3C87A

Crystal structure of the enterobactin esterase fes from shigella flexneri in the presence of enterobactin
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
393
structure length
388
Chain Sequence
LKVGSESWWQSKHGPEWQRLNDEMFEVTFWWRDPQGSEEYSTIKRVWVYITGVTDHNSQPQSMQRIAGTDVWQWTTQLNANWRGSYCFIPTERDDIFSAPPDRLELREGWRKLLPQAIADPLNPQSWKGGLGHAVSALEMPQAPLQPGWDCPQAPEIPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRQQEGVLLEKLKAGEVSAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGGHDALCWRGGLMQGLIDLWQPLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siderophore Mediated Iron Acquisition: Structure and Specificity of Enterobactin Esterase from Shigella flexneri.
rcsb
source organism Shigella flexneri 2a str. 2457t
molecule tags Hydrolase
molecule keywords Enterochelin esterase
total genus 117
structure length 388
sequence length 393
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c87A01
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3c87A02
2D5LA 2QSTA 3SWWA 4YHIB 2PNDA 4GRLD 1GT6A 1RJZA 4I0PB 2X6MA 3U0PA 2IPKA 3NUZA 4Y4HD 4AXBA 4NBYB 2XRAH 3L5HA 1OWWA 3FB5A 1AR2A 3JWNC 4N8VA 4XCEA 2IAMB 4KHTH 2VWEE 5DJXB 1CFJA 4BP8A 3QUZA 2VLJD 5E2WL 4QEKA 2KQMA 1K8DA 1D6EB 2EDOA 1SJVA 3WL9B 2VZSA 4NM8H 3QIBA 5D1XA 4KAAA 4YQXH 1ED3A 3MRCB 4HG4J 2EEDA 3ZMRA 1ZICA 4C4YA 1XIWB 1MAAA 2NXYD 3QWRD 5TH2B 2DM7A 4KGJA 1M6OA 4CMHC 2WBKA 4JHWL 3B3QA 5B39G 1OXMA 4NNPL 4X85A 5GGUA 2OP4H 2OL3A 4QTHA 3HABA 5TFSL 5C0BA 3FZUD 5FGCE 3V8CA 3IKKA 4EUPH 2FCBA 4FQIL 1QO7A 4ODVL 1XIWA 4LXIA 3QUMH 1HPLA 3D2AA 2PSHA 1MJJA 3F7VA 1MJ7H 4R96A 4RRPA 4YHOL 2YD1A 3BYTA 3TNMB 2LU4A 4ESKA 4DTGL 5KN5B 4OI9A 5T4FA 3NCJL 3VJKA 2OL3B 1MAMH 2C3HA 4YH6A 3IF1B 5C0JA 1A22B 4KR0A 4B81A 3CD4A 1UWGH 2RFXB 3QH4A 2FNBA 5GGRB 5HYIA 4MZ3A 2WINB 4P08A 2OL3L 5I2IB 1AKNA 2HKFL 2W07A 2YD6A 5JR1L 5FRDA 3FO1B 4ZO8A 1J1OL 3BDXA 2RONA 1I8KA 1DBKH 4LAJH 1FH5L 4NQEB 4QXGH 4OF6A 4P2RE 3QCUH 1TCAA 4LCUA 4A6YH 3DXAE 4RGYA 5FO8B 3REWB 1RZIB 4L29A 5C0IA 4BFGA 3FN0L 1NFDB 5D72L 1D5IH 3QEHB 4MA7L 4LSDA 1MAKA 4PJ8A 1BX2B 3NTCH 4JG1L 4XVTL 3V0VA 1WWAX 4G5ZH 3MRIA 4IJ3C 1ORWA 2XQIA 1R9MA 3N06B 3KPRB 1AXTL 4UILH 5T1DL 5CRIA 3QISA 4XWOD 3MODL 4UV4H 4XNZC 3G08A 1DP0A 3O3AB 1A21A 2M1KA 3MSPA 3WNLA 1NCBH 4U3CA 3RY5A 4JNCA 3L9RA 1FFQA 5L2JA 1S9XA 1P0IA 3IDYB 5D5MF 4ZS7H 3QDHA 4XPHL 1S7UB 2IH3A 2OK0L 2YZ8A 1HDMB 3T2NH 4HBCH 1YEEL 5SWSA 4FG6C 4AMKL 3DPBA 1JZ3A 1C1EL 3NIFF 2DYPB 1VFAB 3D2UD 3PE9A 1E6OH 3U0WL 3NZHH 4EUPB 1Z3GH 1S7SB 4OPMA 1B0RB 1LP9B 4CGTA 3IJHA 5IMLB 1KSRA 3LV3B 1FG9C 4LIQH 1XZBA 4TNWK 3AIKA 4MQ7A 4NO2A 1JRHL 4Z7UF 2P49B 3UTQA 4HJGA 1RZJL 1D5XA 2I5YL 4I13B 1CDBA 1XZKA 2VXTL 3O4OB 3HZKB 3MV8B 2UUDH 4U0RC 4Y5XC 4WO4B 1YN6A 2ZYHA 3DROA 4ZAKC 2ZPKH 3MRLB 3GBMH 5D93C 5ELIA 5F89A 5E7BA 1CGVA 5EIQA 3RUGF 2DKMA 3EOBB 4AH2A 3O45B 1A2YA 1HSBB 4PJXE 4M6MH 3B2VL 4KK6C 2EIBA 3SDCD 1PG7L 2BVYA 3G04B 1N5YL 2IAMC 4OCZA 3GB7A 1RUAL 2QSQA 4MWSA 1UA6L 2R2BB 1QKZL 4BELD 3O6FA 5C09E 1XKTA 3QCTH 3S35L 1BQSA 3GBNH 1UVQB 4U6VL 3SDAB 2BP3A 5MERB 4OTXL 1H2XA 1QLEH 5BS0D 3HMWH 4BZWA 3SKOA 5J1AA 1OF2B 4P46C 2HT2D 4JDTL 5FUMA 5H94B 1PEWA 5SWZB 1J05B 3RP1A 2W38A 1FVCB 5K9QI 1LK2A 5CJQL 1CE6B 2D03H 5HI4D 2IBBA 2GK2A 5E8OA 3TT3H 6FABL 1RP1A 1YASA 2WU4A 4LYEA 4WTWA 5EIHA 4NQXB 2MCPL 4FBMA 5DD1L 1HKHA 4NZRL 3ILSA 3ILPB 2Z91A 3PDDA 1Z0NA 3EZJB 4U6HB 2XUFA 3PGFL 5BXFA 1LK3L 4Y4KC 1RUML 4X6XA 4X6DA 1P5UA 4NM8L 3NIFE 2QT9A 3F58L 2C0QA 3KXFA 2FIKB 2HH0L 5FKPA 3HZMB 2ARJQ 4G6ML 4NKOB 3TBVA 3OXSB 4BSWB 15C8H 1Y7HA 2E6JA 3H17A 3WWEA 3GM0A 1WC7A 2FSEB 2RHEA 3VRJA 4GBXA 4XXCA 5ALCL 1WEJH 2GSGB 2Q86B 1TFHA 4QHNA 4ONGH 4JKMA 5C7XH 2PTUA 4XMPH 4DNFA 2IQ9H 5JIHA 3EO9L 4AEHH 5HY9A 3I2GA 3JZ7A 1W76A 1MFBH 3A70A 5CBKA 1LPOA 4PP2B 1IGJA 4PJEE 4EXKA 3VWKD 1NCDH 3KXFE 1T7YA 4GRLC 5DMGD 2ATKB 3RGVC 3OPZL 5TF1H 4XP5H 7YASA 4FP8L 5JZ7D 1LD9A 3SO5A 2DL9A 1QNZH 3QXVA 1VFMA 3RX8A 3SKJL 2ZKHH 4XVSH 2G75A 1P4IH 3OGOE 4GRWB 1A14L 3BEVB 3C5ZD 1XZEA 2A77H 3O95A 5F44A 5EBMA 3C5VA 5D6OA 4ZFGL 3FYUA 2XUGA 2MPAL 5I8CA 2NY1C 1EFQA 5EHQA 2Y6VA 5J3HD 2B4KA 3QIUA 1NCCH 4KPHL 5F1IA 4OLUH 4AQDA 4HDIB 2GTWB 3HCVB 2J8UE 3I6LD 3QUYC 3JV4A 3H2JA 3CVHH 1IAIH 3N85H 4WW2A 3JWDL 1DX4A 3M07A 4DJMA 4P2QD 1GCFA 4Q9RL 2AJVH 2FDBP 4EY5A 4U2FA 2G2RB 4M8VA 3UTZB 1P69B 2BNRD 3UMJA 2JJSC 2G5BA 5IB2A 4HZAA 3RVWD 4I5BB 4ACPA 1UENA 3ARFB 4DWHA 2J12B 5JADA 4WW2B 4KK5C 4G8BA 1K6QH 4MNQD 4QTHB 2C4XA 4HQQH 3IBTA 3EGSA 3L3OA 3ZYOA 3W5NA 4K2UH 3C08H 4LF3B 4X6YA 2WUGA 4LCIH 3R40A 4OLVH 2EEPA 2QXUA 4R26L 4L4TA 4YZFE 1EAPB 3CDYA 5ITBL 1VFBB 5F7WC 3GMMA 3NCJH 2OCFD 4PD4K 4JO1L 1K4DB 4ORGA 4Q34A 1EBPA 1E4XI 2EIZB 1OTTC 2DLTA 3STBA 1UXOA 2ICES 3L5WB 1P7HL 2DRUA 3I50H 1IGML 3KGRA 1AI1H 1SJHB 3S96A 4NKMA 3EYSL 3AUKA 1ZD3A 1E5TA 2VXSH 3PQYE 1MREL 4RISH 4OB6A 1XAUA 3O4OC 2CRZA 5LGKA 4AL8L 3DXAD 3PHSA 5KSUA 5I1DA 2ENYA 4JLRB 3WIIH 4U1GC 4Y9SA 3E2HB 2HJKA 4C89A 3VFTB 1MCFA 1QQDB 3IJSB 4MNQE 2WWMC 3HC7A 4MAUL 1E3QA 5IHLB 4F57L 1HXMA 2BVQA 2YKLL 1U42A 2ZUUA 3CX2A 1JWUA 4NQDE 4ZXBB 4DOHB 4KK8D 1JU4A 1YEFL 4HT1H 4FQXD 2DN7A 3GIVA 4NWUH 4G9FD 4C59B 1EZVY 4L8CB 1B4RA 1DBBL 1GGIH 3S7GA 1TQHA 5EO9A 5ABDE 2AXJA 2BVTA 3OF6A 3F7PC 5K9OA 2H9GA 1PLGL 5L2JB 2NXYC 4FMKA 4LASH 4Q6IA 3FVRA 3P3YA 5DJZB 2FGWH 5ALVA 4XTRD 5HHPB 4M00A 1GGCL 43CAB 3CFDA 1OL0A 1WBZB 3HC0A 1AD0B 4U49A 3IAGC 2IIVA 3QQ9D 4ARBA 1BOYA 4R4NC 4AO8A 1UJTA 4KAQH 4BP9A 4F7TB 1DQJA 4KUZL 2R8SH 4G6FB 2GJZB 2D0HA 3C60B 5ISZA 4OQTH 1TDQA 4S1QL 5IF0A 4NRYB 1KIUA 3C43A 1GIGL 2VDNH 1IGIL 5JIPA 1IM3A 1KTRL 4Z7NE 3RAJL 1YB7A 2WANA 3MNVB 4PJCB 1JI2A 4OGAD 3L5IA 3V6BR 2RIPA 4PRHD 5E00B 4M43H 4EI5B 2GI7A 5EC2A 5BZWB 5SYMA 3DYOA 3NAAL 3WL7A 3FOMA 5K3AA 3GSNA 2BGRA 3V0WH 1P7QA 1IM3B 1CFTA 3I85A 1MCPL 1KLUB 2Y1VA 3PWUA 1X4YA 3MREB 3VJMA 4BQ9A 1HHGB 4BKLB 2EC8A 3RRQA 4JQXA 1CUUA 1MPAL 5K93A 4KVCL 4OZGA 1ODSA 4GRMB 4RFNB 1J5OL 4ZDHB 4KQ3H 1UXWB 4PJIF 1L0XA 1ZV5A 4I2XB 2XWBA 3JV0A 4X80L 3WN5C 5DR5H 4D0DB 5LKAA 1WLHA 3VGDA 1BLNA 1W0WB 1Q38A 1N5YH 5DJ2A 1UWXK 4HIHB 4GHWA 4MS8D 5TE7H 3GJEB 4HJ0D 4IBLT 2VRAA 3ALWA 4QLRA 1HHKB 3KJ6H 4R2GD 1FIEA 2Q7YB 1KN4H 1XCTA 4CU8A 3O6LL 4AENA 5CH8A 3QEQE 3STZA 3T65A 3QJHA 4B7IA 3DX9B 3MLPA 1I3GH 2WK2A 1KCLA 1GQSA 1MX5A 4JZJA 3GHEH 1TVBA 4TGLA 5AM3A 5FDFA 2PSFA 1LPAB 5BVPL 4CI9A 4U6XB 5GGSB 1NCAL 2D7QA 2RAMA 1CBVL 5HYSA 3HZMA 4FMFA 2M26A 5HYFA 3VXRA 3DCNA 3RWEB 1G7IB 1KJ2B 5D5MB 1T7XA 1NL0H 3DUUA 2HFFB 4ZAKD 1TVBB 1FNSH 1GKKA 3EO9H 4AEHL 5EUKA 2A2QT 1UM4H 1P0MA 5E5RB 2MFNA 1MJ8L 5A71A 2HTKC 4JO4H 2HN7A 4Y7DA 2AK1H 3ULUC 3LN5B 4YHML 5EB9A 2X70B 5IM7B 1WIUA 3RA7H 1EK2A 4QGYA 4W63A 3T0EC 1DEEA 3VXRE 4X91A 4HK0A 4QRSA 5GRYA 4Y4FC 4LLMB 3K2MC 4OD1H 1QIFA 4FZEL 1MNQA 1WSST 2KQNA 4YXKH 4Q3KA 4ONGL 3WN5B 5C0FB 1RZFL 2A1WL 1GOFA 3PABA 4FQCL 1NGYA 2CKBL 4BZ1L 2OCGA 4GKNB 1ZD2P 3M82A 3G6AB 4PJEB 4P46D 4X95A 1IGMH 3DOSA 1UK8A 2EDCA 5BZDA 5D7BA 2A83A 1U3JA 1S8DA 4DN3H 1NCCL 4KPHH 1EX9A 4ZPTB 3DJYA 4V2IA 4LOUC 1NDGA 5F1IB 3LP5A 1YEEH 5DUPL 1KJ2L 2XWTB 1FAIH 3PABB 5KVFH 3N85L 1WFOA 5JOPD 4BH7A 3WJLA 1F90L 1Z68A 5JOEA 1K85A 4PB0H 5JLZB 4JQXC 1KEGL 3G0BA 4ZAKA 2OXEA 3H7BA 1H2YA 3PJSB 5DJCA 3HC3H 1X4ZA 3O81A 3UTPD 3P0VH 5DSCB 1ZA6A 4J4PC 3EOTL 1RVFH 3RDTA 4NZZA 3HRHA 2R0WH 4HMDA 3RDTD 2Z92A 1A6PA 5D1QD 2ESVA 1BN6A 4BYHA 1NCWH 1JV5A 2LU7A 1CFSA 2ZPKL 4ZOCA 1ZI9A 3EHBC 5E94B 5FV2A 3VRIA 1WWCA 4XBGA 1GGUA 4OT1H 5GISL 4WEBL 2QZPA 2DI7A 1GPNA 4W1PA 1EBAA 3U83A 2V2TB 5AAWA 5J6GA 5CXXA 3MRBB 2NNAA 1WOMA 3IVKA 3MGTB 5I17B 2YUVA 4U3XA 1JV5B 1EVTC 1OB1A 4NDMB 1CUZA 1QLFA 3THML 3BE8A 4YFDB 5FHAL 1ZLUK 2ADFL 4H20L 2JB6B 1DTUA 1JMYA 5JOFB 4LSRL 2ZUYA 3MV9E 3QIBD 1YEHL 5D1XD 5EBLA 1CU4L 4Z6AT 4I3GA 3SGKA 5IUSA 4DGYL 2BNUA 3AZPA 4MD4A 3OM8A 1IKFL 4J6RL 1PKOA 5F7DB 2QKYA 2VB5A 4YDJA 3AUVA 1DLHB 3HCVA 2KH2B 4FFYL 1P84J 3V7AE 5IOPA 2F8XC 5DD1H 2R1YB 4UUJA 4DN4L 5L7XL 2C4FU 3PFBA 2HTKD 4TVPH 3QP3A 3MJ8B 4S10A 3PWPB 5E8NB 5FO7B 5EU6A 1CI5A 5DQJA 2E7LA 4PJDA 4IRSB 2AJYH 5LGJB 3CIQA 1FLRH 1C7SA 1X6LA 4L3CA 4NQDA 3SQOL 4XPBH 2V17H 5F21B 1XGUA 5KJRL 5KVEL 5E8DL 4XCEB 4KKBC 4UV7L 2X09A 4PB9H 1CUFA 4HIIA 4WRLA 5DQJB 5ADOL 3HNTL 1KN4L 2NTSP 4NS4A 1D5MA 4TSCL 2QADC 1PZ5B 4HJJL 3TPUB 3JW8A 1AGCB 4AO6A 5EWIL 3NMEA 4FQHA 4PJ7E 2XMSA 1W2KT 3V7MA 2E27H 3WHXA 1NBYB 4EUPG 4EQ3A 1OTTD 4HIIB 3DYIA 5HHNB 3W9DB 2FH8A 1E27A 5H8DA 2OAGA 3ICVA 3ZPXA 4FQXA 1EHYA 3CFJA 1U41A 2IANE 5JUEL 2OTWB 4RFOL 2DQGH 4DFHA 2DTML 3DX7B 3U1SH 3ROLA 3OKKA 4Y5VB 1HDMA 1DU4A 3SDYH 3MRJA 5LGHL 5D7IF 4MJIA 2XE4A 4TTDC 2XTJC 4NYLB 3ZV7A 4OJFH 2PO6C 1FFOB 5F9OL 1E27B 2X1PA 4WDIA 5D2NA 1MCPH 1A6TB 1H5BB 2R29H 3S4SB 4OB5L 1ZE3C 5DK2A 4M7LT 5CZVH 3WD5L 2OLDA 3L3KA 3AS3A 5HYJD 1JK8B 1UXWA 4HUXB 2WBJC 1P53A 5D3KA 1RIVH 2QUAA 1I9IH 3G6JE 5EZOH 5DEZA 2QXTA 3MLSH 3WKEA 4Y89A 3JXAA 1ZGLM 1P7KB 5J89A 1E28A 3NFSL 2PUJA 5HHPA 3VXUE 3B9DA 5AKLA 3I2IA 5IQ9A 1DJSA 2BVEA 1UOQA 4HK3J 4NRZA 5A2KH 4S11A 5I1AA 5JMRA 1LQSR 1N8ZB 3RVUC 5HDOA 2XLBA 1BZ7A 4HC1A 2AXGB 5ID0A 5TE7L 4DTCA 4U1KA 3ZE1E 5K3EA 4Q9QH 5FGCB 3H8NA 1WUNT 3DHJA 4PTUA 1G7LB 4LCWA 3W11D 1I7RA 1H8OA 2IX9A 2ACKA 1FZMB 3DJ9A 4LU5L 1WZMA 4B53A 5CJOH 1AQDA 5IMLA 4M6NH 1OM3L 3FQWB 4IMLA 1H2WA 4NQED 2DIAA 2J2ZA 4MSWA 1NCWL 2Z0BA 1YPZB 3T0BA 2VSCA 3DMMD 5JD6A 3KPRD 1NCAH 3QJFB 3H2KA 4EKXA 3TC9A 1IM9D 4EI5A 1U3HC 3LKRB 2DIBA 4PLKD 4WEBH 3GSNB 2XIDA 3MV8E 4XP9L 1BZQK 4ODUB 3QEUB 1JNNL 1KCSL 3C6LA 1IQWH 1MUJA 5FYLH 3SJVE 4KRPD 1W0VB 4FTVE 2V5SA 2YRZA 3MLWL 4JFOA 5J1SC 1XF2B 3P2TA 1QIGA 3O2WH 1UM4L 4UIMB 3EBAA 2EDEA 2CK0H 1ODTC 3G9XA 3SCMB 3RPKA 4XP6L 3I3BA 4UBOA 1LDPH 3A6CL 3QUML 5F1NA 5AWNL 4LLQB 3KPRA 1S8DB 1PW3A 3MROA 4DGYH 4ZFFB 4Z8FH 3O4HA 4PJAF 4RGNE 3S88H 4OCYH 1MELA 4GBXC 4MXVE 5I1KL 3WNKA 3IUNA 1AR1D 2XMGA 3PWJB 5KG9A 3EOBA 5DFVD 4YHZL 3O45A 2R1XB 1LPMA 2CLRA 5B8CC 5C0RL 4HUMB 4FFYH 4OLXH 4X6CB 3DNKA 4Y19A 5EUOB 2AI0L 4OCMC 3DVFA 3N1GC 5IROC 4JZJB 2YPKB 2H8PA 4GXUM 1R4ZA 2XQBH 1F58L 3LQAL 1ERNA 4YQXL 2C7UB 3QWOB 4ZUSB 3DV4B 2OBGA 3LCRA 1URLA 4GG8A 4JRYE 1HOCA 2DIJA 4O5LH 3TT1L 4PUBL 3RIFK 5KS9A 1T0NA 1F5WA 4M1DL 4PGDB 2X4SB 4Y5VC 4PGJA 1T03L 1FORL 1NGXB 1KPRA 4M7LH 3EBLA 3NTCL 4XVTH 4DCQA 4MXQC 2QTEA 4F33B 2C9AA 4MA8L 4C83A 2VIRB 5ADPL 5DMIH 4LLYB 3W2TA 1Y18B 3DX8B 1VENA 4DK3A 1O0VA 3JV4B 1RUQH 2GUOA 3EYVA 5HFNA 1WB6A 5DFWH 3PGDB 3QUMB 1NC4A 4XAWH 1N5RA 1GXSA 1VEPA 2IMMA 3DVNB 4OM0L 3W39A 3S36H 3ZKQD 1VA4A 3ILPA 4KROB 5FOQA 1I1RA 1OSZB 1ZMYA 3WEXA 3TESA 2JBWA 2DQEH 2GCYA 4M8QB 1QHOA 2AJCA 4Z7OE 1K4YA 5AM2A 1J18A 4WY7H 4I8DA 1NSNL 5C3TA 4QNPE 1EHXA 2BNRA 1LD9B 5GISH 3GSOB 5JNYA 1U8PB 4TVPD 4F8TA 4FA8A 4W1SA 1MCWM 5KVDL 1QSFD 4IO0A 1H3XA 3TO4B 4UBIA 2BSSA 4E14A 5FFLA 2W0FA 3EJZC 3CZFB 3H7LA 1U8QA 2VA9A 2SEBB 3QNXA 3OR7A 2VE6A 4KMQA 2AJ8A 3JWOH 2BSED 4JKKA 3MV9A 4G9FA 4LPUA 2Q6WB 3SKMB 3GKWL 2Y72A 1GZPB 4PP2A 4P23D 2BVPA 5D72H 5DD5L 1WCBA 2OK0H 3WXVL 4U2EA 1TZIB 1EAPA 3HPLB 4DUVA 1QFPA 4WGWB 5GGSY 3VWKC 1JN6A 5FOBA 2XMBA 3TGXA 5A2IH 3HUJE 5C0CA 1DANU 2EYTA 2Q76A 1FV1B 3GMOB 4GQ9H 4IRZH 3TF7C 2CUIA 4HKXA 1FBIH 2JELH 1EK3A 3MODH 4UV4L 4Z7OF 3WLBB 25C8L 2VL4A 4CFSA 4CL7A 1OAQL 1IUNA 3BQUC 4EDWL 4YX2L 2G5BB 5E2TL 4NQCE 2CIIA 1Y6MR 3E3AA 2HA5A 1CE1L 5D1QC 1S9KC 3CDGA 3TWCH 4D0CA 4TQEH 1CF8L 3ET9F 3RJQB 2NY1D 4U2GA 1JFQH 5GPRA 2JJWA 4JQIH 4ZUVA 3A0OA 5F8RC 2W0KA 1CIUA 1A3RH 3IAPA 4ALAL 5IH7A 3GSNL 2XTJE 5J11B 4GBXD 1EXUB 4JDTH 3MGTA 3REVA 3QPQC 1EGJL 1R9NA 3MR9B 4MWFB 4R6UA 2VJAA 2X42A 3KLAB 1F2XK 1HQRA 3MJ9A 3PQYA 3KXFB 4LVHB 4U05A 4F15C 1YYMH 1HBJA 3MA7A 1BD2E 1MJ7L 3RFZC 5JIKA 4NQVB 1CLZL 3EYUL 3NFNA 1IE5A 4BE4A 1NUFA 5EBWA 1FZOB 2W0PA 4JB9L 4QRUA 1MX1A 2EH8H 2NXZC 4G6JH 4U2ZA 3MRKB 3SX4A 3HE7B 4OZIA 3WKAA 2BX5A 5EU3B 2I07B 2JF0A 4JFDA 1CUYA 3PWPE 4PB0L 5HHMB 3DROB 2DLFL 3QPDA 1WVZA 3OB0H 3BH8B 2VLKD 5CILL 4GLRH 1EGJA 3WFDL 3V79C 1IUOA 3REWA 3FB5B 3BXNA 4I3SL 3KPMA 2DM3A 4I0PC 2XTJD 2EE6A 1YNTA 4NZTL 5HYJB 1M1SA 2EYRB 1MRFH 4JN1L 4LHUA 2PKYX 2ZUQC 1IT9L 2BUAA 3RK4A 2VN4A 1KCRL 1R5IB 5LZ8A 1CN4A 1ZT7B 3ARFA 1RMFL 1FL3A 3NABL 4X8JB 2WLYA 2EECA 4EIZC 4C4KT 5HHXL 1JF1B 5JQ6L 1DTEA 5GRWA 1Z5LA 1ISPA 3UJJL 4OCXH 4PJHA 1YB6A 2Z5GA 3IDJA 1JPFB 1KTLA 3ULVC 1TPXC 1J7VR 1ZT7A 3U4EA 1OAUH 4UAOB 4HWEL 4QNPF 2A74A 3OAUL 1T7WA 1YJDC 4ZNCD 3MC0A 1KGCD 1KB5H 2CO7B 4P23A 3ROOB 4O5LL 3TT1H 1SVZA 1XGTA 5CCKL 4PYGA 5ALCH 1FCGA 2P8MA 4J7AA 3TZVB 5DWUL 4XWGA 4WV1A 3I6KA 2CJUH 5IFAL 1LZKA 4KJWC 3BDYH 1N26A 3UUFA 2RCSL 4FFZH 3RVVC 1BE0A 4JJ5A 3WKDA 1OLLA 4OM1L 4NKMB 3UBXA 1LO0L 1NANI 5ALIA 1G6RA 1KFAH 3W0WA 3P30L 4L8SC 2P8PB 3KPPB 1NAMA 4X6EB 1IEHA 3ULUD 4LRIC 4XP5L 5AOCA 5HYEA 2VDLH 2BHYA 4J0DA 3MRFB 5T1LD 3H6JA 3MLTA 4CN1A 5ALXA 4NQEA 5I15H 2JGMA 5I8EA 1MCBA 3BZEA 1JZ8A 3B6SA 4JEIA 2V5RA 2NY6B 1T5WA 2OQJB 1CUGA 4NO3A 5ENWA 5E4YA 2BNQA 4C56E 5DNWA 3OJMB 5F9DC 1FFRA 1IEBB 1L4IA 5MEPB 1T83C 1WZLA 3LY6A 3HR5A 4P2QB 3DL4A 4I18B 2MPAH 5GRVK 4YXLL 2XZAH 2Z8RA 4X0KB 4EVNB 2G75B 1DBML 3LKSB 2VLMD 3RZCD 3L3JB 4Q6IB 4ODSH 1QLRA 2AJSL 2HG5B 2Y7QB 3F12A 5KANG 4PLJD 2J88L 2VISA 3SDDB 2LAAA 3FAWA 1CICC 1M6OB 3DRTB 3MUGA 1JJUA 1WHTA 5GGQL 2R4RL 1OD9A 2G9HA 3VA2C 3DV4A 3LEYL 5D6DC 4AZ0A 4JFHE 3KPQB 4B84A 5ESVA 4GQ9L 4IRZL 1NDMB 5K3FB 1K2DA 4IEFB 3WE6B 2ED7A 2VXUL 3U30C 1DQZA 3I2JA 3JBG7 3IETB 5L2KB 3QUXD 5EUOE 1RHHB 3NZ8A 1F6AB 4RGOH 5F96L 2FIKA 4TUJB 5D7LB 1U3HD 1DBBH 1GGIL 5FKPB 5IWLA 1EDQA 1BN7A 1KT2A 3O4LB 1GYAA 2OXHA 1RZ8A 5D5ME 3OJ2C 5BS0A 3WV0A 3QIWA 3BPCB 1EMTH 1D5BB 2WQRA 3IETA 3KLSA 5KBNC 4Y2DD 3S3PA 3LS4H 1G84A 1IGJB 4HKBA 4FABH 4RFEA 5GHWH 4YDVB 5EU5B 3UTPE 2ATKA 1EEUA 3AS0A 2IPUK 1MFBL 4HH9B 1CE6A 4GRWF 4NN6C 3ZE2F 4LCCC 5ALGA 4OUUA 3FRPG 1M05B 4YK4C 3C2AH 1K3ZA 1NC2A 4K5QA 5IW1B 3H19A 2GQHA 1VE6A 2ZJSL 1QRKA 3DI3B 1UVQA 2A83B 4D0DA 1I3UA 2FJPA 4YLQT 1BFOB 4OU5A 3RX5A 3ES6A 5F7MC 3GUTB 1O5DT 5I17A 5ALQA 4O2CB 3V4UL 3G6DH 4EN3D 2CPCA 2WQZA 2D7TL 3NA9L 5CT8A 4H5SB 3OKDA 4M43L 3WQHA 2JGLA 4GKZA 4HS8L 4B83A 2PW1A 4JN1H 1X44A 2YHGA 3MFFB 4QRPE 4NVRA 3WIHH 3BT2H 3U0TB 4F7PA 3UTOA 3OJDB 3I9GH 5CWSB 2H26B 4CIBA 4HPYL 2W65B 2BCKA 1CGUA 4PJBE 4Z0BL 2UVFA 2ZOLB 1FNGB 2W6CX 4UHHA 2D4DA 5CP3H 5CSBA 4IOSD 5DDHA 3O6MH 4EDWH 2PN5A 4WUUE 1V3MA 5IVZA 2GSIA 5D96C 5EDXA 3NAAH 2P24A 4WFKA 1JNHB 4MWFA 1G42A 1N59A 3TIEA 3OJDA 1OARH 5FYKH 1GAFH 1KN2H 1SEBB 3VH8B 4BVLA 4ETQA 3SCMC 2APFA 3BF7A 2R56L 2QJDA 1HSBA 3ISWA 3P9MB 4ELKA 1B2WL 1I3GL 2Q20A 2VDKL 1IC7H 1FZJA 4Y1AD 4PJ9B 4POZD 4YHKL 4N8CH 1H3WM 3RTQB 5LIPA 1G1YA 2FATH 2UWEA 4L4TE 2GYSA 3WUWG 4ZTOH 1L0QA 1Y0LB 3WUWA 3VI4F 3TN0D 3RKSA 1M71B 1J0HA 2M8XA 3P9LA 1DDHA 4KTEH 5F70A 3U4BH 1Z0MA 5I1CH 5KSBF 1LDSA 5DJDA 4N0UB 3O41A 4Y2JA 1MCRA 4J03A 3ME0A 3D18B 1T21A 4DVBB 1MPAH 2JEYA 4YBQC 3P40A 3WHXB 4ZFOL 4DUXA 2GTWA 4YDIL 1J9CT 5C70A 1YEIL 1A0QH 4KMLB 4DW2L 2AEQL 1RIUL 3ZHKA 4JFFB 5GRUH 5KW9L 4DGVH 3WXWL 1IM9B 2OLEA 3D18A 2HVKB 3IXTB 1KC5H 1I1YA 3MUZ1 2ICWJ 1B6GA 2WJ4A 5EIAA 3GZJA 4IH9A 2H9GB 2V7NA 3GKZA 2PF6A 4D8PA 4KKNA 1IT9H 4YJZL 1CEXA 4ZFZA 2HJLB 2ADIB 5EIIA 4AY0A 1UM6L 5EPMA 1Q1JL 2AJXL 4YHNA 5FO7A 3PJSA 3RWHB 3GMLA 4J3XA 3C6LC 4PJAE 5AM5A 1YZZA 4PJHE 3VISA 3O4LD 3UJTL 4EI5C 2VXUH 2PW2B 3FHQA 1QQDA 3RWGA 1YYLH 4XH2A 1ZOIA 4MJIE 1DVFD 3VFPA 4LPYA 1PSKL 4HAGA 3PWLB 1TLKA 1DVFA 4YHOH 3QNYB 3VW3H 2FLBT 4MYSA 3MRFA 2DQTH 3OZ9H 1MAML 3MRJB 4KK8C 1YMHA 5INDB 4ZTPL 2CJUL 3IAQA 3HI5L 2AXFA 2X2YA 1AC0A 1IC1A 4G8EB 2EYSB 4UBLA 2NY2C 1IC5L 3RI5F 4OQ1A 2Q3AA 4OCSH 1CXHA 5F7YC 2O61B 4H7EA 5E2IA 4GMSL 5F8QC 4LHUB 4I0PD 5TE4L 3RBGA 4P2RB 1T2QH 1USWA 3ORJA 2B0SL 4KHXH 3H9HA 2JJTA 1CF8H 4YR6B 3WDIA 2EXWC 3L3JA 4KXZH 5F4ZA 5ETUA 1WTGT 2WAHA 4PG9A 1MIEL 4EN3B 2XUDA 5BZDB 1YEHH 5F88B 3ULUL 5GIRB 3PE6A 3FQNA 2JGFA 3SKNB 3IDJB 1MNUH 2X7LA 2X41A 4W70A 2KPNA 2EC9T 5J6HA 2PVSA 3NPSC 3IJYA 3AM8A 2A6IB 5LCVH 1RU9H 3VXUB 4NZDA 5D70H 4PGEB 1RUPL 4X7TB 4LPTA 2PSEA 2R11A 1KTDA 3HMXA 3QQ3A 1KJ3H 2FEEL 4IRJC 4N5ED 4PBWD 3LRSB 5KTEH 1A7UA 5GGRY 3K2UH 4I2XE 5B38B 4DN4H 5T3ZE 1BQHA 5L7XH 4B82A 4PS4H 4XPHH 1JRHH 2WM0A 3U6RA 1ZVYA 2ZCKL 5DNVA 5FA3B 5LQBH 1P7KA 4X5WA 5HVFB 5D7JB 1LPBB 1NGQH 3ZL4L 3DX6B 1FQ9C 3QZWB 1P4BH 1J1PL 1IKFH 4J6RH 3V0AC 4QXTA 1JZ2A 4Y2OA 3MA9H 1Z9LA 1ZSDB 4TTGA 3ARBB 1C5BL 4QDTA 4JDZA 4YHPA 5I7UA 2DJUA 4FFWA 2X4NB 2AXGA 1U8NB 2P5EA 4N1HB 5D7JA 4MB4A 2X1XR 3OX8B 5LXGL 3MZTA 4FQJL 4MGXA 1M4KA 4HH9A 4DUWA 1JGUL 2BNQE 4XVUC 4PY8I 5HHNA 4PJDF 5SWSD 1XF2A 5GRXG 5E8EA 4HS6A 2UY7A 2VDKH 1WQVT 4JPVL 1D6VL 3T4AA 3MACH 4W1QA 5A6VA 12E8L 1QACA 4OZGE 3VMOA 4X94A 3D69A 4B0PA 2H7CA 1BZ9A 5I1JL 4BTVA 3VE0B 4Y4KA 5EO9B 3IGAB 1BJ8A 5CEZH 5MEOA 1A8QA 4CG2A 5D3ZA 2DTMH 3A6ZA 3C45A 43C9B 3KPOB 4GO6B 3ZKMC 1QPPA 3FONA 1ZVHA 3BN3B 4JJHA 4NKQB 2XXCB 3QFJB 4X6CE 2E7HA 2DM2A 5SWZE 4R90H 3VXTA 3W05A 3QWOA 3RWDA 3BE1H 1BZ7B 5DYWA 1XZ0B 3I6YA 4NZUH 3V4VH 4P59L 4HRXA 1CD1A 1J87A 4YAQA 5C9JB 3HMXH 2H7XA 2VQTA 1JHLL 5CMAA 3RBSA 3NIDF 1DN0A 3HUJF 4XNQA 5KOVC 2AV7A 3T3PE 1GRWA 3LEVH 1D9KD 4LRNH 5JW5B 1NMBH 1V5JA 3O6ML 4NQSB 2MKWA 4MSWB 1JN6B 3ZE0E 3QIWB 5FOBB 1U8HA 5HHQA 5AKZA 4K94L 3DX8A 1F4YH 2R0WL 3GI9H 1JNHA 5EZOL 4JPIB 4TOYL 3G6AA 4PJEA 5GGVL 4KXZI 3BW9B 3QI9D 2Y6SC 1CUJA 1EVQA 4MA7H 5AIAA 1FFBA 3H2HA 1YEJL 3O3DA 1YJDL 4HGKC 1ZLVK 2A38A 3TPUA 4L4VB 4PGDA 4OFVA 3QYCA 2IEPA 3IFNH 3TO4C 1NAKL 5DHXB 3WK4A 4NZRH 5E95B 1CPYA 4QRSB 3SDXB 4LLMA 3BZ4B 3MRPA 4XMPL 1A14H 3D85D 2BNRB 1CDIA 2YD3A 1AJ7H 1S7QA 4EEEA 4P2OC 3VFVA 3C60D 2P5WA 2YC1A 4K6GA 4LK4A 5HHOA 4LGSB 1W72A 4I48A 3K4AA 3AMKA 1C7JA 5KZCD 1QSZA 2D0FA 5C0CE 1DQTA 1LEIA 4ROTA 3MCLH 1MHPL 5FM5O 1A7QH 5FGBC 2BHZA 4NIKB 2BRQA 1T21B 1HHJA 1AURA 1XF5B 1YAJA 3PWJA 4HFUL 5HI3C 5FKAA 4H8WC 3FSGD 3WLAA 3NIGE 2Y5TA 5CFHA 3P4OB 4G9GA 2ESVB 1BOGA 2NY4C 1CXEA 1I8IB 1D9KA 1E6OL 1RIUH 4PRAB 1LEIB 1R3JB 2BOBA 4PRHB 2VL5A 3KNBB 3FAXA 4MQTB 4BFBD 1FVDA 1ZHKB 3ARUA 4HAIA 5KS9B 1Q9KA 4BBZA 3MLYL 2JLLA 4UQ3B 4NBXB 1UJ3C 3ESDA 1XMWA 4OZIB 4XVSL 4JE4B 1K63A 4FQXC 2ONCA 2DHDA 1VCAA 1E28B 2XA8L 1T66D 3INUL 3PWPD 4ZXFA 4KRXA 4K3JL 3WO4C 4TUKL 2OJEA 3R3YA 3HTLX 1DSFL 3D39B 3ZE0F 5DEGA 1CVSC 3ARVA 4Y16D 4PJFF 3I2FA 4RWYL 2E6PA 3KHQA 3H9SE 5CJOL 3DKRA 2MHAA 5DRXB 4ZV9A 1E6JL 3LSOA 4CRPA 4IHOB 5D7SL 2GAZA 4Y5YC 2NNAB 1NGXA 2FBJH 3BPLC 3C2AL 4K23L 3I1IA 4QDOA 1PSKH 2X4RA 4ISVA 3BJ91 2GIYA 3MOQA 3BEWB 5HF8A 3EAKA 1CLOH 4P99A 1F11A 2EDNA 4Y2DA 4JYMA 1KB5A 5BJTA 1K8IA 1NGWB 3L3GA 3FB8A 2ZG3A 4JKWA 1EHLH 1JPFA 3O41B 1D7FA 3S9DB 4YHZH 1KJMA 2O5XL 2AXFB 3OKKB 5JAUA 2D2OA 3E6FA 4L0CA 1N6QH 1MCEA 3VXKA 2PR4H 3PL6C 2RB8A 1AQKH 1DUYB 3WNOA 4I1NB 4X6CF 3HPLA 4Z7UE 4DMFA 2HLFD 4MJ3A 2VT7A 2HA6A 3X3FH 2Z31A 2QHRL 3AS2A 5I1IH 1INEL 4HKXB 4TVKA 5ACZB 3H9HB 2OTUB 2EXYC 2BSSB 1KOAA 2GHWB 4YR6A 1OGAA 1RJZB 4MNGA 3WD5H 2DFPA 2IPKB 4IOIB 5C9KA 2DKSA 1CZ8L 2ZUSA 4GSDH 1I9EA 4ZSOB 2BVPB 5D71H 4ZFFA 1UKTA 3DWTA 4JR9H 3NCMA 1NX9A 1F6LL 3GK8H 2BY0A 4X4XB 1PZUB 3N1FC 4Y19D 3T1FA 1IQDB 3CUPA 2DQUH 4PJHB 3GMNA 1MCWW 2OTWA 3D3VE 5E6ID 4Z78A 4M1DH 4RX4A 1D6EA 2DLEA 2H1IA 4G6AC 4ONOA 3UPRB 3H1AA 3G6JA 5CD5C 4KTDL 4JM2B 3BUYA 4BJLA 1ND0B 5J6GB 3VRLF 4N5IX 4ZUSA 1ETZB 5DRWA 3IU4H 4UBJA 3VU2A 1EHNA 1HYSD 3BZFA 2X4SA 25C8H 2FGZA 2DCMA 3TJHD 4BAUA 5D1ZD 5GGTA 5GGUB 5KTEL 3NPSB 5AYUH 2C5GA 2RAUA 2NY3D 3D25B 5TPWL 5FKJA 1P84K 2WIDA 4XPAL 2YA0A 1OM3H 3UTTD 5C07B 4TOYH 4U4BA 1GIGH 2VDNL 3O4JA 1FO0L 2N4IA 4K7FA 3D3NA 4LXGA 4H25B 3W9BA 4AN1A 1T04B 1UGNA 3PIQB 2NY2D 5D2NE 4N8DA 1NAMH 3VH8G 1T66C 4QXWA 5JPMB 3D9AL 2P7TB 4PSDA 4X93A 1N1MA 4AZ8A 3F98A 1YEGH 3MJ8A 4YWGL 2E9WA 5JZ9A 1QP1A 4OI8A 3WZLA 3JWEA 4KY1L 1II4E 3FQXB 3HZKA 3MV8A 4BH8B 2IG2H 3PP4L 5HDLA 3O2WL 4HQQL 1KB9K 4UTBH 1KV3A 1Q72L 1SCIA 3KPPA 3MV9D 4FTVA 4RZCA 2ZVDA 3F5WA 3TCLB 1I1AA 2ARJA 3CC5A 4MXWL 1G6VK 1QLRB 4HV8A 5DRZB 1QYGH 3AAZB 5D2LA 2WJ6A 1BQHG 1WAAE 1EEZB 3EYUH 1F3DH 4CNIA 3PDOA 5IVOA 1HH9A 3GI8L 3QO1A 4LFHG 1XQXA 3BP6A 3R1GL 5B39A 1M05A 4X9HA 4QF1A 1FYTE 1IEBA 4ZFOB 1N8SA 2F19H 3HSSA 1B6DA 2YPVH 4U7MA 5AUMA 3UTSD 4KJPD 3AAZA 4QT5A 3JWDC 5D2LE 4O9HH 4KAJA 1CQKA 3C6LB 5SWZA 2V9ZA 3OHXA 3MRNB 2R69H 4GW5A 1OTUC 1J12A 1U36A 2E3VA 2HFTA 3B5TA 3ARBD 3IXAB 3PHOB 3QFJE 5MENB 4UHCA 5ESRA 2MKLC 2D31B 4FS0A 4NFDA 2CLZB 4PY7A 3PI6A 1U8KB 1KF9B 4ENED 3FYTA 2BVOA 1DQYA 3PNWA 5IKCA 4Y5YA 4YXKL 1OAYL 3BQUB 1U95A 2ITDA 3P4LA 5IVXB 4XPTL 1NL0L 4P5MB 1RZKH 2J6EA 1TAHA 3QG7L 3D0VB 4GG6B 1B0GA 1U58A 2Z8WC 3AB0C 3G5YB 3GDBA 1PFCA 4YHMH 4KMTH 3VFVB 3MOBL 1OAUL 4HH8A 4MDIA 1JI1A 2WINA 2YBRA 4M7ZC 2BXZA 4JZNB 2OPHA 3ZTJG 2EIEA 3RNQA 2XA3A 3QIBC 5D1XC 1ROWA 5T3XL 3U30B 3OR6A 3QO0B 1CXFA 1R5WB 2IGFH 5ALMA 4M6AA 1NJ9B 4YNYA 1ZTXL 3G0DA 5KWIA 2UWEF 4B9EA 2EEBA 2P5WE 3LHPL 4LPVA 5EIEA 4Y16C 5C09D 2AKRB 2YH2A 1HEZA 3KPSB 1WGOA 4ZMAT 4F7CB 1QO9A 3D0LA 1XF4B 5DFVC 3IFLL 3WKML 1JGDB 3ULVF 1AFVL 4D3CH 4HWBL 1FIGL 4G9FE 3BPNC 5IW1A 2R1WA 3GMQB 4JRYA 1DN0B 4GG8B 2WLZA 2OCIA 3LIIA 1KPVB 1WBYB 3HAEB 2ESVE 1INDL 3SKUD 4JAMA 1SJEA 3KPTA 4BSVA 5DYYA 5IVDA 1B3JA 3B9KC 1FVCA 4HUWB 5FYLD 1ZEAH 2WBJB 4YE4H 3VWKA 4F9PC 1FN4B 3NGBB 4TPRL 2GT9B 4DKEL 3WIFA 4D9LH 1GGTA 5MP6H 3I6LE 3O3DB 1YN7B 2N1KA 1D5BA 1I7ZB 4HWBA 1TKRA 2VWEC 1Q9WA 1ZHLA 1JFQL 2V2XB 3MXWL 1FL5A 4OAWB 3DETC 1LHZA 4WI2A 2DWDA 4U1HA 3MGAA 1UCBH 4L3EA 4UBMA 4M48L 4DVRL 5ALBH 2WWKT 3AFLA 1GOGA 5CEZL 5DRNB 2AJZA 1N7MH 4CVZB 2EE2A 4APQD 5HY9B 2ZOKA 4LKXB 1WAAF 5I2IA 5IHBA 4PJIB 2YPLA 4B7LA 2NY4D 1HZHH 3E2HC 4MLIA 5E2VH 1NUDA 5HI3D 4Y2VA 4POZC 4CADB 1XZMA 2EIZA 4ODHH 3HXKA 2VTFA 4PRAA 4QOKE 1CV2A 4QOKB 2ORBL 1MEXL 3GMPA 4MMXC 5DVMA 1KG0A 2GJJA 4YK4B 3L3IB 2QR0B 1WF5A 4EBQL 3ZLTA 4XCNA 2P4AB 4LSVL 2HVJB 4H88H 3X12A 2ZYSA 4OZIE 1I9JH 4FFVD 4ZPVB 4P5TA 4R97B 2VLRE 4ZS7L 4HCRA 2VLRB 5GZOD 1QFUH 1UACH 1ZT1B 3VFOA 2ID5A 2IH1A 1EAJA 1JMZA 3K1DA 2HT4C 3MRGB 1J1XL 2C5DC 2UYLB 4EY4A 3GMNB 1F45A 3VXSB 1G6RH 2ICEA 4G42A 4OGYH 1HH6A 1SC9A 1Z5LB 1JPTL 5DVOA 4LMQE 1FFEA 4NNXB 1WM1A 5B38G 3UTZA 4UHBA 3HB3D 3KYNA 4LPXA 1MCHA 2Q87A 4NO0B 1OLZA 4QRTB 2GTZB 1MLBA 2D7OA 4Y5XA 1C7TA 3TFKD 4OZIF 2Z35B 4GECA 2BSTA 4RIRB 1R1DA 1CGSL 3SDDC 2W65A 4P4RB 5EU4A 2OZ4L 2R69L 4HLZH 3KPMB 1CXIA 4E42B 5DNUA 4CDGC 4MA3A 2HH0H 2FYYB 4E0RB 4M1CC 2XZQH 1HNGA 3DLQR 5HDBF 4QRTA 4X7TA 1B88A 1LO4H 3FLEA 2DOCA 4GRLB 3MV9B 5LAXA 2WTNA 3ILQC 3WK6A 2XG4A 3PHQA 1TETL 2B1AH 5L9DH 1ZI8A 1DE4B 4HIXL 3F7RA 3NBNA 2K3TA 3WJJA 2DQFA 1FLTX 4C01A 3MLZL 2VC2L 2DQYA 3ZDZF 5L88H 3TBWA 5E2WH 1UKSA 4X6FB 1CFNB 3BT2L 1QSEA 5AKJA 5JW4M 2E27L 3FFCD 5GGTH 4X9BA 5CUSH 2R0LH 4XVJL 2DJSA 5BWBA 1X3DA 1QTYT 5MERA 5FV4A 2HJKB 4Z7WA 1IC7L 4F7EB 3SKOB 2P48B 1G1CA 2F8VA 5TH2A 2CLVA 4P9HC 2XN9A 5HHMD 5HDBE 1DINA 2AABH 4KK9D 5JATA 1WITA 4C56D 5C8ZA 4BKLA 1YECH 2F19L 3DRTA 2Y4SA 4FQ1L 5EPMB 3ALPA 1IL1A 4W81A 5K33A 4M3JA 4MXWH 5IB2B 1G6RB 1OTSD 1V3KA 2YPLD 3J8F7 4LCWE 3DYVA 2AJ3B 2HVKA 3IXTA 3OAYH 4N8CL 4GKZB 4DKFL 3V6FA 2X05A 3M81A 1HQRB 2Z8VC 4LCCA 3W2DH 1TPXB 2A77L 4NGHH 4XGZA 4LF3A 1E4XH 5CP7B 3MLRH 4NO2B 5JO5B 2PX6A 1YNKL 3BO8B 1DR9A 2Q86A 4RMTA 3TJEH 1WHSA 1EFXA 1QBLL 1D5ZA 1FNEB 4LPCA 3QG7H 1I1FB 1QO3A 1MO2A 5E1AA 3KVQA 5IVZB 3WWDA 2GSIB 4F7TA 3AMLA 3ESBA 2IANB 3STXA 4P2RD 3RQ3A 1T22A 3KJ4B 3Q1SL 4KH2A 2P7TA 4L29B 4A5SA 5C0GB 2BOCB 3NGBC 3DKKA 3ESCA 2YK1H 1D5IL 3V5HA 3QIWC 4XI5C 4E9LA 2RIKA 4QDXA 2XN9D 3LVEA 1VGKA 4JFXA 5B8CB 1XKLA 2NY0D 4OV5B 5C8XA 4JFPB 3N9GH 1OAYH 4XPGH 5CHNA 1QVOA 1CR6A 4NHUB 4ODXB 3BP4A 5J4MA 4KKAC 3T09A 1ONQA 3QHFL 3DXAB 4I18A 2WFMA 4PNZA 1CQYA 3ARGD 1Q8MA 5ETUB 1K6QL 1U8EA 4XVUD 4L1DA 4TSCH 3O6FC 1AY1H 3V5HB 2OI9B 1U8NA 3DV6A 3DARA 1HINH 1BEYL 4W9RA 3V6OA 1NEZG 2I26N 2NQCA 1QVOB 3GSUB 4JKLA 3UAJC 1QIEA 1FYHB 4H77A 3BPOC 1S7TA 4H35A 3TBYB 2HKHL 4HLJA 3OAYK 9CGTA 3PUCA 3Q5TA 4RAVB 5I1KH 1S8OA 4KE9A 3E1F1 4K55A 4G9EA 1ZTXH 1EO7A 1PQZA 3S3SA 1IKNC 4OD2A 3MCKA 5HF5A 3TIDB 2QSVA 2O2HA 3B5EA 2ITCB 3ARDA 4YGVA 4OSUL 4YAQB 3IFPA 1U2HA 1XCTB 1T2QL 1Q0YH 4EZMA 4P4KC 4U1LA 4YDVA 3RX7A 4MQ7B 1YAHA 4QHLA 3FMGL 1PQZB 4WFGE 5FCUL 3VGGA 4U1SA 1KELH 4OB5H 3L3OB 4QRPA 4WUUD 5CSZB 4JDVB 1ZHLB 5ADPH 4BVKA 3HAEG 1MNUL 3MX0A 2GJZA 4IRJA 1U3HB 1LP9E 1WISA 1RJYB 4HIJA 5J12B 5I0ZA 3ZWQA 3RWHA 3BKJH 3QPXH 5AJHA 4J4PA 4L8BB 4X6BA 5ALSA 4Z0XB 1TQCB 4L8DA 2BRRL 1A9BB 2BSRB 5BOPA 1H22A 1W72H 5IMKA 4ODBD 1W1IA 1JGVL 1TJIH 5CBAA 4WUUB 5DUML 3O2VH 1F3RB 2P5WB 1H23A 2AQ3A 3OKDB 3CFEA 3Q6GH 3CVHA 5JHDA 3TA3B 3IYLW 2I24N 3O4GA 2P8SA 3RWJA 5JHDD 2HRPL 5TDPA 4GG6F 4S1DC 1ORVA 4GLRI 1CD0A 3CMOL 3LSOB 3VFTA 3V5DA 3SDDA 2BCEA 2ED9A 4O2CA 5F1SA 1VESA 2EKSB 2V2WA 5DJ0A 4XCNB 1F2QA 1T6VN 5C92A 5DHVA 4BATA 4YHLL 5I74C 1YQVL 4KV5F 4JPKL 2V9QA 1S7WA 1JRHI 5CJBA 3HRZB 5JOPE 4OKDA 1NGQL 3ZL4H 1P4LA 2ZSVA 4PJ5E 1WWWX 3LB6C 2WV3A 4WUKH 3T2OA 2UYLA 4BCCA 5BO1H 2NY2B 3RVTC 4WHTB 1MCDA 2ZNWA 2YD2A 4TVPE 5MI0C 1FVEA 5D8JL 3O9WA 1VEMA 1VKHA 3ETBF 2AGJL 1OW0C 5JIBA 2I25N 2ED8A 5TE6L 5BCAA 1CVLA 1U8OA 3TLRA 1NFIA 3KNBA 1TCCA 2GTZA 3T52A 1ZK9A 3D39E 2F15A 1N59B 3DURB 3SDAC 1AXSB 3IB4A 3OV6A 2XQFA 5ALWA 4OKVA 4G4GA 4FG6D 4DIUA 3VXRB 4KROC 1CLYL 3E3QE 3MNZB 2EDWA 3QDMA 2WUFA 3GB7B 1MCJA 4ELMA 4HC1H 3KHOA 4BZ2L 1I9RH 4TNVK 1J2EA 5E2TH 3WUZA 2IADA 3LKPB 1ZKAA 5KVGH 5CEYA 4KKBD 5HDQL 5E2UH 2BHUA 4N0UE 4NUJB 1Q9OA 1JHKH 2O5YL 4KZEH 3LKOA 4AQOA 3GJFB 5FA4B 4AEFA 3QIUB 3DL7A 4G8GB 3T4UA 1YA5A 4H1LH 1YC7A 3LZFL 4R90L 3QDMD 2WU3A 3F62A 3VDAA 1RZ7L 1RK0A 3CDCA 3ZZ1A 2EXWD 1FPTH 3TNMA 3HLAA 4LQFH 4KK6D 5JW3L 4MX7B 3VGAC 2DHEA 5J8OA 3I75A 2FO1A 3O3BB 5DURD 1JWSA 3N50A 4PRHE 1T1XA 1L0YA 2YS4A 1OAKH 3RZWA 5T5NF 5IOPB 2CH8A 1I3VA 2X1QA 3OSKA 2GITA 5EORL 4XZUB 3FO1A 4J12A 3QH3A 3VRJB 4DMCA 3HZOA 4DOHE 1UEYA 2FJGA 3KWWB 4AEIL 3T08A 3R06B 4R7NA 4Z7WE 5JPMA 2Z31B 4R4BA 2VUOA 4LARH 4EQ2A 1N5AA 2A6IA 2ADIA 2R2EB 1UQSB 4R8WH 2QOEA 1I8LA 4L5FL 5ISMA 3UJJH 1DQDL 4M93C 2X44D 4R7NB 4ZSOA 3HC3L 5ISZB 1IGTB 3SDDD 4HIEB 1XH3A 2F58H 5ISZE 5HGBA 3HI1B 2DM4A 5KSAD 1QSED 3KPLB 3GSRA 4HWEH 1PKQA 3QEGL 3T8XA 1A3LH 2D7MA 3D2UB 5GSVB 4WWKC 1LPPA 1VXOA 2BVUA 5ALNA 5DUPH 4LHUG 3UAJD 1H0DB 5KSUB 4RSVA 2ZUTA 5TQ2L 1HYSC 1R88A 1I7TA 3RGHA 3IRZA 5IJKC 1ND0A 1R3HB 1CCZA 5L6YL 3VD9A 5D96B 5F7HA 1P7QD 3TBWB 5ESQA 3C8KA 5AKGA 3DI2B 3NCEB 4OV5A 1ZJ5A 3NACH 4X7DC 2WBJD 3H0TB 4PJ8C 4H18A 3QZUA 4XMKH 3RTQC 2X4PA 5AI5A 1L6ZA 1LE9A 2FECI 5DYTA 2HTLC 2R2HA 4NKIH 1FFDA 3THMH 2HIHA 4CW1A 4CVXB 3CCCA 5FUOL 4HGWA 3D4LA 1C08A 5GS1A 2DBJA 5GS2H 4NKDA 3G6JF 4WU7B 5CIPB 3LPWA 1J8HB 4V1DA 2RI6A 1KIRA 2VN7A 3HPJA 4P2OB 4Q0XL 4UB0L 2HRRA 4Y4KB 5CT6A 1XZGA 4UUJB 1MJUH 4OT1L 5EC2B 3B43A 3EYOA 3VDXA 3ELAT 2DMBA 4EDXA 5D1ZB 5D7IE 1LO2H 3CVIH 4B0MM 3ARGA 1OGTB 4Y4FB 1MHCA 2HJLA 3KJ6L 1T1WA 3NA4A 4XNUL 5EIIB 4HUXA 5LVEA 4IRSC 2WUDA 1ZLSL 2QEJA 4U6YA 4Z7WF 4OZGB 2QJRA 2GW5A 4F58H 3MLXL 4YDKH 4KAQL 1XRLA 2AK4A 4LSRH 4UZGA 4RGOL 3HS0B 3HFML 2X4NA 1EO8L 3K8KA 2NTFA 2EO1A 4ZD3L 1GZ7A 1CR9L 4S1QH 3F65A 3MBED 3SDCC 2AJLI 2VQ6A 3INUH 3OHXB 5IBLD 1OGTA 4Y4FA 1S78D 1C1EH 3CFCL 4HV8B 4UQ2A 5IJVA 4HWZA 5DI8B 4AENB 1FGVL 2PTVA 4NN6B 4HKZA 4M9PA 3DX6A 4JANB 3RAJH 1SM3L 1P6AB 4UU9B 5EUKB 5J1TC 4M6OH 5LZ7A 4U1NB 5HVHB 4FABL 3UZQA 4H7HA 4JM4L 3VXMD 1QTIA 3ECBB 1U3HA 1C12A 4JDZB 4PB9L 5F9AC 3OWEA 4G4IA 3P11H 4GFTB 5DTJA 5ALYA 1KPRB 1A6VL 1AQDB 5GS0H 3BRDA 2DYPA 3OX8A 1HXMB 5DLMH 2XI9A 4F33A 5HCUA 1BEZA 2FJFA 1I7UB 1OVZA 4JY5L 5AEAA 4I4CA 3S35X 1G9NH 3BH9A 2JGKA 1IVLA 1XZ0A 2QQKL 4B7ZA 3WZMA 4ERSH 1OSZA 1MVUA 3O0RH 1WB5A 1S7RB 1YPZF 2E6QA 3KDMB 5I30H 3NCCB 2O7VA 3WK7A 3ULVD 1C16B 3DUHA 1MCLA 4RAVA 3WJ2A 4OLEA 1NMAL 4KTDH 4XCYA 43CAA 2BNRE 2F53D 4UINH 4MZ2A 5E0QA 3CSGA 1T1ZA 1F4WL 5M7QA 3QXDA 5A2LH 1KTDB 4HUKB 3G5XB 3GJFK 3PV7A 4NQDD 1XQWA 1Z2KA 3C5ZC 2FL5A 5DF0A 1XCQA 5A16B 3IU3B 3R3WA 3VFNB 1UA6H 1S9WA 2YSSB 1C16A 3SE3C 3HRPA 3O2DA 1A1NA 1FSSA 5MENA 1TQBC 4UBDC 3TJEL 4J3WA 3VFUA 1NEZA 2WBJA 4WIQA 3GNMH 1A6WL 4E41B 1BROA 1WFUA 5LZ4A 3RI5K 2XICA 1H8SA 2JIXB 2YSSA 4R97C 5E6ZA 3K9BA 1XGPB 2H1PL 3GMQA 4YK7A 5D7LE 4P5MA 4ZPVA 4X6BB 1SQ2N 3CXHK 4H0CA 4NDMA 4BAGA 1KEML 4PIRF 1NBYA 4D0CB 3QHTC 2A6KA 4Z77A 4J0CA 1LGYA 3R1GH 1U8MB 3UJIH 1X7QB 1JF6A 4L9LC 3SBWA 4LSTL 3QBJA 4UNUA 4K9EC 4F7MA 3BJLA 1JUFA 4KVNH 3H3BC 4B9AA 4GW1B 4M7KL 3GJFA 1EINA 4GW4A 2YPLB 3STVA 5CBEA 2W9DH 3A2NA 2NR6D 4BQ8A 3WEXB 4DQOH 1HHKA 4X7FC 5HGHB 4F2MA 3C8HA 3GI8H 5JAPA 2MWCA 3ARGC 4ZXBC 2NY7H 3S5LG 5AAMA 1DUYA 4U1HB 4F9LC 3CH1A 5IFJA 2BSTB 5FB8A 4U6TA 5HYSG 3SE4A 3I6MA 3KPSE 1E0OB 5EU4B 3HRZA 4BSJA 1WWBX 4XWOC 3OBAA 2VABB 1QFWI 2IAMA 4M5YH 1N4XL 5DEGB 1GGVA 3GFUA 2WUEA 4X7SH 5DQDL 5HGDA 5LWYH 2R23A 4Z7UA 4PJGA 4B50A 1FZKB 1MCQA 4U0RB 1F0PA 1QEWA 4LHEA 1ZWIA 3FCTA 2WLSA 4Y2QA 1P6FA 3TT3L 6FABH 3ABZA 3E8UL 3MRGA 4TULH 3U9UA 4DGIL 5ALOA 3VXQB 3UROR 3VXSA 1HN1A 3OG9A 2YZ1A 1LO5B 3WLBA 4U2BA 4OCLC 1R3LA 3PGFH 4OCRH 1CRLA 3EDKA 1NLBH 3S36X 1UB6B 4L4VA 3FO2A 3IFLH 1OY3B 2JB6A 2VIRA 5AZ2L 3C70A 1FZMA 4CMMB 3VWJB 2IPUG 1RUKL 2QQLL 1NGYB 3BGMB 5DHYB 2CLVB 1KCVL 5EOCH 3STTA 4OD3H 1G7QA 1X9QA 1G7MA 2PKDA 4MVBD 3AY4C 3QMWA 5ACZA 3AVEA 5ANMB 3VXNB 4BC0A 2JEZA 1NU8A 2W9LA 5HBBA 2ZUVA 3O8XC 1AGFA 4PRNB 2HAZA 4RGNC 1EEYA 2FX9L 1A6TA 1AGEB 5B21A 1MFCH 4PYHA 4BH7B 3OKOB 3CK0H 5BMFH 2DQCH 3FQRA 3TEUA 3TA3D 1E8DA 1G9ML 4XNMB 3MA7B 4H7IA 3TO4A 3QHZH 3UYRL 4IOFC 1IQDA 4QHKI 4HF5H 1JWSB 1W6RA 2X4UA 2VJBA 4LRIA 4NRYA 4NUGH 5BQ7A 3PFCA 2PSDA 1EEYB 4K3GA 4HXBH 4LLQA 3CN7A 4N90E 3EFDL 4EY7A 5HF9A 4IM8A 1G7JB 2ZSHA 1IEAB 4J23A 3QH3B 2HRQA 4Z7WB 1FE8L 4FTVD 2DD8H 4ERSL 4Y4HB 1ACLA 4UOW0 4I77H 2AV1B 1N7ML 2XKNB 4GUPA 5C6TH 5ADOH 1Q72H 1FRGL 4NO3B 4X4YB 2WHPA 2BXYA 3AINA 5F9JB 4WI9A 2XFXA 2X8BA 3N0TA 1X5AA 4MLSA 3UZEA 1G0YR 4PO3X 3BP6B 5BRZD 5B39B 5HGAA 4M7JH 1YEFH 4HT1L 3KWFA 1FL3B 4KEAA 3D48R 3CDGB 2I9TB 4ZTOL 2C0PA 1OT2A 3AU1B 4LL9A 3W9DA 2CBGA 3FBWA 4R2GC 2QLVB 1VFAA 5I1GL 4R96B 1KBGH 5F9JA 4YX2H 4Y2DB 4OCWH 3MMEA 1KB5B 4TRPL 1AE6H 1FG2A 1GKLA 2IJ0C 3BKYH 1BFVH 5JO5A 1MCSA 4J0HA 3MXVH 1PDKA 4FBLA 3FQXA 3MRRA 2AXEA 1DLHA 1QIDA 4NFCA 5D2NB 5IT2H 4XNYL 5JW4N 3F96A 2Y9RT 1YN6B 4R0LC 4H26B 4CVXA 4CW1B 1B0GB 1U58B 3WSQH 5B8CA 2PM8A 4NQVA 5CP3A 2AVGA 4IMKC 5JNYB 4F9LA 3VMPA 5IF0B 2F54A 2QV2A 5HYJE 4I3RL 2WIMA 4V1DE 2EDDA 5I66A 4L3CB 4NQDB 4TQEL 3WK8A 3AREA 1J0JA 1A6VH 2V7HA 5GS0L 3MRMA 2QADB 2Y36L 3OKLB 4WFGD 5IVXE 5D1QA 4NP4L 1IGYB 3DGGB 3GGWA 4OZHB 4F7EA 1MCIA 3QEUA 3QWRA 3B9KD 5D7IA 4QRPD 3V6ZA 2DLGA 2CMRH 3V95A 1QBBA 4K6HA 3ICWA 3FOMB 5DS8A 3CCBA 3L7FA 4UBDD 2DMCA 4O4YL 5KSBE 1U65A 1S9XB 2FL5B 3OKLA 5LKNA 4JFPA 3G6JB 1CUCA 3T2QA 3W06A 3BIWA 2NLJB 3QUZC 2AERT 2NMSA 4E15A 3MGOA 2R0KH 2X5PA 1XLUA 5TDPB 5GQBA 1MRCH 3M17A 4X6DE 4JCMA 1KCRH 3SGKC 5DMKB 1LO4L 4UT7H 1HE7A 2IQ9L 2WSLA 4PBVC 4RMRA 1QR1A 1FFNB 2K9UA 3RUGE 4YBHA 2X76A 3DMMB 1BQLH 5DJ6A 2VDRL 4NJAH 1W52X 4ONHB 8FABB 3GHBL 1JMKC 4OIAA 5IVIA 5DC9B 3ARXA 3D6GA 1CLZH 5EU6D 1F4YL 1GQRA 2ROQA 1ITBB 1FL5B 3JV6B 1HEZB 1P9MC 3P0GB 2XMZA 4O00A 3PICA 2W9EH 1QFMA 2XXMB 5C0EB 3BP5A 1EA9C 2P8PA 4K3EH 4OD1L 4U1SB 1KLGB 3T0EE 1IAIM 5I76B 2FD6L 1S7RA 3I02A 1KCUH 4HZGA 1KEMH 2JE8A 4D0BB 3VMNA 1UZAA 1UKAA 4PJCA 1KPVA 3HAEA 4B80A 1MRFL 1SJEB 3QQ4B 1U8LB 3FRPA 3AS1A 1OF2A 3LD8C 2EKJA 4Z7VB 4NHCL 1VGKB 2VZVA 5DEFA 1BCRA 1RFDL 4LHUD 2X1OA 4FNLL 4WWKB 4XBPB 2J3SA 2UWEE 2YPLE 3KLHD 3ARYA 5IV2B 2QR0A 1W0YT 1R50A 1KYOJ 4M5ZH 1KXTB 1X5KA 4L8SB 1R5VB 4NHUA 4R0LA 3SQBA 4DEPC 5DD3L 1UG9A 3BF8A 1MEXH 4GRMA 5TQ0L 1PGRB 4NUGL 2NY1B 4WU5A 4LIQE 1FCCA 3V4PH 4OM1H 2CDFA 1OQXA 2XPGA 4LDEB 2FJHB 1J8HD 2BJML 3VGHA 1IBGL 5DJ5A 2GK0B 4G8GD 1V7NH 5ESVB 4Q3OA 4K6KA 4X6DF 5DRNA 2C7BA 2H3NA 3TFKC 2FBJL 5AZEL 3QJHB 4NQCB 3ZKXC 4PG2C 4LVOC 5D7KD 1OTUD 4FXGA 2GFBB 4O58L 3H18A 3ARDB 1WB4A 4ZRDA 2XPGB 4XP1H 5F97E 1RUKH 4XC3H 5JALA 3D0VA 4Y4KD 5D6DA 4GG6A 4QDUA 3BGMA 3PXHA 5IB5A 5J3JA 5CKAA 1FNGA 1B90A 3C5JB 3M1BB 3P4NB 3GMMB 4R3SB 4BYMA 5F1NB 1GPLA 4Y2PA 2Z8SA 3BESR 1JJIA 1YNLH 3L1OH 1X5ZA 5CGTA 3QYJA 1GGYA 2GFBA 1J86A 4KDTC 3S8WA 2F74A 4EXPX 2SEBA 4L3AA 5C86A 4XWGH 3K1KC 3TA3A 5FV1L 2V9TA 1Q0YL 3MUY1 4RWHA 2IH1B 4F80A 3GIZL 4WI4A 3IRPX 5J13B 3ARTA 1EUUA 4PLOB 4G8GE 5FECB 4L8DB 1NANH 5EH1A 3IUJA 2B5IB 2BOCA 1OSPL 3HE7C 5IMKB 2UUDK 4MNGE 4CN6A 4OZFB 3KPLA 3OQ3B 3H2IA 3LKPA 4AZ3A 1QSEB 1JNLH 1JWUB 4KWUA 1U6AH 4WI6A 2VC2H 3VFWA 2XKSA 4HXAH 3E3QC 1R5IA 5FUZH 2LQRA 4EVNA 1EDEA 3N1PC 3HUJB 4K8RC 3R0MA 1S9YA 4XZUA 1EHLL 4ZS6D 3VXSE 1UB5A 3GBML 3BH8A 4OZFA 5FYKD 3N2ZB 1CUDA 2A9ML 4GT7A 1H5BA 1AX9A 4R4BB 3CLEL 3SE3A 3U48A 3PDCA 3FFCE 5JQHC 2PW1B 1TZGH 1EGJH 4UILL 4PRPA 2JK5A 4OF5A 5D9SB 2I9TA 1ED3B 3MRCA 2J4FA 5M95B 2IFFH 1SEQL 3FO0L 4LGPB 1K4CB 3PP3K 3FYUC 1GVIA 4X8JA 3TIDA 4OTXH 2V7NB 4GKOA 2IBZX 1VFBA 2X7LB 4AEEA 5DDHB 2RGSA 1OPGH 3DNMA 3UP1A 4MYWB 4CUCA 3HNSL 2YD9A 4OLWH 4EOWH 1AC5A 3BVNB 5E6IC 1BD2D 5FK9A 4GH7B 3QB7C 1QG3A 3X17A 4JR9L 3U82B 3HEAA 3RGVA 2J5LC 4IRJD 2G5TA 1N8ZA 3Q3GA 5C1MB 4FDMA 3WLWC 5AH0A 1JGLH 3MLVL 2VKWA 1LPNA 1MWAH 3B8SA 2CXKA 2H6PA 4PV7A 1OCWL 3FO9A 1INQB 5F6IB 3OC0A 1A6AA 1MI5B 4NCC2 4PGZA 2X4PB 3UX9B 5AI8A 2CD0A 5I66B 1FO0H 1ZHNA 1I1CA 3MOAH 4AMKH 1U4NA 4O02L 5K9QG 4Q3LA 4UTAH 1T2JA 3ARBA 4KC3B 4NO5A 2VR4A 2CIIB 4EHBA 2VTVA 1Z3GL 3JVGC 4KKLC 5I9IA 3R8BB 2GITB 3WSQL 3EFFA 4ZOBA 5A3IC 1RYYA 4FOMA 1L7TL 5DD6B 3SDAD 3JTSB 2NW2A 3L7FB 5AK5A 2AK4E 2APTA 1YC8A 2WP3O 3ZTJH 4XGZB 5IWLC 5F3HB 1NCNA 3EYFB 3FT4A 4HJ0C 5DJZA 4LVNC 3CZJA 3WHE0 4PJAB 3MJGX 3LOWA 3D9AH 2R0KL 5SWQB 1IARB 5E9DE 4WCYH 3TVMA 4Z7NF 3HI6L 2A9NL 3QULB 1IGFH 3FVTA 4CMHB 2E9IA 3ZYZA 3KPOA 4GMTL 5DK0B 2DKUA 3T0DA 3SGEH 2A0LD 2YD8A 2Q8AH 4ZNEA 3DVIA 3TN0B 4DAGH 4LLVB 3HC4L 4ZQKB 4MEAA 4L4VD 4PRBA 3AXLA 3NIDE 1AR1C 4JO3H 3QIWD 2ILLA 4LVEA 1EFXB 2C1OB 1QR4A 4M0FA 4TUOB 5FHBH 4OZ4B 4CVWA 1M7XA 3TIEB 1CTNA 1LEKB 4X3CA 5CINH 1UH2A 4OI7A 3E0GA 3G9UA 4POYA 2FIRT 1TTUA 4LLVA 1A6UH 3WS6C 5DYOA 1JNNH 1KCSH 3T3ME 4HWZB 4PJFE 4JFXB 5C08D 5L8JB 4ODVH 2JCCB 3EOAB 3VI3F 2V7HB 2BSRA 4AO7A 3QPXL 1JPGA 1EFXD 3WN5A 4PJGF 5C0FA 1NBZA 5DC4B 5DMYA 1TCBA 3WKBA 1CL7L 4WJ5A 2RQ8A 2EICA 1J88A 2P5EB 4LP4A 1R24A 3VKFA 4XP6H 1A4JB 5JHDB 3CX5J 4WFHE 2O2IA 5GS0D 5DYOB 1Q9OB 5GRUL 3MRDB 4RRPG 2OI9C 5C0AD 4DFIA 3RLIA 4PJFA 4RFEB 3UCRA 3WXWH 2K2QB 4LKCA 3FT3A 2APWA 4QCIA 3RWCA 3QDGD 3FOLA 1U8MA 4RDQF 2G60L 3WS3B 4Q9CA 3V52H 4RA0C 1BF8A 1CFVL 4KJXA 3NIGF 4MDJA 2XY1A 2HL6A 1AO7D 4NQUA 1KIRB 4P2OA 2AJ3A 4G6KL 1OOAA 2LIPA 2FZ3A 4INZA 4P23C 3MROB 4YGVB 3ZT6A 5IB4A 3OR7B 2VE6B 3EHBD 4KU1A 5DSCA 3WFCL 3SHSA 3H3PH 2CK2A 2BCKB 5TGBB 2HMIC 2DQIH 4JY4B 4RNRB 4NQXA 1T89A 5K3CA 5DD3H 4BDTA 4OGXH 5J57B 3RDTC 4LEOB 5D6CB 4WUUA 3LKNA 1A1OB 3R06A 4OLXL 1NLDH 2IF7A 2WFZA 3QA3B 3QAZB 2J7LA 3BI9X 3SDCA 3D2CA 5DMJB 4KV5E 4L3EE 2JGJA 4LIQL 1ZHBA 3WDHA 1U9KA 1KJ3L 4NKOA 4D3CL 1HSAA 2L0DA 4HX1A 4NKIL 1CU4H 3G7NA 1WC7B 2FSEA 2DQTL 3BP5B 1CUSA 4UQ2B 4JFZL 4G43A 2DICA 1VHPA 1A1OA 5HVWA 4WW2F 3CFIC 4QXTB 2RHWA 4DCQB 3GA7A 1JYXA 4KJQC 4JPIA 2DS4A 3S2ZA 1DQLL 1AZWA 4AYFA 4GEGA 2JB5L 4ZYKA 4A2MA 3D39A 2NW6A 3QG6B 1DWOA 1ZHBB 5HTSA 1JJBA 4JO2H 4Z7VE 4XI5D 1ZIXA 4JO1H 1R3LB 1YMHB 3C87A 1FC2D 4OGZA 3GMRA 3FN3A 2A0LC 3DECA 3VCLB 3SGEI 2B0SH 3VXUD 4K2AA 2DQZA 3IKCB 4ELKB 3EYQD 1K3IA 1UM5L 3ZKND 2O5YH 4G8CA 3WJ1A 3U9PL 2GYUA 1N3NA 1MHEB 2VUYA 2JIDA 2VXSL 2R1YA 4JZOB 3MNWA 4ORZC 1G7QB 1XZIA 2EDRA 3IU3A 3D3VD 3UPCA 3FYUB 2EDBA 4Z18A 3I6ZA 4NWTH 3D5EA 1FPTL 4ZXBD 3HUJA 4HGWB 4TN9A 5D70L 1RHHA 4PG9B 1ETHA 1EUTA 4M93B 4QRUB 4G9FB 2Y06L 3RDTB 5GJSL 1N5MA 4N0FA 1CVRA 4Z7VF 4DKAA 2ZOLA 2DDQH 2DQHL 3MNWB 3WA7A 4GXVL 2V5YA 3BD5A 5J7CC 4ZFZB 4P5TD 3P11L 2JIXA 3F8SA 5EORH 3U7YH 4L4TD 6CGTA 4B85A 4PSUA 2X4TB 3VXMB 3O3EB 3F58H 2QS9A 2VJCA 4JQIL 4QRRB 3L3DA 1MRDH 5J0BA 5IGXH 3SY0B 2AW2A 3FFCA 1OP3K 1EVUA 3T77B 4Z77B 3ARRA 5E8PA 3MNZA 1P4IL 3BVNA 5FK9B 4UDUA 2F74B 3DMMC 4HIEA 1MI5D 4R4FL 2VSQA 2ICWB 2BC4B 3HA0A 2LTQB 1Y18A 1VACB 3UPRA 3C6BA 1IAOB 4HIXH 5F3BB 3WKCA 3RZCA 5FYJD 1IGCH 2MTPA 3G5VB 4OLUL 3T77A 4XXDA 3EO1B 4HLZG 4I19A 3EJYD 4JUIA 1AGEA 5DUBA 5DJ8B 5EO0A 4MVBC 4J0KA 5GGTL 1JU3A 4XB8A 5BWCA 3KWWA 1SJHA 5JORA 3V1LA 3GO1L 4H5SA 1S5HA 3TNNA 4LAQL 4J8RB 4K71B 5A7HA 4F7MB 3HZYB 4GMSH 4CVUA 4NO5B 3SGDI 2RFXA 5D93B 1HILA 4HTAA 4CDHA 2WFLA 1V3LA 1F4HA 3ZYIA 1U93B 3FB7A 1NMAH 1ES0B 3WXVH 1I1YB 2OGZA 1CXKA 4PREB 2B1HH 4TSBL 2IPTL 5A2JH 3VWJD 1BWWA 2J4CA 2XKUA 4JGUA 1JJFA 3MOAL 4N8VB 4NRXA 4XHQA 5AM4A 4OLVL 3R3ZA 3KXPA 5C0IB 3QI9B 3GSRB 5EIVA 3VVLA 2JK5B 5D9SA 3G0CA 5HF6A 2PU7A 5FPQA 1R0AH 2XFXB 3FHAA 2J8UA 4DVRH 3DTXA 3GFFA 3W5MA 5CZXC 5D2LF 5L88L 1XR9A 5SX5K 5I18H 4UMGA 1GGBL 1S9WB 2ICWI 4X4XA 1SHMA 4DAGL 4Q9RH 1TMCB 4CNIB 1CDCA 3NABH 1DVFB 4Z7QF 5FYKU 5FDYA 1LO5A 4P3CH 3QM1A 5JTWA 4IMLB 1OTSC 5JZ7C 2VYRE 5ESAB 5SWSB 1F42A 1H0DA 5HSFA 4MJ6B 2C3VB 4PJ7B 2X4RB 5DJAA 1OSPH 1DUZB 1K8QA 1EJOH 2VR5A 4P9MH 2HP4A 2AQ1A 4OIBA 1G4HA 5F93C 1QFUL 1UACL 2YXPX 4YDLB 3WIHA 1RI8A 5SX4I 3B4NA 3QFJD 2O26U 3VG0L 2DF3A 3Q5YA 4Q82A 4U31A 3NCBB 1L7IH 3BISA 2AK1L 2XUKA 1Q0XH 5FGSA 5TDNB 4PV9B 4LASL 1R24B 4QRQB 3O8XB 1CDJA 4Z7QE 3BYYA 2PO6D 3O2DL 4RAHA 4C56A 2X40A 3LMJL 1YNKH 4AB1A 5CBEB 3PL6D 3KR3L 3QUKA 1UEMA 2X1WL 1OP5K 1QFSA 2FJGB 3WK9A 3MV7D 4ZOEA 2B8OT 2H32H 2OMBA 2J3DA 4EDXB 3O0RL 2E9JA 5DA4A 3CXUA 5FF6B 1MHHB 2EDYA 1Z9MA 4Y7MA 1TCRB 4UU9A 4K23H 4HKJB 1RAMA 1P1ZA 3GKWH 4M3KB 4U1NA 4B6GA 2XWBB 3DO3A 2PO6B 4PJEF 1N64H 3F7QA 3E8UH 4TULL 1KCVH 5EOCL 4DGIH 4W4OA 3BIKA 1IGYA 3DGGA 4OZHA 4Y1AA 1IRAY 4JY4A 3FFDB 4ZNEE 1T0NB 3LPGA 4PTUB 3C5ZA 1I8MA 3GSXA 2QRUA 1UZ6F 2HG5A 2D7NA 5FDWB 4X4ME 5E8OB 4OCRL 1CWVA 3V9AA 1FAKT 3QA3A 3VVMA 1BM3L 1QRNA 4S1RH 3BIKB 3QCUL 3UYPA 3ZSSA 5IB3A 2VLJB 4GDMA 1C12B 3F7YA 5C81A 2HA1A 3DVNA 2DJ4A 4ZUWA 3W39B 1GGCH 4P23B 5D5MA 5DZLA 3HN3A 2A6DB 2L7JA 5L8KB 3K0WA 5LLSA 3EQ9A 4NJ9H 4MCZB 4M61A 1PG7W 4OSUH 3NZ8B 2B39A 3QUXB 5DR5L 5GGRA 5JHDE 2L7UA 5E8DH 4JO2L 5DJYA 4TUJA 5D7LA 2BUCA 1I7ZA 5KSAB 1FNAA 4U2DA 1YUHB 2HLAA 3W0WB 2ZJ6A 3WWCA 2D9QB 5D2NC 4P2QE 4LCUB 5GJTH 5FHAH 2AS5M 3RTQD 3QHZL 3UYRH 3SJVB 3MO1B 3X14A 5J06A 3ARQA 4QEGA 3Q6GL 3OAZK 3BZ4A 3T2NL 3X11A 1OP9A 3DOHA 5AI4A 5BV7L 3DOIA 5HVGB 1X5GA 2Z8XA 3VFRA 1GH7A 1XZDA 4FLEA 2YXFA 1BGXL 4K3DH 1EPFA 2EZ0C 5J9PA 2FHCA 4PJ5A 4AQ1B 4UIKH 1GPKA 3SDAA 5C8VA 2W60A 3I6GA 2R4SL 1NDGB 1TNNA 3VFNA 4QRRD 2Q8AL 3HB3C 3ESAA 1ZANH 4N9GB 4BZYA 1FNSL 1G7JA 2ZSIA 3CFKA 4IMKA 2OR8A 3GEWB 5SX4H 5DQDH 4QOKA 1ORSB 5AKHA 5JD5A 5HHQB 4RGMB 2Q8BL 2X9WA 4PF1A 1RULL 2B4CL 4PJ7F 1ITCA 3T1FB 5AKEA 1A88A 5DEFB 4JN2B 3F8UB 5H35A 5E1HB 2H3NB 2XRAL 1A8JH 1U92A 5T3ZL 4EY6A 3CLFL 5HJ3A 4EUSA 4HC1L 2H2SC 3BN9C 4Y4FD 4L72A 4TNWF 1NAKH 4YO0A 5D8JH 1CDYA 3KAAA 4JVPA 4RGMC 3ILQD 5C8JB 3BGAA 3L1JA 2R9HC 1F3JB 4OGAC 5HPOA 4W6YB 2VXTH 3C5JA 2Z31D 4YDLC 4FN0A 2BDNH 1QR1B 2WBWB 1VEOA 4OUOA 1YN7A 3WIBA 1XRRA 1KT2B 3O4LA 3D25A 1CLYH 3KYNB 3I1YA 4XCFL 4L4VE 1AGBA 3A67L 5I1EH 4PJ5D 2QADD 2FEDD 2ORYA 1JE6A 2HDWA 1F3JA 3H2WA 3PL6B 1FZOA 1U8LA 1A2YB 3MV01 5JOFA 2FRGP 4QHKJ 5TE6H 1MHEA 1N3NB 3PP4H 5HGHA 4O51B 1RK1B 4MNHB 1FFPA 4NZTH 3VXPA 1S5HB 5HDQH 4X6UA 4KZEL 1ADQH 4OU4A 1UZ8B 1VPOH 3BSZH 4CCYB 4MXVF 1FV1A 3GMOA 2QHRH 2R0ZL 2WP3T 2JF1A 3LAFA 1XCQB 5E5UB 5A16A 2F54B 2HT4D 1UC6A 4J0GA 1NCUA 4FNMA 1XR8B 2IPTH 3V7AG 5HVHC 5CMLA 2R23B 4CG3A 3OKNA 4G6MH 1TQBB 2CKNA 1FZKA 4OCXL 2K7QA 4NSKA 5IFHL 4K3EL 4PRPE 1XF4A 1CZ8H 1BFOA 1J10A 5DRZA 1QKZH 2EEAA 2P5ED 1JYVA 2EDXA 4P4KA 3GK8L 4E41A 3LRGA 3CH8A 3S5LB 4HVTA 5F1OB 1KJVB 2FHFA 4IDLA 4AEIH 1N6UA 2A73A 1FAIL 4H20H 3T4YB 4G8IB 3BEVA 3DIFA 2BMKA 1UWGL 3HNVL 1AFVH 3OG6B 5JPNB 1MSPA 4BQ6A 5K9OB 1FSKC 5I8CB 4ZG1A 3AU1A 2Q3ZA 2BFVH 2FD6H 1X7QA 4PRIB 1Q0ZA 5F3BA 3T0VA 4OFYD 4MD5A 1RIVL 1UWCA 2B2XL 3B5HA 3D1MC 5C0BB 4P2YA 2CUTA 1X5YA 3U0PB 5FKAB 1AO7B 1DQMH 1DQQB 5MP6L 2VLME 1PX3A 2OS7A 1TZHA 1YSCA 4JYPA 4PRIA 5I75B 1V7NL 4U1MA 3U36B 2VF2A 3M3DA 4PRID 2NYYC 1INQA 1RJLA 5TQ2H 3RL1A 1YS2X 1OQOA 2YD7A 1INDH 5C0JB 3U0WH 1X5HA 5IHUL 2OSLA 1BU8A 4KTEL 4UT9H 2ARWA 3C6SB 2ZCHL 3UTQB 5DC0A 1EV2E 4XMKL 4Z7UB 3GSWB 2KDGA 1KLGA 3NACL 2J3QA 5JANA 1DE4A 4NOBA 4GAFB 4OD0A 5C0GA 1QNZL 5SWZD 4GW3A 3SE8L 4RAUA 3UC0L 1WAAA 2H6PB 3MLXH 4YDKL 3WL6A 3MV11 4LCIL 1ULVA 1HZHL 4AN0A 4ZXBA 4J0IA 2XN9E 5DS8B 1S7UA 2IH3B 5JW4R 3SO3C 2NY0C 3AIMA 4FOLA 1MJ5A 4WHCA 1L6XA 5JD4A 3DSNA 3B3IB 1I9RL 2CDEA 5YASA 5INCA 5DRWB 2W91A 3UTTE 3GSQB 5A1AA 3MNVA 1XZHA 3IDNB 4EBQH 4JLRA 3GELA 2HWZH 5F7KC 3QULA 4PR5A 5J1AB 3GJEA 3MGOB 5DK0A 3LD8B 4JRWA 1CGYA 3T0AA 4YC2C 1SOMA 3MXWH 1BM3H 3SKNA 3HMWL 3SQOH 2C3GA 3FSGA 43C9A 2Q8BH 1P9MA 4JJ5B 5I0DA 1F4XH 3FT4B 4PJCF 1KIPB 3S37X 2ACEA 4ETWA 1U95B 3ZKSD 4LVHC 4F15B 1TITA 4X4MA 2MOVA 1YMMA 1SM3H 2I9LA 4FXGB 3RHWK 1YYLL 1G9EA 1DFBH 4OFKA 5KZCB 1K5NB 4XP4L 5F7EH 3VJ6B 5EWIH 3CNKA 5SX5H 2AXHA 2ZCKH 4E41D 4ODTH 3LH2H 1KIPA 2IALA 4G8FA 1CR9H 3WIIL 5AOBA 1MAHA 4M7ZB 1WIOA 3SGJA 4IDJL 1OILA 4N0RA 5T1MB 2C1PB 5AM0A 1CDHA 4LLUB 4F3FA 5INDA 2MCPH 3SKJH 2YUXA 4OF7A 3TO4D 3VXSD 1ZD5A 3C6XA 5DMIL 1EEZA 1F02I 4UBKA 4WTZG 1UH4A 3J7HA 3VFMA 4JEGB 3C60A 5CEXB 1TCMA 4NBZB 2H2PC 3FO9B 3RIFF 1EH5A 3QPCA 2BVQB 2Y5EA 4X4YA 2PYFB 1CYGA 1WIPA 2XOTA 4C6HA 2HJFA 3VWJC 5F3HA 5J9PB 5EZIH 3SDXA 3KPRE 3V6OE 1AUOA 2VAAB 2BAGA 4XC1H 3O6FB 5TDOA 5MEQB 2RHTA 5LKRA 4S2SB 1ZT4B 2D3VA 4X4ZA 4QXUH 2FO4A 2GJ6B 5IEKB 4X6DB 1EVEA 1F3DJ 3LQMA 3GMRB 3HKFA 1FFCA 3QQNA 2WILA 2GT9A 4WY5A 1XF5A 5ALFA 1XLVA 4DMKA 4K71C 2ZUXA 4NPYA 1JYWA 4YGAB 5C07A 3LCYA 3MLSL 3OPZH 3VXUA 4XJVA 1KPUA 4ZAKB 4YPVA