1BQRA

Reduced pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PSEUDOAZURIN
publication title Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine.
pubmed doi rcsb
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bqrA00
1ZPUA 2AZAA 4F2FA 5B3SB 2FNWA 2H47C 2IH9A 3UACA 1SJMA 1XMEB 2IWKA 3UGEA 5B7FA 1NIDA 2I85A 1GS8A 2ZONA 4AI7A 1ZDSA 3T9WA 2PPFA 3QJRB 4JHVA 4GXFA 4YSOA 2JKWA 1NPJA 3FU7B 1ZDQA 2QDWA 4TXVB 3T6ZA 4HZ1A 1E5YA 3TASA 3NT0A 4DP9X 3DTUB 2WSDA 3D12B 2A3TA 3GXUB 4HCIA 5I6LA 2XX0A 4RH4A 2XX1A 2CALA 3CVBA 1J9RA 3ABMB 1ZIAA 2MRYA 3KW8A 1X9RA 1AAJA 5B1KA 1BEXA 3BVDB 1OE1A 4AX3A 2FQFA 4DPBX 3FQYA 3NJMA 1CURA 4UANA 3T6WA 3FU9A 3X1BA 2XV0A 1OV8A 1NIFA 1AS6A 2XU9A 1NIAA 3T6VA 3S3CB 4E9XA 2QDVA 1M57B 4W9ZA 3WNIA 4HALA 7PCYA 1ILSA 4E9SA 2HXAA 3GDCA 3QJUB 3NP4A 4DP5X 5E9NA 1PZAA 2FQEA 4FA7B 1KCWA 1TKWA 1RZPA 1GY1A 2XLLA 2CJ3A 2HRHA 2FQGA 4YSCA 5ANHA 4KO6A 2GC7C 5I26A 2BP8B 1ASPA 4UF7C 2I7OA 2VW4A 4KOBA 3FS9A 2QT6A 2FWLB 2ZXWB 3FSZA 4HAKA 5TK2A 2PPCA 3EH3B 1J9TA 1QNIA 2JFCA 2QPDB 2BO0A 3PCYA 2YAOA 1AOZA 3CG8A 3BQVA 3NSCA 3OMNB 4FAAB 1KGYE 1M9WA 4YSPA 3PXLA 1CC3A 3FSWA 3X2QB 1GY2A 2DY2A 2IWFA 1AS7A 1PZCA 3SQRA 3IN2A 3MX0B 2VM3A 3PLYA 1E5ZA 2EIKB 2PLTA 3G5WA 1F56A 1NIEA 1PNCA 1BXUA 1OCOB 1MZZA 2QPEB 1JZHA 1PNDA 1ILUA 2YQBA 2W88A 2XV3A 1QHQA 2MTAA 3X1GA 4CSZA 3V9EA 3CZUB 3SBRA 1V55B 1A4BA 1SF3A 1IBYA 2BW4A 3UAAA 1E65A 1PMYA 2YAHA 3AG1B 4BWWA 1UATA 1ET8A 2J5WA 1AQ8A 4G70B 5LDUA 1J5CA 1PY0A 1KDIA 4ZK8A 4Q89A 1ID2A 3UAEA 4HIPA 4A2GA 1OE2A 2Y69B 5D4JA 3RYMA 3NJFA 2BW5A 4HCFA 2HRGA 8PAZA 1IUZA 1RCYA 5A7EA 3FYEB 3QJSB 2W8CA 4W1TA 2CAKA 1ETJA 2I7SA 3IN0A 1URIA 5B7MA 1BQ5A 3MBWB 4ENZA 1PZBA 3EH4B 2EIMB 4YSRA 3ABGA 4DP4X 1AG0A 2AZUA 2J55A 3X1FA 2YXWA 2XV2A 1OCCB 1JVLA 1NTDA 2J56A 2VM4A 6PCYA 1KBVA 2HX7A 2AFNA 1FA4A 1TU2A 3ABLB 4HCGA 1AZCA 4P5RA 3QJVB 4HHGA 1TEFA 2BZCA 2BWIA 3S3BB 1ZIBA 4G7SB 3TA4D 4A66A 3FYIB 2FT6A 2IAAC 3PAUA 1WA1X 3OM3B 3U25A 2X88A 4N4YB 3GYRA 3HB3B 4BDVA 3SBQA 1GR7A 1BYPA 3UADA 3FSVA 1IKOP 4BXVA 2XWZA 4UAHA 4GYBA 2H5UA 1SFDA 2BP8A 2Q9OA 3DKHA 4A68A 1BQKA 4P5SA 5I6OA 1N70A 1AANA 1KCBA 4YSQA 1AZBA 3WIAA 3AG2B 1AIZA 4KO5A 1JVOA 2PP8A 3TBBA 4GP5B 2PCYA 1SHXA 3NJLA 1JZGA 4E9WA 1CYXA 1HAWA 5I6MA 5B1AB 2WO2B 4BXSV 3TBCA 2RACA 3HEIB 1NINA 2YXVA 3QJTB 3AW5A 2AANA 1A4AA 3FU8A 2GI0A 2Y1AA 4KNTA 5F7AA 1B3IA 3X1EA 4BDVB 4NERA 1NIBA 2DWTA 3OD3A 1GW0A 2J57A 4A67A 2PPDA 1TEGA 1AZNA 5PAZA 3T6XA 1A3ZA 1R1CA 5B1JC 3PPSA 1AR1B 1JXGA 2X87A 1NICA 3NJIA 2E86A 4F2EA 1BXVA 2R7EB 2VN3A 2VW7A 9PCYA 3CVDA 1L9QA 3PAZA 3CDZA 4YVNA 3AG4B 4EF3A 3WKQA 4YSTA 2P80D 2EILB 1N68A 2FT7A 3N2JA 4KNSA 5I5JA 4E9VA 3QQXA 1JERA 4G7RB 4WTQA 2FJSA 4YSAA 1PAZA 1L9RA 4N8UA 4KO9A 4DP6X 2YAEA 5FC9A 4JHUA 2GBAA 2LLNA 1MG3C 5EHFA 3DIVA 4M3HA 1M56B 1ASOA 1QLEB 1V10A 1NWOA 1NDTA 1RKRA 4A2DA 1WS7A 1W6WA 3ZDWA 2YAPA 1EHKB 2UXTA 3SBPA 1AZUA 2DWSA 2PPEA 3QPKA 3CDZB 2BZ7A 4JKNA 4A2HA 4E9YA 5I6KA 2GIMA 1KYAA 2UXFA 4F7KA 1W6LA 1L9TA 5AZUA 1MG2C 2PPAA 3WNJA 1AS8A 2HZHA 2IDSA 2ZOOA 3T71A 3NJJA 4PCYA 1YLBB 1HFUA 3IBOA 1DYZA 2ZWNA 1PCSA 2WO3B 3PAVA 1GYCA 1RZQA 1KV7A 2VSMB 4KNUA 3L45A 2EIJB 1WS8A 3NSDA 4HHWA 3UABA 4DP0X 1A4CA 2IDFA 1FWXA 5F7BA 3N55A 3NP3A 5AKRA 3AY2A 1L9PA 1FFTB 2YAQA 2BP0A 1XB3A 1JOIA 2FT8A 4L0PB 3NJGA 4MFHA 2YAMA 2FTAA 4X4KA 1DZ0A 1MDAA 3H56A 4KOCA 5TK4A 6PAZA 1XB6A 3C75A 4DP8X 2VW6A 3S8FB 1NWPA 2PP7A 3ZBMA 1NZRA 2JXMA 2OCCB 3ZX1A 1PLAA 1ET5A 2Q5BA 1GSKA 3AG3B 3V9CA 3S8GB 2PP9A 1ASQA 3JT2A 2XXGA 5B7EA 1I53A 2DYSB 2XXFA 2NRDA 2IWEA 1PLBA 1JXFA 1KBWA 2AVFA 1JZEA 4GP4B 3QJQB 4PAZA 4DPCX 2B08A 1KDJA 2VMJA 4CSPA 2R7EA 1E67A 1IBZA 5I5IA 3NJNA 2FQDA 2BP0B 4QLWA 1BYOA 3FQ1A 1IC0A 2GB2A 4YSDA 5PCYA 3EHBB 2OJ1A 3ERXA 1SFHA 3FT0A 1A65A 1NPNA 4G7QB 3ZIYA 1J5DA 3EH5B 5AFAA 1A8ZA 2OV0A 2CUAA 1X9UA 2N0MA 3ASOB 1SDDA 4A2EA 1WA2X 3AZUA 4DP2X 1PLCA 3IE9A 1OCRB 1CYWA 4GY4A 1BAWA 4QKTA 2UX7A 3NSFA 4G71B 5D4IA 1J9SA 3FPXA 4YL4A 4DP7X 5I28A 2UXGA 2YAFA 1EZLA 3S3DB 3NJKA 4AKPA 1SNRA 4BK5C 2XVBA 5D4HA 1OE3A 1T5KA 2IDUA 3FQ2A 2HLEB 2B3IA 1AG6A 1OF0A 3FSAA 2CCWA 2IH8A 5I6PA 2HX9A 3TU6A 1JZIA 1J9QA 2PCFA 2BHFA 2P80A 1SDDB 3OMAB 3OMIB 4DPAX 1GS6X 1JZJA 3NYKA 4KO7A 5B1BB 3WG7B 4G72B 4NAJA 5IY5B 3X1NA 3WKPA 1XB8A 1JZFA 4YSUA 4AKOA 5I5MA 2DYRB 2TSAA 3ABKB 4NB7A 4YSSA 1VLXA 2TSBA 3NJHA 1AZRA 1W8EA 2GHZA 2IDQA 1BQRA 4E9RA 2UX6A 4K9JA 3H4HA 3KW7A 3H4FA 7PAZA 4E9QA 1GS7A 1SF5A 2YARA 4BWUA 2HX8A 2UXVA 3FPYA 1ADWA 1MZYA 1PF3A 2EINB 1WA0X 3WI9A 4GP8B 4Q8BA 4A2FA 1V54B 3IEAA 4AKQA 2GSMB 3CVCA 5I6NA 2XUWA 1SHWA 4E9TA 4AZUA 3OQRA 5B1JA 3NSYA 1ET7A 1AACA 3FU7A 4YVUA 1HAUA 1JXDA 1E30A 4BWTA 1WAEA 4DP1X 2DV6A 1ZV2A 2CBPA 3JTBA 1OCZB 1CUOA 4YSEA 2GC4C 1OOWA 2VSKB 2IDTA 3EF4A 4M4RB 4WKXA 2H3XC 2BWDA 1L9OA 2XYBA 1BXAA 1L9SA 3ASNB
chains in the Genus database with same CATH superfamily
2QMJA 4Z7QF 3VSVA 1AYRA 3WJLC 3LKNA 2IH9A 4DN3H 5J11C 3BUYA 3VXNB 4PTUB 2HLFC 1MN4A 4KX8A 3U30C 2HKFH 4ZO8A 3TPUB 3U0PB 1E28A 1CBJA 1TXKA 1YPZA 3MCKB 2YPVH 1TYRA 5IBUB 3ZSTA 4K55A 3P40A 3FU7B 1ZDQA 4GS7C 5DJAB 4QOKD 4WO4A 4HUUA 3EO9L 4XX5A 4HF5H 1I9EA 2WW8A 1D5MB 3LQAL 2X4QB 3QO0B 3VXME 1I7RB 3H55A 1MCJA 3HHMA 5HVGB 3DTUB 2RALA 3HRZB 5T1LB 3HC3L 4MMZC 3DGDA 4LSUL 1HOCA 4R8WL 1S78C 3ABMB 3KW8A 4O2CB 1LO0L 4N0YH 4YZFF 4QHUB 4DQOL 4F15C 3FUFA 3AY4C 5BRZA 2Y4SA 5IVZB 2FQFA 4DPBX 1KJ2H 2YPLD 5LXGL 2FEDD 3WGVB 5FFOA 4HFUL 2BNUA 2GUYA 2P1YA 3TIDB 2XU9A 4UOW0 3I9GH 1A9BA 2QDVA 3A6CH 3M8OL 1ZXKA 4TUOB 4QIRA 5CIPH 3SE9L 4MX7B 4NQCE 1SYSA 1KGUA 4HIXH 1MHHA 3HG2A 1ZTXE 1S7SB 3GMPA 3V5KA 5JR1H 3MKKA 5E1GA 3W0WB 3FQNB 5D8JL 3SE3A 4NQQA 2XLLA 2CJ3A 2CO3A 3QRGL 4MDIA 3U0TB 1KXHA 3OAYK 3N1QC 1CI3M 1ASPA 3AXLA 5DMYA 2OL3H 4JCMA 4Y4KC 3C9NB 3K2UH 3K8LA 4K5NA 2ZOUA 5JPMC 3DWTA 2YC1B 4WNSA 5EC1B 1QNIA 4X6DA 4I77L 2J4WH 4MD4A 5CLTA 2IPTH 2VCOA 4LCUB 4ATWA 3VD2A 3QEQE 3W39A 4F58H 2WUBL 1HYSC 3D4ZA 4FERA 5T1MA 1M42A 2Q76A 4MRCA 1YY9C 4W68A 3BAIA 1I3GL 4LARL 3BDYL 3C2AL 5D2LF 1OSZB 2DY2A 1OK0A 2CO6B 3S48A 5AG8A 4BRJA 5HVFB 3VSQA 5JOPE 1JHTB 4FXTA 1RERA 3FFCA 4I0PA 4RISH 3K7UA 1GGYA 2CIIA 4WO4D 1VPOL 3QE5A 2PLTA 4FQ1L 4JUTA 1N6QL 1G87A 1XF3A 2H6UA 4Q2ZB 4R96B 2XPYA 1CTMA 3SJVD 1OTUC 1Z5YD 5JHLA 5BOZG 1SDAB 5IHUL 2W88A 1IT9H 1M71A 5C0RL 3PL6C 4L1SA 5HHPA 4Z7WA 3NCMA 4LHUB 4BZ1H 3D6GA 4RVBA 4RGMB 4W6XB 5CINL 4LSTL 1PMYA 4XMTA 2YAHA 2H3NA 2P8LA 1IEHA 4R4FH 1URLA 2NNAB 4HWNA 3E0GA 5IQNA 4PJGA 4D7BA 1CXEA 1O6TA 2OSXA 3I9PA 5BZZA 3H53A 4U1SA 1FFOB 2VSCA 5E00B 2P8MB 5D5MB 1AQHA 2APWA 3US1A 4N87A 3H2WA 2JELH 3AQDA 4XC1L 3RWFA 3QJSB 1LD9A 1DUYA 1MFBL 4XMVA 1C5BL 1T4KB 2PYEB 2H6PA 2YJLA 4RCAA 2AXGA 1CDIA 2A6KA 2ADFH 3LB6D 1MFDH 3MBWB 5JA9A 2GSGB 5LGHL 3T0BA 3PHQA 1QTYT 4OSUL 4Z76A 1JVLA 2Z9TA 3CHPA 4QY8B 1H3UA 3QQ4B 1HI6A 4HV8B 1JI2A 3AUWB 4F93B 2EE9A 4AIOA 1Q8MA 1SQMA 3RILA 5FYLE 2ARWA 5F7FA 5ITBL 4P5KB 3DSFH 4AVKA 2Y1YA 2V9QA 4ZX4A 4KMTH 5JO5A 4GQPH 2RMNA 1CE6B 4Y4HA 1SPDA 3UTSE 5GS1B 4FEMA 5J56B 2QFRA 1WFNA 1K4DA 4KXBA 2H5UA 5E94B 4H8PA 5DD6B 2CKBH 4XVUC 1MFMA 1DQKA 5I6OA 3E38A 4XP6L 1DJYA 4FMFA 2IPUG 1LE5B 1QD0A 2Y5EA 2W60B 5GZOC 2DB8A 5TQ2L 1QTSA 3KPTA 3WNMA 1FUNA 3C12A 3KPPA 1QFUH 4HOXA 1CT8B 2PCYA 3ECVA 4N6QA 3TX4A 4BFNA 1AP2B 1SHXA 1EHAA 2X3CA 1IL1A 2BNQA 1N5AB 5AW1B 1BVLB 5AL8A 1JF5A 4YBLB 1R3IL 1HXMA 4F7EA 4L1BA 2FUQA 4PD4J 2E6JA 4LCIH 4R90L 4V1DE 1WIPA 4N2MA 4KNTA 2GI0A 2P26A 3B6SB 4TSCH 1Y6MR 4J6RH 3VGAB 4OVUA 4HGMA 4K15A 4ETQB 4JN1H 4NERA 1FV1B 3NACL 1BLIA 2VGLM 1VEOA 4A67A 3QBTB 2NW2B 3VG9B 5IFHL 1T7VA 2X0WA 2JJVA 1BW8A 3T6XA 1A3ZA 2UZXA 3VXTA 5I9QC 3L5XH 3T3PB 4IS6A 2ZSVB 4KBPA 2VDPH 5KSBF 2E86A 2XFGB 4X6BA 5AVWB 3OLGA 4OGXL 3V4LA 1EVTC 2C9XA 5FUZL 4KKCD 3HNSH 2P24B 4KTEL 2GTWB 2ICWJ 2P80D 1A7RH 5JHDD 2EE3A 3W2DH 4PR5A 1T0OA 3ARGD 3CMOH 4NUGL 3WLBB 2AP2A 3DNKA 1IVTA 1GGIH 5HI4D 4DP6X 1XQ4A 3Q1SH 3I02A 2BCKB 1DJSA 1BFVL 1YNLL 2DQDL 3QJOA 1MQKH 1A22B 4JPVL 4EDXB 3RLSA 3SYOA 2ZP0T 2P7TB 1NWOA 5F0MB 2R4RH 3B9DA 3HNTL 2F54D 2DEYX 2YN5A 1XH3A 1RKRA 4HPOL 4R6UA 5E4IA 2VUOA 1EZSA 3B7RL 3FUKA 1W6WA 4PVBA 1YECL 5DYOA 1EHKB 2UXTA 4ZFGL 3LZFH 4RZCA 4XTRC 2Y6SC 3EOTH 15C8L 3O4OB 1YEIH 4FFYH 5DWUH 1FLRL 2D3NA 1BAFH 3O41B 1A8JH 1RP9A 1RQ5A 1W6LA 3V4VH 3DV6A 3ZJAA 2FJFB 2NQDA 5D7IF 2WNGA 1KFAH 4PY7B 3T71A 2WAHA 5BZDB 4NKIH 4PCYA 3HRPA 1OAUH 4ZS6C 3SDYL 4APQC 1HHIB 3ZK0A 3V0HA 3ULUC 3PAVA 3SIKA 4XVJL 1RZQA 5GS0C 1UH2A 3GGWB 3LSOB 4NO5A 1DBML 5M94B 3NSDA 5MHSE 4HWBA 1SXSA 4F3FA 1PDKB 1RJZA 1KENH 1NLBH 2GIXA 1Q38A 1QPKA 5JW3L 1ZLEA 3D2UB 4BZ2L 1MI5E 4UILL 4G82A 2LTQC 3NJGA 5HVHB 5L4FA 4OGYH 1T6BX 3KCPA 2W95A 2VKXA 1DLHA 3C2SA 4ILDA 2PWHA 1BQHA 2R0WH 5AZ2L 1AHMA 1DN0B 3EGXA 4J8RB 4JFFD 4R2GB 3SBWA 3RY4A 4FDWA 4J5VA 1GVIA 1D2PA 4JKKA 1YJDC 5LG6A 4P06A 3TNMB 4WKZB 1YEHH 3AT9A 4PJIE 3SPVA 2AK4B 3ISYA 3AREB 2BIMA 2NPLX 3BQUD 1GA2A 4ZUVA 3ORJA 3TVMA 4TQ8A 4LDOB 5IK3B 5I6XB 1AKJD 2WYIA 2X2JA 3BVWA 2ZWKA 2HWZH 3DI3B 4S1SH 2BP0B 4KK8C 5K9OA 5KS9F 1BG1A 2CGRL 1BZ9B 3OKMB 4HSCX 1IGIH 4ZUTB 1SDYA 4JRXD 3QEUB 4TNFA 2NY3D 4UM9D 1Z9SA 3ERXA 2AAAA 3QT2A 4OB5H 2A0LD 4FXKC 2XKNA 1FG2B 3M1BB 4IIQB 4HHAB 4D3CH 2YSSA 3IK2A 3MRDB 4AQOA 2XNAA 3C8HA 3WO4B 5IJKC 2AGJL 1HTYA 4DP2X 3EFOA 4HOMA 2H32H 4HUNB 2AABL 4U1MA 4HEPA 3RHWK 3KHOA 3GBDA 3GMNB 4PRAB 4JM2A 1H3PL 4M1DH 3TT1L 1DDHA 4NNYA 2JIXD 2XBZA 3SYQA 4HPYL 4ODVL 4DCQA 2IAMA 2X9YA 1FFPB 1KJ3L 2CDFA 3KLHC 1WK0A 3P73B 4LOFA 2ZCLL 3A21A 5HJ3A 3WFHA 4F27A 4PGCB 1EHNA 3V10A 2HB0A 3C08H 4P9MH 3VU2A 3OG6B 3E8UL 5E4OA 3WN6A 4ODHH 5GS0H 4NKMB 2FD6H 1IEAA 2YEVB 3HB3C 3R06B 5CM1A 1OF0A 3ARBA 4IBYA 3T0EB 2BNRE 4XCNB 2BWQA 3OMAB 2ZCHL 5DS1A 1AY1H 3TYGL 3AU1B 4Q9QH 4LDCA 4JANA 3R8BB 3L17A 1UM6H 3VFPA 1E4XH 1ZLVK 3PWUB 4PY8I 1Q0XH 5FW7A 1QZNA 1QUNB 4QHMA 1LO3L 2A6JA 2COVD 1MXGA 1NKGA 1ZSDA 2OS7A 3GMQB 1QFWM 3SE8H 4YSUA 4PJEB 2RQEA 4XXCC 1HZKA 1YYMH 5CEXB 3GC3A 2V5TA 5BO0D 1QACA 4FQLL 3QAZC 1MCWW 3H4HA 3K5SA 5T1JA 4Q4IA 5DMKB 1B6DA 2R51A 1IX2A 1YJDH 2VIRA 2RIKA 3V5DB 35C8L 2J1YA 2HJFA 5FDWB 1OTTC 2EXYC 3PXJA 3OPZL 1VFOA 1MDTA 2ZYSA 1MZYA 4JFDB 2ENJA 4D2NA 3PWVB 2BOCB 4ETYA 3JTSA 3VMNA 3BN3B 5DHVH 1LO2H 4F15B 1O5PA 2QTEA 4MMXB 4DN4L 1UM5L 4O51B 5HGGS 2CO7B 1TVBB 1OW0A 2MQGA 2A1WH 3CVCA 3KYKL 2HYMA 2Y7QA 1QYGH 4N2OA 2PCPA 4HQQL 1WEJL 1JGVH 4J3OG 4RGND 4AXWA 4DP7X 4O5LH 4QRRB 1WAEA 2H0PA 4X5PA 5BZXA 2A83B 2PF6A 4OKDA 5K39A 2V3FA 4L2YA 5C0ND 5E5MA 4NSKB 1CFQB 1EAPB 4WDIA 1W0WA 3QZLA 4P5TC 4DTGH 5ISZB 5DT1L 4JFEE 5SX4I 2BHZA 5LCVL 1NFDB 1LL1A 4R7LA 1KTDB 2VXSH 1GYAA 4OZIF 4KK9D 4OCXL 1ETZA 2QKIC 2VLJE 4YC2C 4YDVA 5F7DA 1FAIH 2ZUWA 2IV8A 5MP6H 3BZ4A 1ZHNA 3EYUH 1KPVA 2H47C 3D69A 1N9PA 4G9FA 5LVEA 1XMEB 3ILEA 4F8LA 5EU3B 1S7UB 2WXJA 1G7MB 4JPWH 4UV7H 2V7NA 4JREC 2KZ1B 1HL4A 1QRND 3HE6A 3GSNA 3TJPA 1T0PB 4NKDB 2KHAA 1T2XA 1UM4L 5AVSB 4R5TA 3DBXB 5C08B 3VXRD 1P84J 1O6VA 5F1IB 1EH9A 4UU9A 1KWKA 5T5FL 3D25A 1L0PA 3NT0A 1F4AA 3ZKMC 3TA3A 2ADYA 2CKBB 4HDIB 3SDXA 1DBJL 4WEBH 1EHLL 3SGDI 3VI4E 2LR4A 4GI9A 4M8QB 3RWHA 3SYAA 1DJHA 1F90H 1MCSA 1X9RA 2J1ZA 4L9LA 1D7BA 1PJ9A 4JO1L 2WLKA 3MGOA 2I9LA 2PYFA 1N64L 4LLMB 1NCWH 2NLJA 1RJLB 5IB4B 3C8KA 2YZ8A 4N90D 4P59H 1I9IH 4X4ZA 5MENB 3SO3C 3QFJA 1C08A 3GIVB 4QRUA 3L5IA 4BE6A 2R2CA 2X6AA 1JK9A 4ODBD 1BDYA 1I8LA 4Y16A 4I48B 4E9XA 3PL6B 2C4XA 4H26B 2J1WA 1KN4H 3OR7B 3FB5B 1MJ8L 1DBAL 4H44C 4UQIM 4RIRB 5HY9A 3ZGIA 4QXTA 5GZND 1K4CB 1Y1UA 5KZCB 1W91A 3QWRD 2COQA 3UC0L 3F01A 4HKBA 1QWUA 1YMHB 4H8WH 3UTSA 4DEPC 5HHNB 1TKWA 3VGHA 5IR1A 4Y7MA 2DDQL 3ZR6A 2VRAA 3OAUL 3RPKA 2A77L 1B88A 3HI5L 5KYYB 3VXMD 3QGVA 2VITB 2VDPB 4NYLA 3RB7A 3MJ7B 1LEIB 4KOBA 2FWLB 2IAMD 4FOMA 1NL0H 2PO6C 4PI0A 3E80A 5AAWC 4IGBA 1NPUA 3DJZA 1O6SB 4XCFH 2XY1A 4POYA 2PETA 4WFGE 4GLRI 4HISA 2WLYA 2MCPL 5ABDE 4H25A 2OKMA 5CILH 3C5XA 2GTQA 1WF5A 5JOEA 5HPMA 3GB7A 5CD5D 1NBCA 4EDWH 1M9WA 4Z9KB 5A2IH 5H2BA 1BJMA 1AS7A 3A22A 3QB7C 4ONFL 3U4BL 1D9KC 4NQCD 5IBTH 3HOGA 3IN2A 4HUXB 4M4RA 3TO4A 3WELA 4F9PA 2D0GA 3PLYA 4HC1A 1GAFL 1M3JA 4X5XA 5DUPH 1QLRA 3QIUC 4X5WB 2WWMC 1K8IB 3F62A 1XZ0B 3RVUC 3LQAC 2BS9A 3OGCB 3TNNA 5JQHC 3GM8A 2ZUQC 1JZHA 4ELDA 4XBGB 2OXHB 5GRVK 1O0VA 1OTSC 2WB7A 3UJIH 2V2TB 2XWJA 1EJ8A 3R0MA 3O4LB 3QQDB 3BEVB 3GHPA 3QUHA 5L2KD 4OV5A 1PZUB 4XPHL 3T4AA 4AM0A 3FN0H 2BP5M 1J5CA 4WI3A 2QVIA 1PFCA 7FABH 2C9UA 2PW2A 1RK1A 4G5ZH 3U79A 3QEQD 1ZD6A 5EUOE 4ZTPH 5B4MC 1Y1DA 2BY2A 4FGMA 5I1DA 4Z7OE 4JO4L 2DYPA 2HJKA 3RNQA 3NIDB 3LIZL 3GMRA 1S7QA 2NOYA 4KXZH 4O2FA 4W1TA 2Q8AH 4C59B 3QXDB 4O4YH 5DDHA 1LWRA 5JOPD 2PTTA 4G8GE 5CN2A 2NX5B 1F4WH 4ENZA 1NBZB 2DBLH 4NRXA 4U6YB 1C1EL 3ABGA 1J88A 2H9GA 1U30A 3AB0B 1N5YH 4G6MH 3OLIA 5I1AB 2W9LA 3MCYA 1OCCB 4KTDH 5E4EC 3WKML 3KHQA 2EH7H 5FDYA 4XWOC 1KJ2A 5BUAA 1INDH 3BGMA 3O3DB 4GW4A 2WKLA 4AGLA 3BVXA 1TEFA 4FQHB 3GTTA 2WCPA 5DJZB 4D9LL 4I2XE 3K1DA 3KXFA 3TA4D 1ZT1A 3KYNB 2K7QA 1U8PB 3OKDB 1T2QL 4KGJA 5IHWA 3BZDA 4H4NA 5CIPA 2VSDA 3RDTD 1E4KA 4PGJA 4OLZH 4LGSB 4BQ6A 4RRPA 3O2DA 1IKOP 2G5BA 4XN1A 3WKYA 4D9QE 2D7PA 4YX2H 1J5HA 2H1PL 5FKPB 3AXIA 2R2BA 4W4NA 1KTLA 2X1QA 4A68A 5J9PA 2V7HA 1ECYA 3F5WB 5IF0B 5IESL 1HEJC 1RURH 1WV7T 2MQCA 3EO0B 4J3OH 1JVOA 4DSYA 3Q05A 3D1MC 2KS0A 2GCYB 2W0FB 1FL6B 2JJSC 4PJCF 1A6UH 5IMOB 2BDNH 1WG3A 1AO7E 1MH5A 4BXSV 1E4JA 2AJSH 4JFHE 5IMLA 1Z9PA 4OD3L 1F2QA 4O58L 4JPIB 4Z7UF 1A4AA 3ZMEA 4OLYH 5B39G 2Y1AA 3ZDZE 2C9QA 3EJQA 1T20B 3CPLA 3ULSB 3NH7H 1YUHA 2I5YH 5FYLD 1HIML 4TYUA 3H9SE 2B15A 4UBDD 3IXAA 4LVNC 5L6YL 1AZNA 1R24B 4APQB 2VE6B 3UTSD 5C3LD 3WFZA 1XV8A 5EC2A 4M56A 4AQ1C 1RHHA 2HPOA 3N3EA 4PRBB 1VGEL 3V79C 1FZJA 3LD8B 3MO1A 1XAKA 3MOQA 3BH9B 4XNYL 3MRMA 1ZA3B 2GAZB 2FO4A 1TUPA 2WXOA 4WV1C 1GJWA 5DJ2A 3AMKA 3WGUB 4IGBD 3UCRA 5I73C 5I8CB 3N2JA 4ONGH 4LSPL 2V2WA 5BVPH 5HDWA 4S10A 4IBVA 1QPXA 2FSEB 5FUCC 1E42A 1J8HE 4NNXA 1JF1A 4L3EB 4MB1A 1JTTA 3VG0H 5J6GB 4V1DD 3IDYC 3DIVA 1EVUA 5HHQB 3OJVC 2YBRA 3K80A 1SM3L 2HKAA 3CFUA 1AQDA 1IAOB 3N43F 4QGYA 4M1CD 3H2PA 2NY5H 4A63A 3LN4B 5DUBB 4Q97A 3CCHA 3QH3A 1G7HA 1NCNA 4LFHD 4ODWB 3U1QA 1BBDL 1EFXD 4FQXC 5DHVB 3P9LB 4N0UE 5FO7B 5F1SA 4QRQB 2UZIH 3UO1L 3DK2A 1L7IH 2BNRA 4NOBA 1X5IA 1DJXA 5IVXA 1S6NA 3CZKA 5KYUB 1UYWL 5BXFA 4G8FB 3T65A 1SEQH 2E47A 1TTAA 2F74B 3DETD 4KHXH 3VCLB 4GG6E 1UT1A 1E8WA 4Y4KA 5MEOA 1QO3A 3S36L 3SDCD 4F8OA 5JPMA 3FHAA 4PRHB 3CZNA 4KVNL 1NAMA 2VERA 3PV6A 3REWB 1RHFA 1UA6H 2PTVA 3FO1B 3L45A 4ZX3A 4TSAH 1E5UI 1SBBA 5LB1A 1A21A 2GJ6E 2DYPD 3QORD 1Y0LB 5L88L 4QCIA 2YQ2A 2R56L 32C2B 1KB3A 5KBMA 5F7BA 1KT2A 3FRPA 3HVDA 2Z31C 1F18A 2HVJB 1NMAL 3KM1A 5FECA 2IOMA 1L9PA 1TSHA 4FE9A 5D71L 5DO8A 1VFAB 5GGRB 4OD2A 4QHKJ 5I16B 3G9VA 2JKNA 2QR0B 3IWUA 4MFHA 5E5UB 3C60D 3UGUA 2P46B 3B2VL 4KOCA 1F8TL 1U36A 3OJMB 2VMDA 4NM8L 5T3XL 2FL5B 3ME0B 4I18C 2DWDB 1TO4A 3EJJX 2VW6A 1T22A 3FB7B 3R1GL 4N2BA 1FCCA 1XF2A 5CGMA 4EMZA 3R7QA 1U3ZA 4KK6C 1G0YR 1G7LB 4UZSA 3DO7A 4P49A 1FDLL 1JK8B 2TRHA 3KR3L 2YD5A 1VFBA 2WZ5A 3A6OA 4KQ3L 2EADA 4P2OD 4YDJA 4A37A 2NRDA 2YUWA 1BMZA 3QHTC 5A40E 5IHZA 1MFCH 2A73A 1A5FL 4K7FB 4GMSL 4GP4B 1EANA 1A3LH 1CFNB 4U6VH 4NX0A 5MHSD 1JGUL 4PB9L 1GOGA 3ZE0E 2WZ0A 3CIAA 5E70A 3EHBB 3U4AA 2X1PA 1DUZB 4JRWA 3QCVH 1IAII 1MI5D 5FGCB 3WNPA 3ARQA 2OMZA 5EEWA 2OP4L 2ZOKA 3UZVA 3AZUA 4Z7VF 2OYMA 3TH3T 4NZUH 3CQPA 3RIKA 3IXTB 3BXNA 4FP8L 3B2XA 3BZEB 2H8PB 1ESOA 2WLNA 5F88B 3MRPA 1NOLA 3BC9A 3HBGA 4JBSA 4X6CF 3V7MA 1AGFB 3FPXA 3MV11 4UQ9A 4KGLA 4ZMQA 1KEGH 3IFPB 3QWOB 3O9WD 3HI1A 4LCCC 4XMLH 4UDTB 2VMCA 1ID5I 2OMTB 3C5ZA 3KWWB 3ZYZA 4AJWA 4NN5B 1DCEA 3RIAK 3BDXA 2ZG2A 3VI3E 4YH6A 1J1PH 4LEEA 3GDBA 1QMUA 2X89A 4KVPA 1TTFA 4NKIL 3MBEC 2F61A 1TZHB 1FCGA 1SDDB 4PJ7B 3JZ7A 1SY6H 1AMXA 4M48L 5TDOA 4DPAX 5ACZB 3T2NH 1HWGB 1QLFB 5B1BB 5C07B 5I30L 3X1NA 1I8UA 1YG9A 2CR0A 4PBWD 3G7TA 3MJGX 2MHAB 4QTHB 3RZCC 1P7KB 2AQ3A 2X4UA 3WAKA 3E9TA 3DARA 3L08A 5TGBA 2ZPKH 3ZHNA 3GS4A 5DLMH 4EIUA 3CHRA 4L4VA 2FUTA 4YSSA 3NFNB 2QADB 2GHZA 2L3BA 1BQRA 1G1KA 1Q1JL 4HU8A 1DBBL 1I1AB 3QO1A 4L1DA 4HSAC 1MLCB 3HG1E 2NNCA 4GW1B 5ENWB 2EDRA 5KYXB 3ZE2F 4DW2H 3MV7B 4P46D 3HIZA 1FVDB 1IGFL 3LPOA 5AVTB 4CVZA 4YDIH 1D5BA 3BW9B 5JDJA 3MU3A 3VGGA 1QOKA 1JRHI 1B0GA 1QASA 5F9JB 1DZBA 4WHTA 2YUXA 4X8CA 4HK3N 3WD5H 4E9TA 3ZN6A 2BNRD 5AOLA 2YD9A 4FFZA 4J7RA 1SOSA 3V0GA 3FONA 1CFSA 2KQMA 3KDMA 2O61A 1U8QA 3FBKA 2WLIA 1KNOB 1MELA 2Y2TA 3X3FL 1QBML 3RVWD 1OCZB 3MSPA 1XT5A 2NUPB 1O5DT 3T3MB 5IOPA 4Q9RL 1Y7VA 3ZE1E 3I3DA 1XTMA 1B3JA 4PJ5D 3GI8H 4WJ5B 4HZLB 3R4DA 1TVDA 2X4PB 3SKJL 1CK0L 3DTXB 3MUZ1 2D31A 2YPKA 1KTJA 3FF8A 1ZANL 4Q6YA 4ZI8A 3VMOA 1ZPUA 5DVNA 5EU5B 2CSPA 1OXYA 3LRHA 4L37A 1FNSH 3EZJB 5E9DA 5ETUB 4FFTA 5ICZA 5CP7B 2VLLB 3A6BH 3BFWA 1O7SA 3BVUA 1JVKA 2Y7MA 3FDWA 3QPQC 3BLBA 1NCHA 5H37G 4N0RA 3UBFA 2XTSA 3QDJB 5JQIB 3Q9QA 1A7NL 5GSVA 2YLKA 1OAQL 3GFUA 2PWEA 3QP3A 4MJHA 3VD0A 3GSVA 4LPYA 3FAXA 3UYRL 4HZ1A 3UTOA 4MRBA 2VZ1A 4HS3A 2L0DA 3P4NA 5LNDA 1UJTA 2YD6A 3GXUB 1FFNA 4IKLA 5CN1A 3SN6N 5I1LB 4TNWK 3P30H 4PB0L 4GI6A 4KZDH 1L6XA 5HVWA 1ZT4A 3BVDB 4JFED 4MB5A 1A4KB 3SDDC 4NQEE 5G2NA 3DDFA 1UWEH 3FN3A 4A6YB 3BJ91 4A7UA 2MTPA 3FQYA 2WNWA 2WOYA 3EJSA 1OL0A 2VLJD 3FO9A 2NXYD 3D85D 3CHQA 1AS6A 4FHJA 4P2QE 4ZO9A 2ZUQB 1RUML 5DD1H 1HK6A 1OB1B 1XF1A 3RVVD 4LASL 2AEPL 2WN2A 5DK2A 5D1QA 3UJJH 4P3CH 3LNFA 3OZKA 7PCYA 3NESA 1G7PA 4PLNC 4I2XA 1KCVL 7TAAA 4TULH 4Y9GA 2HG5B 1WBXB 4JQXA 4F5CE 5KN5A 4FQCH 2J2ZB 2A9CA 2ESVA 5H8DA 5EOTA 2X7LA 1XGRB 2IFGA 3KPRB 4KQ4L 4OQ1A 5I1IH 2JQMA 4N22A 4NO0D 1PG7H 5BMFH 1C5CL 1CZ8H 4X98A 1DVYA 1I4FB 4JJHA 3JYBA 5FKAA 4HULB 3G3LA 2VXQL 4LEBA 1FL5A 2N3JA 4Y5XA 1BJ8A 3LQMA 3FS9A 2Y3NA 3BRGC 2OJEB 3B8YA 3FSZA 2FGWH 2G9KA 1B4LA 1RP8A 1UJ3B 3U2SB 1MFVA 4PTTB 4Y7OC 1ZHBA 3ECBA 2AEIT 2Y0SA 2VAAB 3GPSA 1HESA 5L4IA 5DJ0B 3PJSA 5KUMA 4BK8A 3QUZB 3OMNB 3RU8L 4F2MA 1JNNH 1G7QB 3QEHB 4HU2A 3MPCA 3WNOA 3PXLA 3WV0A 1A9EA 4IK6A 5CBAA 3DYPA 3KVDD 3H9SA 3F7YA 4HD5A 1BIIB 4JQIL 4TOYH 2DLHA 3VFGL 2YMXL 3D34A 4FXKA 4HT1H 4HIJA 2DQIL 1RUPL 4GIPD 4HFWB 3S5LA 5ADPL 1CGUA 5D7HA 1RFDL 1S8DB 3IFNL 1VSCA 1AQMA 4BFKA 1YPZF 4GRLD 4J2QA 3IVKA 4MNGE 1NMCC 1SYVA 3SBRA 2A9MH 5EWIH 5J89A 2JKSA 3KZ8A 4F20A 1VKXA 3IDJA 3BSZA 4WFGD 5H94B 2ENSA 4ACPA 5C2UB 2Y06L 2ZKWA 4WEUD 1PY0A 4LCYA 5BS0B 4ZUUA 2ZAHA 1KC5L 4AV0A 2G75A 4XCYB 4QHPA 1TJGH 2J6EH 2X3AA 5C9JB 1BM7A 2Y1ZA 3E2HC 1HSAA 1KXTA 3MROB 1F6AA 3U7WL 4YL9A 4MQSB 5C0CB 3IRPX 5CSZA 5DMGD 2APXA 1ZWIB 4GW5A 4M29A 4WWKA 1BZEA 2YGVA 4ZS7H 1OM3H 5B7MA 4M03A 4PG2C 1MUJB 2MFNA 1NBVL 3O8XA 3AMLA 5E9AA 4ZAKD 5CJ5A 1JYWA 2FEJA 2HH0L 3L2NA 1UKSA 2AW2A 1INQB 3F04A 4IRSD 4AQ1B 4N0UA 4Y19B 1GGBH 4DH2A 1ZVYA 4XXCA 3ARDA 1KIUB 5KEZA 3BKYH 1MREL 5B38G 3UCQA 1AZCA 2G2NA 4FG2A 4XP9L 1B4JL 4EQ2A 3BWAA 3S3BB 3DK0A 4LLYB 3TV8A 1MRCH 5AW4B 5DSCB 2FT6A 2W9EH 3P11H 3X14B 4GG6A 2M83A 4GSXA 1CDYA 4X8JA 3EH1A 1LQSR 1NCBL 3BPLB 3MJWA 4LSDA 4QYOA 4RMWA 3STZB 3T2PA 2CHWA 4LPTA 5CWSB 1Q9WA 2F1EA 2VDRL 3DX3A 1F58H 5J6HB 1N70A 4X6DF 2HKHL 2P28B 4LEXH 3VRJB 5CLYA 2Q10A 5KVFL 2X0UA 3ZL1A 4WUKL 4YGAB 4G8GD 1KYOK 4BFJA 2GBTA 2EYRA 1Q1PA 1VIWA 2LVCA 3NA9L 1NQBA 5I75B 3TBWB 4LNVA 1XCQB 1YEGH 2BSSA 4P5TA 3SCMC 3V52H 4ECNA 1QHPA 5KJRH 3NPSC 5TQ0H 2RCSL 1U8CA 3BVNB 3N44B 2QHRH 1AE6H 1F4XH 4TPRL 3TIEA 3GMLA 5I1EL 5IBTL 2DWYA 2QKIA 1U3YA 2MKLC 1UZ6F 5HDBB 5J1TC 2D0HA 1FYHB 5F0LB 5HI5D 4B9YA 5DJXB 2KH2B 5PAZA 4KAQH 4U3HA 5I71C 4Z7WF 3TT3H 2CJUH 2EUZA 1L0QA 4D9QD 1M1XA 1LNUA 3D9AL 4X7FC 1IE4A 2WTRB 1H3TA 5AYUL 4U1GC 5JPNB 5HHXH 3WXWH 3K6SB 5AW7B 4I4WB 3QHZL 1XF4A 1N3NA 5F93C 1ICTA 4PJGF 4FG6D 4EF3A 1NSNL 1ND0B 4EOWH 2EILB 4ZQKB 1ACXA 5A2JH 4G80A 4I1PA 4X7DC 1KCRL 1PX3A 5DEFB 2L7QA 4J6IA 3VRLE 1PAZA 1OZUA 4G6JH 1AO7D 2EE0A 4YWGL 3ZMNA 4JFHD 4XBEL 5EFIA 5FC9A 5ESQA 2EACA 1YQVH 2VXVH 4XO9A 2Z8RA 1RD6A 4FN0A 5IQ7L 3JV4A 4JMXA 5IT2L 5DMIH 3ISWA 2A6DA 2WHVA 2BOBB 4RQQB 5IVNA 3C5SB 3DJSA 3HCVA 1A02N 1T03H 2NY1C 4LQFL 1L9MA 4XMWA 1XFPA 1U8OB 4QAWA 4HS8L 3VH8A 3VI3A 2ORBH 4A2HA 4BQCA 2J88L 4FZEH 4AEIH 5IIEA 1OP3K 5CBEB 4JN2A 5DQDH 3TN0D 1G5AA 4GO8A 3CDCA 3NFPA 4YHZL 5FO9B 1FO0H 4WWNA 2YA2A 3GUTB 4N28A 1YEKH 5DRZA 3SKOB 2IALA 5AAWA 2WO3B 4H8QA 2EDQA 3UEZA 5JW4R 2XZCL 1J8HD 1R5WA 1EMTL 2VSMB 4U1KB 4YFLI 5CCHE 3GXNA 1RZIB 3O6MH 5EO1A 1L4IA 4QTIL 3NSXA 3B9KB 2IDFA 2NY2C 2Z7ZA 1H15B 4JQVA 4IM8A 4A6YL 3S2CA 4NHCL 4K4KA 4FCHA 3DLQR 4JRYA 4RFNB 3DGGA 4U1HB 3ZTDC 1HE7A 3HHSA 5K1JA 5C2BL 2HT3C 4PJ9D 2FT8A 4LCCB 3LNHA 1QNZH 1D9KA 1JPTH 4OBRA 2WBJC 2FK9A 3LKPB 3BKMH 3U4EA 5MEQA 5IM7B 1SVBA 5AENA 4CMMA 4PS4L 4LSVL 3VGBA 3OGOE 1QSVA 3QIUA 4KHTH 3ATAA 4WGVB 4N2LA 5KVGL 3QUMB 3MRGB 2BVYA 3O11B 2ZKHH 3OB0K 4LLDB 3L3HA 1NUFA 2B1AH 1JWMB 1LO4H 3LRGA 3CFEA 4G43B 3UTQA 3UX9B 1D5RA 3U4KA 4KI1A 5GRYA 1VHPA 2Z35B 5EO0A 3RZCB 4G6KH 1IC1A 1FGVH 5GRUL 2IPKA 2R7EA 3PG2A 4MAYD 4ELMA 5G55A 1HJBC 4D0BA 2QKSA 2H26B 2ATKB 2GJ6D 1XGYH 1Y18A 5T1DH 3UTTB 1IC0A 5GGVL 2V9TA 4FYSA 5FO8A 2R1XB 3B37A 4IMKA 2IADA 3B5TA 2JJWA 2CUAA 3ULVD 3PE9A 3H7BA 5D7JC 2AQQA 4NGHL 3KS0J 4A2EA 1HXYB 3VXUB 5D5ME 4AWJC 3CFCH 4OTXL 25C8L 2XYCA 2BIQA 5CJQH 2MPAH 5D1XB 3X12A 4OM0L 2DQCH 3MLWH 1EEUA 4QXUH 4YL4A 3MNMA 2FO1A 2OYLA 4BE5A 5KANG 3U48A 2BMKB 1S7XA 3S3DB 4LOVA 4HJGB 4LBEB 5HYJB 4KZ0A 4KRPD 3BDBA 4FA6A 3BWUF 2SEBB 4K73A 2C9AA 5FB8B 4BK5C 2EYTA 4GQ9H 4UYPA 3SPHA 1VZHA 3KGTA 3DVGA 3L3DA 1A2YB 1H6EA 1NDGA 1W72A 3MNZA 4IRJA 2VL5B 2N01B 1A14H 1J1OL 1DVFD 2Z34A 1MRFL 4QRPD 4XNQB 2PCFA 5C0JA 3LEYL 2K7PA 3WY2A 3LZLA 3OMIB 4CBZA 1XR9B 2K3TA 2QV2A 3KLQA 5BO1L 1ZMYA 3WIHH 2GK2A 4GRWB 2FJUB 1YVLA 3EXLA 4PEEA 2E7LC 1CLOL 1NBQA 2Z6FA 3IE4A 4YDKH 1JZFA 1DJZA 2TSAA 4KKBC 1RSFA 3OKLB 4X42A 4OUUA 4I1RA 4XNUH 1B2WL 2JJSA 2WXLA 2IDQA 4M5ZL 4N2HA 3VD7A 3RFRA 5DXWA 1UWGL 1OAYH 3PDDA 4H0GA 5HGDB 3H4FA 3RPIB 3VGEA 3WHE1 5E8PB 1BYNA 2YARA 3GSXB 3FRUA 2ITCB 3HBPA 1ADWA 4J4PD 3BAEH 4CVXA 4OJEH 5CCKL 5BQ7B 1S5HA 3FZUC 3V5HA 2B7DT 4UQ2A 2AV7B 5I6NA 3G04B 1RZGB 1SHWA 3P4OB 3W5MA 5E08H 3FUNA 1AR1C 3PHSA 1E2ZA 5KSUB 3ETTA 3K5RA 1HAUA 3Q44A 4M6NL 3UPCA 1AIFB 3T08A 4CVUA 4UT9L 3NABH 5IGXL 3ZL2A 3KPMA 2W9DH 4M6OL 4N2DA 5AVXB 2DQHL 3L4CA 3T3PE 1OOWA 3FQTB 5MI0C 4WV1A 3SE4C 1OGSA 2A99A 3S37H 3NVQA 3K71A 2VC2L 5C3TA 1CTNA 1JNLH 3E8VA 2VT0A 3NCFB 2FNWA 3RTQC 1KCKA 5EBMB 4N68A 5AZEL 2HRPL 2IOOA 3MNDA 1IM3A 3HG1D 3INUH 1IZKA 2YGPA 4RA3A 4AI7A 1KCUH 3IJYB 1P5VA 3MLSH 3CGTA 2P48B 4MCMA 1AGEA 3OSKA 5KSAC 1KXQA 1JBJA 1BZ7B 1BD2A 3QK0A 2XWBA 4JM2F 4ODXA 2XA8L 4BBWA 4CGUB 2QDWA 1S7TA 5AAPA 4M8VA 3BIKB 1GGCL 4Y1AE 3T6ZA 2WVVA 3N85L 5C0IB 2EO9A 3TASA 1AHKA 2PR4L 5T33H 1P4IL 2IPUK 3DX6B 3BFQG 4DUXA 4PJBB 5ES4B 2Z93A 3L95B 5I0DA 4RH4A 1UD8A 4X5LA 3AM8C 3Q43A 2GTZB 2ZUUA 2HTKC 2CMRL 3E6FB 3RI5K 1K8DB 3DIFA 4RGOH 4HPHA 5ICYA 1E8YA 1MW1A 3AROA 3N0AA 4K3EL 2Y22A 4S0HA 2DQUL 1M1SA 3IGAB 3D0VA 3S96A 4IKKA 4K23H 2XT1B 3WNIA 3DUSA 1HHJB 2GK0B 4TUUA 4XC3H 1UACL 2R23B 5ANMA 3SDAD 4J1UB 4QOKB 2DMHA 2BVQB 2B4CC 6CGTA 5HYSA 4NFBA 4U4BA 5A6MA 4LU5L 4KY1L 4LLQB 1CDGA 3CXHK 1MJUL 3LKSA 4HJSA 3MX0A 4YJZL 5DLLA 4JO2H 1UEMA 1FC1A 2EZ0C 3TJEH 4Z78B 1ZS2A 3PS6A 4HIHA 3M17A 4LESA 3PAYA 2O72A 4RMTA 3B8SA 4GAYA 5EN2A 2EDHA 5EU4A 5EU6A 5BOJA 2JKLA 4LO9A 3FO2A 3ARZA 4ZXBB 4NQED 5LBVA 3NEOA 5H35B 1NGWB 1IQDB 3WEXA 1EXHA 4OIBA 4BD4A 1WD9A 2X2YA 4N5UA 1RVFL 4P2QD 3BPCB 1UZGA 2AK4E 3MA7A 4YSPA 3ZMRA 4X8XA 3WTSA 1YEEL 2FGZA 5DK0B 1I8IB 1D5XA 3CVHB 3WTTA 2OMUA 2QPFA 3KPSB 4ZOCA 4MJIB 5KTEH 3RFZC 1BQLL 3IPBA 1F56A 3IGKA 3C6LA 3LNDA 4AJVA 4FA8A 1MHEB 4ZMZA 1D6EB 2APSA 5CP3A 4HKXA 4JHAH 1BM3L 4XX1E 3VXNA 1N2RB 1RUQH 1NAKH 1WVZA 2J8UB 3GK8H 3ILQD 3VFWB 3ARFD 1TYJA 2WXPA 3TPUA 1A4BA 4IBQA 5F9WB 1MAMH 3MCKA 4R0LC 4ENED 3U0PA 2VN6A 1IMHC 2MCAA 4U0QB 5ABZA 4BWWA 4XZUB 5EB9A 3QFGA 2CQVA 3TV3H 2NY6D 1FO0B 3SDXF 2APTA 2G0LA 4JPKL 1L3WA 4X80H 1OE2A 2ENPA 2WSKA 3NJFA 3QUML 5I1JL 5ICUA 3SCMB 3QQ9C 4XVTH 3D30A 4NRZB 5T1LA 2VLMD 3DDGA 1EDYA 3WBDA 5EU7E 3EJZC 2VJXA 1ETJA 1I7ZB 3N06B 2E7DA 4MCZB 4DP4X 1ZA6B 2B4CH 3CQFA 3T0EE 2JLPA 2R29L 4NKQB 3TIDA 3S98A 1N7ML 4KZEL 2QL1A 1CQYA 3QIBD 4RLDA 3Q3GA 6PCYA 2VM4A 2N0KA 4TUOA 3RIFK 4MX7A 1QSFA 3EF7A 3MV8B 4AIZB 5BOPA 1S7SA 4QXVA 3M45A 4XHJD 5T1KA 4G7SB 3W0WA 3N5AA 3FT2B 3FQNA 3I2CH 1MVFA 2GPZA 3N91A 4BDVA 4QGTA 5EA0H 5JQ6L 3ZT5A 2G3ZA 1R5VB 2HT4C 4XB3A 4G1MA 2ZICA 3V6OE 1R3HA 4OIAA 5HDQH 4ANUA 2DQEH 3DRQB 1KPUB 4GAJL 3MRIB 4F9LA 1V3JA 2YC1A 3QXWA 4XCCL 3D52A 4JFDE 5EC1A 1JZ2A 2OK0L 4NIYE 4NENA 1GC1L 2HA1A 2Q7NA 3GSQB 3RKPA 2WWOA 1JN6A 2XRAL 2AS5M 4LCUA 1JD7A 3DX8A 1R46A 2K78A 3ZZ1A 4E9WA 4HIIB 4ALAL 1NLDL 5J6SA 4D7PA 1A7QH 4PH8A 4HX1B 3VM7A 4QRRE 4UTAL 4ZDHA 1OSZA 4IU2B 5F7AA 3GTNA 3DIDA 4PWGA 2I27N 5ISZE 3VE0B 5MEPB 2BC4A 2P5PA 3MRQB 4HD9A 1XL6A 1NFDE 3LDBC 2J57A 3PWNB 1LM8V 1WBZA 2DM3A 4N8CL 5I1CL 3HS8A 3HPLB 2Q2LA 1PD0A 5BZWB 5B38B 5BNXD 3RWDA 5C0GB 3PGCA 3QCUH 4S2SB 4JHWL 2P43B 3BX7C 4U6TA 5FFLA 1SOKA 4AQAB 3UAJC 3FTVA 4HJIA 2OTUA 2JSFA 4XPGH 3FMGH 2VAJA 3VFRB 2NY2B 2HAZA 2HT2D 5GIRA 4ZD3L 3RP1A 2NNAA 1E9PB 3PDGA 3BKCH 4JAMA 4YHPB 5C08E 5E6UB 4BH8A 1VB9A 1D6VH 1ZRUA 4KPHL 3ZKNC 2BVOB 4NM4H 4Z0BL 4YSAA 1FFOA 5FYJL 1G4RA 5D5MA 4ISVB 4UWQB 1E3FA 2K9UA 2MQ3A 5I82A 1FH5H 2AK1H 3SDDA 3Q2VA 4X9HA 4LP4A 5F3BB 5J5EA 1T4KA 2PYEA 1A4JB 3U6RB 2B9BA 3LHPL 4X4ME 4XXWA 3V0FA 3K6DA 4DK6A 2WAQA 1RUKH 3DMMC 4B9JA 4ADGA 3MBWA 4A2DA 1JPFB 2GSGA 4PV9A 3SOTA 5CEZH 3VWKC 4GJTB 1OPOA 5HGAB 2DJSA 1AZUA 3C6LD 2FHBA 1UXWB 2OLDA 1C16A 5T3XE 4MA3A 1UFGA 4FFVD 1KGJA 1UB6B 5AB2A 5KVEL 2Y07H 4G6AC 4P5KA 5DF0A 5AZUA 1SN0A 1AD9B 4IHOA 1P4LB 2V2XA 3US0A 4UI2A 3O3EA 3BH8A 3ARGB 3QWQB 5F7YC 4P8QA 1INEH 3KEHA 5E94A 5GS2H 4PGEB 1SXBA 1VGKA 3FB8A 4IEFA 2EIJB 2ZAGA 4ZW8A 1UD2A 4PW4A 4IOSA 1SOXA 1JXKA 1QI3A 43CAB 4B0MB 1LTXA 1U4FA 3N55A 5LBSH 1CT8A 1ETA1 4PS7A 2EIZB 2FWOA 3HC0B 4R5VA 4QRAA 1N5AA 4U3SB 1BVLA 1Z5LB 3E6HA 1LJMA 4I9XA 5AUMA 2OM5A 4LRNL 2LE9A 2XVLA 3JWDL 3T0XA 3GIZH 3WS6C 4X6EB 4NQVB 1RPKA 1SHMA 1XSOA 3CJJA 3FHQA 1ZEAL 1GPOL 1A0QH 1NCCL 2GY7B 4ETQA 1Q0EA 1OQOA 4GKZB 1DCLA 1FV1A 4LSQH 5T5FA 1UWXH 5C6TH 5CN3A 2AJVL 1NCAH 3DXAA 1GSKA 4PIRF 5F9OH 1SVCP 1WD8A 3QG6B 4KAQL 2DQTH 4YBQC 1Z9NA 4MXQD 3UZEC 1IBBA 3MJ9H 4RFOH 3FQRB 5B21A 2AVFA 4G11A 2UVEA 1T1YA 2F18A 4KX7A 2BVEA 3O4LE 3FH8A 3ARSA 4MJ6B 1MCOL 2GTWA 2IWGA 4HS6A 4HVBA 2VDLL 1P5UB 5A2BA 4FQIL 3MLPA 4YQXH 1PYWA 1ML0A 4QRSB 1NPNA 2X1WL 3WLBA 4L8BA 1QA9A 2JXMB 4OFYA 5K9QG 3HR5B 4PVMA 2EDEA 3LN5B 5FA4B 4QXGL 1FG9C 1SRDA 3CVHL 3W37A 3NIDE 4JG5A 4LL1A 2EUXA 4EDXA 4L5FL 4IDJL 5GGRY 3VXPA 4AMXA 1FVCB 3DX1A 3OLDA 4RMRA 2J72A 2NX5E 3BQUB 2ROYA 3MA9H 2YAFA 1MCPL 3AACA 1MNUL 1P7QB 2UZYB 2X05A 3FH7A 5C86A 4WZ9A 5IVXF 1OE3A 3O41A 1XZWA 2IDUA 1LDSA 3BEWA 5DD3L 5TFSL 4K2UL 4M7ZC 1XBRA 1OP5H 1X5ZA 5AD0B 4LHUD 4PY7A 3RTQB 5BZDA 4UM9B 5I19H 4YHKH 1E6JH 4TQEL 3O6KL 4YBHA 1HHIA 1HCYA 2HN7B 4R3SB 5L8LB 4G59C 5JIDA 3QUGA 2OTWA 1DSWA 3RVXD 2BJMH 4WGWB 3TPKA 4AKOA 5I5MA 1BEYL 3GGWA 5GRWA 5FHAL 3NIFF 4FLHA 3KYOB 4NO2B 5D1ZC 5DFAA 1J8KA 1M7IA 1PDKA 1QLEH 4KV5F 4KJWC 5KOVC 3GJFB 1CPUA 4XNBA 3T2QA 3NZ8B 1YNKL 4LNRA 5CF3A 2JIXB 3EJTA 4X9GA 1X4ZA 4KI5E 4P2AA 4P23C 2VZSA 1R75A 4AQZA 1ZSHA 2NUTA 1KPRA 2EINB 4X4XA 4ICWA 1UZ8B 2K1MA 1JNJA 3P2TA 4EN3C 3PWJA 2ZIDA 3RGVC 3RUGF 1MKFA 4WU5B 4R4NC 2CDEA 4DESA 3SSGA 2O5XL 3TNMA 4WKZA 3STLA 1U58B 1U8JB 3HJEA 3RGBA 2UUDK 3I6KA 5J3HD 1FZMA 1BA9A 1JS4A 4A2LA 1M9SA 3WFCL 2P5EB 4PJ8B 5HHVH 1RIUH 2NY4C 3LIZA 2IGTA 4R97C 1K5WA 2YQ3A 3DOHA 1YEJH 1RZFH 3CSYB 1OANA 2WUCL 4N20A 5G4OA 2E7CA 4RMQA 3TONA 1EGJH 3OKMA 4C83B 3VYOA 5B3SB 3GXDA 2E9BA 2HTLD 1WITA 1TQCB 5B7FA 3M1BA 4IIQA 4HHAA 5DR5H 3MV01 2E27L 1ZXQA 1F5WA 4YSOA 1JDCA 4G7VL 4L3EE 4RNRA 3MJ8B 3SGKC 4LMQI 2EDMA 3TC9A 5GGSY 4RDQG 5EDSA 4H88L 2DQFA 3PABB 3HE7D 1FFPA 2OX5B 4NQDD 4LVOC 3P73A 3BRDA 2NY7H 1CS6A 1HHHB 5EUKA 4PGCA 2XX1A 3IETB 2OMVB 3HNVH 1JV2A 1CQKA 1MJJB 5IG7A 5GXBB 4UQ3B 1X7TA 4WI8A 3D87B 4Y2LA 3WY4A 3RFZB 4JY6B 4M62L 4Y2DD 4NZFA 4XCNA 5JXED 3MR9B 1U3HD 3LH2H 2K6YA 4GXVH 3SQOH 1MCBA 1NIFA 1KOAA 3CE1A 4U49A 1C5DB 3N50A 1ODAA 2X6BA 5ERWA 4PS8A 2QJDA 4XPBL 1JZ8A 4GQRA 4ELKB 1WWCA 3NA4A 4PRHE 1JD9A 3GMQA 4O2EA 1UT2A 1WBYA 1KJVA 4A7TA 4PJEA 2OAAA 3BGFC 4Q0XH 2C3HA 3K6OA 3WN5B 5ID1B 5IFAL 1GRWA 2BLFA 3PGFH 5JORB 3AS0A 4U7SA 4Y1AD 3UTPE 3OX8B 3V5DA 5ANHA 3V6OA 4NKOA 5FDWA 2ZQKA 3GSOB 4G8IB 2HFFB 4GPVA 3TZVC 4AM0Q 5AB0A 2QT6A 4K5PA 4FXLA 4JFDA 4TNVK 4ZJ9A 5E1HB 2PPCA 4UTBL 5DO2C 2BOCA 3EOBB 1I8MB 1KB5H 2QPDB 3HZVA 2PWDA 4GFTB 3OC8A 4MMXA 1V27A 4O51A 4HJ0D 5D2NB 5LN4A 3IDMA 3BAXA 1XGQA 2NYKA 3U0WH 1OAKH 5EPMB 5JW5B 3NSCA 1ERNA 1LVEA 3JV6B 3O2WL 4JFXB 1MWOA 4GBXC 4W9FC 4YPJA 2QQLH 1KB9J 2GYSA 3IPFA 4DJMA 3HKZA 3WS3B 1EAPA 1YN6B 3MC0A 5ISZA 3G6DL 4ZUSB 2ADGA 2RH0A 4YGVA 2EIBA 3NZUA 1HWHB 1W0VA 2AJZB 3VXMB 2CLRA 5LQBL 2MTAA 2XZQH 5DGQA 4K3DH 2Y3AA 4NP4H 4TSBH 5EU3A 1NEZA 3P0VL 1G7MA 3D2UD 4HJJL 5FGCE 4EZKA 2BW4A 2BHUA 3F00A 4HK0A 5JYMA 2FX9L 3OSVA 3QC6X 4NKDA 5SWSE 3VB9A 5L2JA 1J05B 5ILTH 5C08A 4NUJA 3QWNA 2WQ8A 2GT9B 2QQNL 3PDOA 5E03A 1S5IL 1E4HA 1EERB 1THCA 1OF2B 2JK5A 3GLEA 2BRRH 1P6AB 3MXWH 4BK5A 1T0NA 2FDBP 2EVJA 4HLZG 4P4KB 1CIUA 2ENQA 3L5WB 2AK4D 1ZGLB 2CBMA 5AG9A 3ARED 2DM7A 5GGVY 2HP4A 1PIGA 5JUEL 4X4MA 1JMZA 1UG9A 1X5MA 4U1JA 5AKTA 1P2CA 2H2PC 2YFNA 5IW1B 2CGYA 4LLMA 1R3KB 1T6WA 5IB4A 3ULUF 5E8NB 5MENA 2BX5A 1BHGA 4AJ0A 4XH2A 1QWNA 5DRWB 5FX3A 3HG0A 3I6GB 1UXMA 4PJ7E 4NNPH 5KSBB 4GAGL 3L9BA 5I8OH 1KBVA 5L2KB 3MLYH 3OR7A 5C07E 5ITFA 2OXGB 4TVPL 2H41A 4IOFD 4RIRA 2YUZA 1K4CA 1XIWC 2D73A 3L3IB 5CD3A 3DROB 2R9HC 1BFOA 1L7TH 4FQJL 1YMHA 1HVXA 4A66A 3PAUA 2YXMA 3U36A 3MTXA 2AQSA 2ZAIA 3U25A 4YHLL 3QEQB 1GR7A 2ADIB 4MQXD 5A1AA 2ATAA 3MOAL 1COBA 5F7NC 1E6OH 2VITA 3UGXA 2IMNA 1OO2A 4DGVL 4DO6A 3Q6FB 1LDPH 4HG4J 1G6RB 2F2HA 1O6SA 4XXDB 3CBKB 2F5AH 3MV7E 4YUEL 4XAWL 5IJVA 3TBBA 3TBTA 4HK3J 5B3JF 3OKOB 3L9RB 4OV6F 3K81A 1HNGA 3UO8B 2LLGA 3T0ED 4OJAA 4OF5A 3FCTB 1AGCB 5C0AA 7CGTA 5FLVA 1DQDH 5F7WC 1MVUB 3SE4A 2C1PA 2YXVA 5IB2B 3T8VA 4R7DA 3FU8A 3QUXC 1MPAL 2XJLA 1ZVSB 4BJLA 2DLFH 5D7IB 2DIBA 2HLFD 4HUXA 4U2ZA 5FGRA 3T3ME 2LU4A 4LSRH 5SWZB 1JGIA 5I2IB 1X7QB 2LU7A 4X5WA 1UXLA 3CPUA 1G84A 3P77A 1K8IA 4GINA 1XZ0A 4GXUN 3A67H 3C6EA 1LHZA 4AYFB 4MMYB 4JHAL 2NXZC 1A6WL 4XBGA 4WHYG 5INCB 1BFSA 5KSAA 4H0HB 2V2TA 2VDOH 1BGXH 3PHOB 3BEVA 5F71A 1N0XL 2HFTA 4YAQB 4S1QH 4ZTOL 3WIIH 2AI0L 1LO5B 3BESR 3QDJE 5C6WH 5IEHB 2VYRE 4ONHB 4Y4FC 2AQPA 3CSBA 3AU0A 5D70L 3OXSB 4BUGA 2I32A 3II3A 1S7WB 1ED3A 4Z77A 3MLVL 3ZHFA 4A39A 4UT7L 4QRRD 1IGCL 2EVGA 2FX8H 4ZZFA 4FABL 1QLEB 3RWGB 4HXBH 3QXDA 2J71A 4LEOA 2EJ1A 4C4BA 3BP7B 1O7VA 3CN4A 2VM9A 4PRDB 4JS7A 2DM4A 2WINA 4BA0A 4H5SB 4QR7A 4HWEH 4YNYB 4HWZB 2M2DA 3GRGA 4P0DA 5I1AA 4U1LB 3GKWH 3QEGL 3E1ZA 3OKYA 5EOCL 5I6KA 4XGZA 4KMQA 2O6DA 1SLWA 1KELH 5JA8B 3CDFA 6FABL 5KS9B 4EI5B 5L8KB 1L9TA 2OBGA 3SQBA 1MG2C 3D3VB 3U9UB 2WBWB 3G6AB 3J7HA 1ZHKA 4LVHC 4M7JL 1U8PA 3OKDA 4Y8DC 1TQBC 5KVGE 4X0KA 1Q72H 2HMIC 3KPRE 3RURA 5C08D 2W91A 3AS3A 3U7YL 2BIHA 1GHFH 1HYSD 3HUJA 3KJ6L 3LXBA 4IIZA 4LCWA 5FKPA 4PV1C 4L05A 2WIIA 4EN2A 3F5WA 4D0CB 1I1YA 2B1HH 3ZT6A 5IROD 3EO0A 4FL4B 2I25N 4JRFA 5EOQH 3QI9C 1SBSL 4TVUA 1IVLA 2W0FA 3UROR 1FFTB 1TZGL 1LE9A 3GJEB 3VYPA 5IMOA 3RVTC 1NUNB 1EFXB 5FCUL 5MERB 4X4KA 5JIHA 3LS4L 5TK4A 6PAZA 3GS7A 5IB3B 4JPIA 3IFOB 1O9ZA 5T3XD 3PL6D 4WI0A 4FJZA 4JR9L 4P2YA 4Z23A 1DSFH 3ZBMA 4MJ4A 3TM6A 1FNAA 2J25A 1QVOA 2E9IA 5DC2A 5KZCD 5E2VH 4OI8A 1R24A 4LBAA 2VE6A 1NGPL 1SUJA 1XL4A 1I85C 1PLBA 4PRBA 4XN9A 1MFEL 1X9QA 4WU7B 1KLGB 3RHWF 3K4ZA 1J1XH 1JZ6A 4OD1L 4OZ4B 1ZA3A 3CXDL 4QLWA 3C8DA 5AYTA 5DQ9A 1KLFB 2JE8A 1CE1L 1SMAA 2OJ1A 5I8EB 4N0FB 2C9SA 2VJ0A 5BS0E 1REIA 4LAQH 5BW7C 2LW3A 1MW2A 4H1LH 1OB0A 1Q4NX 3K2MC 4E9LA 5TE7L 4FLSA 1KBBA 5J6GA 3LMJH 4MNHA 3O6FC 3QS3A 5CJBA 5HHQA 5C0CE 3RZWA 4B6ZA 3F58L 4WF7A 1BQSA 2IXQA 2VRKA 4AQEB 4EI6B 4TQHA 1L6PA 2IANB 2VXQA 2WQWA 3LN4A 4WNQA 4Z7NF 3VI3F 3GKZA 5I28A 5EF1A 3KL5A 4Z0XB 4G42B 4ODWA 1EEYA 2H2SC 1JPGB 4XCEB 5TTRA 4U2YA 1VENA 2B9AA 1KB5B 2KL6A 2ZUXA 3L1OH 3P3RA 3P9LA 4Y19E 2E8ZA 3KPOA 4PV8B 5EZLB 5I0XA 2VB5A 4X4YA 4OZIB 4HCRH 1VFUA 3VD1A 2Q7YB 3IGUA 1SJXA 2WY3B 1UCBH 4MDJB 3QYNA 3O4LD 2DI9A 3BZFB 4LL9A 3G9AB 3QIWC 4JGMA 5KYUA 4EZLA 5GZOD 3UBXI 1XEUA 4G8FA 2Z92A 1KLUB 1NGQL 2F74A 4QNPE 3S5YA 4Y5VC 4PGBB 4JG0H 4K3JH 3S36X 4E41B 4NUQA 1U6AL 3VUAA 1BF8A 2DTML 1T1WA 3REWA 4PRNB 2V3EA 2JKJA 5G5DB 1B0RA 1NH6A 1BJ1J 3ABKB 3HMXH 4JQIA 5FGBC 2Y72A 4NB7A 2MOVA 3UIYA 4CJ0A 1YHPA 3HR6A 2EDJA 1D5ZA 1IBGL 1ZTXL 2D3VA 1E9QB 5GJSH 4Q7DA 4DGUA 4FJYA 4DVBB 4GO6B 4KKZA 3QDGA 3CBRA 1VFAA 3JVGA 4M6AA 4N2AA 4PJIB 2NX5D 3E7JA 5GGRA 5I16A 3IDGB 3O9WB 4E5XG 3GINA 4FQ2H 3PUUA 1R0AH 2W59A 1F4YL 2AXHA 1IFHL 3FU5A 2WK2A 3UYPB 3OF6A 2F53D 3FB7A 4XMPH 5E6IC 3NZHL 1RJCA 1G7LA 2ZXEB 3OHXC 1JK8A 5HDBE 2EE2A 3E3QC 4FXGB 2LQRA 4D94A 2DV6A 2C3GA 1EXUB 4ELMF 1FVEB 2UY7B 1KCSH 2X6VA 1G7JA 2CWRA 2R0ZL 1CFNA 43C9B 2ZNWA 3ESUF 1L9OA 2Z4TA 1G6RL 1OAJA 1TITA 3QXAB 5AOIA 1UD4A 3MACH 1H3XA 1PIFA 1X5JA 3NAAH 3SD2A 1S7RB 4F2FA 4OGAD 4P57B 1P1ZB 2JQAA 4GAAA 1FIEA 3ZL4H 2VISA 1VEPA 4KI5D 5BVJA 5A2KH 2I85A 3GMOB 2E7HA 3V4PL 3T9WA 1QSED 2M1KA 3QNZA 1AHWC 4YHOH 2IIJA 3VWJC 2K8QA 5K59E 3IXTA 1H5BC 1FC2D 4TS6A 4WI9A 1GYUA 4HEME 2GBUA 3L1EA 5IW6B 3VWKA 4OAWA 3ZTNH 4OCLC 5D72L 4EIGB 4NLHA 5F88A 4I5BB 4CN1A 1AGFA 3BKJL 4YN3A 2WSDA 3IFPA 4APXA 4Z3HA 4UDTA 3UBXA 4APQD 2ZKYA 1ECZA 3C5JA 4JB9L 3F7PC 4UUJB 4PQXA 1DEEB 3WKNA 4WQOA 2XFXB 4YFLF 4PJ5B 4MJJA 3WFDH 2R69H 3D5OF 4XNXH 3K91A 2FJHB 4I13B 1A25A 1TZHA 2JB6A 5EZJA 5CEYB 5ACZA 2Y9RT 4G8EB 1QLFA 4X7EC 4Y9FA 4MA8H 2DWEB 2HXAA 5DZPA 5LGJB 2UWEF 4L3ED 4Z95H 1QFWL 3NFNA 1U2HA 2P52A 5FYLL 1KCWA 1OWRM 2PWFA 2XC8A 1SGKA 2JB5H 3DVNA 2HFGH 2OZ4H 3EFDH 1MLCA 1T0MB 5D1ZI 1F6LL 1K3ZA 1YNTA 5E2WL 4Z5RB 3RG1C 3WS6A 4HZAA 4UMSA 4NN7B 5GGSA 4QJ4B 5KYXA 2ARJA 1IU1A 1FVDA 2OR9L 1IQWL 4JFEB 3GO1L 1IC5H 3BW9A 3IJ9A 4ZFFB 4LKCB 3AABA 3B83A 1MEXL 3L3KA 2ZYHA 5CAYB 4E0RB 2DICA 1T5XB 1S4IA 3B9VA 1JWUB 3DX4A 2NXYB 3D85B 2R1WB 4UQDA 4PG9B 3GD1C 4KK8D 3LB6C 1UUSA 2JI3A 1L9NA 4ZW7A 4OW6A 3O0LA 2A9NH 3V0JA 4BZYA 2X42A 2F5BH 2XBTA 3DVFA 4TTGA 3SKNA 4AE0A 3CC1A 4PJFB 2H0JA 4PRHD 4AVHA 3FQWB 3GBMH 4WJ5A 1SXZA 5E4AA 1QKZL 1U8MA 2WKGA 1A1MA 3WY3A 2BFVH 4K5LA 3MNVA 1U8KB 1V3MA 4OFIA 3UTTE 3GNMH 5GRZA 1SMOA 5CP7A 2VLLA 1NCDH 5K1VA 2K6WA 5J8OA 5ESVB 2HUEA 3BZ5A 4N0CD 1S9WA 2R0KL 2V4LA 4JVPA 1OPGL 5TPWL 4YXHL 1JHLL 3QDJA 4F7CA 2Y25A 4HUWA 4KWUA 4PJCB 2CNYA 2XG4B 3HB3D 3NTCL 5TDPB 3RYMA 3T77B 5D1XE 4Z7UB 1XF5A 3QULB 5D6CB 4DPRA 1R19A 4NHUA 2N1KA 1TOXA 3EAKA 3GSUB 1QEWB 3QUXB 1KGWA 3LNIA 2AITA 5HYJE 1X3DA 3NGBC 3TCLB 3X11A 4HYTB 1DVUA 4J3BA 1A9VA 2KC0A 1FL3B 4F8QA 4HWUA 2BSRB 1A7OL 2YSTA 1XGUA 4A7SA 1AG0A 3WYRA 4CMHB 2A9DA 3LQZA 2YXWA 2HRLA 4AV4A 4UDUB 1MCRA 3ATEA 1MHPH 1Z66A 2WBXA 2R2HA 4GRLB 5E99H 1OB1A 4ZG1A 1KN2L 2JMRA 3VFVB 2E6QA 3T8XA 1TU2A 4GRWE 3BP6A 1ZV9A 1OTTD 2JLLA 2QSCL 3SE3C 5D1ZA 1RULL 2J8HA 4YE0A 3MUGB 3TEWA 1WBXA 4ODUB 4X9FA 4L29B 3B9EA 3X3GH 4U6HB 5SWSD 4LF3A 4MSWB 4U0RB 4OT1L 4XR8C 3ZGHA 2QVMA 4KKCC 3RL1A 4ZMXA 1BYPA 4PRIB 1FFRA 4BXVA 3H9HA 2CCLA 4GYBA 4S0SD 3RGVA 2XN9A 5ABAA 2YKLL 2WWNA 3NCBB 4RDBA 2HSIA 4HXAH 3V6FB 4YE4L 3VNYA 4Z3IA 2OMYA 3N43B 1UJ3A 4WY7L 2OI9C 2PABA 4PJDB 1G1CA 4OF7A 1RIVL 4OZFA 1JWSB 4BQBA 3GJFK 4AZ8B 3DRTB 4ZAKB 3WLWC 5DEZA 3QUZA 2JCCE 1CYXA 4H1LB 1G7QA 3QEHA 1W16A 2VXTL 5FUOH 4I0PC 5HGHA 5FYJE 2OJZL 2WOBA 4NZDA 1IZJA 1F45A 5C07D 3QUKB 3IDIB 2AXWA 3HFFA 5TDNB 4S11A 5IB1B 3FU0A 1NGYA 1YEFH 4BV1A 5I76B 5ELIA 1TETH 2QBWA 2DF3A 1CR9L 2QADD 1IGML 1RJYB 4B9IA 4JY5L 1S8DA 5ESQB 1X9LA 1PLGH 4FI7A 1I1AD 5EUOB 4AMKH 4F8NA 2CGZA 3DHPA 3SGKA 1Q9LA 2X2UA 2X9ZA 3B3IB 4D8PB 1AMYA 4TKWA 4WTXA 2Q8BH 3TOPA 4ANVA 3MV7D 2VXUL 5H94A 4CC1A 1YCSA 3Q01A 4U1NB 5LAXB 3AC0A 2G3MA 3MJ6A 1I8KB 2Z91A 4FEIA 4WSGA 5C9JA 1TZIA 2VLKE 5C0FB 3DV4B 1TQVA 3WXVL 4JHUA 1JDDA 3MROA 3L7EB 3L4TA 4GEIA 5E8DL 4PJBE 3WSQH 5CUSL 1CDHA 3MRBB 5C0CA 1I9JL 1H8OA 1VDGA 1ZWIA 1LK3L 1QWHA 4WUUB 2QVKA 3QRFM 3HC4H 1QTPA 4C4KT 3VJ6B 1MUJA 5J12C 1WS7A 4XP4L 4CN6A 1YQ2A 2VERN 5AQ0A 1XGTA 3SBPA 4DZ8B 4F24A 3V8CA 2F08A 4DNLA 1ONQB 2WZPD 5FFGA 1CXIA 3CDZB 4Y0GA 4GUOA 3NCWA 1KIUA 5T5NF 2Z65C 3PP3H 2V8MA 3LNGA 1AFVH 1NC2B 5DJ8B 1U42A 4Y4HC 1Q0YH 1EAQA 1CICB 1JGLL 2V8LA 2CRZA 2YGQA 4LLYA 4JVUA 4NLAA 1EEZA 2PO6D 3CC5A 3DX7B 1OCWH 2JCWA 1YC8A 3LAFA 4QOKE 4BCZA 2F7OA 1J5IA 4UT9A 3MNWB 3STZA 3L2MA 2NY0B 1G6VK 3TZVA 2LGNA 3VFMB 2PN5A 1E6OL 2NY3C 4NCC1 4AK2A 3S88L 3APNA 4QF1A 5IREA 3FQUA 4MJ5B 4BFOA 2A0LC 2CR6A 2ZX8A 4M3JA 2G2PA 1KEMH 2CHXA 4JKPL 5DJCB 5F6HI 3TGXA 3WHE0 3WNNA 3AT0A 3I3EA 2DQJL 3O6LL 1A4CA 3JBG7 2QZ5A 4UIKL 4G83A 1NANI 3THML 3AY2A 4J3OD 4GBXA 4HH8A 3GZKA 4HOZA 3SD5A 3TBWA 1XCQA 2WWMD 1N59B 3VX0A 1AR2A 2FSDA 1KTRL 4MBRA 1MDAA 4YLCA 3BVNA 1VF5C 4HKJB 3A4AA 3MV9B 3UL4A 1OTSD 2CLVA 2CDGB 4LDEB 2A4CA 1KUMA 2QEJA 1SN5A 3QHFH 2K4WA 4QLRA 3KPSE 4L5FE 4MJIE 4PRPB 4DUVA 4AEHL 3TH4T 1DVZA 3IJEA 1CGSL 4IRZL 1WHPA 1PKQB 4BH7A 4MHHG 4RWYH 4N8VA 3KPRD 1X5XA 2YRLA 1DQQB 3BP5B 4UT6L 3QDHA 5SWQB 2WTRA 2EH8L 3MUUA 3QQ3B 5JPNA 4JZNB 3F6IA 1QUPA 2I60L 2J8UE 1CGYA 2ZUYA 3R19A 4I4WA 1NC4A 4OLWL 4ERSL 4MNQA 2YO3A 3FQ1A 3ETBJ 4FNTA 3EBHA 3IFLL 4BCXA 3GLAA 2GSIB 1ND0A 5I1GL 5J13C 5D5MF 5EZOL 3SZ6A 1WZMA 3HMWL 5DEFA 5AW3B 4LPWA 2DIAA 3T1WA 4K3GA 5ALCL 3HG5A 4JO3H 4HEMA 2FBJL 1JGDB 1M05A 1ROWA 2XWTB 2BOBA 1ZS8A 2D7TL 3VW3H 3ALPA 1B4TA 1CBVL 3C5SA 4LLWA 2X9WA 1G9MH 1BIHA 5B39A 5IBLC 2Z4QB 4LHUG 1ACYH 4CUCA 2QTVA 3BWUC 3OZ9L 4RGNC 1U8OA 1SNRA 5ESAB 4EZJA 5CZRA 3WE1A 4L23A 1F2XK 4EXKA 2Y23A 4MAYB 1CFMA 4FF9A 2GVYA 2VDNH 4M93C 4ZFOA 3ESMA 4YXKL 3O45A 5GRXG 2DPKA 4KH9A 4G2AA 3CFBB 4LGRB 4JHZA 5I6PA 3H8NA 3MV8E 2N1TE 1PKOA 3EH2A 5CJXA 2Y5TB 1YDPA 1FRGH 2IH3A 2NZ1A 4L8CA 1IGTB 1PW3A 5FO9A 2XQ0A 3G6JE 5IY5B 2VH5H 3EUDA 4PJHA 1ZY9A 3KWTA 2E7BA 4LT7A 4XRCB 2KBGA 4JFQA 5GGTL 3WKPA 4BFIA 4CAGA 3VTTA 4GRMB 3O0RH 3BAYA 4XVSH 3HAEG 5FHBL 4PGDB 1BG9A 1RZIA 1UWXK 1H5BB 1TQTA 2PXYA 1SJHB 5C0CD 3B9KA 3B9AA 3V0WH 4MXWH 5K9JH 1H15A 3NFSH 1PY4A 5J1AA 1CFBA 5IJBC 1SF5A 5ALBL 2EYSB 2L7UA 1EJOL 1AQKL 3GSRA 4LRIA 4KRPB 1WA0X 2EECA 3ZTJG 2MH4A 2VDMH 3S3PA 4Y19D 3BVTA 2DKMA 3QJFB 4YHML 1IFRA 1KWGA 3ES6A 1GL4B 4NJAL 4TNGA 1U21A 1DVFB 3TVMC 4QRPB 2O6PA 1ZKAA 3OKEB 2YEZA 5D7SL 1P4BL 3O11A 3KWXA 5EZIH 3H42H 4LLDA 3EO1A 3PWLB 4JFOA 1Z2KA 3ELAT 4UINH 5IKCB 4G43A 5ID0B 1FQ9C 3JTBA 5E2UH 1K5NA 2X6MA 4YSEA 5CS7A 2R0LH 1ZLWK 2CRIA 2XHNA 2XCMC 5GJTH 4ZBJA 3QZWG 4DAGL 1J7VR 4UNUA 5AVVB 5A3ID 2ATKA 3WEMA 2XYBA 1WAAF 5AW8B 5CHNB 2XTJB 2NR6D 2RR3A 3ASNB 3BO8B 4OY9A 2R29A 3EYFB 1HZLA 1IRAY 4FNLL 2R1XA 4TNWF 4XPAH 5AVUB 1HEZB 3J2PA 2L8AA 3LKOA 3RWEA 2BVTA 4JM2C 4KROB 1TZOA 3GXIA 1HXYA 3ILPB 3VXUA 4EUPH 2G9HB 2CLZA 3L4VA 4KUCF 1OP5K 1A6TB 4FQXD 1MW3A 1WCBA 2IAMC 1YSOA 5C7XL 3CFJB 4FCAA 3QFDB 4O9HH 5HGBB 3CN1A 4E5XB 4RAHA 3L54A 1EBAA 2QSQA 4S1RL 3QUYA 4FHKA 3ATBA 2YK1H 4WW2A 1OGAA 2A74B 1RZJC 4K71C 2OW6A 3KYMA 4JG1L 4LBEA 3ARBC 1B4RA 3SPCA 2SEBA 4HWBH 3CMGA 4TRPH 3H3KA 3O2VH 1JHKL 1W0YT 2FX7L 3CFTA 4Y5YA 4AX3A 4IBUA 1IC4L 1UCBL 1RUAH 2AF2A 5DHYB 1NCTA 1MIMH 3KLAB 4PVLA 1CURA 3V0DA 1S9XA 4OLUL 3KJ4B 1E28B 1YPZB 2R15A 1GJIA 1V7MH 4NZJA 1U91B 2EEBA 3GBLA 1WIOA 3IS0X 4JDVA 4UTAA 4HUUB 4PM1A 3D48R 3GRWL 4WJKB 5FWRA 3QJHB 3HZKA 3L6FA 1N67A 3QI9A 3EJYD 3GBNL 3OKLA 1GOHA 3GEFA 2D7QA 2V17L 4IBWA 4FA7B 1JSYA 5LNGA 1HOCB 4CA4A 5HGDA 3RPIA 4QI3A 5J7CC 2MQ0A 5E8PA 5C0BE 2ITCA 2EVFA 2YD3A 3U1PA 2WC7A 5GHWL 1OW0C 3IRZA 4KDVA 1KXVC 5GGQL 2BNUB 5TK2A 1GIGH 1I3RA 2XY2A 1SXNA 5DJDB 3PFQA 5DVLA 2X4NA 3FCGA 4F7TA 1MWAB 4FKHA 4BKLB 3TWCL 2UYLA 3G04A 4GAFB 1I85A 3WNKA 1FZOA 1SYSB 1X6NA 2A9AA 1I9RH 1MHHB 2QQKH 1EFQA 4R83A 3ATFA 1ODUA 1I31A 3GMPB 1KGYE 1Z3GH 1G0DA 1HQ4B 4N1EA 3FQTA 5HDRA 1OVZA 3P0YH 4MDIB 5CKGA 3TBYA 4DVRH 5I1KH 1MCWM 2XZZA 1BWWA 1CL7L 3GHEH 1W2KT 1WFIA 2O30A 5LWYL 5BCAA 4CU7A 1T21B 3JWOC 3S5ZA 5F8QC 4ADJA 3HE6C 5EBMA 1MZZA 4NOFA 3GHBH 1CU4H 1RIHL 1DLFL 1ZTMA 4X6DB 3RDTC 2Y36H 4FQQB 3O6FA 3ZDYF 3IJYA 1RZJH 5F96L 1V55B 5CLWA 3W39B 5LAPA 2VDQH 4TVPE 3QXVA 1BZ7A 2Q76B 4G9DA 3ZY7A 4YDLB 2ED8A 4NQEB 1FE8H 1VEMA 2ZUTA 5F70A 4OZGB 2I9TA 5KBLA 4P2QB 1T5WA 1J8RA 1T83C 4NJ9L 1RCYA 1X4XA 2CIIB 1NJ9B 2FH8A 2WLZA 4MZIA 5EF2A 1XF3B 4XP5H 1AI1L 2XV6B 1KZQA 4K94H 3CUPA 4LGPB 5C09A 3BSHA 3RZCD 1TG8A 4Y16C 2QHLA 1K8DA 1N0LB 4YIQA 3BIAX 5CR1A 4Y5VA 4Z7WB 3WUZA 3BUQA 4PWEA 5AKVA 4KRLB 2XV2A 3UTTD 2I24N 3VFTA 3IGAA 3RAJH 1CFVH 2H3NB 1FIGH 1GKEA 2P8LB 4PJEF 2IOIA 5FGBA 3KGUA 1FA4A 5KVDH 2KLSA 3L81A 1HHJA 2WXFA 3VGDA 4J1UA 4QOKA 1WA1X 2BVQA 5TF1H 4NWUL 2NY6B 1YRKA 3CX5K 3GYRA 3L3JA 1LD9B 1DUYB 3RQ3A 3ARVA 4IGBC 5CMAB 1N4XH 4M61A 5D1XD 4UAHA 5H37A