEBA 3PV6A 4WW1B 3MRNB 1EGJH 3OXRA 4FTVA 5DEFB 2WIDA 4E41E 3F7YA 4YHPA 1KTKE 1JGEB 3QUYB 2FSEB 3QMVA 5C0CE 3CFKB 1XFPA 2MWCA 1A8UA 1I1AB 1NSNL 4NQCA 3S4SA 4XCEB 1NLDH 4LLMB 1UQSA 1DVFD 3GRWH 1JI3A 1N64H 1PY4A 1HXMB 1FC2D 2XMGA 4KMLB 1FO0A 4WJ5B 5D72H 1ZIYA 5EA0L 5DUBB 3WJ2A 1U8IA 1ZJ4A 4G9FE 3GUUA 1TENA 2H1PL 2DQUH 1IAKA 4PBXA 4LDOB 4JUIA 3JWDH 3T2NH 3OB0K 2A6IB 4Y2UA 3UUEA 4XVUD 4E15A 3ISWA 3O11A 2IALA 3WN5B 3JBG7 4CI9A 3IFLL 3C60B 1A6UL 3QDJB 2C0QA 4PJBA 4X6DF 4LCIL 2OR9H 1YN6B 5JIPA 1D6VL 3WKCA 5F7YC 2IQ9L 2Y06H 1FNEA 3CFEA 1YJDL 3GSNL 1W1IA 1UACH 3D3NA 1TIUA 1GGYA 4OJFL 4QTIL 2YPLD 1CVSC 2VAAB 1G7JA 3PL6C 4XNMB 4PJDA 4XPGH 5I76B 2AVGA 3HLKA 5CRIA 1AURA 3GJEB 1QE3A 5F7HA 1A21A 1QZ1A 2VSCA 3BKYL 1QFSA 3ARYA 2HT3C 4XWGL 2BSED 1BFVH 5CAYB 1XH3B 3W9EB 1RULL 3GSVA 4F7CB 1XZHA 4X98A 2Z31A 2IFFH 2DQDH 3PDOB 3MV11 4QXGH 5C08B 3ZT7A 4P9ML 3CX5J 4Z7WE 4OZIA 5E99L 4DSAA 4KI5D 5DUMH 4YDKH 4ONGH 3RWEB 3RWGA 4Y2QA 1JNHA 3FQTA 2CDGB 2XN9D 3HNSH 4PY7A 4IRSA 4JN2A 4PJGE 4QOKA 2HL6A 4APQC 2AI0L 5HYQA 1MVFA 3VG0L 5I1AB 3TZVC 1WIUA 4G9EA 4EJ1C 2X5PA 3EYSL 4Q7DA 3MV9D 3SY0B 1LE9A 3RVUC 4U4BA 4OFIA 4P3CH 1TJGL 3TFKD 3HZKB 4ONFH 4QO1A 4Z7VB 3K9BA 4NSKB 3QP3A 3LSOB 1NGXA 3ARPA 3QUYD 2IPKB 5SV3A 2BC4B 4JRWA 3GMOB 5HZGA 4NZJA 1A7PL 1D6EB 4JLRB 4QRPE 4UQ3B 5J13C 2R4SL 2VLJA 4N0FB 4MA3B 1G6VK 1I1AD 3FB8A 5SX5K 2XI9A 2IPTL 3ZDZF 3MNWA 4BKLA 2VKWA 4WFFE 3UJTH 1NMBH 1XIWA 2JJUA 2WUGA 4RMQA 3O4JA 4KVNL 3ULSA 3IXAB 5AKIA 4UQ2B 1C5DA 4DVBB 2VXVH 5E8DH 3UP1A 5HPMB 2R29H 1YNKH 1EK1A 3RJQB 4ZUUB 5DJ6B 1RZFH 5KBYA 3M3DA 3X3GL 3NZ8B 3RNKB 3FB6B 4RGNE 4JZOB 2YPVH 4MXVE 5I66B 1FHGA 1KV3A 3KPRA 3QXDA 4F7EB 3C60D 1XGUA 3GKZA 3PWVB 2DHEA 3OAZH 3QDJD 1ORWA 3WNKA 2Q0XA 1ZGLM 3SDYH 5GZND 3OGCB 2BKLA 1J11A 4X6CF 4LAQL 5A7HA 4HZGA 4Q6IC 4G8GE 2GITB 4QNPF 1XF2A 1JI2A 1EO8L 1JMXA 3EBAA 3PWJB 2X4TA 2VE6B 3G5YA 3U1SH 4F21A 3MV8D 3FOLB 4HJGB 4B53A 3QUXC 1YZZA 4GW5A 5F1IA 1J12A 1MAML 2UWEA 4XNQB 5E95B 3VGAC 1AFVH 4W6YB 4NKDB 1UYWH 5C08D 3UBXG 5KSAD 2R0KH 3BPOB 3RL2A 5A16A 3RGVC 3PWNA 4L8DB 5IMLA 4I0PA 4I13B 7YASA 2GKIA 4P23B 4XVTL 3DJYA 2JJSC 2YWZA 1LPBB 1JFRA 3OG6B 3CK0H 3UDWA 4NT6A 5KVDL 4P2CG 1C7IA 1RK1A 1XQYA 2C5DC 4L9AA 3ZZ1A 4FG6D 1Z0NA 4HKBB 3ILPA 3HZYA 3FT3B 4OUUB 1KUMA 3MO1B 4TTGA 3AM8C 3QH3A 3X3FH 1FVCA 4YDJA 4OT1L 4FMPA 1CDYA 3BKCH 1A7QL 4Y4HA 5J6HA 1A6WH 5DHVB 1JHTA 2EDDA 1AJ7L 5FM4A 1QIEA 4K71C 4DNPA 3GNMH 5K9KA 4MAYA 4S1DC 5E7BA 2V7HA 4NQDB 4O2EB 4W4NA 1OXMA 1J8HE 4N90D 1IEHA 3QUMA 1XZAA 3B2VH 5C0EA 3T2OA 4M62L 1WBXB 1QNZL 1IGFL 1U3ZA 3DBXA 1OAKH 1EHAA 1QSFB 4ZAKA 2W38A 3TPKA 4ZFFB 1MF2H 1D07A 1EDEA 4WUKH 2R9HC 3B3IA 4ZNCD 4NNPL 1Z2KA 2ZUQC 3SDCA 3HNTH 3KGRA 3GSNB 2P49B 3HUJE 1KPUB 2ESVA 3P9LA 1J1OL 3H9HA 3LP5A 3P73B 1MFCH 1OWWA 3HAEG 3OSKA 5BZDA 2LABA 2A77H 4XIIA 5J6GA 5GGTA 1MFAH 1JJBA 1DQJB 4XMPH 1ZLWK 2X9XA 5IESH 4OGYL 1BS9A 4XPBH 5DJZA 4JDTL 3QDMB 1X44A 3DEAA 1NLBH 1MCIA 1OAYH 2OQJA 3VXUB 5EHZA 4PG9A 2A6JB 2XWTA 3VFOA 4FQXB 2B4KA 3SKMA 4BQ8A 1YASA 5J06A 3TBTB 3U46A 2KDGA 5D2NC 5HYFA 3TN0B 1CLYH 4RISH 1CXLA 3P4OB 4YO0A 4FOLA 4Y16B 3JV0A 3AZOA 1KCSH 3TV3L 3QQ4B 4LEOA 1T5XB 3RUGB 4OPMA 4Q34A 1X2BA 1TETL 2Q8AL 4Z95L 3QULB 1ZMYA 3BP6A 3P9MA 4HMDA 2X6MA 4DJMA 2DJUA 3NZHH 4QDXA 5FHBH 1DE4A 4MXWL 3GKWH 3CXDH 4P23D 4BZYA 1UB5A 4MAUH 2WWKO 4FFZH 3G6AA 5BQ7A 4MWFA 3O4LB 2XT0A 4U1LA 4GUPB 5GS0D 1DANU 5IQ9B 4J03A 1ZANL 3DIFB 1MJ5A 1LK2A 5JPNB 1TCAA 2VL5A 4WDIA 5JASA 4XBEL 3WKNA 2W0LA 3MBEA 3UPAA 4GECA 5GJSH 2WIGA 2FD6H 3ET9F 3I50H 3RWHB 4HVTA 3QPQC 3G08B 4OV6F 5CD3A 3G5ZB 2A83A 2Y6VA 4YZFF 1I8MB 2DQTL 2E3VA 1Z3GH 1RUAH 1A6TB 4NQDD 2YEZA 4X7TB 2HMID 3C2SA 4ZUWA 4QDTA 3ARGC 1HEZB 5E9DE 1L7IH 4ZDHB 1QSFD 1ACLA 1S5IL 1T80A 4U6XA 3MZTA 5CILH 4A6YH 3LKSA 4X6FA 3BXNB 2C3HA 2W0FA 1A64A 3D9AL 2OJEB 4PD4K 2JB5L 1NL0H 3VGDA 3MYJA 3FN9A 2LIPA 3OKOA 4OTXH 1SFRA 1ZGCA 5CCKH 4JEIA 1UCBH 5KVGH 2CJPA 3ULUD 4GSDL 5CUSH 4G8BA 5DTFB 3KS0H 3VXUD 1LO0L 3V8CA 4C4ZA 1GGVA 4NZTL 1GZQA 2YD1A 2HKHH 1EBPA 4FQXD 4DNFA 1I8KA 1MWAH 2ADIB 2AJXH 4LOUD 1UKQA 3H7LA 5INCA 4LCWE 3TN0D 1RURL 5GJTH 1NGWB 2HJKB 2QLVB 3AFIA 2HH0H 1JTPA 1CGTA 4Y16D 2XFXA 2I26N 3R0NA 3WK7A 2WUCH 1VGEH 3QYCA 4EUPB 4K23L 3QPXH 4PYGA 3ARZA 1F6LL 1H3XA 1EHLH 5EZLB 4KQ4H 1A1NB 4XP5L 5MERB 4Y19B 1CXEA 5DQJA 1BFOB 3OMZA 5BWCA 2Z8SA 5CURA 2Y2VA 3PL6B 3TVMA 1YPZB 2P8LA 3MJ6A 2M2DA 2E7LC 5ECJE 4OZGE 1AQLA 3OKMB 2V9RA 3D0VB 5YASA 1T22A 1EPFA 5J8OA 1R88A 3SGJA 4CCYB 2FX9H 2J88H 1QBLL 4M7JL 3QI9A 1VE6A 5IW6B 2YD6A 3GMLB 2OL3L 4AIZA 1KJ2L 2HJLB 4FQ1H 1MCWW 4W4OA 1WFNA 5B38B 3MR9B 2Z4QA 4PV9A 5CIPA 4LEXH 2OTUB 1PSKH 3QPDA 3BP7A 4NDMA 2BCEA 1YAJA 1EJOL 4APQB 2WWMC 2XMZA 4U1HA 4DGIH 4X4XB 5EWIH 3ARVA 4HBCL 3TZVB 3WFHB 2NLJB 3WFDL 4L5FH 4FQQA 3MLVL 2VDQH 4HLZG 4I1NB 1UT9A 5L6YH 3QXUA 4H20H 1A7OH 4FNMA 1QSEB 1U3HA 3ARRA 4NNYB 1SJXA 1VFUA 4BTVA 1YMHA 2EH7H 1PW3A 5CMAB 1ZHBB 5KG9A 1AI1H 1I7UB 3PGDB 2MJWA 3T52A 2BSRB 4NO3B 2BVTA 5DMYA 5IB3B 4U2BA 1BPVA 5GRJL 1U8OB 5FO9A 1KN2H 5I30L 1ZD4A 2PYFB 4JFPA 4Z7UF 1MCHA 5JD5A 5J13B 3BWAB 3GMNA 5C09B 4F58L 5BV7C 2C58A 3QO0A 1T89C 4KMTL 1E4KA 1O7VA 4JPVH 5GSRB 2F58H 4QRSB 4Z0XA 1F45A 4D9JA 4QCIA 5BW7C 5D70L 2FR4B 2D7OA 1CWVA 3QEQB 2UZ0A 3QXAB 4HWZB 5J89A 1QLEL 3H1BA 5HGBA 1CUFA 3VFTB 5IB2B 4UIMA 3A6BH 1FNAA 1JPTL 5AG8A 3F5WA 2PYEB 1P4LB 1W52X 2YK1L 2Y36H 4FZ8L 1H0DB 1MFDL 1B0WA 4I3RL 4WWKA 4K3JH 4NBXB 1J8KA 5DFVC 1OW0C 2ATPA 4AO6A 1FFCA 4G43B 4EB0A 2QSCL 3WJJC 4PRIA 3IDAA 4Y19D 4GXVH 5HVWA 4GBGA 2YXMA 4Q6IB 5EUOB 3C5JB 1I3GH 4Y7DA 4P5TC 3P77A 1HH9A 5IBTH 3PL6D 1KCUH 3KVQA 3DD5A 2B61A 3H0TA 2VZSA 4RFEA 4KTEH 4WV1A 1EEZA 3K4AA 1ND0B 2XKSA 1XMWA 3D85A 1KJ3L 2ED7A 4RBPK 4LBEB 1MCWM 5IIEB 2HT3D 3QUXB 4CADA 3KNBB 4X7EC 3T0BA 1A6ZB 5IHZA 3QDGB 1ZJ5A 3SKOB 1XGYH 3INUH 4N8VG 4KY1L 4HV8B 4I48B 3VGAB 1DBBH 1HI6B 3DTXA 5C0FA 3RGVB 2KQMA 4HLJA 3O4OC 3D2AA 1DINA 3D3VA 4N1CA 4M3JA 4PJXA 3F7RA 5E2UH 4APQD 3MCLH 3LEVH 4OI8A 43C9B 4LNRA 4MDJA 3MJ9L 1FNHA 2ZUTA 3TZVD 5AI9A 3WFBH 4TVKA 3T04D 1F4WH 5A2IH 1I4FA 1R5IA 3OTTA 4LF3A 3UZVB 3BAEL 3E6FB 3QWOA 4KJPC 5EU5B 3RVUD 3V0VA 3BEWB 4NOBA 1RIHH 4ZS7L 3TIEB 1TLKA 2F19L 4JO2H 2OCLA 4I8DA 3L5WB 4JM4H 2X4NB 5I6XC 1JGVL 4JFQA 2C1OA 4CAGA 3F12B 3QBJA 4LK4A 4K71B 1XCTA 3MRPB 1UZ6E 1TNNA 4KPHH 3C5VA 2XUGA 1WHTA 3QNZA 1U2HA 3RIFF 2JLLA 5C0JA 2APXA 5C09D 4NFCA 3MLTA 3V4UL 3L3DA 2CIKB 1BRTA 3K2UH 3UTTE 5KN5B 3WIFA 2DQEL 3QSKB 1LNSA 1XF5B 1CQZA 1WFOA 1Q0YH 3E3QC 4ODHL 2FJPA 3WA7A 2GFBB 3QEQD 1AGYA 4KRNA 4DGYL 2ZUQB 4UOJA 4GKZA 5JNYB 5IB4A 2CUIA 4C56E 5J9PB 2W0KA 1MIMH 4OGZA 1CU4L 1CK0L 3JTSB 5CT9A 3M1BB 4KK5C 1F4HA 2ZJSL 5DRNA 1QRNA 5JPMA 1JYWA 1SY6H 3GROA 3H7BA 3MRHA 4E9LA 5C7XL 4ZV7A 4KUCD 3DO3A 3REWB 3I1IA 2BVPB 2ZUSA 2A38A 3LKRB 1FZKA 4OF3A 4AO7A 2BOCA 2YRPA 5J3JA 4NO0A 1CVRA 2VIRB 1RIVL 4HH9B 2AJCA 1A6AA 1KJ2B 2RHTA 1NGZB 1BAFL 3CUPB 4S1QL 4Y5XA 3GM0A 4JFXB 2QKYA 2ZUXA 4I2XA 3IFOA 5D2NB 3U83A 3ARSA 3IJSB 1NKOA 3FT4A 2X09A 4F33B 3BKJL 1X5KA 3MGAA 4NQXB 3NCJH 4Q3KA 2B8OT 3QUXD 3UUFA 5BV7L 1ZT4A 2UZIL 4WY7H 4L3CB 3BZEB 4BQ9A 3STZB 2BAGA 3QDGD 4NJ9L 1AGFB 2WG1A 4R9HA 5DDHB 1TPXC 4M1DL 5F4ZA 3TCLA 4DKEH 1CLOH 2GI7A 2OXEA 3RGVD 2J4WH 3NFPB 3QITA 3T65A 2YMXH 3SDDA 4CGTA 4UTBH 5GIRA 3KPSA 2YA2A 4HC1L 5HHXL 3VXTA 2XRAH 4S1SH 1IC4H 3WDHA 1F4YH 2BY1A 4I0KA 4LHUA 3D69A 3S98A 2YASA 3JWOC 1TZGH 5GS2D 2X1WL 4BZWA 1N5RA 1PYWB 1RMFH 1NCDH 1XZEA 2ICWJ 3VI3F 2HLFC 2I5YL 3HLAB 4XRCA 4DZBB 1I7ZA 3O41B 3ARBC 4JVPA 3DL7A 1NAML 2ICWB 1MX1A 4JRYA 1TQBC 4YDVB 2BNQA 2CRIA 1VKHA 5ITBH 4TSAH 2AJVH 2XTLA 4LGPB 2O5ZL 4GQ9L 4S1DD 1JMYA 5IW1A 2PM8A 3MLSH 2PUJA 4KDWA 2J6EL 4XP1H 1Y7IA 4O4YL 2Z9TA 5H2BB 5LKAA 3FO2B 1GOHA 5SWZE 2BNRA 5FV2A 1MJ8L 2R9HD 4AT6A 5I73C 3CFCH 5BRZB 1TXKA 3TCXA 4Z7NF 1QLFB 2J8UE 3P2MA 2QQQA 5E1AB 5JHDA 1UEYA 2CKBH 1UB6B 1I3RA 2WIIA 2IANB 4XTRC 4JM2C 4GG6B 4DTGH 4XXCC 5TE6L 4HWNA 4P3DA 5JUEL 2UY6A 2RCSL 3T77A 3HXKA 1ZEAL 4HIHB 4QLAA 1TJIH 2FO4A 4JFHD 5FHAL 2HIHA 1P6FA 4LVEA 2Z5GA 5HHNA 1SCQA 5I15H 2DQCL 4ZS6C 4GW1B 1LP9B 2VKXA 4C58B 3F7VB 1I7TA 3MSPA 1HDMA 2I9TA 3DKKA 4HPYL 1J10A 2JCCE 4UBMA 4P5KB 1IT9L 3CFBA 1P4IL 4IEFB 5T1LB 5C0AB 3TBYA 4E46A 4MVBC 4QRUA 3QXTA 5IVXB 4EEEA 5IW3A 1EERB 3CXHJ 1MREH 4PJIA 5HGDA 1SC9A 3VXNA 3V4PH 1UFUA 1U58A 3Q48A 4JFFB 5E5UB 2VSQA 1HWHB 4JZNB 5K33A 1OF2B 4ODVL 1Q1JH 1SHMA 3R1GL 3L1IA 4EHBA 1DLHB 3JWNC 3BQUC 2XQIA 3Q0HA 3WE6B 2VT6A 4MD4B 5ALQA 4HUUA 3ZTNH 1TZHB 1WHSA 4JFZH 4TRPL 1MEXL 5DJYA 3AREA 4G4GA 1AP2A 4L9LC 4JFEE 1RIUH 4PJ5A 2VWEC 3HZMB 1IMHC 1X5YA 5HFNA 3GFUA 3ROOB 3C70A 2HWZL 3L95B 5EIHA 5IJKC 5EPMB 3TJEL 5JW4M 1XGPA 3PJSA 3QPQD 4XVJH 5CJOL 5EO0B 3KYNA 5F7KC 2X4OB 1K6QL 3RU8H 2ATKB 3T1FA 1ONQB 1M4KA 4AQ1B 4MYDA 5F9AC 3BRDA 1QA9B 3CCBA 3UBXA 4H1LB 2Y7QA 2EEPA 5FDFA 3U7YH 2HRPH 3ARGD 2IQAA 3OQ3B 5EO9B 3E4DA 2G5BA 2QQKH 3WV0A 1TJHL 3HZVB 5LQBH 1DTUA 2XZCL 3ZKMC 2VZ1A 4ZNEA 3U6RA 4WHTB 3QZWB 2R0ZL 3W2TA 4OFVA 2XUQA 5BRZD 3FRUB 1WBZA 4JHZA 2OJZL 2OK0H 1QFPA 5ALUA 3ARDA 3VXQA 3V6OC 1ZI9A 4UPDA 2IAND 1FIGH 3C6XA 3S88H 3GSUA 3OOSA 3RAJL 3RVVC 2O5YL 3KPQA 3DX8B 3NBNA 1IRAY 4AENB 4KXZH 6FABL 4JQIH 5BV7B 3ZTJH 1RFDH 3JWOL 5T3XD 4BQCA 4U1JA 2OLEA 5D7IA 1PY9A 4UFPA 5IOPA 3V6BR 5HGAA 4ZFGL 1HKFA 3I75B 5IG7A 4ODSL 3V6ZB 5I8OH 5JATA 3EFFA 2IH1A 5GS3A 3ROLA 5DYWA 3EGSB 1K4DA 1XZCA 4PJFA 5C0AD 4W9RA 1KB5B 1Q84A 3M45A 4LYDA 3EYUL 1LQSR 1P53A 1DN0B 3FO1B 5E6ZA 4LP4A 2YZ8A 2SEBA 4ZOBA 2VZUA 1LD9A 2C0PA 4QRRA 1FL3A 3EOTH 4JFFD 1UCTA 3IDUA 3QHFL 1J05A 4UV7L 1WWBX 3HAEA 4FQHA 3PDGA 2FO1A 5JORB 1HHJA 2BJML 1F3DH 1NAMB 1U8QB 2P5EB 1O0VA 3EF3A 1WBYA 3WNMA 5ISMA 4P5TB 2KBGA 1KEZA 4OKDA 3BH8B 4JFDB 2B2XH 1R3DA 1EVUA 1NCWH 1AQDA 1T0NA 2Z8VC 4WFHD 4MNHB 1EXWA 1IARB 3ABZA 3G5XA 4X7FC 4PTUB 2AKRA 5IFAL 3PF2A 4YR6A 4RZCA 4UILL 1CICC 5BXFA 1X9QA 1ZS8A 4MNGA 1BIIB 1P0IA 5INDA 5DC4B 3V1NA 4L3AA 4XNXH 3O4OB 2CD0A 5L8KB 4NJAL 1E4WH 5FGSA 1INDH 2FRGP 3MJ8B 4D0CA 3RTQC 3QWRD 1BD2B 4LCUB 1FFOA 4BA8A 5AOCA 2EDXA 4P5MB 2GTZB 1MNUL 3P9WB 4RWYL 3FQWB 4H7FA 4PJCF 4LNVA 4LHEA 4B83A 1I9RH 3LN5A 4NS4A 3UX9B 2VO5A 1FDLH 2XA8L 2VDNH 4YDIH 5JO5B 4M5ZL 5I6XB 1DN2A 4WTZG 2RIPA 2VZVA 4MB5A 3TT1H 1LEKB 4HWUA 1NJ9A 4Q82A 1IM9B 3CSYB 1A8QA 4KJYB 4F5ZA 3MRDB 4W70A 4FXKA 1MQKH 3PHSA 2YKLL 1VLQA 2EIEA 4OM0H 5MEPB 3NIFF 2VABA 4XT1C 3ZDZE 1ORSB 3KPPA 1CUCA 4Z7VF 3S35H 3DX9A 3HCVA 5CT4A 3P4MA 1H3PH 4GAYB 2P5WB 3WA6A 1V05A 5DEGB 2ENSA 2IGFH 3NIGF 1IM3A 4PB9H 1MHCB 3MA7A 3DYVA 4KVCL 3HPLB 3O6ML 4YFLF 5LGKA 4UFNA 3DYPA 1SQ2N 2VYRE 4C4XA 3C5ZC 5IK3A 3R3WA 2AXEA 4QT5A 4Y2TA 1I85A 1PD6A 3ORJA 3KSRA 4MLSA 2ADJB 2YXFA 4BSWA 5DFVD 4I4WA 1NAKH 4ACPA 4WTWA 1QR4A 3IF1B 4RMRA 4X6CE 2ZYIA 2WINA 3STVA 2ITCB 2P5ED 4QNPE 4NP4L 3NUZA 4PRAB 1QRKA 1ZHKA 4P5TD 4Q0XH 5D6CB 5GXBB 1NFIB 3V0AC 1XZFA 2MNUA 1F11B 2XKNA 1WTGT 3ARFA 2FJHB 3QG7H 4NQTA 3WFEH 3VDXA 3CX2A 1FGNL 1TPXB 2VXUL 4AM0B 4HUXB 3UXFA 5DHYA 1YB6A 1MO2A 4JVUA 7FABH 3RWFB 3VFRA 4K3HA 4NRXB 1F3JB 3GIZH 4NRYA 1RAMA 1K5NB 1F02I 4OCXH 1WIPA 3BP4A 2VQUA 3NACH 3TGLA 2N1KA 1BD2D 5LP1A 5D7IF 2XIDA 1ZIXA 2ICWI 4KJPD 1CG9B 2ICEA 2PUQT 2A6KA 3KPOB 4C87A 5I8CB 1IVYA 1JGLH 4PY8J 3ARBB 2BK8A 1H22A 3RWJA 1FL6A 3OAYH 1C7TA 1TQBB 3PUHA 3BIKB 1U8LB 2BX5A 3IB3A 2DS4A 4LSSL 1VESA 4PRBA 5AK3A 5EI5A 3LIIA 1UWGL 1IM9D 1KN4L 1M7IA 1G42A 4MCYA 3WL9B 3KD2A 3C6SA 4D8PB 1OY3B 1NCBH 1M6OB 1UM5H 2QADB 3OWEA 1OGAB 3KWWA 3OR6B 4HUVB 4HS3A 1F0NA 3VXPA 5CLTA 4O2CA 5ICXA 1C12B 5IB5A 4JH0A 1OCEA 3GB7B 1I3UA 3QQ3B 3VE0B 5L9DH 1S7QB 1RJYA 5I73B 4OD2B 2YSSA 3TBWA 3IAGC 1OAXL 4NM4L 3GBML 5CIPH 5D7LA 1O5DT 1CUIA 1SJEB 1FGVH 3DGGB 3T3ME 1OB1B 4NWUH 4Y4KC 1Q94A 1MRFH 4KK5D 2WUBH 4WFJA 5FLKA 3RFZC 3DQZA 1Q9KB 1PGRB 1VENA 4OLEA 3QNXA 2CXKA 1KXQE 5JALA 5E2JA 1K8DA 1QIKA 3V5KB 3O2WH 5I7UA 2VSDA 3A2MA 2F74A 4UHBA 4HKJB 3SWWA 1WF5A 1KBGH 4PJ9C 1LBSA 5DGQA 1ZT7B 2XDWA 5T5FL 3S8YA 4LU5H 2MKLC 4GS7C 5K3CA 5AM3A 1FYTA 3FT2A 5D2LF 5LGHH 4XCYB 5I8KL 1N1MA 4LXHA 3ULUF 5IF0A 3LHPL 1IC5L 3D39E 4X0KB 4ENEC 3HE6A 3QEUB 1LE5B 4Y9SA 4N8CL 1BOGA 1DBKH 4NZRL 4NM8L 5E5MB 1G7MB 1IL1A 4X80L 4QWWC 2H32A 3R8QA 4BZ2H 3LZFL 3TEUA 4DUVA 1JZ8A 5C0RH 3E8UL 2ERJB 5H37H 1MPAL 4QNNA 5CZKA 3C6ZA 3BUTA 3HRPA 3G6JA 1QHPA 5LCVL 4KKAC 3WXVL 2VAVA 3KJ6H 4LASL 3LRSB 1KT2B 2Q87A 4ETWA 5HQ3B 3C8KB 4BBZA 3BQUB 4I9WE 2J8OA 2YHGA 5JARA 3O2DH 1P2CB 3VW3L 3HC4H 4WUUA 2MCPH 5FOBA 3X13A 4LSVL 1EV2E 4HUWA 4L9LB 1Y6KR 2EXYC 4GBXA 5ALZA 2J5LC 2HLFD 1IEBA 2OM5A 4E41B 5J7CC 1DEDA 5I16B 3ARBD 5JHLL 4ZV9A 1CUBA 3ZE0F 1A7RH 4HF5H 4JPWL 4NZDA 1R24A 3HR5A 4YZFE 5C0CB 4MD5B 4AMKL 1CGYA 1UJ3C 4PJAE 3EO9H 1K8IA 2A0LC 2A73B 3O81A 4N8VA 3WKML 4MQTB 2QR0B 1UK6A 4CJ1A 1EAJA 1BCRA 3WKDA 2IIVA 1OGAD 2NW2B 4JDVA 3MRKA 3K74B 4HWBL 1CBVL 2CO7B 2BFVL 1ODCA 3I6MA 4KEAA 4X4ME 4DMCA 1WZ1L 1U9KA 4LLQB 4HZLA 1KC5L 4G9FB 5ISZA 1TTFA 2ZKHL 3SDXF 5JW4Q 2OX5A 2KZ1B 5HBBA 3O95A 1ZSDA 2VDML 1QACA 1NCCH 3IGAB 5C07E 3TBSB 4OV5B 1FNGA 4XTRD 4JM2D 2FWOA 2VR5A 4J3SA 1RJLB 1AD9A 1U92B 5FUZL 3V5DB 1ADQH 1BGXL 4W1RA 3EO1A 2JEYA 3VXOA 4ZS6D 2BHUA 2VR9A 1B41A 2QHRH 5IHLB 2KUTA 1H5BA 2C3WA 4EDXA 4R26H 1IQWH 1X3DA 3B4NA 1VPOL 5JW3L 3MOBH 3E6HB 3MVEA 3QMMA 1JWSA 3VH8B 4HIEB 4MVBD 3TT3L 2H8PB 4H88L 2HA3A 5TFSL 5HD8C 3ZLUA 3X12B 1IZ7A 3A67L 4KR0A 3OKLB 1V5JA 3UAJC 4P4RA 1CZ8H 5FV1L 4YPGA 1UM6H 1MJJB 3S6CA 3QXWA 4Z7WB 2HFGH 1MI5E 4XPFH 3S5LB 5HPOA 1AE6H 1NANI 5J0BA 1RP1A 3I2HA 3GJFH 4NO2A 4HIXH 3QO1B 3M07A 5CKGA 3VXSA 2V2WA 4NUJA 3MRFB 1ZT1B 1DL7L 3IFPA 1OAZL 2BNUB 4RAUB 1R3IH 3EAKA 4HGWA 3SKNA 5E7FA 4Q9RH 5CP3A 5ALLA 1A4JA 4HXAL 1MAAA 1CICB 3E1F1 2V97A 1CUEA 1T7XA 2Z93B 3AC0A 3BI9X 4HJJH 4WI3A 2O2GA 4M61B 4LVHC 4E41D 4M1GL 1KNOA 3KLSA 5GGRB 2DL9A 1CFTB 3A2LA 3BWUC 1QFUH 2GIYA 2BSTB 4J3WA 1T0MA 4QRPB 4IMLB 3OM8A 1AXIB 1KJVA 5IVZB 3L3JA 3RTQB 1CF8H 3HTLX 5DWUL 5EIEA 5EOTB 5BVJA 5LYYA 2AXGB 4LPUA 4AH2B 4H25B 5IWLA 3IFNH 2QR5A 4X5XA 3L3GA 3N85H 5F6IC 1DEEA 4QRQB 3ZKMD 3NGBC 4J6RH 1I75A 1TRHA 1J1XH 3GMRA 4U1MA 3TO4A 3VXRA 5ICZB 4U6VH 1YR2A 1A0QH 2B0SL 2X1XR 4WW2A 3LH2H 5IB1A 3HKFA 3GMMA 2MHAA 1E4XH 4Z7UE 2H7YA 3RVVD 2QKIA 3DV6A 4KV5E 5SV4A 3WFCH 4YHZL 2JGEA 3DECA 3W05A 4LPCA 1G6RL 2CIIB 4JRXE 5EH1A 3B5GA 3FMGL 1BECA 5A3ID 4QHUB 5C8VA 1JTOA 4G8GB 3BRGC 1FBIH 3U82B 2X70A 4TUJA 1PVHA 5A62A 3Q6FA 1U8PA 2C26A 1JNLL 4DW2H 3MRMA 2H6PB 3FB7A 1H15A 3W82A 3C5ZB 4Y2VA 1A47A 3O45A 5AWNL 4OCSL 4J4PC 3WIHA 1A1MB 4HJ0C 3KLAB 5FECA 2WBJA 1EGJL 2K7QA 1S7WB 5C0DB 2M1KA 4X94A 5DJDB 4FHBD 4U1IB 2Q6WA 4I18A 2XZZA 3FO9B 2MSPA 5D3KA 4ZYKB 2YD9A 1BLNA 5DS8B 5HHQB 4HMCA 4IS6B 2KZWA 3OF6D 4IHOB 1UH3A 1IAIM 4PV7A 5C86A 3IJHB 4BE4A 3EKCA 5MEOB 3GRWL 1N64L 2JF1A 1Q83A 3IDXH 1VSCA 4Z7OE 2UYLB 5CD5C 4K6KA 5DVKA 4EOWH 4ZXBA 4IRJC 3H9SA 5D72L 4UI2A 3LDBC 1CICD 3DX6B 2X4QB 3MROA 4B5EA 1M33A 5HJ3A 3ZL4H 4X8JA 1FRGH 4UHDA 4R96A 3JWDL 3T2NL 3QCUH 1CS6A 4ODWA 5DYTA 4OZFG 2W9LA 4H0CA 12E8H 3RTQD 4KGJA 2W60B 2XMDA 3B9KC 2OR9L 5HDOA 1K85A 3SX4A 5K93A 4XNUH 2Y06L 4HIJA 5C9JA 5TDNB 1UACL 5TDOB 5CJQH 1XF4A 4QHNB 3ZSTA 3QEHB 4XPGL 1WPRA 2R2CA 3SJVE 3U36A 5BVPH 3GBLA 3KHOA 5FKPA 1IFHH 1EUTA 1ZGLB 1BFVL 1AO7A 1JN6A 4U1SA 4D9QE 4X3CA 3I3BA 4FHZA 3S96A 1B4JH 5B8CC 4N5IX 1I8LC 4U6HA 4UBDC 1REIA 2IBGA 3IUMA 2VLLA 5E8OA 2IFFL 2DQDL 4J3VA 4QXGL 4DWHA 2CO6B 3MCKB 4Z0BH 2WFZA 3O3EB 3LMJH 2OGZA 4ZI5A 5DUML 3QM1A 4YDKL 4EDWH 4ONGL 2FEEL 4XXDB 4ZPVA 1U8NA 3D2UA 3HNSL 3PWPA 5D7KD 1EAPA 4WO4C 3ZHKA 5EIVA 1KYOJ 4G8GD 5CGMA 1THTA 4TPKA 1ZVSA 3C6LA 5C0GA 4NUGL 3MFFB 2HVKA 5D8JH 3I6YA 1HIMH 3MACH 3UTSD 1YY8A 2FLRT 2JB6B 1AIFA 3C5ZD 4L4VB 3MOAH 2OR7A 1ISPA 2XLBA 4P3CL 3LPWA 1CFQA 2VLRA 4OCYH 3L5HA 4ONFL 5T3ZD 1M05B 4HK0A 4OSEA 4DVRH 4BC0A 4WY8A 5IVHA 4XAKE 1ZE3C 2NY7H 1MRDH 5HYJA 1HBJA 4JQXA 5F7MC 5CW2A 4PJ9B 4YBHA 4Y4FA 4HK3J 3U9PL 5TH2A 4JFYB 3DSFH 3R06A 4GS7B 3PUCA 3BD3A 1NDMA 4HIIB 3UJTL 4OZHA 1NMBL 2K3TA 3NN8B 4L29B 1T03H 5BJTA 5CHNB 3DGCR 5EU6B 2MKWA 2F8OA 3MV7A 3G8YA 2VXVL 5E8DL 4PJEA 1PQZB 4O2FB 1TNMA 1YNKL 1OCWH 2EO9A 1U91B 4NZUH 4HG4J 3VRJB 1RZFL 3BPLC 1XGRB 3HG1E 4JO3H 4QY8B 2YPVL 4LIQH 3OC0A 4I77H 3RKSA 5EHQA 5CXXA 2VLME 5IM7A 2H2SC 5GS0H 3ZE1F 1WEJH 5E8NA 2R1XB 5HY9B 1UM4H 1ZA6A 5JADA 2W07A 1T7ZA 5CEXA 3SDYL 1RJZB 2E6QA 3VXMB 1JK8A 2CRZA 2NY4C 4YASA 2GSGA 1G6RB 4LSQH 1W0VB 3JV4B 4UB0H 2V96A 2V5SA 5LAXB 2J5LB 1ODAA 4NWTH 2HT2C 2NNAB 1A4KB 1QBMH 1AMNA 4MJ6B 4FBLA 2EKJA 3U1SL 3CPLA 4IOFC 5BS0E 4GO6B 2C5FA 2P45B 4JY5H 4H7EA 1UJ3B 3MRLA 4G8CA 2X89A 3WNPA 3CVHA 4P08A 3IFLH 1JF5A 2P42B 3OPZH 1UYWL 5IQ7H 2R0KL 5AK6A 5F7FA 2CR6A 4DZ8B 1B0GB 5EB9A 4LLVB 5EBLA 43CAB 4LLYB 4QRTB 1IZ8A 3CK0L 4Z7NE 4J8RB 4WHDA 4O9HH 4J1UA 3BKYH 4Y4KD 2V5MA 4L4VD 1HHGA 4TUOB 5EU7E 3ULUH 5I1LB 1N5YH 3ZDXF 1NBZA 3B9AA 1ORQB 4QXTB 2WFLB 2EZ0C 3X3FL 4HXFB 1MLBA 1S9WB 4WTZA 4I3FA 3BKCL 4MZ3A 5EU4B 1A6WL 4PBVC 2XWBA 4OLXH 1L7RA 1BZ7A 4NQEB 3DO7B 1JWMB 3LIPA 5DJ0A 3GNML 4PJ9D 4RFOL 1EVQA 1NUDA 3O8XC 2NX5A 3W0WA 2ZWLT 4HX1A 1NFDB 3B2VL 5D1XA 4EI6B 5HGHA 4RNCA 4HKXB 3T0EA 3DMMA 4ENED 1OAKL 3WYRA 3O6FA 1E6OH 3OAZK 3MNZA 1MF2L 4WUKL 2P7TA 3CZFB 1TJGH 2AERT 4PRPA 4H5SB 4QWWD 5EU6D 2HFFA 3HNTL 5EZIH 4CU8A 1R9MA 3P4LA 5ACZB 1S7UA 1QOKA 1LEGA 1MFCL 1GYAA 4NGHH 4PRNB 4KKAD 1G7PA 1MFAL 4XMPL 3SCMC 4ERSH 2XUOA 2XUPA 5JW5B 5IESL 3FFCB 4FXLA 1T1YB 2I3DA 1N59B 4XPBL 3RWIA 1QBAA 3DI2B 1NLBL 1OAYL 3VD3A 3DUUB 3RDTC 2WIKA 4ZSOE 3O3AB 3VXMD 3IKKA 4KZEH 4N8DA 2EXYD 3MV01 2YPLE 3ZDYF 4FQIH 1P7HL 1J0YA 4LVHB 3ZMRA 1CLYL 3CDGA 4RISL 1YYLH 3GSXB 1J5OH 3LN4A 1XZLA 2OS7A 1YEHH 4ZFOB 3L3IA 1KCSL 4PRHE 1A8SA 1HXYB 3FN0H 1G7HA 4XP4H 4J3TA 2A0LD 2C1PA 3BW9A 5EIIB 3HI1A 4X6BA 1JU3A 5H3HA 1HHKB 4L3EB 2VT7A 1A7BA 3U4EA 3WLAA 2NY3C 4BK4A 4E42A 3T0DA 3NZHL 2XN9E 2W9DH 5FHBL 4P0DA 5AI4A 5FOJA 1ZI8A 3GKWL 1YCDA 3CXDL 5B39B 3NGBB 5DF0A 1VE7A 1EO8H 4LSPH 4RX4D 4MAUL 4FFZL 5ITFB 3MV9E 4WI9A 3H2WA 3OJDA 4P2OA 4LCCA 5AEAA 1F90H 5DURD 5GGUA 4NBYB 5ANME 2XUAA 1BFTA 5GJSL 3VGFA 1DDHA 2FD6L 3I50L 2H3NA 2YR3A 4GLRI 4NQED 4OCWH 3DVGB 3Q3GA 4C88A 3IXTA 4OQ1A 1S9YB 5BO1H 1TVBA 2J1KA 4POUB 1Z3GL 4HW6A 1FG2B 5CBAA 5C7YA 3DUSB 1WM1A 3ES6A 1E27A 1S5HA 2C4HA 2EE6A 5J57B 2FIKB 1L7IL 4S2SB 4QHMB 2P8PA 3EYFB 2A6DB 5HD8D 3BUYB 5CILL 3UAJD 4A6YL 3PFBA 4IOIA 1OTTC 2HFEB 2WQRA 2BY2A 2DLTA 5LXGH 2BY0A 2F53A 5ALRA 3IDNA 3V1LA 1YEJH 3WSQH 1NL0L 3VU2A 4OTXL 1UK9A 1PKQB 3FFCD 4RMVA 5EDXA 5I2IB 5F9WC 5CCKL 4MQ7B 1UCBL 3UEZA 5KVGL 5DMKA 1HNGA 3QDJE 5CUSL 1MAHA 4M62H 2OSLB 2YUWA 4YNYA 3B9EA 5LJYH 1HKLH 1H23A 2GK0A 4F2MA 2XWJB 1KCLA 2FLBT 3WKBA 4IRJB 2HKHL 5GGQH 1L4IA 3LDBB 1MWAL 2AJXL 5DZLA 2YD4A 3RGHA 1QIMA 1L0QA 4YDLC 3MC0A 3ESAA 4EY8A 2HH0L 1AQKH 1JUFB 4DN4H 3MV8E 4MJIA 5A2FA 5E94A 1H3GA 2VOTA 4P57B 3RI5F 2YUVA 4V2IA 3KYKH 2WUCL 1RHFA 2BSSA 1VGEL 4OLUH 4KE7A 1OOAA 4JFOB 1UXWB 1FV1A 1VXOA 4MA7H 4GAGH 3R41A 3IU3A 4MSWB 1EHLL 1Y18B 5C08E 4KQ4L 3UTTB 3MXVH 4HCRH 4X5WA 3B9KB 4L3ED 3BKMH 1U3JA 4PJCE 5AD0B 4OCLC 5GGSB 5HHOA 1RZKH 5E00B 4WW1A 3TYGH 4QF1B 5E4JA 2X4PA 4NC0B 5DEFA 4XMLH 2HA1A 4JKPH 4TPRH 1I3VA 4C55A 1E8DA 1SYSA 5KS9F 2FX9L 2OCIA 2J88L 5A2JH 4J3UA 5B8CB 2FSEA 5KSBA 3IETB 3G5VB 4GKOA 4WI2A 1YNTB 3NIFE 1I1AA 4KMQA 4Z7VE 4Z95H 4XCEA 4LEXL 4LLMA 5EG6C 1GQSA 1PSKL 4GKNB 1MCDA 3NIGE 4WO4B 5D7JD 1NDGB 2Z91A 3JV6A 1FZJA 5F72S 1T83A 4M9OA 4DGIL 5EWIL 1BBJB 8FABA 2HRQA 3QNYB 4L5FL 3B12A 3V1MA 2QJDA 2VDQL 5L6YL 4EY6A 5DNUA 4ZUVB 2BVOB 4H20L 5CBEA 3A70A 3W2DH 1XGTB 2EIZA 1A1OA 4JCLA 4CNIA 1A7OL 4BYHA 3I6GB 4J4PD 4HJ0D 2O2IA 5HYSB 2EH7L 2DSNA 2BVEA 4GW4A 1MLCA 1AI1L 1PKOA 2FX7H 4LSTH 3C60A 4CRPA 1FFPB 2FEDC 1DX6A 2DYPA 5ESVB 1FFRA 1T4MA 4BAUA 1KN2L 1RZ8B 5EC2B 3Q8WA 4B81A 1FFBA 4BFIB 1CGXA 2L0DA 5DLMH 1JJUA 4JPVL 3TNMB 2F58L 2GCYA 4FMKA 1RVFH 4LPXA 4GHWA 3OKKB 1N3NB 5E8EB 1PZ5B 3OG4B 5CD5D 4UUJB 4IRJD 5AKYA 1R3JB 4YC2B 3TEJA 3U48A 5DO2C 3ESVF 5FKAB 5BZWA 3A6BL 1CD8A 3BPLB 5F8RC 3OTQA 5T1MA 1PG7H 2CKNA 3AGVA 2HU5A 1BZQK 1P9MA 3FQXB 3MRJB 1BEEA 1VZ3A 2EYRA 3AAZB 3B43A 1QIGA 4K3JL 4UAOC 1C5CH 1ES0A 4BATA 4K94H 4PG2A 3JXAA 5I1AA 4GSDH 4PGCB 3UTTD 3B9KD 2NY4B 2GBGA 4GXVL 4C89A 1MVUB 4BFEA 2YS4A 4ETYA 5FEBA 1I3GL 4V1DA 3DOIA 4UU9A 4L8BB 4LFHD 1KCUL 4LIQE 5HI4C 1MOEA 3OXSB 1GT6A 1GGIH 4KTEL 3LV3A 1YEEH 5C0IB 2OAEA 3RJDA 1DWPA 3AB0B 5CXUA 2IPKA 3MJ7B 3GMOA 5E08H 3VRIB 5FGCB 4F3FB 1J0HA 1XGYL 3INUL 4JHWH 4EY4A 2Z31C 1DBBL 3HRZB 3L6FB 4A6YB 4P2RB 3UC0H 4TVPH 3UPCA 2PW1A 3ALWA 6YASA 1WK0A 4QYOA 5C0NC 1QJ4A 4PJ7B 2DM2A 4OD0A 1XR9B 3BPNC 4WO4D 4IRSC 3F65A 3VCLB 5E2UL 3NA4A 4QHKJ 2G75B 3MCLL 2JCCB 3LEVL 3AS2A 4NQDE 1SOMA 1QPPA 3MUGA 4RE6A 4DVBA 5EBMA 1NBQA 3QA3B 5EFIA 3KS0J 3WFBL 1F4WL 4ZUUA 1EO7A 1QSFE 1AGEB 2D5LA 1Q0XH 1JIBA 4HS6B 1QBLH 3FB6A 1AY1H 1RIHL 4JZOA 4BVJA 1OARH 2J4CA 3HN3A 4JO2L 5KSVA 4JM4L 2DKMA 2I07B 3S37X 3WUWG 5I66A 1MWAB 4F7EA 1UWEH 5ALIA 2P43B 3FO0H 4KPHL 4JM2F 1NCTA 1G9NC 1QIHA 2L7JA 3I9GH 3O8XB 2O61B 4I4CA 1Q9OA 3G9VA 2C7UA 2W6CX 5D2LE 3KXFB 2APFA 3UPRB 2H41A 1XZ0A 4XCNA 3ULUE 1P7QB 3K2UL 3PWJA 4GRLC 2FIRT 3VWKA 1Q0YL 2DD8L 1MHHA 3RX8A 3TPUB 1XIWC 4Y5VA 1AGDB 4G80A 4JKLA 3TNNB 4MNQB 2H45A 2XT1B 1XZBA 3IVMA 4BDTA 3SO3C 3L5JA 1EVEA 5J11B 4G8EA 1MIML 5TQ0H 1MCLA 2CQVA 4H1LG 1EI9A 4MS8C 1GPOL 3HRHA 4PP1C 4FZEL 1SY6L 3VMOA 2AJUH 1Q9WB 3SCMB 3JTTB 2ADGA 4LAJH 3DYMA 5ALFA 4L8SA 4P23A 1JCKA 2H2SD 3D59A 3HC0B 2Q86B 1JZ4A 4KMTH 5GS1A 4KKCC 2FEEI 3HI4A 1FCCA 3RDTB 3MLXL 3M17B 2O93L 4WJLA 4EXPX 2NY4D 3MUY1 1IGMH 2DM4A 4IRZH 1S8DA 1UADC 3QDHA 4BDSA 4S1RH 2CUTA 3PWUB 4X00A 1LDSA 4DM7A 3ED1A 1QHOA 2HT2D 1K2DB 1VFBB 3ZE0E 3BPCB 4Z5RA 4WHCA 5DEZA 3L3OB 5DHVA 3JZ7A 3NCJL 1N6UA 4IOFD 3N50A 4FZ8H 1Q72H 3QUZB 4YHLH 5DQ9B 4XZUB 4HT1H 4WY7L 3FTGB 5E2VH 3ZLTA 2WIFA 3NPSC 5DR5H 1QQDB 3TA3B 2HA4A 5DRZB 4DKEL 3C5SB 1CLOL 2B5IC 4P2RD 4W1QA 3I2IA 1D5XA 3H3BC 2GTWB 2Q20A 2NY3B 3I3DA 2X2YA 2J4WL 1WBXA 4WI7A 2YD3A 5F3HB 2FHBA 2DF3A 2AS5M 1UENA 3BMVA 2ZSWB 4OZFA 2YMXL 4UTBL 1FFNA 3KPLA 1URLA 5FA4B 5JZBA 5GRWA 3SDXE 2XRAL 2J3DA 4S1SL 5HF9A 1IC4L 2YN3A 4UBIA 3TIDB 3LEXA 1IEAB 1F4YL 3GSNA 2ZPKH 2AXHA 2EDTA 3ZE2E 1YEKH 3TESA 1UZ8A 1TZGL 3EDDA 4XI5C 5EUKB 1Z68A 3DI3B 4HPOH 2D0HA 4N0UE 4ROTA 4KE9A 5ALOA 1RMFL 1NCDL 4MB4A 4PGZA 5T3XH 3FVRA 4U1KB 2Y1VA 4I19A 2CH8A 5KW9H 4ODUA 2QT9A 4OB6A 2EZ0D 3QQ9C 4WU5A 5MENA 4X6DB 5JOFA 1ZWIB 4Y4HC 3QDMA 3K46A 1PG7W 3VXUA 4PJHF 4TSAL 2X4UB 2AJVL 3HC3H 1EIBA 4MAYC 1BN7A 1SM3H 3O8XD 4PFEA 4TNWK 1N2RA 1MRCH 1THGA 3TBTA 3MLSL 2WU4A 4G5XA 2GUOB 3KXFD 4XP1L 4XGZA 3UTZB 3V8OA 3IBTA 1P7QD 1XRMA 2B1HH 2WNGA 5DFWH 3LKPB 3P4OA 4ZAKC 3L1JA 3FFDB 4BVKA 1EDBA 4MNQD 1L6ZA 2PBLA 3MBXH 3FCXA 4JKMA 3SDCC 2HLAB 5JMRA 3CFCL 4MCZB 3RUGA 2F54D 4LPVA 2JK5B 3TH2T 1CR9H 2CKBL 4LDEB 2HTKC 1ETHA 3QULA 3W9BA 5FYKD 4DTGL 4GG8B 4DKAA 3SCMD 1J0IA 4KYVA 4OF8A 4Z78B 1TJIL 5F9WB 4OFPA 5ESAB 1GGTA 3CD4A 1QYGH 1CXFA 5I15L 3WYNA 1F6WA 2I60H 3RDTD 2EDCA 3O4LA 4XB7A 1J0ZA 4Y19E 4XH2B 3LRGA 2H9GB 2JGIA 1AD0B 1T3FB 2PSDA 3DIFA 2G2RB 5IFHH 4W6XB 4YDLB 3L9RB 5I75C 1R6VA 2ACEA 4HD9A 3E0GA 2X1PA 5C0BA 1TIBA 3W39B 3V4PL 3G08A 3VFNB 3CLEH 4C83B 5ALEA 1QFWH 2RJMA 3LB6C 5DT1H 4KHTL 1EUUA 1I8MA 1A6TA 3DHJA 2R2HB 4Q97A 2AXJA 2E27H 2NY3D 4ZDHA 1Q1JL 1M71A 2MQCA 5JANA 3EDJA 4G6KH 1F6FB 2N56A 3RNQA 3P4NB 3ZTNL 2F15A 3BXNA 4JFZL 3O3DA 4J0GA 1QIDA 3WHXB 3WJ1A 4JY4A 1V7MH 2X44D 4HSQA 1GKLA 1RWQA 1RIUL 3ECBB 3HMWH 5AKZA 3V5HB 3I1YA 3W9DA 3I2GA 4BC1A 3I85A 2H7XA 4WHYG 3T0XA 3AZPA 2HU8A 3MBEC 3SE9H 3FQRA 3V48A 3TP4A 2OMNA 4XVJL 2VZ3A 2XZAH 3IUNA 5E8PB 4LLWB 4QXUH 4HC1H 1EFXB 1KB5H 3WFZA 3U7YL 5F9JB 2HRPL 3N9GH 3MGTA 1NGWA 1KIPA 2QQKL 4QTHA 1MCKA 1JF1A 5LQBL 5IMKB 3GMQB 2FX5A 4EUPA 4LYEA 1OTTD 4OF7A 3OXRB 1YEFH 3QIBC 1YDPA 4YHPB 5DHXB 1A1NA 2OK0L 3FCTA 5MERA 5IVIA 1FIGL 2AK4A 3S88L 1CN4A 5BWBA 4UDTA 2R1WA 1BFOA 2EC9T 2O5ZH 5DVNA 1S8OA 3MRRA 2D4FA 4JQIL 1RFDL 1R3KB 3PL6A 1YPZA 2J6EH 4NQCB 4P49A 3S4SB 2QV2A 1CUGA 1EA5A 4J12A 1UQSB 4OGAC 3OKMA 1KOAA 3BE1H 4HZAA 4X92A 1VGKB 5I8OL 2XTJE 4X7DC 2VR4A 1U8IB 1HOCA 4RIRB 1RSFA 3P2TA 1EMTH 5CJBA 2QQNH 2XG5A 2HJLA 1IAKB 3MR9A 2WG2A 3DS8A 1BWMA 3V0WH 1OT1A 5I1GH 1OL0A 3QDGE 4APQA 3EOTL 4UAOB 2Q76B 1P1ZA 4X4XA 1BBDH 2JIDA 1NEZB 2PTTA 3WFHA 3T1WA 2NLJA 1INEH 4FQJH 1FNLA 1VA9A 3O0RH 3HPJA 4O51A 5IROA 1QSEA 4XBGA 4NNYA 3TBVA 4YLQT 5K3DA 2D31B 3NCMA 1CE6B 1C08B 1G7JB 3TVMC 5CMAA 3HS0A 1ZD3A 2B2XL 1FAIH 1I7UA 3P0GB 5D9SB 5IB3A 1NCWL 5F1NB 1NMCC 2YUXA 1OT2A 1X4YA 3SGJC 3SE3A 2RGSA 1U8OA 4FWBA 1LEIA 3GSVB 4B80A 4X98B 5C09A 2Z31B 4POYA 5ACLA 4EY5A 2ZUWA 5EN2A 8CGTA 2KKQA 3VD7A 4W4OC 3E3AA 4XNXL 4G5ZH 4OZIB 4QRSA 4O5LH 1AR1C 3LQZA 3RWGB 2CKBB 3BPNB 4D0BA 4QHKI 4X6UA 2A1WH 3QEQA 4IRSB 4JN2B 2V7NA 1INDL 4U0QB 5D6DA 5HYQB 4HWZA 1EFXD 1ROWA 3D39B 3AUVA 4TRPH 5IB2A 4PW0A 1N8ZA 4LLUB 2PYEA 1P4LA 4TVPE 1VKXB 4FMFA 5JDSB 3C2AH 1U3HC 1I9RL 1WCBB 32C2A 5GPRA 4YDIL 2VDNL 1JYXA 3VD4A 1RPQA 1AGBA 1ERNA 4G43A 1NPUA 2FEDD 2WHQA 5JXAH 5FGBA 1NC4A 1U95A 1U8KA 4B7LA 2PSFA 5EUOA 4BRZA 4OM0L 4JFHE 5FB8A 1YUHB 4P59H 2WU3A 3S35L 1E4KC 4NQCD 4BKLB 4GRLB 3VFUA 5F96L 1DQDH 1H3PL 1DQQA 1E28B 4K2UH 1XIWB 1HN1A 2IGFL 3KNBA 3ULSB 2XZCH 3SO3B 1YEDB 5C8JB 3SKOA 4EI5C 3RQ3A 5DO2D 1HI6A 4U0RB 4OZ4A 2OJZH 5MP6H 4LP5A 4R90H 1Y7HA 1DQMH 3CH1A 3V6FA 2JJSA 3KPRB 4WWKC 5CSBA 3MRIB 1HHIA 4AG4H 4ZMAT 5K3AA 1WUNT 1NAKL 3PQYE 1XGUB 4JZJA 3BXPA 5FYKU 1MCPH 2IJ0C 3VWJA 3HSSA 3D18B 3E6FA 2ARJQ 5FRDA 4HUKB 3MREA 3DL4A 4Q0XL 5HI4D 4QE3A 2X4NA 3H9ZA 4WV1C 5MHSD 4MB3A 1HDEA 3F12A 2WAHA 1OP5H 1LZLA 3WFEL 5F1IB 4X4YA 3A6ZA 1KLUA 3NPSB 5DQDH 2UWEB 1CUYA 2Z31D 4YX9A 4UV7H 2B5IB 2W92A 2CIKA 5A16B 1U2CA 7FABL 2R2BA 5KN5A 5C0ND 1YMMA 2BMKA 3VH8G 4ELMA 2X76A 4A23A 3PWNB 5IMLB 2VZTA 4LPWA 1CL7H 2EDQA 3KDAA 3GIZL 5F7LB 2GFBA 4IRSD 4OCXL 5ALBH 3VFPA 3QR2A 4MMXC 2OI9C 1Z0MA 5JNYA 3NACL 4NT6B 4IMKA 5IBLC 1CV2A 3QXVA 4HH8A 3S5LG 3HZYB 4X90A 3ZDXE 1UK8A 2BVPA 4DNOA 2FZ3A 1QFWM 5I74B 1JGLL 3QH3B 4RQQB 1FVCB 4Y5YB 4XWOC 4YDJB 5BRZE 3BX7C 5M7QA 2BJHA 4EVNB 5J6HB 1MI5B 4Y4HB 3QPCA 1JHTB 2X4RB 5E4IA 2OL3A 2IANE 2VIRA 4HH9A 4GG6E 1I8IA 1KJ2A 4MAYB 1BQHG 2V7HB 4Z77B 4JFXA 3SE8H 3MLYH 1NCBL 2VLJD 1EZVY 1UM5L 5T3XE 5D2NA 2AJYH 3IJSA 4LRNH 5AUMA 5L0QC 2EKSA 4GRLD 4F33A 4ZAKB 2FYYA 2CMRH 4NQXA 2RAUA 2EECA 1CXIA 5CSZA 5DGRA 1XIWD 5C2BH 1LPMA 3B3IB 4ZUSA 4Z7QF 5L9DL 4L3CA 3BZEA 4NN7C 3SDCB 3OKDA 2LVCA 2XA8H 3STZA 2BVQB 1AGFA 2E7HA 2X4SB 3N1PC 3EYVA 5C0AE 5DRXA 1UKAA 1FGVL 1NFDF 2ESVB 3P9LB 4LCYB 4NWUL 3H9HB 4DIUA 1MRFL 2AEWA 4MS8D 2WUBL 3AU1B 4PP1D 1XROA 3GZJA 5J6GB 4TSBH 3NFPA 3RZCA 3HI5H 4FNGA 3WK6A 5DJZB 2EYSB 3O2WL 4KKLC 3KPRD 2OQJB 3AXLA 4RRPG 5F6HJ 5AIBA 2FBJH 1IVLA 1KBGL 2EDNA 5FK9B 1PYWA 3VFOB 4N1EA 4Y5XC 4LU5L 3TWCL 3L3HA 1MQ8A 2AEPH 3U46B 5LGHL 3F8UB 4DZBA 3I02B 5I75B 1H3UA 2Z92A 5LG1A 2AJ8A 5DJAB 4I5BA 2ICWA 4YO0B 3DXAA 4WFHE 4Z7UB 1DBKL 4YDVA 4NYLB 4JG1H 4ODXB 4BZ2L 2QJWA 4HFWA 3SGDH 5C0RL 4OSUH 5EBWB 4DTCA 4P9NA 2W59A 3P9MB 4ISVB 4H7IA 1A9BB 4LARH 3KJ6L 4M5YH 1WAAA 3CFDA 4S11A 4UNTA 2VLKE 3SDDC 2LAAA 3STUA 3ME0A 2FECL 3GGWA 3O2DL 3HC4L 5HI5C 5BQ7B 3G6AB 2MCPL 5E1AA 3BIXA 4U1LB 1MU0A 3MUZ1 4XI5D 3EFDH 1LK2B 4GWLA 4G6JH 4HIHA 3QQ9D 3C5WP 3MBEB 2JJVA 4OB8A 3BN3B 1A7RL 1MI5D 4Y4HD 4HF5L 4GW1A 1LP9A 5CD3B 1U8MB 3EO9L 4MAYD 1GZPA 2P8MA 1AR2A 3QQNA 2L4OA 2YEZB 1UH2A 4ZUWB 3RY6A 5T1LA 4E5XA 1QUNA 1UK7A 4W63A 2PO6A 5IVXA 2R23A 3PFCA 2CDEA 4YBQC 3IU4H 3WEXA 4ZAKD 2XXCB 2IAMB 3BO8B 2UV3A 4U6XB 2W1NA 2KH2B 1EA9C 2MPAH 1A3RH 4IOSD 1NMAH 2HVJA 3LKSB 3QIBB 4JFFA 3SDCD 3BF8A 3VDAA 1E8NA 2FJ0A 5I8EA 1NCCL 3GIVB 2W0FB 2ESVD 4L4TA 4KKBC 1A3LH 1L6XA 1OF2A 2HTKD 3GHBH 4XHJC 3KAAA 2HU7A 5LKRA 2VTFA 3CFJA 4P46A 3GUTA 3D5OF 4QHLA 5T1KA 4WI5A 3WUWA 1DLHA 1ADQL 1FFQA 5E70A 5F71A 3MFGB 3WE6A 3CN7A 4MD4A 5BOZG 2E7LA 4OCMC 5T5NF 4PLKC 2QHRL 2IBBA 4CVUA 4CMMA 4N5EC 3SPVB 4ELMF 4R26L 1IQWL 4WGWB 1CVLA 4BUGA 1I8KB 2DLGA 3MOBL 4D0DA 3HZMA 4EIZC 4JQVA 4H7JA 4Y89A 5LWYH 3ROOA 5D5MA 3B2UC 3L95A 3U0PA 5EPMA 3NA9H 5EO0A 4U7MA 3C8HA 1UM6L 4ZUTB 4DEPC 1Q38A 4QDUA 1UA6H 1QA9A 2HJFB 1GHFH 3QWRA 4H1LA 2HFGL 4XPFL 2ZUUA 4NC2B 1AE6L 3QIUB 1YA8A 2IG2H 4HIXL 1EK3A 3VJ6A 3SDAA 4X91A 2EO1A 3WS6C 4GAFB 3WWCA 3QZWA 4XAWH 2AV7A 5BMFH 1IC5H 1R3IL 2JELH 1BD2E 3CU7A 1E5TA 4LPYA 1YEIH 1NBYA 3FRUA 3NFSH 4FP8H 1NMCB 2NPLX 4YGAB 5KS9E 4Q9RL 5AIAA 3HJUA 3C9NB 3AREC 3S37H 2X42A 3D0KA 1XRLA 2EH8L 1MCSA 4HJJL 1JGDA 3DX8A 4HHAA 4AENA 4AIZB 5IHUH 1EH5A 4UOW0 1ZGBA 5BV7A 2MTPA 1T89A 1OAQH 4B0PA 3KPTA 3MBED 1MPAH 4CCWA 4G6MH 4EIGB 4IIQC 3VA2C 5CIPB 1QFUL 4Z76B 3WZLA 1LPSA 5BW7A 2LQRA 3BP7B 4NDMB 4GAJH 3H2JA 3I75A 1I1CA 1CF8L 1YEGH 2V2TB 5CJXA 1R5VB 4BCBA 2Y5TB 4IH9A 3EGSA 2APVA 1SMOA 4FQQB 2DTMH 5T3ZH 1IC1A 3IFNL 4XX1E 3E3QE 1D9KA 1C1EH 3N85L 5JOPD 3WLWC 4RNRA 4J6RL 3TYFA 1EB8A 3RY5A 1G9MC 5LZ7A 3QIBD 3PGCB 4U6VL 1OW0A 5KAQF 1A0QL 1JWUB 4R7NB 1KXTB 3LH2L 3WJJA 5FXMA 5I1EL 3PNWA 3ARDC 1E4XL 2FGWH 5FO9B 1A14L 1DUZA 1U8QA 2RR3A 2P5EA 4KDTA 3WKMH 3WHE0 4P5TA 3WFCL 3VFWA 5F97E 3H3PH 3BH8A 4JFDA 4Z0XB 5EZOH 5F1SA 4QCIB 4YX2H 4OGAD 5FAAA 4U6TA 1FBIL 4LVOC 2I03A 4PTUA 3AS1A 4U05A 3LS5H 1YSCA 3GJFK 5DJ2B 5B3JF 4YAQA 2EDEA 2NY1B 4EI5B 4DW2L 4EBBA 5J3HC 1PBYA 4U3XA 4Y1AA 5HGBB 5CEZD 2VDMH 5ILTH 4UIMB 1JJFA 3F5WB 4D9QD 4YFDB 1XZKA 3JWEA 3ESDA 1HCFX 4D3CH 1R4ZA 3WD5H 3FLBA 4BVLA 5AICA 4WWKB 3G0GA 2WP3O 3BVNB 1UOOA 4TUKH 2IBZY 4LCUA 4PRIB 5HKAA 1OM3H 4PF1A 4R8WH 4P5MA 1MFBH 3GSOB 3DARA 4P2QE 3P77B 1HH9B 3SE4A 3S8WA 3UCRA 4RCAA 3TVMD 2H26B 3H0TB 1ZLSH 4RFEB 4WV1B 3IDXL 4NZZA 3ZHLA 4EOWL 4CADB 4TN9A 4NC1C 3CSYA 4KU1A 1HHHB 3MRDA 4X71A 3ZL4L 1FRGL 5DA0B 1ZXQA 5CH3A 3DTXB 3ZT5A 3QCUL 5C0FB 1IBGL 5GRXG 2IADA 1AR1D 3YASA 3G0IA 4GAYA 2WUEA 2P5WA 3T4YA 2GYUA 1Y6MR 4L4JA 12E8L 1U93A 3ULUC 3U7AA 1MHCA 1S3KH 1DVFB 4MDJB 5GRVL 2DQFB 5LBSH 1OGAE 5TPWH 3HPLA 1ED3A 4M7ZC 2JIXA 4XNUL 4PJ7F 4LF3B 3QWOB 3V0VB 4GMSL 4LL9A 4P9HC 5CJQL 5J1TC 3QAZC 1U3HD 1LWRA 4HRXA 1QEWB 2WMPA 2R8BA 5BVPL 4JFQB 5KSUB 3O6LH 1IFHL 4Q9QH 1KXVC 1JPSH 1KU0A 4F7MB 1YAHA 1B4JL 1FZMB 3QNZB 2ITCA 2ZOKA 2VLMD 3UYRH 5AHXA 5C0JB 2OCFD 3MLTB 1NU8A 3L3DB 3LMJL 5L0QB 4EDWL 4ZSOB 1LNUA 4C4KT 2MOVA 3WCYA 1R1DA 2YPLB 1W72H 1G5FA 1QTRA 1SYVA 3L7EB 4NN7B 5D8JL 1OD7A 3BF7A 2KPNA 4GKZB 1HQ4B 1HIML 3MACL 4AZ0A 5EZJA 5IB4B 2RGUA 4EI5D 3QVMA 2XA3A 1G7IA 2W91A 4HUXA 5SWSA 1JFQH 1SCKA 4LXIA 4BFGA 4JY6A 4CVZA 3MOAL 5JPMB 1QRNB 1I85C 4PRHB 4Z8FH 5LZ5A 5JQHC 1UWXH 3QFDA 4OCYL 4KRLB 1F3JA 3SOBH 5JA8B 1CIDA 4DVRL 4AIOA 4AXBA 1FZKB 3BGMA 5H94B 4WWKD 2BOCB 4N8PA 3UROR 2NY7L 1MRDL 3OKYA 5CEYA 3FMGH 2CLZA 2B39A 4WTXA 1A6AB 3K3QA 4PRID 3CX5K 4AO8A 5CKAA 2ZUVA 3I3EA 4Y5XB 3DSFL 1CG9A 5B21A 1FP5A 3NTCH 5AI5A 4XNYH 4I2XB 3IFOB 2ZP0T 3OR7A 5I8CA 4LPTA 3ARBA 4BCDA 1WZMA 3UZEA 3FT4B 3IT8D 1V7NH 1T03L 3ARFC 3BIKA 3D85D 3C45A 4MHHG 4O02L 1D3CA 4OYYA 2OZ4H 5ANMB 2VWEE 4DAGH 1U8JA 5J1AA 1SEQH 1DWOA 1OCWL 3WL9A 4D8PA 4NZUL 3O9VA 4PYHA 1M6OA 3TCLB 3OR6A 3FKUS 4JO3L 2VUYA 1ZV5A 1RY7B 1KB9J 4LIQL 3D3VD 1C12A 1JPFB 4I77L 5D1QA 4OI7A 1EFQA 3T65B 5TGBB 3SDDB 3GB7A 5ALHA 5GS0L 2BOBA 5ALMA 3VXTB 1S7QA 2B4CC 1WEJL 1R3HB 4OD2A 1UM4L 3H0CA 3CZJA 1SJEA 4YGVA 3D69B 3DGGA 5IBLD 4LSQL 5EORL 3ZYOA 4UB0L 4RGMC 1SVCP 4NWTL 4XRCB 4UMGA 1I7ZB 1QBML 4XWOD 1MT3A 3LOWA 2YBRA 4GLBA 3V5KA 4INZA 4OLVH 2C4FU 4JRYB 1LPOA 4WFKA 3OJMB 3D0LA 4PJHE 2BNQB 3V6OE 4BH7B 1MH5A 4JY5L 1WB5A 2DFPA 1GH7A 2C3VB 4LSUH 1ZT7A 3BJMA 2GJ6A 4FFYH 1RZJC 3OPZL 4OCRH 5T33H 3LS4H 5TE4H 4O00A 4N0YH 5IQ7L 1A2YA 4XCYA 2VUOA 4WEBH 5DJCA 5F7DA 4OI9A 2LVEA 4LHUG 4MJ5A 1C7SA 1LE5A 3ILSA 1XZMA 3T8XB 2BNRB 2R1YB 4M0FA 5E5MA 1G7MA 3T0WA 1TFHA 4RWHA 3K8KA 4O9HL 5C92A 5JHDB 3MV8B 3F62A 5DK0B 3FSGA 1CGSH 1QRND 4OFKA 4PRHD 3ULUL 2VNCA 1N5YL 3LRSA 3T77B 1KT2A 1BMGA 4N0CC 4U3CA 3NOIA 3BQUA 4M3KB 2FO4B 2NXZC 2XY2A 5KSAB 5E24E 1CGUA 4KKLD 2XQJA 4OLXL 1P2CA 5HHNB 5FDYA 4P9HL 4J23A 2V5RA 3LD8B 4GXUM 4PJCB 1G0DA 2I9TB 4L9LA 4YEEA 2DQIH 2BFNA 4DNQA 4JO1L 3JVGC 4NUGH 1ORVA 2WLZA 3MRGB 3L7FA 3CFBB 2GSIA 4E41A 3TBYB 4QRUB 4U49A 3O9WC 5GGVH 3UTOA 1OHQA 2ZZUT 3HE6C 1E6OL 3O2VH 4EZIA 5HF6A 4PJIB 5HGDB 1B2WH 3RY4A 5C0CA 4MD5A 3THML 2B9VA 1V8HA 5EZIL 5EFZA 2XPGA 4KJWC 2EDKA 3B9DA 4GXNA 1RZKC 4NKMA 3CFIC 4LKXA 2XYCA 2EE3A 4NGHL 3CMGA 3GDBA 4HTAA 4ERSL 5AAMA 1ZA3A 1IUNA 1HL7A 3U9PH 4WNQB 4LLQA 1QOZA 4MX7B 3SDDD 4G9FA 3H18A 1TZIA 4FFWA 2GYWA 3BIWA 4N8SA 1T04A 3BHBA 3MMEB 1WJ3A 2PSHA 4LXGA 5HI5D 4F9LA 3IAQA 1R3LB 1QO9A 1USWA 1IAII 3AREB 4PIRF 4KZEL 1G0XA 4TQEH 1CUHA 4GBXC 1F6AA 3RL1B 4K2AA 4FQIL 5SYMA 1K3ZA 4UDUB 1YYLL 4OF0A 1J5OL 2DM3A 4IIQB 1YEHL 1CUSA 1VADA 4JRYD 3KG5A 4B41A 3PJSB 2VATA 3KYNB 2BNQD 3BP5A 3KWJA 3T1FB 1H2YA 3FN0L 1NGYA 4XP4L 3T4UA 5HHVH 5KJRH 5EHXA 2Y7QB 3VH8A 3ULVC 5ETUA 2IQAB 5D7KE 1HQRA 2W9DL 2G5BB 4YBQD 3S36H 4WDRA 4FLMA 3EIFA 3X12A 4UUQA 2BNRD 2XTJC 3MGOA 3FYTA 2QS9A 3U6RB 4PV8B 3VMPA 4LSPL 4X5LA 3UTSE 3EOBA 4Z7WA 5JHDD 1WBZB 4IH1A 3S5LA 4KKBD 3ARDB 3VXQB 4XHJD 5AI8A 3WJLC 2O7RA 1F90L 5ACMA 4PJGA 5T3ZE 1F4XH 3X17A 4PP2A 2HYMA 2COQA 3OF6A 1EHNA 4F7TB 4XB8A 3QO1A 2WUFA 4PO3X 1KEMH 3MRFA 4U1JB 3I2FA 2BNUA 4OCWL 5D7IB 4RAUA 1ETZB 5IOPB 3E2HC 4PLKD 2UUDH 3PE6A 1BQHA 5BO1L 4LVOB 2FECI 4N5ED 3EJJX 5IG7B 3QJHB 1CICA 3O0DA 2ZSIA 2IH1B 4KACA 2DI8A 2DLIA 1P69B 2Z93A 4G9GA 2AXFB 1K4DB 4KK8C 4K94C 1EB9A 2GAZA 3B2UD 5GGRA 1G7QA 3FQUB 3MTRA 3QG6A 2OR8A 1QONA 2BSTA 1LDPH 2SEBB 5C3LD 1LD9B 4QRPA 4QRRB 1IGIH 5LXGL 4JGUA 5IVZA 1J05B 4G42A 3RTQA 1GXEA 2FGZA 4FQHB 1YEJL 3WSQL 3N0TA 5CH5A 4AH2A 3RA7H 1HHJB 1QVOB 4YH6A 4RFOH 4U33A 1U65A 4LLAA 1WBYB 2CLRB 2YYSA 1BF2A 1EEUA 4QRQA 4OLZH 2ZNXA 3NGMA 4RRPA 1HNFA 1DZBA 1HKLL 2Z35A 4PJBF 3P0VH 1T0NB 3G5XB 3ARED 3HMXH 2AKRB 5GGQL 4JO4H 4YR6B 4RZCB 3K1DA 1T6VN 3LPGA 2EIBA 2Y72A 4MNGB 4D2NA 4PJDF 5F44A 4DN4L 1AQKL 4DQOH 4M8QA 1EHYA 4CU6A 3KYKL 4QHUA 4OLUL 2G60H 4P2YA 2PKDA 4WEUD 2BGRA 1KCVH 4G8GA 4MA7L 1AKJB 4GAGL 5D2LB 4CBPA 4D0CB 2ZCKH 3MXVL 3V2AR 2IWGA 4HCRL 2H6PA 1HSAB 5JZ9A 4M7ZB 3FOMA 3PHQA 1YC7A 3Q6GH 4OZIF 3BKML 4WCYH 1HKHA 3S35X 3HB3C 1KEGL 4M7KH 1EJ6A 1A1MA 3QAZB 1RZKL 3WLWD 3RM3A 3VFMA 3LN5B 4Y88A 4UT9H 3TYGL 3I6KB 5IBUB 4AEIH 4XMLL 4M7LL 5C0DA 3TO4C 5DJDA 2Y4SA 4JKPL 4TPRL 5AKKA 2EE9A 4WW2C 2D03H 4L4VE 2K1MA 3FO9A 3ARDD 1CLCA 3MRCA 4DSZA 2OGSA 4M6NH 4J3JA 2YRZA 1OGTB 1GKKA 2VABB 4LLDB 3KPPB 1Z5LA 4E11A 3DX9B 4ARAA 2PL5A 2H2PC 2W9EH 1OTSC 5MEOA 1BX2A 2UYLA 2VDPH 4HAIA 3IKCB 4NKIH 2E9JA 3IDGB 1FPTH 3MUHL 2IEPA 1VA5A 5J3HD 1S7XB 4K8RD 5IGXH 5AK4A 3RK4A 4D9LH 4YXHH 3W2DL 4XP6H 5IK3B 1D5MB 1OP3H 2J8HA 5EOCJ 3NAAH 3CLFH 5HHMB 5EU6E 2WBJC 4FDMA 4QRRD 2FX7L 4LSTL 1J8HA 2KL6A 4BSWB 1DLFH 1H8OA 1MHEA 4LSRH 1XRQA 3AY4A 5GSVA 2VB5A 4I18C 3VFSA 1CDCA 1JMKC 5DI8A 5TDNA 4GH7B 3SDXB 5TDOA 4QHNA 3PUIA 5DLML 1OAUH 3HUJA 1A5FH 2AEIT 4U2ZA 1AHWA 2XKNB 3JSSA 4M93C 1RVFL 1XR8A 5FYLD 2R2EA 4CKVX 3VXME 5JD4A 4N0UB 1GPKA 2XMBA 1ZGLA 2DCMA 4ZXBC 1X5GA 5JZSA 4B7IA 1KULA 1W2KT 3P11H 5I17A 1YY9C 3AMKA 5DHYB 3KYOB 3MCKA 2EDAA 1GSMA 1E4XI 5FUCC 4FQ2H 4Q3OA 5J1SC 1PG7L 4JJHA 3MRQA 4R4FH 4EY7A 1AKJD 2V2XA 1C5CL 4K94L 4NCC1 1TCMA 4RSVA 2UWEF 4XCCH 2P46B 5DK2A 4OQTA 4BSJA 2ARJB 3D5EA 1GIGH 3V1KA 4X6XA 3SGEI 4K07A 1I9IH 2JB6A 4RGMB 2ICEB 1PEWA 5DJXA 4R7DA 2W65A 1M05A 1GGIL 3MXWH 3RWJB 1FL6B 1YEEL 4U2GA 3A2NA 3W04A 5C8ZA 2DWEA 2YA1A 4LKCA 3W5MA 2WJ6A 1T1ZB 5E08L 5DD0H 1M7IB 5DVMA 4JHWL 4MCYB 4JFYA 1IGYA 3QYJA 3UC0L 2BVYA 4TVPL 1FFEA 4NPYB 4HS3B 4NQEE 4HIIA 4ZOCA 4D94A 2I24N 3VXPB 4UOW1 5DNVA 4O2CB 3NN8A 5GQBA 3FAXA 2V5TA 5ICXB 5IB5B 2XMRA 4Z7QE 1B6DA 1RJYB 3BESR 5FYKH 2YSSB 4CVXB 5K9JH 1PQZA 5D7LB 1NFDE 3JW8A 2I9LA 1X5HA 3WMSA 3VRJA 3ALXA 4KFZC 5I1IL 1Q0XL 4XBPA 1AY1L 1CLZH 1OARL 5HHMD 4YJZL 4X7SH 1T2XA 3OZ9H 3S34H 2NXZB 1K8DB 3BZDA 3T08A 4JAMA 1QPXA 1UWEL 2F74B 3FO0L 5E9DA 1RJZA 4JQXC 1DCLA 3PDDA 1G6RA 2CDFA 3I9GL 3JV4A 3F67A 4JJ5B 4NIKB 2AQ2A 3FFCE 5CJ8A 3K2MC 3MNVB 4ETQB 5EU3B 1I1RA 4EA6A 4LKOA 1FYTB 3FT2B 1EZVX 4PGEA 3O9WB 5KANI 1NQBA 1A4KA 3V95A 3VJMA 4UIKH 3G0DA 1QP1A 3ARFD 1BOGB 2VJDA 1IL1B 4RMUA 1NANH 5A6VA 2VMFA 3WBDA 4KAFA 2C7BA 4DK6A 5TQ0L 4DMHA 4YUEH 1SVZA 5K3FB 5E56A 4YFLI 5I1KL 2AJUL 1B0GA 4Z6AT 1CT8A 1QBBA 1ZAGA 5DWDA 4LLYA 4FLEA 4LCWA 4WUUB 4L3EE 4OB7A 3K2IA 3FZUC 5FOBB