1OAXH

Fv structure of the ige spe-7 in complex with acenaphthenequinone
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNLKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 122
sequence length 122
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaxH00
5BZDA 4HUXB 3T77B 3QH3A 3QPXH 4UQ2A 2PF6A 4MNQB 4M8VA 1Z2KA 2ZOKA 3ZZ1A 4APQB 5B8CB 3VDBA 4LCWB 3TNNA 1IAKA 4P9MH 2W60B 4XP4H 3DPBA 4L3EB 1MHHA 5FA4A 1A7RL 2PTUA 1FZOA 1CTOA 3D87B 4NQEB 3I3DA 4FQHA 3MJ7B 2FX8H 3MRCB 4OGYL 2ZUSA 4YXKH 4GUPA 2UY6A 1NC4B 1SBSL 1URLA 2X44D 3WFCH 4HXBL 4GLRI 5HHXL 1D5MA 5JIPA 1HH6B 3GHEH 4GW4B 2PCPB 3OG4B 3HG1D 1P7KA 2HMIC 4LHUG 2RBLA 3DSFL 3O3EB 4Q2ZA 3BESR 3D5OF 5DMGC 5BZWA 3IDXL 4FXGA 3LQZA 1PYWB 1ZLVK 2Y4SA 5IGXH 4F2MA 5TE7H 3WNPA 1R5WB 2HTLC 1RZKC 4X9FA 4XXDB 3T2QA 1NMAH 1N4XH 3V7AG 4JVPA 3EKCA 3QAZC 4G43B 4RAHA 4ZTPH 1UC6A 1BJMA 3QJFA 4I18A 3U4BL 3HZKA 4GG6F 4XPFL 1DFBH 1KTRL 3D3VB 3FQTA 3O8XB 4JM2B 5K93A 1UWGL 1U58A 4PRNB 5CBAA 3JBG7 4L9DA 3W0WB 1CE6A 1FZMA 1X5XA 5AG9A 3F7VB 1FZJB 3B9DA 4XVSH 4KKCC 3A6CL 1QO3B 4ZOAA 4FQ1L 3RWEA 3CXHK 5CEZD 3GO1L 5I71C 4X4YB 3PQYD 3BP7B 5CHNB 1RHHA 2VZTA 1I9JH 4P4RA 1S5IL 4HH9A 5ISZE 2DDQL 1LO2L 2J1KA 5DD1H 4GAJL 4PY7A 5HGHA 3D39A 4S11A 1B2WL 3NPSC 1OP3H 4RSVA 2GJZB 3MV9D 1HXMA 1ZGLM 4TUOA 3G5ZB 1T83C 4KRLB 5JHDD 3MLSL 4GRLD 3H9SB 1KUMA 3KPQB 4L4JA 1CT8A 5EIQA 1CG9B 4TSAH 3I02A 3IRPX 4Y2DC 3VGFA 3MLRL 5D7SH 2NYYC 5EZOL 3AAZB 2LAAA 2FX9L 4OCWL 5FYJD 4DEPB 3GMPA 3ZDZE 3L1OH 5TE6L 3IFPA 4Y5XB 12E8L 1IKFH 2EDTA 2VZSA 3VFGL 4PJDF 4EOWH 5DRXB 1KCSL 3T4YB 1EHNA 1MCPH 1X7QA 4AEHL 2C3VA 1FG2A 1E4KA 4OCSL 5F9OL 2V2WB 4M8QA 3TJEL 2DMKA 3OG6B 2HH0L 5E8NA 1Q9KA 4U6XA 4NO3B 2P8MB 3BP4A 5C6TH 3AM8A 3ZT5A 1PKQB 3U7YL 1BQLH 3C5ZB 1A3LH 1HYSC 5SWQA 5HHOB 1ADQA 1JGDA 4FABH 3HI1B 2FHFA 4AEEA 1JTPA 4NKOB 4UINH 4U1HA 2F8XC 3O9WC 4YXLL 3NIDF 4HJGB 4Q58C 4O2CA 1J11A 3QA3A 1U93A 4JFED 2Q8AL 1F8TH 3OXSA 4R26L 2NY6C 3VWJB 5CLWA 2PYEB 5IF0A 1BVLB 4JQXC 4HW6A 3UTSA 3U36B 3BH8A 5DSCB 3C60C 2B0SL 5FV1L 3CVIL 2G5RA 5I2IB 4D9LL 4J4PC 3CVHL 2CKBH 4YHNA 3FT3A 1GZPA 2H1PH 3REWB 5C08D 4NQUA 4HZAA 3MRDA 3HAEB 2ZCHH 3EOAB 3U0TB 4JQVA 5JDSA 4ODSL 3Q2CA 3D2UA 4GBXC 1S8DA 1JZ7A 5BRZB 4Q9QH 1A4KB 3X17A 3S5LA 4YBHA 3WJLA 4PJBE 1MCEA 5HBBA 1AD9A 4Y5YC 4IDLA 4G80B 5FYJL 3FQWA 1XF2A 2AS5M 3O6FD 3ULUF 1N6QL 1XF4B 3REVB 3IAPA 4NRXB 2JB5H 4DN4L 4DN3L 3VGEA 4LBEB 5C0FA 2H32H 1PBYA 3X14A 1EJOL 4LLDB 2H32A 4MA8H 4U6YB 4Z8FH 5KS9B 2K7QA 1FPTH 2XXMB 5GJSL 5I1AA 2GUOB 1TITA 3CK0H 2IBGA 4I3GA 1QSED 2HJLB 4KJQC 1V3MA 1RUKL 2AABL 3GSWB 1CGSH 4U1SA 3SDCA 2ITDB 3WE6A 4G6JL 4GKNB 5KANI 5EUOF 3O2DH 4P4KC 4QY8A 2B7DT 2R0KH 3OHXA 2YSSB 3DJ9A 5IB3A 5DRWB 3MV8A 5E0QA 3MNWB 3WKML 5EUKB 3FMGL 1JNJA 3WS6A 1UYWL 3LB6D 3DURB 3V6ZA 5L0QB 4N0YH 1X5AA 1ZVSA 3WFHA 2MTPA 1IM9B 1YNKH 4YHKL 3HFML 1ITBB 1BLNA 3QCVH 4JRXE 3SQOH 1YQVH 1YDPB 3FB6B 4MAYD 5E9DA 1GOFA 5J11B 1NLBL 1TQBB 3B5TA 1JYVA 2ZJSL 2DMCA 4QT5B 5TDNB 5E6YA 5CGYD 1JZ2A 3U7WH 5C0CE 1EMTL 3KPSA 3ALPA 1NMCB 3MRJA 4PJAF 2A1WH 4MWFA 4DAGH 2E27H 1NFIA 1M7IB 5T33H 3V8OA 4RA3A 5B38A 3MODL 3FO1A 4M9OA 5MERA 3VXMA 3UTQA 2W0FA 1XGYH 4JDVB 2QQKH 4QWWC 2HLFC 3EBAA 3LV3B 4PJIF 4KK6D 1KJ2A 3IKCB 2IGFL 3MJ9A 4AIZB 5F8QC 3A6OA 4X5WA 1U8IA 1U8QB 2PR4H 3MBEC 4U1NB 2OZ4H 4M03A 4OD1L 3QCUH 4P59L 5CUSH 3VE0B 4AL8H 4G8FB 4ZO6A 5MEPB 3NIFE 4BFIB 3ULVC 5I30H 3BPNB 5F7DB 3QEQB 4P57B 1MCHA 3Q6FB 2R8SL 4I18C 1KLGA 3FN3A 3A67H 2CDFA 2NY4C 3P73B 3CDGB 3AY4C 2HKHH 4Y1AD 1OP9A 4HS3B 4TSBH 3TZVB 2DBJA 4ZUSA 2KL6A 4KI5C 4Z7QF 4EIZC 5KVFL 1NEZB 1TCRB 1FL6B 2AJXH 1DBKL 2ADJB 4XVTL 5FYKH 3UJJL 5ID1B 1E4XL 3IJHB 4OUUB 2OR7A 2ZNWA 2XA8H 1U95A 3WSQL 1JGUH 1WAAF 2ICEB 1LK2A 3C8KA 1LE5A 2X4TB 1JHLH 1FC1A 3BJ91 4B0MM 3O81A 5DI8B 3C9NA 3MV01 3UTPD 2WK2A 3BYYA 3G5YB 2DL9A 2BNQD 3QUYC 5FHAH 3QUML 5DZOA 1KIUA 4G9FE 5HTSA 1CICD 2IANE 4FXLA 5F3HA 3FQUA 4CAGA 1YNTA 1IARB 1BM3H 1EGJA 1MI5B 3GKWH 1JIBA 3TF7C 2HA1A 3B6SA 1E6OL 5TH2A 4W6XB 3MLVH 4ZNEA 1DVFB 1XGQA 3BW9A 4OIIH 3SKMA 1V3KA 3RNQA 4HWBL 1OAZL 3NGBB 2NXZC 4OZ4B 4PRAB 1OAKH 5C0AA 1A7QH 3P0YH 1X5JA 4G6MH 4DGYH 4PV9A 3I6GA 3HZVB 4OZGE 3WV0A 3U9UB 4P5KA 4HHAA 1GOHA 4HG4K 2VLRA 3U1SL 5D7LD 1YNLL 5ITBH 3RL2A 2W0KA 1E4KC 3PGDA 1VFAA 3G6JE 4GMSH 2OL3A 2LAGB 3QUXB 1ZA6A 1T1YB 3LDBB 3SCMA 5E00A 3MLZH 5BVJB 4QF1B 3GMMB 4X5LA 1DCLA 3WN5B 3T1FA 1L9NA 5DJ2A 4H88H 3AM8C 5F1IB 3HHRB 1G7HA 4ONFL 4L29B 1I3GH 5IMKA 3BGFC 5DGQA 1JE6A 3VXSA 1HHGA 3FB5B 2Y6SD 5FO8B 4I0PB 2IAMD 4EN3D 1WZLA 3MGAA 1R3IH 1UM5L 3C6LA 4KAQH 5LGJB 3CSYB 3IS0X 2I25N 5E8PB 5ILTH 1ACYL 3FQXB 4RMSA 4N1HB 1ZS8A 1I4FB 5IP4A 2BDNH 3QFJA 3KDMA 2X7LA 4JZOA 4HGWA 4C56E 5A2KH 4RRPG 5AYUH 3WO3B 1ZHKA 1SEBA 1W0WA 5F71A 5T1KD 1A6AA 2VH5H 3VXRE 5D7KE 3KR3H 1CI5A 5EOTA 5IVXB 4JQVC 2MKWA 3P40A 1AO7A 4KHXL 1ED3A 2NY5L 4HMDA 4CBPA 2YA2A 1WWBX 2YMXH 4X4XB 3WJLC 1U3JA 4P5TB 1FE8L 1YPZE 3GB7A 5EBLB 5DK0A 2VISA 2J4WL 1S7QB 1RV6X 3HC4L 5C0BB 2P45B 3ARZA 5J6GB 4H25B 1Q38A 4RFEB 2J7LA 3QNYA 4WI2A 5DTFA 1G9NL 2P8PB 1FAIH 5F3BA 4M5ZH 1MRFH 1ES0B 4L8DB 5JW4M 2J8UA 3BXNA 3ESUF 1A7OH 3IS1X 2EDWA 3ZDYE 3F7QA 4PYHA 3MMEA 3IDJB 3RJDA 1GVIA 4V2CB 1WLHA 2VZ3A 3LN4B 1DEEB 4YGVA 5D7IA 4IRSD 2F19H 1H8NA 5GGRA 4TPRL 1CLOL 1DP0A 1F97A 1KCVH 5C0ND 2OTUA 1DQDH 4JPVL 4Y0GA 5GISL 2RGSA 5HHME 1QYGL 1SHMA 3E8UL 2VUOA 2W91A 3NFSL 3D0VB 4DVRL 1WGOA 3C8HA 4TRPH 4NNXB 2NY7H 3CH1B 1KJ3L 3FOLA 2NR6C 3T2PA 1FO0B 1UM6H 4HIHB 1OSPH 1OT1A 1A14H 3ARPA 1X6LA 2BHYA 5HYJA 1G7LB 3MRPB 4BKLA 4Y5VA 5L2KE 3AMKA 2DYPA 1MAML 3TBSB 4RQQA 4DK6A 4M7LL 4HK3J 2YD3A 2PO6B 3VFTB 2EE2A 1ODAA 1T89C 5DC9B 1PG7W 3QWOB 2HLAB 4PJBB 2Q86B 4PR5B 1ZANL 1ZEAH 4QRPE 5T1MA 1IZJA 1CU4L 3PGFL 3PL6B 3GSRA 1QTYT 5C2BH 4I2XE 1QNZL 2W38A 4L3CB 1A0QL 2A74B 4S1SH 4LAQH 5AYQA 4FQJL 3WNKA 4WTZG 4G8GA 2ADGA 4FTVB 3GKZA 3MV7E 2HRLA 4U3XA 3CDYA 1B0RB 3MLYL 1FLRL 4WFFD 3HUJB 5F96L 1QKZL 1SJXA 4LLMA 5F7YC 4HT1H 1OGAD 2H2SD 2YZ8A 1EHLL 1YUHB 2DIAA 2XZQH 5BV7B 5H35B 5LAXB 3CD4A 2Q7YA 4Z0BL 1A7NH 1GPOL 1KB5A 3QRFM 5T5NF 3HI6H 2EIEA 5A2IH 2FX7L 3MLWH 4X9IA 5JOFA 1PX4A 3WL9A 3QUZC 5IFJB 1F90H 1I7RA 3BMWA 5LCVH 5F9JB 5LXGH 2FR4A 3SDDD 1WWAX 1N5AB 1AHWA 1KIPA 4F7TA 4GAGH 3S34L 1JGVH 2LVEA 2CO7B 3ES6B 2AEPH 3WLWD 2UY7A 4EBQL 2HFEA 1HZHL 1RUQL 4KHTH 4BSJA 5KS9F 5HI3D 3H9YA 3K0WA 4GAYB 4P46A 4JGMA 2G75B 3N06B 2DJSA 2DQDL 2DWDB 4EIGB 3SPVA 3CCHB 3MOAL 3SKNA 4XGZA 1QBLH 3W81A 4P2QD 4LRIA 4ONGH 2VQ1A 1MVUB 4M48H 4PJHB 4XMKL 2ZPKH 3QIBD 3FTGA 4LCYB 4KMLB 2YWZA 2VXTL 4L3ED 5D7JC 5FUOL 5CZXC 3TH3T 3PV6A 1MJJA 1MCRA 5DVNA 3WFEH 3E6HA 1C5BL 3WLBB 4Y4KD 1TJGH 4OD3L 1OM3L 2GFBB 3JWOL 3DARA 3SGJA 4YDIL 4RGOL 5DFVC 3W2DH 4QXUL 5JQHC 4MJID 4NBYB 1GGIH 3HRZA 5E99H 5KTEL 4X99B 4R4BA 2JK5A 1QR1A 3MXVL 4JHZA 4TULH 4QGTA 5BVPH 4NHUA 1G7MA 1F4AA 4E41D 1D9KA 1FL3A 1KF9B 3J7HA 4QRRB 2AVGA 3GMNB 5IESH 2XFXA 3T0WA 2MWCA 3VXUA 1U8JB 4I8DA 2AK4D 1IAIH 2IG2L 3OGCA 1AP2A 1A2YB 3P3YA 2F54A 2DM3A 1KN4H 3VJ6B 1EAJA 3LS5H 1SY6L 1FL5A 1WIUA 1LEKA 4TTDC 3PWLB 2RCSH 3Q5TA 2HT3C 3SOBH 4OV6F 4PUBH 1BD2E 2BMKB 2HFGL 3D3VD 3SE3A 3QDJA 4JM2D 1N64L 1MNUL 2YUZA 5KSVB 1EFXD 5T3ZE 5EU4A 1UXWA 1D7FA 3R0NA 1WC7B 4OAWB 5CJ8A 1J0HA 4RAUA 1IQWL 3TBTB 4HCRA 1LD9A 4ODVL 4NQDE 2MSPA 4WWKA 3HPJA 3FQNA 3QJHA 3L6FB 1T21A 4R6UA 5DJ6B 3MUZ1 4CN6A 3KPNA 5KN5A 2C1OA 1I9IH 1X4YA 5K9KB 3IRZA 5D71H 1N8ZB 2AKRA 4PLOB 1VFOA 3HE7C 4OKVA 1TXKA 3C5SA 2HTKD 3GSOB 3LRSA 3O6KH 1YEEL 3X13B 3NZ8B 5D1ZA 1NAMH 4KTDH 5BO1L 4Z95L 1YN6A 1AGEA 3H42H 1CDHA 4JN2B 2L7JA 2P24B 3C5JA 3S35L 4QLRA 5DZNA 3NFNB 1WWWX 2R0ZH 4FG6D 2FATL 4TOYH 2VWEE 3H9SD 3QHFH 2CLZB 4HS6B 1AKJD 1TNNA 2YUWA 3LEVL 5C0IA 1L6XA 2R2EB 4NZTH 4HJ0C 3ARUA 2XKNA 2H8PA 2VDKH 2EIDA 3GSNB 1U36A 2NY0B 3O3BA 4ZYKB 4Y2DB 2KZWA 4IHOB 4TVSa 1T4KA 4OLYL 5GHWL 1BZ9B 5EIVA 3L3DB 3G04B 5DJXB 1OTUC 1OAUL 3VH8B 4F9PC 2FNBA 2Z0BA 3EAKA 5T3XD 4OD2B 1D5IH 1I3RB 1WF5A 3ULSB 4LGPB 3NZHH 3QRGL 1MCOL 4BH8B 5HHVL 1KCRH 2CGRL 2GK0A 5CKGA 5FYJU 4Z6AT 2X10A 3O4LD 3GRWL 4PB0H 3L3IB 4X80H 3MJGX 4AIXA 4XVJH 5E8DH 1Z3GL 2BNRE 4V1DE 4PJFA 1RJLA 3GMQA 4C56B 1EUUA 5FM8A 3P0VL 5DRZB 1IQDA 2FLRT 5IQ9B 4HBCH 1OY3B 4HKXB 3FO9B 4JPIB 4I5BA 1EBPA 4OLXL 1FQ9C 1XCQA 1QSFD 1T5XB 3BP6B 4GRMA 2PYED 4MGXA 4ODWA 4HK0A 4L5FH 1J5OL 5FYLH 5CEXB 1JGEB 3VWKA 2I27N 3O2VL 3MA9H 4UOJA 3STBA 4F7EB 4Z7UF 1ZGLB 5A16B 43CAA 4DKEH 4K55A 4MDIA 3R06B 1K5NA 4FNLH 1QACA 2ED8A 2PXYB 4O2EB 3HR5A 5CZVL 1I9RL 2WIIA 4PRBB 3TH2T 2B1HL 5BRZD 1AQKL 3DGGA 1H0DB 1HCVA 4Y4FA 1KIRB 1NCWH 4ENED 3GEWB 3RHWF 1INQB 4X6DE 1T1XA 3U9PH 2ORBL 5FKAB 4CVWA 1E4WL 4NWUH 4ACPA 5K59F 3QZWB 2WBJB 1N0LA 2GJ6A 4N0UB 4HKBB 4K9EL 4S1RH 3V0VA 1MVFA 5IVXF 1CK0L 3JUYA 3VRIA 5ADPH 4XNMB 1VKXA 4CGTA 3VXME 5T3XL 4KROC 2VDOL 4WVRA 4EJ1C 2CDGA 2R4RL 1FVEB 3BN9D 3QXDA 2E7MA 5HHMB 5D1XA 5E7BA 1A9EA 3L3HA 1CD9B 2B5IB 5IJKA 3SDYL 3MA7B 3UBXB 1NC2B 4P2RA 4K7FA 4HUMB 4AK1A 3LPGA 5IKCA 3KPPA 2VDRL 4ODHL 4JM4H 4D2NA 4YHOL 2DJ4A 1K4DA 4O51B 2ZCKH 4N9OB 3CAFA 3CPLB 1TCMA 1YMMD 3GHBH 1MF2L 5L2KB 1NCDL 3SGEI 1XIWB 1LVEA 4MJ6B 2NY3C 4EQ3A 1T2XA 2C1PA 4OFKA 3RUGB 4CNIA 1R3LA 2O5XL 1PG7L 3DX6B 2FD6L 3SEPA 3U2SB 1CZ8L 5B3JF 3MLTB 1H3UA 3UXFA 1IM9D 5AWNL 3TPUA 5BZDB 5I19H 3QH3B 4NO2A 5JHLH 4UQ2B 3DVIA 2ZOKB 4W6WB 3OTTA 1IAKB 1LMKA 1H8OA 4PRIA 1NJ9A 1FFPB 1MHHB 5FA4B 5D96B 1FZOB 3SGJC 4PJ9A 4NKDA 4ODTL 1U3HC 5EZIL 3WFDL 4PRPD 4FQHB 2VYRE 2APBA 5IHZA 1JMZA 5AAWA 1GAFH 4GUPB 5EBWA 1A7RH 3WIHH 4G3YL 1D9KC 3FQRB 3SDAA 1D5MB 1MIML 1E27A 5DEFA 4MXQD 3QDME 1I8KA 3U46B 1FCCA 1L7TH 4PJBF 4Q2ZB 5EZLA 2YRLA 5C7XL 4NQCE 1JYXA 1NGPH 4QGYA 3N1FC 4HXBH 5HHXH 4FXGB 5E1AA 2DM4A 3LQZB 4HPOL 5C0AE 2BOCA 4F2MB 3FB8A 1GYAA 2CIKA 3B8SA 3DSFH 1WV7T 1MJUL 2VXQH 4EI5C 5DD3H 3H0TB 3IDXH 1HKFA 5I74C 5JW4N 4L3AA 3SE3C 3RKDC 3QJFB 2NY1C 4XP9H 4CJ0A 4RMWA 2NY4B 3BEVB 4UB0L 3QIWD 3HUJF 1B6UA 4PJXA 3FQTB 4ZNCD 1MFEL 2AQ2A 2WLZA 3DSNA 1U58B 1LO5A 4WWKC 5CBAB 3F6LA 5D70L 4W6YB 1CE6B 1YMHA 5CSBA 1FZMB 3U4BH 3UJTH 1MCIA 3ILQD 3VXSE 5IB5B 4XPFH 3DUUB 4M6OL 1A64A 5ALCL 3ZHKA 1UWGH 3V6FB 2ESVE 1BF2A 1K8IA 5D1ZC 3NH7H 4DWHA 4P4RB 4Q6IA 4BM7A 1MREL 1P2CA 3A6CH 5HXMA 4FQ1H 5HGHB 3GO1H 3QFJE 4M00A 4OF3A 4ZMAT 1FIGL 4P49A 1HXMB 5KW9H 1BOYA 3UTZB 4GRWH 4TUOB 3BZ4A 2XYCA 2ATPA 1P9MA 1S5IH 2FHCA 5D5ME 1FNEA 3BJLA 2DDQH 1LO2H 4J3TA 2Z4QA 5KSBA 1S9YA 4GAJH 5SV4A 1B2WH 4R4FH 1GC1H 1AO7E 4PJHF 2JCCA 1DBMH 2E5EA 2NXZB 3VRLF 2I07A 3WNOA 4PGBA 4K07A 3MLSH 2HJFA 1N59A 3IFPB 3QO1A 3MFFA 4RBPK 3C6SA 1ZSDA 4U1IA 5MP6L 3MLRH 3HG1A 5EZOH 1X7QB 2C3VB 2FX9H 2OXHA 4OCWH 4M8QB 4AMKL 5TE6H 3EOYG 5GGTL 4LNVA 5E8NB 5EPMA 1XH3A 1Q9KB 4U6XB 4NQDB 3VFGH 3BP4B 3R8BB 5FECA 1BQHA 4XP5L 4HWZA 2P47B 4AEHH 4OZIE 5E5RB 5IHUH 3F62A 4OCSH 5K9JL 5F9OH 1JGDB 5IROA 3TJEH 1RZFH 1E28A 3S37L 3BPLC 2HH0H 3KYMA 4U1HB 3VFOA 1UZ6F 1U3ZA 1FJ1A 1N3NA 3FFDA 1MFAL 2H41A 4O2CB 5ISZD 3GJEA 5F1SA 3HAEG 1U93B 3MACL 3OXSB 5IK3A 3VFRA 4NM4L 5T5NG 4YEEA 2GKIA 5E1HB 5IF0B 4GMTL 1CFVL 3UTSB 4XBEL 3BH8B 4YXLH 3BSZL 5ITFA 2A9NL 5HI5D 4MAUH 4DCQA 5H37G 4YHNB 1OW0C 3BP5A 4UDUB 3PQYA 2XTLA 5F93C 3MRDB 4QRQA 2EKSB 3CFIC 4ZUVA 1I9EA 2B0SH 4Y4FC 5JDSB 5DVMA 3CVIH 1MAKA 1CLCA 4Z7OE 2A73A 3S6CA 3VFVA 1IGCL 3RZCB 4D9LH 3CVHH 1S8DB 3L3JB 3CVHA 5DD0L 1A4JA 3S5LB 3ARDD 3MV9A 2VDQL 4LPVA 2AXHA 1IE5A 5DJYB 4IDJL 5JHDA 5B39A 3FQWB 4NRZA 4PJGF 4GRLA 3KYNB 2B39A 3THML 1FN4A 1UH2A 1CDGA 1CGUA 4P5MA 3EDFA 1DLHA 4PJ8C 3X14B 5C0FB 2VXUL 2H32B 5DO2D 2ICWJ 4G8GE 5HY9A 5FYJH 2BNRB 3VXOA 5LQBL 1MFBL 2QL1A 5I1AB 3TGXA 1NBZB 3UJIL 5IVNA 4FQXD 1AJ7H 1UXSA 4DN4H 4U1SB 1EJOH 3SDCB 2Z31B 3KHQA 4YDLB 5JXAL 4NIKB 4NJ9L 3RGVB 2PETA 2B2XL 4QY8B 5FCSH 3MRRA 3OHXB 2Z35B 5E24E 2N1KA 5IB3B 1RUKH 3MV8B 4HGKC 5GJTL 3LEYL 4G6JH 4R7NA 4DUXA 2DIBA 2OI9C 3MR9A 4O00A 4JAMA 4NUGL 4YDVA 3V6ZB 3IAGC 1C7TA 3MCKA 3PWUA 1ZVSB 2NW2A 4XNQA 5TGBA 5J12C 3WFHB 3NA9L 4HWUA 4S1DC 3WKMH 1BLNB 4YHPB 3FMGH 1V7MH 2VJXA 3P9MA 3CMGA 4JFEA 3S88H 5DD5H 4LPYA 1NGXB 2BVOA 3NTCL 4AEIL 2W65A 3QXAB 1GGCL 4X6DB 1OARL 2UUDK 4RBPH 1H15A 3HFMH 1A6ZA 2FL5A 3MRJB 3PL6D 3WEXA 4OCXL 2AGJL 2IPUK 2VQUA 3K81A 3IFLL 5B38B 1LWRA 1NLBH 3FO1B 1NLDL 2ZJSH 4HPYH 5MERB 5C08A 1LP9A 3SDAC 4XNZC 3VXMB 3UTQB 3OKOA 1EMTH 2ATKA 2W0FB 1H9VA 1IEBB 3AFLA 3CFDA 1EA9C 3I50L 4N5ED 5TQ2L 3QO0A 3UC0L 1KJ2B 1ZXQA 4NYLA 4RRPA 1CGXA 4U2ZA 3C2AL 3MODH 4KMQA 3LY6A 5EO1A 1U8IB 5CFHA 4LQ1A 4HC1A 1NEZG 5CIPH 3O6FA 2EDYA 3IDNA 3QWRD 1OF2B 4HD9A 4U0QB 3EOBA 4C54A 5J1TC 2OS7A 4WEBH 3CX2A 1KLGB 5ESVB 1CDBA 3DX8A 4P59H 4G6AC 3V95A 1PY9A 4YBLC 1WSST 4ZUSB 1QSEA 5D2NC 1FO0L 4JRXD 1CFTB 2ZUXA 3W5MA 4H0GA 2R8SH 2F54E 4I1NB 1MCSA 5DHVH 1QFHA 1LK2B 1MPAL 2XTJE 3C8KB 1LE5B 1ZLWH 4JJ5A 1SEQL 5D6DA 5C0CD 5KVFH 2ZOLB 3KJ6L 3CFCL 4HWEL 4XX1G 2IALB 2A6IB 2ZUQC 1DBKH 3C9NB 3LIZH 3WFBL 4XVTH 5KSAC 3L7EA 4FOMA 2KQMA 4Q6IC 4WEMB 2W9EL 1E4XH 3D69A 2HFFB 4CVXA 5IM7A 2BVPA 1I7ZB 4MDJA 1R6VA 1NBVH 1YEJL 2Z8WC 4XAKE 2E7LC 3NAAL 1S7TA 4XP1L 3MROA 5F3HB 3FQUB 1OTSD 4UTAL 4MAYA 2BSTB 2EYRB 1P9MC 4FFWC 4NNPH 3RUGF 5I73C 4K71C 5TH2B 3QDMB 2WUBL 4JN1H 4HMCA 1UWEL 3QUMH 4ZS6C 3GJFK 4M43L 2YA1A 4ORZC 1TVHA 3BW9B 1G7PA 3SKMB 3RNQB 4PLJC 1UFUA 5C0AB 1E6OH 4XWOD 3GBML 1LHZA 2P46B 4PV9B 2ADFH 3I6GB 3MNZA 5E56A 5BV7L 4XXCC 2GTZA 4HHAB 3DTXA 4P5KB 3WNLA 1RI8A 4H0IA 5EN2B 1MEXL 4CVZB 4HWBH 1AI1H 1OAZH 3RL2B 1MLBA 1RQ5A 4HWBA 1MHCA 3PGDB 2K9UA 1P7QD 2OL3B 3B5HA 1JCKA 1ZA6B 3SCMB 2YD8A 5E00B 3RDTB 3FOMA 3LPWA 1RPQA 3T1FB 5DJ2B 1OD7A 1YNLH 3TYFA 4W70A 4WI8A 4QNPE 1G7HB 2ENSA 4OLZH 2F8VA 1XR9A 2C3XA 2D0FA 4HLJA 1CIDA 4WTZA 3VXSB 1HHGB 1O0VA 5IROC 1UADC 1KIQA 1VEOA 3SKJL 3QIUD 4U1LA 5J57B 4XZUA 4MD0B 5DHYA 4LVNB 3C6LB 4YBQD 4ONFH 5GRWA 3EFDL 2OBGA 1KJVA 4Y1AA 1HCFX 1T6WA 4G9FD 2IAND 4JR9L 4NN7B 4LSUL 1YEHL 1XGRA 3HB3D 4MHHI 3MCG1 4X6BA 3KG5A 5ESAA 1ZS8B 5FF6A 3QFJB 4WHCA 3ULVF 1TQCC 4IRJB 2X7LB 4JZOB 2QSTA 3MRMB 4TQEH 1ZHKB 3NCCB 1SEBB 2DF3A 3BVNA 1A6AB 1A47A 1ACYH 1W0YT 4ZUTB 1RZJL 3UYPA 2YPKA 5EOTB 1EZVX 2BNQA 4KI5F 1AO7B 2B8OT 2A0LD 5KAQG 4NGHL 4NZJA 1CICA 1SMAA 2D03L 4GS7C 5GS3A 4J12A 3IDIA 3BD3A 2DQTL 3WHXA 5DK0B 3G6AA 3OZ9L 2VISB 3O11A 5ANMA 3PWJA 3DECA 2DKMA 1JPSL 3LMJL 2NY5H 4RX4D 1UWXK 4Z77A 5E03A 1FVDA 5F3BB 1UA6L 2X1QA 5I6XB 1FE8H 2J8UB 1X4XA 3BXNB 3HC4H 5FV2A 5I15L 2X70A 3OB0K 4OZIB 5FO9A 3W11C 3OJVC 1G9NH 5D7LA 5K9QG 4CMMA 1F4YL 1UB6A 4YGVB 1I8MA 3EDEA 5DRNA 4Z7VA 4LVHB 5GGRB 1NGQL 1INEL 3E2HC 4P0DA 3PG2A 3MOQA 3IGAA 1KV3A 4LNRA 3FO0L 4OCRL 2OTUB 4J3XA 1DBBL 1MLCA 1JTOA 2VC2H 3M8OL 1F58L 2LTQB 3BRDA 2OQJA 1I75A 4C56D 4KJPD 2JTDA 4TPRH 1HDMA 2YWYA 5I76A 1CE1H 1UT9A 3VXRD 1VADA 2CPCA 2IAMA 4RFOL 4EN3A 5K9QI 2AV1A 3GJFH 4XMLL 4JEGB 1BGXL 1MWAH 1QYGH 2DQJH 5HYJB 1WZ1L 3AU1A 4Y5VB 2DYPB 4IBLT 2ICWI 4DVRH 2FEEL 5CJ5A 2O93L 1EEZA 1KJ3H 3GBLA 4ETQA 3QUKA 2W0LA 3V4PL 4JPKH 4UQ3A 1K2DA 4DOHE 1DBAL 4HKJA 4L8SC 2DWEA 2V5SA 5C0EA 4MJ2A 3EYVA 4LVOC 1MAMH 2ZUWA 1HIML 1FNFA 1NMBL 1RSFA 5T1KA 5E6ID 2PXYD 4M7LH 1ZA3A 4J1UA 1A6VL 1U91A 3EO0A 4O02H 4EDXA 2D0HA 4PG9A 1J12A 1EO5A 4P9HH 1ZANH 3GSNL 3CFJA 1MCKA 4G8GB 2ADGB 4X83A 1CU4H 1QNZH 3VA2C 2WBJD 1MHEA 5E70A 3K1KC 3WD5L 1TVBA 2YKLL 3OB8A 4JFXA 5FM5M 4LLMB 1A1MA 4FQJH 5CP3H 1M05A 1XGTA 2VIRA 4GKZA 4PBVC 2IF7A 4UTBL 3W9EA 4HX1A 5HHMD 2ID5A 3S36L 5F8RC 1UACH 5CJBA 2Q7YB 1KB5B 4KROB 3MLYH 4QCIB 1G6RA 1HI6A 5JOFB 5CCKH 4JKPL 1BJ8A 3WL9B 2N4IA 1EHLH 1I7RB 2X5PA 1QRNE 3CSBA 3IDGA 5EZJA 4KUCD 4H8WL 2PW1A 3ROOA 2FR4B 3FRPG 4WFHE 1AHWB 1GPOH 1KIPB 3WDHA 4F7TB 4N1CA 2R1XA 4IRSA 4F15B 5L2KD 1XIWD 2APWA 2FX7H 1PEZA 3H7BA 5DMKA 4LLUA 4WCYL 3HMXL 1CQYA 3V5HA 2NY3B 3HC0A 1QFWH 2DKSA 3EFFA 1W0VA 4P46B 1H8SA 2N7BA 2AXGA 3LB6C 2IADA 3S34H 3SPVB 5HVHC 4QRPD 4LASL 3SKNB 3CXDH 1NUDA 3HNSH 3TEUA 4IOFD 4XGZB 1ZHBA 5A2LH 4EBQH 1ONQA 4HAFA 2EE6A 1NKOA 1HZHH 1UWXH 2VQ1B 4LPXA 4MAYC 3FTGB 2JKXA 4Z0XA 4XPTL 3MV7D 3PV6B 1MJJB 1R24B 3MOAH 3E6HB 1A6WL 1C1EH 5IJVB 3MLXL 4KY1H 1WJ3A 4TNWK 1DTUA 3BIAX 3OB0H 5CGYC 2DLEA 3STZB 2BJML 3IVKB 4UT7H 1A1NA 1RY7B 1QG3A 2A6DA 1KACB 1T5WB 5FUOH 3P4NA 1NGZA 2JIXD 1C5BH 3HRZB 4H5SB 2IC2A 4OD3H 1A3QA 1BJ1J 3JWOH 4AY0A 5DLML 4R4BB 4Z76A 2JK5B 1QR1B 3M07A 4KJYA 4YDIH 2VL5A 4NHUB 1G7MB 5D2LA 1D9KB 2WWMD 1XZ0B 1FL3B 3KLSA 4PD4J 4QXUH 5FUZL 4OZHE 1RJYA 1TZGL 2XFXB 1MIEH 2X4NA 5KTEH 2X05A 1AP2B 3MXVH 1OL0A 2JCCE 2D3VA 2F54B 1OGAA 2MCPH 4YDKL 1D6VH 1M7DA 4HMEA 5F7MC 1FL5B 1LEKB 3WNNA 3PWPE 3R8QA 4WFGE 2LU7A 3EIFA 1IEAA 1SY6H 3SDDA 3SGEH 2NTFA 4Y4HC 4RAUB 1SY6A 3HZYA 4XP6L 5BXFA 1ZHLB 1LD9B 1FP5A 3QJHB 3I75B 3HMWL 3ZYZA 4K94L 5L7XL 3SDXE 4I3SL 1T21B 4XPAH 4L4VE 1MNUH 2F53A 3KPNB 5HDQL 2C1OB 4LK4A 3IFNL 4QYOA 4WV1B 2AKRB 3KLHD 4OKVB 3C5SB 1KCUL 4ODVH 5E7FA 4Y16D 2FEEI 5D1ZB 1T7WA 3T77A 1IGFL 4MJ5A 4LSRL 1YN6B 1AGEB 1OT2A 5DVLA 4P2QA 3HNVH 1M4KA 1AGDA 1FYTE 4GXUM 5ICYA 4M9PA 3QIBA 2M2DA 1EAPB 3NCYS 3VH8G 4L3EA 4ODBD 5BJTA 1EHAA 4JO4L 5BO1H 4Z95H 4Y4KA 3TFKD 2X4PB 5EOQH 2NY5C 4K8RD 3MJ7A 4QXTB 5C0JA 4OM1L 1BZ7A 3MRCA 3TT1H 2CK0H 1RUPL 2H8PB 2K3TA 2YXMA 2FATH 3T0AA 2OX5A 4I3RH 3SKUD 3TVMB 1IEHA 3T1WA 4MJIA 4Q74A 3EDKA 5EIIA 4WJ5A 3LD8C 3LEVH 1BD2D 1G9NC 1I8LC 5I9QC 3BX7C 4E41A 1ITCA 3GSXA 3LKQA 5T3ZD 3MUJA 5J9PA 5GS0D 1U8MA 2GK0B 1AFVL 2OMBA 1OAUH 2AK4A 1PYWA 3K2UH 4NQDD 5LKNA 4KU1A 4XI5C 4XXDA 4L8BA 1RJLB 3QRGH 2Y6SC 3BGMA 5JORA 1MCOH 5HHVH 3VMOA 2X2YA 4G43A 2CGRH 1EFQA 4EN3C 1T7XA 1U2HA 3NCYP 3GRWH 1IQDB 1TJHL 3GRWA 3SE9H 1AH1A 1Z3GH 4I5BB 1DBJL 4JM2A 1EFXA 4PRNA 1QFUL 1XCQB 1E4JA 4GRMB 3PHOB 1E6JL 3AVEA 2KQNA 3EOTH 3P0VH 4HK0B 3CMOL 2JJTA 3VWKB 4L8CA 2L0DA 3P4OA 1IAMA 5LGKA 3D9AL 4LLVB 43CAB 4OLXH 4PIRF 1ACZA 3QZWG 2XN9D 4MDIB 5E2TH 1EZVY 4F3FA 2OMNA 5DMJB 4UNVA 2A77H 2EIBA 1OD9A 4QTHB 3HR5B 2WIIB 5J6HA 4WNQB 3RZCD 3ROLA 1YJDH 3DGGB 5DQ9B 3L5IA 1V7NL 2WUCL 4ERSH 1T1XB 3UBXG 2GTWA 2KPNA 4LARL 2BRRL 1U0QA 5L2JA 5CZVH 3RA7H 1I9RH 3H9SA 4OQ1A 2B1HH 2GJ6B 3V0VB 1AQKH 1AKJA 3VRIB 3T0VA 5C9KA 4GFTB 1LP9E 5E4IA 4NQSA 2IFFL 3AAZA 2CDGB 5T3ZL 1AGFA 2BNRD 3M1BA 2ORBH 4V1DD 5GS0L 5JOPD 1E4WH 2VN7A 3QXDB 4MCYA 5D1XB 1DJSA 2XNAA 2XXCB 3ESVF 1A9EB 3L3HB 4LLYA 4Y5XA 5DFTA 4UAOB 4G7VL 4K7FB 3BRFA 1MRCH 3FZUD 3ZT7A 2IFGA 1A02N 2Z31D 5T3XH 5IKCB 3KPPB 1RZ8A 2VDOH 4IRSC 5DRXA 1JF1B 1K4DB 1AGBA 4ISVA 2R4RH 2DRUA 2V2WA 3RGVD 4LEXL 4N0CC 5C0NC 5L9DH 4F37F 4U1KA 2EXYD 3O4LA 1YC7A 3RNKA 2DQFA 2C1PB 2J8UF 2DQCL 4WY7H 3BKYL 3HLAA 2VDRH 1PKQA 4YHOH 4DOHB 1R3LB 5DVOA 3B9AA 3GBNL 1MF2H 4ZXBB 5E94A 1VSCA 5D7IF 4LP4A 1BWMA 1S7WA 4U1MA 2OI9B 3TPUB 2BSRB 4NO2B 3T0ED 5I1IH 1FNHA 1IJ9A 2FD6H 3CX5K 3U0PA 1QSFA 2PYEA 2XACC 1XF3A 4PRIB 5ICZA 4WEUD 1NJ9B 1XGUB 4IRZH 5AWNH 4UT9L 1OAXL 3LPFA 4LSSL 3UZEA 4YZFF 4BZ2L 3TJHD 1LEIA 4PJ9B 4NKDB 4P23D 1IT9H 3A6BL 3BUTA 3RZWA 5CLTA 2LU4A 1IBGH 5IHZB 3HAEH 1OPGH 4QOKE 3SO3B 1IILE 3HAEA 5EBWB 2DLTA 2Q8BL 3EOAA 4NJAL 3JWOC 4KMTL 3C08L 4X9HA 4HIEA 4ODTH 5EZIH 3WJJC 4YHZL 2OM5A 3V4VL 3WFDH 3TWCL 2CK2A 1E27B 5BRZA 5DEFB 4HF5H 5JLZA 5LGHL 1I8KB 1WICA 1OAYH 1EO8L 2DICA 3T3MF 1NAKL 4X7SL 5H37H 5EZLB 4UV4L 1QRNB 1OTTD 2NX5E 4X8XA 5B21A 4Y88A 4OF8A 4G3YH 3REVA 4XCYA 1F6FB 1MIMH 5E1AB 2R39A 4NRXA 2BOCB 3S3PA 4KK5D 4B53A 2GYSA 3FB8B 4G8EA 2CIKB 3V9FA 2Q7NA 1PQZB 1FHGA 3DHJA 4JFHD 3BAEL 1YY8A 4HPOH 2MMXA 5F88B 3GSWA 3V4UL 3DUHA 1GXEA 1T0PB 1X5ZA 1DQTA 1LO5B 1MJUH 2V2TB 4V2BA 4JZNA 1JK8A 1MQ8A 1YMMA 3STLB 1YMHB 4F33A 4HBQA 5DA0B 5IIEA 3BMVA 3ZE1E 3AB0B 4UV7L 1MFEH 1I1YB 1K8IB 3K8LA 3QXUA 1NGYB 4XNUL 3P9LA 5D70H 3RVTC 3RAJL 2MQ3A 4BK5A 4Q6IB 2IMNA 3WHE1 4M6OH 1IM9A 1P2CB 1M71B 4APQC 5B8CC 3FB6A 1NCTA 2W92A 1FFRA 5ALCH 1FSKB 1SJHB 4RISL 1KEMH 4FQ2L 2NZ9D 4WI3A 3PHQA 3QDMD 3BZ4B 4Y4KC 2ATPB 5I73B 4OZHB 3P9WB 1FNEB 1MREH 3PXHA 5F1OB 4NQCD 2X4QA 2Z4QB 5KSBB 1K9TA 1QRKA 1S9YB 4NOFA 4PRPA 5GSVB 1FIGH 1KJMA 3TV3L 2JCCB 2IH3A 1PY4A 2I07B 1RZGB 3RHWK 4PGBB 4KH2A 3TLRA 5L8LB 1UGNA 2HJFB 4E42A 3MFFB 3C6SB 4N9GB 3ETBF 4PJ7A 5TJWK 1W8OA 1ZSDB 3PWPB 2J12B 2ZCLL 1JYWA 5KSUA 2JJVA 5E2UL 3SCMD 3RDTD 3HG1B 2DLIA 3L3GA 5ESQA 2IH1A 3EJZD 3AUVA 5EPMB 1XH3B 5FK9B 2D2OA 5MP6H 3S7GA 4LMQE 3L7FA 1BQHB 2A6KA 2D0GA 4DZ8A 4HWZB 1KC5L 4P57A 1HQRB 3Q6FA 2ESVD 1FH5H 5D8JL 3P73A 2BFVH 2R0WH 1MFDL 3FT2A 1E28B 4LEOA 2CXKA 3GIZL 3KYMB 3O8XC 3RTQD 4JM2C 4KRNA 5GGTA 5AZEH 3VFOB 1FJ1B 2XQBL 5J3HC 4MB4A 4GAFB 1FC2D 4XP5H 3QIWA 4URTB 1MCCA 5GRXG 1VFMA 5ICXB 2JJTC 2XQYG 2I9TA 4D0DA 2G9HA 5IK3B 4U4BA 5T5FL 1ZT7A 4OUUA 4IRJD 3S37H 4DGVL 5EU7E 2FECL 4ZUUA 5DVKA 1H3PL 1MFAH 2X4TA 3S5LG 2AJSL 5ITFB 1QZ1A 1MHPL 4DCQB 3IDUA 1S9KC 3MACH 3BP5B 2P8LA 3PQYB 4A6YL 3NCJL 4O5LH 4QRQB 1CFVH 4M7KL 3IDYB 1Q0YL 2XA3A 4W4OC 4XBEH 2J6EH 3IF1B 4HXAL 3D25A 1NL0L 2F58L 2Q76A 3BSZH 5HYQA 1U8OA 3M45A 2A73B 3VFVB 4LSPL 2WBWB 5IFAH 3L9RA 3VG0L 5ETUA 1UENA 3HA0A 2LE9A 1TMCB 4CJ1A 4NM8L 3MXWL 1AIFA 1SM3L 5GGRY 5CSGA 5B39B 4GRLB 4S0TD 4KDTA 4WO4B 4YE4H 1OGTB 4OZ4A 4P5MB 2EDNA 5E8OB 1GOGA 4LP5A 4DEPC 1KPVB 1TZIB 4Y5XC 5JPNB 5HY9B 4LDOB 4K9EC 3VXOB 2AV7A 1S7RA 3O45A 1EIBA 2DQIL 3THMH 5J1SC 3OR7A 5JXEC 1UXSB 1ZVYA 3E0GA 1G1YA 2OK0L 5CGMA 2VXUH 4QF1A 3QDAA 4YHML 3MC0A 4AQOA 4N90D 5LQBH 1MCWW 4AENA 3E2HB 1LK3L 4DQOL 1NCUA 3UJIH 5F1IA 2FO1A 3MRRB 2JJSC 2YD7A 2YRZA 3C5ZC 1TJIH 2R9HD 4U3HA 5D1QD 1ZOXA 4HKZA 5E2VH 5HGBA 4XHJD 4D9RE 4R7NB 2AERT 1KELL 2P5WE 3MR9B 4YDVB 4JAMB 3CIQA 1R3KA 3FB7A 2V7HA 2DQUL 3MCKB 3PWUB 4N8PA 2EDJA 2NW2B 4XNQB 3CSYA 5B38G 5HHPA 2UV3A 5T1DL 1G7JA 1ZV5A 3QPQD 4WHYG 5E8PA 3VWJC 5ISZA 3FQXA 5GJTH 3LEYH 3P9MB 4R2GD 4JFEB 3HRPA 4LFHD 1TLKA 4NUGH 4QKXB 3DGCR 5CZKA 4NNYA 2XZCL 1Q94B 4PJFF 1CVRA 4H20L 2VZOA 3KPOA 4BFGA 3NA9H 1H15B 2GSIB 1A6ZB 2FL5B 1GZQA 3WEXB 3H2WA 1GH7A 2B4CL 4MVBD 2E9BA 5EDXA 2VDLL 5C08B 1OARH 4ZPTA 1LP9B 1DQML 3CLFL 1AD0B 4NO5A 2FIRT 3K2MC 3CFDB 4ENEC 5CEYA 4OCXH 3QO0B 2MJWA 1WIOA 4MNGA 4FFYL 4NYLB 1CLZL 4XC1L 1VB9A 3LZFL 4MQXD 3ARDA 1V5JA 2IEPA 1FBIL 3WXWL 3O6FB 3I50H 2DM2A 3IDNB 5EU5A 2QQQA 5TQ2H 5D93C 3MOBL 3UC0H 4R7DA 1ES0A 3PWVA 2CR3A 3C2AH 3EOBB 3KLAA 3BN9C 4N5UA 5F7LB 3BGAA 4CADA 4KTEL 1LGVA 3DX8B 4PRHE 1G7IB 3LN4A 1DEEA 2DBLL 4FQXA 2OR8A 4M62L 1QSEB 1GIGL 1B0GA 3FKUS 5TF1L 4S2SA 3TIEA 1GJIA 1WCBA 4I0KA 2WNGA 3B9VA 1OGAE 3FO2A 1LILA 3DMMD 4MA7L 5JQ6L 3K8MA 4EVNA 1ZTXL 2R1WB 4UBDD 4L4TE 4JJ5B 3BPCA 5C8JA 1FO0H 5L0QC 4MYWB 1L0YA 3L5XL 3L7EB 1CF8L 3LKOB 1JNLL 3GSVA 3D69B 4CVXB 2ICWA 2BVPB 1MPAH 4MDJB 2FECI 1SEQH 3KJ6H 3ZLQC 3CFCH 5J11C 3MROB 1TQBC 3T65B 1NFDE 3WFBH 5C3TA 5F1NA 2F53E 3VFTA 2CRZA 2VQTA 3NCMA 3U79A 3VD7A 3WYRA 1I3UA 4QHLB 2HLAA 4XHQA 2I24N 2R2CA 1YEJH 5DDHA 2O5ZL 3NAAH 1TVHB 2NX5B 2ZWLT 3QDGE 4UIKL 1G7PB 3DRTA 3QEGL 3PL6A 1A9BA 3UZVB 3CFKA 4NC1C 2BP3A 2YPVH 4HGMA 4P2QE 3BDBA 2WUBH 5ECJE 1N6UA 2VZUA 3MNZB 1EUTA 3TYGL 4M43H 2GTZB 3DTXB 5C70A 4M5YL 5AG8A 1BWWA 3IU3A 3IJYA 3LOWA 2J3SA 3ARVA 1MLBB 1TENA 1B0RA 3IXAA 4JKKA 1CDJA 3GBMH 1J0KA 2APTA 1OP5H 4MA1C 1H3VA 5BV7H 5EA0L 3MGOA 2BRQA 4AG4L 3BPNC 1MEXH 3TYFB 2VR9A 3QWRA 5LAXA 4AYFA 1J0JA 4MB5A 1XR9B 2XTJD 5IBUB 1JZ5A 2GI7A 2XWJA 4U1LB 1OAQH 4Y2OA 3QI9D 4K23L 5DQJA 4NN6C 4XZUB 1W72A 5DHYB 5F9JA 3BT2L 3EO9L 3IKKA 1N5AA 3ECBB 4Y1AB 1KJVB 4OLWL 4G8IA 2EH7H 3DROB 3W9DA 4JO2H 1EHXA 4XAKD 4JCMA 1PKOA 4JRXA 3AREB 2DLFH 4YXHL 4X6BB 2EDBA 1LDPL 5FF6B 1LO3L 3FJTA 4O2FA 3RVVD 4LPUA 1DR9A 3EFDH 2IPTL 5GGVL 5IT2L 1VENA 3DNKA 2H6PA 1F3DJ 4WENB 3ZL4L 5J56B 2V2XB 5C0CA 4JR9H 3OKEB 3OSKA 1YEHH 4OI9A 1CLYH 2MFNA 4PJXF 2YPKB 3PIQA 3P30L 2RQ8A 2LV4A 2BNQB 4DZBA 1F4WL 4J6RL 5IUSA 5CGTA 3JV6A 3U83A 1B88A 5GGSA 3OAUL 1CICB 5JA9A 2YPLD 1RZJH 3OV6A 3ZYIA 3QQ9D 1YN7B 3WHXB 3G6AB 3VG9B 1T04A 3O11B 1KXTB 4OF0A 5ANMB 3PWJB 3MYJB 4F57L 3NGBC 4RGNE 4NGHH 3R1GL 4Z77B 1FVDB 2R2HA 3MZGB 2WQRA 3TVMD 1C5CL 4DKAA 1P4BL 4FRWA 2AXJA 5DT1L 4S1QL 1UZ8B 2X70B 2WAHA 3LMJH 1JPSH 3P4MA 5FO9B 4N68A 4GRWF 1EDQA 1JWSA 2X1WL 3QUXC 5D7LB 1UA6H 4CMMB 7FABL 1UB6B 5KSBF 5AD0A 5DRNB 3G9AB 4X9BA 3WN5C 3NCEB 1AC6A 1F45A 4BQ6A 1P7QA 1HHJA 4LQFH 1ZE3C 2HKFL 4XNYL 5H94B 1JMXA 3IGAB 1MFCL 5MENE 4QO1A 1MLCB 2C3GA 3VJ6A 1F4YH 4I0PC 4LFHG 2OQJB 4NZRL 1LQSR 2DIJA 1NGQH 5IMLB 1INEH 4I9WE 5DJCA 1HDMB 4X4MA 3MUGA 2OXGA 1MFNA 2RJMA 4OCRH 3VGDA 2IAMB 3QIUA 1I3VA 4U1GB 1DBBH 3GK8L 3RVWC 1PFCA 3PWNA 4R97B 1F58H 1U8NB 3AU1B 4OAWA 4E0RA 1CDYA 4ZTOH 1T1ZB 1UCBL 5JIIA 2YD5A 3G5VA 4MD5A 4G9FA 1QEWA 2IANA 4ETQB 3QUKB 3BUYA 4JRYE 2ILLA 4RFOH 4UQ3B 4XMLH 5MEOB 1K2DB 4KKCD 4HKJB 2DWEB 1BGXH 1HSAB 5FCUL 4CN1A 5C0EB 4OCYL 3U30C 5HI5C 1WZ1H 2BNUB 3EYVB 3FHQA 1BMGA 1WZMA 2BVEA 3GSOA 4OGAD 3RIAF 5T1KB 2BHUA 1ZA3B 4J1UB 1DBAH 3BRGC 3EO0B 2EIZB 4PG9B 4JN2A 3V7AE 1RURL 4P5TC 1FYHB 3DLQR 4OZGA 3GI8L 1HILA 5FGCE 1HIMH 1NMBH 1SJEA 4FMKA 3ARDC 4U7MA 1A6VH 2EH8H 3JTSA 3MGTA 3DXAE 1TVBB 3G6JA 1A1MB 3GMOB 1T1WA 1M05B 2VIRB 3GSNH 2EC9U 4RX4A 4PREA 5IB1A 4XCFH 3W9EB 2NZIA 3CFEB 5DO2C 1G6RB 1HI6B 3WD5H 2YKLH 2XWBB 1VCAA 1HQ4A 4XPBL 1SYSB 1Z9SA 3IDGB 4Q0XL 4UTBH 1B4JL 1I3RA 2AJZA 2PW1B 3ROOB 3VFWB 2Y06L 3S36H 4BH8A 4DVBA 4PBWD 4OQTH 5IV2A 2IQ9L 3H7BB 1OOAA 4LLUB 4JKPH 1FFOA 5E5MA 1KB9J 1EX0A 3V5HB 2E9WA 5ACZA 4H8WH 5JO5A 1GGUA 2VRAA 3HC0B 3EFFB 4KGJA 1W0VB 2HG5A 4ZXBD 3W39A 4BYHA 4C56A 4NT6B 2NTSP 2AXGB 4ESKA 2IADB 5DRZA 3LQAH 5BMFH 3BQUD 4WCYH 3O9WD 1QLEL 4OCMC 2EDQA 3VXRA 1P84K 5DQDH 1ZHBB 1JFQL 3HMXA 4JPIA 1NBYB 1ONQB 2DB8A 1FNGA 4WHDA 1Z9OA 1KFAH 1YMME 2I5YL 4WTWA 4YFLI 2PO6C 2NY6D 5FGBC 4Z0XB 1P5UA 3LRHA 4LASH 1J8HE 5INDA 3C60D 4U05A 1NCCH 3TBWA 3QULA 4LF3A 1YPZA 3NMEA 4FFVC 2QTEA 4X6CE 2G60L 3PL6C 1A1NB 4WTXA 2A6DB 2BY0A 1J1OL 4XPTH 5F7NC 1A6WH 2PXYA 2DJUA 4O2EA 4WU5A 5E6IA 3K1DA 3MLXH 5I8OL 5DURD 1CFNA 3SQBA 4Z76B 4OZFA 1WBYA 1DANU 4N5EC 4KJYB 2VL5B 2BJMH 5D2LB 3R4DA 2MHAA 3S96A 2VLME 1D3CA 1RJYB 1QRND 1CN4A 2EDKA 2X4NB 4WFHD 3AS2A 3DI3B 2WBJA 5F6HJ 4G9DA 4HKBA 1U41A 5BV7C 3VFUA 3ME0A 3VRJA 3VI3E 2Y23A 4XNMA 3BWUC 1OGAB 1WISA 2FJGA 1J0IA 1TPXB 4M7LT 4BQBA 1IM3A 1RIHL 4OTXL 1T7VA 2IBBA 1HNFA 5F9DC 4FQLL 4KJQD 3ZDXE 2M26A 1IEAB 4O51A 2FWOA 4IIQB 2C3HA 3SDDB 2NTFB 2VL4A 4KXZI 3MJ8A 3HZYB 5BXFB 4JHWL 5L2KA 2FSEA 3IXTA 1XIWA 5I8EA 3ALWA 2F53B 2DAVA 4KKLC 3FT4A 4QYOB 3LN9A 4OM0L 4KQ4L 5MI0C 4PJAA 1A7PL 2AEWA 3AMLA 1X6NA 3HMWH 4QRPA 4FQCL 2CUIA 5JDJA 1WWCA 4I3SH 3ZO0A 1P6FA 5D2NE 4MJ5B 1N2RA 4I2XA 4TVPE 2UWEE 1C8PA 5HDQH 4P2QB 1HHKB 1AGDB 1MH5A 1IKNC 1RZJC 5ICYB 3QIBB 2AJUL 1KCUH 4U0RB 1FFPA 5BJTB 5DR5H 3MV7A 2QEJA 3RI5F 4QXGL 4Y4KB 4LSRH 5DC4B 5TFSL 4MXWH 5C0JB 1BZ7B 5I1GL 2DD8L 3VXTA 4J3OC 3PDGA 1CXIA 5F7KC 3BD4A 3SKOA 2D7TL 2JIXA 4JO4H 4MJIB 4BZ1L 5EIIB 3FQRA 4WJ5B 2HLFD 5GZND 1NQBA 3PWPD 3EDJA 4WFGD 4OM1H 1L4IA 2APVA 1RUPH 4E41B 3U46A 4Z9KB 3GSXB 35C8L 1X44A 1CCZA 3LKQB 2PYFA 1WCQA 5J9PB 1U8MB 3MBED 2XQYK 5I1DA 2XKUA 2AK4B 2COQA 3BKCL 1RMFL 1LO0L 2BVUA 4L4VD 3ULVH 3DRQA 1FORL 4L8BB 2K1MA 3V6OC 5JORB 3BGMB 3H0TA 1CXEA 2X4RA 1HH9A 3QIUC 2VERN 2FB4L 3BEVA 1BJ1H 3UTTE 3UYOD 1YEGL 3VD3A 1BECA 3PDOB 4YEFA 1MCLA 4EI6A 1EFXB 3PNWA 4GW5A 1JHTA 2VB5A 3HB3C 1FYTD 4LCCA 2BY3A 4L8CB 5IB5A 5J4MA 3DUUA 3S9DB 3P4OB 4LLAA 1UVQB 3V6FA 1QFUH 4I77L 4QHMB 1QHPA 2ADIB 4XP4L 2VLJE 4RGNB 3CMOH 4F3FB 1IGML 3QUYD 4Y16A 5M95B 5J6HB 1A8JH 1WITA 2A0LC 2Y25A 2FX8L 3D9AH 3ROLB 3O2WL 1BVZA 4BH7A 5GS2H 1WT5A 4FA8A 3UTZA 1JNNH 1H5BA 2GTWB 5I75B 5CJXA 5H8DA 3GFUA 3WKNA 5L2JB 2Q3AA 2DLHA 5DMIH 5DZLA 1WTGT 3PJSA 5A3IC 5BOZG 1S5HA 4JLRB 1AKJB 4WO4D 1IL1A 2NY0C 1JYNA 1V7NH 5HHNA 1CFBA 3BO8B 1T80A 4NQSB 2F15A 5TDPB 2XZAL 4LARH 3QG7L 3ABZA 1AGFB 3M1BB 1KGCE 4MCYB 4LGRB 1A7BA 4HIIA 2XNAB 2FJFA 3QWQB 5IGXL 4LLYB 5TE7L 4MNGE 4ELME 1FFQA 1BD2A 1RIVL 4HS8H 1OB1B 3NIGF 1RZ8B 2IFFH 1AGBB 4ISVB 4JFPA 1S9XA 4U1KB 4U31A 1CL7I 1J0YA 3O4LB 4G7VH 4MMXC 3RNKB 2DQFB 4NQDA 5HPOA 4H8WC 3V6BR 5F6IB 3HLAB 1ADQH 4KJPC 1HSBB 2O5YH 4U6VL 5FM5O 1JV5A 4LEXH 3AXLA 3LQAC 5EU6E 4Z7NE 5E94B 4M4PA 1S7WB 4U1MB 4Z7VF 4KJWC 2EO1A 3BKYH 2RFXA 3RWCA 3X3GL 5DUPL 5CEZL 5LWYL 6FABH 1CD1A 1I9JL 3GBNH 3U0PB 1QSFB 2X4UA 3HKFA 1XF3B 5ICZB 1JJUA 3FN9A 5DD1L 4B7IA 4J8RA 4BK4A 1LEIB 4LSTL 4KKAC 4UDUA 3MRLB 5E6IC 2PXYC 4ZO8A 2XN9A 4WU7B 2EKSA 1ND0A 3CXHJ 5KZCD 1JRHL 4H1LB 1OAXH 4KC3B 4YR6B 2YD2A 4BZ2H 1A1OA 4HIEB 2C9AA 4W81A 5J0BA 5L8JB 3RZCA 1J10A 4QRSA 3A6BH 4LLQB 3L3JA 5JLZB 2Z8SA 2EICA 3SHSA 2WBJC 3FAXA 5DJYA 4DK3A 4NJAH 3GUTA 1IKFL 3C08H 3H8NA 5KANG 4YJZL 3KPMB 3KYNA 5KOMC 3TWCH 3V4VH 2K7PA 4XCYB 5E08L 2QADD 2Z92B 5LGHH 1EEQA 3NA4A 1EO8H 4G8EB 5D93B 1T3FA 4M6NH 4X7SH 2RIKA 1BQSA 2B5IC 1S7VA 1II4E 2BNRA 4V1DA 1MRDL 1T0NB 1NBZA 2ZUYA 3W5NA 1M6OB 1YY8B 2AAVA 5FFLA 4HULB 4MXVF 4C83A 1A3LL 2Z31A 4OBRA 1XIWC 4FABL 2Y5TA 4JZNB 3RGVA 1JK8B 2FBOJ 2E9JA 1YMMB 4NHCL 4F33B 3BAEH 5IIEB 2Z35A 4F80A 1MUJA 2F8OA 3IAQA 3V4UH 4K7PL 3PDDA 3S8WA 4PJCE 2X41A 5F6HI 3MRIB 4Z7WE 3P9LB 5CBEA 1V3LA 4YC2B 3GI9H 4K94C 3VGAB 4QOKD 2BK8A 4YHPA 4UV7H 3UX9B 1SYVA 2CKBL 1ZLSL 2CJUL 2VO5A 3HC3L 1EBAA 3T0EA 2H1PL 5IEKA 1NGXA 5D96C 2EDHA 3QXAA 3PHQB 4XB7A 2ZCHL 2AW2A 2EYSB 2C4FU 4X6DA 5JOEA 2R2BB 5I16A 5HGGS 2NX5D 2X4QB 5IEHA 4MA3A 5IVZB 1RD6A 4P23A 4RISH 3O6ML 4PRPB 1KJMB 2GW5A 5SX4H 2CQVA 4UOW1 4JFZL 4WHYH 1UEMA 3K8KA 1TETL 2IH3B 4HC1L 3VFNA 4Y19E 1BQHG 1IEBA 4E42B 2JB5L 1KJ2H 4PJ7B 2HFTA 2GY5A 3MJ9H 4UILL 4J3SA 1ULVA 1CXHA 4JFDE 5KSUB 1MCNA 3TV3H 2N7AA 4XB8A 4Z8FL 2OJEA 3L3GB 5ESQB 2VDNL 2IH1B 3NFPA 1KENH 4WUUE 4KWUA 3CK0L 2YR3A 5J1AB 2J8HA 1OF2A 4MA1B 3LH2H 3MLPA 3L7FB 5E2UH 2A6KB 3VU2A 4DZ8B 1T03L 2XPGA 5BOPA 4POYA 5D2LF 2DTSA 3QUZD 5ESVA 1V8HA 4ZFGH 4GG6E 4QHKJ 3FT2B 4LEOB 3O6LL 4X6FA 4NN6B 4F37K 4M1CD 4YWGL 3QIWB 1KC5H 4D0CB 1CFTA 3ARED 3TIDA 1BHGA 1DDHA 2VSCA 2I9TB 2UWEB 4D0DB 3PP4L 1YEIL 2G9HB 5D8JH 1ZT7B 1MFDH 3CDFA 1NUFA 4U6HA 3GIZH 1YNKL 4ZUUB 4ERSL 3B2UD 3TBVA 3SQOL 2ZOLA 4X4ME 3ARYA 2IALA 2A6IA 3BN3B 4DW2H 5B39G 1DSFL 4X7EC 5C71A 1P6AB 4LRNH 1BX2A 2P8LB 5DJ0A 2HFFA 3U7WL 4DGVH 4GT7A 4Q6YA 1I7ZA 5JW3L 1H3PH 3D25B 5HYQB 2Q76B 2AJSH 5HSFA 1U8OB 1MHPH 4AM0A 5D7JD 3L9RB 1EGJH 1JUFA 5ETUB 1H5BC 2BSTA 2EYRA 2DQGL 5SWZD 1DQJB 5CJXC 3B3IB 3NCJH 3QDMA 1AIFB 3QFDA 4M7KH 4A6YA 1XGYL 1Q0YH 4NBZB 4O9HH 5AAMA 1OLLA 1NCBL 1KN2H 5DFVD 4NQCA 4FP8H 4LSPH 4P99A 3VG0H 1JRHI 1G7QA 4NN5C 4PRDB 2X9YA 5HVWA 3BISA 1CYGA 4BFBD 4D3CH 5TPWH 4NM8H 4XTRC 1FGNL 3F8UB 3MXWH 1SM3H 2HYMA 2OZ4L 4RDQG 1J0ZA 3NCBB 3QCUL 1P4LB 3OAZK 2AV7B 5EN2A 2M1KA 4CVZA 2VDPL 1S7RB 3O45B 4PJDE 5GRVL 2OL3H 4EKXA 3OR7B 4H26A 1KYOK 2JF1A 4ZAKD 3TPKA 5GS0C 1DN0A 2R23B 3RDTA 5K33A 3UMTA 3BKML 4N8CL 4J2XA 4AENB 1S7UA 3ZE2F 1T22B 3ZE0F 1QLFA 5BS0E 4C4KT 1UKQA 4TTDD 3TT3L 2R0LL 3GSUA 4HKZB 2OK0H 5IBLD 3Q6GL 2IBZY 1XMWA 2NQCA 5HGBB 4YHMH 2ESVA 3K46A 4XCCL 3CH8A 4MD0A 1R3KB 1PJ9A 3FB7B 3NIDE 2V7HB 5C0DB 1JBJA 1JHLL 3RTQA 2AEQH 5HHPB 1G7JB 4FQIH 5JMOC 5ISZB 3MUY1 5IB2B 1KELH 1EH9A 4NNYB 3UTOA 2VWEC 2DQUH 4IRJA 3KPOB 1U8LA 3MRMA 5KJRH 5D5MA 3HE7D 3AS3A 1GZQB 2FH8A 5CJOH 4TNWF 1RU9L 4ZUTA 3U30B 5DUBA 4FQPA 1U92B 1XF5A 4JM2F 2XZCH 4ZDHA 4H20H 1VGKB 4ZPTB 3RZCC 5L8KB 3GSQA 3LKSA 1X5GA 3FONA 4NO5B 2J8OA 2JJUA 4KDWA 5CEYB 2B4CH 2EDLA 2J5LB 4MQTB 3MRHB 2Z91A 4MNGB 4WHTB 4Y8AA 4DGYL 5JR1L 4XAWL 3ARDB 4KVNL 3ULUE 5FHBL 1DQMH 3CLFH 3L95A 1F02I 3NN8A 5C07E 4P2OD 2FZ3A 3IYLW 4G6FB 2CH8A 5EU5B 3S4SA 1ZHNA 5A1AA 4R7DB 3MBXH 1IC4L 3IFOA 4HAGA 1IMHC 3PWVB 4FFYH 1CLZH 2KKQA 3KLAB 4XC1H 4D0BA 7CGTA 3LZFH 2DM7A 3WNMA 4H88L 4KQ3H 4OZIA 4D9RD 3OKLA 4GKSA 1FBIH 4J23A 3WXWH 2P5WD 4PP2A 1I7TB 4CADB 1VERA 5CILL 3FZUC 5A2JH 3DX9A 3MOBH 3SDCC 2Z31C 3B43A 1XEDA 4YDLC 2UZXB 4FQXB 5HGDA 4LCUA 1SMOA 1B0GB 2X09A 5EUOE 2NW3A 3RGVC 1KTDA 4S2SB 3TIEB 4HG4J 1WCBB 4OI7A 4JDZA 4ZPVB 5C09E 1R3IL 2EXYC 3FO2B 4KTEH 3ZSSA 1NEUA 3D18A 4EVNB 1UB5A 5ILTL 3WS6C 2BCKB 2X4OB 3IB4A 4M62H 3BPCB 5C8JB 5D1QA 5TF1H 1W2KT 5T1LD 5ALBL 5CAYB 5JQ6H 3GSVB 1X4ZA 5AYUL 1RZIA 2LQRA 1ZTXH 2ICWB 2Q1EA 3WO4B 4DGIH 1BF8A 1UH4A 3O3DA 2GCYB 4X7DC 5EULV 1K8DB 3TC9A 3KR3L 2R15A 5EWIL 4M1DH 3L5XH 4O58H 2Q6WA 5F1NB 3ZTNH 1JNLH 2V17L 2BOBB 3OAZH 2Y36L 5IW6A 4PJAE 3L5WA 2YMXL 5SX5K 5DDHB 2BSSA 1I8IA 3DRTB 1BAFH 1A9BB 4PGCA 2CD0A 3CFKB 5SWSE 5EBMA 3IT8D 1GSMA 1Q9WB 4NQVA 5HYFA 3U7AA 4ZFFA 5IBUG 4PJIE 4M5ZL 4UIKH 5IBTL 3QEGH 1XCTA 4PRHD 3EJYC 3ZKND 3IU3B 3IJYB 1G6RL 2AI0H 3IXAB 1OTTC 3LSOA 1CDIA 3JSSA 5F72S 4QRUB 1XAUA 2VKXA 3TYGH 3MGOB 4M5YH 4YAQB 5FDWA 4KK5C 3KYKL 2R4SH 1KB5H 2E3VA 3S37X 2P5EA 1KCVL 4QCIA 4L4TD 3V2AR 1AXTL 2XWJB 1DQDL 2ICES 5HDOA 4KV5F 1U9KA 4P3DA 4PJCB 3GGWA 5EA0H 2Q20A 5DQJB 1ETZB 1W72B 5F1KC 4Z7WB 4ZO7A 4OBSA 5GRUL 4Z7QE 5DK3A 5FDYA 4G8IB 2LABA 1T66D 1JNHA 2NY7L 2EKJA 2EO9A 4XVUD 3PHSA 5F7EL 5HGAA 3W9DB 4LSDA 4MLIA 3RBSA 4JRXB 1H3WM 4K23H 1HHHA 1WAAE 2F53D 3DMMA 3DUSB 4R9HA 4YGAB 4O2FB 3BT2H 4M6ML 5E95B 4OLWH 1KLFA 5DD6B 5FXCH 1AXSA 2H6PB 1QVOB 5C0CB 1K6QH 3QDGD 4F7MA 4CU6A 5MI0B 4J3WA 3JWNC 1CFQA 1LDPH 3HS0A 1I1AB 3X3FL 2QSCL 3PIQB 3ZKSD 3QNZA 4WRLA 1DUYA 4DZBB 1IZKA 5DMYA 3OKMA 4OFYD 5GGVH 5IT2H 1JPTH 3JV6B 3QYCA 2QHRL 5GGSB 2MCG1 4QHKI 1CFSB 1R24A 5IJVA 1U42A 4LAQL 5FM4A 3T3PF 3P30H 1T04B 1U3HD 1F4WH 2Z93A 4J6RH 2F9BT 3STZA 1CXLA 4RWYL 3IVKA 5ADOH 1EERB 2GEEA 3OAUH 1T5WA 4JY4B 2R2HB 4Z5RB 3VW3H 5JNYA 2C26A 5GS1A 4UT6L 2ZZUT 1FIEA 1OHQA 4H5SA 1CGYA 4LCWE 5HYSA 5E2WL 2CRYA 4LMQI 2XZQL 4W68A 4F57H 1FNSL 3P4MB 2AEIT 1XZ0A 4HIJB 4BELD 4Y89A 1JWSB 4NQEE 3I6KA 3MTRA 1C5CH 4PS4H 3SCMC 4GG6B 3RDTC 3KXFE 1P4BH 5DT1H 2R1YB 4YK4B 5AD0B 2M8XA 1CD8A 1P7QB 1I7UA 3ARTA 1HHJB 1F90L 3C09B 3EJZC 1V05A 4KZEH 1T6VN 5LXGL 2VNCA 2D4FA 2QJDA 4KFZC 7FABH 4EI5D 4EUPA 2YC1A 4PJ7F 3RKDD 1QOKA 2AEPL 5DJCB 4LVNC 3C6LC 3MUGB 3QIUB 4HLZG 1CQKA 1P69B 3QI9A 4KHTL 3PWNB 1IGJA 4KXZH 5SX5H 2VMFA 4NN7C 4QHUA 1N5YH 1H3XA 4E0RB 4HCRH 4NZRH 1R0AH 3G5VB 1ZHLA 4MD5B 4G9FB 1QEWB 2IANB 3I75A 1QBLL 5GRYA 4IRJC 3BUYB 2ED9A 4ONGL 4PGZA 3GK8H 4M48L 3OBAA 1IAOA 3L3KA 3UAJD 1KEGH 4OSUL 2HP4A 2YEZB 4WV1A 3V0WH 2QBWA 1UCBH 4M7ZB 4RGND 3EYQD 3R0MA 3WFEL 3U0WL 2AJYL 1OLZA 4X4ZA 5DS8A 1AR1D 2NPLX 4PGJA 3W0WE 5FCUH 4OCYH 5C1MB 2PW2A 4XWGL 3W2DL 4IJ3B 5E6ZA 4QHNA 4JKLA 2H2PD 3B83A 2B4CC 4OZGB 1HILB 3P11L 1EAPA 1GGIL 1SJEB 2YPLA 3OAYK 4M3JA 3RJQB 4KI1A 4PJDB 4AEFA 3JTSB 3MGTB 3EO1A 2X4PA 2Y7QA 2VZ1A 3G6JB 3FN0H 1HOCB 1FDLL 2XN9E 4QXTA 1T1WB 5I6XC 1CR9L 3GI8H 5MEND 3MRFA 2A2QT 4PREB 5IB1B 4GLRH 1F3DH 3TVMA 1IAIL 3VFPA 5BS0B 4HEPG 4PLKC 3TNMB 4I9WD 1HQ4B 4OLEA 1KN4L 4LHJB 4YHYC 3LS5L 1IC7L 1KB9K 1UKTA 4LVHC 2AJZB 2OTPA 5DEZA 3BDYL 3SOBL 4OLVL 1MCJA 1G0XA 4DVBB 5IV2B 3L3OA 3INUH 1NH6A 4YQXH 2Y5EA 1FFOB 2LTQC 5E5MB 4GW1A 5CD5D 2B1AH 4XPBH 4JRYD 5ACZB 3SGKA 5JO5B 3F7PC 1B4JH 4X98B 5D1QC 5JOPE 2Y06H 3ARGD 3LRGA 4LHUD 2C4XA 2HG5B 3W39B 4C4KO 1KCKA 4XHJC 1ERNA 1UG9A 5HPMA 2BHZA 3QXWA 1JPST 1VHPA 3VXRB 4Y5VC 1FNGB 3BHBA 2GY7B 1UJ3A 4R2GC 3PHOA 2P49B 3TN0B 3BZFB 2I60L 2KUTA 1QBBA 3E6FA 5HHOE 5INDB 2XG4A 3TBWB 1JFQH 3QULB 4N8VA 5HD8D 4LF3B 1YPZB 3TP4A 3DXAD 4LLVA 1WUNT 2I5YH 1QBAA 4TOYL 4MVBC 2FBJL 4RMRA 3WIIL 1A6UL 4NC2B 5FGSA 4QTHA 5E6IB 3K74B 4WU5B 2E9IA 4LSVH 4WNQA 2VLKD 3T0EE 2D7PA 1CFNB 4OZFB 1WBYB 2VDKL 5DQ9A 4ZODA 2EEDA 2MHAB 3S96B 1J1OH 5I66A 2FYYA 3KLDA 4G6KH 1UKSA 4ZS7H 2H26A 1YA5A 5I8OH 4G9DB 4EEEA 3VFUB 5EUOB 3BE1L 3VRJB 1D5IL 5C09B 3NZHL 4PJ8D 2FJGB 3VGHA 5KVDL 4BSWA 1IM3B 4PB0L 4NWTL 3ZDZF 2BX5A 3QB7C 2DQHL 5E8DL 2WBKA 1AHWC 4R0LB 5HVFB 4F15C 1JF1A 2VDML 2FWOB 2ZSWA 1DLFL 1HINL 3MJ8B 3DVGA 2FSEB 3IXTB 2KDGA 2OR9H 5GRJH 5ELIA 5I8EB 1RULH 3NOIA 3CGTA 5KAQF 4FQLH 5KS9E 1J8HD 4P46C 1JL8A 4HUVA 1RHFA 4HQQH 3TA3D 3JWDL 3FT4B 3OAYH 3D48R 4ZXBA 4JFHE 4JHWH 1CGTA 4PJAB 3ZKXB 3EW3B 1XT5A 4NFCA 4G5ZH 4AJ0A 1HEZA 4LRIC 4P3CL 4QRPB 3BQUA 3GMRA 4PG2A 3O9WA 2BSRA 4KZDL 4S1DD 3EUUA 1N2RB 4I2XB 5SWSB 4DKEL 1YECH 3LQMA 4OM0H 4KQ4H 3RVUD 4WUKH 1MH5B 1MSPA 2EE3A 1A7PH 3WHE0 2VLMD 1XGUA 1J1XL 2W9DH 3MRGA 4GQ9H 4R4ND 3ARWA 3MV7B 4FQCH 4G7YL 5DJZA 3RIAK 3C60A 1NCWL 1S7SA 2WSKA 4FFZL 5I1JL 3SE8L 2FLBT 5LBSL 4LKXA 1G0DA 1KT2A 3TESA 1C5DA 4GXVL 1PZ5A 3VXTB 1KSRA 4MS8D 4M61A 4KGLA 3SKOB 1EVTC 2JIXB 4S1RL 4JFFE 2FHBA 5DXWA 1PZUB 4OGYH 2DD8H 1MOEA 2UZIL 1SBSH 1QRNA 2PYFB 5IMOA 3MPCA 1CVSC 4ZOBA 5TDOA 2P48B 3VGGA 5I1DB 5I18L 4UNUA 1IAII 3TCLA 2X9WA 1Y6KR 4JM4L 3B8YA 3WUWB 4KRMB 35C8H 3DRQB 2XTJC 4ONHA 3GHBL 4POUB 1PQZA 3WMSA 2X4RB 1HH9B 1MCWM 3QI9C 4G6AD 5F88A 3BKCH 4P2CG 1LO0H 4TVPD 3MO1B 1FORH 4EI6B 2GAZA 3PNWB 3VDAA 4GW5B 1JHTB 1F5WA 5J06A 2V2TA 3TBYB 4KK9C 2YHGA 4LCCB 3STLA 3FFCE 4GJTB 1F3RB 5J13B 3QEQE 5I19L 5JPMA 4P4KA 3N9GL 4PP1C 2LU3A 5JHLL 3Q1SL 1YEGH 5F9AC 3RVVC 4OLUL 4WV1C 1D5ZA 1UQSA 2RAMA 3SJVD 1I1YA 2BY1A 2VR4A 3OGOE 3OKKA 5KSAD 1IC5L 1NGYA 2HRPL 2GITA 3FRUB 5FUCE 3KS0H 1JGLL 3PABA 4Y16B 1M71A 5CINL 1PEWA 1SJHA 3O4OB 4I77H 1JWUA 3VXQA 1GAFL 4BH7B 4FFWD 3QQ9C 3WIHL 1H5BB 1T20A 1IGMH 4JFOA 4ZS6D 4OZHA 4NCC1 4WI9A 5E5UB 3KXFB 3S36X 3PJSB 1PSKL 1QP1A 1S5HB 5GSVA 3O2WH 1IL1B 5HHNB 3TVMC 1L7TL 4PLJD 4CMHB 4D8PB 1T2JA 4NN5B 4M1GL 1NGPL 5L88L 1RZGA 2W1NA 1H3TA 1MI5E 4HIIB 3EYOA 2FJFB 3RBGA 4N9GA 4XX1E 4RZCA 3PWPA 4XPGL 2WANA 1BD2B 2OYPA 3UTTD 3PE9A 1ORSA 2VXQL 1BVKA 5DD3L 2XZAH 3QG7H 1DN2A 1B6DA 4JFPB 4LDLB 4XP9L 3ZMRA 5JZ7D 3MBEA 1S9XB 1FRGL 12E8H 3SGKC 1WBXA 3JV5A 5FK9A 2W0PA 5I8KL 2XG5A 1NDGA 1MY5A 3NIFF 1RIVH 5DYOA 4TVPL 3SDXA 1KCSH 1TFHA 4L4VA 1HQRA 2F5AL 3VA6A 1JV5B 3P4LA 3AXLB 3UJTL 5DJ8B 2VLJD 3AY4A 1JZ4A 2BXZA 4L1HA 5DEGA 1UJ3C 2RFXB 3RWCB 1UEYA 4IMKA 2BSED 1JP5A 2NY2D 3U7YH 5ICXA 2XWTA 3NH7L 4BJLA 4U6VH 1CD1B 4H1LG 4N90E 3VWKC 5M94B 2X4UB 1FYTA 3OKDA 4R3SB 4Z7UE 1MJ8L 4J8RB 1JI2A 1P1ZA 3X3GH 2D9QB 3DIFA 5DUPH 5CEZH 5LWYH 5KW9L 2NMSA 4OGAC 2Q8AH 1ZWIA 2AQ3A 4R26H 1P7HL 5I8CA 1VFUA 2XN9B 1J05A 1ND0B 3IF1A 4WWID 3QUYA 1KGCD 1A1OB 4LSTH 3JV0A 4R4FL 2BVQA 1GC1L 4QRSB 5DWUL 3O41A 1ZLWK 3RI5K 3ZT6A 1DBML 4RFNB 2CDEA 5K59E 4IMLA 2EDRA 5B4MD 3GUTB 1JRHH 4G6FD 1ZGLP 4UUJB 5IVXE 4IM8A 4ODSH 1B4RA 4LKCA 4HSQA 4WO4A 1OGTA 2C3WA 5E8OA 1HKLL 4F7CA 5D1XC 3QNXA 3JV4A 1T3FB 1KPVA 1TZIA 5JPNA 1S7VB 5IJKC 1KLUA 4OZGF 4UAOC 3EYFB 3BPOB 1WFUA 4V1DB 3DVNA 4KK8D 3ZYOA 3W11D 1N6QH 2VUYA 5EU6D 5E08H 5C0BE 2FEDD 2HN7B 1PVHA 4DN3H 3EJJX 3G6JF 4C83B 5IHUL 1JHKL 3JTTB 1RZFL 4RIRA 2XICA 1MRDH 2Y5TB 4DTGL 5GJSH 3ZSTA 1NCNA 1GL4B 3OR6A 2P5EE 1EPFA 1MUJB 2HT4D 3DX7A 2GT9A 2AABH 3RVXD 4GO6B 4ZXBC 5DA4A 5B3JE 2I26N 4HH8A 5CWSA 1QPPA 3BQUC 4PG2C 5CBEB 4ZOCA 3V5DA 4NHCH 3NCFB 1Y6NR 2EDOA 3QBTB 1EO7A 4M3KB 4MAUL 1AGCA 2H9GA 4K7PH 1SYVB 1J9CT 5GRVK 1RAMA 5ID0A 2WV3A 3T0EB 1UYWH 3KAAA 5IEKB 1G9ML 1Q94A 3CC5B 4U6TA 4PJ9C 4UIMB 1MJ7L 4I4WA 4QRTA 5I16B 2GSIA 4YHKH 1ZLSH 5IEHB 2CJUH 4MA3B 4S10A 3RU8L 2CKBA 4P23B 3HC3H 3SO3C 4X0KA 1W8NA 4ORGA 2GK2A 3JZ7A 4JZJB 4TUKL 1ZLVH 2IQAA 3VFNB 1AD0A 15C8L 5HJ3A 1KNOA 2CO6B 4LIQE 4R96A 4OF6A 3O6MH 1YPZF 3T4AA 4JFZH 4KUZL 1TETH 4HC1H 2OJEB 4RA0C 3QR2A 3NFPB 4LPWA 4Q7DA 1AJ7L 1F42A 1C08A 4HV8A 3BFOA 5HI4D 1Z0NA 4UILH 2IGFH 2OJZL 4FTVE 2XPGB 2YK1L 2VDNH 4ZFOB 3ZDYF 4OD1H 4LAJH 2VOTA 1Q9LB 1RK0A 3HUJE 1G7IA 1FV1A 4X6FB 5JW4R 1BIHA 5ERWA 2X40A 2EC9T 5F7FA 1PAMA 3HE6B 3RWJA 3DBXA 4JY5L 1T03H 5GGSY 3TIDB 1DDHB 2HVKB 3AB0C 3O2DA 4X5XB 5K9OA 4U6HB 3O6LH 3TBVB 2R1WA 1V7ML 3TO4D 4YWGH 1R3HA 3S88L 4CDGC 5DD5L 1A3RL 3QHZL 5M7QA 1I1AD 3PP4H 1YEIH 4NSKA 3UJJH 1BX2B 3LKOA 1HHIA 5DJ0B 4KUCF 3JVGA 3LN5A 4TUJB 3WSQH 4QOKA 1FSKC 1JF5A 4Y19D 4Z78A 2IMMA 4AM0B 3T65A 4JFFB 1JUFB 4ELKB 4ZUWB 1DSFH 5F97E 4HPYL 3KPRD 4M7JL 4JFDD 3QXVA 3QFDB 4QHLA 1T89A 1G0YR 1S3KL 3LCYA 4A6YB 1B9ZA 5JW3H 1I1RA 1F3JA 2Y72A 4LGSB 3QSKB 1YY9D 4WUUD 2OCFD 2NX5A 3GM0A 4NQCB 4KRPB 5GGQL 1MCBA 1G7QB 2VE6A 4PJHE 2DQGH 4IS6A 3VRLE 1HK6A 2YD4A 2P44B 4XH2A 4YX2L 1OSZB 2YPLE 5GZNC 1NCBH 4L9LB 2F5BL 2XT1B 4TN9A 1AY1L 2GSGB 4H26B 4OF7A 4M93B 4B5EA 4WEBL 1DN0B 3ET9F 1FGNH 1S9WA 3RPIA 5JA8B 1UM4L 1W72L 3TM6A 2OZ4A 2FO4A 4MHHG 3U1SH 1S7UB 2VDPH 1DANT 3GIVA 1QLFB 3FFCB 5KVMC 3GSUB 1FLTX 2I9LA 3UPRA 4QRRE 3BKMH 3VD9A 3B9KD 4N8CH 4PTUA 2ESVB 4QXWA 3QUZA 1UZ6E 4HUKB 1HNGA 3QQNA 4IMKC 3ECBA 3RTQB 2X1OA 3TT3H 2R0LH 4Y4HD 3DROA 3JXAA 3LIZL 3RWGA 3Q6GH 32C2A 3ZHDA 3AREA 5C6PB 4XCCH 4DUVA 2MPAL 2V5MA 1UM5H 1A6TA 4KDVA 1NBVL 4IOIB 3V6OE 1F4HA 1U8LB 4NOBA 2V2XA 3CSPA 5D5MB 3U48A 3OKEA 5IW1A 3OKNA 1BFTA 4JHAL 4NNPL 5DUBB 1QSVA 3ILPB 3IDYC 1XF5B 4JN1L 4F58L 2WP3T 2ZKHL 1R3JA 2AXFA 4ZDHB 4YHIA 2G5BA 3UYRL 3GSQB 3LKSB 2WMPA 3FONB 4JY6A 4PLNC 1RU9H 1CGWA 1T0MB 5D7JA 2Z91B 2P7TA 1YN7A 5EO0A 1J87A 5SWZA 5F9WC 2ADFL 3VD5A 4GRLC 4PJGE 3N1QC 1GHFL 2UVFA 3MYJA 4KHXH 1B90A 5I1HL 3L95B 3NN8B 4WO4C 2PUQT 1AI1L 2FZ3B 1J18A 3S4SB 1ZHNB 5FO7A 1YYML 4YDJA 5DUML 3IFOB 5BS0D 3U4EA 1NFKA 2J4WH 5JR1H 4D0BB 2ZUTA 1UZ8A 4XAWH 3T08A 4KVNH 5FHBH 4RGMC 3OKLB 4GKSB 4YUEL 4PP2B 3D85B 4M02A 3ARFD 4OLZL 3VGBA 1I85A 3DX9B 4YHYB 1IC4H 4NDMA 5HGDB 4LCUB 4MMZC 4JREB 2NW3B 4ZAKA 5FA3A 1KTDB 1QQDA 4JDZB 3ARBB 5H94A 4CU7A 4WFEE 4MQ7B 4PJ5D 3KPTA 4XI5D 5CILH 1IGYB