4Y2DD

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
b'AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 57
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD02
5DFWH 1MCJA 2VDRL 3TIDB 2ZWLT 2GY5A 2LABA 3N9GL 5D2NA 3WJLA 3NZ8B 2GSGA 1EHLL 1OD9A 4FQXB 2XKUA 3EOBA 3NACH 5CZKA 3L9RA 5T5FH 1GXEA 2ZSWB 4X6DF 2YPVL 3O2DA 4ZFOA 1LD9B 4XNQB 1A6ZB 3CLEL 3GSUB 4IOIB 3N85L 4HWNA 2R0ZH 1OM3H 4CVUA 3ARSA 4N90E 2VLME 3DURB 1DEEA 1TFHA 3DROA 4MX7A 3CXHJ 2JIXD 3QDAA 4QY8B 1HYRC 1ZHBA 3U79A 5JHLL 2P5EA 4KKLC 4WVRA 1Z6JT 4U1KB 2BMKB 3MRLA 4C59B 1H3PH 4LSRH 4KZEL 2DWDB 4RGMC 2JJSC 4PJ9A 2PTTA 3ARGD 4F7PA 4X7EC 1JUFA 3X11A 1MVFA 5FHAH 3TCXA 4X4XA 5D9SA 5I6XB 4BKLB 3GGWA 1DBKH 1U42A 3IDMA 2VRAA 3W0WE 2W0FA 3MV7B 3VFRB 3B3IA 1DQJA 2XV6B 1EHAA 2ITDA 4WI8A 4TULL 2V7HA 3QXTA 4ZAKA 3GSWA 1INEL 3Q3GB 4U31A 1ITCA 3C09B 1A5FL 2D0FA 2W38A 4C83A 5I1AA 1RUQL 2HJFA 3GBNL 3MNVA 3LHPH 3KPRB 3T2PA 5DRWB 3QQNA 3KLAA 4CMHB 1RJLA 4GQ9L 2Q87A 4F58H 1VESA 4NNYA 2VITB 1DVFA 2Y07L 3LKOB 5GZNC 4OZIB 5T3XH 1GRWA 5C3LD 3GI9H 4Q7DA 3MUGA 1FH5L 5GGRA 2ZSVA 4DK6A 3T0EB 4Z6AT 4PJXB 4XVJL 3A6OA 5KN5A 3SDCD 1A7PH 1CLOH 3TYFB 2Q8BL 5DTFA 4J4PD 1W0WA 1YNLL 2J6EH 3VCLA 2WBJC 5C08A 2VLJE 4OD2A 2HFEB 1ZEAH 1II4E 3ULVD 1EZVX 1VGEH 3CH1A 4RWYL 3LSOB 1X5KA 3EJYC 3BZDA 2NY3B 4GSDH 3QDME 4BZ2L 2JK5A 3BW9A 4KFZC 4OF0A 4MAUH 4ZS6C 2ADFH 1JWMB 2IMMA 2NNAA 3C08H 4OLEA 1R0AL 1LK3H 5I1HH 3RA7H 2R0WH 1QR1B 4P5TD 1DANU 3VWKC 2NXZD 2IGFH 3DGCR 3T3PF 5E24E 3SGDH 1YJDL 2CIIA 3MCG1 1CL7H 1WWWX 4HUUA 4LHUB 1ES0A 4LNRB 2B0SL 4KJPC 5I17B 3DOSA 4P59H 1DANT 4JG0H 1MNUH 2HMIC 4WDIB 5KSAC 4ZSOB 4PYHA 1KCLA 4NUGL 1I1FA 2YC1B 4X8JA 2GW5A 3CX2A 3IB4A 3PWNB 3QPQD 1EZVY 3S98A 1C8PA 1G6VK 1OP9A 1A9BA 1KBGL 2KBGA 3GSQB 3AXLB 5E9DD 1S9YB 2JJTC 1LO3H 2EECA 2Y25A 3WL9B 5IROA 4H20H 5JHDD 2VXUL 2I27N 4FXGA 5EORH 3FB7B 4ONFH 3ZDZF 4OM1L 3D9AH 4GO6B 4EVNA 3S35X 2HRPH 4LSPL 1AR2A 5F7UA 1E4XI 1QRNE 2GJ6D 2DQIL 5GGSY 1UEYA 2H2PC 4O4YH 1NANH 2A73A 5EA0H 4HK0B 4G42B 1FVEA 2ICWJ 2YK1L 2Z0BA 5TGBB 5J12C 1KIRB 3QJFB 1TZHA 2VZ3A 3NA9L 4MQ7A 4NRYB 4F37F 3LZFL 1ZWIA 4PRNB 4PJ8B 1EX0A 1AJ7L 2VZVA 5EZJA 3H8NA 1FYTE 5FOBA 4CVZB 3EZ8A 1P4IL 4F57H 3F62A 5T1MA 1G0XA 3RL1B 4Z0BL 4F7EA 3PWLB 5IBLC 2C26A 3I2CH 2G2RA 3PNWB 5F97E 2RQ8A 4KGJA 1MOEA 5FIEA 4Z7WE 3HNTH 4A6YB 2ORBH 3MOQA 5KANG 1GC1H 1MSPA 4FXLA 3W11D 5F9JB 3L5IA 2F54E 2ZP0T 1MRDH 5E03A 1F3DJ 4BFEA 5L2KE 3ZE0E 4CBPA 4EI5C 4JJHA 4BSJA 3ZKXB 1FPTH 4LEOA 1TLKA 5J1AA 3U0PB 3V5KA 1NAML 1NCBH 3FAXA 4EN3A 4P9MH 3G08A 2J1KA 3O3AA 4E0RB 1I4FA 4K94C 4RAUA 5GS1A 2BRRL 1TZIA 1K4CB 4WFED 5BV7B 5JIPA 2DM3A 4HXBH 4KVCL 2GKIA 3CFEB 3OGCA 2PYEB 2RB8A 1BZ7A 5IJKA 3EO1B 5JA8B 1QHPA 4L4TB 1D9KA 1XGRB 4YDKH 3QUMH 2H45A 4QGYA 1RVFH 1M6OB 4PJCF 2ESVD 5IHBA 4QXUH 3ESUF 3VDCA 2PYFB 3D48R 4PFEA 1W0VB 4OUUB 2DQFB 2IBZX 4NOBA 4O2EA 3SE9L 4HCRH 3RWIB 4ENED 1I3UA 2BHUA 4L4JA 4CJ1A 2VH5L 4Y4FD 4NC1C 4R2GC 1WIPA 3RIAF 4BH8A 5GS0C 2DKMA 4XI5C 4HX1A 1GOFA 3DVGA 2BFVH 1R5VB 3ILPA 1PSKL 5DT1H 5F89A 3RTQA 2LE9A 4JZNB 3R8BB 1JTPA 3LS5H 1N4XH 4OIIH 5B38B 3SHSA 2Z31D 5DJZA 1HE7A 1S7QA 3BXNB 1H3GA 4GKNB 2WANA 4LPWA 1XH3B 2PR4H 1FFPA 1HSBB 4I0CC 3SKJL 2QR0B 5IOPA 4K2UH 4QRRB 5I71C 3IFLH 2IBZY 2VXQH 3QI9D 4ZXBD 4DUVA 2XWJA 2PXYD 3FT4A 1WIUA 4G7YL 2NY6B 1HOCB 4NZUH 2G5BA 3U0TB 4LOUC 5JR1L 2EYSA 4E41E 1YQVL 4RFEB 1B0GA 3VFVA 1H3WM 4LLMB 3CGTA 4QYOA 1IZKA 3MRGB 1J88A 2YSSB 4HDIB 4R4FL 4UV7L 3TIDA 1ADQA 4RAVB 3MNZB 4FQ1L 1P6AB 2E6PA 3UBXI 1CLZH 3BIAX 3CXHK 3MV9D 3NZ8A 4OFYA 3NABL 5ELIA 1KN4L 1PG7L 4FQXA 3HG1D 5F1IB 2OR7A 4HV8B 3F7RA 1BQUA 4PRPB 2ZSWA 4P2YA 4PLOB 2FD6H 5IKCB 1RZIB 5L8KB 1LD9A 2BNRD 4XNQA 1A6ZA 3RQ3A 3GSUA 1F58L 1L4IA 3IDXL 4IOIA 5A1AA 1NFKA 1TQBB 4H8WH 5BVJB 3ARED 4YXHH 1V7ML 3DURA 2QEJA 1D5BB 4OI7A 4QY8A 2D0HA 4HHAB 4NHCL 4NKMA 3ZDYF 4LFHD 3OPZL 2VLKE 3TLRA 4U1KA 2BMKA 1JPFB 4JCMA 1Z9MA 2C7UB 4MHHI 2DWDA 4TNWF 3DMMD 2NY2D 2IG2H 2GHWB 3AY4A 4YR6B 3UZQA 2FGWH 4FG6C 4OM0L 3IS0X 2GIYA 1YPZF 3RKDD 1MFCL 3MRJB 3MV7A 1WT5C 3NCJL 3VFRA 2B39A 2YBRA 3MJ9A 1I1YB 4WUKH 2F74B 3E3QE 4M62H 4OT1L 3Q3GA 4HC1L 5JOEA 1Q94B 1YMHB 2XN9D 3KPRA 1MCRA 5DRWA 5FO9B 1E6OH 4D9LH 5BW7A 1KJ2B 2VITA 4G7VL 1JHLH 4RGNC 1CBVL 3HI6L 3Q48A 4WI6A 5IB3B 3LKOA 4OZIA 1UCBH 3BMWA 5C0AE 2Z8VC 5CILL 3T0EA 3RWEB 4PJXA 4F15B 4L8BB 4XNYH 4OGAC 3AROA 3TYFA 2DKUA 4HUKB 1WAAE 4M7LH 4UUJB 4JFED 1JWUB 5DLMH 3BWAB 1VA9A 4HUVB 1A4KB 4OV6F 4K9EH 4D3CL 2HFEA 3HMXA 1JPSH 3LSOA 4KK8C 25C8H 1BP3B 2HLAA 1A6UL 3CVHH 2WIIB 3QAZB 4MB5A 1YEIL 1NGXB 3DYPA 4L3CB 2JLLA 1GPOL 1JWMA 5IFJB 1KULA 3VW3L 3WHE1 4XAKD 2CMRH 3ZHLA 4H5SB 3QYCA 1QR1A 4XP1L 2XTLA 3TVMD 3MRKB 2DQCH 3WFHB 3CFKB 3D85B 3NBNA 4AEEA 4OJFH 4R0LC 1CCZA 5GSVB 4LHUA 4LNRA 5BXFB 4G6FB 5I17A 2D4FA 3LKQB 5ILTH 4WDIA 4MQSB 1IC1A 3GHBH 1IGIL 3MLTB 4G9FD 4N0YL 4ZSOA 1BIIB 2X4PA 2YC1A 3PWNA 1HNFA 4JDZB 4ODWB 3I3DA 4S1DC 3O3UN 1KUMA 4PB0H 4RZCB 3BGAA 3SE3A 5GHWL 3GSQA 2GI7A 3AXLA 1YY9D 1S9YA 1FO0H 3WL9A 1J8HE 1CR9H 1JPGB 1AXTH 1FJ1B 4GRWE 1NUDA 3FB7A 1WQVT 5B39B 4OSUL 4NRZB 5HYJD 3VD4A 4QNPE 4P2OC 5IHUH 5GSRB 4HK0A 4WFEE 4G42A 1WC7B 3O2DH 5DEGB 1DBAL 5TGBA 5KVFH 1SM3L 4JRWA 4GKSB 5SX5K 1KIRA 4UU9B 3QJFA 3E1F1 2Q76B 5FYKU 1T5WB 1JJUA 4PRNA 4PJ8A 3NZHH 2F53B 4OF6A 2ICWI 4IM8A 4FP8H 2ESVE 4M5ZL 4CVZA 2OYPA 3I84A 3SGEI 4S1QL 2AVGA 2X89A 3B5GA 4GQPH 5DMJB 3PWLA 4XCFH 3PNWA 1ZA3B 4Q6IB 4PTTB 3UEZA 2VZOA 3SY0B 3PGCB 3ZE1F 4IOFD 3NH7L 4A6YA 1ZVHA 4HPYH 1IAIH 3H6JA 5F9JA 4MNHB 4P48A 4F37K 1EFXB 3ZYOA 3OBAA 3OAUL 5LBSL 4XNZC 4ESKA 2IAMB 4GAYB 5TDPB 3RDTB 4NZRL 3UYPA 3U0PA 5JORB 4TTGA 4K8RD 1QNZL 4I13B 5HHXL 4FTVD 1QSFD 4E0RA 2J5LB 5HGHB 1AKJD 1K4CA 1J0YA 2VR9A 4ELKB 5J6GB 1CDIA 4JO2L 35C8H 3CFEA 4LARH 2PYEA 5DA4A 1NMAH 3ARGC 3EO1A 4L4TA 4J3OC 1XGRA 5DA0B 3S34L 3VMPA 1XR8B 2VYRE 1M6OA 2OTWB 3UROR 2IPUG 4IHOB 2PYFA 5I2IB 2ZPKH 2F5BL 1W0VA 2ICES 4OUUA 3IAPA 2DQFA 1IFHL 2XA3A 1UFUA 5GRZA 4PJBF 4LQFH 3QZWG 4U3HA 3EAKA 3QDGE 3RWIA 5CJXA 4TNVF 1S3KL 4R4BB 1OCWH 3SDAB 2BNRE 1KCRH 3L1OL 2PUQT 1BLNB 2X4TB 1NMBH 1R5VA 5D72L 1NCAH 3VXUB 1XIWB 2MQCA 4RMTA 5F9OL 4JZNA 4L8SB 4Q9QL 5FF6B 3KWWB 3TEUA 5B38A 2R2BB 2H1PL 3BXNA 3SDCC 1QBLL 4GKNA 2BHZA 4J4PC 1XH3A 1KV3A 1HSBA 1IC5L 3LAFA 5HVHC 1NGQL 1WTLA 1ZLUH 2QR0A 2OX5A 2RR3A 4BK5A 4QRRA 2BOCB 3ULVC 5CMAB 4KY1H 5DQ9B 2Y36L 4U1LB 4PP1D 2HT2D 5FGBC 3RIAK 1EHXA 3Q5TA 1HOCA 5HSFA 5I1CH 3U0TA 1D3CA 1Q1JL 4RFEA 3SQOH 4HWBA 4OCMC 4PR5B 5GRWA 1ZANH 4LLMA 4P5TC 3MRGA 2YSSA 2GTZB 2NXZC 4HDIA 5CHNB 4RAVA 3UJTH 4MA8H 5HHPB 3MNZA 4OD1H 5TQ2H 5HGGS 3L7FB 2YXFA 2X9XA 5HVWA 3E3QC 5AYQA 4OCSH 4LPCA 1JGVL 3OG4B 1A64A 1GAFH 4V2CB 5F1IA 2Q7NA 4PJDB 1KCSH 4HV8A 3ETBF 4X4MA 3V6FB 3X14B 5DJDB 1IEAB 2WUBH 2X1QA 4HWUA 5K9QI 4PRPA 4KUZL 2ZUUA 3QPQC 5IKCA 1RZIA 4YHZH 4IMKC 1JCKA 5D7LE 1ZT4B 4M7ZC 5BVJA 2AXFB 1OAQL 4EKXA 3NPZB 1CD8A 1Q0XL 1BFOB 3C5ZD 1D5BA 2YRZA 4PPTA 1BBJB 4JFEE 4HHAA 1HXYB 1IGMH 4M93B 5IFHH 1LE5B 4WI2A 4JRXB 1F3JA 5C6TL 1N0LA 1ZVSB 1JPFA 5IMOB 5M95B 2C7UA 3C2SA 2EIDA 4NKIL 3WFBH 3SE4A 5CZVH 4YR6A 4P4KB 5CSBA 3EYUH 1BWMA 2OP4L 3MRJA 3MV8D 1OP5H 2Y7QB 3PGFH 4GKZB 3H7LA 1I1YA 4FNLL 2F74A 3U1SL 1TQCC 4OB5H 4LKXB 2R4SH 5DMKB 1SEQH 4J3WA 4G9FE 2VL5B 3ZKND 1L7TL 1Q94A 1YMHA 2ITCB 5DJ6B 4BQ6A 5FO9A 2QSCH 1CXIA 1A6WH 1KJ2A 4TNWK 2FJHB 5EG6C 2X41A 4UINL 5IB3A 4YXLL 3FFDB 2DBLL 1EEZB 5TE6L 1AGBB 4GAFB 3W11C 3K4DA 3RHWF 3RWEA 3G6JE 3TPUB 4L8BA 4Z9KB 2V9TA 4RFNB 4UT7L 3FO2B 1J1PL 1Q8MA 4WNQB 4UUJA 5T1LD 1JWUA 5JMOC 3BWAA 4GG8B 4PB9L 4HUVA 1A4KA 4X98B 3QCTH 5HYJE 3EUUA 2GSIB 4X83A 4O02H 3VMOA 3T0VA 2B8OT 5F9DC 1IAIM 2WIIA 4JN2B 2WNGA 3R06B 4KHXL 1NGXA 1PEZA 2LVCA 4G6KH 4L3CA 5IFJA 5JW4M 3BD3A 4F80A 3MA9H 4H5SA 1I9RH 3MRKA 5I30L 4HGKC 3CFKA 3WFHA 3BAEH 3D85A 4KI5D 4EDXB 4HEME 5KW9H 4XPBH 3QEUB 4W4NA 5KBNC 2V17H 4OF3A 5GSVA 1NFDF 4JE4B 5BXFA 5GGRY 1FYHB 1MY5A 1QVOB 1F4HA 3LKQA 4MJ4A 5EC1B 3X3GH 4HZAA 4X6DB 4X7DC 2JTDA 2BJMH 1RULH 1LVEA 4RBPK 3MLTA 1NAMB 5CWSB 1BIIA 1FZMA 4RWHA 4JGUA 5DD0H 3U48A 1RFDL 4JDZA 1U2CA 4ODWA 1FCCA 1XF3B 2FHFA 4ENEC 3QISA 2DM2A 5DSCB 4RZCA 1JK8B 4HFWB 4Y4FC 5AAMA 1DSFL 3BDXA 1W72L 4PJHF 4U33A 1JPGA 2P7TB 3L5XH 1FJ1A 1ADQH 5JQ6H 3V4VL 1MQKH 5F7HA 3MBXL 5B39A 2J12B 4GS7B 1IKFH 4NRZA 2Z31C 3VFSB 3DSFH 1QSFE 4GMTH 3MLWH 4NKDB 2J8HA 4DJMA 5GSRA 4BZYA 1WC7A 4M6ML 5DEGA 4XMPH 5I19H 1DQLH 4GKSA 4UU9A 2JELL 3QI9C 2Q76A 4ZXBC 1K6QH 1T5WA 2WBKA 4JM4H 2PXYC 3ZT5A 2F53A 4WTWA 4GH7B 3MRNB 5J13C 1PD6A 1VADB 2NY5L 4HT1H 4PY8J 2OJZH 1TETL 2RAMA 5EO9B 5FUCE 5D7KE 3PWPB 2VR5A 3LCYA 3L5WB 4CUCA 1PY9A 3MFFB 1YEHH 1G7HB 5HDOA 3BD4A 4OF8A 5L7XL 4JFQB 1ZA3A 1QBBA 4Q6IA 4IRJD 3S5LG 4PTTA 4W68A 3DWTA 4QRTA 1EERB 3SY0A 3PGCA 1CLYH 1A1MB 4XPGL 1S8DB 4WUUD 2CXGA 3RWGB 2APBA 3B9KB 1HHJB 2UVEA 1MAJA 4MNHA 3ULUF 1EFXA 1T7VA 1QSED 3MJ9H 4P3CH 2IAMA 3KR3L 4GAYA 4ONHB 5TDPA 2FJFB 3OJVC 4DGVH 3RDTA 4XXCC 3GBML 4PG2C 3AREC 5ESAB 1MHHA 1K8DB 5JORA 3VMNA 3ZYIA 4OQ1A 4MJID 5HGHA 4J3VA 4ELKA 5J6GA 2BVYA 3G6AB 1NGZB 4R90H 4S0TD 5DWUL 3DMMC 2NY2C 1L6ZA 3KJ6H 1DBBL 3OKMB 1JZ4A 3HC0B 4J3TA 1XR8A 1MIML 3RKDC 3PWJB 4IHOA 5HXMA 2CLZB 3NGBB 5I2IA 3V79C 3V9FA 2EXWD 1P2CB 4IJ3C 4RA3A 4AEIL 2DQTH 4KPHH 4Y89A 1DQMH 3QQ4B 4JREC 5D1QA 5EC2B 1R3LB 1XR9B 4W4OC 4WI9A 1IRAY 2NY0D 3M8OL 1M1SA 2BZDA 5SWQB 3ZSSA 4EEEA 4R4BA 2AJSL 2QQKH 3CC5B 3RZCB 3N1FC 3FTGB 3SDAA 2LTQC 2A6DB 4AM0B 3DSNA 3WNLA 2X4TA 2YA2A 1CTNA 5C86A 3VXUA 1HHKB 1XIWA 1KLGB 2BNQB 2OR9H 5F21B 1ZXQA 2G60H 4L8SA 4PJ7F 5FF6A 2R2BA 1YYMH 3GMMB 3GMRB 1T1YB 4Y0GA 4MLIA 2ZUYA 2X7LB 3JSSA 2YD7A 4PIRF 5DJYB 1TZGH 3QQ3B 1MFBH 1Z0MA 5CMAA 1WZLA 4TNVK 4XMLL 5DQ9A 5I66B 4TSBL 4U1LA 5ID0B 4ONGL 1I3RA 3VXRB 1OGAB 1L0YA 2P8MB 4OCYL 3G5YB 4PR5A 1P1ZB 3MV8E 2MOVA 2WWMD 3TVMC 2GTZA 4G5ZH 2APWA 4L4VD 2XRAL 5L88L 5HHPA 5I0DA 2IC2A 32C2B 2CK0L 2W0PA 3L7FA 3RPIB 4JDTL 2R0LH 1HQRB 3UYOD 3QWRA 2XZQL 3MV11 4PJDA 3VG9C 2R2EB 3HAEG 7FABL 1BECA 3V6FA 4JCLA 3QH3B 5ECJE 3X14A 5DJDA 1IEAA 3IFNL 3LN9A 2ZG3A 1IGFH 3FRPG 1BQHB 1ZT4A 5I74B 1YY9C 5C09D 9CGTA 2AXFA 5JW3H 1BFOA 3FO9B 2EYRB 1BBJA 1WV7T 4S1SL 3B8YA 3BN9C 4LAJH 1HXYA 4I18B 3FN3A 2KPNA 4PD4J 4X7SL 1LE5A 4JRXA 4NBYB 1ZVSA 4WHYG 5CEYB 4Q97A 4A6YH 5IMOA 3RUGE 5IJVB 2DQJH 2IH1B 3QEQB 2D7QA 3EYFB 1OAYH 4Y19E 4KDVA 3P9MA 2B4CH 4PTUB 4P4KA 4KRLB 1QFUH 1NCDL 3AS1A 2O26U 5E1HB 3IGAB 5A2IH 2KDGA 2Y7QA 4GKZA 4NKOA 4U7KA 4TVPD 4DVBB 3BQUB 2VZ1A 2HAZA 4H1LB 3I85A 5F3HB 4LKXA 5DMKA 1LEIB 5D2LE 3LQAC 1D6VL 1MCEA 2VL5A 1T4KB 2ITCA 5EU4B 5DJ6A 5BV7H 4WY7L 1F97A 2UWEB 1X5YA 2FEEL 1BREA 2P8LB 3SDYL 5FCUH 4DEPB 2FJHA 1ZTXL 2EE6A 1MWAL 4IOFC 5B22A 3FFDA 3BZEB 3X13B 1EEZA 5I18H 1F90L 1AGBA 4NM8L 1XGUB 3KPSE 3QCUH 4J7RA 5TE4H 4MJ6B 3O2VH 1FNSL 3D0LB 4LVOC 3V4UH 3TPUA 3NN8B 3QA3B 2Q6WB 4G6JL 2NW2B 4PJAF 5IEKB 2AJUL 3FO2A 4WNQA 4TSAL 4JPVL 2CGRL 2DD8L 1H5BB 4GG8A 2NXYD 4X98A 5DMGD 1MUJB 2ZCLH 2GSIA 3BKCL 4IBLT 4K8RC 3SDDB 4W6WB 3QCVH 4NQEB 4L3ED 4XBGB 5GZOD 2PW2B 3QBTB 5LWYL 4Z77B 4Y5VC 3R06A 5T3ZH 3IFOB 1FAIH 2CQVA 4P2RB 5D2NE 2JCCE 4P5KB 4UBDD 5D8JL 3RAJL 1DL7H 3VFOB 2VZSA 3RHWK 1CTOA 3F58L 4EDXA 3SO3C 3QEUA 1TPXB 2P47B 1Y6NR 1I3GH 3ULSB 1QVOA 1WBYB 3PQYD 2AEPH 1MJ7H 5EC1A 4X6DA 3SOBL 1CS6A 4MZ3A 2EE9A 4HJ0D 1NAMA 1JFQL 1KEML 5CWSA 1QPPA 1KIQB 1X5HA 4HQQH 1KG0B 5C9JB 1XF3A 4HGMA 5KS9F 5DSCA 3KYNB 3V95A 2P5EE 1JK8A 4ZUSB 4HFWA 2EO9A 2BY1A 4B7IA 1T83A 3VGDA 1G7IB 1MJ8H 4L1DA 4U6VL 1DBMH 4OD3L 2P7TA 5ACLA 1ZHNB 5EOCH 3NIDF 3FL7A 5SV4A 4I9WD 4XX1G 3EYQD 3FN9A 1G9EA 5CSZB 1BPVA 3TF7C 2HVKB 3V52L 3VFSA 3SJVB 3BZFB 5CEZH 2A2QT 4Z7VB 4MJIE 4U7MA 4NKDA 1RY7B 5D7SL 3OR7B 4XVSH 3Q6GL 3WUWB 4U6YB 1YEEL 4FFYH 4N5UA 4AQ1B 3IXTB 3T0DA 4NGHL 4PP1C 2HT2C 2FX8H 2X4SB 1IBGL 4A2LA 3MRNA 5JXED 4Z18A 5L8JB 1LDPH 1VADA 3GRWH 3QXUA 5EO9A 2VDQH 2Z9TA 3PWPA 4WW2C 2R56L 4URTB 3L5WA 3MFFA 3ZZ1A 1MHCB 3CD4A 3FN0L 1X5GA 1G7HA 1JRHI 4PY8I 4JFQA 2EIZB 5KVMC 4JGMA 1VDGA 1A1MA 1WFUA 3G5ZB 1S8DA 1CGVA 3RWGA 5HPOA 1JTTA 3B9KA 3QUYB 1HHJA 4OZGF 1X5XA 1ZV5A 1BFVL 3SKNB 3OF6A 2APTA 3S35L 4ONHA 2FJFA 3U7WL 5ESAA 3BGFC 3L3KB 4O51B 1N2RB 2WWKO 1CIDA 3C5ZC 5GIRB 1K8DA 5JNYB 3ESVF 5F9WB 3TM6A 2J2ZA 4ODHH 3GSVB 2VQUA 2AEWA 4PUBH 5I1LB 3P4MB 4LFHG 1KJ2H 3NACL 3MV7D 4OZHB 3LRSB 3C87A 5T5FL 2NR6C 3G6AA 1CD0A 1UWGH 1TJGH 1IMHC 4DVRH 1NGZA 2YPKB 2C9AA 3H9SD 3OKOB 4KKNA 2R0ZL 5LXGH 1OM3L 1OP3K 1S7WB 3TN0B 3OKMA 4HMEA 3HC0A 8FABB 1Z9OA 3I02B 3T3MF 3KNBB 2AW2A 2QQNH 3PWJA 3GMLB 2CLZA 1WZKA 3RVUD 1NQBA 4HULB 3MOAH 4HWEH 1WFTA 3IKCB 1P2CA 1H3PL 1T03H 4NNXB 3O41B 2AK4D 4JPKH 5ICXB 1P7HL 3QQ4A 3ZKNC 5EC2A 1R3LA 1XR9A 3BSZH 5TF0A 2YPLB 3MCKB 3QIBB 3GMOB 5SWQA 5FHAL 3CC5A 3RZCA 2RCSH 3FTGA 3U9PH 1IT9L 2YS4A 2A6DA 2EDDA 5DVLA 4PGDB 4AM0A 3L3HA 1IM9B 3EIFA 2BVPB 4JN1H 4ODXB 1HHKA 1KLGA 2AJVH 2BNQA 2EC9U 2NX5D 2CIKB 1RZKL 3BT2L 1RIVL 3GMMA 3QDJB 4O5LH 3GMRA 2FHBA 1T1YA 2X7LA 4H25B 2EC9T 5M7QA 5DJYA 3LHPL 3MRFB 2WV3A 2WLZA 3QQ3A 4HC1A 4F58L 4PRHD 4CJ0A 1NLBH 5T3XL 5I66A 4NKQB 4YHPA 5ID0A 5HHOB 3GI9L 3WIFB 1YA5A 4MXWH 5I8KL 3VXRA 2WBWB 1OGAA 2P8MA 4OCWL 3D2UD 3CNKA 3MMEB 1A7PL 1P1ZA 1CLOL 5HI5D 4KI5C 4FQLH 32C2A 1ZEAL 1ETZB 3RPIA 1MJUH 1VGEL 4LCWD 1HQRA 3PABB 4OI8A 1MFNA 4PD4K 2R2EA 3K1KC 3VE0B 3QH3A 3C08L 3D39D 4Q74A 5CGYD 4KRPB 1LK3L 3MXWH 4QXGH 5I1HL 1QFWI 4CAGA 3RA7L 2R0WL 1FN4B 4P2QD 3M17B 2N4IA 1BQHA 2IGFL 4Z7UF 1QQDB 4WCYH 1A7QH 1NCUA 1YEDB 1CL7L 1RUAH 1DFBH 2DQEL 3VGEA 3FO9A 5A3ID 1SVCP 2EYRA 4JG0L 1F42A 5EDXA 1MNUL 1OQOA 5I8EB 4ZFGH 4I18A 3O3BB 2WAHA 3MRIB 5CEYA 4J6RL 3L7EB 3C60A 2AV1B 4KDTA 1T89C 5IJVA 1CD9B 4L3EE 4W6YB 3LS4L 2IH1A 1CYGA 3QEQA 5DGQA 2DWEB 4BSVB 1S9XB 2JF1A 2G9HB 2RBLA 3BZ4B 3EYFA 4LSVL 1LO3L 5FOJA 4PTUA 1T7WA 5JDSB 1Z3GH 4H20L 3VH8B 1FRGH 4WGVB 3SDXB 3K8MA 3FKUS 4DKFH 5EORL 2YRPA 3IGAA 4ONFL 3AM8A 4PJBB 3D9AL 1G7PB 1LHZA 2HRPL 3FZUD 5T1KD 4DVBA 2X4OB 3BQUA 4H1LA 5F3HA 5F3BB 1K8IA 1LEIA 1CXEA 3GSRB 1T4KA 2DIJA 1EK3A 4IRSB 4KHTH 5EU4A 5EA0L 3VXTB 5MENB 5JOPD 2UWEA 2VLLB 4IRJC 3STLB 2P8LA 5EULV 1ZGLM 2YPVH 2W59A 5EWIH 1X3DA 3BZEA 2ZOKB 4YFLF 3X13A 3CLEH 4LVHB 1VFBB 3FO0L 1XGUA 2DYPB 4MJ6A 3D0LA 3ZKQD 4D8PB 3NN8A 4I9WE 3QA3A 2Q6WA 2NW2A 5IEKA 4X9HA 5JHLH 2PYED 1VFMA 3UPRB 1H5BA 1IC7H 4KJWD 1ZLWH 3I2CL 4UT9H 4L4TD 1MUJA 4LHJB 2QJDA 4D2NA 1KCVH 4OGYH 3TV3L 2ADGB 3SDDA 3VXSB 4Z7QE 5E2TH 4NQEA 2ORBL 4XBGA 4G6MH 2PW2A 2PCPB 2D7NA 2CKNA 1GC1L 3IFOA 4P2RA 4MAYD 4P5KA 1IAKB 1AHWB 4OCRH 1MRDL 2YA1A 3KS0J 3RY4A 3VFOA 5C70A 4I3RH 2Z8SA 1C7TA 3DI3B 1FPTL 3CPLB 1NCBL 5C0CD 3D0VB 3ULSA 1WBYA 1XF5B 1T22B 2K7QA 4JQVA 4NO2B 4U6HB 1RUQH 2FDBP 2E6JA 1DQDL 5E00B 3BPLB 1KIQA 1KG0A 4HXBL 1F13A 3KYNA 4ZUSA 1YQ2A 2IH3B 3LY6A 2Z92B 4HJGB 4YDKL 2NY0C 5MI0B 3E8UL 1G7IA 1FH5H 3W82A 4RAHA 2IPKA 1ZHNA 3KPNB 3KYOB 4UQ2B 4N9GB 5JIHA 2HTKD 2OBGA 4P2CG 2QLVB 4UNUA 2HH0H 4FMFA 5AUMB 5CSZA 1LMKA 2BC4B 2HVKA 5EU7E 3SJVA 3BZFA 3UXFA 4HCRL 5EU6B 1CGSL 1RPQA 4Z7VA 2ZCHL 1WEJH 2N7AA 5F1SA 4JB9H 3MV7E 4U6TA 2FH8A 1OAUH 2XWTB 3OR7A 4ZUWB 3W5MA 4LVNB 3WUWA 4U6YA 4U05A 1R0AH 1INQB 3H9SE 3NPSC 3IXTA 4H0IA 2BFVL 4WTZA 2W0KA 5DR5L 3EDDA 1AP2B 4RX4D 2J8UE 2X4SA 1YJDH 3LDBB 3LS5L 1N4XL 4OIIL 2B0SH 4OZIE 3UTTB 3CFIC 5E4IA 4AG4L 5I1IL 1JGEB 2OI9C 1DLFH 2WWMC 2PR4L 5CD5D 1MHCA 1ULVA 2VLRD 2VQTA 1E4KA 2B20A 5ESVB 4MJ2A 4K2UL 3T0EE 2EIZA 5HYIA 1L7IH 1FGVL 3CCHB 2GQHA 4Y4HB 3AB0C 3G5ZA 3KXFD 1IGTB 5I9QB 4E42B 1KBGH 4NZUL 3QUYA 5D7IE 4B7LA 3SKNA 3QIWB 2VXUH 5EU3B 1IGYB 1P69B 1JHKH 3TP4A 3L3KA 4O51A 4ZDHB 5BCAA 3OKLA 4LSPH 1J1OL 1N2RA 4LK4A 5GIRA 4EUPH 1CLZL 3TBTB 3VGAB 2CH8A 5JNYA 4MA3B 4I5BB 2APVA 4PY7B 5KZCD 4OIBA 2P24B 3GSVA 5I1LA 3P4MA 4U0RC 2M1KA 3LRSA 4OZHA 2YK1H 1BJ1J 5CS7A 3K3QA 4OF5A 5SWSB 2C3XA 3C2AH 2FD6L 1JTOA 1L0QA 3LV3B 2YPKA 4HMCA 3OKOA 3LZFH 4ZSOE 3F7YB 4H8WL 4I1NB 1S7WA 5IHZB 1KTLB 4LQ1A 2PO6B 2IALB 8FABA 1BVLB 3I02A 5HDLA 3KNBA 2ZUWA 3EKCA 2XACC 2FYYB 1KB5L 3GMLA 3INUL 3ARZA 3IDUA 3ZT6A 3GM8A 2EH7L 2GJJA 4XP4H 3T09A 3IKCA 1UZ6E 5IB5B 4NNXA 3O41A 4PJEE 2ZUQC 2X1XR 3IF1B 3X17A 1VERA 5ICXA 2EDWA 4PJHB 3KPLB 4XBPB 2IG2L 4K94L 2YPLA 3MCKA 3QIBA 3GMOA 1H9VA 2FGWL 4PGDA 4PJIE 3MV01 4I0PB 4XCNB 5DEFB 1IM9A 2BVPA 2F5AL 4ODXA 4C56D 1U8HB 1AE6L 1JBJA 2WWKT 4WUKL 2CIKA 4M62L 5F1KC 1YDPB 4IIQC 1E4JA 4JFPA 3QDJA 1NAMH 4LPTA 1RK0B 3UJIL 3PXJA 4H25A 3QEGL 2V2XB 3MRFA 2NXYC 4UTAL 5DMGC 4Z7WF 1E6OL 4LCIH 1EGJH 4D9LL 2IBGA 5CINH 5TF1H 1JHLL 3UCRA 4G6FD 3V7MA 1UCBL 2V9QA 5GZOC 3WIFA 2FO1A 4IEFB 4Y7MA 1U9KA 5H35A 1MWAB 5F6IB 4G8EB 4L9LB 4UBDC 3HZMB 5F88B 4XNYL 4UNVA 3ZE0F 3MMEA 2DQDH 5H37G 4M7LL 3HE6B 5CJOH 3FQRB 4PJ5B 3SGJC 4K9EL 3OB8A 3QFDB 4EQ3A 5IV2B 3NA4A 1ETZA 1JPSL 1TVHB 3TJHC 5F8RC 25C8L 2OL3B 3PABA 3TO4D 4F9PC 5JOPE 1UB6B 4HJ0C 2ENSA 4YK4C 3VE0A 1HCFX 3OKKA 2IWGA 2CMRL 1FN4A 3M17A 5A43C 1PSKH 2W60B 2DQCL 2NCMA 1QQDA 4Q0XH 1YEDA 4I77L 4MDIB 4OJFL 4KMQA 2DLHA 3BN3B 5M94B 5DURD 2PYEE 3H42H 1WSST 5ILTL 2YD5A 5I8EA 3GHBL 3EYQC 4FQ2L 4BFIB 4L4TE 3O3BA 5LCVH 3MRIA 3HRZB 2VN7A 3RY6A 3L7EA 1T2XA 2AV1A 3HZYB 1FNEB 2VAAB 4BSVA 1FFRA 2DWEA 1S9XA 2R1WB 2G9HA 3BZ4A 4G8GD 1L9NA 2JB5H 5JDSA 1MREH 1CR9L 4I3GA 1X4ZA 3VH8A 3VU2A 4OLUH 4DK3A 4PJBA 4QRSB 4U1GB 4Y16B 1G7PA 4UOJA 1LEGB 5JXEC 1U41A 3B83A 2X4OA 4KQ3H 2GK0B 3UBXG 5F3BA 1MAMH 4WV1B 3GSRA 2C3HA 4IRSA 5IHUL 1CDCA 3M45A 4N8VG 3VXTA 5MENA 3O2DL 5KVFL 2VLLA 3STLA 4X9GA 2H32B 2VO5A 4GLRI 2L7JA 4MA7L 3NZHL 4K55A 2ZOKA 5I1JH 1F58H 4NCC2 5F7DB 1CFVH 1VFBA 1EEYB 5DVMA 4FP8L 2DYPA 4ETYA 3WXVH 5IQ7H 4QRRE 1V7MH 1P7KB 4D8PA 5SX5H 2XQYG 2Y9RT 4EUPG 4XNXH 5GGSB 2KZ1B 4WO4D 1FG9C 3RVVD 4LMQI 3ZTJH 5FYLD 4EQ2A 3DO3A 1KSRA 5GGQH 3PGDB 2ED7A 2ADGA 5J11B 2DLGA 2AXGB 4HUMB 5EU7C 3VXSA 3L5JA 1DDHB 4MHHG 2DMCA 1F3DH 2PCPA 1IAIL 5D1ZB 3DNKA 4S0SD 1WZ1H 4KMTL 1IAKA 1AHWA 4OM0H 1MFCH 2YD6A 4ZOAA 3P11L 5SWZD 1RURH 5CEZE 5IVOA 3FFCB 4V1DD 3QP3A 4X4ME 2UV3A 2GEEA 3AS0A 4PRPE 4JKMA 2ZZUT 4JHBA 1O7SA 3CPLA 3D0VA 3SDAD 4OZ4B 4XP5H 1XF5A 1T22A 5IB2B 4ALAH 4HC1H 4NO2A 4NQDD 4U6HA 3RVUC 1Z5LB 4LPXA 1LP9B 1V3MA 2V2TB 1KCKA 5E00A 1G84A 4U0QB 4LCYB 4LP4A 4Z7OE 3MTRA 1UCTA 4LLYB 5GGTA 35C8L 5C07D 2AABH 1RJYB 4G7VH 4LARL 4NQCD 5E7BA 1I1AB 1NMAL 1XF2B 2IH3A 1UT9A 2Z92A 2YUWA 4HJGA 5GJTH 5HDBE 2ZG2A 5CILH 3RZWA 3KPNA 3KYOA 1QFPA 4UQ2A 4N9GA 4KGLA 4UDTB 5LGHH 2CDEB 2ZPKL 1J18A 1EXUB 4H0HB 5AUMA 2BC4A 2BY2A 3UZVB 2DDQH 1S7VB 5EU6A 4CN1A 5E5RB 2HKFH 2XWTA 4ZUWA 4QOKB 4DUWA 3W9EB 1OCWL 1BFTA 1GPOH 1INQA 3REVB 1EH9A 3VW3H 2YD4A 3DHJA 4PJFB 4TSCL 1AP2A 5AG8A 3MBEB 3PL6C 2HT4D 2DLEA 2OXGA 3QO0B 2VDKH 1X4XA 3QHZH 1EFQA 1CDBA 3S4SG 5TDNB 1MCNA 3UTTA 1JGEA 4AMKL 3OJDB 1HI6B 5FKPB 5HI5C 1QFOA 4N0YH 1T5XB 5ESVA 3EYOB 4HBCL 1S7RB 5MEQB 4KY1L 4APQD 5C0BB 3CCHA 5E2JA 1BM3L 4Y4HA 1IGTA 4E42A 4YDLB 1GGUA 5L0QC 5EZIL 5I1CL 2KL6A 3QUKB 3ARUA 2ZOLB 3P40A 5CGYC 4E9LA 4JVPA 4MNQB 5LAXA 1ZANL 3QIWA 1CICC 1S7TB 1G1CA 2AKRB 5EU3A 3TT1L 1IGYA 2ZJSH 3QSKB 3UJTL 4OD1L 4ZDHA 5TQ2L 4OSUH 3FQWB 5C7XH 3TBTA 5A3IC 4WW1B 4MA3A 4I5BA 4OCSL 4PY7A 2P24A 1HWGB 5K59E 3HZKB 1KCSL 3VD5A 2WUBL 3WDJA 5SWSA 4YHZL 2JKXA 3LV3A 4HKBB 3EDJA 3KJ4C 3F7YA 3P0GB 4HFUL 5IHZA 1KTLA 2FLRT 2PO6A 4GRWF 2IALA 2XI9A 1BVLA 1C5BL 3O11B 1A1OB 4M5ZH 1L6XA 2FYYA 1P5VA 4UV4H 5AYUH 1IGML 5KS9B 5IFHL 5FA4A 1MJJB 4RMQA 3FZUC 5DJXB 1VGKB 2CJUL 4QNPF 5IB5A 2YHGA 3P73A 4W70A 1P84J 3IF1A 1UH3A 2NW3B 4PJHA 3WFBL 3KPLA 4XBPA 3O9WD 5CZVL 4X9IA 4Q58C 4L5FH 3EYUL 4GXVH 4HF5L 4I0PA 1YY8B 1NLDH 3OAUH 4XCNA 5DEFA 2QTEA 2LQRA 3AMKA 2A6IB 2GUOB 1K4DB 1IARB 1A4JB 1U8HA 3PGFL 3ZTJG 4NZRH 1JGDB 4OB5L 1CDJA 1E0OB 3QFJB 2R4SL 1YDPA 1SEQL 1FIEA 1YMMB 3IFPB 3WN5C 1RK0A 2F53E 4RMRA 4YPJA 1T66D 2V2XA 4KJWC 5GRJH 4P23B 5BMFH 1KOAA 2QSCL 1A6WL 3G04B 1XFPA 4G8GE 4JO2H 4K7FB 3UTOA 3AMLA 2QADD 3ZE2E 4Z76B 3WV0A 4BQ8A 3JV5A 4AY0A 3EFDH 3GBLA 1EHNA 4G8EA 4L9LA 4MAYC 4NQUA 4RGMB 3S34H 1F11B 3HZMA 5F88A 2DIBA 2V5SA 3HE6A 4GUPA 3PDDA 1B0WA 3FQRA 3O6FD 4PJ5A 3RGVD 3JWDC 1Q0YL 2IANB 2GY7B 3QCTL 5LJYH 3QFDA 5IV2A 2DL2A 2YD9A 1IFHH 1TVHA 3VXMD 5J8OA 4OZGB 3MRCB 5DK3A 2OL3A 3O4LD 4D0DB 1UB6A 3D3VD 1S3KH 4X8XA 5IMKB 3VXQB 4QHMB 3ULVL 3MA9L 3I6LD 1NEZG 3IT8D 5AZ2H 3U4EB 1I9RL 2W60A 2YWZA 4R3SB 5D72H 3VFGH 1DUZB 3BAEL 5KW9L 4YO0B 1KIUA 2E3VA 4XPBL 4MDIA 2V17L 4R9HA 1NAKL 2EDEA 2OXHA 1VACB 3G5VB 1F02I 2CDFB 3X3GL 2HTKC 3C6LD 5I15H 2BJML 1RULL 4BFIA 1I8MB 1Z9SA 3DIFB 2XOTA 1NGQH 4M6NH 1PQZB 4YC2C 3HRZA 5DD0L 2MQ3A 3TA3D 3QG6B 3DJ9A 3HZYA 2WBJB 3QO1B 1FNEA 4CKVX 1FSKB 2VAAA 2R1WA 1KB9K 1N6VA 1ZGLP 1JGLH 4RBPH 2GAZB 5ISZD 1QLEL 3I9GH 3L5XL 4X6BB 5JQ6L 2ERJC 4CL7A 1MQKL 1RZJH 4QRSA 3WJJC 4BELD 4Y16A 4YLQT 1LEGA 5E94B 1IKFL 1RQ5A 1MHEB 3DSFL 3VWKB 1CT8B 1SJVA 4WV1A 4FHBD 1B4JH 5CD5C 2IQAB 4N1HB 4YHOH 1DQLL 1HQ4B 3WHXB 4NQCE 1RJZB 5DJ8B 4AK1A 5KSAB 5IW3A 2H32A 1NCNA 2A6KB 2A77H 5DHXB 4JM4L 4LKCB 2UVFA 1FL6B 1I8KB 4WWID 5F7DA 1EEYA 1I8LC 2DAVA 4HIXH 2VQ1B 4YJZL 2OJZL 1OAQH 1VEMA 1P7KA 3KPPB 1LO0H 5GGSA 4LCUB 3V0VB 3R8QA 2EIBA 1YEHL 4QLRA 5BS0B 1F2XK 4XPFH 1ERNA 1MIEH 3PGDA 5GGVY 3V2AR 1CLYL 1DDHA 5DQDL 2P5WB 1GGBL 4NKIH 1XGQB 4ODVH 4YHNB 4MB3A 1CDYA 5D1ZA 2D7OA 4DQOH 5E2UL 1JF1B 1ZE3C 3MJ9L 4P3CL 2A9NH 5KSBB 2MSPA 1NC4D 4PJDE 3FFCA 4DGVL 5J12B 5AWNH 1B0RB 4LHQB 4FNLH 4O58H 3V6OA 4UTBL 3W2DH 4ONOA 4OZ4A 5IB2A 1L7TH 1Z5LA 4XC1H 2V2TA 3OXRB 4HG4J 4LCYA 4JVWA 1RJYA 3CX5J 1PZUB 4AEHH 4R90L 3WBDA 1CZ8H 5CUSH 1I1AA 4LCCC 4YXLH 2VUYA 3KJ6L 4KK6D 4JRXE 1FZJB 5E8EB 3UC0L 5FUZH 5FO8B 3RL2B 1CFSB 5HYQB 2CDEA 3BUYB 1EXUA 1S9WB 5GRVK 1KB5B 2NQCA 2X6MA 1F6FB 1S7VA 2DQTL 4IDLA 5EBMB 5LG1A 2HT3D 4EI5B 1DQML 5FO7B 3VXNB 1BJ8A 3JZ7A 4Y2OA 3DYMA 4QOKA 3ECBA 3W9EA 2QQKL 4KK5D 4JRYB 4HWZB 3F7PC 3REVA 2E7LC 4FQPA 2LV4A 4PJFA 3G6JF 2XZAH 3MBEA 3QO0A 4AENB 4EXPX 4XPTH 3FOLB 1KT2B 2R9HC 5A16B 5ID1B 1O0VA 5TDNA 5C2BH 2BY3A 5IMMB 3OJDA 1HI6A 4NN7C 5FKPA 3AUVA 4JFFB 1T5XA 4E5XB 3E6HB 3EYOA 5ALBH 3TZVD 4WFGD 3RWJB 1S7RA 5MEQA 2Y23A 2NY1D 4NO3B 5C0BA 4NCDA 3TO4C 4U1HB 4DGIL 4G3YH 3GMPB 4RQQB 4DTGH 3T0XA 2XKSA 2ZOLA 2V5TA 4F33B 1X5JA 4MNQA 1I7RB 2D03L 4OLVL 5JMRA 3DUSB 1S7TA 4R2GB 1R6VA 2AKRA 3K7UA 4POUB 2VISB 3OKYA 1W2KT 3BUTA 4DUXA 3FQWA 2IJ0C 4WW1A 1RUPH 5FEBA 4HLJA 2EKSB 5ACZB 1NCWH 3HZKA 1NKOA 3C5SB 1KNOB 3T77B 3BPNC 4LP5A 4R97C 4BFBD 1I7UB 1P84K 3VG0H 2Q3AA 1IGFL 3B9DA 3F6LA 4HKBA 2EDHA 5J1SC 3MLZH 4P3DB 2W91A 4Z7NE 4OCNC 3U4AA 3MSPA 5CBEB 2F8VA 5I71B 1IM3B 2IEPA 3AGVA 1K3ZA 5JW3L 2BVTA 5LGJB 3O11A 2NY5H 1MI5D 1A1OA 2AJZA 1FIGH 2NZIA 4W6XB 3T65B 4TPRH 1RUKL 2L0DA 4YEEA 2VDPH 3ZL4H 4KZDL 1LO5B 5KS9A 4QTHB 3MFGB 4W81A 1VGKA 5DJXA 2VXSH 3O4LE 4KROD 4DN4L 1JE6A 5CLTA 2DQJL 3BPCA 2NW3A 3D3VE 1OAYL 1MRCL 3GI8L 5DK2B 4LDLB 5E0QA 5DD1H 3DO7B 3JWOC 1QFUL 1B3JA 3CMOH 1YY8A 2GYSA 4KI1A 5EOQH 2A6IA 1MFAH 1K4DA 2GUOA 1A4JA 2VB5A 3MLVH 4JPWH 4M7KH 2QSQA 1JGDA 3QFJA 3O6KL 1PW3A 1G9NH 4YHLH 1YMMA 3IFPA 4WO4C 4HXAL 1J5OH 2XIDA 5CJ8A 2KH2B 5GGTH 3RVVC 5BV7L 2FEEI 3G04A 2G75B 3VJ6B 5FCUL 5GS2H 2M8XA 4K7FA 4KUCF 2DTSA 5CJBA 3ARYA 3DTXB 5DWUH 5I18L 4Z76A 2VLJB 2R23A 5ISZE 1DBBH 3O2VL 3V4UL 1T0PB 2JJSA 1BF8A 1F11A 1IAMA 4XXDB 4YHKH 5JW4N 1PAMA 3SO5A 3QDMB 3IYLW 5D7JD 4XGZB 2IANA 2HFTA 1YNKH 2ZCLL 2DLIA 4UIKL 2D9QB 3QT2A 4P46D 4GRLD 5DUBB 3UTZB 4OZGA 3QQ9D 3MRCA 3X3FH 4YIQB 1NC2D 4D0DA 5TDOB 5IB4B 3LD8C 3S37X 5T3ZL 3MUY1 2ARWA 1Q9KB 5B8CC 4K3DH 1L9MA 3WSQH 5IMKA 1QP1A 1JL8A 4QHMA 3VXQA 4JO1H 3CSGA 3U4EA 5JO5B 4R3SA 1DUZA 3K4AA 2BSED 1GGCH 4RGNB 4YO0A 1DN0B 3ULUC 1INDH 2Z4QB 1I3GL 5GJSH 1VACA 3G5VA 2CDFA 1EPFA 4KKBD 3VFNB 1I8MA 1QLRA 3DIFA 5HI3D 1PQZA 2N7BA 5ICZB 2HFGL 3QG6A 4HQQL 1CGUA 2WBJA 3QO1A 4NNPH 3MZGB 4K3GA 4XMLH 1VFAA 4HJJL 3MRBB 4HLZH 2EE2A 1UXSB 2GAZA 3OB0K 4OCYH 5T33H 4N90D 4EBQH 2GFBB 3EBAA 5EOCL 2VLMD 4X6BA 1J0HA 5E8DL 4G9DB 3Q1SH 5DQJB 3VCLB 1N6QH 2XRAH 2HT4C 5FM8A 5DO2D 5E94A 3RU8L 3DV4B 1MHEA 1ZT1B 1FLRL 2H41A 3ROLB 2VN4A 3VWKA 4X4ZA 4JDTH 2A6JB 4KQ4H 5EH1A 5MEPB 5J9PB 4R0LB 1ZS8B 2BNQE 1TJHH 2IQAA 4XVSL 1B4RA 3MOBH 5T1DL 7FABH 2YUXA 3ALWA 1HQ4A 1A3RH 3WHXA 3LVEA 5INDB 5DJ8A 1RJZA 4FFYL 5KSAA 3QUZD 3DX9B 4APQC 2A6KA 2J88H 1FV1B 4LKCA 1JZ7A 2P48B 1SJXA 1FL6A 1UKQA 1I8KA 2FX8L 3QRGH 1NBQA 1T21B 3W0WD 4HH9B 2P1YA 2VQ1A 1LDPL 3GRWL 3S36X 4ELMF 1E6JH 4HPOH 3ARBD 3KPPA 4Z7WB 2VDQL 4LCUA 3V0VA 1KC5H 2JJTA 4S1SH 1UKSA 2HTLD 3TWCH 2CR3A 2Z93B 3VXRE 1A7NH 5F70A 1OGAE 4HKJB 5BS0A 4O2FB 4X8JB 5C0JB 3TN0D 4R8WH 3CSBA 3LQAL 5L2KB 2HP4A 2A83B 1XGQA 1U8NB 4YHNA 1PG7W 5SX4I 3UDWC 4NC2B 4HG4K 4GG6E 4P2OB 1JF1A 3F8UB 5KSBA 4NO0B 4MVBD 4J3XA 4JANB 1B0RA 2WMPA 3NCCB 3R1GH 1J12A 2YR3A 4WENB 1HZHL 2V5RA 1CK0H 2F58H 4MD0B 4NHUB 3CXDH 1D6VH 4ODHL 2AI0L 3BX7C 4PUBL 1KJ2L 4WFGE 1W0YT 3V4PL 5C0FB 3OXRA 3QIUD 12E8H 5AG9A 3Q6FB 1UWGL 1BAFL 3J7HA 4DVRL 4K8RL 1ZTXH 3QDJD 5KANI 1MHPL 1G6RH 1TNNA 3O9WC 5LXGL 3S5LB 4L3AA 4GW4B 3OTTA 3V0AC 2ATKB 1W8NA 3EZJB 1FVDB 1FZJA 5E8EA 4KI5F 1FNSH 5F7EL 2X1OA 3HFMH 3RL2A 2QQNL 3QEQE 1KXVC 4ZUUB 3ZHDA 5HYQA 5DGRA 2EXYD 4WEBL 3O6MH 3BUYA 4JPVH 1QKZH 1S9WA 2CGRH 5T1MB 4PV8B 2DD8H 4HWEL 5D2LF 5HHOD 2OL3H 1OP3H 1KB5A 1PVHA 4XNZB 3ULUH 3F5WB 4WTXA 1IC4H 4JPKL 1A8JH 5EBMA 3BKCH 5HI4D 3BDYH 4EI5A 5FO7A 2LAGB 3MODL 3VXNA 1T66C 3BSZL 4YFEA 2JIXB 4ZNEE 3U9PL 1P9MC 4JRYA 4KV5E 4HWZA 3BE1H 2QADC 3B8SA 2NMSA 5D8JH 4XP9L 4JN1L 2AJVL 1A14H 3DUHA 2HVJB 4FA8A 2UWEE 4AENA 1QBMH 3FOLA 1KT2A 3R0NA 4O5LL 3ARGB 5A16A 1MCWM 5ID1A 4KAQH 3TO2B 4CN4A 5ADOH 5IMMA 3HMWL 3SOBH 3O6FC 4DGYH 1I4FB 1KENH 3RGVC 4JFFA 1GOHA 1JFQH 1KEMH 4OBSA 4E5XA 3E6HA 1Q9OB 5IESH 3N1GC 3B2VH 4JLRB 3RWJA 1NLBL 4JEGB 4NO3A 2FATL 3TYGH 1WWAX 1MFEH 3HNSH 1G1YA 5FHBH 5FV2A 4U1HA 2H8PB 3GMPA 2JCCF 4RQQA 4MXWL 2YKLH 4F33A 5ITFB 2NLJB 1I7RA 4OD3H 1J9CT 1I9JH 3DUSA 3IRPX 5FKAB 4NQEE 5IG7B 5IHLB 1FYTD 5EIVA 2VISA 4YEFA 2LU3A 2VZTA 4P2RE 1MCLA 1MJUL 4M03A 1A3QA 1EO8H 5FYKH 4M43H 2Q86B 2EKSA 3C6LC 3LB6D 5F7KC 5ACZA 2IPTH 1EAJA 5D7SH 2ARJB 4WWKD 3LEVH 3SDCB 3C5SA 4BH8B 3TA3C 1KNOA 3T77A 4QXGL 5E6ID 1YEEH 5HVHB 1I7UA 5F7YC 3SGDI 2F54D 2X5PA 3P77B 1CL7I 4P3DA 4RSVA 5CBEA 1A7QL 3TNNB 3BEVB 1IM3A 4M1DH 2PKDA 1DFBL 1UADC 5LGJA 5F72S 3MACL 3T65A 3L3OB 5E8OB 5ERWB 2R56H 4YE4H 2RIKA 1FFPB 1LO5A 4QTHA 4L29B 4TN9A 3FN0H 5GISH 2UY7A 1B2WH 4P5TB 3HR5B 4LSSH 3D1MC 4YGVB 2NXZB 2A1WL 3BP4B 1Z3GL 3DO7A 1FRGL 3CMGA 3I3EA 1BFVH 3JWNC 4PG9B 4DKFL 4Z7VE 2RJMA 3S35H 1KXTB 1N0XH 3EYVB 1XZ0B 2R0KH 5FM4A 3U7WH 4OF7A 3GMNB 1A6VH 2YXMA 4M7ZB 1NANI 5E9DB 2B5IC 2JE8A 4KHTL 2AJXH 1R5WB 5JHDB 1GZQB 3WUZA 3NCYP 3MLRL 5CSGA 5FM5M 2G75A 2BHYA 2MCPH 2WW8A 3QG7H 3QXAB 3VJ6A 3FB8B 5EWIL 2ZCKH 3MREB 3MQIA 3DTXA 2WLYA 3HE7D 2VLJA 3DXAD 2GJ6B 3QR2A 3C6SB 2XICA 4XXDA 3MLYH 3WNPA 1A7RH 4NKMB 5EBWB 3QDMA 4XGZA 1AH1A 1IC7L 4UT9L 2C4XA 1KCVL 4OGYL 3WKMH 3UTZA 3L3DB 5DUBA 3IU4H 1WT5A 4YIQA 5E2TL 5TDOA 5IB4A 4G6ML 2HJKB 5IW6B 1TQCB 4BZ1H 5L2JB 1YEJH 1Q9KA 5CAYB 1I8IB 4YBQD 2IMNA 4OCRL 1IT9H 3EHBD 5TQ0H 4E41D 4UT6H 5CZXD 4I3RL 3ZTNL 1JNNH 1U3ZA 4KK6C 5JO5A 3GEWB 3IDYC 4OZHE 3C8DA 5ANMB 1DN0A 3WO3B 1FORH 2YBRB 4J2XA 1RZKH 3BT2H 4XMKL 1RIVH 2Z4QA 3VI3E 2VC2L 3VFNA 4O9HL 1F00I 4FXKB 2OTPA 2CO7B 4LIQH 5TFSH 5ICZA 2HT3C 4WHTB 4OLWH 3MRBA 1P7QD 1UXSA 2ZNWA 3RY5A 3EW3B 5I8KH 1NUNB 5D71L 4KK5C 3CDYA 4KC3B 1QRNA 4OCWH 2GFBA 4M00A 4G9DA 5FYJH 2YPLE 5DQJA 5HYFA 2HH0L 3DX6B 4D9RE 3E0GA 4OGXL 5FUOL 3RFZC 3DV4A 2V5YA 2VLKD 1ZT1A 3L3IA 3ROLA 1FZOB 3ARDD 4UOW0 2A6JA 1WEJL 3BRFA 4JB9L 3T4AB 2HLAB 5MEPA 3HPLB 3T8XB 5J9PA 4R0LA 1ZS8A 1OAUL 5IWLC 1ODAA 4ZFFB 2ESVB 4GAGH 3TZVC 1V8HA 5INDA 1SJHB 1EMTH 3QDJE 2NY1C 3N06B 3DX9A 4N5ED 1CG9B 1FV1A 5DZLA 3VDBA 1T21A 4LU5H 1QR4A 4HH9A 3UTSB 2AP2A 2DQEH 2OMNA 3O4OB 5D6CB 4Z7WA 4Y4FB 3HR6A 3JUYA 1CFBA 1DLFL 5HHOE 3U82B 2Z93A 2WP3O 5MHSE 4HKJA 4O2FA 2X4PB 5C0JA 4J6RH 3NFNB 5DUPL 1L7IL 1UH4A 1HILB 5L2KA 2CDGB 3LS4H 2A83A 1D6EB 1SQ2N 1U8NA 3LKSB 2Z31B 1X6NA 4LSVH 3N0PB 2WM0A 5C0AD 2O5XL 1QFWM 4D9QD 4P2OA 5C1MB 4NO0A 4WJ5B 1BD2D 1JHKL 4OTXH 4F2MB 4JANA 4ZXBB 1V3LA 1J8KA 1T1XB 2PXYB 3S7GA 1CXHA 1H3VA 2WQRA 4MD0A 4NHUA 2CLRB 5J13B 4K71C 3OZ9L 2AJYH 5C0FA 4ZYKB 3HRPA 4GW1B 4KROC 3Q6FA 3C2AL 2BY0A 4M48H 3S5LA 4GW4A 1KJ3L 2ATKA 3MV9B 3FO0H 5H8DA 1FVDA 3S97C 3UO1H 3H3PH 1QO3B 3HG1B 4ZUUA 1UWEH 1OARH 4M6AA 4PV8A 4XP4L 4JM2D 3MCLH 2BNRB 3SDXE 5ABDE 3F5WA 3TV3H 1BVKB 4AH2A 3AREB 1CVRA 1IEHA 3MROB 4MD4B 2JIXA 3GJFK 4ISVB 4FQHB 1OLLA 3P4OB 5IK3A 4Y5XC 1J8HD 5HVFB 4DKAA 3STZB 5MENE 3AVEA 5TE7L 2HVJA 4OBRA 4C58B 1QEWB 2PN5A 4DWHA 4JHZA 3DMMB 2NY2B 3ARGA 2IFFH 3TO2A 1NSNH 2ADIB 3OAYK 5D7JC 1ZMYA 2R39A 2FSEB 5C0EB 1FQ9C 4LCIL 4Z7QF 1EGJL 1Q9OA 4P4RB 1DQDH 4JLRA 5CINL 5TF1L 4RIRB 4AJ0A 4P46C 4GRLC 3QQ9C 1OB1B 2H8PA 4Z8FL 4YZFF 4IJ3B 3GSNH 2BSSB 3E8UH 4HD9A 3HUJB 4JREB 5JPMB 2RHEA 2XN9B 5ITFA 2NLJA 1FL5B 3VXSE 1VPOL 3NMEA 3IVKB 2DQDL 5FKAA 5IG7A 2F15A 1U92B 1JNLH 5CJOL 2VDOL 4IOSD 2LTQB 3LPWA 2P44B 1AI1H 1RZ8B 3K4ZA 2GJZB 3ZMRA 1RHHB 2Q86A 1CGSH 5DJAB 4N8PA 4KKBC 2ZCHH 3U4BL 1KCUH 1OGTB 3HNVH 4PYGA 5CP3A 5F71A 2ARJA 5I8OH 3M1BB 4MQXD 5HI3C 1LO4H 4Q9CA 2LVEA 3SDCA 3Q0HA 5DJCB 4J4PA 4JFEB 4LDOB 4C4KO 1MCDA 3DXAE 3P77A 5DR5H 2A38A 4Q0XL 3TNNA 3BEVA 1H0DB 4M1GL 4JFDB 2LU4A 3BJ91 3FJTA 5FGBA 3L3OA 3H42L 4PLNC 5E8OA 2YN5A 2MKWA 4AG4H 3L95B 5I1IH 5ERWA 1VEOA 5LCVL 4L29A 1GSMA 4M9OA 5DO2C 4ZFZB 4P5TA 1A2YB 1Y6MR 3HR5A 5D1XD 5CKGA 3TVMB 4YGVA 3QNYB 3P0YH 3VWJD 3WNMA 4Y5YC 1FGVH 2JB5L 2JB6B 3BP4A 3DLQR 1MREL 1PG7X 2QHRH 2OM5A 2XQYK 3MGAA 5EU6E 4PG9A 3QUZC 4OLUL 4G9FB 3HAEA 2J8UF 3VG9B 3CLFH 3EYVA 2UZIH 5F7FA 1XZ0A 1DJSA 2VWEE 3GMNA 4OZIF 2E9WA 4KQ3L 4IMKA 3FRPA 1J1OH 3ARBC 5FAAA 1MAML 4G43B 1I1CA 5E9DA 4JHAL 3QJHB 4MYWB 2HTLC 2D7TH 3QDGD 4D0CB 3MJGX 1R5WA 5JHDA 2VNCA 1HN1A 2VABB 1GZQA 3G6JB 3TN0C 3T1FB 3ARWA 3EFFB 3QXAA 1VFOA 3QULB 3T1WA 2J4WL 3UTTE 1EUTA 3FB8A 3N1PC 5D7IF 4JY4B 3MREA 1DEDA 2RFXB 1U8IB 5I1JL 3QUXD 1CFVL 5FV1L 5HYJB 3CVIH 2Z91B 4JHWH 3WXVL 5IQ7L 2GJ6A 2O5YH 4YGAB 1ZGLB 3C6SA 4Q9RH 4XNXL 2HLFD 1KB5H 3JXAA 5EBWA 3INUH 2ICEB 5DZNA 5JXAH 4MVBC 4N68A 3VRLE 5CLWA 1F3JB 2EH7H 3PG2A 4Y8DC 5GGQL 3L3DA 2EZ0D 5BZWB 1IAII 2MKLC 3KS0H 3OAZK 2HJKA 5IW6A 5L2JA 4R7NB 4K94H 1HIML 1F8TH 5BVPL 3QIUC 1WZ1L 1I8IA 4C55A 5ITBL 1RZ7H 1B88A 1RURL 2AK1L 2F5AH 3IJHB 5ANMA 1AE6H 5SWSE 4MSWB 4NBZB 5MEOB 4XP5L 2EDRA 4ALAL 1SHMA 3UJIH 2P43B 2EXYC 1UZ6F 2HKHL 4LVOB 3QEGH 4PJEF 3HPJB 4GT7A 5IVXB 3BJLA 4FXKA 1JWSB 4UTAH 3BH8B 1ZOXA 4G80B 2AABL 5HI4C 4WHTA 2Q20A 2D31B 5GJTL 5D7LD 4PJIF 5HHNB 4D9QE 4MCZB 4HAFA 5GS0H 4FTVB 1QSFB 2BXZA 4Y5VB 1UKTA 4PJHE 3ALXA 4F8QA 1AKJB 1BD2E 3CSPA 3E2HC 2DI7A 2DLFH 5LGHL 2DQHH 3QHFH 1YEKH 2NTSP 5CBAB 3DX6A 4PJGB 4JZJC 2YZ1A 4N8CH 2WQ8A 2DDQL 1QYGL 1FZOA 1M71B 1CE1L 2HKFL 1U58B 4DKEH 4MNQD 3T4AA 3SO3B 3HPLA 3T8XA 4ZFFA 2ESVA 1S78D 2EE3A 3K74B 3A6BH 4CN6A 1SJHA 3BO8B 2VJXA 1BFSA 2A9MH 2FEDD 3ZSTA 1CG9A 1M7IB 1FNFA 1BJMA 2VDKL 3UTSA 4I77H 3QHZL 4D0BB 5D6CA 2R1XB 4LGRB 4Y4FA 2J3SA 3MJ6A 1P53A 1I1RA 2Y6SD 4MA1C 4Y2DD 4FQ2H 1P5UA 4YBHA 1FZMB 3K80A 4UIMB 3NFNA 4WEUD 2E8ZA 3ARFD 1AO7D 1R3HB 3LPFA 1HILA 3LKPB 3LB6C 2CDGA 1D6EA 3LKSA 4NP4L 4PJ5E 2Z31A 4WFFD 4WWKC 3TCLB 4JDVB 3O0RH 5B4MD 4GJTB 5E5UB 5E6IC 3PUCA 2WIMA 5JZ7D 1G9MC 4XCCL 2ZJSL 3PHOB 4WJ5A 4F2MA 4ZXBA 2VDNH 3C5JB 1RU9H 1JZ2A 4WI7A 1T1XA 3SPVB 2PXYA 5C7XL 2UZXB 5K93A 4WHCA 4JFZH 2CLRA 4NO5B 3C9NB 1IKNC 3MRHB 5DD6B 4GBXD 3EOAB 4ZYKA 4WW2B 4GW1A 3O3DB 1ZLVK 3WS6C 4F9LC 5F8QC 1EVUA 2J8OA 4MA7H 5ESQB 2D7MA 3FT2B 3MV9A 1LWRA 3CDCA 4P23D 1QO3A 3HG1A 5EFIB 3KAAA 4XCEB 4R7DB 4RRPG 4UV4L 5AYUL 2WP3T 3MR9B 2X42A 1Q72H 2B1AH 1WCBB 1J05B 3SGKC 4DW2H 2BNRA 4J12A 1IZJA 4YH6A 1BVKA 4XXCA 4QRTB 4PG2A 3AREA 3BGFB 1MCCA 1N3NB 3MROA 2VDLH 3C5ZB 4MD4A 1LNUB 2FRGP 2GTWB 4KTEH 1F45A 1FZKB 3AFLA 1UJ3C 4ISVA 4L5FL 4FQHA 4UQ3B 5JW4Q 3P4OA 2CKBL 4GXVL 5EBGA 4KMTH 1NLDL 3NFPB 1H15B 5FYKE 3P11H 3STZA 3BHBB 3HE7C 4M1CD 1MHHB 1QEWA 2XXCB 1I85C 1OPGH 3DMMA 2FX7H 4MWFB 2H26B 2ADIA 1ED3B 5GRJL 5BMFL 2FSEA 5C0EA 5L9DL 5B3JE 4P4RA 4RIRA 4IDJL 5ADPH 2F8OA 2H3NB 2EEAA 3MV8B 4ELMB 1OB1A 4YHYC 2AEQH 1U8KB 4I8DA 2BSSA 1JNHB 3EFDL 3O8XD 3BKYH 1T2JA 3HUJA 5JPMA 3BH9B 4YBQC 4M8VA 2XN9A 1FL5A 3EHBC 4W4OA 1QOKA 3IVKA 1T6WA 1U92A 5CZXC 5D7KD 1T6VN 3CH8A 1O7VA 2W0LA 2VWEC 5LGKA 1RZ8A 2GJZA 4NT6B 1KTRL 1N5AB 3BISA 1WGOA 1RHHA 3UP1A 3SEPA 5DJAA 1T1ZB 4NQSB 2MWCA 5D1QB 1OGTA 3FFCE 1M7XA 1RHFA 4Z7OF 1XMWA 3SE8L 3M1BA 3NIGE 4M3KB 2DM4A 2I24N 3V6OE 4XC3H 5DJCA 4KUCD 2DLTA 3DBXB 4JFEA 1ORSB 1C08B 3SCMD 5HDBF 5AZ2L 1HH6B 4P0DA 3B43A 4LSQL 3VFGL 5E1AB 1H0DA 1LP9E 4TSCH 4JFDA 1C5CH 4ACPA 5D5ME 2FECI 4O2CB 4R96B 1DP0A 4Y4KD 4YXKH 1J86A 3WXWH 1C12B 2LU7A 1S5HB 3GJFB 4PS4H 3IAQA 3L95A 5I15L 4FABH 4FQCL 4RGOH 1G9MH 3TBSB 4AMKH 2QSVA 4M6NL 3GFUA 4ZFZA 1FLTX 1A2YA 4HBCH 3TVMA 1FNGB 3ARDC 3QNYA 4M4PA 1BM3H 2MJWA 1JGLL 2JB6A 1I3RB 5EZIH 3CFJB 4OLXL 4LLVB 3VI4E 3I9GL 4G9FA 4N5EC 4LSDA 2DKSA 1RZJL 3QNZB 5DC0A 4X7FC 5EZOH 5C8JB 3OR6B 1A1NB 2K1MA 2P5WD 3TT1H 1N64L 4I0KA 2XY1A 4G43A 1H8NA 4KU1A 3QJHA 4PJFE 4CVWA 1B4JL 5HVGB 4D0CA 3QRFM 4YHOL 5FYJU 2VABA 2C3VB 3G6JA 3T1FA 4C4KT 4ZO7A 3EFFA 3QULA 1LO2H 2A77L 4JY4A 4XAWH 1HYSD 2RFXA 1U8IA 2AERT 4X9BA 2CRYA 4X6CB 5HYJA 4HFUH 2Z91A 4HIXL 4OCLC 5BO1H 4C57C 1ZGLA 2E5EA 1C5BH 4ODBD 1LO0L 5E08H 2X4QB 3JVGC 1NDGB 3S6CA 4YBLC 3GRWA 4MD5B 2ICEA 5EUOB 2NY4D 5T3XE 2JCCB 3FQTB 4XPFL 1K2DB 1MIEL 2CJUH 4MNQE 3CDFA 5K59F 5BZWA 2OR8A 1F4XL 4UILH 5DRXB 4ODVL 3UBXB 1J0ZA 4R7NA 3P9MB 1U3HD 3LN5B 4JFOB 4DQOL 3MXVL 4P9HC 3PP3K 1IAOB 4N8VB 2A9NL 4HF5H 2ZKHL 2HWZH 4P3WA 3TNMB 3FONB 4EI5D 2DQGH 1F5WA 4IRJB 2QQLH 3EYSL 3IJHA 5AWNL 4YWGL 4NKOB 1MLCB 4O58L 3LKRB 4WUUB 2CO6B 4MSWA 3W2DL 5MEOA 4JRYD 4XB7A 2VR4A 4NIKB 4QCIB 3R0MA 4EUPB 1I75A 3WO4C 4XC1L 2NTFB 3HPJA 3ARTA 5IVXA 1LILA 4K3EH 1JWSA 1QSEB 2PW1B 1AO7E 3BH8A 3OHXB 4JM2C 5IGXH 1TVBB 4G80A 4BFGA 4AEHL 1CVSC 1CZ8L 4WFFE 2YOCA 5CUSL 5A2FA 2D31A 1OOAA 5HHNA 4MCZA 5FUZL 4FTVA 1QSFA 1JNJA 4M7JH 4Y5VA 4MJIB 4N0FB 1T7ZA 1AKJA 4XNUL 1JP5A 1RV6X 1BBDL 3W5NA 5CBAA 4PJGA 1Q0YH 4ZQKB 4Z0XA 1KTKE 1MCOH 2ARJQ 5CP3H 3WEXB 2ZUSA 1M71A 4JFXB 2Y06H 4LPUA 1U58A 1KGCE 1IQWH 3MUJA 1EEUA 3RP1A 4NN5C 4Y19D 4QHKJ 3ZE2F 3QFJE 3BO8A 4DN3H 1YMME 3ULVH 4JQXC 1GGIH 1M7IA 4OZFG 2XZAL 1RJCA 2HFFB 4XPTL 1MAKA 4D0BA 3OV6A 2R1XA 3NAAH 1NAKH 2NY0B 5C2BL 2XQBL 2HYMA 4R4ND 4WU7B 4LLQB 5ALBL 3ET9F 3VXPB 4UIMA 3IJSB 1R3HA 3LMJH 3LKPA 2CUMA 4UB0H 3EO9L 3OWEA 4G3YL 4DTGL 5D6DC 1JGUH 2IANE 4MQXC 4HIJB 3HAEH 3TCLA 1WLHA 3ALPA 4JDVA 1BX2B 3KPSD 1CGTA 1QLEH 2VXTL 4WI5A 4ODSL 3PHOA 5DD5L 2B7DT 2QQQA 3NPSB 4PRIB 3C5JA 1V3KA 2C1PB 2OTUB 3SPVA 4Y1AD 1RUPL 1QFHA 4L9DA 1NCWL 4NO5A 3C9NA 3S4SB 3FAWA 3MRHA 5DD6A 5HTSA 1PZ5B 3EOAA 4WHYH 3V8CA 4WW2A 5D1XC 2OI9B 3O3DA 4L4VB 3VWJC 3VG0L 1AGDB 2BNUB 3MLZL 5ESQA 3FT2A 1QZ1A 5KVEH 5AZEH 3ZT7A 5J7CC 5KG9B 4N1EA 5KTEH 1FIGL 3AB0B 1IQDB 2KQNA 3BIKB 5EFIA 4TPRL 4AEFA 1SBBA 1SMAA 4XCEA 4K23H 4R7DA 2YD1A 2E7CA 2VDPL 3MR9A 3ZL4L 1MPAH 1WCBA 4JO4H 3F7QA 4PGEB 3VFWB 1J05A 2VXSL 4KMLB 4U49A 4PV9B 3CFCH 5C09B 3BMVA 4F7CB 5DQDH 3S9DB 1N3NA 1GGBH 2FB4L 3MPCA 3UYRL 3C5ZA 3U0WH 1LNUA 4EIZC 2GTWA 2P5ED 3LEYH 1FZKA 5DD1L 1N6UA 1X7QB 3HI5H 4UQ3A 3JBG7 1WZMA 5E2UH 2CLVB 3CMOL 4U0RB 3P0VH 1BQLH 1U8QB 3FOMB 3NFPA 3RVTD 5EOQL 1H15A 3QUXC 1AQKH 3BHBA 1MFAL 4PJ9D 3MLVL 1PLGL 4JPWL 4M7KL 3BFOA 2O93L 1G9NL 4YHLL 2HLFC 4UTBH 4MWFA 2H26A 1S7XB 1J5OL 1B6UA 3QPXH 1WICA 2ICWB 3O45B 1ED3A 5GGTL 4GRWH 5IFAH 4QTIH 4LDEB 3SKOB 3BGMB 2H3NA 1T3FB 3MV8A 2EZ0C 1OAXH 2VSCA 2Y4SA 4G8IB 4ELMA 2HA1A 1UG9A 4ZAKD 4LRIC 1L0XA 3GKWL 1U8KA 2ZUQB 5BS0E 1UGNA 1RIHH 1JNHA 1RD6A 3BH9A 4PJDF 3UC0H 4YHKL 3A0OA 2P5WE 3ISWA 1DVFD 3GM0A 4DFIA 1BVZA 1YNKL 2B1HH 1KJMB 4NT6A 1N5AA 3X3FL 4YX2H 5KSBE 2VZUA 5J89A 1T1ZA 4NQSA 5C0ND 4IIQB 4BA8A 1DQTA 3TBVB 1CXKA 5C08D 4BH7B 4K3DL 3WSQL 1Q9LB 4Y8AA 3DBXA 3FB6B 4ZOBA 1R3KB 4JO1L 1ORSA 1C08A 2NXYB 3L3HB 1HH6A 4BM7A 1RZGB 5E1AA 1GGCL 3MRPB 5CEXB 1YYLH 1JV5B 4POZD 1INDL 4O2CA 4R96A 3WFDH 4L3EB 5GJSL 2XZZA 1C12A 1AGFB 5BZDB 1S5HA 3GJFA 3TBSA 1ZA6A 4PBVC 4XH2B 1TTGA 1FNGA 4X80H 4NNPL 3DRTB 3A67L 4YHPB 4DGIH 1CN4A 3HLAB 1S78C 2PF6A 3CFJA 3PQYB 1AFVH 4LLVA 5T33L 4EBQL 2ED9A 2FEDC 1T2QH 2D03H 3QNZA 4OLVH 4YK4B 1Y18B 3Q1SL 3OR6A 5C8JA 1A1NA 3B9EA 1N6QL 1FDLH 4J3SA 1KTDB 1X4YA 4JRYE 3TH4T 2Y6SC 5E7FA 4KQ4L 3MZTA 1PX3A 4Y2DC 1TJHL 5HHMD 1T7XA 1UH2A 5FGCB 3MOBL 4NQTA 2C3VA 5D96C 1A3RL 3ZDXE 3ARFC 3FQNB 2J88L 4OI9A 2AJ3B 1A7OH 3GUTB 4ZPTB 3QRGL 3VFUB 1G7JB 4X6CA 4JFFE 1T89A 4MS8D 1DCLA 1OW0C 1FL3B 4GOSA 2D0GA 1E6JL 4HPOL 3G9VA 4MDJB 5B4MC 2X4QA 5JZ7C 1KC5L 5MP6H 1NDGA 1RUKH 3P30H 3TWCL 3L3JB 4MD5A 5EUOA 5I0ZA 3ZO0A 1A7NL 5CJ5A 4KZDH 3HS0B 4UAOC 2JCCA 3FQTA 3WFCL 1K2DA 3C60B 4R8WL 2WZPD 2DIAA 5IBUG 4DN4H 4NC1E 3V5HB 2YN3A 5DMIH 5DRXA 4PJCB 3UBXA 4RNRB 1MRCH 3GI8H 5FYLL 4GBXC 3LN5A 4JFOA 4LSTL 3I50H 3SN6N 4Z7NF 1IAOA 4N8VA 4POYA 2APFA 3LOWA 3TNMA 4IRZL 3FONA 1KACB 1YEFL 4IRJA 1MLCA 4P23C 3R1GL 3LKRA 4WUUA 3O6KH 1K8IB 1NCTA 1CK0L 2F58L 2XA8H 3CXDL 1V5JA 1JYWA 4FFZH 4HXAH 4QCIA 5HGAB 4EUPA 4TTDD 3E6FB 1OTUD 2NTFA 4NZTH 1OSPH 4FMKA 4QKXB 12E8L 1QSEA 1FFNB 2PW1A 3OHXA 1QRKA 5IMLB 1TVBA 1JN6B 4K7PX 1MCPH 1OD7A 1YECH 5E99L 4MNGB 3JTSB 1G6RL 5CFHA 1U93B 2B2XH 4EN3D 5J57B 4MMZC 4KTDH 3IDJB 1CDUA 1I9IH 3HFML 4MJIA 4N0FA 1JZ3A 1HHIB 4EDWL 1I9EA 1MCHA 1GGYA 3O6ML 3VFPB 1QKZL 5FB8B 4GKOA 4CRPA 2OL3L 4M1CC 4Y1AE 4ZQKA 1D9KD 1JHTB 3ULUL 3H9SB 3WEXA 1IC4L 1AD0B 4UIKH 4JFXA 3OJ2C 3BDYL 3WS3B 3RWCB 1C7SA 1GC1C 2X9WA 1T04B 2J8UB 3HC4H 1PEWA 2Q3ZA 1JYVA 1G7MB 2UYLB 1P4BH 3BE1L 1U8JB 2I5YH 4K7PY 3QXDB 4EOWH 4QF1B 1XGPB 4KXZH 1A14L 2CKBB 1CLCA 2AK4B 2HFFA 2OK0H 3O8XC 4QHKI 1QBML 5IF0B 1T0MB 4KAQL 1FHGA 4EXKA 5ADOL 1K3IA 4OCXH 5FUCC 5D7IB 1FSKC 1KENL 4DGYL 1GCFA 3NTCH 4WU7A 1GZPB 3KYKH 4LLQA 3VXPA 5IESL 2MMXA 3B2VL 3RTQD 4P57B 3WDIA 2HFGH 3IJSA 4ZOCA 3TYGL 3CSYB 1MFEL 2NX5B 3HNSL 4LASH 5FHBL 3UTPE 4I3SH 6FABH 4X0KB 1EGJA 3O2WH 4HJJH 5EBLB 4HIJA 2G5RA 2APXA 2YKLL 4ORZC 1BX2A 2IPKB 5EN2B 4XHJD 5K9JH 1I9JL 1QFWL 2YUZA 3SCMC 3ABZA 3HI1B 5HPMB 2XTJB 5E8DH 5J6HB 4PRHB 2QBWA 5CP7B 4PRIA 3G5XB 3PV6B 2C1PA 2OTUA 4Y4KC 3RU8H 1EO8L 5FYKL 1FLRH 4M43L 3PL6B 4CU6A 2IPTL 3PE9A 3QWOB 1YPZB 5DVKA 2FNBA 3D2UB 3S4SA 4RGNE 3LEVL 5T1DH 5JW5B 3H9HB 5C9KA 1OVZA 1PZ5A 3TH2T 4L4VA 1AGDA 2BNUA 4OFYD 1DTUA 3NCYS 5F96H 4M1DL 4FQXD 2O61B 1VSCA 5KG9A 4LCWB 1ONQB 2J7LA 2W9EH 2OSLB 4NDMB 4PJEB 5KJRH 1IQDA 3BIKA 1Z9LA 3HCVB 2A0LD 5L0QB 2VDML 3D39B 4YE4L 1FG2B 1WTGT 4NN6B 4PGEA 3BOVA 3VFWA 5GISL 1CICB 1B2WL 4P2QB 4PV9A 3ORJA 1HHGB 4LBEB 4LSSL 1BGXH 4PJIB 5C09A 4F7CA 1CFNB 1QHOA 2YRLA 3LQAH 3S3PA 3MRQB 5C08E 5H2BB 5BJTB 4TRPH 1MQ8A 1X7QA 2E9JA 2R29L 2CLVA 1QSVA 3RWDB 1U8QA 1N0XL 3FOMA 3KLDA 1HYSC 1ZLWK 4NM4H 1FNLA 2R0KL 3T2NH 1TNMA 2FHCA 3D69B 1SBSL 1OAKH 3OKLB 5GRUH 1A6VL 2AS5M 4H26B 1FP5A 3KJ4B 1YNTB 1TITA 5IM7B 1HZHH 3KLHD 1S7XA 3L3GA 2M2DA 3FQXB 2ICWA 1U6AH 2AJXL 2NY4C 3O45A 2AI0H 1KPVB 4HBQA 4N0UB 3V4PH 1FC2D 1I7ZB 4NZJA 2VTFA 1WVZA 2MCPL 3QG7L 3SKOA 3BGMA 1A9EB 3EDKA 4N0CD 4G8IA 1T3FA 1BAFH 2DI9A 2ZCKL 4K8RH 5T1KB 4H8WC 4GG6F 1MHPH 3TIEB 3WNKA 1U3HC 5KVGH 5C3TA 3WCYA 3KPRD 3MLYL 5F7EH 5E4EC 4GMSH 1A7RL 1UM5L 4WEBH 5EPMA 3DGGB 4HEPG 4BQ9A 5I73C 1KJMA 4ZTPH 3WKML 1EVTC 3IU4L 2DMBA 3T0ED 4BYHA 5HHME 2BVEA 4BZ1L 3MODH 5I1GH 1YEJL 4IIQA 2E7HA 3PF2A 3UX9B 3TBVA 4BH7A 3WN5B 4MXQD 1Q9LA 5TQ0L 3A6CH 3FB6A 1IILE 1R3KA 4UT6L 4GXUN 1JNNL 3CK0H 4XP9H 3WIIH 1RZGA 2NY3D 3WMSA 3MRPA 1FORL 4OFIA 1F6AB 1UENA 1JV5A 2AGJH 3U36B 5CEXA 3PXHA 4L3EA 5K9KB 3PV7A 2X9YA 4JFPB 4PLJD 3SKMB 1AGFA 1ORQB 3RGHA 5BZDA 4MAYB 3RJQB 3HMWH 4B5EA 1UXWB 1RUMH 2XG5A 5TFSL 4LIQL 4CADB 4XH2A 5DJ2B 3UTSD 3DPBA 3BI9X 1OAZH 4LHUD 2ZUTA 3SGJA 2FATH 3DRTA 4OLWL 5JW4R 3QXWA 4KV5F 3CJJA 5C0CB 4ZUTB 3HLAA 3RWFB 5H35B 3PQYA 5DDHB 4F9PA 1YC8A 3MYJB 4JKWA 2DMKA 4Z78B 5KSUB 2UWEF 1Y18A 2DOCA 3THMH 5FYJL 4WGWB 5C71A 3KLSA 4K9EC 2I60H 1A3LH 1KTDA 1NEZA 3QHTC 3X12B 4L8DB 5DJ0B 3VGGA 4DZ8B 4Q6YA 4Z95H 4R4NC 1X44A 3ZKMD 3RNQB 3HA0A 4GAGL 5J56B 3BPOC 1EMTL 3OKKB 3FQNA 2AJ3A 3GUTA 4YC2B 4ZPTA 3VFUA 1G7JA 1S9KC 3B9VA 4G6AD 3AC0A 4LU5L 1FL3A 4X99B 5F7NC 4MDJA 3MACH 1AIFB 4OLYL 5DVOA 3F7VB 3L3JA 4OUOA 5ALCH 1J10A 3SBWC 4PJ8D 2R2HB 3HS0A 2ERJB 4HUNB 5E2WH 3V5HA 1A0QL 1E4XH 1JZ8A 1EV2E 5JXEA 2A1WH 4PJCA 4RNRA 2X89D 5K33A 4YDJB 2YZ8A 2VLRB 5D2NC 3WJLC 4OTXL 5I1EH 3TFKD 4I48B 2EDXA 1MEXH 3KXFB 3OG6B 3NVQA 1EAPB 3QEHB 4KWUA 5IW1B 3ARRA 1JYNA 5HGAA 4OGZA 3ULVE 2X2YA 3E6FA 2AJYL 1NDMB 1FFNA 2OLDA 2SEBB 5IMLA 2FO4B 3IDGB 3MLRH 1JN6A 4K07A 4HKZB 4MNGA 4TOYH 3JTSA 1UVQB 4M48L 1BEYH 1U93A 3V7AE 4BQCA 1HH9B 4Z7VF 5KZCB 4BKLA 4YPGB 3UO1L 2EDLA 3H3PL 3IDJA 2E9BA