3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
4JKKA 2BUBA 1L7TL 4OLUH 3SO3B 4GG8A 5D1ZC 2NY5C 4RX4A 1CVRA 3H3PH 5JASA 3CU7A 1Q9KB 4DZBA 1EBPA 1T7YA 4CG1A 2NZ9D 3F5WB 5EU7E 1FZMB 2OMBA 3MRLA 1ZD3A 1UK6A 2XIDA 1AGBA 4YX2L 1JJUA 2V98A 4N8PA 1MREH 3NOXA 3U4AA 1E4WH 5K3BA 5IB5B 1KULA 5EHNA 1KIRA 1MN6A 4LCYA 1HNFA 2QR0B 2XZQL 3NIFE 3TN0D 1F11A 1IC4H 4WV1A 5AZ2L 4DGVH 5BXFA 4OI7A 4WW1B 4KTEL 3P4NB 3TC9A 2R56H 4OCSL 5FYJD 3RJQB 4AENA 5IMLB 3ABZA 4WU7B 2B1AH 4MAUL 4MXQD 5ALNA 1W0YT 1LD9B 3C8KB 1JN6A 3TWCL 4BZWA 3DRQA 4UTAL 2XQKA 3BD4A 4OB6A 1H5BC 5FYJU 1AI1L 2XQBH 3N85L 5DRNB 2CK0L 1X5IA 4R4ND 1UKCA 1FSKB 3PE9A 3MLWL 2QXTA 3RVUC 4DUWA 2JK5B 3BRGC 1IAIM 3G6JA 4AJ0A 4TOYL 4BA8A 3LEVH 3ARFD 5JIBA 1C5CL 1P0IA 3RA7H 4DNPA 1MLCB 1L6XA 1P84J 3SGKA 5FECA 1G7HB 4NKMB 5JR1L 5SX4H 5AKEA 5KTEL 5TDNA 35C8L 1I1CA 5D6OA 3N2ZB 3G08A 5CJOL 5KZCB 4FLMA 3GIZH 2YPLD 1OT2A 3HTLX 3VXTB 3GDBA 3SJVE 3QIUD 3U36B 2X70A 1GKKA 5FXMA 3HG1D 4LSSH 4NO5A 5CT6A 4POUB 1D3CA 1MIMH 2V9QA 5F9WC 1XT5A 4NQVA 2BRQA 2G5PA 3VH8A 2V7HA 2W65A 2HVKB 5IB5A 1QYGH 3I02B 1A1MA 1XZDA 4ETYA 3MLZL 4M7LT 5I1KL 1QTRA 4UT6L 5TDOB 1Y0LB 2ED9A 4I0KA 1Q0XL 2OM5A 1JU3A 3WUWG 1B6UA 5EI5A 2HFJA 3PHQA 3ZSSA 4AM0A 1PZUB 4OCRL 1A7PL 4Z7VF 2AGJH 2EDEA 3M17B 1AQDA 1Q84A 4F8QA 3TYFB 2CR6A 3GSOB 5IEHB 3HZVA 2HFGL 1JN6B 2ZSIA 3F7VB 4XVUD 2N1KA 1K4YA 1MPAL 2X1XR 1H3XA 4ZYKA 1K4CB 3QRGH 4UHBA 2WUBL 3GMOB 2XICA 4OQTH 2W0LA 4MJ5A 4PBWD 3OF6D 4Q9RH 3HI4A 1G6RH 3ES6A 2EIZB 3MXWL 2WJ3A 2WJ4A 1T1WB 1GC1H 2Z9TA 2VDPH 4P57A 5C0IA 5HHPB 2DS4A 3PWPD 4YNYA 1LO2L 5BZDA 5I17B 4NYLB 2EEAA 5FGCE 2Q0XA 1QSED 3LCYA 2O5ZH 5HGBB 1CFVH 4GRWF 3T3PE 3N1MC 5HHNA 5E8PB 4RDQG 2NTFB 1UZAA 1KN4H 3MODH 4QRRD 4HHAA 1LO5A 1TQCC 5FDWA 4L3ED 4H0HB 5DQDH 3ULSA 1T03L 2QADD 3ARGC 1UOQA 4MNGB 3RPKA 5E8OA 3HZOA 2AXEA 3C8HA 2XQIA 5ANMB 4YHOH 2HMIC 4J0DA 2FSEB 1CUIA 4LARL 1BM3L 1E27B 1A6VL 2FBJH 2R29H 5A2KH 5ICYB 2HU7A 1MNQA 4ONGH 5IGXL 5IFJA 4B53A 2OTUA 1NUFA 2Y7QA 1WB6A 1XRPA 1JGLH 5D93B 1XKTA 1NSNH 4BJLA 1J87A 3HN3A 4TRPL 3MUGB 43C9A 3QJHA 2BGRA 4G8DA 4YXHH 3L95B 1ORWA 4A2LA 3WLAA 5EO0A 1UH3A 3O6LL 2C3GA 4PJDB 2IH1B 3HRHA 3MODL 2BXYA 5TQ0H 1MAAA 2BMKB 5FCSH 2O93L 2F8XC 3K46A 1R5VA 2O5ZL 4HLZH 1S7SB 4PJEB 2JCCB 1ZLSH 1SY6H 1NGPH 1Z9MA 3DWTA 5CHNB 5JW4R 4XI5C 1R9NA 4KJYB 3AS3A 1RUQL 4D0DA 3CH1A 2C5GA 4G8FA 5A40E 3ULVH 4N8DA 1EX0A 1TMCB 3H9HB 4OLXL 3EIFA 3QRGL 1IEAA 3MLXH 4D9LL 4NYLA 4KRMB 4LVHC 3ZZ1A 4NQCE 3ZSTA 4ZOAA 2PXYA 1NGYB 5F1NB 1ZGLP 1O7SA 1X5XA 4OCWL 3WJJC 4GAJH 4TTDD 1A7PH 3MRGA 1DBMH 5DFWH 4Z77A 2YEZA 3SE3A 1NCUA 3VFNB 3P0VL 4TNVF 1G7MA 5CUSL 2ZKHH 2C1OB 4RCAA 3F6LA 4I48A 3PDCA 4PSUA 3QUYD 4OZ4A 1K3IA 1KF9B 1HHIB 5EIAA 1I9RL 5D1XA 2DWEB 1OP9A 4J4PD 1LGYA 4B6GA 1N8ZB 4N1CA 1A0QH 5D71L 1NCBH 4C83B 4QY8A 1RU9L 3L95A 2Z4QB 2D31B 1WB4A 3BPLB 4C89A 5FCUH 3DXAB 4WGVB 3WKAA 2CGRL 3H0TB 4BP9A 4G9DA 4JDTL 5AUMA 1YN7A 1T1XA 3YASA 3OKNB 3MNVA 4X9GA 4JRYE 2H2SD 2BKLA 1YYLL 3BPCB 2W6CX 1C5CH 4NC1C 1VKHA 4NO0D 5K59E 1D5IH 3PDGA 3QWOB 3CCCA 4X5WA 2A6DB 4J3SA 4MLIA 4Z0XB 3JV5A 3GSQA 4LKCB 4UAOB 3C6YA 2H9GB 2DDQL 2P43B 4D9QD 4R0LB 4FQLH 3O9WC 3HI1B 4KDVA 4M61B 3QFDA 4PYGA 3P9LB 3PUHA 4NWUH 5HYSB 3BDYH 2C58A 5BVJB 5FA3A 2MQ3A 3C2AL 1THTA 2PBLA 4FNGA 2E3VA 1CVLA 2YXMA 4EZIA 4DFIA 2VLKE 1DE4B 5E4TA 3MBED 2D7OA 4KKBD 2IPKB 5KANG 3CJJA 4QKXB 1UJTA 1F3JA 5C0JB 5C0AD 1FO0H 3KPQB 1ZT1A 3IVMA 4GBXD 5ALBL 3BRFA 4JZJC 2X44D 4AY0A 4IH9A 1VCAA 3UYRL 3WFZA 3QEQA 1XZIA 3LS4L 3PF2A 4HWBL 3HLKA 3CX5J 1C7IA 3WE6A 3KDMB 2FWOB 4XP6H 5K9QG 3QO1B 5KN5B 4JFFD 1F3DH 1RJYA 4U6VL 3UDWA 1S7XA 2V9RA 4UOW0 5E08L 1AE6H 1NAMB 2Z8VC 1UVQB 3UTOA 3FSGA 3VXNB 5FM5M 5DYWA 3SE9H 4UTBH 5F8QC 3OGOE 3VRLF 1GVIA 3RIFF 1D9KD 1Z0MA 1M6OB 3CC5A 4D0BA 4LP4A 1BP3B 3VXMD 4LSVL 1IT9L 2IAMA 2F54D 1WIOA 1W72B 1IQDA 4A16A 3VI3F 2OK0H 1I9IL 4OF3A 3WIFB 1UCBL 4BFIA 5CGMA 3WIIH 3B3QA 4QXGH 3QBJA 3JTTB 2GBGA 1ZOXA 3EYOB 1N2RB 3LQAH 2XMCA 4PUBL 1UWXK 3VGDA 2XWJA 2FIKA 1ZGCA 1WBYA 4XWGL 3IA2A 1PYWA 4FQ2L 5GS1B 1NMBH 1DQML 1XQXA 1DQQA 2B0SL 4FXKB 1IGFL 3IAQA 5I1HL 1G7PA 4NQED 5INDA 4BCDA 1IM3A 5HYJA 1K3ZA 5SX5K 1EDQA 1FFOB 1MFAL 2JGFA 5T33H 3QQ3B 2QM0A 3FQXA 4CG2A 2G63A 4TVSa 3K2MC 1KU6A 2CKNA 1X70A 1SVZA 2GK2A 1RJZB 2DIAA 5E4EC 5KAQG 4J7AA 1V3LA 1NDGA 5IVZA 5DUBB 4C56D 3KWFA 2NYYC 1GGBH 1MJ8H 2CDFA 3DJ9A 3EYUH 5EBLA 4GDMA 1TVDA 1IAOA 4ODXA 3QO1A 3I3EA 4F7EB 4HXAH 3WNNA 3LIZL 2F19H 5KJRH 2IQ9H 1T0MB 2LE9A 3ECBA 5B38B 1HILB 3GZKA 4RMWA 2K3TA 4I18A 2J4WH 4MJIE 3FN0H 1OARH 4JO3H 3K80A 3WEXA 5IKCB 2HFKA 5K3DA 2H26A 3QHFL 5FHAH 2AXHA 4BQ9A 1O5DT 2XZCH 2BSSA 3ARQA 1KXVC 8FABA 4OBRA 4PRHA 4MYDA 4ERSH 3KLHD 3B43A 4X5XB 3O6FD 2DQCH 2EDWA 4JDZB 1K8IB 4MD5B 4BKLA 3RPIB 4QEKA 3U0TA 2ZOLB 4UIMB 1AZWA 4KK5C 4KDTA 3H0TA 2MCPH 4G9DB 4PRNA 3QB7C 3MCKA 1K2DB 1MHPH 2V9TA 1KJVA 4KQ3L 1A9BA 2YC1B 4OD3L 3TO4B 3STXA 1YA8A 2FD6L 2B0SH 3VWJD 2Q8BH 4EVNA 3HAEB 4PJ8D 1A6WL 3SJVD 4GXVL 3MRFA 1FJ1B 4R4NC 4Y1AD 4F2MB 5JW5B 2VT7A 3BH8A 3D85D 1MO2A 3IGAA 5EUOB 4QXGL 1IM9D 2WTMA 5DRZA 2HG5A 1YYMH 4UFNA 1DQLL 3IJYA 5KWIA 1F3DJ 3KPSD 1EHLH 4G4JA 1F97A 4P3CL 5DQJB 1WTLA 4HFWB 4KK6C 4P5TA 3P73B 3HNTL 3D39A 4RA0C 2WJ6A 2F5BH 1BN6A 3GHEH 2YXFA 1GGVA 3NACL 3A6ZA 1LEGB 2ZCHL 5BJTA 2X76A 4R4FL 2VJCA 2OJEB 3QUXC 4IOFD 4XMLL 1ZT1B 1SEBA 1CEXA 3SGDI 5FO7A 2DQEL 5KSAA 3TA3C 1KLFA 1J5OL 2O5XH 5FXCH 4DOHB 3NGMA 2WWKO 4I3RL 3T0XA 4X3CA 4QWMA 4OCLC 4PJ9C 1S9KC 5EC2B 2QR0A 3ARGA 3RX8A 4KY1H 3BZEA 1XH3B 2IANE 2KH2B 5M94B 1BZQK 1FFQA 1QSEE 3LSOA 3U7WH 5GRXG 1BBDL 1LNUA 1RIUL 4RNRB 4I0PA 4PLJC 5BVPL 4L9LC 5F9JB 4EN3B 5CCKL 1S78D 4PB9L 1ZA3B 5EU5B 4R3SA 1QO9A 4HGKC 1FIGL 2AEPH 1P7QA 4HS8H 4NZRH 5MI0C 4KXZH 4NDMA 4AIZB 3HC4L 1BU8A 1EK2A 2IC2A 1FN4B 3PWLB 3F62A 4HUUA 5IK3B 5GGTH 1UXOA 5L7XL 1MHEB 4N9GB 1LZKA 5AM2A 3AU1A 4XC3L 3QZUA 4DWHA 1T2XA 2R2EB 1KPUA 2J7LA 4KMTH 2JIDA 1MF2L 5HHOB 3MA7B 4G80B 4WFKA 4NHUA 4JZNB 3FQUA 4QXTB 4JKMA 2HG5B 3BJLA 3RWFA 1AC5A 3WKBA 4WU5A 3DSFH 1BIHA 3MACL 1HQRA 4PJHB 1I7UA 5BS0A 3WWPA 1MY5A 3EZ8A 5YASA 4L72A 2CGRH 1QO7A 2OCIA 5EIEA 4HEPG 4OGYL 4JQIH 1ZD5A 4KI5D 3BT2H 4OF8A 3RDTD 1CFQB 4LGSB 1NCBL 1GGIH 3KXFB 2H1IA 4NZDA 1QD0A 1VFMA 3IDIA 1P4BH 2OJZH 4PJGA 4PRIA 3ARBB 3GFUA 3B8SA 4BTLA 3BEVB 1QFUH 1T5WB 2HFEA 5AZEH 2AJBA 1VB9A 5GRVK 3ULUD 1XLWA 5EHZA 3CMOH 3O4LA 1CL7H 4HH9A 1OCWL 1QIGA 4FFWD 4NQDB 4GAGH 4YHIB 3KPSE 1HHHA 5JANA 4RNRA 2DQFB 1AQDB 4XVTL 4Y2XA 2UZXB 3JWEA 1ORSB 4R97B 5CBEA 1I3GH 2XXMB 5ILTL 1ACZA 5M7QA 4X7SH 4FXGB 3MV7E 4ZFGH 4ZFFA 5T4HA 1MCNA 4Y19A 5D7SH 4K7PL 1B3JA 2PTTB 4ZAKD 4FOMA 3MSPA 3PQYB 4LMQI 2XI9A 2I07B 4MNHB 2DQHH 5DUPH 2VZVA 1QRNE 2BDNL 1EINA 4JFDE 3FYUC 1T1WA 4NRYB 3UZEA 3QIWA 5SWZB 2QHRH 3A0OA 3VFVB 5L6YL 2JGLA 1QSEB 5DUBA 5CT4A 2R23B 4X91A 5HD8D 4KV5E 1TK3A 5DO2C 1NCAL 5HHVH 1AP2B 5AOCA 4DN3H 5ESQA 3B9AA 4FFYL 5I66B 2HFFA 4PGEB 1IQWL 1ZGLA 3AFIA 3T77B 3FO2A 1D9KB 3ZE0F 1WPXA 1Q9WA 3V4PH 4XNMA 1K63A 1JVKA 4FBMA 4GBXB 1NSNL 2YPLB 3V6BR 1KC5L 1N6VA 4JO2H 3PJSB 2MCG1 2VAXA 4YGAB 12E8L 3EFFB 3IYLW 2J8UE 2Z31A 3ARDC 1A5FH 2IALA 4NNPL 3HMXH 3C5ZD 4HQQH 2AXFA 5F7YC 3RL1B 4KZEL 1CV2A 3G6AA 5LZ7A 1WF5A 3O4OC 5AICA 3CCHB 5ALRA 3JV6A 5EU3B 4GW1A 1EAPA 1OAKH 3QAZC 3ALPA 2C1OA 4JUIA 1XGTA 5DGQA 3LKRA 3MUHL 2ICWJ 1GPNA 4KJXA 4G9FD 4YEEA 3A2NA 4HAGA 1LEGA 1J12A 3VWKB 5BJTB 1B9ZA 3WS3B 1YA4A 4P4KB 2R1XA 4MSWB 1XQVA 3MLYL 4WJ5A 4P0DA 3MCKB 2H2SC 3RGVD 7FABH 5C8JB 3WYNA 3W9BA 1F4AA 3FT3B 4JPVH 2EZ0C 1TZGH 3G5VA 2PTTA 5CD3B 4GRWB 4P2RB 1JT2A 3MYJA 5JZSA 1I9JH 1UXSB 5IVNA 4U1JB 3NN8B 3KXFE 4QWWA 3MV9E 2PO6C 4LBEB 1DVFB 2F9BT 4PLNC 1H15B 4JG0H 2W60B 1OP3K 5KVMC 2NY2D 2JCCE 4P3DA 2RBLA 5JDSA 4G5XA 2IMMA 1TENA 3IUMA 4KK5D 1KIQA 4IHOB 2C1PA 4A23A 1MY7A 4WO4B 4BM7A 3QPDA 1Q0XH 1V3KA 2ZJSH 1OP5K 2M8XA 2XQJA 3WDIA 1KV3A 4ZFZB 3K4DA 1I1YB 3QWRA 5DK0A 2W91A 1U41A 3E3QC 1NC4D 2GFBB 1R24B 1UXWA 4HK0B 3EDDA 3R06B 3SGJC 4MX7A 3HAEH 2OPHA 3QNXA 3Q6FB 4X6YA 1WFNA 1AO7D 5I2IA 3U2SB 4V1DA 5DYTA 1WFOA 3BF7A 1KXTB 5HHMB 3SQOH 3KR3H 4WIQA 1WOMA 4JEIA 4L3EB 35C8H 4OF6A 4P46A 4YO0B 1L7AA 4OLVH 2FYYA 2E7MA 1N0XL 3LCRA 3EHBD 3HI6L 2FJFA 4R7DB 4IRSB 5EIIA 2FX9L 1DTEA 2NXYC 3MUZ1 4WO4D 2AJSL 3RWHA 1ACYH 1RIHH 2J8UA 3L3GB 3K8KA 4YAQB 1SEQL 3S8YA 3T3PF 1CU4H 4ARBA 3QDJE 3DECA 5BW7A 4TOYH 5J9PB 5C2BL 4RZCA 1ZI9A 2VE6A 1UB5B 5E95B 3H2IA 5ALFA 1RUPL 3HB3C 3PP3K 2ENSA 2OMNA 4KU1A 3BEWA 5DJAB 1AO7B 1IAII 3RTQC 3TO4C 1ZOIA 3FHAA 1QQDB 2P42B 4FFVC 4EDXA 1DR9A 1FE8L 2DM7A 3P9LA 15C8L 4IMKC 1KLUA 1B90A 3ZE1F 4FFZL 1P1ZA 1R3HA 3E0GA 4KQ4H 2IQAB 4PJ9A 1IGYA 3OPZL 5GS2H 3EOTL 4YIQB 4LXIA 2AJUL 4AEFA 2IANB 2WBJB 2BDNH 2OGTA 3G6JB 4PJIE 3V5HB 4RWYH 5I15L 1DLFL 3BP7A 3E4DA 1HHGB 2VO5A 2EO9A 1KBGL 1FZMA 1FNGB 2CUHA 1BHGA 1DWPA 3IAGC 4F15B 1DFBH 3U48A 2ZJ6A 3OB0H 1FG9C 3H2HA 4ZGBA 1MNUH 1I85C 4OV6F 4YX2H 1ZD4A 4POYA 3KS0H 4OUOA 2NYYD 4G3YL 4O02L 4JNCA 5LGKA 5MERB 3OKLB 3BL8A 4LLDB 1OSPL 1XIWD 4X4XB 1RY7B 1OWWA 4BUHA 4WUUA 3ILQD 2MWCA 5E8NA 4BUGA 5J8OA 4XVTH 2ZUUA 5CJQH 1OAQH 3VFTB 1J0JA 2AERT 3BYTA 3G0BA 1F4XL 4GAGL 4TULL 4JFHD 3NA9H 4PS4L 4LQFH 1OPGH 2ICCA 5E5MA 3UUFA 1BQHB 1HKLH 4W81A 1N2RA 3G0GA 5EZIH 2EDJA 3SDXB 4JB9L 3T2NH 1UT9A 1MRCL 2Y6UA 3BSZH 2DQUL 2DQTL 5ERWB 1AFVL 1CG9B 3AM8A 4FQHA 1DQQB 2XN9B 2I3DA 2ESVA 2BSRA 4QRSA 2EDFA 2XWJB 2VQUA 1WBYB 4JHAL 4PJ7E 5H37G 5IVXF 5JZ7D 4V1DE 1ZHBA 4TQEH 5AKZA 4J3WA 4ZOBA 4Y2DC 4HPOH 4DVBA 5I1IH 4CVZA 1T5XA 1LDPH 2NZ9C 2DJSA 5HFAA 1ZWIA 1GAFL 2IEPA 4PP1C 2AW2A 3GHBH 1S7TB 5ALPA 1CICD 3O4GA 2EH8L 3TBTB 3U79A 5B8CA 3I2GA 2XG5A 1W72H 1Y6KR 4Y4FD 1ZGLB 3CXUA 4J0CA 4Z7WE 3TT1H 4BH8A 4X6DA 4FRWA 3RL2A 4Z5RB 5IMOB 3OKKA 5E6IA 4QHUB 1WZMA 4NQCB 3SJVB 5C07D 4D9RE 3FLAA 5LG1A 3IF1B 2CR3A 1QIFA 2E9WA 4UHHA 4OSUH 3IDNB 4JO4L 5D1QA 5FUZL 3P2MA 2ENYA 5KSVB 4G8GB 4N8CL 2VXSL 4PB9H 1G9NC 1MSPA 1QFWH 2HJLB 2VIRA 4GG8B 5TFSH 3GKZA 3QSKB 3LKOA 1BJMA 2A73B 5F7KC 4Z7UA 3QXTA 1Q9OA 5KVFL 5AD0A 5DS8B 2YD2A 2VNCA 4N9OB 1SM3L 4PRHB 1F0PA 5I30L 5EH1A 1XZLA 3T2QA 3QYJA 1MIEL 5I2IB 4XZUB 4V1DB 2XQFA 2J88L 2EH7L 3WUWA 3QA3B 2IJ0C 4DN4L 4X8JB 4XIIA 1HCVA 5IESH 1OL0A 4Z9KB 4G8EA 4YBLB 5TJWK 1NGQH 3TBVA 3E0XA 2F5BL 4YE4L 4L4VB 3OKYA 4X6BA 3S7GA 3PICA 1T21A 1T22A 3FFCD 2VRAA 5D9SB 3WK5A 4PRNB 3NGBB 5T5FL 4IOIB 3T0AA 5F21B 5FKAA 1U8NA 2ADIB 2ED8A 1UKBA 4ZREA 3E6HA 1I1RA 4EY7A 3X13B 4Z8FH 5ADOH 5EFZA 2C0QA 5E99L 2K1MA 2EDTA 2W92A 3DROB 3QCVL 1X3DA 3OKKB 1CTOA 4XHQA 2R1YB 5FM5O 2GIYA 5DRZB 3LRSA 1JBJA 2Y5TB 1ZVSA 3DDUA 4KAAA 3QUXA 3AS1A 3CFJB 1P4LB 4MHHG 3BQUC 2X4RB 4OZIF 1QQDA 2XMDA 2HA6A 1AD0A 2IBGA 4JFOA 2EDCA 1KELH 1ZGLM 4Q6YA 4P23B 3OJ2C 4XCCL 1S7RB 4AMKH 2PW2B 4NPYA 5DD0L 2VZ1A 3O3BB 1JZ8A 3QIBA 1RZFL 1G5FA 5IB4B 3MRIA 3C60A 4PJAB 4GEGA 1IC7H 3VFSA 4X6UA 3RWFB 3FCYA 2IBZY 4LRNH 4F60A 3GJEB 3KPOB 3OR6B 1CUEA 3MV7A 1YEIL 4IIQA 4ZNEA 4DVRL 3QDGA 4PJCF 1ZS8B 3ESUF 3HLAB 3MRRA 1E4XH 2QSVA 5J1AB 4Y9SA 1OM3H 5EO1B 1URLA 4FQJL 4CMHB 4PJEF 5FPPA 1XCQA 4W70A 3BZEB 4I4CA 1UCTA 5IW6B 1QRNA 4LPCA 1A8JH 1P7QB 4RAVA 1ITBB 3RZCD 4ELMF 4XRCB 5I73B 1FV1A 2JIXD 3O6FB 4HXAL 3KDAA 1D6EB 3KPTA 1IAKB 2ADJA 3CAFA 3P30L 4GW4B 2F53A 4DKEH 4LPUA 2VXTH 3FQWB 4N1EA 2WIKA 3R1GL 2DQFA 3W9EB 4L8CB 1SY6A 2NQCA 4R4BB 5LXGL 4JR9L 1X5LA 1KJMB 3QDAA 3VWJC 1U3HA 1L6ZA 2VTFA 4YNYB 5IWLA 2YWZA 1LHZA 4JM2A 1MRFL 2VLRE 5FM4A 5E9DD 3RWJA 3X17A 1UK9A 3GSRB 3QT2A 2PTVA 4NJAH 3LQZB 3TV3L 2MQCA 4E41D 3H2WA 2NY0D 4ENEC 2V17H 5ALUA 3HRZB 1UWEL 2NMSA 4LSTL 4Y5VB 5T1KA 5DMYA 3D0LA 3DSNA 1OTSD 5D93C 2CLRA 1HWHB 5L0QC 1AC0A 4XAWH 2LFGA 1K6QH 4KVNL 1WFUA 2QBWA 5C0EA 4WDIB 1YS2X 3I6KA 5KBYA 1MFBH 3LQAL 2DKSA 4IMKA 4Y4HB 1FFNB 5EZIL 3DNKA 3QWOA 5FK9A 1IAIH 4Y16B 5L8LB 4LSVH 4XX1E 1YMMA 2ZUQB 3CPLB 3EOBB 4YASA 2H7CA 3MRMB 4X8XA 2D0DA 3MV9B 1MCEA 1VEPA 4U7KA 2BUAA 3QJHB 1QZ1A 2IH3B 2MFNA 1ZLVK 4Z78B 5JOPD 4NNYB 3U7YH 1INDL 2OGZA 4EI6A 4OZGA 4HEME 3FN3A 1CRLA 4PYHA 2R39A 5JATA 2IALB 1FL3B 4QF1B 5AK4A 2IGFL 4CCWA 3R41A 3NZ8A 4M7LL 1YJDL 1YY8A 5IW3A 1EDEA 1KPRA 3SWWA 4FMKA 2NY0C 1KN2H 3BIKB 4AL8L 1BN7A 4EJ1C 1AKJD 1UEYA 1OW0C 5HDOA 5I1DA 1L4IA 3TCLB 3REWA 3RVXC 1FH5H 5B8CB 3HZYA 5L2KB 4L4VD 4Y5XB 2B4CH 3MX0A 4U6XB 4C4KT 3EYSL 4WWKD 3MLVL 3FYTA 5DSCB 3AMKA 4JQXC 1T2QH 2Y72A 4U1MA 1WAAE 5I71C 4P5MA 4JJ5A 5AKGA 1XIWB 5ITFA 3TESA 4R97C 3JWOH 3PFBA 5SWZA 4UUQA 1GRWA 2YSSB 1BEEA 4NKMA 3T77A 3JW8A 5DUML 1G0YR 3VXRA 2YK1L 3ZDYF 4F0JA 1AR1D 4HT1L 5C0BD 3H1BA 4U1JA 1QBBA 3I2JA 1TNNA 1T1YB 1N64H 4JGMA 4EN3C 3BN9C 4MAYC 2V17L 3KD2A 3OB0K 2VAVA 1CFJA 3B5GA 3O41B 4WHCA 4KJWC 1LK2A 1WC7A 2EYSB 2R2HA 4P3DB 1H3PL 5D1XB 3KS0J 1SEQH 2DLTA 1ODCA 3CFKA 4LNRA 5L2KD 5F9AC 1GJIA 2Z31B 1PEWA 1ZLUH 1XF1A 1LBSA 5TDOA 4S2SA 4CU6A 5KOMC 3MNZB 1GZPB 2VDOH 3U4EB 4OLVL 1Y7IA 2BVPB 3LKNB 3QWQB 4QRRE 3AROA 3R06A 2CQVA 4FMFA 4L3EE 3SOBH 1JWSB 5AKJA 4C4XA 4S1SL 4YQXL 1CQWA 5HDQH 5AOBA 3HFML 5JOFA 1QEWA 5DO2D 4H8WH 1ZV5A 2VL5A 3Q5YA 5GIRA 3F9CA 3VCLA 4XPFH 1FJ2A 2BUCA 2IWGA 2V2XB 1A88A 1AGCA 2DOCA 3JTSA 1R3IL 1U6AL 4LSRL 1U95B 3QXUA 1H0DA 3V5DA 1XZFA 3GMNA 2D0FA 5CH5A 1UK8A 4PJXE 4ZAKC 3ESDA 2WUGA 1FQ9C 2X10A 3RWCA 1KEGH 4NM8H 2K9UA 2GY7B 4FTVD 3SE8L 4S10A 4LPWA 4L9LB 4H1LA 3KJ4B 2VYRE 1WVZA 1QFWM 2EDDA 4JY6B 1DE4A 5DI8B 1KCRH 4JRXD 1UXWB 3WK6A 5JUEH 3FNBA 4QDTA 4OCZA 2P5WD 4LIPD 4XCCH 1IC5L 5F88A 4APQB 1WAAF 2DHEA 2DFPA 1U8JB 5FF6B 2XPGB 5ENWA 1WAAA 1SHMA 1WWAX 5AM5A 3OM8A 2DL9A 2MPAL 5K93A 3TH4T 1J05A 3LHPL 2CSPA 2XOTA 4XGZA 4AO8A 4P46B 4EDWL 2PU7A 1OGTA 4B0OA 3WWCA 2F15A 2UWEA 3PL6C 4A6YA 1KGCE 2C9AA 2DJUA 4X80H 1DEEA 2IX9A 3ZTJH 1DTUA 4OZHE 3P4MA 3S3SA 4HWUA 3MRNB 1A2YB 5D1QC 1A7RL 5AM3A 5ISZB 2FEEL 4U1HB 3X3GH 2ERJC 3KPLA 3QQNA 1UB5A 3BUTA 12E8H 2OQIA 1ORVA 2UUDK 3GA7A 1LO0H 3O3AA 3VFTA 1KC5H 4NOFA 4A2MA 2NLJB 4ZUWB 3DI2B 3KPMA 2FDBP 2V7NB 2Y5EA 4KTDH 2QQNH 2PNDA 2NY7L 3QDMB 4G6KH 2AV1A 4WW2F 3OHXB 4PTTB 3STYA 1E89A 1IQWH 4NIKB 4WI4A 5IJVB 3IJYB 2CIIB 4KHTL 4FDMA 3I2HA 1N6QH 3MOQA 5DEFA 1T20B 4XMPH 2BVQA 1FAKT 2RR3A 4UILH 4J7RA 2EKSB 1JRHL 4XNXH 3QIBC 3SQBA 2FX8H 1Z0NA 3MC0A 5MEND 4JZJA 3W82A 1WM1A 1FZJB 5C8ZA 4QYOA 5B39A 4Y5VA 1JGUL 5TFSL 3O45B 4KUZH 3RBSA 2GY5A 3FB5B 3FOLA 3V4VH 2PUJA 2VDPL 1EVQA 4N8CH 2OR7A 2BJML 4JG1H 4NN6B 1S9WA 3BQUA 1R5WB 4XP1H 2J3DA 2OP4H 5IBLD 2WUBH 4OQTL 4H18A 5EOQH 5KS9B 2HRLA 4M6NL 3A6BH 2E7HA 4ZPTA 4ZXBD 5K9JH 2E7BA 5ISZD 3S35L 2HFGH 1IGIH 2PO6A 1TNMA 1QBML 2WQ8A 5E8PA 1E6OH 5D1ZA 5DRXA 3BP5A 3LEXB 1UWCA 3IJSA 4UPDA 5CFHA 3FOMA 2X5XA 5HI3C 4TNWF 1CIUA 1OAZL 1YNLL 3RUGA 3RZCB 3H18A 3RWEA 3HXKA 4EN3A 1OWRM 1W72L 2YN3A 2WWMD 3G5YA 32C2B 3ARBA 3LB6C 3MA9H 3DYVA 3CSGA 4AEHH 5MEQB 1R1DA 1JZ5A 1CL7L 1M05B 1EHXA 2VJXA 2BFVH 3D4LA 1O7VA 2EYSA 4WFJA 4OCNC 3KLHC 5T5NF 4ZSOB 5LZ5A 4I0PC 2G75B 1LPMA 1HXMA 4JHAH 3R8QA 1DSFH 1YDPB 3BD3A 2MNUA 2A6KA 1Q94A 2VXQL 1JF1A 2D7QA 1DSFL 5CJOH 4U49A 1RK0B 3FB8A 3QR2A 1G0DA 1NFKA 2K7PA 3KPPA 4IBLT 5DJDB 4JVUA 4KACA 2CXKA 4UI2A 2Z8ZA 4OZIE 3VW3L 5BWBA 4N0FB 3ARWA 1EEZB 1T2NA 4N8VB 3L6FA 3M45A 3WA6A 5CJQL 2FCBA 2APXA 3KXFA 3QEUA 4GW5A 4Y2TA 5GGQL 4RRPG 3IVKA 5IVKA 4G8FB 4BQCA 4PBXA 1F3RB 2W1NA 4RAUB 5JAOA 3IDYC 3S35H 4NQCD 4QHUA 3L7FA 1MCLA 1OAUL 4LPXA 1J8HD 5KN5A 1V7ML 4JZOB 3HAEG 2NY3C 1MU0A 3DROA 2JJSC 4PLKD 5JOEA 3NFPA 1E28A 4XP5L 3CFCL 4OFIA 4FNMA 1BBDH 1RIUH 3C5ZC 5J12B 3VG0L 2AJUH 2WUDA 1LWRA 2B2XL 4M4PA 3E3AA 1UOPA 2MOVA 1GQSA 4B84A 4KQ4L 2WFLB 3PGFL 4GWLA 1L7RA 3RVVD 1EK1A 2P8PB 1MREL 1I6WA 1N6QL 1P9MC 2W9EH 4YDVA 1AQKH 3H6JA 3MMEA 3PQYA 1NGZA 3U82B 1WPRA 2NY7H 2X4OB 3TBVB 3T0DA 1YEJL 4M7KL 4PJHE 4R26H 1KYOK 1RUPH 1FFAA 1DDHB 1NMCB 4HGWB 1MFEL 5EBGA 3VXOA 3PHSA 1U58B 3QEQE 3ZYZA 4X97A 1WBXA 5HQ3A 2Q86A 4OZGF 1EFXA 4N5ED 3GMNB 4MNQE 3BXNA 3IDGA 3S97C 1I7ZA 5T1LD 4MCYA 4U31A 5ESQB 1NCWH 4QXUH 5D7JD 4ZUVA 3HC0A 5E00A 1UM4H 3W0WE 4INZA 3MRGB 3L9RA 1KTDA 1LGVA 3CX2A 4HWZB 1U8NB 2ADIA 4XH2B 1XLVA 1MHEA 4HRYA 3O3AB 5LVEA 1CUCA 2BNRE 3IU4L 3EHBC 2XN9D 4CNIA 4RDQF 1LD9A 4I19A 5KG9B 2E5EA 3DV6B 3S6CA 3CZFB 4ZODA 4GBGA 3L3KB 2XTJC 4LGRB 1PQZA 4K6KA 4FXLA 4PJ7B 1WZ1H 1EO8H 1HQRB 3VXKA 4Z18A 1FPTH 3RX7A 1BECA 3DO7B 4NC0B 3NOIA 3T0EE 4NJ9H 1U8KB 3MXVL 2DL2A 4OZIB 3NFSL 4L3AA 3P11L 3WD5H 2HH0H 4HJJL 4PTUA 1C5BH 2KQMA 3C60C 1PX4A 4N5EC 5JZ9A 3GK8H 3NCJL 4G7VH 4N0RA 4MX7B 2FZ3B 4BZ2L 5DJ2B 2E3JA 5LQBH 1U91A 3O2DL 2J5LB 4YDIL 3MCLL 3GUTA 1KEGL 1BROA 4WI5A 1CK0H 3CNKA 4RGND 2B8OT 1A3QA 3QHFH 3JV0A 3BRDA 2AJLI 4Z0XA 3O4IA 1KENH 4E5XB 4H7HA 3A2MA 5FDYA 1EO8L 3BPOB 1ORQB 4LLVB 4LVNC 2V7NA 4P92A 1CS6A 2WK2A 4JPVL 1QRNB 2A1WL 4X4MA 4DNQA 2HLAB 5C0FB 3UP1A 4DZ8B 3MV8D 3V6OE 1DUYA 4U05A 1CXEA 3SOBL 2R4SL 2CMFA 4P08A 5EHQA 2FR4A 4FQXD 4U6YA 1I1YA 3RAJH 2XZAL 2AEQH 1U3HB 3BEWB 5DJAA 2WSLA 2AJVH 2XUDA 1VDGA 1FL3A 4QF1A 2RQ8A 3OGCA 5EIHA 4NRYA 1MH5A 4F7PA 3N50A 4PJBF 1J88A 5IEKB 4NQEE 4M43H 5EOCH 3ROOA 4PGJA 4BZYA 2OTWA 1AP2A 5F3HA 1NMAH 2R69H 3HUJE 2WBJA 3TZVD 1AQLA 1S8DB 1A6TA 2HDWA 3BP7B 3PWVB 3P9MB 1R0AL 4Q9QL 1THGA 5EU6D 2D9QB 3GO1L 4LDLB 5ALCH 4Q7DA 2AK1L 3D3VB 3GMRA 5D1XC 5KSBE 5C0EB 3ULVE 4S1DD 3TEJA 3VJMA 1T2QL 1UM5H 4N5UA 4C01A 3NPSC 2CRZA 4OIAA 5E8EA 4FP8H 5DDHA 5J56B 1A7QH 3THMH 1N6UA 1F2XK 4FTWA 3LSOB 4ODTL 1QPXA 5E4JA 5B38A 1OGAB 1PFCA 4HWEL 4JDVB 2NX5A 1WWCA 1PYWB 2BCKA 5ALJA 2I60L 1MCCA 2J1KA 3QISA 4WW2A 5I1LB 3T04D 4GMSL 3FYUB 1FFRA 3FO1A 4OGZA 2NW2A 3WN5C 3FB6A 5IK3A 3BKJL 3AUKA 1YPZB 4Y5XA 4MEBA 4LIQH 4JY5L 1I3UA 1NANH 3GBMH 3KLAB 4N0UB 1NX9A 3TCLA 4ISVB 4K3JL 3VJ6A 3SKJH 5IB2B 2V2TB 4HGWA 2OI9C 4NHUB 4IS6B 3CMOL 4PJ5E 1ZI8A 3O0RL 1FSKC 2CZQA 4X4ME 3I3BA 5TF1H 4BZZA 1ZEAH 4RMRA 4GRLA 3C2AH 3RIAK 1I7UB 2HU5A 3TO4A 1MFBL 4KDWA 5LCVH 1NQBA 2RJMA 4F33B 1MHCB 4NWUL 5GS2D 2Y1VA 2FJ0A 1IEAB 1KTDB 2YPKA 4ZSOE 2A38A 1P6AB 3GRWL 4JQIL 1TVHB 4ZUSB 4GSDL 5IIEB 1XRLA 1RPQA 3VRJA 1NBZA 1SYVB 2PR4L 1BEYL 4YHLL 4AMYA 1ZIYA 2G5BB 3WMSA 4JQXA 1X5FA 5DLMH 3PG2A 4AEHL 5C8XA 1U8IA 3LMJH 1TCRA 4MS8D 4UBMA 4FQHB 1FFBA 4LCUB 5AIAA 2L7UA 3QITA 4LAQH 1DQJA 3R4DA 4K94L 1OAZH 1YNLH 4FQQA 3O3DA 4XBGB 5FUCE 4L8BB 5L7XH 2CUTA 3M07A 3D69B 3MLUH 2VXTL 5HF9A 4HMDA 5IV2A 4UT7L 4TNWK 4QRRB 1I1AD 1PG7L 1UWGH 1U91B 4NZTL 1HZHH 1N5AB 4X6CA 1I9RH 1NJ9B 1MWAL 2X4PA 4KUZL 2QJDA 4RFEB 3UJTH 3NBNA 1A21A 2FX8L 1T1XB 2VN7A 3WIHA 4LHUB 5DWUH 4O5LL 3RWCB 1AXSA 2EC8A 1T21B 2IPUK 1T22B 4OFDA 3UYOD 1QIDA 1H23A 4TVPD 4DVRH 3EAKA 1AUOA 1J5OH 2Z8SA 4GAJL 4ZO6A 3EDEA 4IRJB 3BXPA 1Q1JH 2R2BA 4PO3X 4TUJA 3L3KA 2W59A 1YECH 1WIUA 4XX1G 4ZD3L 4HIXL 4YIQA 4CDHA 3MLXL 3FT2A 2HTLC 4WTZG 3LKPB 1RWQA 3G5XA 1CD8A 4ARAA 2PYED 4UDTB 1R3KB 4NRXA 4ZDHB 3KHQA 1TIBA 3AGVA 4HG4K 1DX6A 1OTUD 3OZ9H 4GKZB 4X6DF 4N68A 1NC2D 2I9LB 4H26B 1HYRC 2NW3B 4G8IA 1AY1L 5F9OL 3ROOB 4U1SB 4MQMA 2H6PB 3V6OC 1UZ8B 5DJCB 3QG6A 4DGIL 4M7ZC 3KPRA 5IG7A 3QCVH 2IBZX 1R5WA 3O6LH 4M8VA 4PJIA 3P4MB 3CZJA 4UBKA 1OAYL 5JMRA 2MPAH 3K6KA 3MRNA 4G4GA 5JPNA 1FYTB 1MHHA 5EU5A 3BW9A 1GOFA 3UAJD 3E6FB 4JHZA 1IC5H 3GSQB 1UKSA 4LKCA 1D5MB 2GT9B 1RZ7L 5D8JH 5SWSB 1MX1A 2ZUSA 3G9ZA 2BVYA 3D3NA 3QZWG 3ARFC 1KCRL 3CDGB 3L3OB 4XWOC 1OQXA 3MYJB 5C0GB 3UJIH 4NQDA 5I8EB 2ZCLH 3OHXA 2ICWB 4LSPH 2J88H 3WHXB 4N0CC 4ZQKA 1YEFL 1YPZF 1MJ7L 4J3XA 4ERSL 4HIJA 2O5YL 5J4MA 4UBDD 3L5WA 2NXZD 3EZJB 4F7PB 3WO4B 1NLDH 3ZHKA 3S37X 1ZHLA 4LEXL 4N8VG 2HT2C 1HINH 2PVSA 1VFBB 5C0NC 2OR9H 1MI5E 1NKRA 3QIUC 3DL4A 1QVOB 1S9VB 2H32B 4NM4L 5D2LA 3MREB 4KI5F 2VDLL 1F3JB 2R8BA 1YNKH 1FNFA 2FLBT 3KLAA 4N0UA 1SCKA 4WFFD 2YZ1A 1X9QA 4LASL 3QM1A 4X6CE 5LIPA 3MRBB 3SDCA 1WT5C 5GS0C 4H20H 3D3VA 3GMRB 5GSRA 2FH8A 1CFBA 4YHYC 2VDML 4PJFF 1QONA 3FMGH 4BVJA 5ESAB 1GZQB 4E46A 2EYTB 4EI5B 1U0QA 4YXLH 1Z3GH 5JD6A 3RWDB 3TH2T 1F11B 2GTZB 2VSCA 2E7LC 1MCWW 2ARWA 3U30B 1H3WM 2ZSVA 4M00A 3MLZH 4HS6B 4MNQA 1CR9L 2A9NH 2AJ3A 2BNRA 3JSSA 4RISL 2J8UB 3L3GA 4YAQA 1CFSB 2EDRA 1G66A 4WW2B 2HA5A 2BGNA 4BATA 4WEMB 3I6MA 3MBEB 3HI5L 3W9EA 2NY2B 3GRWH 3VVMA 4HW6A 4RFOH 3L3OA 1HIML 2GITA 1QA9B 4OTXH 3FONB 5ELIA 3D25B 4L8SC 5AKYA 5E6ZA 4ITVA 1FNSH 5JORB 2DQTH 1LO4L 2X1WL 2GI7A 4NUGL 4L8BA 4PJAE 4Y2DB 5KTEH 4JE4B 3ME0A 4KUCD 1P5VA 3L5IA 4KAFA 1UCBH 2H1PH 1VEOA 4O2CB 1G6RA 5H2BB 3VFVA 4NQUA 1NGZB 5IHBA 1X4ZA 3IFPA 4HFUL 3D7RA 1U93A 5TE4L 1LEKA 1BVZA 4LHEA 3R40A 2PF6A 1W0VA 1CCZA 3MRQA 5F89A 4Z76A 3KYNA 2X70B 4F58H 3DYIA 3LB6D 5C0AA 4BZ1L 3LLCA 2CK0H 4Z49A 5EOTA 4GBXA 3V4UL 2GK0B 4M7LH 1UFOA 3LS4H 3TWCH 3MBXL 4LEOA 3K9BA 3WBDA 1T80A 2QJRA 4LLMA 4QDOA 2FHCA 1MCRA 4HUNB 4LNVA 4CJ0A 1BZ7A 2FH6A 2XZQH 3ANSA 3VFGH 2FJHA 2Y2VA 1LVEA 1UZ6F 4J3TA 2C7UB 5TH2B 5M95B 1JWUA 4L4TE 4KKBC 4HKBA 5HGGS 1G7IB 1LP9E 4PGBB 4KDTC 1A9EB 1HQ4A 4MSWA 2VXVH 2UY6A 2XLCA 1C1EH 3P73A 1JV5B 4WWID 3ES6B 3U1TA 3MNZA 3U0TB 3QQ4A 3P4OB 4JM4L 4GS7C 1WCQA 1YA5A 5DT1H 1S7QA 3CD4A 4OLUL 4RISH 4RFNC 1TXKA 3NCMA 1K5NA 3UTZA 4NQEA 1CD0A 1HDMA 1P69B 3BW9B 4PJBE 1EV2E 5FAAA 3VGFA 3GMQB 2D4DA 1IRAY 2EDXA 5C0CB 3CSYA 5CP3A 3HI6H 1J2EA 3WFBH 4U3CA 5C0RH 1I3RA 3MRQB 2H8PB 1UA6L 4HZAA 2VF2A 5DEGA 3K74B 4X6DB 5KVDH 1J1OL 4HUMB 5EZOL 2UYLA 3FMGL 4OZFB 5JTWA 1OILA 2EDYA 4NN7C 2M1KA 2OL3L 1WIPA 2Y2UA 1INQA 3FQTB 3S37L 3KYMB 5KG9A 3BZFA 2VABB 5KW9H 1G7HA 3AU1B 1MAKA 4U2CA 4NM4H 5CEZD 2ACKA 2H41A 1IM9B 4UUJB 1QFPA 2WHRA 2SEBA 3OGCB 2YBRA 4JZNA 1JWSA 4JM2C 4LEXH 3TVMA 2BMKA 5I1GL 2EIBA 1EIBA 2H7YA 5AM1A 5C0CD 4OF0A 3WFHA 4YFDB 1FFEA 1CIDA 1SYSA 4BZ2H 4OCWH 1I75A 3Q1SH 4WCYL 5BS0B 3SCMB 1PY4A 2ZCLL 2HH0L 5DJ8B 4WV1C 4QRQA 1AD9A 1I9JL 3EDKA 5DFVC 1SC9A 4PGCB 4WO4C 4XMKH 4M0FA 3NCBB 1Y0LA 3R3ZA 4HCRL 1RZ7H 2BSTA 1RUQH 2FEDD 5D8JL 4R3SB 4YEFA 5LZ9A 1FZOA 5HGDA 1A22B 1JU4A 1RHHB 1KACB 5IQ9B 1FGVL 5I1EL 3U7AA 3PGDA 4L8DB 4JFHE 2P24A 2RIPA 3ESVF 3MLYH 3EQ8A 3EFDL 4JGJA 5DMGC 5E1HB 2XUGA 1KPVA 2ZUTA 2GAZA 4F80A 2J4CA 4Y5YC 4QCIA 4PJ8A 3ZLVA 1BOYA 1G7MB 1F6WA 2HIHA 3ANTA 3DETC 3F7PC 3MREA 4G80A 3QFDB 4Z8FL 2JLLA 2OCKA 1MFCL 4M5YL 1XZ0B 2ICES 4QGTA 1MJ5A 1A4JB 3F8SA 2DIBA 3HMXL 5L2JB 4NNPH 3FB6B 5IJKA 4GQ9L 2FRGP 3MRCB 5KSUA 4XGZB 5E6YA 2A77H 2VABA 4XBEL 5HJ3B 3C6BA 1A6TB 3PWVA 2QQLL 1CBVL 1WZLA 2G2RB 4HIXH 4X6FB 3VE0B 3UTPD 2P48B 1X7QB 1LPAB 2ES4A 5AUMB 4PJHF 1FCCA 1Q1JL 4KPHL 4I18C 1IEBB 3FLEA 4RA3A 3SEPA 2P7TB 4XPTH 2HA1A 5ALXA 3CVIL 1MQKH 4K8RH 5HHVL 4GRLB 4U1HA 5TQ2L 4IQ4A 3VXSD 1YEGL 1JP5A 4QDXA 2QKYA 3STLB 1RJYB 2XWTB 1QRKA 5ECJE 3UJTL 1VKXA 3DXAE 2DQHL 4O9HH 2VXSH 1GC1L 2VZOA 2PW1A 1NEZG 2BNQE 1HKHA 2V96A 1RJCA 4JREB 1FV1B 4NFBA 4Z7UB 3KJ6H 4AT6B 3FO1B 3M83A 3OR7B 1QNZL 1RHFA 3B2UC 4GMTL 3P2TA 3QPXL 5FO8A 4YJZL 4Z7WB 3B83A 1KB9J 3HS0B 1RULL 4PY8I 4F5ZA 3FQWA 3I9GL 2FIKB 5LKRA 3WJLA 4UZGA 1MJJB 3UTSD 3GHBL 4YDKH 1XZ0A 3RNKB 5I8OL 1MCBA 5DLML 5JW4N 4AO6A 3H7BB 1E4JA 4NCC2 5E6IB 3TNNB 5SWQB 5BCAA 4HPOL 3WJLC 4TQEL 3VGGA 3T4AB 3MRCA 1MIML 1XF4A 3RWJB 4WW2C 3D0VA 5JIIA 3VFUA 1VXOA 5ESVB 5HHPA 4XVSH 1MAML 3DIFB 4ZV7A 1JGEB 2OSLA 1FCGA 4NN5C 4XVSL 2DQUH 3BT2L 1CF8H 3ZKXC 4UNUA 5HHNB 5C7XL 2DMKA 1NBVL 3QNZA 4WTXA 2AK4A 5A2GA 5BZWA 5I8KL 5IVIA 2P8LA 2IAMB 3DSFL 2BFVL 4WVRA 2Z35B 1R3JA 3TJMA 4LYEA 1X2EA 1ZI6A 4YWGH 3HMWH 3GBML 4LIQL 4EI5D 2HT4C 2WUCL 4XC1L 5MEOA 4KR0A 4CKVX 1N3NB 5T1MA 2ILLA 3SDAC 4RBPH 2WBJC 2SEBB 4GMTH 4Z7OE 1YEKL 3C8DA 3TYFA 1R5IB 5EZJB 5J3HC 4IIQC 5HHQB 3NMEA 3SCMD 3QUKB 2DLGA 1I8LA 1KB5A 1B4RA 3C08L 3AZPA 1EEZA 3RNQB 1FIGH 2AEPL 3BIKA 1RI8A 3DUHA 2R56L 3MQIA 3MV7B 4JPIA 2F5AH 5J11C 5T4BA 1JUFA 2X4OA 4ODTH 1TJHL 3E6HB 4P9HC 5BVPH 3HUJF 5J6GB 2AJ8A 2A6IB 4Y89A 1ODAA 1I1FA 3DTXB 4HXFB 5I18L 2VAAA 4GO6B 4JFPA 4XMPL 2R4RH 3D3VE 3QIWD 1FFPB 1NFDA 3WI7A 4P5MB 2BZDA 2R1WA 3TFKD 3C9NB 4OFKA 2APBA 4QOKE 3IDJA 2YZ8A 4F3FB 4JN2B 3QMVA 3NFPB 4QOKB 4R4FH 3IU3B 4HIIB 3BGMB 2HKHH 4W68A 2XI4A 4S1RL 1PZ5B 4QGYA 4EHBA 5EUOA 1L7TH 2LVCA 2RHTA 3U9PL 3K2UH 1U2HA 3KPQA 2VLRA 3ZWQA 1WC7B 3EO9H 3ARDD 4P3CH 3HJUA 1WLHA 3FTGB 5J57B 5EWIL 5D70H 1A7BA 3GJEA 1NCDH 5CZXD 1LEIB 4H7IA 1QVOA 1S9VA 1MFCH 3QG6B 4Z95H 2XZAH 2FL5B 4MJID 3SDYL 1I4FA 1JNLL 4NO3B 2VDRL 4OZFH 4XPAH 3VJLA 4UIMA 4X6FA 1XZKA 3IUNA 4M6ML 3STUA 3U0WH 1T1ZB 1VPOL 3RWHB 5JXAL 1AXIB 3GSNH 3B9KB 5GJSH 3WNOA 1LE9A 5GJTH 3BIBX 1R88A 4HRXA 1CUHA 2D7PA 1FFNA 2W0PA 3DXAA 2WIFA 3GJFB 3K1KC 2ADJB 1RIVL 4XMKL 4L1DA 4ZAKB 2XKUA 4K3EL 1Q9LA 3H19A 3EJYD 4B0MM 4UT9H 1FO0A 1IARB 1OT1A 3AJAA 3BJRA 4XXCA 3VG9B 2P45B 1MLBB 3ESBA 4PGDB 3WL6A 4LLUA 2BNRB 3A6OA 3JV4A 3UTTD 2QUAA 4QWWD 4HBCL 4JJHA 1PX3A 3SDDC 2O2IA 2OXEA 3BMWA 4HJJH 3STVA 1M4KA 3C43A 2EIZA 1JIBA 1JPGA 4Q6IA 5D6DC 1KLGA 4LSRH 4ZYKB 1U6AH 1K4CA 3T0WA 1BIIB 2G9HA 3QIUA 3RGVC 5KW9L 3MTRA 1QR1A 1X5KA 3G9VA 2X8BA 2BRRH 4LK4A 3WNKA 5K3CA 1U2EA 1ZJ4A 3F8UB 1NC4A 2XMQA 2OL3H 5ALDA 5DVOA 1R3LB 3AXLB 1H3VA 1KCVL 2W9LA 4ETQA 1TDQA 1T7WA 2YD4A 4KC3B 2ZYIA 3ARDB 2ZUVA 3ZT5A 1J1OH 4OUUB 1TTGA 4S1QH 4AH2B 3P9WB 2Q76A 4V1DD 3C6SB 4BELD 3TBSB 1S8DA 1QLRB 4GRMB 3KWJA 1DINA 4OV5A 5GZOD 3RL2B 1IFHL 5D5MF 3H7LA 4G7YL 1QPPA 4QHNB 3A6CL 1VE6A 1WGOA 4GJTB 5T33L 2GTZA 2HLAA 5KSBB 4J2XA 2XTJE 2AK4B 3U1SH 4Q05A 4FZEL 4GH7B 3IS1X 1X5JA 4IMLB 4OFYA 3NZ8B 3OR7A 3OF6A 1T0NA 2AJ3B 3ULVC 2IAND 3HPJB 4XPBH 1BGXH 1HXYA 4YR6A 3UPCA 1CDCA 3HUJB 2ESVB 4QRSB 1OD9A 1GPLA 3BF8A 4G9GA 1OGAA 4D0BB 2MMXA 2CLZA 2J8UF 3FO9A 2CKBA 3ZTJG 3CK0H 3CDYA 3H9SD 2VITA 1Y6MR 4JN1H 4XNYL 4LSUL 5CH3A 4URTB 1SJVA 5HYSA 3C45A 5FP0A 3GSWA 5CJ5A 4KJPD 4RIRB 4AN1A 4CVZB 1HH9A 1F90L 4TSBH 4ELMA 4NNXA 3FRPG 4BTVA 5CSZB 1JCKA 2CIKA 2CB9A 5DHXB 3HC3H 3VG0H 3BO8B 1M7DA 3C09B 2Y9RT 4KKLC 1QTIA 3BGFC 2FJGA 1JE6A 2FNBA 2NXYD 3VXUD 4EEEA 4HWZA 2QSTA 5I1AA 2ONCA 4G8CA 1U8LB 1AE6L 4K23L 5DXWA 3WIBA 1EZVY 1T1YA 1EHAA 4FG6C 1GL4B 2YPVH 3ZT6A 4H7KA 3VKFA 2VAAB 4JFPB 1GC1C 3O8XD 5DHVH 2WIMA 5F1NA 4YXKL 3S3JA 4ODWA 1A7NH 1INDH 2R0ZH 5LKNA 4QHMA 1HL7A 4WUUD 4KMQA 1NAMA 4WI6A 5J6HA 1MCJA 2ID5A 4FQ1H 1T04A 1CUDA 2GJ6E 2DWEA 3JWOC 4GLRH 1U8QB 1PZ5A 4EKXA 5MEQA 1UM6L 1K8DB 4JO1L 1OB1B 4HUKB 1KCSL 3O6ML 5D2LE 5LGJA 4X7CC 3GUTB 1HXYB 2E7CA 5DJ6B 2NPLX 4RQQB 5KS9E 2AP2A 3K1DA 3WWEA 4LSQL 1EB9A 3DKRA 4HAIA 3GMMB 2YD8A 4YUEH 4KE9A 1I7TB 5IV2B 5DMKB 4JREC 5HF5A 2XNAA 1JNNL 4F7MB 2JF0A 5HKBA 4C4ZA 1MRFH 3DVIA 4OKVA 4XP9H 3IDAA 5LKAA 4BYHA 4U0QB 1JZ4A 1YYLH 5I74C 4PP1D 1TCCA 1VA5A 4NO2B 5I8CB 4MJ2A 4OD1L 3AAZA 4OCMC 3HI1A 4H88H 4OGXL 3IFNL 5TE6L 3NPSB 3PWPE 3V6FA 1JPTH 1KJVB 1OY3B 4HJGA 3M1BB 4GRLC 3NN8A 3P0YL 5LWYH 1ONQB 4PRPE 1Q0RA 3P30H 4JY4A 1AMNA 4H20L 3TGXA 3C8KA 2AV1B 4QXTA 2FB4L 4HXBH 5C07A 3TO2B 4WFGD 4XCYB 1DJSA 3RI5K 3HE6B 5JDSB 4JO1H 5F7DA 3VDBA 2XPGA 5DTFB 4ENED 4NS4A 3ECBB 3ROLA 3HZMA 1CFNB 1UH4A 4GAYA 4X99A 2RCSL 3RY4A 4ZXFA 3SDAA 3D69A 3NUZA 2DJ4A 5I6XB 2HJFB 1YAJA 1CGXA 3FOLB 3M81A 3MFFB 2UY7A 4RGMB 1O6FA 3BH9A 3GMPB 3CXDL 5MHSD 3VFPA 3W9UA 2P5EA 3NABL 1YNTA 3QUZB 5DVLA 4QRUA 1J0ZA 1XF5A 2V5YA 5ADPL 3HEAA 1CUGA 3U36A 4G9FE 5D7LA 3NCFB 4Y2JA 4AMKL 1RZJH 3DX7A 3X3GL 4BSWA 2VDNL 4YHPB 3SDXE 2BSTB 3VGHA 5FUMA 1NGPL 5KSBA 1M6OA 4NP4H 3CIQA 4UHEA 4PF1A 5TQ0L 4DGIH 1JPFB 3BKCL 5K59F 1BCRA 5CWSA 4ELKA 1LNSA 1FZJA 5ICZB 1AY1H 4X9HA 2EZ0D 4ISVA 5INDB 3G9UA 5DJZA 1GOHA 2IADB 1QIHA 4HH8A 4JLRA 3LQMA 4XPBL 2GBCA 1KJ2H 5IW1A 3NWOA 2VDQH 1YCDA 4LP5A 4FZEH 4OF5A 1A4JA 4U2YA 5EA0L 1W76A 4Q82A 1A6VH 2R29L 4PJ7A 5CSZA 3VDAA 5FOBA 3QQ9C 3D0LB 4LKXA 1JMYA 4PD4J 3A6CH 2ZUYA 4MQSB 1OLLA 1PVHA 2QQQA 3F7YB 5BMFH 3QPQD 4X90A 1D9KA 2JELH 3F7RA 1IGML 1CUUA 4F57L 4PRPA 1TPXC 5CD5C 1KN4L 1K5PA 4F7EA 5BW7C 2NY3B 4Z0BL 2VB5A 1Z9OA 2CXGA 2VQTA 3PF8A 1D5BA 4N90D 2ZVDA 3PABA 3E1GA 3FAWA 5DNVA 3MRHB 4WFGE 5AI4A 4JZOA 5GZND 4E41B 2R2CA 4R6UA 2JGIA 3BUYA 3TJHC 2A6KB 3M17A 5FUZH 4K6GA 4O51A 3QUZC 3DMMC 2R2HB 4TVPH 1JYNA 5AOAA 3SGEH 1BD2E 1XGPB 4Y4FC 4ETWA 2WSKA 3MRJB 5DMIL 2H2PC 5F93C 5B21A 5AI6A 3IXTB 4K94H 4OCRH 4LAQL 2FGZA 2HRPL 4ZWNA 1UKQA 4C54A 1RZIB 1HYSD 1QBAA 4UT6H 5B3JF 5F3BB 1MFAH 1AC6A 2WWMC 3LD8C 4LL9A 3RPIA 2XRAL 5CP7A 1H3PH 5MEPB 1U65A 3ARFA 1USWA 4YHLH 4AEIL 3RNQA 3WFEL 1NDGB 3G9TA 2A74B 1N64L 2WUEA 2IF7A 2X4UB 4LSSL 3WYRA 1NCCL 2N4IA 3D0VB 4FFVA 2BP3A 5AI8A 1P0MA 2L4OA 5LBSL 5LCVL 5ANMA 4LLQA 4UMGA 4EBBA 4P4RB 1FLTX 3IKCA 3CFEB 1L0YA 2Q87A 2R1WB 1ZSDB 1P6FA 3HG1A 5CRIA 3V5KA 3B2UD 1OPGL 1OTTD 2HFEB 5HYQB 4HVTA 3EYSH 2X4QB 3O11A 1ODTC 2E7LA 2DTSA 3OKDA 2F8OA 4ALAL 4K3JH 6YASA 4YHYB 2IBBA 4FQCL 3BGFB 1OAQL 2NXZC 4I5BA 4GW3A 4GG6B 5JW3H 2PX6A 5CS7A 3VI4F 1I85A 3HKFA 2GUOA 3V48A 3SHSA 3MGOB 1V5JA 3H3KA 4QRTB 4Y2DA 3U4BH 5EBWB 3G6AB 2EE2A 1HHJA 3JV6B 5EU3A 1U3YA 5IFAL 3NZHH 3VWJA 1GSMA 1KEZA 1IGJA 3IDMB 5ALBH 3ILSA 2FZ3A 2X89A 3U7YL 5I18H 2Q6WB 5IJKC 1IC4L 4DGVL 3THML 3Q0TA 2HTKC 4I0PB 1P7KA 4KK8C 4A6YB 2OQJA 2Q7YA 1CDBA 1RZIA 2QKIB 3WL7A 3EW3B 5C8JA 4DFHA 3W5NA 1XKLA 1H8OA 2F5AL 2FEEI 4HIJB 2V5MA 1QSEA 2WFZA 5JADA 2AK1H 2BVTA 3NZHL 3QNYB 1QR4A 1A14L 1Y18A 2HKFH 3BWXA 1K6QL 3C6LC 3CZFA 4KVNH 4WI2A 4XAWL 1YAHA 1BJ1J 2IFFL 1CIJA 1FO0B 1VFBA 1BD2D 3V7AE 3E2HB 1MCIA 3CLEH 3FHQA 1HHKB 4Y4KA 5LZ4A 3O3EB 3BPLC 4XNUH 2UZIL 4LCWE 1I8IA 3FTGA 5HXMA 2GKIA 2YASA 3V0AC 5FA4B 5FA3B 1EVTC 1FG2A 3PJSA 5EN2B 2AQ1A 5F9DC 1AD0B 3HE7B 4P2OB 2FX9H 1YSCA 2QADC 3ARGD 1JJIA 4LOUD 2DCMA 4Y2PA 3MO1B 2ZNWA 1IL1B 3MOBH 4LLYA 2P4AB 2GFBA 5E4YA 1NBVH 2IMNA 2XKSA 4NQSA 4OLEA 4XTRC 3R3WA 3RAJL 1E8DA 5LBSH 3MGOA 3F7YA 2ATKA 2RFXB 3B9KA 2EXWC 4E42A 1LE9B 3EQ7A 4X92A 1A3RL 1W8OA 4YPGB 3ZLUA 1A0QL 5D71H 3SN6N 1DEDA 4GFTB 3V1LA 1G4HA 2XUPA 5IB1A 3BPNC 5C08A 1A1OA 2B39A 5DJ8A 3OURA 2XQYG 2Z93B 4H1LH 1MI5B 2B61A 1I3RB 1CD1A 3OAYH 1UVQA 1OAXL 4QLOA 5CIPH 1GXSA 4ZO7A 4FZ8L 4ZTPH 3UJJL 5CGYD 3VFWA 3NTCL 2BVQB 1AH1A 3HR6A 1ORSA 1CUSA 3GK8L 5D4QA 1J8HB 2C5DC 1T4KB 2NY1B 3WN5A 2D0GA 4YR6B 3BZDA 3IURA 1F6FB 4KKNA 3NFSH 3SKOA 1Z9LA 5BO1L 5I1LA 4TVPL 2KZWA 3BVNA 2AJXL 4UINL 1S5IH 2QTBA 3QFJA 2I26N 4Y88A 3WYDA 4IRSD 3RKPA 1OGAE 3CLFH 4Z76B 3KYNB 1S9YB 5BRZA 4FXKA 4L4VE 3SKUD 5L88L 2P5WA 1H2YA 4OM1H 5JARA 5JALA 2IQAA 3MRKB 1SY6L 3MGAA 3LKQB 1QTYT 3OX8B 4X9FA 2CKBL 3KVQA 3IDIB 3OAZH 4D94A 1JRHI 4HUVB 1YZZA 3TBSA 3IF1A 1QLRA 5CJXA 3U2SA 3QUYC 5EZLB 1MUJA 4MDJB 4P49A 1F6AA 2HLFD 3KPRB 5IG7B 2ITDB 1UM4L 3ETBF 1NFDE 5EOCJ 3F96A 4HJ0D 4D0CB 3AIMA 5IVXB 4Q1VA 4O2EB 4WUKH 4QWWC 2WIGA 1MCHA 1A5FL 5AG8A 3KGRA 3CSBA 4ZSOA 4ESKA 3JTTA 5DGRA 3GZJA 1YMMB 3EOBA 4WUKL 4YHOL 3X3FL 4J03A 3O11B 5FKPA 4JFZH 1T83A 1YEJH 4M7KH 5E6IC 3IRPX 3RARA 1UG9A 3IXTA 2GJJA 1M7IA 3NA4A 4NNYA 4ZUUA 5IVDA 3UDWC 5ALIA 2GCYB 5T3ZH 3S3PA 4ZQKB 2QMQA 3UYPA 3SGKC 1CZ8L 3HRPA 3VH8G 1PKOA 2BK8A 3F7VA 1I8MA 2CKBH 1XRNA 5CD3A 3UTZB 3LQZA 4H0CA 1WQVT 3G0CA 4KRPB 4OSEA 1GXEA 3L1JA 2VDNH 2BVEA 2MTPA 3EF3A 5TGBB 1M7DB 4ZS7H 3DD5A 5GISH 3V0VA 3W11D 5EBMA 5D3ZA 2AJXH 3UPRA 5HZGA 5GHWL 4PJXA 2V2WB 3H7BA 2ITCA 4HDIB 4BB0A 3I50H 5MHSE 4G6JH 3CFJA 4R9HA 1TLKA 2M2DA 1RZKC 4KJWD 2PKDA 3P77A 1QO3A 4ZTPL 3UJJH 3MV9A 2NY4B 3FFCE 4Z7VE 4XH2A 4M8QB 5D1ZD 1U36A 2PW2A 2W0KA 5J13B 3O3UN 5BOPA 2VLJD 3Q0HA 1ZHNB 2RCSH 4G9FA 3S35X 5I1KH 3KPSB 1OCWH 4JRXE 25C8H 1I9EA 1MOEA 3LKPA 3EYQD 4QHKJ 4X93A 3RGVA 3QIWC 4Y2RA 1JTPA 1Q9KA 3HNSL 2HT4D 5CMAB 3S37H 3OL2A 3Q6GH 1QFUL 8FABB 3KLDA 4HXBL 2XN9E 3L5XH 1PSKL 4QHKI 4P2OA 4KVCH 3QMWA 4Q2ZA 4DQOH 5EZOH 1YUHA 3ZKMC 3ZE2E 5HY9B 3G5VB 1UH2A 1EH9A 1S3KH 1JPTL 4K2UH 1LPOA 3I6LE 3RRQA 4J6RL 4HS3A 4OGYH 3WK9A 1U92A 4KV5F 5DMKA 4IRZL 2PCPB 3T3MF 1PG7X 5HHXH 4OD1H 2R0WL 4QT5A 4W4NA 4TULH 1MFNA 3DURA 1BX2A 5D7IE 1LQSR 4OCYL 5FB8B 2NW6A 4IRJA 4ZOEA 4KJPC 2CDEA 4OM0H 3ZI7A 5KVGL 5DT1L 4UFPA 4CU8A 5IHZB 1SJHB 3CLEL 3V5DB 1IGIL 2IFFH 4Y4HC 2EEDA 2CO7B 4G3YH 3HZKA 2VXVL 3LDBC 1J8KA 3R0VA 1AO7A 2OP4L 4KROD 3BISA 1WHTA 4X98A 1RURH 1WICA 4C6HA 1KBGH 1UM6H 3TJHD 1JPFA 3V4VL 2GEEA 4X99B 43C9B 3QUXB 1MI5D 5KSVA 3JXAA 3VFGL 1AJ7L 1I7RB 1A02N 1GOGA 4KY1L 4WY7L 3TH3T 2XV6B 2I25N 4E15A 1F4YL 4YHNA 5DK2A 1HHGA 3CUPA 1QJ4A 1RZJC 5CD5D 3MBXH 5GIRB 1VACA 3PGCA 1T3FA 5ACMA 1HYSC 2ZNXA 1XH3A 4XCEB 2K7QA 2CK2A 4K7FB 4PRHD 3D87B 1F8TH 4KKAD 1DN2A 3BH9B 3GMPA 1LO0L 4NVRA 2Y06L 3PXHA 1BFSA 4JRYA 1VKXB 4QTIL 4CN1A 4X71A 1U95A 1K4DB 3QDJB 3WKEA 1AGBB 4JQVA 2Y6SD 4LLWA 3UX9B 3MOAH 4B80A 2AI0H 1A7RH 4IDLA 4PV7A 1TJIH 1P7HL 5ALWA 4HFUH 4P2RE 1DQLH 1G7QA 2B1HH 2XG4A 5EO1A 5GGSY 4XHJC 3PWLA 4HUUB 1N0XH 3MRHA 1QIIA 5DK3A 4M1DL 3IU3A 5F7UA 1ZANL 1TJGH 1B41A 1QHPA 1ZMYA 2OCGA 3KPMB 3QI9C 2X1QA 3K3QA 2HT3D 1TVBB 1JPSH 1CUVA 2AEWA 5F88B 2JF1A 1VE7A 3O95A 2F53B 2GHWB 3HI5H 4M7JL 5F6HI 5JIPA 4OD3H 2DB8A 3FVRA 4KRPD 2D5LA 3BX7C 4LU5H 1XIWA 4MA8H 5ITFB 1FLRH 1XF4B 1G6RB 4LXHA 1CGUA 5HVWA 2UWEB 3OKLA 2VXUH 4WFHE 1CQZA 2HRPH 3ULSB 3VGEA 1JGVH 2OR8A 1FL6A 3B9VA 5DC0A 4OD2B 1NEZB 2VWEE 3AZOA 1ES0B 4JFFE 3HE7D 5A7GA 3VMNA 1BQHA 4LASH 4Q0XL 3WNMA 4O08A 1J0HA 4G8GD 3NVQA 3IETA 1V3JA 1TZGL 3FJTA 1JMKC 5AKIA 2VSDA 3R3YA 3WQHA 4WTZA 2F19L 5KJRL 3IIIA 3P4LA 1JGDA 1XGPA 4RFNB 2FJHB 3D48R 5BWCA 5HI5D 4Y19B 3VFMB 1W72A 1P7QD 1N59A 4LCWA 3GROA 1F2QA 1ERNA 3UTSB 1BBJA 1KG0B 4NUJB 3FZUC 2KPNA 4WHDA 4Y4FA 1INEL 1UZ6E 4JFED 3ZL4L 1U8MB 4BRSA 2DI7A 4G43A 1LP9A 1BWWA 3PHOA 2LTQC 1H8NA 1V05A 4PJ5B 4I9WE 3P4OA 4GAFB 3H04A 4JYPA 5A2FA 2VLJB 5E7FA 3FB8B 1NFIA 4LPYA 4LU5L 1X5YA 2FHBA 4ZFOA 2D03H 3OXRA 3KDMA 1FFPA 5TDPB 2VDQL 3MV11 5KANI 4WRLA 5IVXE 1CQKA 1NUNB 4ODHH 4B9AA 5JXAH 2ZSWB 3GSUB 4J23A 5DA4A 3HCVA 5I9QB 4JY6A 2CLRB 4X9BA 1HN1A 3BKYH 2VDKL 2G4LA 3P4NA 2XUOA 4F9PA 4Y2QA 2X4RA 3QQ9D 1FZKB 1M05A 4K07A 3LAFA 4MEAA 2YKLL 5FDWB 2L7JA 3K2IA 4MA7L 1FL5A 4R96A 1GH7A 3QXWA 1UKTA 5E03A 5T1DL 3CDFA 2DLIA 5CILL 3KYMA 1IZ7A 3SDDD 3T4YB 3C09C 3CN7A 3DX8B 5ADPH 5GS0H 4NN6C 1YEEH 4S1RH 3TVMC 5FO9B 1I8LC 2XQYK 4UDTA 4DGQA 2IITA 5D7SL 2PL5A 2FGWH 1EZVX 1KUMA 2PCPA 3GM8A 4LRIC 1QLFA 4X7TA 3VI3E 2Q8AH 5HHMD 4EBQH 3BO8A 3PV6B 4M62L 2O61A 4M6OH 5A7HA 1OLZA 3H9YA 5ITBH 2NY1C 2ZCKL 1T7VA 2APVA 4LVEA 3RBGA 3OKEA 4ZAKA 4CU7A 2FYYB 4L1HA 2OXHA 3QH3B 3ZDZF 1A7UA 2H9GA 5AEAA 1S7SA 1WBXB 1G7LB 1RZGA 2QTEA 3ZT7A 4ZI5A 3SKMB 4K3GA 3MRPB 4HC1A 3L7FB 5E2VH 1D5XB 4PTTA 4HPYL 2FB4H 4FNLH 1QHOA 1KGCD 1KIQB 3I02A 4IHOA 4NGHL 2AV7B 1F42A 5C0ND 4L8CA 4KRNA 5LWYL 2VE6B 3WL8A 3C60D 1RFDL 1HILA 4MNGE 3GMLA 1Z9SA 4GXUM 1BQLH 3F12B 3QUYB 4X9IA 1W52X 4RWHA 1DU4A 2HJKA 4XC1H 4H25A 1MCPH 2OBGA 2WUCH 1MNAA 5IB3A 4JKWA 4FKBA 2YMXH 2DTML 5C07B 4P46C 3W5MA 3DO3A 3I75B 2XFXB 3FQRB 5D7JB 4J0GA 3IFLL 2YUVA 2YMXL 2J6EL 4ETQB 3MMEB 3PUCA 3RY5A 4IRZH 4OF7A 4OZ4B 3RUGF 1EEYB 1EA9C 4WNQB 5FCUL 1V8HA 3UZVB 4APQC 3DO7A 1BQLL 3R1GH 1PJ9A 1CF8L 3KNBB 4RGNC 4G8BA 3RZCA 1N3NA 2EXYC 5T1MB 4OBSA 2A9ML 1E8NA 3OG9A 4NGHH 1MCWM 1NH6A 5HGBA 2DQIH 4QTHB 2OJEA 1XROA 4OKVB 1L7IH 5EFIA 3PFCA 4Z7QF 5INCB 1AURA 1QEWB 3BDVA 1XR8B 5J9PA 2P24B 2IPUG 25C8L 4MJ3A 3RZWA 1XR9A 4JM2F 5ALYA 5BQ7B 4YDKL 3Q3GB 1S9XA 3DHMA 1MCOH 3DL7A 3DX7B 4JY5H 3SK0A 5SYMA 4J1UB 3G02A 5I7UA 2JB6A 3WJ2A 1EVEA 1RULH 2IFGA 4JM2D 4EBQL 3FFCB 4Z7VB 2DQEH 2CKMA 1XEDA 2YPVL 2BC4B 3GGWB 4HIEB 2DF3A 2ZCHH 3I50L 5DD6B 2G5TA 3MZTA 2C3HA 5IVOA 2Y25A 4D9LH 3WXWL 4K23H 1FFDA 1RZFH 2ARJA 1WSST 5CWSB 4ZO8A 3ULVL 2HN7A 2AXJA 3ULUC 5BZDB 3QCTL 3HC7A 5E7BA 5IH7A 1X6NA 1EHLL 4PJCE 3PNWB 1EI9A 5ISMA 1Z6JT 2PYEA 1O0VA 1BAFH 1MVUB 3LZFH 1S9YA 1YEGH 3ZKMD 1TCAA 4QEGA 2WIIA 5EBLB 1MQKL 4U1MB 1UKAA 4JN1L 4XNYH 4XPTL 4I3SH 1OF2A 3IUQA 5FK9B 1XF5B 4MNGA 3QI9A 1XGYL 3DIFA 1I3VA 1FVDA 3ZKSD 1CGWA 5EZLA 2B7DT 4WHTA 1JGLL 5IT2L 2QQLH 4LCIH 1CBVH 4QDUA 2D7TL 2GK0A 5C0AE 4M03A 1DP0A 1BREA 5C0FA 1LPBB 1H9VA 2I3ZA 2AABL 2CO6B 5EOCL 2ATPA 3BPNB 1VSCA 4Q3KA 2JJSA 1AKJA 4MXWH 4Z7OF 2YUXA 1CLCA 3MJ9L 1ETZB 4UBLA 2X4SB 4YDVB 4N8EA 1GHFH 1YQVH 1BFOA 1D5ZB 4C58B 4KROC 5FKPB 4WWKA 1KFAH 1BFTA 3C5SA 4KK6D 5B8CC 4JYMA 2FATH 2ZOLA 4XCNA 2LIPA 3V9AA 5SWZD 1CXFA 2OG1A 1EH5A 3EFDH 5HDLA 2NY0B 4HIEA 3GSNA 4FABH 4BFBD 1U8PB 4KKCC 2A1WH 2EKSA 3FN0L 2O2HA 3HR5A 2XUHA 2YSSA 5HI3D 3FVTA 1CUAA 3NFNB 1F6LL 1U92B 1S7QB 2IQ9L 3MRFB 1S5IL 2HVJA 3FB5A 4JO4H 2I27N 1S7UB 4OSUL 2X7LA 2DLFH 3JWDH 4X4YB 2LV4A 4QHLB 1R3LA 3AXLA 1QFMA 2HA7A 3DQZA 4WCYH 4HBCH 4XNQA 5LQBL 5J7CC 1JGVL 4B5EA 3EQ9A 4F7CB 5I66A 2WG0A 5FFLA 5DVMA 5DTFA 1FNAA 4BVLA 2VXUL 2JJTC 1C5BL 5DYOA 3FOMB 1TPXB 4P5TB 2P44B 1GAFH 5TE7H 2FO4A 4CN4A 2BCKB 4MA8L 1HCFX 1DN0A 4C55A 1G7IA 4PGBA 5FYJL 4DAGH 4DKAA 5CBAA 5J11B 4LFHD 4RGNB 5EIQA 3FQRA 3VFRB 2RAUA 3EJZC 4L9DA 2R0KL 1CICC 4S11A 2HA2A 1DQJB 1VJ5A 5CIPB 43CAB 3DPBA 1ZE3C 3RKSA 2VDRH 1TQBB 5FEBA 3TVMB 1EO5A 4P48A 1XF3A 3E3QE 3FO9B 3CFBA 3UTQB 1HHJB 4H5SA 1XZHA 4U1KA 3AB0C 4MXDA 3QPQC 1VACB 1CUYA 4N8SA 4QXUL 2A74A 2GQHA 2HRRA 3GSNB 1F4XH 5EFIB 3S36L 4P23D 1AGFB 1J1PH 1OHQA 4NRZB 5SYNA 3LEVL 2UZIH 4WFHD 4OT1L 5E2WH 3SE9L 3BKMH 4C57C 1QSFE 3ZV7A 4ZFOL 3N0TA 3QYCA 1F8TL 5HVGB 3QUYA 4R26L 5SWSD 2CD0A 5FGRA 1DQDH 1ZSDA 4P9HL 5BVJA 2X7LB 3ARBC 5D1XD 4HWBH 3R8BB 3WDJA 2W9EL 3OJDB 4AIXA 4CMMB 1JI3A 2C3VB 4YDLB 5GRZA 4UBOA 4V2BA 1DQZA 2R2BB 1SBSL 3DMMD 1NCTA 4OCSH 3SCMC 3TIDB 2ZYRA 4B0PA 3PGFH 1J7VR 1MWAA 4WY7H 1R6VA 1A6AA 2BC4A 3WSQL 1WEJH 2A6JA 3IGAB 4CJ1A 5LZ8A 3D2UA 3ISWA 5BRZE 1BEZA 5C9JA 4IOSD 5HFNA 3LN5A 3KOOA 3H8NA 5KBNC 1MX5A 2YA2A 2VZTA 3EOAA 4JKLA 4LFHG 4DUVA 15C8H 1OAUH 4XWOD 3BEVA 5JHLL 4KWUA 5J1AA 3AREC 2H6PA 3AS2A 3TBYA 3TPUA 3ZKQD 4PRDA 5KVGH 2DN7A 1X7QA 3MUJA 2G60L 1VGKA 4X6EA 4PJBB 4HKXA 2H3NB 4OV5B 5DJ2A 1D6VH 3T1FA 2MSPA 4XRCA 4XPHH 1K4DA 1CTNA 3QDJA 5I16B 4MB5A 5IM7B 1XQYA 4O4YH 1DBAL 1FP5A 1BOGB 5F97E 3FFCA 4Z7VA 2R0WH 3F58H 2XTJD 3E6FA 3MCG1 2PM8A 5L8KB 5MENA 4YPJA 4HV8B 1TQHA 1DQYA 3I6GB 3FAKA 4UB0H 4F7TB 3RQ3A 3T8XB 5IKCA 3U9UA 3V6ZB 5IMMA 1NCCH 1RK0A 3OG4B 3PL6A 1MAMH 3Q5TA 5KOVC 1D5ZA 2D7NA 4UNTA 5JDJA 4TVPE 1CGVA 1EGJH 1DQTA 4CNIB 5ALSA 4P4KD 3QEQD 3RJDA 3Q6GL 2WZPD 4NOBA 3PNWA 4WI9A 3PWUA 4N0FA 3TBWB 2H9YA 3I1YA 2XMGA 5HF8A 1QBLH 3N1FC 1VESA 2VLKD 4P2RD 5I8OH 4PJAF 1A6UL 3L1HA 4EUPG 1CLYL 3G6JE 4PJIB 4U6XA 1XZJA 4OZIA 3LIIA 3I6KB 2M26A 4Y5YB 1J0IA 1BLNB 1MAJA 4CDGC 3LDBB 2IAMD 5TDPA 4AMZA 5SX4I 1QNZH 1SYVA 4AK1A 4LCCC 1CT8B 3T1WA 2OLEA 1UACH 4HJ0C 3HAEA 4HKJB 5MERA 4X6CF 2VQ6A 5CLWA 4XP1L 2DMBA 3VXPA 4PRDB 4F7CA 1TCRB 1DBJH 1YQ2A 1JNJA 4YDJB 4X4ZA 4ZRDA 1EXUB 1UJ3B 4I4WA 2WFLA 5ANME 3RHWK 4FABL 1E27A 5KS9F 4K7PY 4KRYA 5DDHB 2WBKA 1IMHC 2X5PA 2CRIA 5CJ8A 3GSWB 4RGMC 4AIOA 1QFOA 2P47B 2GTWA 3CVIH 1CN4A 3VXMB 4F57H 2XLBA 3QXDA 3WLBB 1LPNA 4RGNE 3HYSA 2BSSB 2PTUA 5CBEB 5B4MC 1U58A 4G5ZL 2OQJB 3NIFF 5HDBF 2ZP0T 3FYUA 1H22A 2AKRA 3DOHA 4I3GA 2WP3T 3HSSA 1EFQA 3STZA 3HA0A 3F97A 5EA0H 3IVKB 2B4KA 2YD7A 3ILPA 5K9OA 2NY2C 3BE8A 2EXWD 5I1JH 4F7MA 2B5IC 1QSFA 3AVEA 3M3DA 2I07A 3WK7A 4YHKH 1Q83A 2XY1A 1LMKA 4PBVC 4M5YH 3MRDB 2DQGL 1UFUA 2F58H 3RWDA 3LIPA 5J6GA 2C3WA 3G04B 5CZKA 5A2JH 3S4SG 4PRAA 5T3ZE 3BP6B 1D5XA 3C6LA 3STTA 5EULV 3O2VL 3MJ6A 3WKCA 3CFKB 4LNRB 4P2QA 1GGTA 3TA3A 2WINA 4I9WD 3QCUH 4OCXH 1FZKA 2QSCH 4OM1L 5FRDA 5E1AB 4KAQL 1P2CA 4K71C 4QOKA 3VXSA 3FZUD 5FYKU 5E9DE 3TIDA 4LKOA 5HGHB 4BAGA 3RVWD 5IOPA 5EO0B 5JW4Q 1N8SA 3ZDXF 1Z5LB 1JL8A 1UACL 4AG4L 4XXDA 3WZLA 4Y4HD 2HL6A 4ZPVB 3RGVB 2NTSP 3BYYA 4X7SL 3Q1SL 1RYYA 2UV3A 5HVFB 3NTCH 3AC0A 3SE8H 4U6TA 5F7WC 3DVGB 1CDHA 1ZT4A 3SDXF 2BJHA 5F6IB 2HADA 1OAXH 2OXGA 1NUGA 4D0DB 4UBJA 4W6WB 4J3UA 2I5YH 5F9JA 5J12C 4RNCA 1RZ8A 3WLWD 3O9WD 4U1LB 2CJPA 1KCUH 2NNAB 5J13C 4L4VA 2CUMA 3O4LE 3V6FB 1F00I 4GRWE 4XPFL 3ARFB 3FOBA 1LILA 1L7IL 5A16A 4PW0A 3DURB 5F7EH 1P4BL 2OJZL 4H1LB 4CMMA 2C3VA 5C92A 3MRPA 4P5TD 1XR9B 4OZGE 3UPAA 1X5ZA 4N9GA 1Q9LB 4UB0L 1ZD2P 3UMTA 4NMWA 2C7BA 3N0PB 4H25B 5KVDL 2QR5A 4NT6B 4R8WL 4I48B 3BD5A 3ROLB 3L3DA 3TN0A 5HVHB 5JR1H 4S0XA 2R1YA 4OIIL 1Q9OB 2DM3A 1JHLL 1ZGBA 2QLVB 1U8EA 5IIEA 4GT7A 1SFRA 4FLFA 4F15C 5FF6A 2IPTH 3RA7L 3T52A 3H17A 1O6GA 5DZLA 3WL5A 4YFEA 4XNUL 5I1CL 1EEYA 4WNQA 5CMLA 1ADQA 1GGYA 1MF2H 1BEYH 3ZHDA 1I4FB 2GYVA 1TZIA 1OGTB 2G60H 1JFQH 4J8RB 2HLFC 3QIBB 3LV3B 4KXZI 5IBUG 1G7JA 1FNHA 1Z5LA 1LLFA 4FS0A 5A62A 5E8NB 5JHLH 4ZNEE 2YR3A 1GQRA 3QNXB 1WK0A 3RI5F 2WU3A 3FQNB 3RK4A 1DBKL 3F5WA 5IVXA 4FNLL 2XMSA 4PR5A 3O6MH 1H2XA 2FECL 1NGXA 4KH2A 3QO0B 2Z5GA 2Z8XA 5KVEL 4UDUA 2HFTA 1HE7A 4H1LG 3MLVH 1CUBA 1P4IH 2XWBA 3RWEB 2X4PB 3EGSB 5D2NE 1WEJL 2GW5A 3NCEB 2Z8RA 3UC0H 5C09B 5HF6A 4HH9B 5JAHA 3MVEA 3OAZK 4PG9B 2DHDA 5GGUA 3V95A 3V4UH 4P9HH 2XUAA 5K33A 5C6TH 4Q3LA 3ARYA 1BCSA 1DQDL 4JEGB 1I8MB 5E2TL 3W0WD 4I2XE 5GGTA 4L5FH 4DUXA 3GBSA 2ARJB 1S7RA 1T5XB 2EDNA 4V2CB 3RDTA 5IQ7H 4EUPH 3BWAB 1CXHA 2CKBB 2VJAA 4MWSA 2XXCB 4FQCH 1E6JL 2ECFA 2QADB 1J1PL 5T1DH 5TE4H 3PUIA 3S36H 5T4EA 4WY8A 1R3HB 4PB0H 1EEQA 1U3ZA 1MEXL 5BS0E 2VLRD 5AH0A 2NZIA 3PGCB 3WO4C 4LHJB 3O4LD 1A6ZA 4MJ6A 4Q97A 5DRXB 3VXTA 5B3JE