4Y2DD

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
239
structure length
239
Chain Sequence
AAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILELATPSQTSVYFCASGDEGYTQYFGPGTRLLVLEDLRNVTPPKVSLFEPSKAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
total genus 57
structure length 239
sequence length 239
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07654 C1-set Immunoglobulin C1-set domain
D PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dD02
1A6UH 3PG2A 4P2OA 1SM3H 5I1JL 2EC9U 1T3FB 4UDTA 3LN5A 1QFHA 5HJ3A 4NQVA 2ED7A 3H9HA 3ARDB 3RTQC 3PWPB 5HYIA 1BGXL 4QF1A 1S7WA 2X1QA 1J05B 5GS1C 1A9EA 4GOSA 3VFPB 2GJ6E 3LY6A 5FDYA 2OQJA 4K7FB 2EIZA 3PGFL 1CWVA 1R5WA 4HWEL 4HIHA 4N8PA 1YEDA 4IMLB 2VDML 3MA7B 2NY3D 1BQHG 4P4KD 3GBNL 3MJ7B 5AAMA 2EXWC 4W6XB 3ZL4L 4JG1H 4OGYL 3L5XH 1N5YL 2P24B 1S9YB 1P84J 1Q72L 1AR1C 4KI5D 2WV3A 4XNUL 3SDXB 3CJJA 4KJQC 2WUBH 3L7EA 3PWJB 3ARBB 5EO9A 1L9NA 5L6YL 1A7OH 1GZQB 1W0YT 3Q5YA 3MACL 3DUUA 4W4OA 4XTRD 1R3IH 1ROWA 3U6RA 3ZHKA 1FLRL 4F9PC 1DL7H 5JTWA 1Y0LB 3C08L 2YD1A 3MV9E 4HFUL 5J56B 2FL5B 4Q9RH 5T5FL 3SO3C 3AM8A 2R2EA 4A6YA 1JHKH 2NX5A 2GJ6D 1QBMH 5DQ9A 1QFWI 1P7QD 3HB3C 3RVTC 3B9EA 2XKUA 1EFXB 1LNUB 1U91A 2YS4A 1MUJB 1UGNA 3ALXA 2A6DA 1EGJL 1AC6A 1G9MC 4KKBC 4R0LA 1ZT4A 4IRSD 5E5MB 2J12B 3RL2A 4M43L 4M7LL 4NM4H 3I6LE 4L4VE 1U3HC 4NQTA 4X6DB 1J12A 4MD5A 2IAMD 5LAXB 4LIQH 2X2YA 4BQBA 2NY0D 1V7MH 4PJHB 5BS0B 1MCIA 3OJ2C 2BDNL 3RGVA 2AGJH 5D6DC 5FUZL 3BKML 3RKDD 2DQJH 4I0PD 2Y07L 5I1AA 4YDVB 3AMKA 5A1AA 4LLMA 1FE8H 4BQ6A 5JHDD 4I4WA 4CADB 4JPWL 5IFHL 1OAKH 1RIHL 3MV9D 1F3DH 4HIXL 3U0TA 3T2OA 4PLJC 5FB8B 5A2LH 2HVJA 1S5IL 2XFXB 1IEAA 5KZCB 4D0DA 4RGNE 5HHMB 4K2UL 3IFOA 4JGUA 5CZXD 1BWMA 3G5XB 3FO9A 3HCVB 3E6FB 4DZBB 1N0XH 2DKSA 5D7LD 3T65A 1Z9LA 1F6AB 1MJUH 5FDWA 3DSFH 2A6IB 2V17H 2V2XA 3ARSA 3F6LA 2J8UA 1OT2A 4YHIB 4L4VD 1D6VL 1NBYA 3LKQA 4DGIH 1KFAH 1VGKB 4H8WL 1RUKL 5DHYB 1HXMA 5F3BB 5I73C 2O5YH 2ZUXA 3B9KA 3L7FA 4NQSA 5J06A 2E7BA 2R0ZH 5JDSA 5ISZE 3ULVF 4KZEH 2GK0B 4H20H 4F58L 4Y2DB 3GI9L 4KVNH 3TO2B 2R8SL 4QOKB 1JHLH 3IDIB 1L7IH 4G8GE 2P8MA 3A6BL 5M94B 3PV7A 5DQDH 2EEBA 1UXSA 4XRCB 4RGND 3RWHA 5IB5B 3ELAT 1CDCA 3OKYA 4IRJD 4PP2B 4N9GB 3VFMA 1CYGA 4X7CC 4HWUA 1MI5B 5BZWB 4OJFL 5DD5H 2IH1B 3QCVH 4R96B 1A6UL 5HHQB 5I8CB 1SM3L 2Q7YB 5I0ZA 3SGKA 2LU3A 3IDNA 2GKIA 3WS3A 3QJFA 4NRXB 3RNQB 4Z77A 1K3ZA 4JM2B 3MRDA 2OJZH 3PQYB 3RWCB 3QBTB 2NLJA 4Y8DC 5T3XH 4KVCH 2A6KA 4LHQB 1ULVA 3DSNA 4U1LB 1S5HB 3OKKA 1ZLWH 3BGFB 4U3CA 3TNMA 3WLWC 2MCPH 4JG1L 1DLHB 3L5XL 2O61B 5I19H 5ISZD 3BPNC 3OGCA 5E4EC 4WO4C 4MXWH 2WUBL 5C0AA 3IB4A 3OKEA 2EIEA 2FWOA 1A4JB 3GMNB 1J1OH 4G8GD 1A7OL 4RA3A 1FL5A 1MELA 2AS5M 2J3SA 1YYMH 1IEHA 1R3IL 4PTUA 2DBLH 1OF2A 1DL7L 2ESVB 4GXUM 1B9ZA 3MZGB 4Q9RL 2EKJA 1RK0B 5BOZG 3C6SB 1JHKL 4YBQC 4BKLB 3RY4A 4YO0B 1QBML 3DIFB 5GS0D 4XXDB 1GC1C 4XZUB 3IJHB 3GJEB 4Y19D 4OUUB 3MRMB 5DJAB 1NFIB 2F19L 1UH2A 5BVPH 1AO7D 1BD2B 3DXAB 4U1GC 3JV6B 3TZVD 4QRRE 2JJVA 1MVUA 1ZHKA 4NM4L 3GSNA 1MLCA 1FNGB 3U48A 3IAQA 4HV8A 5T5NG 4JQXA 1V7ML 4Q0XH 2AGJL 4OZGF 5EBLA 2DQJL 3O6FD 5BQ7A 4POUB 1FE8L 3EO9H 1YPZF 1OAKL 1LEKB 4OCRH 1I1AD 2H26A 5SV3A 2BSSA 1R5VB 2IBBA 1ZHLB 1I1YA 3ARTA 3FT2B 1CE1L 2ARJB 3C87A 4DCQB 3KPRB 3FQTA 3IDYC 5BVJA 3IRPX 4PJ5A 3S4SG 2Q8AH 5I1CH 2FJFA 1JPSH 1NC2D 5F72S 4OQTA 3OX8B 4P2QA 4NHUA 5I66B 1RUMH 1MJUL 4ISVB 4DGYH 4LLUA 2KKQA 3DSFL 4G6KH 4BQ9A 1HDMA 3H9SE 1YEEH 1YEIH 2V17L 1DQQA 4QRRD 3K8MA 4PTTA 2YRPA 1EMTH 3MBEB 4WDIA 2NNAB 4OLUH 1YMMA 1T1XB 2NTFB 2CLRA 2JJUA 4DGIL 1KFAL 2H9GB 1KBGH 2X5PA 3SJVE 5GRVK 1J0YA 1U8HB 2R0ZL 2QADC 1PYWA 4LRIC 4MJIE 1BX2A 1SMAA 1KJ2A 4FG6C 3MC0A 4HF5H 4KZEL 4EI6A 4NNPH 3WFBL 1BIHA 4H20L 2AP2A 3RVXD 1ES0A 4KVNL 1E27A 1N6UA 1JHLL 1YMHA 3QIWD 4PJ8A 1L7IL 5I0DA 4F7TB 2CK2A 3V52H 5DQDL 2D2OA 1WC7B 4HCRA 2XG4A 1XR8B 4HS6B 2BNRD 3SDCA 1KCKA 1CZ8H 4HULB 1G6VK 1X5GA 5A2JH 1L4IA 1T21A 5AEAA 4JFOB 5DD5L 3S7GA 1KXQE 3QCVL 1M05A 2V5TA 4KV5F 3DI2B 3UTSE 4NO0B 1XGQB 4JM4H 1QSFD 3QUXC 4EDXA 3TH4T 4Z7WA 4OLZH 4BJLA 4ODUB 2FR4A 2OJZL 4MNQA 4XX1G 2WANA 1EXUB 5T3XL 4KVCL 4TUJA 2VR4A 3T0ED 5EZOH 3SJVD 1H3XA 1QFUH 2MCPL 4Y4KB 1OTUC 4F7CA 1UWXK 3K1KC 4MJID 2VE6B 5I19L 3OHXB 1PLGH 2BRRH 4UBDC 2W0KA 4LLQA 2DLHA 3ZTJG 5DTFB 3X12A 5T1LA 4MXWL 3VH8B 3ULUD 3GJFK 1Z2KA 4EBQL 4G6FD 3P9WB 2YR3A 3R0MA 4JQVC 3SE3A 1J1OL 1AQKH 3DYPA 2OJEA 5EUOF 3UPRB 3ARGA 5I16B 1YYML 4F2MB 4GRWB 1F2QA 2DBLL 1MAMH 1EK3A 1FV1A 3LN9A 4GKSA 2Y72A 3LKPB 2YUWA 3OL2A 1DBAH 4ZAKA 4RCAA 3BOVA 4KQ3H 3UTSD 4W70A 4EIGB 5J13C 1HHGB 2OTUA 4H0HB 3AROA 1QBLH 3QFJB 4S11A 3IFPB 1CIUA 2XICA 2XPGB 4HAFA 4CAGA 4PJ9D 3CIQA 3MX0A 4OIAA 1NEZB 2IMNA 4G80B 4PGDA 3IJYB 3REWA 1F58H 3K74B 4QHLA 4TTDC 5FGBC 4S1RH 5BVPL 1A8JH 4BFIA 3W9DA 5SWSE 5F6IC 1GXEA 1N64H 1UWGH 2VDRH 5IOPA 1BLNB 3HG1E 4M1CD 2HN7B 2Y36H 3BWAB 4MA3A 5DVLA 3MV01 2R2CA 3QIUC 4Q0XL 2I9TA 1EEYA 4HKBB 5FOJA 2W9DH 4M93C 1PGRB 1Q1JH 3EO9L 1JZ3A 3C2AH 3GSQB 4OCRL 4L8SA 5KSBE 2WBJA 2GQHA 3IDGB 3FO1A 5FCSH 1U8MB 3OF6A 4MCYB 4JFEE 3SCMB 4IRZH 4WU7B 3PWVB 4RMVA 3UCRA 1S9WA 5ANME 5I1CL 3O45A 3OXRA 2Q8AL 1JPSL 3PL6B 5HVHC 4DKDC 1CVSC 4WJ5B 3FFCD 3S5LG 3MTRA 1RUML 4DGYL 2C4FT 4Y1AA 3LV3B 4G6KL 1YEEL 1YEIL 2KQMA 4X7FC 1HNGA 5F88A 4X6FB 1EEZB 1EMTL 2GSGA 4OLUL 3ULSA 3WLBB 4W4NA 2I07A 3L5JA 5GSRA 1M71B 1KBGL 3HG1D 3CFCH 4P57B 5LGJA 4HJ0C 3QI9C 3P9MA 3ZE2F 5HYSB 4ZSOB 2C3VB 3G9AB 4NNPL 3P4OB 2PTVA 2EYRB 2PW2B 4HJGB 3VXMA 1U8QB 3ULVC 3NFNA 1MQKH 3TPKA 3V52L 4U49A 2IANB 4JRYE 3MRRA 2H8PA 1JZ4A 1CZ8L 4GG8B 2F54D 4W81A 3MLWH 4RWYH 1Q0YH 1I7ZB 5EU4A 5GISH 1XCQA 1X5FA 5EA0H 4JEGB 1AKJB 2NW2A 3QNZA 4Y5XB 5DGRA 4Q97A 2VZSA 4PJCB 2BVOA 4ODVH 3M17B 5E00B 3WEXB 4ZNCD 3MLYH 5F8QC 3UTTE 5CJQH 2YMXH 1AGCB 1AH1A 3UC0H 5D1QA 3SGDI 5I6XC 2AEQH 1LE5A 1PLGL 2BRRL 4CW1A 3TO4A 4JAMB 1ZA3A 3K8LA 3ZDYF 3VFTA 2PXYB 5CJ8A 1CFTB 4MNGE 1DEEA 3D69A 4HK3J 3T09A 1I9EA 4Z78B 4RQQB 4F9LC 1AQKL 1TQBB 5FIEA 4JRYD 2FJHA 4UDTB 5HJ3B 1MAML 3I85A 3H9HB 5FM5O 2HT2C 4KKCD 4GG6A 5JZ7C 4OLYH 1DBAL 1UC6A 2F9BT 5L8LB 4KQ3L 1E28B 3D2UA 1F3JA 2OQJB 4GLRH 5B4MD 1QPPA 5IMMB 5KANG 1IQWH 1R5WB 5EIIA 4HIHB 3VFGH 4E41B 5C09D 4HZAA 3CDGB 1QBLL 1TMCB 4XXCC 5C0NC 3STZB 1IKNC 4KGLA 4PV9A 4WWKC 1T83A 4Z7OF 2G60H 3UTTD 3PHOB 3HS0A 3TF7C 1F58L 2XN9A 3MXVH 4S1RL 3L7EB 4PY7B 3LKSB 3BYTA 5CILH 3CX2A 5EO9B 3GSUA 3B2UC 1CXFA 3PWNA 5D93C 3RHWK 4RZCA 1N64L 1UWGL 2VDRL 1ADQH 2EH8H 1FH5H 3DUUB 4RMWA 4JFQA 4KJPD 1NEUA 3A0OA 2Y36L 4LVOC 3TPUA 4O2EA 1BQUA 2X4SA 2P44B 3JTTA 2CQVA 2W9DL 3ARQA 1DQDH 3CFKA 1LEGA 1Q1JL 4ZOCA 1RJZB 3C2AL 2RIKA 4PRNA 4XHJD 1IEBA 3BSZH 2NX5B 1I4FA 1MWAB 4JFDA 5DQ9B 5E2TH 1PSKH 2D7QA 2FHBA 1Q94A 3SN6N 3ZLQC 3HE7D 3VXTA 5E1AA 4RDQG 1LO3H 4IRZL 4B5EA 2YWZA 2E8YA 3BW9A 4CVXA 3W11C 3O3EB 1FIEA 5E8OA 4R4FH 5JQHC 4DJMA 5HGBA 4POZC 2P8LA 1AHWA 4KKAC 5A2KH 3C60A 1KIQA 4R0LB 1ZT4B 4WWID 3RL2B 1KLGA 5IB4B 3X3FH 2AXJA 3FHAA 3KAAA 4PJFE 1CQKA 1JN6A 1MIMH 1B6UA 4N0CC 2LU7A 4PB0H 1JVKA 4PRAA 2C3XA 3EYQC 3CC5B 1U3JA 3G9VA 2CRIA 4X6CF 2D3VA 2OL3B 3CFCL 5I1AB 1NGZA 4LLMB 2HJLA 4J3WA 1C5CH 2YD7A 1KSRA 3RPKA 5CGYC 2PNDA 5CMAA 5IVXE 3S37X 3U0TB 5I8OH 1I7RA 1I85A 1VA9A 3PV6A 5DJ2A 4M7ZC 1MY5A 4OCYH 4D0DB 5HI4D 1G1YA 1MQKL 3IFOB 3QUZB 3LEYH 5ICYB 2HJKB 4P23B 3T65B 5B39B 4MB3A 1CGYA 4JRXA 3MLWL 1T66C 4OT1H 4YWGH 4RWYL 1CLOH 1Q0YL 5ALCH 4AEFA 1P69B 1NC4B 1K8DB 4L1HA 2MKWA 5GISL 4HXBH 5K93A 1CGXA 5EBWB 2VAAA 5EA0L 3ZYJA 2X4QA 5GPRA 4LMQI 4GJTB 4PBWD 4NQSB 3L7FB 1BBJB 2P5WD 4ODVL 3BVNA 4TVPH 5JDSB 3MLYL 3I6KB 4U1SA 1X44A 4J3UA 5D2NA 1J8HE 3VWKA 3MRCA 5CJQL 2YMXL 4HJJH 5EBGA 3S35X 3QUYC 5JIPA 3TM6A 3UC0L 3RWJA 4JHWH 3L3KB 4EXKA 2V2WA 2CIKA 5C0CA 32C2A 4BFGA 3NGBB 3GM0A 3SKOA 4TN9A 2COQA 5MP6L 5DFVC 4OZHF 4MA1C 1FNSH 3C5ZA 1N59B 2C3WA 1J18A 2NY4C 1K3IA 2E7LA 3FTGB 1IE5A 1XGRB 4R2GD 1NMCB 5ERWA 3QJFB 3EO0A 1OLLA 3EGSB 4Z7VE 2Z31B 4OLYL 4MXVF 2JJSA 2J88H 4Y5YA 2W59A 4U0RC 4XMPH 2NLJB 1IQWL 2A6KB 3VFGL 2ADJA 4I3GA 4Y5VB 3TNMB 5C86A 4JFPA 4PY8I 2G60L 3OGCB 3E3QC 3BUYB 2UUDK 3N1MC 3MXVL 1MCEA 3ARFD 5T1MA 1MAKA 3V8CA 5CILL 3OKEB 1U42A 4ELMF 2FWOB 1AIFA 1X4XA 3UZEA 1NAMA 1FL5B 1ADQL 2EH8L 1FH5L 4A6YH 3S36X 2IPKB 4PTUB 2Q76A 4R26H 4B53A 1CD8A 2VQUA 4UT6H 1ODAA 1B4RA 2R1YA 1Y6NR 1IGJA 4LLWA 3CGTA 3BSZL 1AXSA 3UTOA 2EEAA 5E2TL 4EUPH 1PSKL 4X0KB 5IB1A 4HUNB 1VSCA 3V6FA 1LO3L 4JY5H 3O3AA 5J12C 4FABH 1VB9A 4NIKB 4R4FL 5KSAD 3ZDZE 4KRPD 2UWEE 4EKXA 4D3CH 4Z5RB 1MVUB 1QBAA 3GSNB 3H7BA 2DN7A 3V6OE 1C12A 4KTEH 3X3FL 1IM9B 3V4UH 4M4RA 3WFEH 1MIML 4CU8A 4E5XA 3OGOE 4PB0L 5ICZA 5F9WC 1UENA 4LSDA 5EBLB 3D85A 5BQ7B 2ZG1A 3SHSA 1G7IA 1C5CL 4JFFE 5EORH 4PJEA 1C5DB 3TA3A 2H26B 4G6AD 5I8OL 2Q86A 1I1YB 3FQTB 3FO2A 5C9JA 3D87B 3CPLB 4OCYL 3QQNA 3DV4A 3LDBC 1XMWA 3C6LA 2FJFB 3MRKA 4PJXF 4U6TA 2Q6WA 3FOLA 2EE2A 2APXA 3EAKA 2N4IA 3LEYL 4NHUB 3WJJC 2YSSB 5IBLC 4LLUB 2VDLH 1I9RH 3MREA 4OT1L 1HDMB 4YWGL 1CLOL 5JDJA 1DQQB 5ALCL 1AGDA 1FYHB 4PTTB 4YAQA 4HXBL 1YMMB 3CSPA 5F93C 4Z7UE 3FQUA 4WI8A 3X3GL 1I75A 4MJ6A 2NXYC 3I6GA 1KB5B 4H88H 2Z8RA 2Z92A 1IC7H 4YK4C 3WUZA 1PYWB 4TVPL 3NFSH 4CBPA 4HJJL 4ZUUB 1QRND 4JFFD 1ES0B 5DI8A 4JHWL 5KSUA 4X8JA 2OMNA 4M7LT 4PJ8B 2AQ2A 4CVZB 1RPQA 5ICXB 1PX3A 4XPGH 4PJBA 5KS9E 3SDCB 1FNSL 5FYJH 2NY7H 3BZDA 4OF0A 1T21B 2N7AA 3BP7A 1M05B 4ZPVB 3W39A 5ITBH 4QGYA 2FX7H 5DYOB 3LHPH 3DI3B 4WUUD 4ZO9A 5HGHA 4U6HB 4Z7WB 4KK8D 5DA4A 2D7OA 3AU1A 2J88L 2J8HA 4LEOA 4XI5C 3HI5H 2FR4B 5H2BA 1CXKA 4MNQB 4XMPL 3EHBD 4TUJB 3CXDH 2WINA 4C54A 3S3SA 4P9MH 5IJKA 3IDXH 3QXDA 4OGXH 1ORQA 4YHOH 3L3GA 1S7UA 4F7CB 3OB0K 4JB9H 1LP9F 3TN0A 2OI9C 4WW2A 4PJDE 3H0TB 2VB5A 2BY0A 1AE6H 3T4AA 5F6HJ 3RVWD 3L9RA 1S7VA 1SYVA 5BW7A 3ARGB 4FQJH 4JZNA 4A6YL 3MV8E 3AUVA 3BH8A 5ADOH 2FECL 1TZGH 4R26L 1FV1B 4ZFFB 4ZXBA 4UT6L 1Z3GH 5TPWH 1J87A 4ZAKB 2ZUWA 5F7DA 3QXUA 3ARPA 1YY8A 2OTUB 3EO1B 1QO3A 3LKOA 4IOFD 5A16A 4MLSA 4Q6IC 4K7PX 3GSNH 2R2BA 4JY5L 4FFZH 1VERA 4PGDB 4FABL 3REWB 1DEDA 3P30H 2WNGA 3K4AA 4D3CL 4ZFOA 4G9FD 4BFIB 3W9DB 1U8KB 4KTEL 5JW5B 5IOPB 3V4UL 1ZMYA 4N8VB 3WFEL 4MVBD 5F7WC 4RFEA 1VESA 5IG7A 4G9DB 1R3KA 1CFQB 5CP7A 4PRHE 5J6GA 3HUJB 1EEYB 3CFBA 5EORL 1JGDB 3O4OB 2GJ6A 2WBJB 4HUMB 3T3ME 4OQTH 4P46A 3CVHA 3KXFB 1YJDH 4U1KA 3O45B 1RJLB 2AEWA 3ES6B 3OXRB 5DMGD 3VXSE 5KANI 4DEPC 3MGAA 3N1QC 1M4KA 2AJSH 3G5ZA 3LKNB 4UT9H 5D1ZD 4Y1AB 5IVOA 2VDLL 1I9RL 4TSCH 1Z0NA 4WTZA 3B4NA 2NY6C 2IAMA 5F88B 2A83A 1KJ2H 5L7XH 3I3DA 5CEYA 5IWLA 2GSGB 3PP4H 2F8OA 3ULSB 4I0PA 4EXPX 3A6OA 5CINH 5F97E 4H88L 5IQ9A 1IC7L 4PRHD 5JA8B 3KHQA 3FQNA 3CSGA 1IAIH 3LD8B 3O2WH 4HCRH 3NFSL 3WNKA 4AY0A 1KGCE 1QLRA 2NY5H 1J11A 4NO3A 3U7AA 5T3XE 3SDXE 1SJVA 4GS7B 4JCMA 1OP3K 4Y4FD 2MMXA 5I9QC 3NFNB 3WO4B 3GIZH 4G8EB 2JCCA 1DQMH 3QXTA 4XPGL 3MLXL 5J1AA 2H8PB 4XCCH 1FBIH 5FYJL 2NY7L 3VXSD 1F6LL 3BZ4A 4LNVA 3VE0A 3TH2T 3NCMA 3ZSSA 5ITBL 1CK0H 2FX7L 5EOQH 3LHPL 1D7FA 4L4VA 1XCQB 3ARDD 4YPGA 3QZWA 3PWPD 3P0GB 5GRYA 2NW2B 3HI5L 3BFOA 5DVNA 3BRDA 5MI0C 2CDEB 5KW9H 2BVOB 1AGFA 4J8RA 3VCLA 3CXDL 3LPFA 2DIBA 2HTKC 3B2VH 4IMKA 4ZFZA 4P9ML 3IDXL 4OGXL 4KAQH 4YHOL 5DRWB 3MXWH 5FAAA 3PHQA 5D1QB 3IFNH 4JB9L 1LE5B 1OGTA 4CW1B 3TO4B 3WHE0 3QHFH 1KGCD 3JBG7 3VFTB 5T3XD 3MLPA 5I75C 5DD0H 4QHMA 3D69B 4Z7QE 4KI5F 1AE6L 4X6DE 3ARBD 1PZ5B 2C7UA 3B3IA 1EAPA 2J1KA 3DMMC 1FAIH 2P48B 4QRTB 4PJHE 1T0NA 5BS0E 4FQJL 3O2VH 3BO8B 1I3GH 5ADOL 1AHWC 3G6AA 1XF2B 3BZFB 1G9NH 1TZGL 5JMRA 1A5FH 3RVVD 1Z3GL 4KXZH 4N8CH 5TPWL 3H3KA 3LN4A 1OARH 3HZKA 3D2UB 1F3JB 3MRJB 3QEHA 3Q3GA 5EIIB 3EYOB 4ETQA 5D7JC 2C1OA 5HHME 1G7QB 1JHTA 3NIGF 3DVNA 4YC2C 5H35A 3GSNL 4PV9B 4FFZL 2HMID 1UEMA 1NGPH 1QP1A 4HKZA 1NLBH 3MRLA 5FV2A 1JPGB 1UKSA 3GSUB 3UXFA 3PWNB 1WT5A 1GZPA 4RZCB 1XGUA 3IAGC 3AGVA 4WFGE 3ARXA 4JFQB 3E2HB 4F7EA 5BS0D 1U95B 2HKFH 4XPAH 4O2EB 1Q8MA 1BPVA 1RHHA 4I8DA 4FQIH 5FUCE 3JTTB 3JV4A 1W8OA 1UH3A 2AK1H 1U3HB 2DF3A 3KS0J 3CFKB 1CFNB 1LEGB 3QO1A 3RIAK 5DEGB 1IEBB 3Q1SH 4PGEB 5CKGA 1I4FB 3MGTA 3WNNA 4OQTL 5KZCD 3FB5A 3BW9B 4CVXB 5HHMD 1PY9A 1YJDL 1XCTA 5HGBB 4BQ8A 1MI5E 1QFWM 5K59E 3BIAX 3C60B 1KIQB 2X9WA 4UT9L 4DN3H 2E8ZA 1NKRA 2CIIA 2BY3A 4TSCL 5AZ2H 1A14H 1NCTA 3E6HA 4DAGH 43C9A 1JN6B 4G8IA 1JF5A 2E9JA 1KJ2L 5L7XL 3BMVA 3PQYE 3PP4L 3FRPA 4PRAB 5FHBH 4JREC 2P7TA 3TIEA 3CDCA 5CINL 1RK1A 1NGZB 3SEPA 2HJLB 3K81A 3BDYH 3QWRD 1YN6B 5CFHA 1LE9A 1YEFH 4L4TB 1IAIL 3O2WL 4HCRL 1I1AA 2I24N 2NY5L 4LAQH 8FABB 2DD8H 4Y2DD 3PV6B 2P1YA 3QJHA 5DJ2B 4YEFA 4QOKD 2EYSB 1VCAA 1W0WA 3GIZL 4WW1A 4EN3C 3VRLE 2EE9A 3VH8G 4JPVH 2CUIA 4RRPA 4FXGA 4XCCL 1FBIL 3IETA 1MI5D 2P45B 4JRXB 1HWGB 3HMWH 4H0GA 1V7NH 5EOQL 2HAZA 2GT9A 4UAOC 2B5IB 5E08H 2IALA 2VAAB 5HVWA 2X4QB 1K4CA 4WGVB 4ZD3H 3HC4H 3PQYD 1D6EA 3LZFH 5B8CB 5KW9L 2YN5A 1VFAB 1ZLUH 3BVNB 4KK5C 3B2VL 2AJVH 5L8JB 5D2NB 2ZUTA 3VWKB 1ZAGA 4KAQL 1TDQA 2JJTC 3MXWL 1XF5B 3IFNL 3JTSA 4PPTA 3RWJB 1BD2E 3DXAE 4HG4K 1M7XA 5CGTA 3QHFL 2F8VA 5I1HH 2BX5A 4QXWA 5C0CB 5D1XA 32C2B 3ZE1E 5DD0L 3EZ8A 3SKOB 2VLJB 2YZ8A 3KYOA 2ZP0T 1FAIL 4K9EC 4N0UE 4LASH 4I5BA 1XT5A 5C6TH 3V5DB 3O2VL 1LO2H 1G9NL 4M5YH 1A5FL 1MCCA 3H9SA 1V3MA 1TZIA 2ESVD 4N8CL 4G7VH 1A6VH 1OARL 4Y5YB 5L2JA 3PWLA 2NZIA 4XHQA 3KPRE 2ADJB 3SJVA 2FZ3A 3RGHA 1NCDH 1I7UB 2Y9RT 4JFHE 1DJSA 4X7TA 4LU5H 5DC4B 2PUQT 1NGPL 2H41A 2DMBA 2BP3A 1NLBL 4YHKH 1WITA 1BD2D 3DXAD 5SX4H 1AIFB 3NABL 2EDYA 3VXUE 3T0AA 1A6ZA 1T1YA 1DUZA 1CL7H 4K3HA 5I74B 1FP5A 1KPVB 3GZKA 2HKFL 4Y8AA 4FQIL 2E6QA 3UTSA 1T6WA 3OKMA 2R1YB 3MRBA 4HHAA 2AK1L 4LLWB 3T3PE 3O41A 5LJYH 3Q1SL 3UJTH 1AXSB 4C4KO 5CJ5A 5HYSG 4OLEA 3AY4A 5IB1B 5F7KC 1QFPA 4NQDB 3VD5A 1QZ1A 3ZE0E 4GRMA 3KPRD 4AEEA 2X41A 2WM0A 1PKQB 1HHJA 3B9AA 3CU7A 3O3AB 3HAEA 4UT7H 4WV1A 1WGOA 2EO1A 4JFHD 1OAYH 4WUKH 1UZ6F 2YD2A 5I18H 5GGSA 4JO4H 2AVGA 3I02A 5IMLA 3H7LA 4DN3L 1WTGT 3H7BB 4KHXH 3E1F1 5AZ2L 1A14L 1A1NA 3WS6C 4DAGL 1G7PB 4E5XB 3MBED 3TYGH 1YEGH 5JXAH 3VFOA 2GSIA 2BERA 2IH3A 3RAJH 1TQCB 3KLHC 1E4WH 5C92A 1O0VA 3GMQA 1QVOB 1T2XA 3DX7A 2G75B 4IIQC 1G7IB 1NAKH 3BDYL 2GY5A 4D0BA 1YEFL 4PJEB 5DJYB 3TA3B 1H0DA 4LAQL 2DD8L 3HA0A 2Q86B 4KQ4H 5EZJA 4GT7A 3FO2B 5C9JB 3WIFA 2BNUA 3DYMA 1A3LH 3C6LB 3MRKB 2QADB 3VGFA 2Q6WB 3IJSA 4JPVL 4XCNA 2DI9A 4GRWE 3MJ8A 4EEEA 3RHWF 3MREB 3HMWL 4PYGA 3RX5A 4APQA 5SWSA 5J6HA 4NO0D 5FA4A 1REIA 1V7NL 4YAQB 5GGQH 3BWUC 5EIVA 3LSOA 5E08L 3FQUB 1MCWM 2DM7A 3HG1A 1ZT1A 2QSVA 4ZD3L 4JDZA 3HC4L 3QFJE 2Z92B 3SDAA 1FLTX 3U0WH 3LZFL 1NGXA 3KPMA 4AMKH 2XKNA 3ESUF 3ZKSD 1XH3B 2AJVL 3L3HB 2A73A 3RJQB 1ITBB 4PV8B 1Z5LA 4Y4KD 3BHBB 5F1IA 2OZ4A 5IESH 2Y5EA 5KSUB 5I1HL 4LK4A 3CFDA 3PNWA 4D9LH 4JFEA 4P4KC 1YUHA 4NSKA 2VWEC 1G7MA 3ULUF 5ANMA 3GMOA 4LKXA 5B3JE 4LASL 2AJXH 1CD1A 4KI5C 5C6TL 4PREA 3W39B 1LO2L 2DLFH 1BMGA 1WWAX 4M5YL 4YJZL 4GW5B 1TENA 5L0QB 3AU1B 5L2KA 4G7VL 1A6VL 4LEOB 4GO6B 4XTRC 3L5WA 1FAKT 4HLZH 3I9GH 3PGCB 1MREH 4ZPTA 5JXEA 1RUAL 2WINB 1NCDL 3QG7H 1RD6A 3QXDB 4IS6A 1S7UB 4LU5L 3UX9B 1NAMH 5JNYA 4XNZC 1FYTE 3H3BC 4H5SA 4WTXA 4YHKL 4HMEA 1HWHB 4ZS6D 3ROOA 2AQ3A 3T4AB 1EA9C 2VLKA 1HN1A 2VL5B 4HUUA 5ALBH 2PO6A 3VI3F 4DVRH 1SYVB 1LO0H 5I1DA 3L6FB 1CL7L 4JZNB 2IEPA 2GIYA 4IRSC 1ED3B 1ND0A 1F90H 4YR6A 5TDNA 4ZXBB 3U30C 2JF1A 1UZ8A 2Z9TA 4HGWA 5F6IB 4ZSOE 5DMYA 5JORA 4AIOA 2XQBH 2NY0C 2XG5A 1YC8A 1IARB 4CMMA 2FEDD 1WTLA 5DK3A 4L1DA 3UJTL 2GJZA 3LKOB 5HHPA 3RKDC 5A16B 3HE6A 4JY6A 3H6JA 5I2IA 1HILB 3HZYB 1LD9A 3SCMD 4MS8D 2R2BB 4WFFE 2AV1A 2IANE 4U0QB 4UT7L 5K9KA 4J1UA 4X80H 4K3DH 1OAYL 3PL6D 4WUKL 4OM1H 5I18L 4JO4L 1ZWIA 4HG4J 3ESVF 4OCSH 4MNGA 5LGHH 5DR5H 1A4KA 1WUNT 4KHXL 5B39G 5CZXC 1U93A 3VG9C 3DETD 4ODXB 2XZCH 2VAJA 4PG9B 5EZIH 1T89A 3AMLA 3TYGL 5IG7B 1YEGL 5JXAL 1A9BB 4PJCE 5IJVB 1BQSA 3RAJL 1E4WL 1Q9KA 3CFBB 2Y7QB 1CCZA 1NAKL 1U2HA 4XH2A 3I84A 3AVEA 2I25N 3F7QA 3T0XA 1X5JA 1PEZA 4ENED 4TVPE 4KQ4L 4P46B 3T0DA 1A3LL 5KSBF 3QI9B 1MCWW 4U1KB 3AS2A 4PJGA 1B0RA 4WFFD 1CBVH 1HQRA 2IAND 1WIPA 3VDCA 5CLWA 4LHJB 4JZJA 1D5ZB 1TITA 4HGMA 5AD0A 1ZK9A 3C8DA 3BPOC 5IGXL 3V79C 1FZMA 1UM6H 3SBWC 2A83B 5GGQL 5J7CC 4RGNC 5CEYB 1OD9A 4IRJC 4YNYB 5TGBB 4N9OB 4PR5B 4E41E 1AKJD 1R3JA 1TETH 4YDLC 4NRZA 5TQ0H 2HT4D 3WFZA 4G5ZH 1KELL 3U0WL 4JVWA 4AMKL 2Z35A 4WI9A 4HUWA 5L9DH 1MJ8H 2XOTA 2Z93B 5H94A 4IJ3C 3PF2A 1QLRB 4PJIA 3NZ8B 1MCLA 3QDGE 1K4DB 3IFLH 5D72H 4IOIA 5IESL 5D5MF 2PYFA 5FF6A 1MQ8A 2ZOKA 2PXYD 3MFFA 4D9LL 1KJ3H 1NJ9A 5HDLA 4TVPD 2JCCB 3G04A 2ZNWA 4AZ8A 2EE6A 4OLXH 1WBXA 1MFCH 1MLBA 3F7YA 3SKNA 5IROC 5J1AB 1DSFH 4R97C 3BT2H 5I6XB 2AJXL 4L3AA 3BZ4B 3VE0B 1DQTA 1T4KA 3HI1A 4PLOB 4Y89A 2Q8BH 2DLFL 3GB7A 25C8H 5E8PA 3DGGA 3TBYB 4C83B 4YPGB 4PJFA 1JNNH 5JOEA 1GOGA 1QQDA 3CZFA 3BXNB 3GMLA 4ORGB 2NX5E 4FRWA 3O11A 3RI5F 3I9GL 1EUUA 1MREL 2ED9A 1BOGA 2DDQH 1DN0A 3JV5A 2VABA 4UTBH 5EOCJ 4ZFZB 3QG7L 2UZIH 1KULA 1Q9OA 3CFIC 3PABA 4LP4A 2QLVB 3D25A 1NAML 5IVXA 4QGTA 4QHMB 5GS0C 2C7UB 3B3IB 3F6IA 4NC1E 1RUPL 5FUOH 3IVKA 8CGTA 3LRGA 5ALBL 4DVRL 1LO0L 3FT3A 4L3EB 3TZVC 3G6AB 1UB6B 1F90L 4LCWE 5EN2A 4LLYA 2O93L 1QSEB 4LDEB 3HNTH 4S2SB 3BD3A 5D93B 3EYUH 2XQBL 5GGRA 3CDYA 3Q3GB 2NX5D 4LVOB 3EIFA 2C1OB 3O6FC 3DVNB 5H35B 1CF8H 3C09C 1AJ7L 1J8HA 5MEQA 4HKZB 4X80L 1I1AC 1J0HA 2X9XA 3MRLB 4K3DL 4OM1L 4NBZB 2DQGH 1XIWA 4K94C 1A7RH 4OCSL 4I3RH 5LGHL 5DR5L 1GZPB 1CG9A 2XZCL 4KDVA 2R2HB 5EZIL 4GLRI 2QBWA 2WBWB 1NUDA 3TBSA 3RGVD 3UYPA 1RHHB 4NUJB 3Q5TA 3CVHH 3K2UH 1PG7X 4Z7VA 1TTFA 1AD0B 1NMAH 5E8EB 1V3LA 1WCBA 4D94A 4HUXB 5DD6B 1XGPA 3CX5K 2AXFA 3WKNA 2DQEH 1CR9H 3MOBH 2UYLA 3RWGA 2CR3A 5KSAA 1IAOA 1XCTB 4CMHC 3RVXC 3WE6A 4B7LA 4CN1A 1ACYH 4XBGA 1CBVL 3GSWB 3QUZD 1MRFH 3WIIH 5E24E 4P23D 1XF4A 3KYNB 4M7ZB 3QIWC 2WWKT 4EQ2A 3DRQA 5GQBA 43C9B 1NH6A 3SDDA 2BY2A 4MQ7A 4EI5A 5BJTA 1NC4D 1UM6L 4YFEA 1FVDA 1FZOB 2ATPB 2LFGA 5HBBA 1FFRA 1DQLH 2FIKA 1JF6A 4X7DC 4X5WA 3IU3A 1TETL 2V9QA 5DK2B 5TQ0L 2DJ4A 1IZKA 1RK1B 4G5ZL 2Y25A 5L9DL 5ACLA 4U05A 1MJ8L 1LE9B 2JB6B 5BV7B 4DZ8A 1RAMA 5EU5B 5IVZB 4WHTA 3IFLL 1A6PA 3T0EC 4L8BA 3PDOB 3QQ9D 1W0WB 5IT2H 1JPTH 3QHTC 1KJ3L 2D0HA 3PGDA 1W2KT 2HLAA 4IHOB 3DRTB 4OLXL 1MFCL 2P43B 4FXGB 1DSFL 1BHGA 4R9HA 4BELD 3BT2L 2UWEA 4Y16A 2Q8BL 1BJ1H 3ULUC 3GO1H 2NXZB 4KRLB 25C8L 3V6OA 4M6MH 2GT9B 3KYMB 3X13A 1PG7W 4MD4A 5CBEA 1JNNL 2IALB 2NPLX 5MEPA 3ZDXE 4AIZA 5FYJD 5LGKA 1K4CB 1S7XA 5CSZB 3UEZA 2NY4B 1D6EB 3MLZH 1PZUB 5FO7A 2DM2A 4Z7NE 5D70H 2DDQL 1YNTA 4UTBL 2UZIL 2HRPH 1VHPA 3BESR 4QHKJ 5GGUB 4HQQH 3JTSB 2JELH 2CLVB 4E0RA 1W0VA 5ACZA 3UMTA 1DANT 5D1XB 4Z8FH 1AFVH 2BC4A 2Y23A 1JNHA 2I9LA 4PJ9C 3KYOB 5FUOL 4NT6A 4U1NB 1PEWA 5DEZA 2A6JA 4NQEE 4P2CG 5HYJA 5BRZB 4N8VG 2HJFA 1IC5H 1KCSH 4GAGH 1TIUA 3H9SB 4DVBA 3ISWA 1TZIB 3HNTL 3JWDC 4GRLA 3RL1B 3RWEA 4Z9KB 3G6JA 1NBZA 4LCCC 3G5VA 5L2JB 3PWLB 3EYUL 3Q6FA 4M1CC 4Z7UA 1CFSA 4WHDA 5FECB 4RNRA 1H8OA 5DURB 4ZFOL 1CF8L 5DHVA 4X7TB 3K0WA 1HI6A 1BBDH 3MUGA 3SKMA 1UQSA 4YXKH 4L9LA 1F3RB 4LCUA 3K46A 2DQGL 1D9KA 1JWSA 2ATKA 5EU3B 1A7RL 4E42A 2NY1C 4I3RL 5GRVL 2DWEB 3S9DB 1HHIA 1LDPH 1IM9D 1YMME 5GGVY 1T1YB 3GFUA 1DUZB 5J12B 5KS9A 1JYWA 3OXSB 5E6IA 4RFNC 1ETZA 5GS0H 3FFDA 3MYZA 2IF7A 2IBZX 3CVHL 3K2UL 3OKMB 5J9PB 2X4NA 3MRBB 4HHAB 1NMAL 3O41B 4I48A 3S37H 3IKKA 3VJ6B 3P77A 3W5NA 4NKDA 3VGAC 4OFVA 1A7NH 4MDJB 4HEPG 1F4WH 4RDQF 5T33H 1VADA 1Y18B 2DQEL 1CR9L 3MOBL 3OWEA 3HAEB 4PJ5D 1ACYL 3H9YA 3SGJC 1MRFL 3WIIL 2KL6A 4P2QD 2FECI 4OCNC 3I02B 4XMLH 4PJDA 1ZGLM 3BIKA 5ITFA 1CXHA 3SGEH 2ZWLT 5GRJH 3ZDZF 4Z7WE 1A1NB 1OSPH 5DRZB 3LDBB 4UIMB 3WJLA 1CICA 4UNVA 4MNQE 5BV7H 1YMMD 3RU8H 1DQLL 3VFOB 1BAFL 2GSIB 3KLAB 4XCYB 3MV8A 4QHUB 2VH5H 1RMFH 3GMQB 3WYRA 3DX7B 3S35H 4D0BB 3BX7C 1H0DB 4NBYB 2A74B 1VKXA 2H2PD 4YXLH 2AQ1A 1RU9H 4TNWF 1V05A 3T77A 1XFPA 1YN7A 1JPTL 4PJ8D 5IT2L 2X4UA 4XBPA 2HLFD 1HCVA 3IJSB 2I5YH 4KDWA 4XCNB 3SDCD 1DANU 3K80A 3MJ8B 3D0VB 4P3DA 3GO1L 5SWSB 3NIFE 4HSQA 4M6ML 2LVEA 5DMKA 1HSAA 3LSOB 1KJVB 5E94A 5IMOA 3KPOA 2VDOH 4JDZB 4MNQD 4XWGH 4PRPA 3SDAB 2EIBA 3MLZL 1NGXB 3KPMB 2XKNB 5D70L 4KKCC 4P5KA 2JE8A 1L6XA 4NPYA 2X7LA 2A73B 4LBEA 2HRPL 2N7BA 1G7HA 1Z5LB 2VISA 3BUTA 4HQQL 5B4MC 2JELL 1X3DA 5F1IB 4Z0BH 1H9VA 2VITA 3CFDB 1AFVL 2Y6SD 4ZUWA 1YUHB 1JJUA 4GW1B 1G7MB 3CX5J 3RQ3A 3GMOB 4FQXA 4PS4H 3VA2C 1QD0A 3VXSA 3S96A 5I71B 4YFLI 3S36H 1I3RA 2LABA 3ARGD 1SJEB 4PREB 4BSWB 3HUJE 1V5JA 5IKCA 3FN3A 1IC5L 1KCSL 3OV6A 1JRHH 3ARDA 4GAGL 2WAHA 5LBSH 3UDWA 2BHYA 1BZQK 1JTOA 1O7SA 4ZAKD 3VFPA 5L2KB 4Y2OA 3TIDB 5DJZB 4K7FA 3L5WB 1I8IA 4KJPC 3MQIA 4D9QD 4ZPTB 4IMLA 2P42B 3KXFE 3MA7A 4V2BA 5TDOB 2YN3A 3B83A 4S1DD 3VI4F 4GXUN 3NPZB 4UILH 2P24A 2FBOJ 4Q9QH 1KACB 1A22B 1WZMA 1KPRA 3EJZD 5JNYB 4XHJC 4H5SB 3V4PH 1BBDL 1C1EH 2PYEA 1JI2A 4YXKL 4Y1AE 3PWJA 1CGVA 5L88H 2DM3A 1IGMH 3HE7C 5F7NC 5I8EB 3ROOB 4Q6IB 4ZUVA 2VLKB 4OBRA 1GZQA 2PO6B 1LDPL 3GKWH 5C2UB 1CDBA 5DJDB 2E3VA 3HR5A 5I1DB 3ZKXB 1DDHA 3K4DA 3TC9A 1ND0B 5A40E 4WI5A 2ICWB 5BOPA 1Y0LA 5GS0L 1UZ8B 2NY2B 4HGWB 3WSQH 2YK1H 1H5BC 5HYEA 3HAEH 3RY6C 3FB7A 3S37L 2DKUA 2E6JA 4CMMB 1KJMB 5HHPB 2GJZB 2WBJD 1A7NL 1X5IA 3HE6B 4JY6B 4ORZC 1RVFH 5I2IB 1FNEB 2CDFA 1NBVH 1F4WL 1LD9B 5T33L 3DARA 1EFXA 3KXFD 4NKQB 2JB5H 1II4E 3DBXB 3WNLA 1LNUA 3EJJX 1MUJA 1IL1A 4J1UB 3AC0A 4D9RD 5C0BE 1DUYB 4OI8A 1EAJA 1X9QA 2WQ8A 4X6CB 3CSBA 1GAFH 4XMLL 4DK6A 2DLTA 1R3LB 4MNGB 4Y1AD 3V7AE 3PHSA 1A4KB 5GRJL 5HI4C 1KXTB 4XVTH 2YXMA 1OSPL 4QNPF 5MEOB 4BK5A 3BJ91 5BS0A 1OGAB 5BV7L 3UBXA 3RU8L 5TE6H 3OG6B 1EBPA 2VH5L 4IDJH 1Q9KB 4YDVA 2CH8A 2NY6B 3VGEA 4A2LA 4CADA 3S35L 4XH2B 4BH7B 3TP4A 2YPKA 2J2ZA 3I75B 2F53A 2VDKH 2JIXA 4MGXA 5FB8A 2R0KH 5EFIB 5I1EH 2XFXA 2F74A 3VXMD 4YXLL 1RU9L 3HTLX 1KTLB 3WCYA 4J3TA 1JFQH 1HKFA 1RZKH 1H8NA 3T3MF 4EOWH 4PJGB 1UADC 3HCVA 1HQRB 3CFJA 2I5YL 4F57L 2DQCH 2PTTA 1F6AA 1HZHL 5AD0B 2EDRA 3OJVC 5J8OA 1BREA 5F7YC 1FZMB 4UV7H 4M3KB 4YHIA 4WI2A 3RUGF 3QT2A 2BCKA 1HQ4A 1VGKA 5DHYA 1R3JB 2OZ4H 4XWGL 2VDOL 3RDTA 2MCG1 3KHOA 3LPGA 4XC1L 2UUDH 4R2GC 4HUWB 2GK0A 4QHNA 2HYMA 5H94B 5DHXB 4PJIB 4QO1A 5D1QD 1OQOA 3WV0A 3TO2A 4JPKH 1BZ9A 4YBLC 4Z0BL 2PYFB 2B20A 5MI0B 3TO4D 5FF6B 2ZOKB 4HUVA 3MRFA 3MFFB 5J11B 1AD9B 1NJ9B 1TZHA 3SDXF 4AQOA 3G04B 2WLZA 4UU9A 3NZHH 2QR0A 5IB5A 1WBXB 3SKNB 1MLBB 3F7YB 3MJ6A 4PP2A 4PS4L 1DBKH 3U46B 4LPYA 4LSVH 3S36L 1ZT7A 2IH1A 5HHQA 3EDEA 1T4KB 4R90H 3HI1B 3ARFC 1UEYA 5CJXC 3GB7B 1AGEA 5E8PB 3DGGB 5I75B 4KJQD 1JRHL 5F8RC 3ZMRA 3RNQA 5LBSL 4KUZH 4JM2A 3DMMB 1IAII 1TCRB 1QQDB 3CZFB 3GMLB 3K8KA 3D2UD 3CFEA 2JTDA 5EU6B 2C1PA 2VNCA 5C1MB 4K7PH 4U1LA 1BOGB 1DN0B 1S5HA 2KPNA 5F71A 3L3JB 4FMKA 1DLHA 1Q9OB 4UILL 2O61A 3PABB 4Q9QL 2R23B 3D25B 3V4PL 2RFXA 1C1EL 2XI9A 2EECA 3VXNA 3BH9B 1GJIA 1PFCA 5L88L 1IGML 3TGXA 1VGEH 1X5YA 3HNVH 3QQ3A 3GKWL 2HWZH 4KRPC 3FT3B 4DKEH 3KLDA 4X4ME 1WAAF 5EN2B 1BFVH 4PJHF 4XB8A 4J4PA 3RWIA 4L4TE 5IP4A 4F7PA 3WSQL 2YK1L 3MRIA 1U3HD 1RK0A 1F13A 3UJIH 4HT1H 2Q7NA 4K23H 3C6SA 1A47A 4BKLA 4YO0A 2ICEA 4JFDD 2D4FA 1RVFL 3P0YH 1NBVL 3MODH 2JB5L 1OTSD 5MEQB 1NFIA 3D1MC 1MIEH 3FCTB 4G6AC 4JRXE 1BD2A 3DXAA 1MFDH 3C60D 3DO3A 1VEPA 1GAFL 2J5LB 4X4XA 1FNGA 4XVTL 4C58B 3GMRA 1CG9B 4AT6B 4N0UA 5ESQA 5F1NB 5DJXA 4OFYA 1FFQA 2BXZA 1BFSA 2OYPA 4H0IA 5TE6L 2I27N 4P4RB 4IDJL 1OHQA 4JHZA 1QHOA 4PJXB 5HDQH 1TPXB 1T0PB 4L4TD 1PD6A 2B39A 5FM8A 1R5VA 1WK0A 1RUQH 2ZUVA 1ZV5A 5C0CE 2VDKL 4AENA 2X4OA 2R0KL 5I1EL 1XGPB 4JREB 2VLJE 1XGTB 2ZUQC 2WWKO 2UYLB 3RWGB 1JFQL 5HI5D 3KS0H 1E6OH 3LEVH 1RZKL 3WE6B 4EOWL 1ZOXA 5J3HD 3KVQA 2NCMA 4LF3A 2QHRH 4H8WC 2DQCL 3OX8A 1U3ZA 2CO6B 2VLLB 5I66A 4ISVA 1OWRM 2O5ZL 4JRXD 1KN4H 4PJAA 5IW6B 3RA7H 4ZUSB 3DRQB 3SDDB 5BJTB 4MQ7B 4UV7L 1EFQA 1FVDB 1P53A 3VXUA 2H9GA 3FJTA 2FIKB 4X5WB 3IU3B 9CGTA 2OZ4L 5FOBA 1I8LC 3NIDE 1IM3B 4KK8C 5DMJB 2DYPB 3LCYA 3VWKD 1H3UA 4WHTB 3GI8H 2VQTA 4JPKL 3EHBC 4OGAD 1LWRA 1H8SA 3NVQA 4LKCA 4OV5A 3BPLB 3TVMA 5C0CD 3FB6B 4YDIH 2ZG2A 3D0LB 3MLTA 3PGDB 3VFRA 4AEIH 2VLJD 2CD0A 2HLAB 1XR8A 1D5XB 3NZHL 3GEWB 1DBKL 3C5ZD 4J7RA 4LSVL 4Z0XB 2UWEB 4Y16B 1GH7A 4R90L 4ETYA 4FP8H 3RVWC 2APVA 3ZYIA 3L1OH 3X13B 4MD4B 4LARH 3U4EA 4KUZL 1LP9B 4AIZB 2OXGA 4OCMC 1S7XB 1NL0H 2WIIB 1UKTA 1U8IB 4KC3B 2G2RA 4MWFA 5FO7B 4NQDE 3VGHA 5B38A 5HPOA 4K7PL 2PKDA 1DVFA 1YNTB 1PKQE 3EOTH 4L8DA 1F5WA 4MAUH 3ZKND 3VMPA 4LL9A 3MNVB 3SPVA 3N0PB 4OD3H 2ZNXA 2BOBA 4P99A 1W0VB 5F1SA 4IOFC 5DTFA 3J8F7 1YEKH 2P8PB 5GZOD 5TDPB 1JNHB 2I9LB 3NA4A 3J7HA 3BN3B 1VGEL 1NGYA 3HNVL 3SY0B 3UPRA 2FEEI 4LHUA 5D7IF 2HWZL 2A6JB 4DKEL 5HYJB 3QHZH 2HJFB 2A1WH 5HDOA 4MA8H 3LKPA 1BFVL 3UROR 1BGXH 4DVBB 5JIIA 3N1GC 4PIRF 3RWEB 5E5RB 3G6JB 4PJEE 3QWOA 4MVBC 3UJIL 2CKNA 4Z7UB 4HT1L 3WJLC 3HC0B 4K23L 4RNRB 4OI7A 5K9OA 3QFJA 3IFPA 4LVHC 4RMSA 4NZRH 2XPGA 1WCQA 1S78D 3P0YL 4NQDD 3TBTA 1NEZA 5DHVB 1UT9A 3UZVB 3MODL 5GHWH 1HI6B 2UZXB 1MIEL 4MNHA 1ZLUK 4KKNA 2XIDA 4L9LB 4LCUB 1QG3A 1D9KB 1JWSB 1TJHH 1MEXH 2ATKB 2EC9T 4E42B 4ZS7H 2AKRA 5DMGC 1BLNA 5KS9B 1MHHA 4WTZG 4MZ3A 1IRAY 3WL9B 3O9WC 5E6IB 3ZHDA 5D1ZC 1ETZB 3MCG1 3FFDB 3C08H 4HKBA 1GOFA 3D85D 4XPBH 3UJJH 5DRXA 2X4NB 3NBNA 5HDQL 4I48B 4O4YH 3N06B 4NKDB 1YQ2A 3M45A 3IDGA 4OCXH 5DZOA 3TA3D 1N5AB 1RUQL 5FEBA 1U8MA 5CEXB 4GAFB 1SYSB 2EE3A 4MCYA 3T3PF 3K7UA 4WU7A 2D7MA 4FOMA 3PWVA 5SX4I 3C6LD 1E6OL 3LEVL 4HAGA 4TVSa 3ZE0F 5JW3H 3MNZA 1CL7I 1FYTA 2QHRL 3QUMB 3PIQA 4Y4FC 5CEZE 2LV4A 4NCC2 1FG9C 1KN4L 3RA7L 3IXAA 1EEZA 4OAWA 4HWZB 3DGCR 1G7LB 3U36B 5C07B 3WLBA 1WWBX 3BEVA 5FUZH 5TQ2H 3QZWG 1M71A 2Y07H 3GSXA 5CD3B 4P57A 4F80A 1GVIA 4I18A 3DUSA 3RIFK 4MYWB 4ZSOA 2C3VA 3P4OA 1OAZH 5SX5K 4M3JA 2PW2A 4TNVF 3C9NA 2ERJC 3GI8L 1VKXB 5E2WH 3BRGC 1MH5A 3IGAA 2MQCA 1YN7B 1YNLL 2X4UB 4YDIL 4XBPB 4AEIL 2ZCLH 1DQJA 1UACH 4EDWH 3RY5A 3DX6B 2D31B 1KXVC 4LNRA 3ZKQD 4DK3A 4KWUA 4P5TA 4U2YA 1J0KA 4P3DB 3VDAA 3ARBC 5CEZD 4FP8L 1RI8A 4P4KB 2LTQC 3L1OL 3QULA 5DMKB 4LARL 3MRHA 4X5LA 5MHSD 4FXKA 3NCYS 1NL0L 3KPOB 4PRPB 3O6KH 4P5MA 3QIBA 3RVVC 4OF3A 3EOTL 4P5KB 5CAYB 2X7LB 4MAUL 4LBEB 2R1WA 3Q6GH 5K9QI 1IAKA 1LEIA 4KDTA 2VISB 2ZCKH 4OD3L 5CLTA 5FHAH 4R4BB 1JIBA 1H3GA 4ODSH 4NN5B 1CFTA 3TN0D 5F9JA 1YEKL 4ZUWB 4PBXA 3BKJH 3SDYH 4MXQD 3ZT5A 2HH0H 4Z78A 4NYLB 5C70A 4RQQA 4FQXB 3WFDH 2HMIC 3QUKB 3QNYA 3IT8D 2EDXA 1LO4H 1I3RB 3WUWA 2IG2H 4XNZB 2BVEA 3ROLA 3QHZL 3EOBA 1CGWA 5IKCB 2A1WL 3CMGA 4MA8L 4MJ5B 4ZXBD 1U9KA 3RP1A 5DHVH 1E28A 3V6ZA 3MV11 5K33A 5KAQG 5IMMA 1JF1B 2NMSA 1I8IB 4E41A 3QNXA 1NDMB 3CDGA 3LPWA 4LSPH 4YGAB 3DJ9A 1RZJH 1VFBA 4NZRL 2H45A 1Q9WB 5CJOH 3STZA 5F9OH 4PRIE 3U30B 2YWYA 2BVYA 5I76A 3QCUH 4GUPB 3PHOA 1KPRB 1S7QB 5GHWL 2ED8A 3QDGA 4ALAH 2PYEB 4PY7A 1SMOA 3LKSA 4ZODA 2CXGA 5GSVA 1EJOH 1TJHL 1MEXL 3T2QA 3BJLA 4ZUVB 1I1RA 4ZS7L 1JZ8A 4P2RE 2AXGA 3HR5B 2IBZY 1V3JA 1HH9B 5C08E 1DDHB 4YHLH 1MSPA 3RZCA 2ITDB 4QRUA 4BUHA 3FRPG 2YA2A 2VRAA 3FKUS 1Z0MA 1U2CA 4XPBL 3UJJL 4HFWB 2CMRH 3Q2CA 4KU1A 3FB7B 4QRPA 1RJZA 3VG9B 5FYLE 1T2JA 4O4YL 3F7PC 1B0WA 2FDBP 1MWAA 4OCXL 3QPQD 1M7DA 3QSKB 5D7LB 3VWJA 2IFFH 1LVEA 4KHTH 2XQYK 2CDFB 5C0GA 4P46D 2JCCE 4RMTA 1NSNH 3O3EA 1RFDH 4RWHA 2F19H 1IL1B 2MTPA 3F7VA 3S88H 3EYSH 4PYHA 5JW3L 4Y2DC 4OIIH 5MENE 1JNJA 5IB4A 4RRPG 5JLZA 1SJXA 4FQCH 4Y0GA 3HZVB 3CC5A 3UBXB 3V4VH 4K55A 5TQ2L 1T0MA 1W72A 1BWWA 1UH4A 5IIEA 2G5RA 2OL3A 1S7RA 4LCWA 3BPOB 3QDJB 4JR9H 1FZJB 2YPKB 1OAZL 2Z91A 3MV7A 4IRJB 1CE1H 2F53B 5FYLD 2JIXB 4MZ2A 2F74B 1GGBH 1S7SA 5E2WL 3AS3A 5ELIA 1FDLH 3O81A 1MCFA 4I9WE 5FK9A 5IBTH 3BGFC 1CLZH 2NQCA 3QO0B 3QUZA 4IJ3B 3CFJB 2ZCLL 1UACL 5ICYA 2HJKA 4P23A 4EDWL 4L3EE 1SQ2N 2GITB 2PTTB 1CXLA 5A3ID 5B39A 4P9HH 1QSEE 1HYSD 1HHHA 1NC4A 1K8DA 5D7KE 1T7ZA 3I6LD 5LWYH 2BCKB 5DRNB 4AL8H 5F7HA 1HQ4B 4FQ1H 5EBWA 5EB9A 5CCKH 1ORSB 5IV2B 4R97B 2R0LH 3RDTB 1CXEA 1BBJA 3O6KL 1WBZA 3I6KA 4QHNB 1NGQH 3EDJA 3WFBH 3LQAC 2FRGP 2HT2D 3W5MA 3Q6GL 2DJSA 2ZCKL 4OZGE 3L3KA 5FHAL 1UJ3A 3CZJA 1BZ9B 5FFLA 4ODSL 4HUVB 3MRFB 3SE4A 4H25A 1T7YA 1NBQA 5E2UH 3IYLW 1TZHB 1YPZE 3DROA 3BKJL 4GFTB 4LDOB 3SDYL 4UU9B 5ETUA 2QR0B 2HH0L 2VLRA 4I9WD 4D0CA 3WFDL 1CQYA 1N59A 2E5EA 2YC1A 1YECH 1LO4L 1ZT7B 4XAWH 3MFGB 4JHAH 2IG2L 2GYSA 4E9LA 1BQHB 3FTGA 1ZLVH 1AGEB 1XGRA 5CUSH 2KQNA 3EGSA 1ZHBA 3KR3H 2Z31A 3BD4A 4F8QA 1QSED 3CNKA 1NCBH 4WCYH 5HGGS 4Y19B 4W6WB 1G7JA 4KMLB 5D7KD 2QQNH 3HLAA 3CFEB 2C1PB 1QYGH 3D39B 1IBGH 1AO7B 2RBLA 4LSPL 4MHHG 4Y5VA 4U2ZA 1PQZB 1RZJL 1RV6X 3L5HA 5CJOL 5F9OL 2VTFA 1OTTD 3QCUL 3BUYA 4N0RA 2K7PA 3AS0A 4ALAL 2RFXB 3HAEG 3QYCA 3VXNB 4O2FA 5IM7A 3C5SB 5JHLH 2VXVH 1UCTA 3OB8A 4EBQH 1XR9B 5EOCH 2IC2A 4FS0A 5AWNH 3OJDB 1EJOL 5D71H 3X11A 3C09B 2EC8A 1BEYH 3QQ3B 4MQXD 5FO9A 2CKBA 4MQSB 1ZKAA 2IPKA 1I7TA 5DGQA 4YHLL 1X5ZA 3KG5A 4YHNA 4POZD 4XPTL 3MUY1 4HKXA 1E4KC 4HX1A 3GUTA 1FGNH 3RWIB 2APWA 4F7PB 2A9MH 3MYJB 2CMRL 2ITCA 3MRIB 3MBEC 4KV5E 1BF2A 1UM4H 5DK0A 2ICEB 4PJ7A 4X0KA 2IFFL 4KHTL 5CBAA 4NWUH 1NSNL 1MHCA 1SBSH 1RFDL 5J1SC 2EKSA 3S88L 3EYSL 1HIMH 3BQUA 2WUCH 4OIIL 1S7TA 1EPFA 4Z5RA 4X4XB 1IM9A 5HGDA 3AAZA 5IHZA 3GMRB 1OCWH 3KYAA 4GAYA 4FQCL 1HKLH 1RIUH 4N0UB 4Z76A 1F4XH 5ESQB 4CMHB 5DJXB 2J8UF 1BVKA 2BVUA 4XNMA 1KOAA 1HEZA 4NQEA 2X4RB 3V4VL 5GZND 3FL7A 2DIAA 4TSAH 5C0EA 3GIVA 3BI9X 3VD7A 3DECA 4JR9L 1C5DA 5E99H 4RIRB 4U6YA 3QRFM 3A6CH 4YFLF 4P48A 4AENB 2X4OB 3W81A 3CPLA 1GGBL 4U1JA 1FDLL 5IBTL 1QSFB 1CLZL 1GGIH 4YHPA 4Y4KC 2X10A 3O8XA 4LF3B 4TUOA 2RGSA 5BRZE 2YSSA 2FGZA 4QEGA 4P9HL 3T0EB 4PJAB 4IEFB 2NXZD 4L4JA 4RMQA 1KPUA 3VXUB 5LWYL 4L3CB 4AL8L 4FQ1L 5CCKL 5LG1A 5EDXA 3PDGA 2R0LL 2N1KA 1LDSA 1KB5A 4HIIB 4LLVA 5F3HB 3C8KB 5FOBB 2DBJA 2NY4D 1IMHC 4HDIB 1X7QA 1OP5H 2BJMH 2V5SA 4Q2ZA 5DMIH 2BSED 1NGQL 4NFBA 4LP5A 4ZUUA 1K2DA 2K1MA 5C8JB 3AB0B 4NDMB 4KGJA 4LKCB 4OV5B 1NMBH 4CVZA 3TVMB 5D1XD 5ICXA 5E2UL 3WDHA 3MLTB 4MAYC 5DD1H 1A7QH 3VFRB 3IDMB 4R7NB 2ENSA 5C71A 5EU7C 2BHZA 1UFUA 4Q58C 1YECL 4BSJA 5IEHB 2M1KA 4XAWL 1J8KA 4ZPVA 4JHAL 5HYQA 3TJHC 2EDTA 5BRZD 3W0WE 4ZS6C 5DYOA 5HSFA 4FA8A 2WK2A 2YRLA 5CUSL 4DFHA 3H9SD 3KR3L 4U6HA 4KROD 1F6FB 1E6JH 1NCBL 3D6GA 4WCYL 3U4EB 3KPQB 5F96H 2IJ0C 1KEMH 2QQNL 1WIUA 5CSBA 1LGVA 5HGAA 1QYGL 1IBGL 2G2RB 4MWFB 5B38B 1A3QA 2Y5TB 2CGRH 4OSUH 1DVFB 3V2AR 4U7MA 5DURD 4L8DB 2GUOA 2J6EA 3F5WB 3SPVB 4YGVB 1FCCA 4LCCB 4U31A 1OT1A 1N26A 4Z7NF 3GMMA 2BOBB 2FEDC 2XV6B 3H0TA 2EYTA 3ZE2E 5JHLL 2VXVL 1U8PA 4FQQB 1T03H 3FB8B 3SCMC 2MNUA 4GMTH 4MS8C 5EOCL 5AWNL 4UTAH 5D71L 4ZTPH 1QSVA 3LQAH 1EDQA 1NGYB 1BEYL 5JPMA 4LHUB 2XXMB 3PL6C 1J88A 3JWOH 1A6AB 4KKLD 4ZFFA 5D2LA 1PG7H 3MR9A 2RCSH 4P3WA 4X9FA 4AH2A 2XWBA 1FGNL 2NY1B 3DETC 2A9ML 3QWOB 2A2QT 2ZZUT 5FV1L 4FQHB 4BH8B 3EO1A 1I8MA 1VEMA 3ILPA 1UM4L 1A2YB 5K9OB 3U7WH 4RFNB 5FYKE 4M1GH 3TBTB 4XPFH 4PB9H 4NWUL 1QNZH 2ZJSH 2AV7A 1SBSL 3BZEA 3PDDA 4MNHB 1U58B 1HIML 4U4BA 3VGAB 2WUCL 4ENEC 2ZOLA 3RNKA 5LVEA 1U8KA 5AAWA 1P9MC 5INDA 5JW5A 2AKRB 3MCKA 1OCWL 4JJHA 4N8VA 4WFEE 1MHHB 3C8HA 4XP5H 1HKLL 1RIUL 1F4XL 1JGLH 4G9DA 1CFQA 1D5IH 3HUJA 3HMXA 2EDLA 4TSAL 5DRXB 2V5YA 1YZZA 4K71B 3N50A 3IS1X 1JGDA 3BP4A 4HS8H 5E99L 4UDUB 3MSPA 4BZYA 2F54B 2HT4C 3A6CL 2W0LA 4Y5XC 2KUTA 3KXFA 3TNNB 5C6WH 1OB1A 1RZ8A 1YYLH 1T1ZB 5CSGA 2AJ3A 2EO9A 5DUBB 1RJLA 3ES6A 3KWWB 1X6NA 1GGIL 4LVNB 3MNZB 1FYTB 1F97A 3LKNA 1P6FA 3PIQB 3ARVA 2PXYC 4Z7OE 1BQLH 4K8RH 1F2XK 3IXAB 4APQD 5SWSD 5L2KE 4OAWB 4S10A 3VD3A 2EDJA 2X09A 3BEVB 3QXAB 4WFED 1TQBC 3CXHK 2EDBA 3GSXB 4P2OC 4IBLT 3SDAD 5EH1A 4I18B 3DUSB 3PP3K 4NZUH 2BJML 3IDUA 3MROA 5DMIL 3WN5A 2OTWB 3WHE1 3C9NB 1R0AH 3F58H 1H3VA 3IKCA 1FFOB 1MH5B 3IGAB 4QY8B 4R3SA 4G8EA 1NMBL 2VLKE 4Y4HA 3SGEI 5KSVA 4JFED 5DD1L 1A7QL 3S97C 3HFMH 1DQJB 2CLZA 3WFCH 5C0BA 4JN2A 4LNRB 4W68A 3C2SA 4P5TB 4H1LA 4TULH 2E9BA 2FHCA 3LH2H 3QULB 5IB3B 2CRYA 1E6JL 3MRHB 5F96L 5L2KD 1KEML 3U2SB 1KLUA 4FXKB 2CDEA 3AREB 4NNXA 3NIFF 1ONQB 4W4OC 1YEJH 5E7BA 3T0WA 4P5MB 5JXED 2CGRL 3QIBB 4OSUL 2CK0H 5SWZE 1X4YA 3ARRA 5E8NB 2R1WB 5JUEL 2ZUYA 1IAKB 3MRNA 5DRWA 4JKKA 1LEIB 5GS1A 4X6CE 2VYRE 4HIEA 1OP9A 3KJ4B 3AM8C 3VXOA 1BZ7A 1NCAH 1F4HA 4JANA 4JDTH 4MSWA 1F11A 5F9JB 4GRWH 1T03L 1PZ5A 1Z6JT 3MLSH 1CGUA 5EULV 1FN4A 4GMTL 5MP6H 1DCLA 4UTAL 4ZTPL 4QRTA 3LQAL 2VLKD 3QNYB 1OGAE 2PO6D 2QKIA 1QLEH 3WUWB 3BO8A 3LB6D 3JWOL 1ZVYA 3ROLB 1XF2A 1ZA6B 3BZFA 3EOBB 4R0LC 1JV5A 2RJMA 1SY6A 1PG7L 3HE7B 3F12A 2RCSL 2NY2D 3V6ZB 4NC1C 3FONA 3MRJA 3UTPE 5EPMA 3EYOA 1BJMA 3QNXB 3OZ9H 3RGVC 4F9PA 4KFZC 1VFBB 3HE6D 1G7QA 3U7WL 3H2WA 1TVBA 4M1GL 4U33A 2HFTA 4XPFL 5I76B 3ZYOA 4PJGE 4UIKH 4PB9L 4GBXB 1QNZL 2ZJSL 1FVCA 2RHEA 1NFDA 3QDGB 4HLJA 6FABH 4GKOA 3JSSA 1JPGA 4KJWD 4LPXA 4F15B 2EZ0D 4QLRA 5GSVB 3WNMA 4XP1H 1JRHI 4PRBB 1FL3A 4KK9D 2AXGB 3L3DA 4XP5L 2WMPA 3RZCB 1OGAD 1U95A 4NOBA 1JGLL 3N1FC 4P23C 4QRUB 2W1NA 2YKLH 1D5IL 1MCPH 3WKMH 4OZHE 1EHLH 4HWNA 1U3HA 4KUCD 2NY6D 4PJIE 1CFNA 1WZ1H 4QRPB 3U1SH 5DEGA 1KV3A 3S6CA 4HS8L 4PGEA 1XAUA 1M7DB 3VXQA 3VWJB 1FZKB 2OSLB 5GJSH 1R24A 5D6DA 5JW4N 4HK3N 1D5BA 1AP2B 5C0GB 3B9KC 4S0SD 1YYLL 4XCFH 5HHOA 3TYFA 1H15B 2ZPKH 3F7VB 1GGUA 1F8TH 3VMOA 3V8OA 4ZO8A 3ZTNH 5FGSA 4X8XA 1INEH 1I9IH 3QQ9C 4XGZB 2P5WB 1BQLL 5JLZB 4K8RL 5F6HI 3NFPB 3IXTA 2JJWA 4QCIB 3DX8A 5EU6E 2FGWH 2AEIT 1T0MB 4ELME 1W72B 5IIEB 5IK3A 4X4MA 1I3UA 1BM3H 1S7RB 4LCWB 3SGKC 5FYKU 1NMCC 2HRLA 1AQDB 1J9CT 1YN6A 4NZUL 4L4TA 3LAFA 3O6LH 3OPZH 4PP1C 3MV7B 2Z91B 3TT3H 8FABA 3MUZ1 3TV3H 1R0AL 1BJ1J 2ADFH 2H2SD 1BVLA 3F58L 1S7SB 2EYSA 4YZFE 2AK4A 5FK9B 2VUYA 5T3ZE 1XF1A 1GCFA 2B4CH 5BZDA 1Z9MA 3HFML 5KN5A 3PE9A 3EFFB 2YPLA 3WFCL 5C0FA 4YBLB 1BF8A 1GRWA 2VR5A 1GHFH 1HHHB 4TULL 4X9IA 2E7HA 3LH2L 2CRZA 4TPRH 3X3GH 4GG6F 3O2DA 5DJ8A 3MRPB 5EU6D 2F5AH 5B8CA 2VQ1B 4J23A 1YEJL 3ORJA 1VFAA 2JK5A 1JNLH 1P4IH 1WBZB 3MRQB 2CK0L 3HPJA 1E4XH 1XF5A 5J57B 1MY7A 1UJ3B 4NRYA 1G1CA 1TXKA 1NCAL 4JDTL 4RA0C 4H25B 5DXWA 2VLJA 3DROB 5HY9B 3MLSL 5ETUB 1WIOA 2VLRB 4D0CB 4J12A 1A02N 3FAXA 2YC1B 1QLEL 3V5DA 4QT5B 1NDGB 2VZ1A 1S8DA 2AERT 1JL8A 4WO4A 4PJXE 1ZHBB 2DQHH 1QEWB 2XZQH 4Y88A 2XTJB 1JZ7A 1G7JB 2B1AH 4KMTH 3HLAB 3LEXB 3AS1A 4JQXC 2Y1VA 5CD5D 2LVCA 5DWUH 1EX0A 2FH6A 3OZ9L 1I7UA 3MBXH 3A67H 3CXHJ 2CO7B 1IAIM 4WHYH 4UIKL 4UQ3B 1J8HD 4U1IA 6FABL 3LOWA 4O2FB 3VXRB 5IM7B 3D3VB 1N8ZA 2WQRA 5IHLB 1XIWD 3FN0H 3X11B 4XP1L 1Q9LB 4BUGA 4OM0H 4OZIA 1INDH 4U7SA 5FO9B 2CKBB 2VXQH 1I7TB 2GHWB 4YHNB 1KPVA 1MWAH 4HKXB 5HYFA 2YKLL 2IQAA 4FFWC 6CGTA 1MCPL 4HX1B 3WKML 1U8NA 3GUTB 1EHLL 2SEBA 2UZYB 1YJDC 2ITCB 1WZ1L 2GEEA 5F7EH 3U1SL 1TVHA 5DK0B 3NPSB 4PJ7B 3UPCA 5GJSL 4O58H 4NQDA 3U9UB 1PKQA 5L8KB 5CBAB 4XCFL 4ODHH 1MHCB 5E95B 2EKSB 2ZPKL 1UKQA 1MPAL 1F8TL 4C4KT 4JQIH 3ZTNL 4XP6H 3BQUB 3BEWB 4DUVA 2H2PC 1S7TB 1EHNA 1CDIA 1W72H 1INEL 2OL3H 5A43C 1I9IL 5HGDB 3AAZB 5IHZB 4PJ8C 3EOAA 2H3NB 1G7PA 2HLFC 3ME0A 1LP9E 4GAYB 3SDDD 4EI5D 3VDBA 1FFPA 4ZUTB 4Z76B 2NY5C 3SDCC 1WWCA 2FGWL 1BVKB 4U3XA 2V5RA 4XNMB 1N6QH 5ABDE 1HEZB 4NQEB 5GRZA 2OBGA 3RWFB 3UYOD 1QVOA 1BM3L 5C0EB 2G75A 3GIVB 3O6LL 2DYPD 1XZ0B 5DJYA 3OPZL 3TT3L 4U6YB 5FA3A 4D8PA 3TV3L 1CDGA 2APTA 2ADFL 4U1JB 1AI1L 4LRIA 5EIQA 4YHPB 4M48H 1CXIA 2B4CL 2X40A 2XZAH 2WBKA 3O8XB 3T08A 2YPVH 5E2VH 4TUOB 1CDUA 5HYJE 3VRIA 1WJ3A 2EXYD 2P5EB 4Y16D 2Y6SC 4BQCA 1GHFL 3G6JE 2HTLD 1K85A 1KPUB 1N4XH 3ZT6A 4X83A 3SE3C 3B8SA 3EKCA 4TPRL 2Q1EA 3ARGC 4LLVB 4HD9A 2F5AL 1T22A 1X7QB 2HT3C 1JNLL 1P4IL 4Q2ZB 1XH3A 3L3HA 3QUXA 1E4XL 4PV8A 4ZAKC 1DBJH 3GBMH 1K2DB 3BHBA 4DWHA 3GSRA 1N3NB 3RPIA 5KJRH 1G9NC 1UB5A 1EHAA 3LS5H 4FHBD 4S1DC 4ONHA 3VFVA 3MLXH 2IQ9H 4KTDH 3EJZC 1CLCA 5TJWK 3QEUB 1WQVT 3DHJA 5IW1A 1JCKA 5HYQB 5HYJD 1UXWB 4G8FA 4GW5A 1FVEA 2BXYA 2DQHL 2XZQL 1X5XA 4YEEA 4V1DB 4GRLD 4JQVA 4YE4H 1EO7A 4WENB 2DKMA 2GFBB 5DF0A 2B1AL 4KMTL 5HGAB 3PGCA 5DWUL 4N68A 4X5XB 2PETA 1CGSH 3MBXL 2E27H 3A67L 2GUOB 3PXJA 2DQFB 1QLFB 5EO1A 1A3RH 2VC2H 3QAZB 3GMMB 2CKBH 2P47B 2X4TA 5HHNA 4L8SC 4ONGH 2C26A 2WBJC 2EYTB 4CUCA 1FIGH 1U8PB 2NYYD 3SE8L 2XACC 2W38A 1D9KD 3FN0L 3NMEA 4I0CC 2VL5A 5C07E 4X7EC 1FCGA 4OM0L 5JPMB 1INDL 3QEGH 3X14A 3L6FA 4GQ9H 3FQWB 2VXQL 1TLKA 4RGMB 5FGBA 1ED3A 3DX9B 1MWAL 5C7XH 5D2LB 5E6ID 1G9EA 5E1HB 1X5LA 3MR9B 3UBXG 2GY7B 1TJGH 2XWBB 4AH2B 4QXTB 4HPYH 4M8VA 4JG0H 5GRWA 2A38A 4FFVD 4YH6A 3BDXA 5F7EL 1I8MB 3ILPB 3O9WB 4NWTH 3QIUA 1ZE3C 1P1ZA 2KDGA 2YD9A 1HILA 4O58L 3HZYA 4WI7A 4HC1A 5I1IH 2YUVA 4FNLH 4X4ZA 5BXFA 2AV7B 4ODHL 3BZEB 3LD8C 3HRPA 1IGIH 1H3TA 3FHQA 4JQIL 4QWWC 1N6VA 4XP6L 2FX9H 2ZOLB 3RNKB 2KZ1B 3OKDA 1W72L 4OF8A 5INDB 2OL3L 2R39A 3W82A 3BP6B 2VWEE 4ODXA 4Q9BA 3MCKB 1BJ8A 4PG9A 2VZ3A 3MJ9A 1CICD 5C07D 1T5WA 2KH2B 1SJHA 1X6LA 1QKZH 2E9WA 1A9BA 4PRPE 3OAYK 4NFDA 5IJVA 1N6QL 3MV8D 4KK6D 2IWGA 2Y7QA 2VDQH 3D5OF 3LQZB 3WIHA 3BP4B 1PVHA 3WDJA 3FQXA 1F4AA 2V9TA 3WHXA 1OB1B 1RZ8B 3RUGB 3O0RH 2AJ3B 3QI9A 1YC7A 4PRIA 2WP3T 5KVFH 3GK8H 3MMEB 1N0LA 2BNQA 3KPTA 4M03A 4M48L 2XZAL 5J89A 3QR2A 4FN0A 2YPVL 1ZEAH 5D1QC 5E2VL 1D5ZA 3BGMB 5D96B 3NIGE 2E6PA 3P73A 3STBA 2ERJB 4PJBF 3TO4C 4R6UA 1KB5H 2AW2A 5EC1A 3O3DA 2UY7A 2G5BB 5EBMA 1QA9B 1X5HA 1N4XL 1MAJA 4YNYA 1P2CB 2BRQA 1EEQA 4P2RA 5TGBA 3QFDA 4PR5A 5CKAA 1J86A 5C08A 2PN5A 4PRPD 4M6AA 5F70A 2HVKA 2Z93A 3MROB 3WN5B 3JUYA 1FL6A 5F7FA 2LTQB 1M6OA 3NZ8A 1DBJL 3GBML 5AZEH 1TVDA 2PYEE 2BFVH 1K4DA 2HKHH 2P46B 3IKCB 4R3SB 1YNKH 3HR6A 5KJRL 3LS5L 5KSVB 4Y4HB 4V2CB 4GW4B 4J3XA 5JHDE 4WW2F 2IQ9L 1T83C 3VW3H 2CLZB 1L6ZA 4ZTOH 4FQXD 4KTDL 5GXBB 5C0BB 4YHYB 4JN2B 5MENA 4H1LB 4G43A 1TJIH 4B7IA 3OKNB 3TBYA 4C83A 3M8OH 2J6EH 1KTDB 1JUFA 1B90A 4K3EH 4YE4L 4F9LA 3BXNA 4ORGA 4OFKA 1KLUB 4NNXB 5D7LE 3E2HC 4XMKH 1R3HB 2ICWJ 2J8OA 1JYXA 1CGSL 4EUPA 4GKNA 2E27L 2KZWA 3RZWA 2VR9A 3JV0A 3RTQB 3MRNB 5GS1B 1A3RL 2VC2L 2YEZA 2BK8A 4HIEB 1YY9D 3VXOB 2CKBL 1BZ7B 4JANB 3B5GA 4ONGL 2PYED 4MSWB 1F11B 4W6YB 1FIGL 3IS0X 1FN4B 4XXCA 5CHNB 1IKNA 3QDHA 4NZJA 1OTSC 4WWKA 1LO5A 2QKIB 1J0IA 2YRZA 3QEGL 4L3EA 4GQ9L 1UB6A 3C60C 3ZT7A 5C7XL 1JV5B 5I1GH 3RVUD 4NHCH 1QSEA 4S2SA 2HFGH 3F12B 3QDJE 2DM4A 4M02A 1TJGL 2AAVA 4HPYL 3Q5OA 4F33B 3FONB 4JG0L 4IDLA 1IFHH 5EPMB 2D03H 2F53E 4NUGH 1K6QH 5C0DB 1OW0A 2YOCA 4OQ1A 4NWTL 1GYAA 3DVFA 1TVBB 2X70A 4NN7C 1EFXD 2VDNH 5I1IL 4FNLL 1FVCB 3TWCH 3P9LA 2OR8A 1NFDB 3SO3B 4OZGA 4JDVB 4JY4B 1IGIL 1I85C 2ENYA 2FX9L 4HPOH 2NR6D 1IILE 3E8UH 3HMXH 3NABH 1YPZA 3FZUD 3NN8A 2IADB 1FL3B 5HI5C 3P4NB 5J3HC 1GPOH 2R2HA 3L3DB 5KOVC 4OF5A 4UUJA 4LEXH 1VPOH 3SKUD 2CJUH 3CCHA 3WD5H 1QKZL 3B5TA 4NUJA 4OUOA 2D0GA 3MUHL 1AD0A 2VDQL 5E8EA 1B3JA 3ZKMD 1TFHA 3QDJD 5FGCB 1OAQH 2B5IC 4BA8A 1GOHA 1RULH 3T8XA 4HUXA 5DD6A 3VXQB 3FOMB 1R24B 2F53D 3GRWA 1D5BB 2JIXD 4RX4A 1KEGH 4C56A 5B8CC 3T2NH 5F7UA 2IPTH 1FPTH 3B8YA 3OTTA 3O0RL 5FKPA 3TYFB 5HHOB 5D2NC 5KVFL 2K9UA 3VWKC 3GK8L 3GSWA 1OAUH 3THMH 2JCCF 1ZEAL 1C08A 5D9SB 4OGAC 3KYNA 1KB5L 1SVZA 3DVGA 1LK2B 3IXTB 2B1HH 4Y19E 1FZOA 2ATPA 3IU4H 2BMKA 4EVNB 3DX8B 2YD3A 4LSRH 3C5ZC 3D39E 1A1OB 4WFGD 1AO7E 5DK2A 2NZ9D 5IK3B 5E2JA 3RDTD 2E7LC 1D5MA 1BFOA 2D9CA 5B38G 2JB6A 2VIRA 1RQ5A 2X1XR 5EU5A 2JJSC 4Y5YC 5IVZA 5AZEL 1WISA 2BFVL 3NCBB 1GGYA 2HKHL 1BVLB 3PDOA 2VERN 3DO7B 5I73B 2AK4B 3D18A 1YNKL 4H1LH 4FQLH 2X42A 4WU5A 1IC1A 3ZKNC 4IHOA 1FRGH 5BZDB 1OLZA 3DRTA 4H26B 4ZOBA 5KN5B 3VW3L 2YPLB 3QUYA 4ZTOL 2XWTB 2DQUH 5C0FB 4LCIH 1WFUA 1CD9B 5GZOC 4LHUG 4DTGH 1SEQH 3ARUA 1TJIL 3FT4A 5KG9A 3KYMA 3M8OL 1UZ6E 2J6EL 1FC1A 3KLSA 4N1HB 3TBVA 4JM2D 4K3EL 4WI4A 5CSZA 5DJ8B 3D39D 3HRZA 4XMKL 5I74C 4ZDHB 2JK5B 2DQDH 2LQRA 3HPJB 2C3HA 3BDBA 5EUOA 2W9EH 5D7IB 5DA0B 5GGUA 3SOBH 4NRYB 3MGOA 1NEZG 2CLVA 4LIQL 3KNBB 3DPBA 2VO5A 1IGTA 2IFGA 1S78C 1SY6H 2OX5A 2EDQA 4O00A 1B4JH 4U1NA 3BPNB 3H8NA 1KCRH 1C5BH 4B50A 1T04A 4WIQA 1S8DB 5BRZA 5E4EB 4WO4B 5ENWB 1UWEH 5I1GL 4NHCL 4DGVH 3RL1A 2HFGL 3GGWB 1MCRA 3PXHA 5IB2B 4J4PD 4UMGA 2BNRE 1EVTC 2BOCA 4LLAA 5KAQF 4OB5H 1IFHL 1KN2H 4M62H 2D03L 2MFNA 5H8DA 2X05A 5FECA 2X4PA 4NUGL 1RUAH 1JP5A 1K6QL 1N0XL 1TQCC 3ILQC 1QSFE 5LXGH 1ZSDA 2VDNL 3TWCL 2CDGA 3DV6A 3CLFH 3MA9H 1KT2A 4U1IB 5FM5M 3TA3C 2Z8VC 4MCZB 3BN9D 4CU6A 2R69H 3T0EE 4PJAE 3NOIA 1G9MH 1N8ZB 4HPOL 5EU3A 3NTCH 3E8UL 3HMXL 4JKMA 1DFBH 2DWEA 2O5YL 4OZIB 3C6LC 5CP3A 1GPOL 3OXSA 4LEXL 1VPOL 3LRSB 2CJUL 4Q9CA 3WD5L 4OFYD 5SX5H 4U1GB 4JKWA 2IQAB 3ULUE 4N1CA 3W0WA 1U8NB 4P3CH 2SEBB 5J9PA 3OSKA 5HVFB 3WFHB 3VJ6A 3QDMA 1ZLVK 1TVHB 1OAQL 1RULL 4MDJA 1S9VA 1MJJA 5IUSA 4WEBH 1KEGL 1Y18A 3T2NL 2QJDA 2IPTL 1FPTL 5CZVH 1AXTH 1J1PH 1U8LB 5IHBA 2Q3AA 2BVQB 1OAUL 3THML 4CVWA 4OKDA 2ADIA 2R1XA 5DZNA 3IDYB 1I8KA 3EOAB 5DRZA 2L7JA 4UIMA 2B1HL 1FFPB 3IU4L 3KPSA 3FO0H 3VXUD 3DTXA 4LSRL 3KLAA 5DZLA 4XCYA 2FIRT 3WJJA 4QHUA 5JW4M 2DTMH 3EDDA 1EHXA 2FJGB 3VI3E 4LCYA 4K8RD 4UOW1 1J0JA 5L0QC 4I1NB 4KRMB 4QTHA 4XCEB 5I8KH 4O2CA 5FA3B 4D8PB 2A74A 1URLA 4LGSB 3UBXI 3ZSTA 3LIZH 1T2QH 3F62A 3T4YB 4FQLL 5IJKC 3TVMD 3QEQA 4LPUA 1FRGL 2BSTA 5JW4Q 4ESKA 3O2DH 1U8JA 3VRIB 2DQUL 3DOSA 3D0VA 4LCIL 5IGXH 3TN0C 2QQLH 4WW2C 2P4AB 4DTGL 1SEQL 3WUWG 4MXQC 1ZLSH 4MAYB 3ETBF 5BW7C 1KJVA 4LMQE 3FFCE 1P4BH 1KELH 1T22B 3U79A 4LAJH 1MCQA 1DVFD 4ZXBC 2DQDL 4Q6YA 3BP5A 3QUXB 3UPAA 2W9EL 2HFEA 3QB7C 3SOBL 2MKLC 3GSRB 1BFTA 1NQBA 3FN9A 3RPIB 1UB5B