1OAXH

Fv structure of the ige spe-7 in complex with acenaphthenequinone
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
122
structure length
122
Chain Sequence
EVQLQQSGAELVKPGASVKLSCKASGYTFTSYWMHWVKQRPGRGLEWIGRIDPNGGGTKYNLKFKSKATLTVDKPSSTAYMQLSSLTSEDSAVYYCARMWYYGTYYFDYWGQGTTLTVSSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antibody Multispecificity Mediated by Conformational Diversity
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN E
total genus 25
structure length 122
sequence length 122
chains with identical sequence J
ec nomenclature
pdb deposition date 2003-01-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1oaxH00
4YQXL 3MCG1 1S3KH 1TENA 5IG7B 4S1RH 2VL5B 3HR6A 4NUJA 4UBDD 4G9DB 3ES6A 4Z77A 5I9QB 4ETYA 1RURL 2C3VB 4QRUB 5LGHL 4M6MH 3V5DA 4OJFL 4Q2ZA 3LMJL 3HAEA 2IPKB 2IQAA 4KK9C 5MEPB 4X5XA 4P2OC 3B9DA 1KB5A 2H3NB 1U93B 1WSST 1QEWA 4M1GL 4JZNA 4L8DA 4MLSA 4Z7WE 2HFFA 3D18A 2L7UA 4JFEE 3T1WA 4PJHE 2VLKB 3LKOB 4K7FB 3TO2A 4PRBB 4ZS7H 3VGFA 5IMMB 4PGDB 5GS2H 5EO9B 35C8H 4R4FL 4OZGA 2PXYD 3H42H 1AC0A 2Q76B 2O93L 3MACL 43CAB 2FLRT 2OTWA 4G8FA 4LCCC 4LHUA 4C59B 1IBGL 1J1XH 1MJ7H 3OKEA 1CFNA 2R0LH 4RFOL 1HEZB 1T1WB 4GS7C 2VWEE 1GIGL 1IL1B 1OAKH 2AK4B 4U33A 5DJZB 3WHXB 4P59H 4UOJA 2C7UA 4CVZB 3EUUA 4FXLA 3U4BL 2OL3H 3RIAK 2EKSB 4ZPTA 1FAIL 4NO0D 4P3CL 2X4OB 3IDIB 1QFHA 4Y5YB 3TV3L 3MLPA 3DETD 3C6SB 5JXED 3Q2CA 5C2BH 4XWOC 2KUTA 5DJCA 4ZUVA 5B39B 1T7YA 4LNRA 3K80A 4QOKE 3WMSA 5B4MD 2G60L 4OLVH 5ICZA 1KEGH 1F5WA 3QNZA 3SJVE 4HG4J 3S96B 3FRPG 4UQ2A 3QIUC 4DFIA 2Z31C 1TQCC 12E8L 3QQ9D 4APQD 1A7PL 3HAEH 1IEBA 4G7YH 1FCCA 4WI4A 4P3DA 1HCVA 4X0KA 3DIFA 3KPPA 5J6HB 1RUAH 3S7GA 1M05A 4NQCB 4QCIB 2YUWA 2I25N 5ICXB 4DN4H 5GXBB 5HHOD 4JFXB 4PRHD 3VD3A 5I73C 2B0SH 4JFEB 3SKOA 1WIUA 3GDBA 5C0CE 2RFXB 4QEGA 3F12A 3QAZC 5D71L 1LO0H 4KK9D 3O6FA 1NLBH 5DRWA 5FUZH 3VFNB 3L3KB 4H25B 5FHBL 4J7RA 1FFPB 3IFLL 3OMZA 1FLTX 3VXUE 1HWGB 4N9GB 1W72B 4H20H 2PUQT 4F7TB 1D3CA 2QADB 2RGSA 5FECB 3P3YA 2IAMD 3K2UH 3QIWB 3U4EB 2CIKA 3WO3B 1S7TB 2UVEA 2MCPH 4MX7B 3RJDA 3RZCA 3AU1A 5TQ2L 5DMKB 2ZUWA 1ZLUH 4A6YA 4OLZL 4JY5L 2X4RB 3BPNC 1U8JB 1FSKB 4KI1A 3G08B 1ZGLP 1KENH 4UDUA 1RU9H 3LN4A 5DMIL 1BQLH 1LO4L 3VXSA 1A8JH 2AV7A 2EDOA 1HHIA 1N0XH 1ZANH 4M8VA 4JQVA 5CJQH 3VDBA 4MNQB 5ICYA 1FZMA 3MCKA 3RPIB 1G7PA 3QDMA 5BVJA 2F54E 3K2MC 3C6LD 4YHML 2XZAL 5DRWB 2PYFB 2DLGA 3GMQB 2VABB 2EXWC 5FYKD 3NTCH 4YO0A 3CUPA 1FGVL 4HMCA 1CDIA 3FMGH 1I7UA 5F3BB 2WWKO 4OZ4B 1CD0A 4Y19A 2ZCKL 2QSCH 3JV4B 3HG1A 3VI3E 4PJ8B 4PLKC 1YYMH 3VWKB 1CXEA 2R2EA 3GJFA 3SPVB 1N3NA 1NLBL 5L2JA 1IKNC 1IAII 2EDWA 3BRGC 1KOAA 2ZCHH 4PG9A 3SCMB 1NDGB 3DXAE 4CAGA 5K93A 1BAFH 3DYPA 5I19L 4PLOB 2CR3A 1WFNA 4ONHA 5E8EA 3FTGB 4QRPB 3UX9B 1ONQA 4P4KC 1EV2E 3SDXA 4C56E 1I1AC 2IBBA 5CEZH 2QQNH 3OR6A 5C8JA 1HI6A 3O3DB 4WENB 2GFBA 3QNYB 1N64H 4FXKB 4CL7A 5KS9E 1NBYB 1WFOA 5T5NF 3BZFA 1KN2L 5ILTH 4JO2H 5F7EL 2D7OA 2NY2B 3ALWA 4R7NA 4H1LA 2JJVA 4I77H 3RTQA 4OTXL 3L6FB 3S34H 2VRAA 4PJDA 3V0AC 4I3SH 3Q1SL 5DS8A 4AK1A 4UB0H 5B3JF 5DVKA 1A6ZB 2Q87A 4LGPB 4YIQB 1X5AA 3SDDA 3VA6A 1NGQH 3U36A 1XGTB 4ZFOB 2JCCE 1AXSB 3DUSA 1X9QA 3HFML 4ODWB 5E95B 4KGJA 2CRZA 2Y06L 2V2WA 3LQAL 2CDEB 1OM3L 4PGCB 4MDJA 4NFCA 3TIDA 4FQIH 5HDOA 2DLEA 2ZNXA 5TE7H 2UWEE 3RNQA 2I07B 4JO1H 4QRQB 5T3XH 2BHZA 5CP3A 4N0FA 4PB9H 3PGFL 3C5ZC 5CINL 4M5YL 2MQ0A 2X10A 4GG8A 4UTAH 4GKSA 2IAMC 4AM0B 3VXRD 4DKEL 4KTEH 3SDYH 3MRPB 3CU1A 1MFAL 3TO4D 1LEIB 1X4ZA 4PRPA 4N1EA 5IKCA 5C0AA 4X80H 1MCSA 4KKAD 2OJZL 5DC4B 5T1MB 4BSWA 3VDAA 1U3HA 3MUJA 5CKGA 3BO8A 4PJIA 1B2WH 1FN4B 2H45A 3MRKB 3P30L 5EZIL 1G84A 3AC0A 3MLWH 4PY8J 2F5BL 5E4IA 3U1SL 1CXLA 5JZ7D 2EDLA 4XPTL 3UPAA 4ZO8A 4LL9A 1Z3GL 2XI9A 1ZWIA 4NN6B 4LK4A 2XQBL 5MHSE 3SJVD 5D1ZB 4NO3A 4QWWC 3ZYOA 1M7XA 4ODVH 4D2NA 4YDIH 1HZHL 3T0XA 3S37H 1HK6A 4XNXH 2FHBA 5IR1B 1DQLL 1IGIH 2ARJQ 3QO0A 2DWDB 1KLUA 1FLRL 4H8WH 3RGVB 4EUPB 5MERA 1TIUA 4LSVL 1X5YA 3EYVA 4GXUM 3RVUC 4KQ4H 3BP7A 3PXHA 1ERNA 1A3RH 3FHQA 5F1NA 5JA8B 1A7BA 5DUBA 5GGTA 1BJ1H 3MTRA 3KS0H 5FUCE 3RZCC 1WAAF 3E1F1 3CGTA 1G7MA 5DFVC 3UTSE 3MODH 1DUYB 3KPLA 4OCSL 4RX4A 5GRWA 3RWHA 5MEQB 3V79C 3FT4A 1RZGB 4JPKH 5DD0H 3VXMA 5FO8A 1IGTB 3VXMD 1HKLH 5E2TL 4N5EC 3SE8L 4L4TB 1EXUB 3RGVC 5JO5B 1KIRB 3ULVC 4P99A 4LHUB 2QSQA 3GGWB 1W0VA 2ADFL 3MBXL 3PGCB 5EZOH 4ERSL 2VXTL 1DFBH 1FFPA 4NQDE 3DROA 2VL4A 5H8DA 1YPZF 1FL3B 1VFBB 3DYOA 1C8PA 4OAWB 1AO7E 2X4NA 3DJ9A 4G43B 3NMEA 1IBGH 4H26B 1FYTE 3IDUA 5F1NB 1ZE3C 3SE4C 3B83A 5KZCD 3LPFA 5DI8A 2A1WL 4J23A 1EZVX 4R7DB 2WBJA 2HRPH 4ZUWB 3EO9H 4Y4HA 3VFRB 4L8BA 4MJ6A 5HGGS 1TITA 3S96A 1KEMH 3MOBH 4QRSB 4YO0B 5I71C 5DGRA 1RK1B 5C9JA 2R1XA 3H0TA 3P0GB 1NDMB 4JFOA 3CLFL 1YEHL 5B4MC 3L6FA 5AZEH 1SJXA 3F5WA 3P73B 5KG9B 3LEVL 1FZMB 3MCKB 4MNQA 5ICYB 3MBEA 4O58L 3EJYD 1H5BC 1RURH 4LSQL 1BBJB 5C0EB 3T0DA 3LSOB 1WZ1H 1SVZA 4XNXL 3PNWB 3HI5H 1S3KL 2DDQL 5HVGB 4HC1H 2GQHA 3SJVA 2QEJA 4LDLB 4RNRB 5AAWA 1OD7A 1KIPB 5I18H 2Q20A 3SO5A 4Z7VA 2YUZA 2VOTA 1P6AB 4UV7H 1OWWA 3IXAA 2DJ4A 5FCUL 4I18A 3PP4H 5J13B 1S7TA 3DOSA 4JFFE 2ADFH 1FC1A 1FJ1A 3FQTB 5I8CA 2ENSA 3I6GA 5CGYD 3O2DA 4HBCL 4JPWL 4XNMA 3W11C 2UUDK 1BHGA 1U92A 2PTTB 3EYQD 3FN9A 3FZUD 2R2EB 4JKPH 2CO7B 5HGAB 2OM5A 2IPTH 4LEXL 4WO4C 5CZVH 5L2KD 5KG9A 1KGCD 1X5FA 4R3SB 4WEUD 3HAEG 3IJYB 5H35A 1MJUH 3ARWA 3B2UD 2DWEB 3KPRD 3ZMRA 3EFDL 2WINA 4HUUB 4L9LB 5GSRA 4JFHD 2VYRE 2F53A 3RHWK 1I1AB 4NUJB 1GHFH 5H35B 1T2XA 5ABDE 5D5MB 1QRNB 4M4PA 4V1DE 4W6YB 4X7TA 4AEIH 4NWTH 5FYJD 1DCLA 2VDPH 4FFZH 2EIZA 5TE4H 5IFAH 5IHBA 1JN6B 5FAAA 2E6JA 5TE7L 5LGJB 2YD6A 2HT3D 3KVQA 3F7YA 4IJ3C 1GGIH 1MFCL 1JF5A 2HAZA 1A9EA 1XGUB 3RFZC 4CVUA 3TN0A 1AHWA 3ESVF 4S1DD 1FFNA 3B2UC 2IADB 1QBLH 2AJYL 3RY4A 5DEZA 2NLJA 1T04A 2XA8H 1AXIB 3U79A 3BGMB 4JEGB 4UNUA 5HHMD 4P9ML 2DQDL 4GOSA 3MRLB 2DI8A 1L6ZA 1NGYB 1QLEH 4IIQA 3OJDA 5E2VL 1T6WA 2NX5E 2VQ1A 2CLRB 2E8YA 2W60A 3AU1B 3LS5H 5JLZB 5T33L 1RHHB 2WSKA 5LQBH 1XEDA 4JG1L 5BZDB 5F88B 1MRFH 1I8IA 3CDCA 3VXQB 3TJEL 3OGOE 1ZLWK 2FLBT 5FCSH 4OLWH 1ITBB 2XWTB 3D9AH 1BQHB 4PJGA 3W2DL 4AT6A 3FFDA 1GC1H 4WUKH 1T0MB 5CD5D 3CXHK 3KDMB 3O6FB 3VFNA 4HIJA 2EICA 1NBVH 4YZFE 2YS4A 5JR1H 3I2CL 3S35L 2YD9A 1OGTB 1JPFB 1U3YA 3PDDA 3DNKA 3O9WC 1MFDL 3C6LA 5EOCJ 1EHLH 5LKNA 2YK1L 1IGIL 5GS1A 4NP4L 2E7LA 1O7SA 1A1OB 1E0OB 4OD1H 2IBGA 1FLRH 3V7AE 3V2AR 2EXYD 5HDBF 5T3XL 3VU2A 4MNGB 1TPXC 2DIJA 3OAYH 3KNBA 2P8PB 2HFEB 2AXGB 4MGXA 2AABL 4PJDE 1U8HA 3WFDL 3DWTA 2QLVB 1QLEL 4UTBL 4U4BA 1QZ1A 4Z7WB 4ELKB 3ARDC 3GRWA 1ZVYA 3GO1H 5C0BA 1UM4L 3N1PC 4OM1H 2BCKB 5L7XL 2VIRB 5T1MA 2CIKB 3TBSB 1UZ6F 3DUUA 3KYOA 4HUVB 2LQRA 1ZEAH 3QDJD 4FZEH 1K8IB 1ZT4A 4WWKB 3U4AA 1Q9WA 2Q76A 1E4KA 2FBJH 1BVKA 3FRUA 4O2FB 3O41B 5D7JB 2P8MB 2UWEB 1NMCC 3MFGB 4PY7B 1M71B 1AI1L 5MEPA 3OKLA 5IESL 4HBQA 1IC7L 5C0JA 1GOHA 3IJHA 4DW2L 1TPXB 1D9KB 2NY0B 1Q0XH 1BQHG 4UMGA 1EAJA 2J8UF 5E9DE 5HHME 1FNSH 4YHZL 2P24B 3L9RB 3GB7A 4PY7A 2XQBH 1ADQA 4HZAA 1AI1H 3BN9D 4Y2OA 3P4OA 3W9DA 4F7MA 2DLHA 4HQQH 1A9BB 3B9AA 4NKQB 1FL3A 2YOCA 4Q9RH 3K1DA 3TA3A 1KB5L 4PJDB 2HT2C 2XKUA 3QYCA 4JRYB 1GGCH 4D0DB 5EWIL 5L2KE 1JGDB 2Y5TB 3GBML 4TNWF 5C09A 3WO4C 3W11D 4JANB 3OKEB 4XI5C 1RIUH 3P4LA 2NY3B 1I9JH 1SHMA 3RWEA 3H3KA 3WHXA 3DX9B 1LK2B 4CMMB 4PGEA 5E9DD 1QBBA 2Q8BL 1VSCA 5DHYA 3RDTA 3ROLB 3VFVA 3QIUD 3RWIB 3FQXB 3IXTA 2AW2A 4QRPA 2R8SH 4Y0GA 4G8FB 3LH2L 3WJLC 4WFFD 5EULV 4WWKD 3PGFH 4QNPF 4X9BA 3NCMA 4LHUD 4DAGH 4GKSB 1UJ3C 3GSQB 4KXZH 4TUOB 4X4MA 4QRRA 4P5TD 2LE9A 5FGBA 2FO4B 4R90L 3ZDZE 1C1EH 1II4E 4UT9L 4N8CL 2R23B 2YA2A 5A3IC 2OZ4L 3HAEB 1IC7H 3D85B 1IILE 1FGNH 2Y07H 2A74A 1SMAA 4NT6B 3E2HB 4I5BB 1BLNB 1LDPH 2GK0B 3QXAA 4HKZB 3V0WH 3QUZC 4M7ZB 1ETZA 1DBAH 1RIVH 4P23A 4RMRA 2EE6A 1T4KA 2WQ8A 4FRWA 3WO4B 2OR8A 1A22B 3O6KL 1R6VA 4HWEH 1G7LA 3HZKA 4NNPL 4UU9A 4RMWA 4Y4KC 5EWIH 3RWJA 3QIBC 2UVFA 5ESAA 4J4PD 2NMSA 3L5XL 3MNWA 2PYEE 4G80A 2VZSA 2C4FU 1WEJH 3O4LD 5D2NA 3CFEB 5LGHH 4G6ML 2NY0D 4EXPX 3DMMA 4ZYKA 4OGYH 1NEZB 4P46D 2Z8WC 5T3ZE 1A3LH 1S5IL 5CP3H 5D7SH 4M6OH 2ICWI 3QCTL 2A9ML 5AD0A 1LILA 4RSVA 1T1YB 3N1FC 3T0EA 4UOW0 3IU4H 4YDKL 3NABH 4ZYKB 1OT1A 4NRYB 5IB4B 2OP4L 3QIWA 3CZFA 1VA9A 1X5JA 3T3PF 1FAKT 1NUDA 1FPTH 4LLAA 1FYTD 1PZ5B 4HLZH 4NGHL 4EI5B 3FB7B 4KUCF 3WKML 4N8VA 1MHHB 4JHBA 1QR1B 1T04B 5D7KD 5SWSD 4CADA 5T3XD 4WWKC 1NMAH 2IANB 2WANA 4UQ3A 5ADPL 1MCRA 3GUTA 1E28B 3WKMH 1FG2A 1ED3B 4LLUB 2JIXA 5ESVB 3Q48A 1S7UA 3MJ7B 3MRJB 5TF1L 2X7LA 1YDPA 1A6ZA 4RISL 4YGAB 3HNSL 5BRZA 2PYFA 3CVIH 3UPCA 5HGDA 1DEEB 2FJFA 4TVPH 1XT5A 3BW9B 3KLHC 3HMWH 4AZ8A 1SEBA 4GRLD 3B3IB 4XPGH 2A9MH 1A2YB 4FFWC 3CIQA 3PIQA 4F3FA 4PBVC 4YHKL 2K9UA 4ALAH 3AM8A 1GZQA 2LTQC 2VXTH 3G5ZA 1KIQB 4GS7B 2H32A 2VITB 3P4NB 4Z78A 3L5WB 4GQ9H 4PGJA 4JVUA 1CDGA 3DTXB 1HHKA 2M2DA 1XF5A 1P2CB 1OP3K 3RU8L 3HC4L 1IVLA 5DD5H 5C0IA 2XNAA 4NCDA 1F02I 2F53E 3BGFC 4F7PA 4XMKL 4DEPB 4HT1H 4NRZA 2CXKA 4PRAB 1BF2A 3WDHA 3IDJA 5IFJA 1KB9J 1L9MA 3ARGB 4HWBA 1G7LB 3HZKB 3MLTA 4OD3L 4UU9B 3TGXA 2FO1A 4R4FH 5CIPH 4WVRA 2W0KA 5AZEL 1ZHNB 1MVUA 1WTLA 3MLRH 4O2EB 5GZND 3WIIL 3MREB 3OG6B 4XC3L 4W68A 3HLAB 1TZGH 4OD3H 1V7MH 1QRKA 3HE6C 4JGUA 2SEBB 1TVBA 4Y16C 1BD2E 1ADQH 2Y25A 1GGBH 4M3KB 3J8F7 3SBWC 3LDBB 4NO0B 2Y36L 2VDRH 3TH2T 3KYMB 5GSVA 5FK9B 4D9RE 3R1GL 5CS7A 5I9QC 1ODAA 1QRNE 3RWGB 1SJHB 3PV7A 1EAPA 2FJHB 3DRTA 1MEXH 3GI9H 4Z95H 4Y8AA 3QHFH 3MLZL 5IJVA 3V6BR 5TGBB 3GHBH 5E5RB 4L9DA 4NQTA 1LNUB 2EDTA 1BOGA 4NGHH 4FFVC 5C0CA 1JCKA 4XPFL 1HXYA 1WICA 5B8CC 4MAYD 4XP9H 4ZSOE 3JSSA 3WE6B 5DFTA 1LD9B 4L3EB 2BY0A 1ZT4B 1XF1A 1AGDA 1IKFH 1GZPB 2CR6A 1HXMB 1R3LB 1S7XA 5DUPL 4DVBB 2V7HB 4U1GC 3RBGA 1RZIA 4KAQL 4JB9L 3OX8A 3LPGA 1FH5H 4RA0C 5C2BL 4KFZC 3NGBC 4PJ5D 4RMUA 4MJ4A 4O51B 2JTDA 4WTXA 4P3CH 1MCLA 2AJVL 2IH3A 3QQ3B 5KTEL 3CCHA 3OV6A 5I1IL 1M6OA 5AWNL 1J1OH 4K71B 5DR5H 1OD9A 4Z0BH 4DK3A 2AXGA 5HSFA 4K7FA 4KDTA 3O8XA 5D4QA 1EXUA 1YJDL 4RAHA 1XFPA 3WFHB 4YGVB 5E8NB 1XR8A 5E4EC 2W0FB 5DJ6B 4GMSL 1NAMA 4IMLA 3V7MA 4F9PA 3SKJH 1EX0A 3QUXC 5F7WC 4U6XA 4XP4L 2Y7QB 2XWBB 3QJFA 4I9WD 1EJOH 5EU3A 3MMEB 3N1MC 3UTOA 5GGVY 3RPKA 3QIBB 2VXSL 1CD8A 5I0ZA 1E27A 5GGSB 3DRQA 3T4YB 5IR1A 2M26A 2VZVA 1J0YA 3GZKA 1INEH 3DVNB 2MPAH 1EO7A 1OGAE 2AQ1A 4ZUVB 5B39A 4BQ8A 2DKSA 2NZ9C 2VLKD 5FYKH 5I15H 2PW2A 4I3SL 3BIAX 5TDNA 3QISA 3S3JA 1NGPL 4NKIL 3ISWA 1CVSC 3DMMD 2O5ZH 1QG3A 3FONB 4OQTL 4PJGE 3NIDF 4LKCB 4KDWA 1DQJA 4POZC 1S7WA 4X98A 2VR9A 5EU7C 2BMKA 1FL5B 5E8NA 1UJTA 4RMTA 4F2MB 1O0VA 4R0LC 1XF2B 1IT9L 1W0YT 3VFWB 4LRIC 4N0CC 1RIHH 4LSRL 1AGEA 3VGAB 4DGYL 2A6DB 2EZ0C 1BM3L 2OR9H 1WT5C 5F1IB 5FYKE 4GW4A 3QXWA 5CSGA 4G6KL 3H8NA 1B0GA 1JHKH 1NH6A 2ATKB 2AXHA 5FOBB 5FGSA 4M7JL 4AJ0A 5JNYB 2XTJE 2H3NA 3R0NA 1PZUB 1AJ7L 3H7BA 4YLQT 2GTZA 4WGWB 4Z0XB 1UJ3A 4WV1A 4E9LA 4TUJB 5LCVL 3UZVB 3O3EB 3LZFH 5ITFA 4NOFA 4QHMB 2X4QB 4PD4J 1DE4A 5DD1H 4AMKH 2J6EL 5E00A 5ID0A 4DTGL 2D7TH 1JWMB 5DO2D 3DGGB 1RJLA 4QRPE 3V4PH 4HS3A 4P2RB 3RIFK 2CKBB 1G9ML 1U0QA 2DM3A 5CZXD 1NCWH 5IB1B 5DEFA 2OZ4A 4PY8I 4RQQB 1N64L 1HQ4A 1D5MB 4EN3B 3D6GA 1QSFE 5ITFB 4KK5D 1RUMH 5F7EH 2GJ6E 4PTUA 4F9LC 5KZCB 3P9MA 4JY6B 1T1ZA 5EU7E 5MEND 1MVFA 4XP5H 3D48R 1B6UA 1HYRC 1OAQH 5CJXA 1KJ2B 2FEDD 3BKJL 4O02H 2DLFH 2CLVB 3LKPA 3UBXA 4QTIL 4YHZH 1U41A 4PFEA 1S7SB 5C6TH 2BFVH 2JK5A 5J6GA 3MROB 1G6VK 1DBBL 3T04D 4O02L 5C07E 4WCYH 4KKBC 1JNLH 3GNMH 4RMVA 4HLJA 5GRZA 2H32B 2ED8A 3S8WA 1VFAA 3OJMB 3OPZH 1HIMH 4MSWB 5SWZA 3QI9D 1NCAH 4OLUH 5L2KA 4HUUA 3AFLA 3I50L 4L9LA 3DPBA 5DEGA 4IRSA 4ZTPL 4ZD3H 5KSAC 4OZ4A 3FONA 4N0UA 2A6JB 4HH8A 4LLDA 3GK8L 5JDSA 3EO0B 4YHYC 3NFNA 1UENA 4PJ8A 5IWLC 3TBTA 3PQYA 4URTB 5DD6B 3L3DA 2P7TA 3AAZA 3IDNB 5GJSH 1J05A 5EU6A 2IMNA 4OZGF 1NC2D 4WW2A 1GPOH 4LP5A 4PJ7B 4MCZA 4WV1B 3WIFA 1AP2B 2B4CL 1QPPA 5J1AA 3DVGB 3DHJA 1XCQB 2XN9E 4HIHB 5TQ0H 3VXSE 3W39A 3P2TA 5KBNC 1A3QA 1ZK9A 4RWHA 3WS3B 1T2QH 4PV8B 2EYSB 4I4WA 1IGFH 4O9HL 5ACZB 4HMDA 2BHYA 3GMNA 3BJ91 1Y6KR 1ZMYA 3MXVH 2XOTA 3O9WD 1A1MA 5JOEA 1I3RB 1T22B 1DBBH 4DKAA 3PWLB 2HJKB 5C70A 3OHXB 2IANE 1KC5L 3BT2L 1QOKA 5K9QI 3NPSC 1AO7A 3ILPB 2QKIA 1ACYL 4WUUD 1NANH 2D0FA 3BZ4B 3NA9L 4TNVK 1CWVA 3RKDD 5JZ7C 1AD9B 4RFNB 5D9SA 5GRUH 2ARJA 4BUGA 4P3DB 4OIIH 3WUWB 1UCBL 4G6AD 5SX5H 3H9SA 4OZIB 4RGMC 4GRMB 5BS0D 4XPBH 1ZA3B 5I8KH 4HGKC 4HK0A 4CDGC 1T3FA 4Y4FD 2ZUQC 2XG4A 4K55A 1KCRL 4N68A 1UZ8A 5D7JC 4R2GB 3MLZH 3RI5K 4NT6A 1DVFC 4MNQE 2BRRH 3V7AG 3ZZ1A 3ET9F 3VXSD 5CSZA 2QHLA 3MLVL 1NCAL 2Y36H 2R39A 3QJHA 2XWBA 2YD2A 3QJFB 2HYMA 3IDGB 1TTGA 3DUHA 4F37K 4YGVA 2N1KA 2NY5H 5HYJB 5JMOC 1JGEB 1MCIA 2EECA 4PRPE 4U05A 4PJ8C 1X6NA 4XVUD 4PJ8D 4Z7VE 1CQKA 3WNMA 4X7FC 5A40E 4D9RD 3P9WB 4NWTL 4Q58C 1F4YL 3VG9B 1LO0L 2BK8A 5FUZL 5DJXB 1YNLL 3FO9A 1U42A 1NSNL 3BP4A 3GMRB 3FMGL 2NY6D 5HGBB 3MACH 4PJEB 3SE9H 4CMMA 1F58H 5GZNC 3LPWA 2XV6B 1CGSL 2NX5D 5CWSA 5SX5K 4PRAA 4ACPA 1JF1B 1YNLH 3GSOA 3I6KA 4PTUB 2MWCA 3WUZA 3VWJD 3Q3GB 3MRRB 2PO6C 2BVPB 4G6KH 5E99L 2ZNWA 5IW6A 4PRHA 4F80A 4I2XE 4DOHE 1A7PH 1MI5E 2IBZX 3DARA 1KLUB 4TNVF 3BYTA 5LBSL 3JUZA 4XVTL 3F6LA 3O9WB 3FOMB 5JW5A 3LN5B 2BVOB 5D1QB 3T0BA 4L8DB 2XTJD 1X7QB 5FK9A 5CSBA 1BP3B 5DD5L 1EO5A 5GS3A 2L4OA 5H2BB 4O5LL 1YEGL 1TJIL 1K6QH 3BDYL 3L7FB 1B0RA 5AYUH 5B8CA 1QSFD 4KK6D 2OMBA 5L2KB 3QUMH 3M07A 3L5JA 3KPRE 1YNTB 4PGBA 2DQUL 3MLYL 3FQUB 3RQ3A 1WCBA 1CFVH 3UTTE 5IVXB 1U8IB 5IHUH 3REWB 3TC9A 4ZNEE 4MNQD 2P5EA 5EUOA 3VXPB 5D1QD 3EYOB 5HI5D 2KZWA 4YE4L 5BMFH 3N9GH 1FNEA 1NGWB 2X4TB 1RIHL 2XNAB 4R26L 1WZMA 1RQ5A 1U9KA 3CDGA 1KXVC 2VLKE 1JNHA 2VZ1A 4C55A 1KEGL 1TDQA 3RAJH 2JJUA 4Q9BA 5DFVD 4RMQA 4IRJB 4BYHA 4JDVA 4XRCA 1FVEA 3V8CA 2WBKA 5IHLB 3SE4A 3DSFL 4OZFH 5AUMB 4RA3A 4GW5B 3Q0HA 1H8OA 4JZOA 1AIFA 5FKAA 2I9LA 2LU7A 4XVUC 1MJJA 4GBXB 3RTQD 4KHTH 3PWVA 1R3KB 1N5AA 3SDDC 2VDOH 4P9HL 2PN5A 2X70B 3VXNB 1DSFL 1IGCH 5DJ8A 5DUMH 3UJJH 1EFXA 4J8RB 4P3WA 5HYJE 1SYVA 3QUKB 4WO4B 3ARTA 1IM3B 4ZFZB 1JHLL 1EMTL 2P8LB 1ETZB 1U2HA 4Z7UB 4POYA 2GSGB 3WJJA 4OLEA 2MNUA 4EUPG 3HNVH 4WHYH 5IJKA 1P4BL 4QTHB 5I75C 3ULUE 3G5YB 1C5DB 2XWTA 4R90H 1CR9H 1YYLL 1QSFB 4DK6A 3D69B 1DBKL 2KZ1B 3MUGA 3RWCA 1Q0YL 4MS8D 3U0TA 5JW4R 2CXGA 5K33A 1AR1C 3VFTB 2VQ1B 4K71C 2IF7A 1TNNA 1JK8B 3BPOB 2ZUTA 4EXKA 4B41A 3BXNB 4E5XA 3BP5A 4M7ZC 1YNKH 1ORQB 4TUKL 3TO4C 1XGYL 1Z5LA 3LKQB 1NEZG 2ZKHH 5EBGA 1ORSB 4YC2B 5HXMA 3H9HA 4YWGL 3NTCL 4XWOD 3FAWA 3JV4A 5CIPB 1F42A 4HEME 5ICXA 5FYJH 2Q6WB 2XIDA 1JRHH 1YUHA 3W0WA 2YEZB 4NN7C 3LQAH 3W5MA 1A9EB 1XGUA 4HKBA 1HHHB 5B8CB 5D6DC 5F96L 3QUMB 2R2BB 1I8LA 1G9NL 5D6CA 4C4KO 3TF7C 4D3CH 3TO4A 2I26N 4WW1B 3CFJB 4LU5H 5BVPL 2ID5A 4FOMA 2YMXH 3D3VB 1NJ9B 1RAMA 1NAMH 3TVMC 4EBQL 2VXVL 4L8BB 4ZTPH 5DXWA 3BFOA 1WAAA 1E4JA 1FYTB 1NBQA 2ADJA 4UNVA 2MQCA 3QXAB 1RUPL 1PLGH 5E6IA 4U1JB 1AIFB 4G9FB 3L95A 1GPOL 4XXDB 2IAMA 2J6EH 3OF6A 2NY6C 2R2HB 3KPTA 1J8HE 2C9AA 1JZ2A 5HI5C 4L8CB 3UROR 4JDZB 2JJTA 3EDEA 2PTTA 1P6FA 4DCQB 1EEQA 1VFBA 2FBJL 4LLQA 1K5NA 3VMPA 4KI5F 6FABL 2X4PB 5A16B 3WL9B 3MGAA 3FQXA 3IXTB 1VGEH 4LQ1A 1D5XB 4IOIA 4U6YA 1NFKA 2HLFD 3VCLB 1BIIA 1D7FA 4PRIB 2D9QB 4DEPC 3B5TA 4F7EA 5J56B 3QQ3A 1IGYB 5MEOA 1YEFH 1G7HA 3VGDA 3V9FA 4ZS6D 5FV2A 1BECA 2XTJC 3C8HA 1I8MB 1I7TB 1ZVHA 5BV7C 1OCWH 1WGOA 4JRXB 4X6BA 5CD3A 4IDLA 1OARH 3BH8B 4HKJB 4K7PH 1QYGL 4OIAA 4WUUB 3BDBA 1NGQL 1YC8A 4AH2B 2Z8SA 3FB5A 4V1DD 2VDLL 4KK8C 3OF6D 5KS9B 3DURA 1JE6A 1T21B 2BOCA 1HQRA 4OLXL 3L5XH 2XT1B 5FA3A 2VL5A 4MNGA 4EOWL 3FB5B 1SJEB 1ZS8A 1CE6A 3ROOB 1NLDH 5TFSL 3H9SD 1RULL 4NDMA 3RVUD 2GJJA 1YUHB 1A4KA 4WEBL 1KB9K 3U7YL 3WNOA 3MRRA 5C3LD 3RVWD 4G8GD 3MBEC 4IS6B 1OB1B 4ZS7L 2VLRA 1NC4B 2I9TB 1QUNA 4KMTH 4P2RD 4FQJL 4GBXD 1QKZL 5KVGL 1UWXH 4P9HC 2F8OA 4U6HA 3LEXA 3V6OE 5JXAH 5KSVA 3HHRB 3MLTB 5GGRB 4N8CH 4BA8A 4AL8L 2E9JA 5HY9B 3JWOL 4DUVA 3ZDYE 1F4AA 4XP6H 5DRZA 1ZLWH 2Z31A 1F8TL 4GKZB 1JNNL 1KELL 5D1XA 1U8OB 4Y88A 4LARH 4PRPB 1JVKA 1YN6B 3V4VL 1K9TA 3VWJB 3MOAH 4J4PA 3DVGA 4JGJA 3SQBA 1W8OA 2JB5H 3EHBD 3T4YA 1CFTA 1CBVL 1EGJA 4YHIA 2PXYC 5BRZE 2W91A 3P4OB 3W9DB 3WDIA 2JJSA 1KPUA 1YEFL 1DANU 1LO2H 3ELAT 4MS8C 1U8OA 4JR9H 2K3TA 1KJMA 2I5YH 2L0DA 4JRXA 2V2WB 4KMTL 3T3ME 2Z4QB 2A9NL 1A6VH 4XP1L 4LSTH 2EE3A 3GMPB 3L7EA 4KQ3L 2VDRL 15C8L 4P5MA 3RKPA 4PLKD 1CZ8L 3X3FH 5L9DL 5F7DA 3LIZL 4QHUA 5F9OH 5IFAL 3ZSSA 3HUJB 2NZIA 3C6LC 2BSSB 5MENE 5C0FB 4LCYB 4P4KB 5I76B 3OBAA 3CZFB 3QWRD 5IGXL 2BP3A 5J3HC 1JYNA 2Z93B 2RR3A 1FIEA 4XVSL 3OXRB 2FX9H 5C0GB 4O2CB 1CFVL 1U8QB 3MRQA 1OT2A 3RA7H 1A5FH 4EI6A 1X44A 3D25B 3Q6FB 2IQ9L 3N50A 5I2IA 3K81A 2GSGA 3BPCB 3WDJA 5M94B 1JBJA 1N0XL 3KG5A 4LGSB 3C8KB 2D0GA 4XPFH 2EDRA 1F2XK 2H41A 3ZT7A 1PFCA 2EEDA 4U7KA 2RCSH 4HKXB 1L7TH 3TEUA 4ALAL 4X7TB 2OX5A 1BWMA 5C0EA 4P2QE 4M1DH 3BI9X 2A77L 3ECBB 3GB7B 3MGTB 3SDCA 1V5JA 3P73A 4LLVB 2KDGA 3MJ7A 1D9KC 1IM9A 5E2WH 3WSQL 4HKZA 5I66B 2ESVB 1LVEA 1BQSA 5KAQG 5F3BA 1G1YA 2ZOKA 1N6QH 3NFSL 4MAUH 1DQDH 3WHE1 1XR9B 5TPWL 2NY7L 3V6FB 4FHBD 1UXSA 1IFHH 1Z5LB 3LKQA 5GGQH 5EBLB 3BSZH 3IJYA 3N85L 5GHWH 5HI3C 3O3BA 4XBEH 3WKNA 1Q72L 3K3QA 3TH4T 1F00I 3MJ8A 5BJTB 2N7AA 3MRDA 5KANG 3SQOH 1CFSB 1ZT7A 5EPMB 4PUBL 4XMKH 4HAFA 5IB4A 5KW9H 4ZUUB 3FT3B 1YN7B 1PG7W 3HPLA 1T66C 1I1RA 2GUOB 4WI2A 5FYKL 5C0IB 1CICD 4PJBF 3GM8A 2XQYK 3MRDB 4IDJL 3QUML 4UT6H 2JB6B 2C3XA 3HB3C 4XNQB 3JTTB 5JW4Q 3RY6A 1NAKH 1WIPA 4WRLA 1AGBA 5GRVL 3BVNB 5IHZA 3C2AH 3CFKA 3LEYH 1Z3GH 1YQ2A 1CG9A 1IAMA 2O5ZL 3WFCL 1QLFA 4MCYB 3QG6B 3CFIC 5HYSA 3KAAA 1H3XA 3F5WB 3MV9E 3QZWA 5J7CC 2DB8A 4XT1C 4I9WE 3PL6B 2YA1A 3EFFB 3NFNB 5IMKA 3IDXL 3TPUB 2CKBA 1OTTC 4HKBB 4HXBH 1YJDH 3FT2A 1LMKA 3L3IA 3HCVA 1XH3B 3L3OA 3GSVA 5EU4A 1TVDA 1FG2B 1IEHA 2A74B 3T08A 1B0WA 4FQLH 1MY7A 4OGAD 3HE6A 4HUNB 3SO3B 4XRCB 5I1IH 1I85C 4F9PC 2E7CA 1RZKH 1CFBA 1QBMH 4F7CA 4R3SA 3MNVB 1JNHB 3IU3A 2YC1B 5F9WB 2FGWH 5CEXB 3ZT6A 1Q9OB 3I6LE 4YXHH 4KKLC 1U92B 3FO1B 1C1EL 2KH2B 3MCLL 4JM2B 4UUJB 2EO9A 5D7LD 4L8SB 1V3LA 5C9KA 2VXUL 1A14H 5AWNH 3QG7L 3REWA 3K7UA 5IVXA 5D2LA 1XGRB 4PRDB 5JIIA 1U8KA 4N9OB 4KHTL 1P4BH 1TFHA 5C0BB 5L8LB 2X09A 2Q86B 4BQCA 5HYJA 1R0AL 1CL7L 4IRJC 3MV9D 1T03L 2VLJD 1I7ZB 3QG7H 4KUZL 3U2SA 3ULVD 3GHEH 4U7SA 4IHOB 5T5FL 43CAA 1RJZA 4YR6B 1MCNA 1OPGL 1JGVH 4HWEL 4H1LH 5DQDL 5DUBB 4HS8H 5IKCB 3QH3A 4X6CB 2KQMA 3TN0C 4BZ1L 2BSRB 4PJHA 4FZ8H 3OL2A 4XPTH 3LV3A 4YAQB 5JW3H 1IQWH 4FQXB 1MRCL 2X5PA 4G5ZH 4FQHA 2BVTA 3PABB 3QDGB 3TBTB 4PRIE 4K94L 1QBML 3MRMA 3GHBL 4G6JH 5A2KH 2A6KB 5AZ2L 2YN3A 2ARJB 1XIWB 1ZT1B 4WIQA 1RZJH 3N0PB 5IEHA 3STZA 2CDFB 4PJXA 3UTZB 4GKOA 3UZQA 4YK4C 3BEVB 4NQXB 3HFMH 5T1LD 4P5TA 5IV2A 1C16B 3VRLF 2JF1A 2EYTB 1S9XB 5FUOH 2DTMH 1ZLVK 1FE8H 3IDXH 5T1KB 1NFDE 5D1ZA 1UH3A 2H2PD 1MHPL 4QOKA 4NZRH 5F97E 3ZDXE 2DQFA 5HGBA 1L0YA 1Z9OA 2R2CA 4IOFD 2NXZB 3OAZK 4MNGE 1XF2A 2CKBL 4YXKL 2YKLH 3L5HA 3RWEB 2FH6A 1I8LC 1T0NA 2EC9T 2NY4C 4HS8L 1F3JB 3MJ6A 4G6MH 1RMFL 4UV7L 3TYGH 1I8KB 3KYKL 3HNSH 4EIZC 3S3SA 5IT2H 2XY1A 4NZUL 1JF6A 1HI6B 4M6OL 3VG0L 1J0JA 5DQJA 3AM8C 3CXDL 2CKNA 1W8NA 5AG9A 5J8OA 4EN3C 3HS0A 4QOKB 3QFJA 2J2ZA 5E6IB 4JRYE 1TZHA 4UUJA 3MBEB 4M43L 5EZIH 4KTEL 2V17H 1CE1H 3M8OH 5JW5B 3D18B 1TVHB 3STBA 3JWOH 1F3RB 3K8LA 3STLA 1G1CA 2ORBH 3SGEH 4JPIA 4NNYA 3MRCA 1MCPH 5DJAA 3LKRB 4BFEA 5HGDB 2NX5A 3MMEA 3RI5F 3V0VB 1AC6A 3WUWG 1OWRM 3AY4A 4P23C 2V7NA 4ZFOA 5LWYH 4RRPA 2X44D 3EKCA 5ADPH 4XGZA 3QRGH 2I5YL 4LVHC 4NO5B 4K9EC 3K46A 5I1DA 1CGSH 2VLJE 2IH1B 2OJEB 4OCYL 4KQ4L 4PJ7E 4L3CA 3O8XB 1K8IA 2AEPH 1WVZA 3C9NA 3QRGL 4KTDL 3QXTA 3A6OA 3MZGB 1PX3A 2YPLD 4OCXH 5CEYA 4QXGL 3RTQB 2BNQE 2AJ3B 1DP0A 4LSRH 2X1QA 2FWOB 5C0BD 5F1IA 1H8NA 5IFJB 1HZHH 5BQ7B 2OYPA 3FO0L 4CN6A 3CSYA 3MSPA 1WV7T 1YEDB 5TQ0L 3T0EB 5DTFA 3DBXB 1MAJA 1PSKH 2HVKB 3LOWA 4XNZC 2F58L 3HB3D 1MPAH 1VADB 4MJ5A 1QLRB 1KCSL 3DMMB 5DA4A 3FO1A 1S9VB 4ETQA 3LZFL 4W6XB 3SPVA 1VKXA 1R3HA 4JFDB 4X80L 2FATL 3H9SB 4PG9B 2V9QA 3S37X 4ZAKB 4RGOH 2HFTA 2CKBH 1T83C 1T4KB 2WIIA 2AEWA 5EIIA 1LHZA 1QHOA 3GBNH 5IMLB 2X4QA 4Q9QL 1TMCB 5IIEA 2RIKA 4FQJH 4OIBA 4OFYA 2VLRD 2F15A 3QO0B 1ZGLA 3PWNA 4PR5A 5D7IB 3ARED 1AXSA 1R24A 1UKSA 1S9WA 2WNGA 4K3GA 1H3PH 4E41E 1YPZA 2VLLB 4PJHF 4NM4L 1HNGA 4X0KB 3WJLA 2OK0H 4YIQA 3NFSH 4MAUL 1NCUA 5ETUA 3HI1A 4UNTA 4UQ2B 5J11C 2DJSA 2A0LC 5HVFB 4Z7WF 4JGMA 3RDTD 4JRYD 5E7FA 3GSQA 2WW8A 2DLFL 4YHYB 4ZO9A 1NGWA 3M1BA 2OQJA 3TBWA 5L6YH 4AY0A 4BH7A 3GGWA 1OP5H 3LAFA 3HR5B 4FG6C 3QO1A 4FG6D 2L7JA 4D9LL 2EKSA 4ZPTB 3WFEH 4KDVA 5F7HA 3KPMB 5L6YL 3VWKD 3UJJL 4XC1H 4N9GA 3TN0B 3ZDYF 5BOZG 4PJAE 1P1ZA 1CFNB 4U6VH 4Y2DD 4I2XA 1MRDH 3I9GH 5C09B 1EHXA 4OCMC 1G7MB 2ERJC 2VSDA 3CX5J 5IB1A 5DDHB 4IRSC 1CFSA 5JORB 2FCBA 3T0WA 3K1KC 3H2WA 4D0BA 4FQ2L 5I8OH 4HCRH 4YFLF 1Q9KB 4F37F 1QA9B 2A6JA 2FB4L 4NHCL 4YFLI 1QFWH 4X4YA 5I1DB 3L3KA 4H25A 4KVNH 4S1DC 4RWYL 1CLYL 1P4IL 3GRWL 5KSUB 4NQCA 3VXOA 1G9MC 2VDQL 2LVCA 1PQZA 3C5ZA 4NQDB 1KLGB 1NCDH 1D5BA 4OB5H 1IC4L 3LRSA 3KLDA 4LIQE 1VGKA 1WISA 4EIGB 5FA4A 2PYEB 4NP4H 4U3XA 4JN1H 3ARFD 3ZE0E 1Q0XL 4GW5A 3NCBB 1BM3H 1CFQA 1U3ZA 2OR9L 1FFOA 4ONOA 3U9UA 2DMKA 5HGAA 2VLJA 5BMFL 5D70H 5I1AB 5F9WC 35C8L 4G9DA 5EH1A 4FFYL 2H8PB 3DX8A 1JTOA 3WN5C 3OKMB 2AV7B 2WWMC 3FB6B 5FDYA 1MFEL 4NKDB 1DSFH 1IGCL 3NFPB 3VFWA 3UDWC 1SM3H 4ELMB 5GRJH 2A6DA 3G08A 4N0UE 1UM4H 1PKQA 2JE8A 4P59L 2CRYA 5BRZD 3MRNA 5ANMB 3QEQA 3FTGA 1HCFX 2EYTA 2E27H 2ICEB 3HA0A 4QYOB 1U8PB 4J3UA 3PL6C 2DYPD 1S7XB 3MNWB 5HY9A 2C26A 2P48B 1CL7I 2Z0BA 5FIEA 1T5XB 1WZ1L 5A1AA 5D2NE 5FYLL 2FZ3B 4P57A 5KSVB 2ICWJ 4OLZH 3CH1B 3UYPA 4YDJA 5I8EA 3VWKC 5GGSA 4YFDB 5E00B 5ID0B 5IF0A 3K2UL 1DEEA 1ZA3A 2FJFB 3QUXD 4XH2B 1V8HA 3WXWL 4Y1AD 4F57L 2XYCA 3BH9B 3ILQD 4FTVB 1XF3B 3QDMD 2C3VA 4QRUA 5L88L 4LAQL 1ED3A 3Q5YA 2CGRH 3GMQA 1F4HA 4U1IA 5D1QC 5DJ6A 1IEAB 4G43A 1IQWL 1LEGA 1D5ZA 2B0SL 5TH2A 2GCYA 3MGOB 2ZJSL 2XZAH 2DAVA 1EGJH 2R0WL 5JR1L 2D31B 1A0QH 1R5IA 2VDKL 5J13C 1F6LL 4XAKE 1C7TA 5CJQL 3SGEI 4OCLC 1ZWIB 3KJ6H 4LPVA 2MKWA 4KMLB 4MVBD 2J4WH 4X6CF 2AJVH 4I48A 3PGDA 4CN1A 3HC3H 2VE6A 4KTDH 4MD5B 1FL5A 2W60B 1ZHBA 3ARSA 4I0PA 1OF2A 4PV8A 1DJSA 4UIMA 1FAIH 1FIGH 1NBZA 4TPRH 4FXGA 4XXCA 4D0CB 2IALB 3FO0H 1KPRA 2VDOL 4YHOL 5J06A 3TNNA 4HWZB 4PJ9D 4PG2A 4L1HA 5FGRA 2R9HD 3MJ9L 2XZZA 3QI9A 3KNBB 3RBSA 3IU3B 1K4CB 1OGAD 3EGSB 3DRTB 3WS6A 5GGVH 4M7JH 5BRZB 5TGBA 2VN4A 2C3GA 1C08A 4U1KB 3S9DB 1R5WA 1BX2B 4JFDD 5B3JE 3HE7C 3WV0A 4J12A 1MIMH 2EDEA 3V5DB 3L3IB 2DD8L 3FT2B 3VGGA 4ZUSB 4OKVA 1MUJB 3KR3L 5GRVK 2ZCLL 1FZJB 3CH1A 5HVHC 3UEZA 4JPVH 1B3JA 1QA9A 4KJYB 1DFBL 1HWHB 2X1WL 1CGWA 1CL7H 2O5YL 1IC1A 5L0QC 4LP4A 3FT3A 1MVUB 4PRHE 4GQPH 4MHHI 4NQUA 4ETQB 3MO1B 4LSVH 43C9B 4N1CA 5FKPA 5ACZA 4MXVE 4JRWA 2YPLB 3WIHH 4NNPH 5GS0L 2IGFH 4XNQA 1RZIB 3FQTA 3CFDA 4QHLA 4QGYA 5GJTL 5I8CB 1U95A 2CO6B 3DLQR 2Y6SD 5HDQH 1A7OH 2ZSVA 1LE9A 1RIUL 3E3QE 1RJYA 1UEMA 5DMKA 5IMOA 2YXMA 2P45B 4AM0A 3RUGB 5EO9A 3DX7A 3HKFA 1WLHA 4XMLL 3FN0H 4DWHA 1NANI 2FGWL 3ARYA 1AXTL 1CXFA 5FF6B 1EDQA 4ZMAT 3FB8B 3F7QA 3EOTH 3LB6D 5DEFB 2K1MA 3WIIH 4NHUA 2D03H 1CZ8H 3VJ6B 3X3FL 3TZVC 3MYJB 4S1QH 4GAJH 2ATPA 1JWSB 2EH8L 3FO2B 4PJCA 2X41A 3ZE2F 3IYLW 1MFAH 4RRPG 4LLWA 5D5ME 1H9VA 5F9AC 1CLYH 5C08D 3VXOB 1HYSC 4I3GA 3S98A 1NCDL 4ODVL 3MGTA 1OVZA 2H2PC 1HILB 3KPQB 5E0QA 1LP9E 4K23L 3AS1A 3BRDA 4MVBC 4CADB 4IMKA 3HE7D 3KPNA 3QUMA 4XPBL 3WNNA 1EEUA 3VG9C 1Q9WB 4EI5A 2QV2A 3RHWF 1MLCB 4MZ3A 4DFHA 3UBXB 1NLDL 2VR5A 3T0EE 2B1HL 3G6DL 1DLFH 1L6XA 3IFPB 1CDCA 3P4NA 5E08L 1P7KA 1CDUA 4L4VB 5DJZA 4RFEB 3X14B 3DGCR 5HYSG 4JQXC 4RBPH 1YPZE 4HIIB 1E4XL 3H7LA 3FCTB 3I02B 4MA3A 3SCMA 3UTTB 3K4AA 3A6BH 1VEOA 2LFGA 1F4YH 3MV7D 4ZO6A 5EA0H 4LCIL 3OPZL 5FYKU 2H2SC 5IEKB 1ZHKB 2Z31D 5LGJA 3BHBB 5J3HD 1V7ML 4MWFA 2LV4A 4KWUA 3U0WL 8FABB 3O45A 2HG5B 2E7LC 1WCQA 2HTKC 2DKMA 1QSED 3CDFA 2CJUH 2XY2A 3F6IA 5EOQH 3B8YA 3GMOA 4JQXA 1JYVA 2GTWA 3OKNB 3WYRA 3BEVA 3NABL 1I9EA 2EH7H 4GLRH 4NUGH 4TTDD 3OWEA 4BKLA 3UBXI 1M71A 3MLVH 3QUYD 4PBXA 2EC8A 5D7SL 1J0HA 3ARDD 4NNYB 4Y19D 4N5UA 1QFWL 4U1MB 3VXNA 4S1SL 2QHRL 3O41A 4EQ3A 3WXVH 4TTGA 3E6FB 3QI9B 1DL7H 4GAYA 1ZAGA 4N5ED 4RBPK 4WTZA 1B6DA 5EUKA 3QQ9C 5BXFA 1OQXA 1WC7B 1QP1A 4Q0XL 1T1YA 1KCSH 3JUYA 1JPST 2W92A 5FO7A 4I18B 4MAYA 3QPXH 2W9LA 4HFWB 4HGWA 5C71A 3QWOB 3RZCD 2OLDA 4Y4KD 4NRXA 4HZLA 3D0VB 1KJVB 4MA8L 4I48B 4TOYH 1AQDA 4CJ1A 4PJFF 2FWOA 3HI6L 1ZHBB 2BVQB 5HYFA 1HHGA 1HDMA 4RAUB 2KKQA 4MXQD 4EDXA 4RMSA 3GMRA 1MJ7L 3OQ3B 1WC7A 1HINH 2H8PA 1UWGL 5HHQB 3HN3A 3QEHB 1IZJA 1D6VH 1DBMH 4KU1A 5D72L 4GAYB 2X9XA 4JZNB 4KRPD 4LSTL 2LU4A 1T21A 5LG1A 4XB7A 4LCUA 1KB5B 2WV3A 4MHHG 4UDTB 1EEYB 4AH2A 1CE6B 3ROOA 4KPHL 1MRFL 2W07A 2CLZB 2G60H 5E8PA 2AJUH 4U1KA 4K8RC 4U3CA 4H8WC 2XFXB 5E2VH 3S88H 1T80A 3P4MA 3NZHL 4Y4KA 5FGCB 1T0MA 1KCKA 1XH3A 3L3OB 4PJXF 1ZTXL 2AERT 1PW3A 4KKCC 8CGTA 4EZMA 1GGYA 2Z9TA 3MRGA 3BN3B 3V52L 4G42B 1QNZH 3QUYC 1OTTD 4ZSOA 3M17B 1KB5H 3VXRE 1GIGH 1OAKL 2MPAL 4PGEB 1I7TA 5FYJU 2XKSA 5IB3A 3CFBB 3Q5OA 5DQ9A 1XZ0A 5IW6B 4R8WH 4L4TA 5DMYA 5E56A 1F3JA 2AXJA 5DYOA 4LVOB 2WBWB 1V7NH 5CMAB 5CWSB 2GFBB 4FXKA 3JTTA 5DA0B 1I75A 4TULL 2F19L 1XF5B 5JPNA 5EU6E 4MA1B 2QSCL 1DL7L 2I24N 2DQHH 1U8HB 4BZ2H 3CSGA 2FIKA 1CLZH 4ODSL 3C87A 4XWGL 3PNWA 3PHQA 1SY6L 3MBED 4GW1A 2AJXL 4E41D 4F7MB 2Z35A 2R1WA 2ERJB 4ZXBA 1H15A 3H9ZA 3F7RA 4I3RH 5JQHC 1XGPA 1E4KC 3QP3A 3EDFA 2EDJA 3VFMA 3RVVC 3TNMA 2D03L 4PP1D 3HE6D 4NQVA 5HTSA 4HIJB 1I3GH 4PV9B 2CDGA 2PNDA 4QY8B 4R0LA 4GMTH 1GC1L 1R5WB 4NQDA 4LLVA 3QPQC 1MH5A 4PJGB 1EO8H 3HE7A 3QEHA 5BV7B 4MJID 4JO2L 1M1SA 4GJTB 4MD4A 4H26A 5J11B 2CUHA 4JO3H 5J0BA 1WBZB 2W38A 4QHKI 1KTDB 3GJEA 1HHGB 5I18L 4UBDC 3QEGL 1T5XA 4Y16B 1KCUH 4RZCA 5IROA 1WZLA 3UTSA 3DXAA 3AXLB 1EA9C 4KKNA 1KG0A 4HIXL 1RU9L 1FN4A 4U1LB 5DMIH 1E6JL 1RZ8B 5JO5A 4YBLB 1PG7X 4MZ2A 3C2AL 1U8QA 3O6FC 2O5YH 5JHLH 1AQKH 4FN0A 2AS5M 2YPLA 2GUOA 1A7QH 4BH7B 3NAAL 2P4AB 4PRNA 3ZSTA 3P0YH 4ODTH 4YUEL 2C5DC 3QBTB 4J8RA 1X5IA 2X4SA 1BZ7A 4RAVA 5DWUH 4NKMB 2Y6SC 3BMVA 5C6TL 3MLUH 1BVZA 4UT7H 1QR4A 5GZOD 5DK2A 3ZKXC 4RDQG 4WHYG 4NN5C 4J3SA 3QUKA 4WO4A 1A6AB 3T4AA 2ESVA 2EIBA 1J05B 5EU6B 4Q9CA 2XWJB 5KSUA 3LMJH 2WIIB 1P4LB 3S6CA 2ZUUA 2J8OA 2J8UE 4NKMA 1Q9KA 3FOLA 5KVFL 1XGPB 4GRWE 3Q5TA 1GYAA 1AKJA 4LASL 4WJ5A 3VXRA 2GT9B 2FX8H 4FFWD 1T03H 5DJDB 2Q7YB 3V4PL 1CXHA 1VFAB 3IDIA 4LAJH 3MLWL 4P9MH 1MELA 3PWUB 2D7PA 3ROLA 3CPLA 3VFVB 3OKOA 4AMKL 1U3HD 1CU4L 1AHWC 3CDGB 1RVFL 1DANT 4K07A 5DTFB 1S9YB 4RNRA 3TIEA 3TJHC 5J9PA 3BRFA 3X13B 5E8EB 4WHTA 3NCJL 3R0MA 2JCCF 2AEIT 3TBWB 2P43B 5DSCB 1UACL 3QR2A 1KEML 3MOBL 4JFHE 2HLAB 3T0AA 5BW7C 4LPTA 1NGZA 4FA8A 3F7VA 4LU5L 3BAEL 5CJXC 3QHZL 4GRLB 3T2PA 1SJVA 5E08H 4Z7NE 3LN5A 3MRIB 5T5NG 4MAYC 4HSQA 1TZGL 2WK2A 2MSPA 2AK1L 4Q97A 1DZBA 5L9DH 2O5XL 4QRQA 3PWPE 4CNIB 4NJ9L 3U46B 1ZT1A 3UAJD 4JDTL 1SYSB 3UTSD 1WUNT 5C0JB 1YQVL 1A7QL 4Z7UF 1HSAA 3A0OA 4XBGB 4EBQH 5I75B 3ECBA 3MOAL 3JTSA 3UO1L 3UJIH 4ZUTA 3Q3GA 1PQZB 2IGFL 3UTPE 4D9LH 3DGGA 3QA3B 5D1XD 1MHPH 4O2FA 4U2YA 4LSSH 5EDXA 3DRQB 3KPSE 3ETBF 4DUWA 2XZCH 4HHAA 5DO2C 3WNLA 5LAXA 1NL0L 2NY4D 5INCA 3LKNA 4GRWH 2NY2D 3UO1H 2D4DA 5JHDD 4KHXH 3VFUB 3UXFA 2VC2H 5DLMH 4CU6A 2D4FA 5D1XB 3UJTH 2LU3A 3B9KD 4S1QL 2DBLL 1W2KT 1MHEA 4R4NC 2R29L 2VKWA 2AK4A 1W72H 1FO0L 3SJVB 4OGAC 3OXRA 3KPMA 3B9EA 2VN7A 4KDTC 3HMWL 3KPLB 5FKPB 5MEQA 1UM5H 5LXGL 4ZOAA 1KELH 3BAEH 3CVHA 3QWOA 1L0QA 2RHEA 5L0QB 1E4WL 3FL7A 4LLMB 1W72L 4LBEA 2X89A 4JN1L 3M17A 1CXKA 1D5IH 1NC4A 1J1PH 4J1UA 2VDNH 3T3PE 3RU8H 3GSWA 4O51A 3EJZC 3QEQD 5JA9A 4BH8B 1SY6H 5INDB 4ODXA 4GXUN 4ERSH 1Q38A 1A4KB 5BV7L 4QHKJ 3DX6A 5FA4B 2NCMA 4QTIH 3C09B 5D7IA 3PWNB 3GIVB 3STZB 1G7QB 3UTPD 2BVYA 4HJ0C 1XGTA 3V5HA 2VABA 3SOBH 3IAQA 3UP1A 1RULH 3ILPA 3F7VB 1BVKB 3CFJA 3IRZA 3JXAA 1JMZA 5IQ9B 3QIBA 3RL2A 1A6UH 5C0DA 4P5KA 1RJCA 1X5KA 2VZOA 2W9EL 5I1CH 1ZVSA 4HWNA 4J6RH 5DSCA 3D39E 3KYMA 3R06B 5BZDA 1R5VB 3RGHA 3B5HA 3VWJC 5FO9B 2HKHH 5FFLA 4G6AC 3IAGC 4IHOA 4XP6L 2IPUK 5GGTL 1CDYA 5JOPD 1F4XH 3NA9H 7FABL 3A67L 2APWA 2JB6A 4OCRL 2P42B 4Y5VB 3O6ML 3BYYA 1LEIA 5GHWL 5CUSH 4MB3A 5E5UB 3BWAB 4NKDA 1CT8A 4KV5E 5BQ7A 4GG6B 4APQA 4WI6A 1RSFA 4R4ND 1VFOA 4X5LA 5F89A 4G6FB 2WQRA 1JFQL 4P2CG 1ITCA 4XAWL 4JHWH 1IRAY 4LSPH 1EK3A 3ZKMC 4N90E 1G0DA 3QUZB 3QAZB 1CICC 2GJ6B 3CD4A 4JFEA 3S4SA 3SKOB 1C5CH 4DGIH 5MERB 4EUPA 4U0RC 3RGVA 1DUZA 5J4MA 3DI3B 2CDEA 4NQCE 3L95B 2ESVD 1Y18B 1QO3B 4OUOA 2C4FT 4KJQC 4X5XB 4AG4H 5I66A 1FNFA 2FR4B 4LGRB 1XIWA 2E27L 4O00A 1YY8A 1ZANL 5I17B 1JZ7A 1SEQH 5E8OB 5DJAB 3LQZA 4WU5B 4LLDB 2AVGA 1J0IA 3ZHDA 2O26U 3KPSA 4IEFB 3ZKXB 3O6LL 1R3HB 2YD3A 2R0KL 4NNXA 4OUUA 2FH8A 1INQA 2VQTA 4PRNB 1DN0B 5I1KL 4NO0A 5CINH 3LN4B 4N1HB 3D0LA 4E42B 4NIKB 2D3VA 3ZKND 4C83A 1AGCB 2F54B 2ZUQB 4MJ5B 5GGRY 2CRMA 1DBJH 5I2IB 5I1JL 5CFHA 4O2CA 5EU5A 4F7EB 3QNYA 1HEZA 1T1WA 5C1MB 3ORJA 3CSYB 1CCZA 4WO4D 1YMHA 5CJBA 3QI9C 4JKLA 3WHE0 2FBOJ 5ISZE 4HJ0D 2Y4SA 1MF2H 3OG4B 4XZUA 4M8QB 3CU7A 3QCVL 1YN7A 4CW1A 2YWYA 4XNZB 1T7ZA 4L3ED 2DM7A 2RCSL 3NPSB 5CCKH 3PP3K 2VLKA 3LKOA 5IMMA 2FATH 3B6SA 1FFOB 4LLYB 5E1HB 4F33A 4J2XA 3HUJA 4DKFL 1PDKA 2BXZA 5LQBL 4RGOL 1NCCH 2AAVA 3C60D 4RQQA 2DQGL 1S9XA 1QFOA 3V6FA 3RTQC 3JVGA 5EOCH 3DIFB 3SDXE 3HZVB 1AGFA 4MQXC 3GHEL 3MR9A 4OT1L 3TZVA 3BW9A 2NXYC 2PW1B 4LCUB 3VJ6A 3Q1SH 4YDVA 1JZ6A 4ODUA 1SMOA 1TJHL 1WQVT 5EOTB 3QUZA 2R69L 2CK2A 4X6DF 3WLBB 5DJCB 3BX7C 4PP2B 5IT2L 1P5VA 5F6HJ 1IKFL 5FKAB 1Y18A 1MCJA 2GIYA 3GNML 1AJ7H 2RAMA 1P9MA 4NN7B 4L29B 3PGCA 4YBQD 4HPYH 3GMLB 5JNYA 2AJZA 2ZCKH 2AJXH 3EOTL 1VEMA 4X6FB 3HR5A 4XCCH 2ZSVB 1LE9B 4WFEE 2ESVE 5JUEH 1U8JA 1OP3H 3CFBA 5D6DA 3S36X 2FX7H 4Q74A 5KN5B 2YRPA 5FM5M 1FE8L 5DRXA 1FO0H 2ADIA 2ITDA 5I1HH 5BOPA 1I7RA 5C92A 4KTYA 4X6EB 4OM0H 3W81A 3F12B 3RWIA 2ZUYA 3TT3L 4F9LA 1KFAH 5JW4M 3BP6A 4YBQC 3WCYA 2JLLA 3O4LB 4Z7OF 2QBWA 5E6YA 4KI5E 1M4KA 4RGNB 1EMTH 4G6JL 5F7KC 1XR9A 3SDAA 2VWEC 3CUPB 3ARBB 4J3WA 3VFRA 3V5KB 3MA7B 1KPUB 4JPVL 5KANI 2NX5B 4YQXH 2Y7QA 1MCKA 3TYFA 3I3EA 2YBRA 4LVEA 4ZAKA 1JRHL 1YEJH 1WWAX 1FVDB 1N8ZB 2M1KA 2GW5A 5DJYB 5I1GL 2E5EA 3TJHD 2X1PA 5BW7A 2AJSH 3PDGA 1XR8B 4W4OA 4PJ9B 2J7LA 3QFDA 3VFPB 4LEOA 1N8ZA 4QXUL 2DQTL 3KHOA 2FJGA 1EHNA 5EC2A 4CVZA 2HVKA 1UA6L 2R56H 4HWZA 1MREL 3U7YH 1K4DA 1U8LA 1MWAH 5K59F 1V3MA 4KJWC 4LCWD 1RZFH 2B1AL 5ALCH 3MODL 1T0NB 1WBXB 4LRIA 2FEEI 4OCWL 4GAJL 5I74C 5EG6C 4DZBA 4UIKL 4DGYH 1I4FA 5CBEB 3IAPA 3NA4A 1DVFA 5JHDB 2ITCA 2VXVH 1J86A 3O6MH 5GGRA 4Z8FH 4KHXL 5INCB 1GSMA 3MUY1 5FYLH 3AGVA 2VIRA 4M93C 2G5BA 3HNVL 1T1XB 2CD0A 2CK0H 3MJ8B 4JCMA 3PWPD 5CBAB 1PEWA 4X4ME 3ZHKA 4L9LC 4WNQA 3MFFA 5EIVA 5BS0A 1J0ZA 1XCQA 5SWSB 1EVTC 5D7LA 1OAYH 3MXWH 1YEJL 3RL1A 5HYJD 2X4UB 1H3TA 1K8DB 1DQTA 3OGCA 2HG5A 1MFBH 1FHGA 4WFHE 1LP9A 1SJHA 1WFTA 3IKCA 1JGUH 2H26A 4M5ZL 3EYSH 4OI8A 3BDXA 1DTUA 2MJWA 2ZUXA 4K94C 4WW1A 3WS6C 3EO0A 4LMQI 3ARQA 4CUCA 4AEIL 2AK1H 2D0HA 1RUKL 2Q6WA 1IGMH 2J5LB 4M6NH 3VH8B 4PLJC 4OIIL 3H9HB 3BIKA 1T83A 1P1ZB 3NN8A 1XF4A 3VMOA 3BO8B 4PJIB 1P7KB 2PO6B 1G9NC 3A6CH 1BIIB 4HPOH 2WIMA 5GGTH 2X89D 2YXFA 4HJGA 5HDBE 3B9KA 4M02A 1I3RA 1T22A 3ARGA 5EN2A 2YRZA 3MV8E 4P2YA 4H0GA 1YMMA 1X3DA 1BGXH 4L4VE 1A2YA 3D85D 3TIEB 5DT1H 2YZ1A 4M8QA 1C5DA 2YC1A 1JGEA 1WIOA 3X12B 2DBLH 1NFDB 3PHSA 3KPQA 4JDZA 5FCUH 4X6FA 1G7JA 5GJSL 3SCMD 3UTZA 3SGDH 4P4KD 2VC2L 5C08A 2LABA 1JNJA 5KSAA 4Q2ZB 4NQDD 3HMXH 2IAMB 3QIWD 3RVXD 2A6KA 4X7SL 4EDWH 2F54A 4J3OC 2HFEA 4PR5B 2BOBB 4M48H 1FYHB 1B2WL 3LRSB 5D2LE 1ZS8B 1RZ7L 3T65B 4JN2B 2ZP0T 5SWQA 1UB5B 4OF7A 4X9HA 2R2BA 5DZLA 4O58H 4XCYB 1Y0LA 2QQKH 5E99H 3CNKA 2HT4D 2VH5H 3FHAA 4LPWA 1NC2B 5FF6A 2BNQD 4M03A 3EOAB 1N5AB 2CK0L 3NIGF 1G6RB 1U58B 3D39B 1AD9A 2X9WA 5GRUL 2VDQH 1VKXB 3G04B 3X3GH 1DQDL 5GRYA 1VACB 5FUCC 3EO9L 4Y2DB 5DRNB 1EEZB 2FDBP 3Q6FA 5CHNB 1DLHB 5E2WL 5ITBH 3WN5B 4JM2F 2FD6L 3RY6C 4QRRD 5JIPA 2XRAH 5AUMA 1FPTL 5GS0C 4ZXBD 2HA1A 5HHNA 5F3HA 2P49B 4KRNA 4MQ7B 3BSZL 3R4DA 1A6TB 4LQFL 3PE9A 3RWCB 15C8H 4WCYL 5A16A 2WWMD 4GBXC 1AKJD 2HP4A 4MJIB 2WUCH 4U1NA 3BWAA 2DQEL 4PGBB 3WN5A 5GRJL 1A4JB 1I3VA 2MCG1 5B38A 1QSFA 4KVNL 3MV11 3P9MB 2AJZB 4JY6A 5KVDH 3GMLA 4JR9L 2RQ8A 1QD0A 3KPSD 4ISVA 5TH2B 5MHSD 5FYJE 4OCSH 1J18A 4HS6B 3D39A 1BLNA 2GK0A 4I5BA 3MLXL 1J8HA 4PJCB 3FO2A 3GSUA 4S0TD 1FQ9C 1B4JL 1T2JA 3PWJB 4WV1C 1GGUA 1OL0A 2EDNA 3LD8B 3AS3A 3PL6A 2EIZB 4ZOBA 1QTYT 4NFDA 2BNUB 3EOBB 5TDOB 1P69B 4RDQF 4XBPB 1F58L 2BOCB 5JHLL 2MHAA 3O2WH 4JZOB 4KKLD 5IHZB 4HUWB 2JJTC 4X7EC 2HWZL 1JPTL 2UWEF 5KSAB 1ND0B 5EC1B 4PJIF 4LSPL 2DBJA 3VWJA 5F8RC 3SE9L 1P53A 1G6RH 1MCWM 3D25A 3THML 5L88H 3MX0A 3U7WH 4I3RL 4LPXA 3VD9A 4LDEB 2GJ6A 5HYEA 2AXFA 4O5LH 2VDML 5FV1L 1LO5B 3MRBB 3FZUC 2OP4H 1S8DA 1FGVH 3EO1A 4U6TA 2FIKB 3I6GB 5I1KH 2DM4A 2BSSA 3SDDD 5HHOE 4NQSB 1KT2B 1YMHB 2FIRT 1LK2A 3REVB 4DN4L 1D5XA 3BESR 1M6OB 2EIEA 5EBLA 4KJQD 3KXFA 1OB1A 3SGJC 1RUAL 1S78C 3EBAA 4OF3A 5EBMB 4DCQA 1KFAL 4U1HA 3NZ8A 2AXFB 2Z4QA 4LMQE 1CLCA 3ZTJH 1J87A 1UCBH 1CTOA 4Y8DC 5SWZE 3KPRB 5T33H 2BHUA 3UPRB 5KSBA 3LVEA 3E2HC 4P2RA 1JV5B 3F58H 4MXWL 3F65A 3O9WA 4JY5H 2BRQA 4PYHA 3E8UH 1J8KA 1U91A 3O2VH 1F6AA 1WITA 4FFYH 4G8GA 4NSKB 4CN4A 2YBRB 2CLZA 2AEQH 2JELL 4JFZH 2AK4D 1MJ8H 1HSAB 4WUUA 4NWUL 2YK1H 5CEZE 1G6RL 1UJ3B 1HHHA 1OAUH 3MLSL 5CD5C 4EDXB 2ICEA 3HPJA 5IQ7H 2NQCA 3OKDA 3CSBA 1MIEH 2HTLC 5CAYB 2PKDA 4OCYH 4OFVA 4M1DL 4OZFG 1MCOH 1KJVA 3M45A 3I2CH 3S35H 5JPMA 2A83A 3IDYC 4FQCH 1KUMA 1YYML 2VDLH 1JRHI 2YPLE 4X8JA 5JQ6L 2J3SA 1HDMB 4RAUA 5ANME 3T2NL 4UZGA 2NNAA 5DJXA 5JPMB 1R5IB 4BFBD 1CD1B 2PYED 4PBWD 3GMNB 3S35X 2AGJH 1HOCB 2UZIH 2A6IA 3W39B 2GY7B 3BISA 1YY9C 5I16A 3MA9H 3IGAA 5CJ8A 3OKOB 1IC5L 4J3TA 5IBUB 5IV2B 1YPZB 1FZKA 1F4WL 2R4SH 3VXTA 3SKUD 1HKFA 3I75A 4UAOC 2FL5B 2Z92A 4K3EH 4KJWD 4NQCD 4HQQL 2OJZH 3TT3H 3SY0A 2AJUL 4PRPD 2ZCLH 4JJ5B 1CN4A 5D7IF 5KVEH 4O9HH 2FL5A 2Z92B 5IM7A 4GRMA 2NY4B 2CH8A 4XX1E 5KJRL 1YNKL 3C5ZD 1L0XA 5SWZD 4N0YL 3CXHJ 1UH2A 3BZ4A 5A2LH 1PVHA 3C60B 3TCXA 5C86A 1SY6A 4NM8L 3BPNB 1WBYB 3VXUA 3IF1A 3KDMA 4IRSB 1I7ZA 4X6DE 4G8EB 1SBSH 3CLEH 1HOCA 2IJ0C 3CK0L 2B5IC 3B4NA 2G75B 1V7NL 4YPJA 5IEKA 1S7QA 4PRDA 4WWID 1IGJA 3OKMA 5SV4A 3RDTC 4MMXC 3PP3H 3FCTA 3P11H 1KJ2A 4M6ML 2XZCL 1NCBH 4WTWA 3LKPB 5TDPA 4JQIL 2OSLA 4HIHA 2E7BA 4BJLA 2F58H 4IRZL 5DVNA 4ONGH 4DTGH 2PYEA 1RMFH 4QWWD 5GGSY 2EXWD 5CP7A 2PETA 4W6WB 3QFJE 1JNLL 4YPGB 2BJML 4NZJA 5DT1L 3S5LA 4ODUB 1L9NA 1PAMA 3KLAA 4WU5A 4ZUTB 1X5LA 5IW1A 3FKUS 1N4XL 4BFIB 2OMNA 4G7VL 1N5YH 3WUWA 2QQLL 3EFDH 4WFED 3U83A 5JDSB 4I2XB 4XI5D 1QSZA 3C5JB 4LLWB 3EYFB 4OQ1A 2XTJB 2OTUB 2HTLD 4HS6A 3KLSA 4YPGA 2QL1A 2B1HH 3G6DH 1WZKA 3QWQB 3SDDB 5LWYL 1Q8MA 2NR6C 2PXYA 2YD5A 1A64A 2BC4B 3BUTA 4Y5XB 1MHHA 3RJQB 1IT9H 1N59B 1QQDA 2X4SB 4PJFA 4TN9A 1E4XH 3WD5H 4GW4B 4KAQH 4KROD 3KYNA 4P5TC 4GG6A 2KL6A 3JWDH 1K5NB 4ZFGL 4G8IA 3PWPB 1MFBL 3NCYS 5EO1A 1N59A 3ARGC 1JHTA 2J1KA 5EPMA 5EU5B 2K7PA 5J9PB 4UINH 1OAYL 3MXWL 3B9KB 4GQ9L 4QF1A 5KSAD 4HFUH 2WUBH 2BY1A 1A6WH 2C1PB 2NY6B 4WDIB 4G8EA 3GSNA 1FO0B 1NKOA 4KRLB 4Y5XA 3R8BB 1YNTA 4HC1L 1DLHA 1R24B 5AYQA 1BFVH 4XGZB 1X5HA 1XF4B 5KS9F 1CLOH 3QXDA 4TRPL 1HKLL 2QSVA 5HJ3B 1R3JA 3NCYP 4LVNC 1B0RB 4ZS6C 2EH7L 1YMMD 2YN5A 1RPQA 4KJYA 4HS3B 5HBBA 4G3YL 3ARGD 3L3DB 1XAUA 3HNTL 3GJFH 1OGAB 4EI5C 3GI8L 3TESA 2J8HA 4CMHC 4P23B 3DETC 1SBBA 1IAIH 1MH5B 3PWJA 4X6CE 3ZTJG 4GRWF 2R29H 3MV8A 4X7CC 1AR1D 4OZIA 2APXA 2DYPB 4IJ3B 3PXJA 1C5BH 4JO4H 4H5SA 4E41A 5C08B 3K0WA 1OLLA 2DQJL 4R4BA 2F5AH 3I3BA 1CE1L 3DYMA 2JKXA 2W0PA 2IALA 2YUXA 4RGNC 4NKIH 4ZXBB 1A6WL 1XGRA 1FH5L 5J6GB 1CT8B 1O5DT 1WWBX 3ZE0F 1BVLA 3RY5A 3VXPA 5E8DL 4DVRH 3V6ZB 5F7LB 4A6YB 3IF1B 4FFZL 5TE4L 4K9EL 1P84J 4P5MB 4BELD 1VACA 1S7RA 4IS6A 2I60L 1CS6A 1R3IH 2Y72A 25C8H 2GCYB 2LAAA 4JHAH 2YD8A 4Z7WA 5CILL 3RGVD 1LE5B 4HCRA 1CIUA 4IRSD 4P4RB 2GITA 3DV4B 4X83A 3ARRA 2F74A 4HPOL 4Z7QE 4Z7UE 5GIRB 3KWWA 3W9EB 5IBTL 1MI5A 5HHOB 1JZ8A 1MSPA 1LP9B 1YYLH 1BJ8A 5E9DB 2MMXA 4XNUL 3JTSB 3IS1X 1LEGB 5JUEL 4MD0A 1Q72H 2WWKT 3UPRA 2HMIC 3KWWB 3W9EA 2QJDA 5D7LB 4RWYH 1J88A 4XCFL 1JV5A 2YSSB 4JY4A 4HBCH 2FHFA 3QG6A 5GS0D 4NKOA 5KVEL 1JPSH 2QTEA 4JB9H 2B2XL 1FZKB 5IHUL 5HYQB 3DHMA 5GQBA 2YRLA 1OAUL 2NY5L 3MLSH 4XNYL 3TA3C 3O4OC 5B38B 4O2EA 4CJ0A 1ES0B 4X5WB 1YEGH 4B53A 1FO0A 3IRPX 2ADGA 5DMJB 3EDKA 4TSBH 2UUDH 3IDMA 2ICWA 2NZ9D 4JFPB 4XCEB 3BZEA 3V52H 1JTPA 2XKNB 4FQ1L 3CVHB 3MV01 1MAMH 3WFCH 5F88A 5D93C 4GAGH 4V2BA 4FNLL 2FB4H 4NHCH 5DJ2B 5D8JH 3LEXB 4OLYL 4DVRL 4IOIB 1CGYA 2A83B 4D8PB 1CVRA 1U3HB 4YHMH 3LS4H 1C5BL 1S8DB 4JO4L 4Q6YA 4DQOH 4JM2C 2DS4A 3AREB 3O3BB 2F9BT 3GKWH 2NY0C 3X14A 2AGJL 2YPVH 5F9JB 1FORL 2PXYB 3NIFE 4LHUG 5D70L 2NY3C 3L5IA 1WFUA 3MRPA 2NLJB 1U8MB 3L5WA 4WY7H 3KPOA 4IDJH 2UZXB 4UT6L 4U1JA 3WNKA 4DJMA 4PJ7A 5CGYC 1CD9B 3GSVB 3SO3C 1I1FB 4XVJH 5SX4I 4DN3L 4HGMA 1RZFL 3RVWC 1A7NL 1ZLUK 1INDH 3WFDH 4X6CA 3E6FA 2ARWA 1CFQB 3U9UB 2AK4E 3CLFH 4CDHA 3DURB 5KS9A 2VDMH 3ARDA 4WUKL 3DUSB 4H0IA 1N6QL 3QEGH 4KH2A 4EVNB 4HWBL 2CPCA 1F4WH 5GISL 5IB5A 5DGQA 1VCAA 2R4RH 5LJYH 4HCRL 2VISA 3T8XB 5F7UA 4OT1H 3MYJA 1WWCA 3GFUA 4IMKC 4HV8A 1WJ3A 4X99A 5I73B 1MLBB 3G9AB 1H3WM 1TJHH 2JCCA 2VTFA 2IWGA 1WEJL 3TZVD 1QSEB 2JK5B 1S7SA 2PTVA 4WHTB 3RRQA 2WZPD 1Q9OA 4UILL 1KF9B 1BFOA 5K9QG 4APQB 2DJUA 3QUZD 4JFFA 4NO2B 1WBXA 1LO5A 4GT7A 3BD3A 2EDXA 1IAOB 4NRXB 3SDXB 5DD3L 5F3HB 5AEAA 3MV7B 1T20B 4HD9A 5CHNA 5J12C 1K4DB 1U8LB 3ZHLA 4OBRA 2ED7A 3CFEA 2UYLA 3CC5A 3V4UL 2ICES 2QQNL 3ZLQC 2ZG1A 4DGIL 4Y16D 2XACC 1Q94B 5AG8A 1YEIL 1SEBB 4G9FD 4AEHL 4PP2A 1LD9A 4HF5H 3IB4A 4L3EA 3WE6A 4Z7UA 1ACYH 1MCCA 5C0AE 5I6XC 5B22A 1CDJA 2WM0A 5ESAB 4EUPH 2BJMH 5DJYA 2E7MA 5IQ7L 3VFSB 2DTML 4YDVB 4U1MA 3DVNA 3FAXA 4HF5L 1NUNB 3ULUC 2DF3A 2P5ED 2P5WD 4MA7L 4Z0BL 3G5XA 4MB5A 5EZJA 5JW4N 2NY1B 3GSRB 3GBNL 3MJ9A 1JHKL 4LHQB 4OGZA 2DMCA 1FL6B 1JIBA 1J7VR 2EDYA 5EZLA 3T0EC 1UM6H 1PG7L 1GVIA 3DSNA 2AI0H 5F1OB 3ZL4L 4WDIA 2UY6A 4M61A 1IC5H 1UWEH 1KCUL 4EEEA 1QYGH 5ENWA 3TP4A 1RUPH 1QFWM 4P2QA 5DD3H 3QQ4A 1DN2A 3U30C 3O4LE 3OB8A 3GEWB 1XGQA 2ORBL 1UWEL 5HD8D 1VESA 5B38G 4M7KH 1OSZB 3BN9C 3TCLB 1F3DJ 2P5WE 4PJFB 1OAZH 1U3HC 4U6HB 4LLMA 4OGXH 1HSBA 1GGCL 1LO3L 2PO6A 1FNGA 5HGHA 1ZKAA 3TVMB 1RFDH 1P9MC 3DO7A 1TQBB 4MX7A 4X8XA 5F96H 1JP5A 4ELME 4G80B 4OLUL 3KYAA 2HKFH 5DC0A 4F7TA 4WI9A 1NEZA 4QXGH 5FYJL 5BZWA 3NVQA 1KN4L 1KGCE 1OM3H 4NFBA 1J5OH 5BS0E 1LK3H 2IEPA 5IK3A 2P47B 4E0RB 4I0KA 4KQ3H 5HDLA 4MD4B 3KPNB 1E4WH 2CRIA 4BUHA 3LKNB 4I0CC 2ZPKH 1UXWB 4LFHG 5JTWA 2DDQH 3VI4E 3TH3T 5E7BA 3T8XA 2XRAL 1Y0LB 4I18C 2CJUL 2OBGA 4G3YH 2ZSWB 5D7KE 5SWSE 3X17A 4DGVL 2A73B 4OKVB 7FABH 3HZVA 1AXTH 3EJZD 3TYFB 2WLYA 4G6FD 4JAMA 4XNUH 5CUSL 4WW2C 3V4UH 4OBSA 4PJ7F 3MRCB 3LKSB 4ZFFB 5T1DH 1KJ3H 5D7JA 4GFTB 2NR6D 1JGLL 1T7WA 2R23A 4OJFH 3MNZB 1LDSA 2NW3B 4M7LL 1TJIH 3MV9A 4XH2A 4PTTA 4A6YL 3QIBD 2R4SL 4BQBA 3LHPH 4HUKB 3QDAA 3QDJA 5KVDL 3VW3H 1PZ5A 2GYSA 3BWUC 5K9KA 1BBDL 4P46C 1H8SA 5T3XE 1T5WA 5I76A 5I30L 3NH7L 3AS0A 2ITDB 4QHUB 5E6IC 2VXQL 2D2OA 5GGUB 4XCEA 5A43C 2CIIA 3P9LA 1I4FB 3CVIL 1MCHA 4BZYA 1HH9A 1JWUB 3N9GL 2NW3A 1OF2B 3N1GC 5F72S 4D0DA 5F44A 4JZJC 3G6AB 1NPUA 5HHXH 4WI7A 4OCRH 1KXQE 1F11B 4Z78B 3VH8G 3K4DA 2Y5EA 3JWDL 4ZFGH 1MFCH 2PW2B 2BY2A 1DBML 4P5KB 1Z9MA 3H3PH 4FABL 4HHAB 4JJ5A 4XBEL 3OB0H 3D3VA 1AKJB 1U91B 2FRGP 4Z9KB 4PJFE 4PS4L 5I17A 1L7IL 5I1JH 5D96C 4X4XA 1KJ2L 3MLRL 2H6PB 5I71B 4DZ8B 1PLGL 3AVEA 3SGKA 1AD0B 3VD7A 3NIDE 2EXYC 4XMLH 3HC0A 1Q1JL 4EDWL 4BK5A 3MLXH 2PR4L 3NPZB 2IANA 3N1QC 3QNXB 1CLOL 4TRPH 2E3VA 2ATKA 5FOBA 1B0GB 4M00A 3TT1L 3GSOB 4ZDHA 5F89B 1MI5B 1SEQL 1AO7B 4Y5XC 1VFUA 4KUCD 3FQWA 2E9BA 4OZHA 3O4LA 3L3GA 4AENB 3FFDB 4C57C 3CFCL 3IS0X 3RWFA 1S7VA 2V2XB 4JKKA 4LSDA 1MHCA 3SE8H 2I9TA 2UY7A 1I7RB 3KYKH 3OJVC 3H9SE 2N56A 2Q86A 3SDXF 5IOPB 4KZDL 3UDWA 4DZBB 3BGMA 1IGTA 1PD6A 3HUJF 4YDLC 4LPCA 3Q6GH 5D2LB 4Y2DC 4M61B 4HH9B 4MXQC 1JL8A 4YBLC 2BXYA 1KIQA 3MUHL 4QRRE 5ALBH 2NY7H 4X6DB 1MEXL 5C0NC 3UTSB 4H5SB 4YZFF 1UKTA 3RIAF 2OQJB 1HXYB 3RL2B 1KJ2H 4LSUH 1A21A 2XZQH 5FA3B 1X5GA 3AREC 3OZ9H 2ICCA 4HMEA 5IJVB 3BD5A 3HCVB 2BNUA 4HK0B 3EOBA 2F53D 3LQZB 2EE2A 3PL6D 5TDOA 3TFKD 4JKPL 4XCYA 4OFIA 5KOVC 2H2SD 2NXZD 3V5KA 5CZVL 1NSNH 5E2JA 3AMLA 3LCYA 3BE1L 3U46A 3CZJA 2ZWLT 2HRLA 4FQ2H 3KS0J 2F53B 3CFKB 2CMRL 1KLGA 5DZOA 1UADC 3BKMH 1FC2D 4GRLA 1NGXA 3I9GL 4YHOH 4TTDC 2UZIL 4TVPE 5C2UB 2W59A 4X6EA 1I9RL 1ZHNA 4LBEB 1G7IA 3X12A 1OPGH 2HLAA 5E2UL 3RUGF 5GS1C 3HZMB 1JHTB 1FNEB 2QADD 4XVTH 2GSIB 4KK5C 4K8RD 2DQIH 4P2QB 2VR4A 4N90D 1ZT7B 2A2QT 2NXYB 3BPOC 3MV8D 4KVCH 1YMME 3QHFL 1GAFH 1TNMA 3DSFH 1Q1JH 2CGRL 1FNSL 1AGDB 1DEDA 1BMGA 2JIXD 5F1KC 3C8DA 1EEZA 1NCCL 4JLRB 1MLCA 4YXLH 2CUMA 2ZJSH 4NWUH 43C9A 2G2RB 3FB6A 1Z0MA 1RUQH 1NMAL 4I13B 1GAFL 4RZCB 4YUEH 1AH1A 4LSUL 5IB3B 1G6RA 4ZFOL 1BQUA 4FQCL 2A1WH 2BNQA 4JRYA 5C0DB 1WBZA 4AEHH 2PW1A 4ZSOB 4NN5B 2HH0H 3FFCE 4XBGA 3RP1A 3C60C 2W9DL 1FIGL 1RK1A 2XWJA 1ZV5A 1P7QA 2E9IA 2OTPA 1S5HA 1Z0NA 5C6PB 1S9WB 3WSQH 2V5TA 3MR9B 3DX6B 1YECL 1PX4A 1H3UA 4H0HB 2WINB 3KPPB 5J6HA 4F33B 3S3PA 2V7NB 4XCNA 3LH2H 1HYSD 3GO1L 4BFIA 4TUJA 4BH8A 3IDYB 4ESKA 3UYRL 4CVXA 4MJIA 2VNCA 1T6VN 3F58L 3PF2A 4MXWH