4Y2DD

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 57
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD02
1NMAL 1UACL 1J86A 3IB4A 1BX2A 2UUDK 3OAZK 5CGMA 5JXAH 3VU2A 2RCSH 5H35A 3SE8H 1MI5B 3H42H 2K3TA 5HHMD 1L7TL 1YN6A 3H9SE 4GG8B 4JO4H 1II4E 3BZEB 2GW5A 2DQTL 4XNMA 3QUZC 2DWDB 2E27L 5T1LA 2EDKA 3SPVA 1UZ6F 1NLDH 4PLKC 5FO7A 1M71B 1UFUA 3NCYP 2EE9A 4OCNC 5AAWA 4TSAL 1QA9B 4WU5B 3RL2A 2CDGB 2X9XA 5FV1L 4NO2A 2CH8A 1ODAA 2Q76B 4Q6YA 3P4OA 1D5XA 4U1LA 3MGOA 1WGOA 1KN2L 1BAFL 3QQ9C 5DHXB 5AYUH 3T0DA 4F7TB 2XZQL 2P48B 4NN5C 3B6SB 5HGDB 1W8NA 3MXVH 4HT1L 3IDJB 1DSFL 5F89A 2YXMA 3QXDA 2W0FB 4JY6B 1KB5L 2PYEB 3V0WH 4U1KA 3WNNA 4EBQL 5DD6B 3LQAH 3FQTA 1HINL 5T1MA 2SEBB 4F9LC 4LLMA 1I8LC 4LCWE 1BECA 3MRCA 4BFGA 3GSOB 1YECH 1JNLH 3IRZA 3WDIA 2VIRB 5EN2B 1LO3H 5DT1H 4PRHA 4RCAA 1EHLH 1TJHL 3MBXL 4DTGH 1UJ3C 2E7MA 4PJ9C 4F8TA 1HHGB 2AXGB 4CRPA 3BDBA 5CINL 4MD5A 3MRJA 3F7QA 4K7PL 5FYJE 1IGYB 3V6ZA 4QHLB 1KENH 4QRUB 4RRPA 5I66B 5EIIA 3AY4A 2PUQT 3TC9A 3UROR 4OGZA 4RMRA 3MGTB 3V95A 3HAEG 1FNSL 1OAXL 3AC0A 2I5YH 2NY5L 4V1DB 1TPXC 5DWUL 5HI3D 3T4YA 1JGVH 5B3JF 2HRPH 2DOCA 4BSVB 5KSBF 5A16A 2AEQH 3L7FB 3BHBB 3WLWC 3UC0H 2D7TL 3SBWA 3TNNA 5E9DA 3BXNA 1WEJH 4HIHA 4CJ1A 4HUNB 1G9EA 2PW1B 1WFNA 3KPPB 4QGTA 4YIQB 5SWSD 2VXSL 4GUPB 5DRXB 4DGVH 5DS8A 1JYVA 2NZ9C 1MIEH 4NO3A 4U1IB 2X6MA 4S10A 3VGHA 5KJRL 5I8EA 1ZGLM 4N68A 3ROOB 4LCCB 4LSTL 4P2QA 4PJ7B 3VXME 3ZE0F 4NPYA 3MUZ1 3IJSA 5CJOL 5A2JH 4C83A 1VB9A 4S2SB 5D1XD 2BMKA 3A6CH 1ZGLB 2RJMA 1ZA6A 4HS6A 1HN1A 1CICC 1EGJH 2NR6D 5E2JA 4YHNA 4UAOC 4K55A 3EDDA 2ADFL 4HCRH 1KJ2H 5H8DA 4CW1B 4Y4FC 1ZHLB 3LS4H 5A3IC 4XX1G 1ZANL 5H2BB 1SM3H 4MZ2A 1HXMB 2Z8WC 3RDTB 3SGDI 1QSED 4MJ6A 4HKZB 4FMFA 2WIIA 3DXAD 5DMIH 4TPRH 5FUZH 3CFJA 4X6DA 1RVFH 4G8IA 1K85A 1S9XB 5DJDA 3QUKB 2F53A 2C1PA 4Z7OE 2MKWA 4G8GD 1SEBA 5IBUB 5IK3B 3CFIC 2DTMH 5JNYA 2C9AA 3HI5L 4LARL 4DKEL 4HWEH 5D7KE 3VG0H 1MUJB 1OB1A 4FQIL 4QF1A 4XP1H 3NA9H 5JO5B 3ZTNL 7FABH 4ZOAA 3RZCD 3GJFK 4M6OL 5DC0A 4MD0B 4KK9D 1KNOB 3H9SD 1G7HA 1PG7H 2E5EA 1KOAA 4LDEB 3U1SH 5F7HA 2B0SH 3F12B 5JOFA 2DQCH 1KTLB 4Y19D 5FGBA 4M48L 2NY2C 2CRYA 4UU9A 5SV3A 2FEDD 1CFTB 1A4KB 1BJ8A 1KTKE 1JBJA 1MRFL 4WO4B 4JRYA 4YR6A 3SQBA 4HKXA 3QO0B 5I19H 2EH8H 4Z7VE 5IJVA 5GRXG 3K2UL 3N1FC 4PTTA 1JJUA 5GGVL 4JRXB 2KBGA 4X0KB 1KF9B 1OF2B 3KAAA 5CEYB 3TVMB 4Z5RB 4WW2B 3HNVL 3J8F7 1TENA 5INCB 1LEKA 2DKMA 4M7JH 4HWNA 1KJMB 3QUXA 2R29H 1RUPL 4HH8A 2VZSA 2LU7A 4JZJA 4LP5A 4ZOEA 1YMMA 1FIEA 1WZ1H 1HIMH 4P2RA 3BH8B 1FL6A 5FAAA 1B4JL 1FP5A 5EO0B 4NNYB 1U3YA 4F33A 5BV7L 3ZE1E 3TGXA 4AJ0A 1XIWA 3ULUL 5DUML 4YDKH 1ZS8B 1IGFH 4C59B 1ORSA 3WSQH 1CIUA 1MHCB 3RTQC 3LEXA 5IIEA 4LKCA 4BQ8A 5FUOH 2UWEA 1VKXA 4XBPB 2Y25A 5B8CA 2AEPL 5TQ0H 4WEBL 2I60L 4UMGA 3G08B 5C08B 3RY5A 4M1GL 5FYJD 1KCLA 2KPNA 1K2DB 4OI9A 1A7RL 3B3IA 3B9AA 3QIBC 4TSCL 3HPLA 1IT9L 2BY3A 1HHJA 5EZIH 1XZ0A 1T03L 1FNHA 4JE4B 5KSAB 3W9EA 1BFVH 1UH4A 3BDYH 4Q9BA 4PBWD 5JHDB 3LQZB 4K2UH 3WL9B 4RA3A 3VH8B 4OLUH 5FYLH 2CK0L 1DL7H 1QVOA 2OSLA 3CK0L 3MCKB 3LKSA 4XPBH 5FO8B 2EXYD 4HH9A 2X89A 1EHNA 3IU3A 4M3JA 3KJ4B 5ADOL 2V2XA 1INEL 4WWKA 5IFJB 3B83A 3P4NB 3F7VA 3BDXA 4QYOA 3EYQC 3I6LD 3L95A 3BW9B 4PS4H 5C0RL 2A77L 4HC1H 3VXMD 5C0CB 3RWFB 1NFDE 3O6KH 5DJ8B 2XN9A 1Y6MR 5F3HB 2EDNA 5E2WL 5KW9H 3MJ7B 3BAEH 1C7TA 3EGSB 3GI9L 4RFEA 2E9JA 5DJXA 3U4BH 4GXVH 1JIBA 3JWDC 4XCNA 3DIFB 2AK4D 1I1AC 4XVSH 4EN3B 3GK8H 1HILA 4OFKA 3TNMA 4OZIE 3G5YB 4GW5B 4K23L 2A9MH 3U0WL 5A2KH 4B50A 1SJXA 1T0MA 4GXUN 4P2OC 3LKRA 5ID0A 1A9BA 1QNZL 3O6LH 1UB6A 3A6BH 5I1IL 4X6BB 1JWUA 2HT2C 2IFGA 3W11D 1JN6A 2NXYB 4OLXH 2V5SA 5DJ0B 2I9TB 3NZHL 4LPXA 1E28B 3ARUA 1YEEL 1S7WA 4K94H 5I16B 1NBVL 1FN4B 3V4UH 2R8SH 3IFOB 2P44B 4G7YH 3CFDA 3VXPB 3WEXB 2PYFA 4Z9KB 4CVZA 1YNTB 1P7QA 5GGQH 2DM2A 5TH2B 2NY0C 4NRXA 1DBBL 3QA3B 5CZXC 3PL6D 2FR4B 1LK2B 2MKLC 1GCFA 3V4VH 4MB4A 1X5JA 4A6YB 3NFNB 2V2TA 3WXVL 1UQSB 3T3PF 3SHSA 3JVGA 1OSPH 4P57B 4WUUB 5T5NG 5D7KD 4I0KA 4U6XB 5LGHH 3QHTC 4LQFL 2VMFA 4Q0XL 3LIZH 3BKJH 1GJIA 4L8CB 2VRAA 2Q8AL 1HEZB 3WMSA 4GG8A 5IQ9A 2WAHA 3BZEA 3IETB 2DQUL 1A7QL 2DWDA 3MJ8B 3VFNB 3RWIB 5E4IA 4TYUA 1A7NL 3OAYH 3MO1A 5TJWK 4KZEL 3KR3H 3WLBB 3RJQB 2VQTA 4TUOB 4WU5A 2CDGA 1LO2H 1BBDL 1JZ8A 1RHHB 3MRDA 5JW4M 3O9WC 2GTWB 3NCJH 5T1KB 1ZHKA 5I1LB 3U46B 3P3YA 4NUGL 4S11A 1PEZA 4F7TA 4QNPE 3B6SA 2X41A 4Y4HC 1KN4L 5GJSL 3O4OC 4NQCA 5HDQH 3IDJA 4YO0B 1E6OH 3B8SA 3G04B 3ZT7A 4BUHA 4JY6A 5KVFL 2VLKE 2PYEA 3VWJD 5DD6A 3KYAA 1N5AA 4G7VL 4Z7WE 3L1OH 5CS7A 4OD3H 3MMEB 1QBAA 2CR6A 4R96B 4LVNC 4PJXB 2HFFA 1NL0H 3GSOA 5MEQB 5C6TL 2VIRA 5F8RC 3UJTH 4URTB 4Y5XB 2IGFL 5EN2A 2DD8L 1MHPH 3QDMA 5DK0B 4DKFL 4Y4KB 3O2DH 4EOWL 3NTCH 5DDHB 4OGAC 4Q6IC 3RIFF 2AXGA 5D93B 5C8JA 3C08L 4FQ2L 1QP1A 4ONGH 4QRUA 2VSDA 4U1NB 5I66A 4JEGB 1AI1L 1P7KB 1QEWB 1TNNA 3CLEH 1XF2B 2VKWA 4RBPK 4B7IA 4RGMB 2CKNA 3MGTA 1PY4A 4KH2A 4KY1H 5DD1H 3V52H 4V1DA 4FXKB 4JHBA 5IW6B 4BSVA 4L3EB 3L7FA 3BHBA 1EEUA 43C9B 4QRSB 1VACB 3RX5A 4J3SA 1QRNA 5F9WC 4L9LC 1A7OL 5IBLD 3FAWA 4PLNC 5FCSH 2DWEB 2UVEA 3MJ9L 4L3AA 2PW1A 5F44A 4HXAL 3REWB 1R0AL 4YIQA 2DB8A 3OWEA 4XP4H 1CDCA 3WFDH 4U1IA 4ELMF 3O3UN 1XF1A 3ROOA 4PJ8D 4WY7L 4PJ7A 3HZKB 4S0SD 3PWLB 1EH9A 3G5XB 4JGJA 3C5SB 4ZAKC 4UINH 1SJEB 4HAGA 4NO0B 5C09A 4XH2A 4GT7A 5E8DL 2F74B 1ZGLA 2FX8H 3MCG1 1HYRC 3IXTB 5LWYL 3MV8D 5CCKH 2AXHA 3MLVH 3LCYA 3ZT6A 4CW1A 5DC9B 4MMXC 2Z8SA 5IB2B 2PN5A 1ZHLA 1YPZB 1NFIB 2QQKH 4GMSL 3UYOD 5IBTH 3AMKA 1MFCL 5H2BA 3ZYJA 3UXFA 4Y2OA 1DZBA 4JPVL 3L7EB 3MROB 1HXMA 1BOGA 3VRLE 3V8OA 3F6LA 3RDTA 1FYTB 3O8XD 4HKZA 4FFZH 1JTTA 4DVBB 1NGQH 3EDKA 1SEQL 3PWPE 1C5BH 3OHXB 2IG2L 1S9XA 3BP4A 3HE6B 4M6MH 2FHFA 4X98B 3WO4B 1GAFH 4GKNB 3RVWD 3LQMA 3QSKB 4R4FL 1LQSR 3L5XH 3MV11 2CMRL 3BEVB 5LG1A 3WIHL 3NBNA 2CPCA 2NX5E 4YDVB 4MLSA 3P9WB 3MUJA 2MPAL 3LS5L 3AAZB 2ICWI 5JO5A 2A0LC 2DLTA 1T66C 1DBJH 3IVKA 4U6TA 1NSNH 1YY8A 4XXCC 3ARFD 1FAKT 1OTUC 5DRWB 1KNOA 3MRMA 2XOTA 1SBSH 1NPUA 5KANG 4LSUH 1JGEB 3VDCA 3D25A 3F12A 2HT3C 1KTLA 1J0ZA 2AJUH 3LD8C 4JY5H 1LDSA 4HGKC 1CFTA 1A4KA 4YZFF 2DBJA 4X9GA 4LVEA 3TF7C 1KEML 3O0RL 3K4DA 1AD0A 3QO0A 4U31A 5D7JB 3NACL 1T7XA 2K9UA 4P9HL 3AU1B 1MFNA 3UJJL 4HGMA 4J8RA 2QR0B 3JBG7 4M3KB 4Q74A 4JRXA 4X0KA 2A1WL 5I73B 5CEYA 1OF2A 3ARRA 4Z5RA 1WAAF 3TVMA 4NZUL 4WW2A 1ZTXH 5INCA 3BP7B 1T1YB 1KJMA 3P11L 5TDPB 1F3JB 4XTRD 3CVHH 3KLSA 4XVUD 5T5NF 1XGPA 1MQKH 1KCVH 2VLKD 5ALCH 4WI5A 4OSUH 4Z7QF 3BH8A 5CD5D 3DRTB 1MCWW 5EO0A 2DLGA 4NNYA 1P1ZB 5EOCJ 5D7LB 3MACL 2BERA 3GFUA 3ZHLA 4UNVA 4PV8B 4YAQB 4TQEL 1MHCA 4KMQA 4UOW1 4NBYB 5CEZL 5JOPE 4UB0L 5DVMA 4XBPA 4QY8B 2OR9L 4UI2A 5C08A 1U6AL 3ZDXE 4F9PA 2HG5A 5F8QC 4NIKB 1K2DA 1L0QA 4NJ9L 1Z2KA 4BK5A 5EBGA 4DVRL 3H3PH 5L2KA 1MCPL 3MXWL 5KSAA 5E6IC 5I1HL 1PG7W 3RKDC 5JHDA 3LQZA 4PUBL 3KYKL 3ARZA 4FTVE 4R6UA 3WL9A 3VH8A 1RUML 4HS8L 4HBCL 3O3DA 5K33A 2DRUA 3G6DL 3RA7H 3UTSD 5ALBH 5FO9B 1PW3A 5AAMA 2W91A 5FO8A 1J12A 3BE1L 3FO0L 5IFJA 3C5ZC 3P4NA 1D6VL 4GRLD 5LGJB 5CLTA 2ZUYA 3BW9A 2MQ0A 2DQFB 1BLNA 2HH0L 3DYMA 4XC1H 4XWOC 3RWFA 5DJ8A 5E00B 5F96H 2VDPL 3OR7B 3M8OH 3MJ7A 4Y5VA 4ODHL 2NPLX 5DD5L 1S7QB 5BXFB 1RK0B 4RGOL 3MPCA 3HNTL 4P23D 3DIFA 3PDOB 5SX5H 2D4DA 4EN3A 4CGTA 1INQB 1YYML 2HWZH 4GW5A 1FBIL 4OFYA 1Y0LB 1BQHA 1V8HA 1ZHNB 3MX0A 1NC4D 1QSEB 4P3CH 3VGGA 4G6FB 4HEME 4X6BA 3DXAB 4ONFH 3T2NH 4C4KT 5A1AA 4JKPL 1S9KC 4AT6B 1WZMA 1NC2D 2R23B 1V3JA 1GC1H 5DJ0A 2ZUWA 2I9TA 4YBLC 2Y06H 5HYEA 1E28A 2F54E 4TVSa 4YDLC 2ITCA 3QDGE 2N1KA 3QCVL 4WTXA 1UWEH 2H3NB 4LSQH 5GJTH 3IFOA 4WU7B 1CLZL 5CWSB 5HGAA 2EEDA 4U2YA 3VXPA 3WEXA 4CNIB 1YEGH 1YNTA 2XT1B 4D0CB 4RGNE 2YD6A 5TH2A 3RWGB 3NIGF 3QHFH 2VL5B 3TO4A 2NY6D 2FR4A 3L3DB 1LK2A 2D0HA 3ZDZE 1RJLA 2AK1H 4JFPB 4A6YA 3NFNA 1UQSA 1HZHL 1H8OA 3HAEH 3TYGL 4WUUA 4X4ME 2NY5C 4AEFA 3EFDH 4FZEH 2R0LL 1DE4A 3MRNB 5L6YH 3NFPB 4L8CA 4Y19B 1OSZB 1G6RA 2ZSWA 3SDDB 5BS0E 1HEZA 5DJZB 4ODTL 5C0IB 3IETA 1WICA 1HWGB 2WZPD 3MJ8A 3VFNA 4HIIB 3RWIA 1H3WM 3TIDB 2NXZB 3HG1D 4R26L 5GS0D 1H15B 3I3BA 3T3ME 4CBPA 1QHOA 2YZ1A 1U95B 2WIMA 3QH3B 4KJQD 4TUOA 2WWKO 3DHMA 4HAFA 1ADQL 4AH2B 5D2LB 1FZMA 1JHTB 2D9QB 1RHHA 5IFAH 2GTWA 5T1KA 5JPNA 3OJVC 3VFGH 3U46A 5I1LA 4CMHB 2ZOKB 3BPOC 1EUUA 1WTLA 3KXFA 3VGAB 5DO2C 4OZHF 3KS0J 3TH3T 2QQNH 3R4DA 1LEGA 4YO0A 4LHUD 5JUEH 5E2UH 3QEQA 3G04A 3BP6B 1A6WL 4FQLL 2O5ZL 2YA0A 5TF0A 1I9JL 3I84A 3D0LB 1NCUA 2JCCE 5E1AB 2DDQL 1CDBA 2Q7YB 5CIPA 5HVWA 1FO0H 1RZ7L 1P2CB 2X1PA 2D2OA 3MMEA 4R96A 3HNSL 5IOPB 4PJXA 3TBTB 3VFPB 4BFBD 6FABL 4BYHA 5MEQA 1XT5A 4Y5XA 1K4DB 5JOPD 2FZ3B 1U8JA 4KK5D 5DK0A 2I26N 4YJZL 2X40A 5DQDL 4A6YL 3GMRB 3MLZL 3B2VH 1T2QH 4U1NA 4WI9A 1M7XA 1QEWA 5GRYA 1XF2A 1UM5H 1P6FA 3WHE0 4PRDB 1MEXL 4LASL 3P9MA 3LHPL 1MLCB 2ITDB 3OAUH 4FXKA 3SBWC 4ZS6C 2ZPKL 1G6RL 4FTVD 1B90A 4PB9L 4L3EA 4PJBB 3MLYH 2H2PC 3BRGC 5KS9F 4YNYB 43C9A 4QRSA 1VACA 5SWZE 1NCBL 4LEXL 4AK1A 1MCEA 3IJHB 4MMZC 4OJFH 4FQJL 3MV7E 2DWEA 5A40E 2HT4D 4ZO8A 3A6OA 5I6XB 1N6UA 3H6JA 5I8KH 2V17H 5IJKA 3QB7C 3LSOA 3LVEA 3NGBB 3VXOB 1EEZB 2HMID 1NBZB 3SDAD 3HZKA 3D9AL 3EDFA 1DQLL 1CFVL 2LAAA 1IBGL 3PWLA 2NW3B 2AK4B 3G5XA 3HFML 4FQQA 3C5SA 3TIEB 5I1EL 4QHNB 5K9JL 4A2MA 3C09B 4XPTL 2C3GA 2F74A 2W60B 3J7HA 4KJPC 3MFFB 4H0IA 4HUKB 2IC2A 4GJTB 3IFLH 1S8DB 1Z3GH 4FFWD 3ZSSA 3K46A 4XBEH 5BV7C 1UWGH 1YPZA 4XP6H 1C5CH 5DSCB 4P2CG 4XPFH 1DVFD 3L7EA 2Y23A 3MROA 3ULUC 2AI0H 5EZJA 1CQYA 3ZYIA 4GAYB 3FOLB 1DEEB 2XQBL 1FYTA 5CJXC 3QDGD 2AKRB 4DVBA 1PQZB 3PGFL 3PL6B 1X5GA 3RWJB 5DTFA 2DBLL 2VC2L 5LAXA 4OFIA 4L8BB 4X98A 3ZE0E 1H9VA 1SY6A 4DN3H 2RHEA 5FKPB 1Z9MA 1U3HB 4JO2H 2G9HB 4HFUL 1NEZG 4J3OC 1PYWB 4JREB 4ZS7H 5JW4Q 5HHXH 3Q5OA 1LP9A 2VNCA 3UAJD 3BEVA 4DGIH 4KUCD 1T5WB 1GGTA 5IFHL 4YDVA 2AVGA 5C0DB 1CI5A 4IHOB 3AAZA 2Z35B 5EA0L 4M7LT 3CX5J 3BMWA 3S4SA 5F7FA 1IJ9A 1UM6H 3OKKB 4TN9A 1CLOL 1JGEA 1IGCH 5J1AB 4O4YH 1URLA 1V7ML 5GGSY 4PGDB 1PFCA 3X17A 4FQHB 1WWBX 1IC5H 3E6HB 4X99B 1OCWL 5JQ6L 3PP4L 4GRMA 4KROD 4NZJA 5D7JA 1F2XK 4PJDE 4CADB 1SJHB 1ULVA 3AU1A 4CMMA 4QHMB 5GISL 5FECB 2QR0A 4GLRH 1NMAH 1UACH 2JB5L 5D96B 2H6PB 3VCLB 2DLFL 4K3JL 1FH5L 3D85B 4LLQA 3BP7A 4WI8A 5GRJL 4PGJA 1X4YA 5TDPA 3C6LD 1CTNA 4Y0GA 1XGYL 1YQVL 3VA6A 3ARQA 3ZZ1A 3U0TB 3QUYC 2WLYA 2E27H 3UEZA 2W9LA 3HC3L 2QHLA 3HUJA 3I2CL 4KKCC 5CGYC 3OBAA 5BVJB 3NIDE 3HTLX 3TN0D 4XP9L 4PV8A 4YAQA 1VESA 2OX5A 2XTJD 3C5JB 5E56A 4LP4A 1BQUA 3QT2A 2X4PB 4CJ0A 4ZQKA 4QY8A 1KN2H 1BAFH 2XZQH 3QDJD 1V3KA 3EIFA 5F1SA 3WUWB 4HT1H 5IROA 1HYSD 2BY0A 4OCRL 1KB5H 1VENA 4EBQH 1NANI 2ADGB 4NT6B 2J4WL 3F7RA 5H94B 3U83A 1P4BL 4KQ4L 1YNKH 5IHZB 3HMWL 3ALXA 4X6CF 1LGVA 4WWKC 5SWZD 1RI8A 4H5SB 4LFHG 5GSRA 25C8L 3H2WA 4OKDA 5C70A 3MV7D 4OIIL 2CDEB 4BK4A 4HEPG 3T2OA 3QG7H 1TJHH 3MBXH 5BZWB 3B9VA 3LV3A 5LGJA 3BKYL 2ZUQB 5CINH 4K7PH 1EV2E 2DQFA 3PWNB 4XAKE 5D1XA 2WV3A 3L9RB 4PJAF 4S1QL 5DD3L 4KJYB 3OR7A 3FB8A 3DETD 3D0VB 4JFDD 5ETUB 3FFCE 1FNSH 3MV8B 2DAVA 1MAML 1S7QA 2QTEA 1OAXH 5BXFA 1RK0A 5DWUH 3HR5B 4YXHL 1NCAH 3PDOA 4DUVA 3T1WA 1CT8B 3UTZB 1VGKB 2D7TH 1JK8B 4ZMAT 3LZFL 1IEBB 4LPUA 4M1CD 3S36X 3TWCL 1ZHNA 4FZ8H 1QSEA 2VXSH 3DXAA 1DN2A 4HLJA 1XH3B 3BPCA 3O41B 4BZ1H 2NY4D 1U8LB 3GJEB 3SKUD 5FYKU 5KJRH 2WM0A 4NNPL 2J1KA 3C87A 3I6KB 2EC8A 4LSTH 3S88L 2H3NA 1F3DH 4RQQA 4K8RC 4YHKH 4G8GA 3JV5A 3BZ4A 1V3LA 3B5HA 5GGSB 4CNIA 4GQPH 3S5LG 4D0CA 4AENB 3O4LB 5L0QB 2VL5A 3L3DA 4JO1L 1F4WL 3JVGC 1WBYB 3W0WD 4JFPA 2DN7A 5IVXF 4JB9L 2P5EB 5EU4B 5JDJA 3DUHA 2D7NA 4WV1A 1BQHG 5JA9A 5EUOB 1EA9C 4QWWC 2AXFB 2IH3B 3MRNA 4WI4A 3NFPA 3AFLA 1RZIB 4HWUA 5F9OL 2R1WB 4LAJH 4Y19A 5CSGA 1OSZA 3X14A 3SDDA 2YHGA 2GSGA 5DJZA 1DQML 1B4RA 3P40A 1MCOL 5C0IA 1K6QH 5FYKH 4ZNCD 3CMOL 4HIIA 3VGFA 5ESQB 3TIDA 2AS5M 1OWRM 3MZGB 4RSVA 3BGAA 1T04B 1Q1JH 5ILTL 1H15A 1FVCB 5EU7E 1N5YL 2ARJB 1CFBA 1A3LL 2DQEH 1TZIB 1U95A 3S96B 4GFTB 3SDXF 3LRGA 3V6OA 1SVCP 5D2LA 4K07A 1F58L 1JHTA 5GRUL 5DZNA 3O6FC 1RIVL 3HI5H 3BN9C 4N9OB 4LARH 4DKEH 4LVHB 1Q9WB 1YEKH 2XY1A 1UCBL 5GRWA 1HSBA 3OKMB 1N7ML 4FQIH 4L8DB 1NLBH 3ZTNH 4QTHB 4M6OH 4IRSD 1HWHB 2EC9U 2V7NB 3G6JB 1CG9B 3ETBF 1EAPB 5IW1B 5DFVD 3ALPA 3DROB 4KTDL 5BW7A 5E1AA 2ID5A 4XMLH 2Q7YA 4DZBB 2VDKL 5K9OB 1J0YA 1JVKA 1P2CA 1S5IL 5DLML 1MRFH 5IOPA 3MLSL 3TBTA 4F15C 1XR8B 4KK6D 1PZUB 1F8TL 2GYSA 3L5IA 3QCTL 1MCLA 1IRAY 4KDWA 1KCRL 1EZVY 1K4DA 4YK4B 5GGVH 1IMHC 4ZUUB 1EMTL 2FZ3A 1B0WA 3HNVH 3D39E 2AAVA 5DD0L 1OTTC 1RUPH 3GMRA 1BD2D 6CGTA 3FJTA 3S6CA 3MUY1 1G9NL 4KXZH 2BNUB 1P4IL 2X4SA 3C60D 4M7LH 4NZRL 3MNVA 4ZO6A 5IGXL 1B4JH 1INDL 1MLCA 2ITDA 1X5HA 1ND0B 2C3WA 2HAZA 1M6OB 3SGEI 2AQ1A 3KLAB 4JCLA 4PJBA 1GGCH 4K3GA 5J6GB 4YNYA 1RUAL 2VSCA 5TQ2L 2Z91B 1PZ5B 5DUMH 4YHZL 3CSYB 3IJHA 1I7UB 4MNQB 4GRLB 1GSMA 1OP3K 3CX5K 4NYLB 5HVFB 4TVPE 3IT8D 3N1MC 4KI5F 1JNHB 4OLVH 2AEPH 2GCYB 4WUKH 4LCCC 4X5WB 2I60H 2X1QA 4P9HC 3QPXL 5FHBL 2HKFL 2NW2B 4XAKD 4YHYB 3QXVA 3VXOA 1NBZA 1A7RH 4ZNEE 4P23B 5ESAA 5L9DL 1IT9H 2AK4A 5GZNC 3K8LA 3TIEA 2P46B 1T03H 4QHNA 4GSDL 1S7SA 5HI5C 1P9MC 3ARGD 2W60A 2QJDA 3NVQA 4NHUB 3LKNB 1KJ2B 5I8CA 5EG6C 4UV7L 2E7CA 3IGAB 1U8MB 2C26A 2CK0H 4X83A 3CK0H 2XICA 4NRYB 4OT1L 1E4WL 5ADOH 4ZUSB 3SJVB 1INEH 5D5MB 1KPVA 3HRZA 5DSCA 3T2QA 1KCSL 2L0DA 4GAYA 3FOLA 4KK8C 1DEEA 1ZLUK 5ISZE 3WXWL 3MFGB 2A77H 1HKLL 2AKRA 1PQZA 1FNGB 2NY6B 3PL6A 3RWJA 2NLJA 4KUZL 3TH4T 2YXFA 4MJID 4QXTB 5F21B 4OBSA 5FKPA 3QIUD 1NMBL 1U3HA 1YYLH 3EUUA 2G9HA 4CAGA 1PYWA 2CGRL 1OP9A 3U2SB 1CE6B 1T5WA 3D3VB 4MGXA 4K23H 3U0WH 2ZG3A 4QO1A 4P0DA 4YGAB 4M4PA 1ZGLP 4IHOA 1Q38A 3WNOA 4Y16D 1I3RA 1QNZH 5FGSA 4NWTL 2Z35A 4ISVB 5I1IH 4Z77B 5EWIH 2O5YH 1ZOXA 3HB3D 3OKKA 1LMKA 4NRZB 1NCNA 5C3LD 2PO6B 1BQLL 1YEEH 3HG1B 5J1AA 2UZIH 1NBVH 5ANME 3CFCH 4WO4C 5DK2A 4PGDA 2OI9B 1OAUL 2AEIT 4Z7VA 4FQHA 1MIML 3E6HA 4X99A 1DBBH 5HYJB 3EKCA 1MFEL 5BQ7B 4ZTPL 2V7HB 3TVMC 3RVVD 1SJHA 4CADA 4LCIL 4NOBA 5FECA 1PKQB 3I75B 3GZKA 2H6PA 3VCLA 3KPSB 4LHUB 3D85A 3BT2L 4LQFH 4Q0XH 1KLFA 2E7HA 3F8UB 3VWJA 2EDBA 3S4SG 2Q8AH 3IXAB 2VLME 4GBXB 4AZ8A 1IGML 1LE5B 3U0TA 5C0BE 3BGFB 1S7XB 2IANB 2AV7B 2DQUH 1A7QH 5M94B 3DGCR 4HQQL 5GS2H 2GQHA 3CSBA 3QZWA 2CLRB 2CLVA 2BVTA 1A7NH 2R4SL 4YEEA 3RGVD 3ZKND 4KZEH 1DQDL 5MEPB 1NEUA 4AMKL 2I9LB 2VR4A 4P4KD 1NUNB 2HTLD 2GUOB 1YN7A 3SY0A 1I9RH 3WFCL 1BBDH 3GDBA 1MCDA 2ESVD 3C5JA 3HI6L 2F19L 4QHKJ 1KIUA 3BYYA 3QULB 5DR5L 2X4PA 3JXAA 1UH3A 1TTFA 4F9PC 1JPGB 3HS0B 5MHSD 2X4OB 4NUGH 1QFPA 3CU1A 4WFHE 1YEJL 3PP3K 5GJSH 1E4XL 3WUWA 2VZVA 2F5AH 4Z18A 3GIZL 5EC2A 2YN5A 1F90L 3DECA 5D6DC 5KSAC 4PJEE 3E3QC 5KVFH 3MRIB 1JMZA 4NT6A 1TIUA 3NH7L 4J3XA 1E4KC 1X5LA 4X4YA 5H94A 5T33L 5KVEL 4G3YL 4G7VH 5JW3L 2NTSP 5IHZA 3CFKB 2ERJC 4ZSOB 3HLAB 4PJHB 1WZLA 3KJ4C 1KLUA 4H5SA 3IDIB 4EDXA 3VI3F 1G9MC 4ZUVB 5C6TH 3TV3L 1NCTA 1G7LB 5DMGD 4GG6F 4M5ZL 4EI5D 5FKAB 4ZUTB 3X3GL 4DKFH 5IMMB 1JGUH 1NFDA 3REVB 4EOWH 3KPRD 3TLRA 4PJCF 2A83B 4RAUB 4N90D 5JIPA 3C08H 3SE4A 4FQ2H 3PWNA 4IDJL 1AI1H 3L9RA 3U79A 3TA3C 5EIVA 4HULB 3VWKD 4LLYA 5ETUA 4EN3C 2Y1VA 3MV8A 4KV5F 1J10A 3HR5A 3UTZA 1VGKA 1JK8A 1IFHL 1DVFB 3BPLB 1IEBA 1A7OH 3V6BR 3MC0A 3MJ9H 3U82B 2NXYC 3CX2A 2LVEA 1FV1B 3MLRL 1WFTA 4HXAH 1R0AH 2D31B 5M7QA 4PJIF 3RUGF 1XH3A 1RFDL 3ARBD 5I18L 5IKCB 2W0PA 3O41A 1WV7T 4M6AA 1U8LA 1S3KL 4HPOH 3EFFB 4WY7H 1S9VB 4U3HA 4POUB 1WCBB 3DMMB 2YD8A 4W4NA 5D7IF 2BRRL 3OKDA 1G7MB 2HYMA 4AENA 3O4LA 1WBXB 3HZYB 2JJVA 3K80A 2JE8A 1WBYA 4K3EL 2Z9TA 1NGZB 2WBKA 4H20H 4JM2D 5LWYH 2D7QA 5C9KA 2P5EA 4ODSH 5EU4A 4OZFB 1QTYT 3ARFA 1IM9B 5EUOA 5F6IB 4MNQE 4R97B 3ULVE 3MBED 4FQCL 2AXFA 2IH3A 1RZIA 4JPVH 3GMQB 2R1WA 1Q9KA 4JY4B 4M7KL 5DHVH 4I3GA 2CUMA 1U58B 3MA7B 4NQUA 3TPUB 5HYSG 1SEQH 2A6JB 2CR3A 4EEEA 5IB3B 4KROB 4P5TC 5F6HJ 5ESQA 3GMMB 2BK8A 1T04A 1FVCA 1UG9A 3VW3H 2ARJA 4R4FH 4RAHA 5DI8B 3S96A 1C08B 3V0VB 3NIGE 3WIHH 1Z9LA 5K9QG 3V5KA 2MMXA 4YWGL 4P3WA 1Q9WA 3W82A 2MPAH 3LS5H 3OKMA 2VYRE 4L8DA 1N26A 4QTHA 3OMZA 4Z7UF 1RZKC 1TFHA 2Y5TB 3G6JA 4OQTA 5BRZE 1CG9A 2VLMD 1MRDL 3BSZL 3UPAA 4MJ4A 3QUML 1EAPA 5C0BD 5IW1A 2H45A 3K1KC 1BGXL 1F2QA 4JN1L 3TN0B 2G2RB 3MZTA 4F58H 1T5XB 4G6ML 4MNGE 5E94B 4DZBA 3ZE2E 4JGMA 5JHLL 4QRTB 5IMOB 2XTJB 2PXYB 1KEMH 4QXGL 3O0RH 5BZDB 5FOBB 2D0FA 3NACH 4L29B 5FUCC 3OKEB 4Y4KC 4HWZB 3R8QA 3UJJH 1CXIA 4ZUUA 4F7PB 2A1WH 4QTIH 4HHAB 5F1KC 2P8PB 5IESH 3D3VE 4E5XA 1SJVA 2W9EH 3P11H 3SCMD 2J5LB 4RGNC 4RGMC 3ULSB 2R69L 3RWDB 3IDXL 2BNUA 3TM6A 2X7LA 1ZSDB 5CZVL 2RCSL 2D7OA 1Y6NR 5MI0B 1XF5A 1I85C 1ND0A 4JDTL 1IZJA 1M6OA 3QWOB 3MACH 3UTSA 4M43L 2ICEA 2VDNL 3BH9B 4ZXBB 4KRPD 4QOKD 5J6GA 4IBLT 4JPIA 5DGQA 1T2XA 2UY6A 2Z91A 1PZ5A 2J8UE 3CSYA 4AL8L 1N6QL 1I7UA 4TQEH 1QLFB 3HN3A 4GRLA 5TE6L 4U4BA 4F57L 1PGRB 5CEZH 1CIDA 3P4LA 4UB0H 1RZFL 3NPSB 4KKLC 1Z5LB 3THML 1JNHA 5CKGA 5B39B 5F7MC 3AM8A 1C5DB 2DJSA 2OR9H 1DCLA 4I2XB 4S0TD 4X5WA 5GGRB 5J06A 4ODBD 1OM3L 3QJHB 1U6AH 2NW2A 5L88L 4NJAL 1YEDB 1A6ZB 1UWXK 3MRQB 4NJ9H 5IEKB 2B39A 2Q86B 4P23A 5J1TC 4PY8I 4DK6A 5E03A 4DVRH 2P24A 3MXVL 1WWWX 1MCPH 3MV9B 3MXWH 1EGJA 2YK1H 1OGAE 5KSBB 4OQTL 1T21B 5I1HH 5JXEC 4PUBH 3KYKH 4NHUA 3UTQB 5BCAA 1KJ2A 2Y6SC 5I1AB 1RUMH 4HBCH 4NFBA 2EYTA 1U8MA 4G80B 3G6DH 5ICYB 1I1YB 3T65B 5J11C 2NMSA 3L3HB 4NRYA 3BE1H 2HVKB 4ZUSA 2W07A 5E8OB 5D5MA 3FO0H 4L4TE 3E6FB 3LH2L 4MAYB 4TTDD 1D6VH 2PF6A 2A2QT 2VITB 5C92A 2ZZUT 1U9KA 2Y5EA 4U1HB 2EDXA 3HE6C 2HH0H 3WO4C 3OKNB 1RZJL 1FNGA 1T2JA 2VDPH 3FT2B 3W0WB 1KJ3L 2CRMA 2EIBA 2CJUH 2G60L 5DD5H 4ODHH 4ZUWB 4QXTA 3GMPB 5AD0A 2BSTB 4RGOH 2D4FA 3HNTH 3L5WB 4M5YL 3C8KA 3OXSA 4IRZL 3RGHA 3TCXA 5HDBE 5F88B 1YYMH 3U2SA 1CE6A 4G9DB 1XGTB 3VFWB 1FBIH 4ZSOE 2WBJD 3B9KB 1JGVL 1OPGL 4AEEA 5JDSB 2D3VA 2MCPH 3UC0L 3ULVD 3K81A 4NGHL 2R1XB 4Z77A 2N4IA 1ZVHA 2P5WD 1PSKL 3BFOA 4JKPH 4N0RA 2MJWA 1NAKH 4E0RB 3MRRB 2PO6A 1ZA3B 3ECBB 3HG1A 3ZO0A 2OM5A 3MREB 5E70A 4Y2DC 2LU4A 2NY1D 3C8HA 1J0HA 3PQYE 4U0RB 1BP3B 8CGTA 5D6CA 3OB0K 2OL3A 2P43B 5D7JC 3MR9B 3STZB 2WWMD 1CWVA 2IPTH 2JIXD 5HYJA 2R39A 1HCFX 5I73C 5BQ7A 2V7HA 5C07B 2J8OA 2WSKA 3LPFA 4R4NC 2CXKA 1HZHH 1PKQA 3GB7B 4AY0A 5IP4A 1F42A 2BNQE 3HZMB 3CDFA 1Z6JT 5I30L 3KPSA 4LHUA 4JAMB 4F37K 4FABH 3CVHB 2QADB 1QACA 2R0LH 4WW1B 3WJJA 3MRKA 1AHWA 3QCUL 5BRZD 3UYRL 3IXAA 1CBVL 3IKKA 4GBXA 1LE5A 1VDGA 1SM3L 5D9SB 1S7XA 2AV7A 4AYFA 4OQ1A 2CLRA 4OLYL 4R26H 3GMOB 3R06A 5DMIL 4AG4L 5MEPA 2I9LA 3NAAH 4DOHB 4PRPE 1ADQH 1U8PB 1JYWA 1ZLWK 4ORGB 3Q0HA 3QULA 1WF5A 2QSCL 1N4XL 1JPGA 3HS0A 3VFRA 2X4OA 5IROC 3KPMB 3LPWA 3C60B 4HWEL 3VG0L 3WS6A 3IU4H 1A6WH 3NA9L 4XP1L 4FQLH 2EE2A 2O5ZH 4FTVA 1I9JH 1IAII 4OIBA 4G8FB 2WINB 3PHSA 3CJJA 2DDQH 5T3XE 4YE4L 4PJFE 3QZWG 1RZ7H 4LSPL 3CFKA 4ETYA 3HNSH 4R3SB 3HLAA 4PJHA 1NGWA 4B0MM 5GS0L 5HBBA 3IDIA 4XPHL 4ZUVA 1TMCB 3TESA 1G7LA 2KL6A 2OL3L 4ZUTA 5I1GH 3MNWB 4BZYA 2C5DC 4ONHA 3REVA 5I19L 3TBVB 3QI9C 4OZGA 4XPAL 4HC1A 2A83A 4RAUA 3AREB 4TNVK 2R2BA 3VXRB 2ATPB 1KG0A 2BRQA 3ARGB 1R3LB 3MGAA 3R1GH 4HZLB 2R29L 1MEXH 3NIFE 2G75A 4LASH 3QP3A 3PGDB 4NKOB 5E2VL 5DURB 1DLHA 2P4AB 4NC0B 1YZZA 2X5PA 3EO0B 3X3FL 1MCRA 1WZ1L 2ZPKH 1G6RH 4AIZB 1T7ZA 4ZPTB 4PB9H 5DA4A 5FV2A 5IF0B 4MQTB 1DVFA 3SN6N 1NCBH 4LEXH 4U7MA 2YA2A 5F9AC 4CN1A 4FQJH 1P69B 4YBHA 3RKPA 4I3SL 2IJ0C 2ZNXA 3LN5B 1PBYA 5DJ2B 4ZFZB 5D72L 2D31A 4L4TD 5EC1B 3BWAB 3WSQL 3RPKA 2HTKD 4P4RB 4LSVL 3EFFA 1NGXB 1EJOL 5TQ0L 3D9AH 1CFVH 1IBGH 1WCBA 5LGKA 3HFMH 1ZHBB 2J7LA 1CL7L 1CLCA 4NN6B 5I1EH 1G7MA 5K9JH 5KOMC 4CVUA 1WBXA 4XPTH 3HZYA 2UZYB 3LKPB 1CD1B 5FXCH 1NGZA 3T0ED 3HAEB 3TT1L 1CD9B 4Y16B 1U42A 1BFVL 4OZFA 4J7RA 5C0AB 3BDYL 2BNRE 4XGZB 5J1SC 3X12B 4HLZG 5CIPH 5GQBA 3EJZC 1QQDB 3SDDC 2QEJA 1B6DA 1A1NB 1AGBA 5FYLL 2EDLA 5HHPB 3GMQA 5AUMA 4HKJB 1QPXA 4JY4A 3BZFB 2XQBH 5J89A 2LQRA 3QRGL 4I2XE 1IKNC 2NXZC 3TPUA 1U8HB 1VHPA 2A6JA 2Z31D 3PGFH 4MWFB 4L9DA 4HPYH 3DUUA 5IB3A 4H88L 1RUQL 2GTZB 2DBLH 2VC2H 4WI3A 1F5WA 3V6OC 3GMMA 4LIQL 4Y7MA 1X5AA 1MJ8L 1GGIL 4HFUH 5DI8A 4GW4B 3MV9E 1C08A 3V0VA 3TBWB 5F1OB 5ICZB 4CMHC 2BNQD 1KIRB 1U3ZA 1G6VK 3VGAC 3AROA 1JF5A 3GSUA 4XVSL 3QUZD 4M6NL 5EA0H 2NY3C 4NKIL 2Y5TA 1F97A 2VUOA 2GJ6E 5E8PB 4UDTB 4PLKD 5BW7C 4PGEB 3RGVB 2CO7B 1V7MH 1JZ7A 3QXTA 1EFXD 3UZVB 1T7WA 3TN0A 2G2RA 4G9FE 1T5XA 4BZ2H 5E94A 2DYPD 3MRBB 2ESVB 5IMOA 5JW4R 2PXYA 1OCWH 5JQ6H 3V4UL 4Z7OF 1XGUA 5FOBA 3PP4H 3QQ9D 4J6RL 3W5MA 1QFWM 3GMLB 3VJ6B 5GISH 3QDJA 4GKOA 2HP4A 5D2NB 2BFVH 2JB5H 3DGGB 2DLFH 5D7SH 2E8YA 4BQ9A 3MRPB 1FH5H 4ELKA 1FJ1B 2VQ1B 3PWVA 5GRJH 4HK3J 3N9GL 2BVEA 2W0LA 4BSWB 4XVTH 1OSPL 5CKAA 3ULSA 1RPQA 3RWDA 1G7IB 5EO1B 1XGYH 1YQVH 3D69B 2EDOA 1I9IL 1TVBB 1ZSDA 2DKUA 1F00I 3SDCB 2E8ZA 3CFEB 3L3OB 5SWZA 5T3XD 3RIAK 5KZCB 3HC3H 3QWOA 1ZE3C 4P5MA 3RX7A 2FSEA 3MV7A 3I2CH 4WHDA 4XI5C 1JNNH 1A6AB 3BH9A 4N1EA 4G8EA 1MFDH 5CILH 4DZ8B 2BP3A 4EI5B 4PJ9D 3GBLA 4XP9H 4I18C 4PFEA 4ZPVB 1TVHA 1QLFA 3KPRB 5C0GB 1EBPA 2YKLH 3GNMH 1KSRA 3PJSB 5EU5B 3KJ6L 1ACYL 4PR5B 4U33A 4MYWB 5I8OL 1Z5LA 3CAFA 4P5KB 2PTVA 5B39A 3UBXG 1FVDB 2H32H 3FKUS 4Z0BL 5GGRA 3MRLB 5DXWA 3QJHA 4JFDA 1EFQA 5EU7C 1YEDA 4KTYA 4LMQI 1A6ZA 4OCRH 3S35X 2Q86A 3BUTA 3WLWD 4BJLA 3WIFB 4R7DB 5F1IB 1CFQB 3DUSB 4FXGB 3HC4L 5HDQL 2J4WH 1E6OL 2EYRB 3SKNB 1P4BH 4KQ4H 5KSBA 2FLBT 1T21A 3UTQA 2C4FU 3TJHC 3ZE1F 2H26B 2NZ9D 3T65A 25C8H 2E6QA 4OD3L 4OIIH 1JNJA 2HVKA 5E8OA 5IQ7L 1YNLH 2P7TB 3WCYA 4PJGE 4MAYA 2RAMA 3UJTL 2VXQL 4NKQB 4ELMB 2VITA 1U2HA 4JPKL 4KFZC 4U1HA 3NTCL 3OKNA 1CICD 1BFSA 4NQDD 4S1QH 5DD3H 1U3HC 3CPLA 4WTZA 3T77B 3W0WA 5EULV 4XMPL 4HX1B 2R9HC 4ZUWA 4Y4FD 1MAMH 2BSTA 5DMKB 5JQHC 3CLEL 5A3ID 5EIQA 4YXHH 3L3KA 1U3JA 1KPUA 2ICES 3AS1A 4KWUA 1OAQL 4FQXC 5F88A 5DUBB 3EHBC 4G9DA 1KC5L 1XGTA 1ZT4B 1X4XA 3MBEB 3KPNB 1W0VA 2XYCA 3LZFH 3VFWA 3OSKA 3VFSB 3TWCH 5JDSA 4D9RD 1BPVA 4AQ1B 5EU6B 1ES0B 4YX2H 1MJ7L 2R1XA 4S1RL 3VRJA 3QAZB 4OFDA 1RZGB 1VA9A 4LHJB 1KCUL 4D9LL 3F6IA 2WWKT 3MRRA 1ZA3A 4Z78B 3ECBA 2CO6B 2I27N 4NNPH 3STBA 3S88H 2APTA 3H9HB 3OG4B 3DWTA 3MR9A 3STZA 1N59B 3BEWA 4KMLB 3EOAA 1KXQE 1ITCA 4F3FB 4JO1H 1F4WH 2YPKB 1DQQA 4JFEB 4JZNB 5SX4H 3B5GA 4JR9L 3FOMA 5D96C 3IDNB 1QSVA 3OPZL 4JB9H 4UIKH 1RJCA 4BUGA 5JZ7C 3HZMA 4OZIF 1N8ZA 4IDLA 4JAMA 3CVHA 4WW1A 2NY2D 2GJ6D 5F9OH 3ABZA 1Q0YL 2W1NA 1DQMH 2Q1EA 2QQKL 1MCOH 5D9SA 1QSFE 1QO3B 4G9FD 4TUJB 3CMOH 1AP2B 1AJ7L 5ILTH 1A3LH 1D5ZB 1W72A 3BQUD 4ZFGL 1U8PA 5HHOE 1F58H 5GRUH 1VCAA 4U49A 2D0GA 1BD2A 5ID1A 3TBSB 1LO0H 2GI7A 1N7MH 3FCTB 1BJ1H 3C60A 5HY9B 2B8OT 1CU4L 1KB5B 3WN5B 1B0RB 1A9EB 2VABA 4NWUL 5MENE 1JWSA 1RIUL 2AXJA 3DLQR 2WBWB 3QXAB 4K3DL 2IADB 4QOKB 4G8FA 4KTDH 4UNUA 3RVTC 2WINA 2XWBB 3CZFB 3RTQD 3BWUC 2VDKH 1S5IH 4HFWB 5DLMH 4I8DA 3VD7A 4R3SA 3MLSH 4YHIB 4P46B 2ZOLA 3KYOB 2FECL 2EE6A 4IMKA 3RP1A 3OAYK 4BQBA 1KCRH 4M1DL 1F11B 5E4EB 5LCVL 1UXWB 1S9YB 1OAZL 1EMTH 4R8WH 3QIBD 3MNWA 1ZVYA 4RDQF 3SE4C 3VXUD 3CXHK 3TBVA 1MCKA 1U92B 5DD0H 1ZLSL 3Q5YA 4QNPF 3OG6B 3VXRA 4MNHB 1QR1B 1EO7A 4D2NA 3DX6A 5FHAL 3KLHC 1G9NH 3QBTB 1BX2B 3ARGA 2K1MA 1Q9OB 3T08A 1R3LA 3ARTA 1P4IH 2Z8VC 4HZLA 1RZ8B 4NZRH 3PGDA 2FH8A 1INDH 3PHOB 3EO0A 1KCVL 4XP5H 4OSUL 4XRCB 4J1UB 5T3ZD 2V2WB 5HI4C 2EYSA 1EJ6A 3LDBC 3EYQD 1UVQB 4GRWH 2YPLE 5T1LB 5TQ2H 3SPVB 1JRHL 4YHZH 2HJLA 4I0PB 1F4YL 3JV6B 5FO7B 5TFSL 4D94A 2C7UB 4JDZB 2VLRD 3LN5A 4ZFZA 3D87B 4Y1AE 5EC1A 3VI3E 3BWAA 1XGQB 5F9JB 1W72L 2Z93B 1XMWA 4NQEE 4NO2B 3QPXH 1XCTB 4D9QE 5FHBH 1Q94B 3SKJH 2HKFH 3EO1A 3P4OB 5FYJU 3W39B 4MJIA 1NGXA 5FA4B 4PJCE 3QIUA 1I1AD 5L0QC 5L9DH 3RVUC 3LEVL 4M93B 2JELL 1ZHBA 4XPGL 1T1WA 4HZAA 4N0UB 2YC1B 4LNVA 4P2OD 2DL2A 2WBJB 2OJZL 3RWCB 3IDYB 3GSVB 4O00A 2ZUUA 4LRIA 3LKPA 3HAEA 5SV4A 3LN4B 1H3GA 2VXVL 2HT2D 4KV5E 4Y16A 4UV7H 3KPQB 2DM7A 3MUHL 3GRWH 3P9LB 5C0AA 2HA1A 4M7ZB 4XGZA 2FIRT 2P5WB 4OT1H 3X12A 4U1GB 4LLDB 1RQ5A 1QQDA 2VZ3A 1KULA 3LB6C 1A1NA 5HHPA 1BFTA 2VXUH 5DJ6B 1KCSH 5J0BA 4W70A 2NYYC 4KVNL 2NY0D 3WXWH 1NGPL 5CZXD 4PJIE 1HKLH 2E7LC 1HNGA 5FYJH 2GK0A 2JIXB 4MWFA 1RJYB 2OMNA 4HW6A 2GTZA 3B4NA 1LDPL 3WDHA 4MD5B 3MRJB 1AGFB 5HSFA 1T0PB 4KDVA 1NMBH 3TJEL 4GW4A 2CGRH 4LVHC 3ORJA 5D1QD 5DFWH 5MERB 4WI2A 3TBWA 1NAMA 1FSKB 2CD0A 4MB3A 5A16B 4W81A 1E4XI 4WFFD 4NWTH 3LQAC 5E9DB 2F15A 2ADIA 2VLJD 4UDTA 5IT2L 3HC0A 3CU7A 4PGEA 4JM4L 1BQLH 1XF4B 3RGVA 1QSFD 1CXKA 3D1MC 4JQVA 5TDOB 2BVPB 4B7LA 4XBGB 1OAUH 2Y06L 3NFSL 4PRAB 1MIMH 3MRBA 2ESVA 1MF2H 5I8EB 4DWHA 4O58L 3O9WD 2FL5B 5GJTL 4YK4C 1MFEH 5A43C 2DI8A 4ZTPH 2EIZB 3IJSB 4Y4HD 2VE6B 5I76B 3QPQC 4LCIH 5IW3A 4J2XA 2AK1L 3DGGA 1CTOA 4NQVA 3U4EB 3BT2H 3FMGL 4OZHB 1FJ1A 4PJ5B 2VQ1A 1J1XL 2GSIA 4BSWA 1HQ4B 2P42B 3HRPA 5EU6E 5IEHB 3BD5A 1LEIA 4CVXA 1G7IA 5EO1A 5JR1L 1NUGA 4LPTA 4MD4A 5MEND 3D69A 3CDGA 4PP2B 1TVBA 1IGMH 4PY7A 4PRID 4FXLA 4JFXB 3SDCA 1A3QA 1OOAA 3CFEA 3L3OA 1D9KC 2R2HB 2D7PA 4L8SB 2WIIB 1U8NB 1DQDH 4WVRA 4DZ8A 4EI5A 2FEEL 4OGAD 4X6DB 3S3SA 1OY3B 3WFCH 2NNAA 3G5ZB 3KPRA 1CVRA 3AM8C 3HI6H 4DEPC 1MCJA 2F19H 3PJSA 4PR5A 5DR5H 5JW5B 2V9QA 4P5KA 1G7QA 4YHYC 2QKIB 3O6ML 1FVDA 5JNYB 4Q9QL 2BDNL 4C56E 1IVLA 3MRLA 4WFGE 1YEJH 2P8LB 5F70A 4PGZA 3VWKA 3TBYA 1E4XH 5IFAL 1IC4L 1NAML 4LK4A 1TTUA 2XQYG 2YD1A 5IVOA 1X44A 3VFGL 2E9BA 1F90H 2X1XR 3WIFA 5F1IA 2BVOA 1CFQA 1B2WH 1MY7A 1U41A 2QQNL 3NH7H 1P5VA 4F7MB 2FJFB 3NCEB 2EYRA 5JUEL 1Z0NA 5T33H 5KVEH 3SKNA 1MHEB 1T6WA 5JW3H 1VEOA 1JYXA 5JOFB 5KS9B 2H26A 1PKOA 5HGHB 2YRLA 3NABL 1KB9J 2ATKB 3S36H 4NFDA 1FZOA 3TV3H 3OZ9L 4QRRE 4U7KA 1RMFL 4Y1AD 1CS6A 1EHAA 1YC7A 2P7TA 4HKXB 5IJVB 4JPWL 4ZAKD 4ELMA 3RHWK 4OTXL 1FCGA 2YD3A 5DFTA 5I2IA 5I71B 4IDJH 4EKXA 1A2YA 3GI8H 1DFBL 5J57B 2Y7QA 3QUXB 4HX1A 1LD9B 1QFWL 3B2VL 1PY9A 1T2QL 5DMKA 2VDLL 1YMMB 4O9HL 4U6YB 4P2RB 1G0DA 5J13B 4WHTA 5DUBA 1WZKA 3MBEA 1IFHH 3PWJA 3OAUL 1WJ3A 3VFSA 3QQ3B 4K8RH 1JF6A 1W2KT 5EZLA 2PO6C 1MRCL 1IM3A 1RZGA 3MJGX 4XB7A 1RFDH 5F7EH 5I18H 2WUBL 5IIEB 5GZOC 4O51B 1S3KH 1MJJB 2OI9C 5ADPL 2ZUVA 3H9HA 2XPGB 2J12B 2V17L 4LU5L 4PLOB 2BRRH 3QEUB 5ENWB 1N59A 2KH2B 5KAQF 4IIQB 4Q58C 2FBJL 2OYPA 4F3FA 2YPKA 2A0LD 4JFEA 3UTTB 1T66D 3VGEA 4K3EH 4RFNB 3IS0X 1YMHB 1BF2A 4ZO9A 1OTUD 1UCTA 3W9EB 3WJJC 4KPHH 3SGJA 3K3QA 3OKOA 5SX5K 1TTGA 2HT3D 4OFVA 4QRPE 4JKLA 2WNGA 3LMJL 3K8MA 4BH8B 4TULL 4GBXC 5C0BA 3MA9L 1ETZA 4OD1H 4W6WB 3AS0A 1MELA 3IFLL 1VSCA 4LDLB 1EFXB 3BGFC 4HIXH 4M7KH 2R0KH 2V2XB 1CFNB 4XP6L 2DYPB 4XPFL 1EZVX 3VA2C 1JZ6A 4QEGA 3L95B 1AP2A 4OIAA 1TITA 1T3FB 4MHHG 2XN9B 1D5ZA 4MVBC 3EO9L 3ARDB 4U6HB 4NCC1 3ZDZF 2IAMB 2MSPA 1WAAA 4JO2L 1QKZL 4KUCF 4YWGH 4DFIA 1IGJB 5HHXL 3WS6C 3TNMB 1BIIB 3FCTA 2EE3A 1U8QB 1B3JA 1I8KB 1S5HA 3BVNB 1KB5A 1W8OA 3WN5A 1B0RA 4N0FB 1A9EA 1MRDH 3BSZH 1G1CA 2W38A 4HLZH 3QUMH 2VDQL 1UB6B 3QXAA 2IADA 4PRHE 4QOKA 1LO4L 1UM6L 1D5MB 4JN1H 2XWBA 3CZFA 2XWTB 4G6MH 1S7TA 4N8CL 4H8WL 3P0YL 1S7WB 4HFWA 4QXGH 4J3UA 4YHIA 2NTFB 1H8NA 1B9ZA 3GO1H 3T3MF 3CFDB 3PGCB 2PYFB 1P7QB 1UYWH 2YD7A 5F7NC 1F11A 1UXWA 1J0IA 1S9YA 4JFOB 3WD5L 2V2TB 4C56D 4WFGD 2CIIB 1QR1A 4MNHA 2R69H 3EJYC 5E6ID 3RKDD 5E9DE 5HD8C 5LJYH 5E7BA 3IDXH 4O2EA 1Q9OA 2C4XA 3SGKA 3LEYL 1MCSA 1M4KA 1RZ8A 5CZVH 5CZKA 5T1DL 4CDGC 3FB5A 3FHAA 3PHOA 4JDTH 2JCCF 5IQ9B 4N1HB 1T7VA 2Y9RT 4M43H 3BPLC 4X6CB 4XRCA 2VDNH 3C5ZD 4J1UA 1OWWA 1Q8MA 2V2WA 3A67L 1UVQA 3RJDA 4OUOA 4P2QE 2ED9A 2XZCL 1RK1A 3DI2B 4I0PA 4AL8H 1N6QH 5ERWB 5TE6H 3JV6A 3MO1B 2C7UA 4JDZA 2PCPA 4F57H 4K94C 5KG9B 4XWOD 1OGTA 5I1CH 4W4OA 1RZFH 1I8IB 1XGQA 3THMH 1YJDL 5F9JA 1CICB 2EDHA 1CGUA 2Z93A 4NQDB 2VLLB 4JKMA 1OM3H 3MRDB 1D5BB 1LK3L 1WWAX 1XCTA 4YHOL 1Q94A 1DQJB 5L88H 4NJAH 3W39A 3DMMC 4PJAB 2DQIL 5FA4A 1ZHKB 5ACZB 4NQCB 3WKNA 4N0UA 1MCFA 2YC1A 1BFOA 5CSZB 1NQBA 2WBJA 3RWCA 3GSVA 4OQTH 3QIWC 1O7SA 2Y07H 4XMKL 3U6RA 1YEHH 3LN4A 2BC4B 3ULUE 4NC1C 1N0XL 5F6IC 3KPQA 1N5AB 3P9LA 4R97C 1YNKL 4X6DE 2P5WA 1J88A 4LLDA 3ME0A 4ORZC 2YSSA 2F53E 4LVOC 2HFFB 4S1DC 5DHVB 1GGYA 2FGZA 3FAXA 3LH2H 5DJ6A 3UZEA 3QG7L 5DYOA 3QDMB 4CL7A 2JIXA 1RZJH 1FFPB 1RJYA 2FDBP 4U3XA 5C8JB 1RV6X 4WHYH 1AGFA 1KJ3H 2G60H 3DX7B 4UZGA 1XCQB 5EOTB 4IEFB 3WFBL 3M1BB 1SYVB 1U8OB 3MLWL 4M5YH 4KKNA 1TZGL 1TXKA 4IRZH 5MERA 1J8HD 2GJJA 2FATL 3O81A 3DSNA 2ZCLL 2YRZA 1NCAL 1OPGH 5F72S 4QRPD 3N1PC 2HVJB 2OXHA 4HMEA 4Q2ZB 4JRYE 1QRNB 4NGHH 2QL1A 4Y88A 1PSKH 4FZ8L 4MNGA 3DO7B 1UKSA 5SWQB 2ORBL 1XF4A 4J3VA 4XHQA 4F2MB 2G5RA 2XTJC 2PXYC 3V7MA 4APQB 5TDOA 3D2UB 3JZ7A 2BVPA 3BQUB 4BZ1L 4XBGA 1ZKAA 3NZ8A 4PRAA 5KSVA 2VDOL 2FL5A 3SDXB 1KB9K 4YHKL 4MJ2A 3FFDB 1H5BB 3UTPE 3UO1L 2EIZA 5DO2D 2VE6A 5I76A 1QBLH 5C09B 5FIEA 1NEZB 4XH2B 5E5MB 2W59A 2IWGA 2J5LC 4J3TA 5I30H 2GJZB 4YHLH 3U4EA 4UT9L 1TCMA 4OZHA 1K5NA 1OQXA 5AYQA 4PJ5A 1HQ4A 5IEHA 4M9OA 3S37X 3QCUH 3ULVL 4RISL 4OI7A 3UYRH 5IV2A 4MQXC 5MI0C 4XNZC 1QZ1A 2APFA 1CBVH 4PP2A 5EOCH 5F71A 1IQDB 4JFXA 1BOGB 3JTSA 4Y8DC 4ZXBC 2JK5A 2UWEE 2R2HA 3DV6A 3VXSD 4NO5A 3QFDB 4L8SA 5AWNH 4U1SB 3VD5A 4OLYH 1U8NA 1K6QL 5FYKL 2ZP0T 4NZTL 4AG4H 2JTDA 4PP1C 3MRHA 1UC6A 3EYFB 3VXUB 2FB4L 3BP4B 3NPSC 4PJDF 3G5ZA 1HHIA 1Q1JL 2DKSA 3RNKB 3GSNH 2DQEL 5JW5A 2QSCH 3LN9A 1N4XH 5AZ2L 4KHXL 5IVZA 2QKIA 1V7NL 2P8LA 3ROLB 1YEKL 4ZS6D 1ERNA 1NLBL 2H2PD 2CDFB 3IVKB 1YY8B 4MCYA 2F5BL 3ZKXB 1ZAGA 1WISA 2FJFA 4F7MA 3MRMB 1JPSL 3Q6FB 4YE4H 1MHEA 4EJ1C 2A73B 3D25B 4LSPH 5KS9A 1M7IB 3SE9L 1A1OB 4LCYB 4EXKA 4KRLB 1OVZA 1HI6B 2VLRB 4Z95H 5HGHA 4L4VB 5GS0H 4L4TA 3NIDF 4XMLL 4XPHH 2ATKA 4MAYC 1IEHA 1MFBL 2OL3H 4FG6C 1SBBA 1FNAA 2ICWB 1AD0B 1N3NA 1NCWL 3Q1SL 4G42B 4XPAH 4J8RB 1R5IB 1J0KA 3ILQC 5DJYB 5KOVC 4KJPD 2VR5A 4EZMA 3T0EA 3PV7A 4JFFB 1FNEA 1LD9A 4M03A 5E2VH 2AEWA 5CD3A 1UXSA 1XGPB 5GRVL 4CU7A 3X3FH 4UQ3B 3T4AB 1IEAB 1RSFA 5ICXB 5JIKA 4D8PB 4U6YA 5GGTA 1QFHA 3B9KC 4M7LL 4E41E 1OAKL 4NFCA 1RJZB 3MNZB 3QO1B 4KZDH 3QQ3A 4LCWD 1HH6B 1QUNA 4I3SH 1GGCL 5D72H 2B4CH 3IAGC 2YRPA 2Z31A 1AR1C 3EOYG 4U0RC 4XHJC 5ITFB 2N56A 4O51A 3D48R 4LSVH 1MJJA 3L6FB 4OLVL 1EJOH 4WUKL 2FIKB 3FB6B 2XPGA 1CL7H 4LCUB 3QEUA 5D1QB 5ENWA 2HG5B 1MPAL 1U91B 1J1PL 4IIQA 3PABB 3WE6B 1MI5E 4GQ9H 2FRGP 3UTTA 4Q9CA 4LLUB 3TT1H 5L2KB 1YMHA 4GKZA 1VFBA 2QADC 2DM4A 3ES6B 4BH7B 4M62H 3RBGA 1L7IL 2VLJB 3I02B 3O3DB 5BOZG 4BH8A 3TCLB 5FCUL 1CF8L 5JMOC 3O45B 1EFXA 3OF6D 1HXYA 1KIPA 3UJIL 1PEWA 3DI3B 1CFNA 3QRGH 2DYPA 3O3BB 3PHQB 1A7BA 4H88H 1OLZA 1RUQH 1EXUA 3M17A 3PE9A 2FJHB 5CJBA 4Z8FL 2APWA 4LIQH 5BOPA 5DRZB 4HUXB 3KYNB 1BLNB 1MJ8H 4IMLB 1T3FA 3JV0A 1GGIH 3UTPD 4PIRF 1BM3H 4U6HA 3ARDA 3S5LB 4Y5VB 2PYEE 2IAMA 4OBRA 3TEUA 1YYLL 4ONOA 4HGWB 1IGJA 4F9LA 1BIIA 3QUYD 1KCKA 4M6NH 5GGTL 4NKIH 2AV1B 1U8QA 1I8KA 4KU1A 4PRIB 1CGXA 3BVNA 4ZOCA 1BQHB 2DICA 4BA8A 4N0FA 4KKCD 5CGYD 4RMVA 4DK3A 5B38A 5EWIL 2ZUSA 1JGLL 2O5YL 5CAYB 1D5MA 2XWTA 4GW1B 3KGRA 2NZIA 2ITCB 2UZIL 4IMKC 3CFCL 4GOSA 2NTFA 5D1ZB 3H0TB 4J6RH 4K71C 1QLRB 5HGAB 3PGCA 3BYTA 4XCYB 3TO4B 2E3VA 1HNFA 3AREC 1UB5B 1RJLB 2V5RA 4V1DE 2Q6WB 4NZDA 4JFOA 5DMYA 3DRQB 3N9GH 3LRHA 2CIIA 1WTGT 4UIMB 3FQNB 2EECA 1QRNE 3EJJX 4OZFH 5L8LB 1DE4B 1I9IH 4WWKD 4WHCA 4ETQB 1U2CA 1TQCB 1AO7B 1G6RB 2ZSWB 5ITBH 5LXGH 2YOCA 4LSDA 4OD2B 4X6CA 3TO2A 1X3DA 3QFJB 2APXA 2B1AH 4K9EH 3JWOC 1WITA 4PJ7E 3MJ9A 4GG6B 5ERWA 1GC1C 4ZAKB 2LVCA 3DBXB 3I50L 1U8IB 5KG9A 3KJ6H 1ACYH 1F13A 2FX7L 5I8OH 1I8IA 1VFAA 4XCEA 1I9RL 1FZMB 1NH6A 1CICA 4NQDA 4Z0BH 2VLLA 3V5HB 1D5BA 1T1XA 1DQJA 1G7JB 4PJAA 1DUYA 4Y4FA 5JPNB 2JF1A 4OLWL 4H26B 3P30H 5ACZA 3KXFB 4DUWA 3KPTA 4LRIC 2W0KA 3HC4H 1LEGB 2F5AL 5E8EB 1A3RL 3D6GA 4XAWH 5CSZA 5I1KL 3QEQB 2DQGL 1MCBA 4E41D 5T3XL 1IC1A 2HN7A 2BC4A 1S78C 5AEAA 1KPRB 1FZJB 5CIPB 4WTWA 1N2RB 1FVEA 5IQ7H 4K8RD 3RUGB 1QBBA 5DHVA 2VXQH 4N0CC 1GGUA 4JPKH 3F65A 1U8JB 3BRFA 2E7BA 5DRNB 1JGUL 1F02I 1EHXA 1FFPA 1RU9L 2UYLB 5E5UB 2V9RA 4XMPH 4PYHA 3DX7A 2PNDA 5DJAB 1UT9A 1XCQA 5EOTA 3M1BA 1MI5D 1SYVA 1U8OA 4QWWD 5IVXA 3WIHA 2MQ3A 3IKCA 1OAQH 2XKSA 3P9MB 1CR9H 3JV4A 1KC5H 3H7LA 2XA8H 2H2SC 3FRUB 1R5VB 4XNQA 2HVJA 3C9NB 4Q2ZA 3H9YA 1MJ7H 3S37L 4S1RH 4LSRL 4NQTA 1VADB 1KCUH 4JKKA 4D9LH 4FMKA 4JQVC 4QHUA 4WNQB 3DO7A 5SWQA 4F2MA 4JRXE 2A38A 4X7TA 4APQA 2NY7L 3F5WB 3D2UA 3BQUA 3O6FD 4KAQL 3BN9D 4HPOL 1QBML 3LSOB 2X05A 1M05B 3DX9B 2RFXB 4X4ZA 3SDXA 2FECI 1MLBB 2GITB 5D2NC 3FFDA 1H5BA 1VFOA 1R3HB 4JR9H 4FQQB 1KEGL 4LF3A 3OPZH 4G6KL 1CGTA 1NEZA 4JM2F 5E5MA 4LGPB 4JFYB 1JPFB 5FEBA 2GJZA 2NCMA 3EYOB 3V7AE 4XXDA 4H20L 5ESVB 4Z7UB 1A6UH 1EPFA 2DIBA 5FGRA 4ODSL 3QWQB 3BESR 4PBVC 1EBAA 1BBJA 1Q0YH 2J6EL 5DGRA 3SDCC 4FFYH 5IB4A 1JV5B 4PPTA 2RIKA 1IQDA 1KFAL 4OV6F 4V2BA 3PXHA 5EZJB 1Z9OA 4JFHE 2FWOB 2W9DL 1AJ7H 3QFDA 4U1SA 1GL4B 5C08E 5BJTA 2IH1A 2Y36L 5DTFB 3EYFA 4ZFGH 1OTTD 5LAXB 3VXUA 4R2GB 3UYPA 4F37F 2DMCA 4MXVF 3GJFB 3VW3L 3FZUC 3RNKA 5L2KE 2H32B 5GXBB 5EPMB 3E3QE 1LP9B 5JHDE 5E8NB 4JO3L 5DEGA 1FL3A 5DJCB 3ROLA 4DW2L 1CU4H 5HHMB 2ILLA 4NWUH 3EDJA 1RIUH 2VZUA 4Z6AT 2CDFA 1P7HL 3TZVC 4K3DH 4RZCB 3S4SB 3C5ZB 4X4XA 4RFOL 3Q6FA 3RY6A 2A73A 1PD6A 1M7IA 1A1OA 1SYSB 4LCYA 2VLRA 1HI6A 4MX7B 4L4VA 3D5OF 1GOGA 2BXZA 4F58L 5C0CE 4C57C 2CQVA 3L3JB 4EQ3A 2F9BT 2DLIA 4MA7L 1VGEL 3CUPA 1JP5A 4M1DH 5LCVH 1YEIL 2ICWA 5FM5O 1OAZH 3AB0B 4GRMB 4HDIB 3BPNC 4CMMB 3O2VL 4G42A 5FA3B 5HI5D 1R5IA 1ZLSH 2A6DB 4QTIL 5DJYA 5IESL 4NM4H 5FHAH 4LLQB 3VFUB 1BEYL 3GKZA 2W9EL 4MJ5B 4LEOB 4PJEF 4JFFA 2BJML 2JJSA 3R0MA 2BY1A 1JHKH 3I6GB 3V4PL 4NCC2 4ZOBA 4UQ3A 3T4AA 1IEAA 3VXNB 5ICXA 3SE3C 4D8PA 4U0QB 3QEGL 3MV01 4PBXA 1RJZA 3MNZA 3I9GL 3QO1A 1JRHH 3FB7A 3QXWA 3HUJB 1F4YH 5TFSH 3QAZC 4CDHA 1HH6A 3QHZL 4PY8J 4HUMB 4TNVF 3MLPA 1VFMA 1R6VA 1W72H 4IJ3B 1P84K 5ITFA 4ZQKB 5I9QC 3L6FA 3EYUH 4J4PC 4WUUE 2FIKA 3FB6A 4UV4L 1GGBL 1ONQB 3LEVH 4EIZC 2JELH 4LCUA 4XPGH 5D1QA 1J8HB 1E27B 1U91A 3F58H 1N64L 3PABA 4PGBA 2OJZH 2XIDA 3WE6A 2Z4QB 1AQKL 5EORH 4LLUA 2VXVH 4OCWL 5JIIA 2YK1L 3ES6A 4BH7A 5T3ZL 4PG2C 2VLJA 3I02A 5JORB 1X5ZA 4WO4D 2W92A 2COQA 5SWSB 3TCLA 4ZFFB 4WFEE 1QSFA 2R1YB 4EUPA 5GSRB 3O45A 4W6YB 1MFAL 4KVNH 1X5IA 1NGPH 2IBBA 3O3BA 4YHML 2RR3A 3AVEA 5I1DB 2P45B 3QISA 3LV3B 4YXKL 3TVMD 3PHQA 1T20B 2EDEA 3JWDL 5JPMB 1LDPH 1O0VA 2FJHA 2XXCB 2RGSA 2FEEI 3IDMB 4Y4HA 5EUKB 2R15A 5AZEL 5DRZA 2Z8RA 3KYNA 4HUXA 4KKAC 1QD0A 4IMLA 5D1XB 1ADQA 4LPYA 3TJEH 3S5LA 3FB8B 2CJUL 3F62A 3DHJA 4JHZA 2VO5A 4HGWA 3LAFA 5FM5M 3WN5C 4PLJD 4UTAL 5C9JA 2AV1A 3UMTA 4PRIA 4PJXE 1GPOL 3ULVF 1GRWA 2OBGA 3KWWB 1P4LB 3U30C 2J8HA 5IT2H 4YFEA 2MCPL 4JM4H 1HHKB 2HKHL 1ZWIB 4ENEC 1OQOA 4GXUM 3E8UL 5CMAB 3BPCB 4M4RA 5FUCE 2V5TA 4Q6IA 1NAKL 4P46C 4GW1A 4U7SA 4P3DB 5GSVA 3NFSH 5C08D 5HYSB 5EBWB 4O58H 2KZWA 3PWPD 3HPJB 4RQQB 5D1ZA 2ZWLT 3H0TA 4QCIA 4G8GB 5E4EC 5HGGS 1MOEA 2YD5A 1K8IB 3BZ4B 1QLRA 2OMBA 1KJVA 3DARA 3PIQB 3CCHB 1KYOK 1C12B 2IPTL 4XCYA 1A6VL 1G84A 1FZKB 1WUNT 5KSAD 1UB5A 3FN0L 3VMNA 4X7FC 4WI6A 2Q6WA 3FMGH 1J1XH 2NX5D 4QGYA 3DRQA 3RZCB 4L3EE 3GGWA 4FA8A 4UIMA 4IRJD 3FQNA 4WV1B 5JR1H 3H9SB 1MAKA 3LPGA 4N8VG 4FABL 3IF1B 3NN8A 3VD3A 4XCFL 1FL5A 4PRBB 1A0QL 1JYNA 4ETQA 1WVZA 1AO7A 1JHLL 5B38G 1ROWA 1CGWA 3X14B 1TJIH 3JWNC 2GSGB 1EERB 1WBZB 1SHMA 2IQ9L 4OD2A 2ZCHL 4GRWB 3ZE2F 4I0PC 4AQOA 5C71A 3QFJA 4Q97A 3GIVB 2DQDL 5C0CD 3UPRB 4MA1B 4GG6A 1I8MB 4DN4H 4ZAKA 3DBXA 1U8IA 3NAAL 2H8PB 4PJCA 3TA3D 5E95B 3O6MH 3WNMA 4Q9QH 2BDNH 3V5HA 4EN3D 3K74B 4ODUB 4M93C 4WWID 1G7JA 1IC4H 1NAMH 5DEZA 1NMCC 1HSBB 4H26A 3RIAF 3IJYB 4RWYL 3IDYC 1YPZE 4RMQA 3IFNL 5F3BB 5E8EA 3S34L 5MEOA 5BO1H 4RMSA 3IU4L 2NXYD 4GMTL 4M7ZC 1ZLVH 4LCWB 5C0FB 1FYTE 4TSBL 3HI1A 1KPRA 3NABH 1AKJD 1FZJA 1MHHA 2JB6B 2Y4SA 2J8UF 1N2RA 3OZ9H 4HWBA 4PJIA 1RMFH 3FO2B 2KUTA 2X4UB 4U2ZA 3RUGA 4XCCH 5C86A 4JPWH 3HR6A 3B9EA 5JIHA 4OTXH 5I1GL 1JI2A 5DRNA 4XNYH 3BD3A 2XI9A 3FTGB 3ZMRA 4WUUD 2UYLA 5D7IA 1DFBH 5HHME 3AY4C 2J3SA 5KTEL 1QFWH 5DJAA 3GM8A 2IPUK 2E9WA 2VDLH 5C0NC 3VRIB 3R1GL 3UZQA 5HPMA 2X4SB 4O9HH 1FSKC 2VH5H 3MNVB 3NCMA 3WFZA 5DEFB 5C2UB 5IB5B 3ZTJG 1XGRB 3UX9B 3FRUA 1R5VA 3RNQA 1C1EL 4DJMA 3GSQA 3C9NA 1MJUL 3CVIL 4P5TD 4WEMB 3BKML 1UM4H 1MRCH 3DYPA 1VADA 2Z0BA 2WUBH 1UWXH 1FGNL 4WNQA 5ADPH 3VXMB 5HDOA 3F5WA 3G9VA 5T1KD 1HH9A 2ZG2A 1NDMA 2VWEC 1L4IA 4LU5H 1M05A 3FONA 3DX9A 3W2DL 2RFXA 2FBJH 1MLBA 3IRPX 2GITA 4KJWC 1F6LL 5ESAB 3OKLB 1R3HA 1S7SB 4MXQD 4HUWB 5HDBF 5ELIA 4P49A 2ZG1A 4JFYA 5DMJB 2MWCA 1JPFA 5INDB 1FAIL 3GBML 3EYOA 4BM7A 4GLRI 5D7LE 5ESVA 4Z7UA 5I8CB 1WWCA 3LMJH 4TULH 3MA9H 3RWHA 1AGDA 4QKXB 1JPST 2YEZA 1K4CA 1JV5A 1KPVB 3HRZB 4CU8A 4HWBL 1FNFA 4Y4KD 1I1FA 5HGBA 4LMQE 2VISA 2F54D 5J56B 2FWOA 4F7CB 1J8KA 3EW3B 4PB0H 1OTSC 1J1OL 1Q72H 4HPYL 2NLJB 3BRDA 2OS7A 3EO9H 4RGND 1LO5B 3GJFA 1QKZH 3QWRD 2H32A 4R0LB 3RY4A 2X2YA 5EPMA 5E8NA 4L3ED 3P4MB 3ZLQC 5DJCA 2EC9T 4JQXA 1I3RB 3RU8L 1OP5H 2VDQH 4RZCA 4FS0A 3C5ZA 2IPKA 1LO4H 5BS0D 4JLRB 5FGBC 1H3VA 4N8CH 4H8WH 3P0YH 3OJ2C 1SYSA 4MX7A 1OT2A 3VFMB 1YEFL 4GAJL 4BZ2L 5DK2B 3L3JA 4Z7VB 4I0CC 1A64A 4X9FA 2OXGA 1RIHL 3KYMB 3ZDYF 2H1PL 2K7PA 2EDWA 4NO0D 4DAGL 5B4MC 4HDIA 1MQ8A 1GOFA 3ZSTA 3WD5H 4K3HA 5I71C 5FA3A 4HJ0C 1BZ9B 5EBLA 3RX8A 2A6DA 3K8KA 2BFVL 3QUXC 4UUJA 5JXED 5D7SL 4MAUL 4NKDB 4JZJC 2Y6SD 3VFUA 3ZT5A 3LEYH 1ITBB 4MJ5A 1Z0MA 4LEOA 4XVTL 3L5JA 3VWJB 1QSEE 5T1DH 2BVQB 5J13C 4Y89A 1D5IL 1RURL 3HMXA 3DXAE 3I6GA 4ZODA 3VXNA 2DL9A 2M2DA 2R56L 4PJFF 1FYTD 1ZLWH 3A67H 3QZWB 3S7GA 1NKRA 1XIWC 2FBOJ 2XZCH 4KHTH 2CLVB 2PKDA 1JNNL 2HJKB 3CDYA 5CILL 1MFDL 3HE6D 1OD9A 4MDJA 2DTSA 1HQRB 3CGTA 1YN7B 3SY0B 4EI6B 3BKCL 1YJDH 4M8VA 4TNWK 2P47B 2DQHL 5B8CC 2YKLL 2BOCB 2XZZA 1LK3H 3GNML 4YHOH 5TPWH 3SOBL 1FFOB 3CLFL 4ODWB 2DQIH 2EDRA 3PF2A 3T0XA 3VFVB 1BIHA 3WIIL 1TLKA 4IIQC 3OXRB 4LLVB 1ONQA 4JG1L 1UA6H 4MLIA 1J8HA 1E27A 3NIFF 4RFNC 5EC2B 4O02L 5KN5B 4OKVB 4Y19E 4Q9RH 2Z4QA 5DHYB 2QQLL 3CDCA 5EOQL 4QRPA 1T1ZB 4XMKH 4AEHL 1KUMA 1X6LA 4HJGA 4X4YB 4GRWE 1N0XH 3QR2A 3VE0B 3B2UC 4PTUA 1IGIL 3ZYZA 4YBQC 5JW4N 2AJYL 5JORA 4Y2DD 1KLUB 5SWSA 4ZFFA 3U36B 2R1YA 4EDXB 5D7JD 2BX5A 4D3CL 3V6OE 1IE5A 1NCCL 3O6FB 5D2LE 1YNLL 1NJ9B 5KVGL 5I1DA 4OCSL 4PJ8B 1NFDB 4LBEB 2XG5A 4R4ND 1T20A 5JPMA 3TPKA 1I1CA 4LOUC 4AM0B 1BJ1J 5EUKA 3IDMA 4H1LA 3ARDC 2IAMC 3WFBH 3ZKMC 3MLWH 2YR3A 1TZGH 4LPVA 3C6SA 3BIAX 4LLYB 4OZIB 3O3AA 2FATH 2B7DT 2ZCLH 3OQ3B 5HTSA 5DZOA 3HMXL 5CEXB 3OR6A 5D7LD 2XA3A 5TE4L 2VDML 4F15B 4IOIB 4LKXB 1L6ZA 3QUMB 4EUPG 1YY9D 3KWWA 1P4LA 4ZG1A 5HVHB 3VXSA 2LE9A 1LVEA 3O8XB 4YX2L 1T0NB 2ORBH 1HHKA 3MRGB 1ZWIA 4ZFOA 4HV8A 5JMRA 5CMAA 3G5VB 4P3DA 1QRKA 2VDOH 5HYSA 5EBWA 1NDGB 3HPJA 3UPCA 1K8IA 3PIQA 3DTXA 3DV4B 3CCHA 3UO1H 3OKDB 5HHVL 3T0AA 5J12B 1C12A 4G5ZH 4J3WA 4CU6A 3BIKB 4MA3A 1FZKA 3VDBA 5DQJA 1F45A 1GYAA 4UT9H 5KSUB 1W0WA 4UIKL 4I4WB 3RZCA 4PJBE 3ULVH 3ARFB 4RISH 2KDGA 3H9SA 4ACPA 3IF1A 3I6LE 1O7VA 4PRBA 2L7UA 3RI5K 4KXZI 4YFLI 2H9GB 1Q9KB 9CGTA 1I7ZB 1MCQA 1WBZA 1I3GL 5IMLA 4U1JB 1L9MA 5C0EB 4RIRB 4TUKH 5I0ZA 4NZTH 3GIVA 3QI9D 3QNYA 4OCYH 5KANI 3UPRA 4JJHA 1CFSA 2FB4H 4H25B 1I8MA 5E08L 2AK4E 3P2TA 1IAMA 4OLZL 5CJ8A 2H8PA 5MP6L 5AZ2H 4KHXH 4MCZB 5AG8A 5HYFA 2EDTA 2ZKHL 1CXFA 1V7NH 5DK3A 3V5KB 4ODUA 1DBML 3SEPA 3TFKC 3VD4A 1LO0L 1CK0L 2VLKB 3IJYA 1IKFL 5F3BA 2F5BH 3K7UA 4G6FD 2DMBA 3WHXA 1JPSH 4AEIL 4Z7WB 4FFVC 3T0BA 5CJXA 3U9PL 4X8JB 3GRWA 4LCWA 3SE9H 5C0FA 2VAJA 5IUSA 4ZFOL 2FYYB 4K7FB 3DX8A 4JRWA 1TQBB 5IHUL 2I25N 2JB6A 3W9DB 1MFBH 5HJ3B 3FO2A 2X4UA 1LE9B 1NCWH 3Q1SH 1ZK9A 3M45A 2OQJB 3H7BB 4I77L 4R8WL 2EZ0C 3FTGA 3CNKA 2Q20A 3UBXB 4E5XB 2IF7A 3LKQA 2GT9A 5GS1B 2X44D 3VFTB 4KKBC 3CXDL 3EJZD 2X7LB 3SDDD 3VRIA 2DMKA 1OAKH 5LVEA 2BZDA 4JDVB 5KVDL 1XF5B 3AS3A 4UQ2B 5DEFA 1DBAL 3UTSB 4XP5L 2EDFA 5IB5A 2ICEB 4FQ1H 3Q3GB 3OF6A 1XGRA 4EQ2A 4XNUL 2NXZD 1MWAA 4P59L 4X6FA 4LDOB 3RHWF 2BOBB 3FT4A 4JPIB 2ICCA 4UTBL 1FFQA 2DM3A 1OAYL 4PJGF 3MRFB 1R5WB 2X9YA 1OARL 1FDLL 4NKMB 1H8SA 4APQC 2XACC 4GH7B 3BQUC 3VXMA 3Q2CA 4HG4K 1CCZA 3SKJL 1H5BC 1XEDA 2EH7L 1MPAH 3SGDH 1J1PH 3WO3B 3VGBA 3OKLA 2P24B 2NY3D 2VXTL 1DBKL 3FFCD 4OF7A 4C55A 1T4KB 3QUYA 4HUWA 1I1RA 1YDPB 4OB5L 3RVXC 5INDA 1L7IH 2F58L 1NC4B 3RBSA 1AGEB 2BCKA 5E1HB 2EYTB 4Z7NE 5FCUH 3GRWL 5DVKA 1CXLA 1CF8H 3WFHA 1AXSB 2X1WL 2VJXA 3L5HA 1NC2B 3UJIH 3OB8A 1KV3A 4MS8C 3RDTC 3S98A 2VXUL 3PWPB 2OCFD 4WGVB 4F7CA 4Z8FH 1ZT7B 5FYJL 4FRWA 2F8OA 1T7YA 3CH1A 2FO4B 4HIEB 3GSNB 1DJSA 1LO5A 5AD0B 2NX5B 1FGVL 5M95B 2HLFD 4R0LA 4IRJB 3C8KB 3K4ZA 3OXSB 2ERJB 1I75A 1TVDA 3FQUB 5GGTH 2KQNA 4WI7A 4D0DB 1IC7L 3P4MA 1JF1B 1D7FA 3ZKXC 3QRFM 4XI5D 2A9NL 3RY6C 1MWAL 4OCXL 1JGLH 3DVGA 4X8XA 4JLRA 3GHBL 1Q9LB 2QLVB 1CZ8L 3E2HB 2VR9A 3V9FA 2QHRH 4EVNB 3VFMA 4KI5C 3CFBB 5D6CB 2OL3B 3TA3B 1MF2L 3MUGB 3KYMA 3F7YA 1GIGL 4LRNL 2GY7B 3MV8E 1WIUA 1U36A 1FC2D 4MXVE 4R7NA 5K59E 4WW2C 4DGYL 1BZ9A 4IOFD 3GKWH 2WW8A 2JJSC 4NKDA 3GUTB 3TJHD 4Q7DA 3WJLA 4DKAA 4E41A 5L7XL 3MRKB 3OGCB 2BVQA 1AHWB 2EXWC