1BQRA

Reduced pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
b'ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bqrA00
1E65A 1PNCA 4A2GA 4HCGA 2WSDA 1SFDA 2OV0A 2WO3B 1A4BA 1BQRA 3DKHA 2FNWA 4YSPA 3C75A 3OM3B 5B1KA 1OF0A 2FQFA 2GB2A 2OCCB 2XV2A 2YARA 3HEIB 1NPNA 3NJLA 4DPAX 2YAHA 3IEAA 3GYRA 2GSMB 1ZPUA 2LLNA 1JZGA 1M56B 1GW0A 4YVUA 1DYZA 3T9WA 3X1EA 2ZONA 1BEXA 3HB3B 2XV3A 3JTBA 3S3BB 1JXFA 4PCYA 2NRDA 4YSAA 3IBOA 4X4KA 2PPEA 3CDZA 4UF7C 1IKOP 3TA4D 2QDWA 2QPDB 1E5YA 2XXFA 1MG2C 1OCZB 5FC9A 1R1CA 1SJMA 4BK5C 3NJKA 4GYBA 1WS8A 2IDSA 1NINA 4YSUA 1OCRB 3WKPA 4KNSA 2XX1A 2VM3A 1NIDA 1WA1X 3WIAA 2DWTA 5ANHA 1GS7A 4G7SB 5PAZA 1IBZA 6PCYA 1SHXA 3WG7B 2WO2B 2XU9A 4KOBA 3AG4B 2OJ1A 5AKRA 3T6ZA 3UAEA 5B7FA 1ID2A 1ASQA 1V54B 1AOZA 4N4YB 2E86A 2VW7A 4E9QA 2PPAA 1IUZA 1MDAA 1WA0X 1J5DA 2CBPA 2HLEB 3BVDB 3QJTB 4KNUA 2YQBA 1MG3C 1SNRA 2XUWA 4GP4B 4ZK8A 3QJVB 3CVCA 4HCFA 5AZUA 1JZJA 4M3HA 5I5IA 2W8CA 3EH3B 1AZBA 3IN2A 3UABA 2DYSB 4DPCX 1X9RA 2HXAA 4KO7A 1HAUA 2UXGA 3AW5A 1W6WA 2FQDA 2BW4A 1PMYA 2AANA 1T5KA 2ZWNA 3OMIB 3NJHA 1J9TA 4F2EA 4AX3A 2PCFA 2BWDA 4HCIA 5EHFA 3CDZB 1PAZA 3PXLA 3NSCA 1SDDA 3EH5B 4YSQA 1FFTB 2PLTA 3G5WA 4HHWA 1J5CA 1AS8A 2GHZA 2QPEB 3AG3B 3FQ2A 3QQXA 1JVOA 3T71A 1PZAA 5IY5B 2H3XC 2YAQA 2YXWA 4BXVA 1F56A 4W9ZA 3V9EA 3QJRB 4A66A 1SFHA 2YAOA 2TSAA 3FU7A 2QT6A 1NICA 2A3TA 1JVLA 2IDQA 1AAJA 2CJ3A 2FT6A 4E9VA 1WA2X 5LDUA 2GC4C 3H4FA 1AIZA 2BZ7A 3AG2B 2DYRB 1PY0A 3ZIYA 1GY1A 4E9XA 1NTDA 3SQRA 4A2HA 2I85A 5I6KA 1L9RA 5B1BB 1X9UA 1ET7A 2Q5BA 3NSDA 4NAJA 1NDTA 3NJMA 3NP4A 1ILUA 3FSZA 3S8GB 3S8FB 1ZDSA 4ENZA 5I28A 1URIA 2J55A 4KO5A 1KDIA 3OD3A 2BHFA 3MX0B 5I6PA 1SDDB 1PZBA 1ZDQA 3T6WA 1QHQA 5I26A 1CYXA 3FSAA 2GC7C 1M9WA 5D4HA 1OCOB 3ABMB 4F2FA 5TK2A 1XB3A 1NIEA 2VMJA 2YAFA 4G7QB 3WNJA 3RYMA 4HHGA 1EHKB 2BZCA 2VN3A 3FYEB 3EH4B 4A67A 2JXMA 3GDCA 3TASA 1NIAA 2UX6A 3FU7B 4P5SA 3FSVA 4HIPA 1JXDA 2PPFA 1N70A 1PCSA 2UXVA 2IH8A 5D4JA 3ZX1A 3OMAB 5A7EA 4NB7A 3X1GA 1MZYA 1V55B 2J57A 3NSYA 2XVBA 3X1FA 2YXVA 1AS7A 1JERA 9PCYA 1N68A 3N2JA 1TU2A 2BP8A 4FA7B 1ET8A 3TU6A 1GY2A 1E67A 1OE1A 2HRHA 2GBAA 1NPJA 5TK4A 5I6NA 3NYKA 1BXVA 3H56A 1TKWA 4GXFA 3ERXA 4GY4A 2EIMB 3V9CA 1XB8A 2JKWA 4DP4X 1HAWA 3L45A 2I7OA 4YSTA 5F7BA 3FQ1A 2MTAA 4HALA 3NT0A 1AS6A 3QJUB 3NJJA 1HFUA 1PNDA 5B1AB 4YSDA 1PZCA 1TEGA 1BYOA 1NIBA 1ZV2A 1VLXA 2IDUA 3X2QB 3U25A 1SHWA 4A2DA 4AI7A 1ETJA 3FS9A 1RZPA 3NP3A 1GYCA 4M4RB 1WS7A 2P80D 5I6LA 1AQ8A 4YSOA 3DIVA 1KCBA 2VW6A 8PAZA 5B3SB 3UGEA 2HX8A 1DZ0A 3PLYA 2PP9A 4Q8BA 4CSPA 3S3DB 2IWKA 1BYPA 1KCWA 1WAEA 1ZIAA 4MFHA 6PAZA 4E9WA 1A4CA 3FPYA 1J9QA 2VW4A 4UANA 1GSKA 4WKXA 1UATA 2X88A 1L9OA 2BP8B 2PP7A 4DP0X 2RACA 2Q9OA 4NERA 2CUAA 2IDTA 3ASOB 1ADWA 3X1BA 1L9PA 4F7KA 4EF3A 1ASOA 3QJQB 4Q89A 2ZXWB 1OCCB 1J9SA 5F7AA 1AR1B 5B7EA 3NJIA 1PLAA 3BQVA 4QKTA 3QPKA 1EZLA 3FYIB 2IAAC 4WTQA 3TBBA 1NWOA 2EILB 3ABGA 5B1JC 1V10A 1A3ZA 4G7RB 1BXUA 5AFAA 1KV7A 1B3IA 3UADA 1RZQA 1W8EA 2VSKB 4JHUA 1ASPA 4N8UA 3PCYA 1KBWA 2W88A 4GP5B 1AG0A 4KNTA 3NJNA 3ABKB 3CZUB 4DP9X 2AZUA 3UAAA 1SF5A 1GS6X 7PAZA 4A68A 1FWXA 4RH4A 3MBWB 2UXTA 1KBVA 1OE3A 2HX7A 1YLBB 1OE2A 1CUOA 2CAKA 4BWUA 3H4HA 2IWEA 1A8ZA 5I5MA 1AZRA 5D4IA 1A4AA 5B7MA 2I7SA 1GS8A 4UAHA 3IN0A 2DY2A 3D12B 1RCYA 4YL4A 1JZFA 3DTUB 2DWSA 4JHVA 1E30A 2CALA 2BP0A 4AZUA 3WNIA 1A65A 3FU9A 2B08A 2GIMA 1CC3A 4DP5X 1I53A 1JZEA 2IDFA 3CG8A 2VSMB 1PLCA 4W1TA 4K9JA 3PAZA 4AKQA 1KDJA 3JT2A 4A2EA 4DP2X 3N55A 3CVDA 3PAUA 3QJSB 4PAZA 1FA4A 1BQKA 3AG1B 2XV0A 4BDVA 2HX9A 4KO9A 3ZDWA 3ZBMA 4BWTA 2MRYA 1QNIA 3FU8A 2B3IA 1NIFA 3OQRA 4AKOA 1BXAA 4YSRA 4KO6A 2FTAA 1AZCA 4YSEA 1PF3A 2FT8A 2XXGA 1IC0A 2AVFA 4P5RA 2HZHA 3SBQA 5I6OA 1KGYE 1XMEB 2UX7A 3EF4A 2J5WA 4DP1X 2AZAA 5B1JA 2EIJB 3NSFA 3FSWA 5I6MA 2PPDA 4E9YA 4DPBX 5E9NA 1OV8A 2AFNA 3AY2A 1GR7A 1CURA 3FQYA 2Y1AA 2BP0B 1SF3A 4HZ1A 2YAMA 3T6VA 2BW5A 3FT0A 3GXUB 2DV6A 3WI9A 4GP8B 3IE9A 2FJSA 3KW7A 1PLBA 1XB6A 3TBCA 1L9TA 4HAKA 1ILSA 1NWPA 4G70B 3PAVA 2R7EA 4CSZA 1JOIA 2XWZA 2YAPA 3ABLB 2XX0A 2EINB 4G72B 4A2FA 4BDVB 4FAAB 4BWWA 2IWFA 1ZIBA 1KYAA 4E9RA 4E9SA 2XYBA 2GI0A 1IBYA 2IH9A 2HRGA 1AG6A 5PCYA 4DP7X 1MZZA 1L9SA 1E5ZA 1AZNA 2Y69B 4JKNA 3FPXA 2FT7A 2CCWA 2N0MA 1JZIA 5I5JA 4DP6X 1CYWA 2UXFA 3S3CB 3SBPA 2P80A 1NZRA 3AZUA 2FQEA 2PPCA 1BAWA 2H47C 1QLEB 3EHBB 4YSCA 4YVNA 4AKPA 1ET5A 1BQ5A 3CVBA 2XLLA 3NJGA 2H5UA 3UACA 2YAEA 1RKRA 2ZOOA 1W6LA 4YSSA 2BWIA 4TXVB 1JZHA 2TSBA 3NJFA 1L9QA 2BO0A 3OMNB 2QDVA 2PCYA 4DP8X 2VM4A 4E9TA 2J56A 4G71B 1AANA 4QLWA 7PCYA 4L0PB 2R7EB 4KOCA 1JXGA 1M57B 2EIKB 1AACA 1AZUA 2FWLB 3ASNB 2X87A 1TEFA 3WKQA 2PP8A 4BXSV 3X1NA 3T6XA 3SBRA 3PPSA 2FQGA 1J9RA 2JFCA 3KW8A 1OOWA
chains in the Genus database with same CATH superfamily
3FO9A 3B3BA 1FZOB 2EIZB 3O8XA 4QPEA 4PRDA 4BQ8A 3G5XA 3MCLH 2XXMB 3RWEB 5HGHA 3LRHA 3QIWC 2ENJA 3GBNH 2N7BA 3ZL4L 3OKNB 4EVNB 2EE3A 3ZGIA 4FZEL 3SDYL 3NJLA 1PVHA 3M1CA 1PZ5B 2F8IA 1QATA 2IC2A 4KWUA 4OZIE 1G4MA 4OJEH 5DYOB 4FXKC 2CNZA 3HB3B 2WQSA 2XWJA 5FDWA 3KPOA 4HIHA 5D2NB 4HJTA 3FT3B 4M6NL 4FERA 4Q9CA 1RPQA 5KYUA 3FO1A 5AAWC 2WYZA 3C8HA 2OQJA 2Z0BA 4HC1L 5F8QC 4JDZA 4HS6B 1P4LB 4BZ2A 5EUOF 3IDMB 3VFOB 3PQYA 4M7LH 5D7IE 5F7HA 3H9SB 1N3NB 2GTZA 4PHZA 1S7VA 3MRBA 4I77H 3SOTA 3TP4A 2Z7WA 2J2ZB 1SEBA 4CC1A 5J1SC 2F5AL 1K2DA 2WVTA 1YYLH 5ES4B 2CA4A 4OLVL 32C2B 3HZYB 4QTIL 1G7IA 4IBVA 4XP1H 3V4PB 5I2IA 3RFZC 3LS4H 1MDAA 1WA0X 2IQAA 2CBPA 3A67L 2A6JB 3FQNA 3T0EB 2FHFA 3L4TA 2G9KA 1TFPA 4YNYA 1OAJA 3VH8G 2A77H 2YLKA 5IR1B 4M3HA 1QUNA 2X6MA 2GK0B 3UABA 3IN2A 1OKEA 4TVPL 1BBDH 1HAUA 3GSOB 1Q1JH 5CEYB 1QRKA 4Y9GA 2VM9A 3T3MF 2NZ1A 3QIBA 3T6QC 5L6YH 2VN6A 3PUCA 1BVLB 4OV6F 3QIWD 2NXYC 4L23A 4P3DB 3GSXA 1IBGH 1QFOA 2ZWNA 1A1NB 3MBXH 2JJTC 4JFDB 4JGUA 3MA9H 5D1ZA 4DHLA 4DK5A 4Z76B 3DV4A 2W94A 1OY3B 3CFIC 4J4PD 3MRMB 4AQ8A 5I0DA 2P42B 4EDWL 5BPPA 2AQ3A 3O11B 4XP4H 2C26A 3VFPA 5F21B 1M2OA 3GUTA 1GOFA 4PRNB 4ECNA 4BQ6A 4PJEE 1CFNA 4AGOA 5KN5B 3PWPE 1BFOA 1HESA 5IUSA 5IJDC 5HI3D 5FIEA 4GKZA 5FCUL 2H3XC 2TRYA 3QG6A 3TFBA 2WUCH 1KIRB 3KYKL 3H7BA 2DI7A 5BRQA 3WSQL 4HKZB 3ZXAC 5A2KH 3LKPA 1FVDA 4YDNA 1TKWB 3WNLA 3H54A 3RAJL 1KN2H 5DRXB 4QRPE 5B3NA 3SD5A 1A1MA 3WGUB 1YJDC 4L4TB 4MB3A 2BOLA 2CBOA 4WHTB 5D1QA 1E9QA 3SYAA 4OLYH 5D6DA 4IGBB 5KWYC 4WLCA 2BZ7A 2UVEA 4ZFQA 1SYVA 5MEQB 2XNAA 2LVCA 2DJSA 3IKCB 4A2HA 4AEFA 3TO2B 1H3GA 4HZLB 1J5OH 4MNGE 5EOQL 3IJSB 5CUSL 2RQ8A 2LHAA 4U1SB 1QI3A 3MPCA 2CGRL 4TQIA 2YJLA 2OJZH 5DEFB 1QFWH 3WFZA 3E6HB 3NJMA 1JF1B 1QUPA 2BVQB 43C9A 2Y7NA 5H94B 5I28A 4FJZA 1A6TA 4GQPH 1X5YA 5JZ7D 3PWLA 3IFNH 1NOAA 5DS2A 5C92A 4D0BA 2D73A 2NY1D 3FTSA 1CLZH 3P9MA 1SDDB 2YA2A 4YHOH 1IT9H 1XFPA 2Y7QA 4FQ1H 4P23C 2PCPB 1ZT1B 1D6VL 1ZCRA 2VGLM 1ZKAA 4FFYA 5AB0A 4IRZH 2BIPA 3ARDA 1DN2A 3OB8A 4Z7WB 3EXLA 4ZSOB 2A9NH 4DO6A 1MQKH 4HKJB 3O45B 3UBXI 1A6AA 1X5ZA 4P5TD 1DQKA 5C8JA 5DZLA 3GRWH 5SX4H 4JLRA 4Y1SA 4BSWB 2DD8H 5BS0B 5J4MA 3HJEA 1RUQH 2C34A 3TCLB 5J8OA 1UM4L 2J1KA 2PPFA 4NYLB 5A16A 3F7VA 2CO6B 3GNML 3ZX1A 4H8HA 4PVNA 3K46A 1PTZA 4XNMA 1V55B 3FN9A 1T89C 1QLEH 3MREA 1YAIA 4ENEC 2QQNH 1D9KA 1I1YB 2C9UA 3GSRA 3P3UA 2GYSA 5AAMC 2O26U 3UTTB 3NGBB 4TNFA 1JFQH 1TLMA 1FHNA 2YD2A 4ANUA 3KDMA 3IVKB 2Z4TA 4WY7H 3HA0A 3CV5A 4HKBB 5I1JH 5EZIH 2VAJA 5C09B 3HS0C 5JHAA 4TLSA 5D7LA 5BO1H 2XFXB 2OR9L 3V9CA 2UWEF 4Q14A 2W38A 1J1XL 1BZQK 5LCVH 3B1TA 2VSCA 5F0MB 3V55A 3V5KB 1HFUA 2Y6SC 3BAXA 4GNKB 4XMZA 1LQBC 4JY4A 3MBEB 4WI9A 3O41A 1T04B 3EOTL 4FNQA 3SB3A 2WWKT 4HXAL 1Z2KA 2IXQB 1PFOA 4EIUA 3BDBA 3QCUH 2QBWA 4YHIA 5DS8B 4NLHA 4XI5C 2CHWA 4BSJA 2FO4A 3CBJB 4GAYA 3VXNA 2DLFL 1Y0LA 3SODB 1BYPA 1FPTL 2QTEA 2CO7B 1J9QA 3MGOA 2OMUA 2VR5A 3UJTL 3V0HA 1EQWA 3FOLA 4UQ2A 4XZUA 5DK3A 4NERA 3BQUC 1VFUA 2ZCHH 2XZZA 3D2UD 2WQ8A 3BGMB 1MCWW 3MCKA 5CAYB 4HMDA 4XBPA 3UROR 3ZRCC 4MNQB 2X7LB 2NY6C 4WTXA 2VN5A 1AKJA 3N5AA 1IGIL 3N85L 4X5RA 2PR4H 4ENED 1OAXH 4DZ8A 3S3JA 3U0WH 1A5FL 4EZKA 3QFDB 1VGKA 1SLWA 3ZHNA 1L9MA 3ARRA 1PGRB 2WIIB 2OSLB 5L9DL 3ABGA 2V2TA 4N0FA 4DCQB 1A3ZA 3QQ3B 4FMFA 4MYWB 4MMXC 4XVJL 1RIVH 1W8EA 3BGFC 4NO2B 5EO1B 5E0FA 5DCCA 1FORH 1ZS2A 2W88A 4ZQKA 3D0LB 1D2PA 4K94L 1HWGB 5DK2B 4DP9X 4UIKL 4Q56A 2ATPB 3WD5H 1QPKA 3GPEA 1G7LA 2HJFB 4Y4FA 3H55A 4P05A 3UAAA 3UJJH 4JFOB 1NM4A 5BOZG 3QXAB 1VAHA 4J3VA 4JO1H 1H6TA 5FO9B 1RK1A 2VAAA 4R7NA 1VEOA 5DC0A 3DURB 4TNVK 3MUGA 2MSPA 1KNOB 4QTFA 5AUMB 5CO1A 4XI5D 2G2PA 5DRNA 2E7LC 2IWEA 5DD6B 1S9YA 3JYBA 3KXFD 2JCCA 2X2HA 3RUGB 1TF4A 3VMOA 3LH2L 3Q5TA 3L81A 5T3ZL 4AQEA 4NWUL 1AXSB 4HCRL 2I7SA 5KTEL 3TXAA 1H3PH 5I23A 4KQ3H 3D12B 1ZAGA 1R19A 2NYKA 3JVFC 2ZPKH 3DUUB 1O9WA 4F24A 3KS0J 4PGEB 3VD9A 3K91A 5DRZA 3MV11 4S1RL 3Q06A 1OAQL 1VZIA 5DJYA 1CC3A 4AOFA 4AYEC 5JQIB 4AY0A 2AQ1A 1I7RA 3BAIA 3HG2A 3IFLH 4W1TA 4G42B 3ATBA 1QBML 1R24A 5JYLA 3N06B 1AC0A 3PAUA 1SJVA 4LL1A 5DHDA 5CWSA 3RB7A 3RWCA 4OZHB 5F8RC 4Z7OB 1XX9C 1UD8A 4E41B 4PTUA 1KCRH 1RK0B 4A6YH 4HGWA 5IVXF 1N0XH 3CDCA 2VLKE 1AHWB 3ZBMA 3DJRA 4C57C 2Z3FA 1A3QA 1TSRA 3AY4C 5H37H 4ELDA 1K8DA 4PS7A 2UUDK 1WBZB 3KZ8A 1NGZB 4NQEB 4MQSB 4XX1E 2R39A 1HHGA 1X44A 4JY5L 3WUZA 2VDPH 2B0SH 2RFXA 5FA3A 1BZEA 1LDPL 3B8SA 3RIFF 1EZUA 1QHOA 3L5HA 1KJ2L 4DP1X 5EBMB 1WFOA 1QFWI 1ETA1 1BX2B 2ZWZA 3FSWA 5IFJB 3I9IA 3DX8B 2HVJB 1I8UA 1BM7A 1JVKA 1KBGH 5EOCH 5IVZA 4M6ML 5CU5A 3HNTL 4YEFA 4NKDB 4QEGA 3K74B 3EYUH 3CZNA 5C0BA 4GXUM 3IE9A 2GBVA 2WXHA 5DUPH 3N3EA 1F0LA 2ZUXA 3VUAA 3R06A 3EJRA 2X1OA 3QNZB 4GSRA 5DJ0B 3JV6B 5JW4R 3RWIA 3L7FB 4Z7UF 1B4JL 3CQQA 4TTDC 2F7RA 3TN0D 1I3RA 1O6VA 4U3XA 3SBWC 4I2XE 4PY8I 4U2ZA 1ACXA 4CSZA 1A14H 4W4OC 1OT1A 2WXKA 3ME0A 1UWGH 3NIGE 4BDVB 1XSJA 5M94B 3IKKA 3HC3L 1KYAA 4O4YH 1IBYA 3QFJB 5GHWH 1JRHH 1O6SA 3QYMA 2CMRH 4PWFA 2RALA 2OX5A 1JE6A 4RFEA 1FN4B 1WH0A 3T8XA 5BV7L 4JO3H 2GJ6A 1UADC 1HXYB 4LOUD 2ADYA 1EAQA 1QRND 5JUEL 1O6TA 2KZBA 1WGVA 1INDH 3O6LH 4JRXE 2XA3A 3C6LA 5KZCD 4OGXL 2PPCA 5I1CH 2FSEB 3HVDA 1HN1A 2HT2D 3FB5B 3OJMB 4U6HA 5F71A 2E7BA 4WWPA 3OZKA 5CZVL 1FYTE 1RZ7H 3RVWC 3IE4A 1IBHA 4XN7A 2CDGB 2I24N 5JNYB 2X1PA 4JKPL 5TQ2L 1DVSA 5D7KD 3RPIA 2O6DA 1K3IA 3O3EB 1LEKA 3GMPA 4HJJL 1ZV5A 4HWEL 4WU5B 1HYSC 2ZZUT 4P9ML 1KLFB 2J8UA 2Y1VA 3F7RA 1N5AB 4N5ED 3VWKC 4A7VA 4POYA 1NSNL 3Q2NA 4WW2B 5TH2B 3MRJA 4PJ7E 3F7YA 3I84A 3Q8CA 4LHQB 1NEUA 1X5KA 2ID5A 2WP3O 4PUBH 3DX1A 5DJZB 4ABWA 5KW9L 2VABB 2PP8A 3I74A 1UQSA 1TZIA 2P3YA 1PZDA 1VF5C 2D7PA 4AQ1B 4JAMB 2PCFB 2BVEA 4KK8C 4ODWA 4PV9B 2PF6A 1OOWA 3Q1EA 3BCDA 5SWSE 1I1RA 3FBKA 3QIUC 4TTDD 4FOMA 1G6RL 3PF2A 4F5CA 1M7DB 3DOIA 3ELQA 5L0QB 1QASA 5JHMA 1X3DA 3R0NA 4JM2D 5DEZA 4U1JB 1ROCA 3IGAB 1MCBA 3FTGA 4XB7A 5IMLA 1T22A 3DI2B 5FYJL 3QJFA 4KROC 4U1MB 2XV2A 3W9EA 2GTWA 2WMPA 3D18B 1RZJH 3RZCB 4S1QH 3LV3B 4H8UA 3DMMB 4BCXA 1DN0B 1JZGA 1YEJL 2LLNA 4QT5A 4BRJA 4NCDA 2GABA 2FIKA 2F54B 2NRDA 4HS8H 4Y19D 1U36A 1R75A 1QSEB 3LZNA 1I8KA 1GMIA 3OAYK 4N87A 5F97E 5IIEA 3EJZC 2DTMH 1W0VA 1UB5B 1MG2C 1CD1A 1E43A 3B2UC 3RVWD 2DL9A 4GYBA 1TVDA 4LEBA 3GSVA 4B5EA 5BV7B 2QPSA 1QO3B 3CFBB 1V7MH 4XMPL 5HPOA 1NIDA 1S7RA 1S7XB 1TO5A 3EJPA 3G7TA 2GCYA 4MDJB 3ATEA 4RWYH 5E6IA 5INCB 3WXVL 1SHXA 4UQCA 5FKPB 2ZG1A 1XGQA 4NKMB 4RRPM 2MQ0A 2KQMA 3QUZC 4KJYB 1IUZA 3M8OH 3T65B 4IKIA 1SQMA 1UVQB 3O2DL 3O4LE 4PRPD 1LP9B 3NH7L 5D7EA 5LB1A 4FQ2H 1ODAA 3QYNA 1WITA 1F18A 2FJFA 1IAIH 4KK8D 4LP8A 1WIOA 3W39A 3OGCB 4NZTL 2NYYD 5LQBL 4UOW1 2ITCA 2VLRD 5I1AB 5AVYB 2AANA 4HPHA 3QDMA 2IPTL 4NZRH 3DX4A 1T1WB 2BCMA 4NRZB 4P2AA 5I9QC 1CGVA 1DQVA 3O6FB 2FBJL 3PY9A 4M48H 1HQ4B 5CP7A 1AR2A 1J5CA 3AC0A 1P7KB 2BWQA 2NT1A 4XCEA 1G6RB 4N0YH 4JPWH 5E5RB 4BKSC 2QVMA 1DVYA 3KWVA 4NNPH 4HJIA 3CHQA 3KCWA 3Q6GL 4ODBD 2JK5B 2YSSB 2WC7A 2CJUL 2FUQA 3IAPA 4LO9A 2TSAA 4GAGH 4H26B 3QXDA 1MREL 3CSBA 4RSVA 4UB0L 5C6TH 2O6EA 2ZXBA 1AAJA 4N6RA 2FWUA 3ZYOA 4F2MA 1U8KB 3I6LD 5JORA 4CN6A 4YO0A 2D2OA 1XZ0A 1YNTF 4NPKA 1NFKA 1S5HA 2JQAA 3H4FA 3S97C 1AIZA 2W91A 3DBXA 3OKEB 4LLYA 3LAFA 4PWGA 4YXHL 4KX8A 4UTAA 5AW6B 3H3PH 2PYFB 2X6UA 4GFTB 1XF4A 2W92A 3BPOB 2F7OA 3QNFA 1RXLA 4ENZA 2J55A 2Y07L 1SM3L 2BHFA 5EH1A 5I8EA 1DDTA 1MFMA 1R33A 5JHDB 3JWOL 2XWDA 3US0A 2AQRA 5DUJA 1LEGA 5F96H 2NPLX 1WZ1L 2A7BA 2X4QA 1A6ZB 3QWOB 5D4HA 3B2XA 3SE3C 3FN0L 4EI0A 2BIOA 5IMMB 1AQKL 1CFVH 4XMLH 3B9KA 2AAVA 3TBVB 4HAGA 1J1OL 4JREB 4M1DL 1SJEB 3OTTA 3THML 5IJKC 4LEOA 1RZKL 3O3BB 3RVXD 3VGDA 3FU7B 2FATL 1QD0A 3OXSA 4Y5YA 1ZWIA 5F7DA 9CGTA 3P4OA 3QDGB 1NEPA 2XPYA 4HJ0D 2P8PA 3QI9D 1XF5A 5E5MB 4M7ZB 4XNXL 3ZKNC 3HG5A 5JW4Q 2Y9RT 2XWBA 4MQTB 3VSQA 4D8OA 1KXQE 3BW9A 5L2KE 5IMOB 3NSYA 4P9HH 2XIBA 3ULVD 1O75A 4Y4KB 5JDSA 2BRRH 5I1KH 4K0OA 2ORBH 1H5BB 1ET8A 1TVHB 5TE6L 3FCSB 1MIMH 1SPDA 2FLBT 1KCVL 3MFFB 1YHPA 5TK4A 3V4VA 5HYSA 1F90L 3TVMC 1XGPA 3FH5A 3WIHH 3L3JB 3CVHH 1AD0A 1SRDA 1OW0C 1YVLA 2Y72A 1BYNA 5I0WA 1T1YA 2FNBA 5A6IA 4XTRC 2HCZX 4UQ3A 3WMSA 1U93B 4XVTL 5C0AB 4EUPH 1UJTA 3CLFH 1N8OE 1NIBA 4RSYA 3B2VH 5CP3A 4CVXA 2FX7H 5ISZE 1RP9A 2VDQB 4N24A 2W9LA 3UTSB 3AREB 5I75B 1LHZA 1GYCA 2VR4A 4M4RB 3TNMA 2A6DA 1FFPA 1JNLH 5JTWA 3MR9B 1UA3A 1MHPL 1MUJB 1GGBL 3GMOA 1AYRA 3K6FA 4L37A 5CKGA 1CFTB 3UBGA 1IM9A 1NC4D 5E1QA 2V3FA 4DOHE 1RZIA 4J5VA 4WEEA 3PLYA 4CDGC 4Z7AA 4JMXA 3A4DA 3IU4H 1CT8A 3GSQB 2CA3A 4I48B 4NQXB 3V7AE 3NEXA 1WG3A 4E9WA 3QDHA 1B4LA 3O9WD 4L8SB 2D7TL 3HZVA 2MPAL 4GI6A 4OW6A 5DMGD 5HVHC 4EOWH 4PBWD 4GJTB 1MJ7H 4EIZC 5CLWA 2VERA 1UZ8A 5LWYH 3OPZH 3BKML 1RZJC 3QJHA 4BH8B 3K8KA 4U6YB 1LO2L 2BNQA 4QO1B 4B9YA 1ZLVK 3JZYA 1Z3RA 3DTXB 3HFMH 3H9HB 2DIBA 4TSAL 5GGSY 5HGDB 2R1WB 2GFBB 1QX1A 3QPKA 2XTSA 1FVCA 5CD3A 1AKPA 4WTZG 4L4VA 4F7TB 7FABH 1DQDL 1NEZA 3VXRB 5BZWB 1CFMA 4WK2B 5ETUA 4LCUA 3TBSB 2IPKA 5DEJA 4S1DC 1ZA3B 3EJYC 3U1SL 1FNSL 1BZDA 5LGHH 3OKMA 1MJJB 2YD5A 1FAIL 2OMTA 2VXTH 5MEOA 2PTVA 4CSTA 4J4PA 5E9DE 3RA7H 1RL1A 1CF8H 3DGCR 4ZO9A 4LLQB 4AVJA 5TE7L 4ODVL 2IADB 2C7UB 1UUSA 4LVOB 5CJOH 2R0LL 4IKKA 1TZOA 5IB3A 3SGJC 3AQZA 1P5UA 5KVFL 7PAZA 4QTHA 4QUOA 2HLAB 3ULUD 1JHLH 2PYEE 4RH4A 3ZJAA 1C8QA 2EDRA 1JDDA 4U2YA 2NY4B 3U2IA 3DX2A 1R3LA 1YDPB 4KJWD 5E4OA 4C58B 4Z7QF 2UYLB 4NXKA 2OMVB 1U41A 4KPHH 2VXQA 4XT1C 3WIFB 1HINH 3W0WB 4TVUA 2ZSVB 1FC1A 3DUHA 4EUPG 1CLOH 4X4ZA 3MA7A 4QLRA 2WJ5A 1UT1A 4OM0L 3BSZH 4QRAA 5I5RA 1R17A 1LMIA 3HE6B 4WUKL 2DQDH 2WUBL 4OFDA 3KL5A 2WZ0A 3CH8A 3WNIA 3ZQXA 1MPAL 1EHLL 4F8LA 1A9BB 3US1A 1UD5A 1CBJA 5JR1H 2LLGA 2MCPH 4YHPB 1HWWA 1M7UA 3CVDA 4MA8L 3AQYA 2APSA 2R9HD 4EI5D 4XVSH 2NY0B 1T1XB 2R56H 3LN4B 3ZRSA 2JKTM 1X6NA 3EZ8A 1EFQA 3BN9C 4XBGA 1TQCC 2Q3AA 3HG1B 5IWLC 4B96A 1TDQA 4TSBH 5E8DL 4AJYV 1EJ8A 4YUEL 4IOSA 4Y0GA 4Z5RB 2BHYA 1F97A 4AT6A 1TFHA 4UT9A 4Y9CA 2C9XA 4OZIF 2P47B 3I9AA 3JV4A 3CH1A 1OSZA 1SJXA 3VXMD 3BHBA 4NSKA 4ZUTB 4XODA 2TAAA 4UINL 2Y23A 5C07E 4ZFGL 1PDKB 5A3IC 4JFFB 3ZE0E 2UY7B 4PY8J 4DGVL 1UT2A 3C5ZD 4FI6A 1OM3L 1V27A 4IMKC 3CFKB 1ZT7A 2DH3A 1CURA 1GR7A 3RG1C 4N25A 2J12B 2OMXA 5KYXA 3SDXA 3OR7B 3GXUB 4R7XA 4H20L 2FYVA 1URLA 5ILTL 2DIAA 1CDCA 3AXLB 4A37A 4G11A 5KBNC 4J3BA 3WS6C 2PXYA 4TQEH 1VB9A 1GGCL 4NCC2 5FHAL 3UZQA 3O3UN 4XNQA 5KSBA 3EO9H 2VDOH 4FAAB 3GMNB 4BWWA 4NBXB 1U8LB 5D2LA 1WUZA 3S34L 1Q72H 2OL3A 4GKOA 3OXRA 4HDIB 4LLAA 3C09C 1F8TL 2JWYA 2ZUQB 3LD8C 4H5SA 5FK9B 1I3UA 3MRLB 4P9HC 5B1CA 3S3CB 2W9EH 3BPNC 4CN1A 1EV2E 4NO0A 3RKDC 4L05A 4HGMA 1JI2A 2DWEB 5KUKA 1RLBA 4RCAA 5E1AA 1XR9A 4YVNA 1I3GH 5DJ8A 3TA3D 2XLLA 4E36A 4OAWA 4DTGH 4GRLB 3O81A 2ILLA 3UMNA 3TPKA 1XIWA 4ESKA 1ORQB 3AB0B 5F9OH 1XTMA 2AERT 2QTVA 3DVGA 4PJEF 4ZUWB 4I9WE 3BUIA 4KQ0A 3ISWA 3F83A 1GTNA 3MLYL 4K71B 4KX9A 1UWEH 3HNVL 3MV9A 4JZJC 3SKMA 5GRUL 2ICWB 4P46B 2PUQT 3UPRB 2IWGA 1JNNH 3P0GB 4NM4L 4R7DA 1JWSB 7PCYA 3LKSA 3L6FB 5FF6A 5HBBA 5KBDA 2FR4A 5MERA 1GJIA 2FB4H 1BIIA 4WHDA 3I50L 1LO0H 1MXDA 2HFFB 4ETYA 3RE0A 3GSNB 4Y1AB 4MDIB 1U8CA 3UCRA 4X5WB 4GMSH 1GIGL 1WBXB 3P11H 4U1HB 4C59B 4QRQB 2XFGB 4AENA 2ADGA 2WNKA 2DM2A 3K0WA 4GSXA 4R26H 1IZKA 4RRPA 4ZAKD 3O4OC 3RL2A 3WJLC 4WKZA 4S1SL 2XQYK 4NRXB 1DVFC 1ZE3C 2CR0A 4JPQA 3RJDA 4CDHA 4G43A 5TF1L 3LEVH 1RD6A 2CBTA 4H88H 1ODUA 5ECJE 2YR3A 2F53E 3QIWB 2OCCB 3DYMA 4I5BB 5CZXC 1NPNA 4WO4C 5DLML 3WO3B 2L7EA 2YAHA 2KPNA 3C12A 2PW1A 4PJ5A 4HULB 5A2JH 1NM9A 1YJDL 2GJZB 2OCJA 3WEXA 4CMHC 5GZOD 4OT1H 4XAWH 1I9JL 4N2GA 1A6WL 1QLFA 4HIQA 2BY2A 2EZ0D 3EJJX 4PGCA 1BJ8A 4M6OL 1AP2A 1AC6A 1GZHA 3K72B 1AO7E 2ZJSL 3WKPA 4KKLC 3JTTB 4ZOCA 3SYPA 5IK3B 4XPGH 3ZHDA 5IQ7L 1ZJAA 1J8RA 3DOSA 4HWBL 5DF0A 2CU9A 3STLB 4BQBA 5L8KB 2EXYD 2RB8A 2XU9A 3MMEB 1I31A 5B7FA 4IJ3B 4QHUA 1IBFA 1QVOA 3MLVL 4DAGL 1IEHA 1R5WA 1UOKA 5C0IB 3EGSB 1KXVC 3V0VB 2YQBA 1AGBA 5FFOA 3EOAA 2X1WL 2EH8H 3FB6A 3F65A 3G6JA 3H85A 2B5IB 2X6VA 2VZ3A 4L9LC 1WJ3A 2AXFB 5DC2A 4U1LA 2EP6A 3TH4T 1B6UA 1CO1A 2IPUK 1E8YA 5FUOH 2NY1B 3FMGL 3FL7A 4JPSA 2Z1PA 4X99B 3K2UH 5DMKA 3ZZQA 3ZDXE 3D69B 5FO2A 2L7UA 1U3HA 3P4NB 1T0MB 4M8UA 5E7BA 4L1BA 4BV1A 3TFKD 1VFBA 1YQVH 3MLTA 2NXYB 3LX9A 2MHAB 4RBPH 3UEZA 5C2UB 3C8KB 3ZDZE 3QQXA 4GSDL 4O58L 3RWEA 1F3RB 4H1LB 1S7WB 1LILA 3EDFA 1IAMA 1NCTA 2Y4SA 3IMWA 4A2LA 1CLCA 1XGZA 2NY3D 4F33B 4IBUA 1Q4NX 4XVOA 1S8DB 4HAFA 1SFHA 1X9QA 3TJPA 3C5SB 5B22A 2AK4B 2RCSH 2DWDB 2QT6A 3ZE2B 4JN1H 4UYQA 1M6OB 1YN6B 4HHAB 4J2XA 1NAMA 3LIZH 2LQRA 4NT6A 4PS8A 4ZPTB 2GC4C 2JCWA 1GAFH 5EOCJ 5DR5H 3S5LB 4UV4L 1I82A 4HS6A 4CSSA 5KSAA 4KVCH 4APQA 3VFOA 1KMGA 4Q0XL 4ADIA 1N3NA 2O61B 4AUYA 2O5YH 2AKRB 1UXLA 3NCJL 4GRMA 1WEJH 3WKYA 2J2ZA 3GHEH 3NFSH 3MV8E 1RUMH 3CN2A 3T77B 4NO5A 4DSYA 32C2A 3HZYA 2LU7A 3MCLL 1CR9H 4KO5A 1FNGB 3S8WA 3V4PA 2GSGB 2H8PA 1BGXH 3LZFH 4NI6A 3GBNL 3FRPG 3T6WA 5DVMA 4AM0Q 3T3PB 3K2KA 1N12A 3VXQA 1QWHA 4XNZC 3Q8FA 3D51A 2HG0A 2W0FA 3BP7B 1VSCA 3AITA 1CGTA 1MCEA 2PWFA 2R23B 3FCTB 3FCUB 2GK0A 4O5LL 4URTB 3FQ4A 3GSOA 1TCRA 3GDCA 5BCAA 1NCWH 4FQIH 1BPLB 1GW6A 3M7FB 2X4TA 1QQDA 4F9LC 3CUPA 3WYRA 1DVQA 4OLZH 2BIIA 4QGYA 5EOTB 3VG0H 4Z76A 4MJHA 5ANMB 3LRMA 3MRMA 2CR6A 1MFBL 4M7LL 4X6FA 3IXTA 5T3XD 3D2UB 2J57A 3EW3B 5IB4B 4W9GC 4I77L 4HUXA 3APFA 4NQSB 2YS4A 5KANI 2YXMA 4AQAB 3N2JA 3ZO0A 1YYLL 5IB5A 1YMMB 2B2XH 4XP1L 3TURA 5EN2A 5HVGB 3E38A 1N4XH 1UEMA 2EEDA 1U8NA 3LS4L 5IQNA 1TKWA 5SX5H 1EDYA 3FQXB 3HLAA 4PCTA 1UENA 3ZTDC 1IEAB 3EIFA 3GEWB 3T04D 2QADC 4PG9B 4Q6YA 3ZOAA 1KIQB 3UTPD 2A77L 1JWMA 3VH8B 1HAWA 1QR4A 4WHTA 1WT5C 2BSSB 4MJ5B 1BBDL 3VYPA 4BFIB 1Q1JL 3G5VA 4YFEA 1EEZA 1LE9A 4GKLA 3X2QB 1LWRA 3QYCA 5L6YL 3PHSA 2VQTA 5IHHA 2Q6WB 2IALA 5FUZH 3SCMC 1HH9B 4IRJC 1NUNB 1YEWA 1IBGL 4XAKE 1M05B 1CN4A 2JVUA 3MBXL 4G7VH 5I1EL 3MA9L 1ADQA 1JTPA 5DEFA 2Z8VC 1N18A 4EQ2A 1DANU 2Y22A 2IH3A 4XP4L 5AVXB 1CGSH 4HWUA 2WQXA 4Q8BA 2AEQH 5IM7B 1WTLA 3LIUA 3LKRA 4GEIA 2FZ3B 5DZAA 3LEXA 3V6OC 3BZFB 3OR6A 5F1SA 3VI3F 3A47A 5J3HC 2PCPA 4AYBA 2NTFB 1F1DA 4PVBA 1ZSDB 1KJVB 4FQJH 4DN4H 1YY9D 4HEME 1KN2L 1OK8A 3ASOB 1AY1H 4NZUH 3TBTA 2AQSA 4X0KB 5JXAH 4ZSOA 2Z9TA 3BQUB 2Q3ZA 2FSDA 3RIFK 1OCCB 3KWWB 2ED9A 3NJIA 4W6XB 5ICXA 1RAMA 4OLYL 3KWXA 5E6UB 3RWGB 4LFHD 3KR3H 2NY6B 5C6PB 4O02A 1LNUA 3FFDB 1V10A 3APDA 4ZYKA 1OPGH 2FGWH 5L2JB 1ZD6A 2OJZL 1EHAA 1JGEB 1QFWL 5IQMA 4UM8B 1JYXA 2DJMA 1HSBA 2C3HA 3H2WA 1ZTXE 3MV7D 4EBQH 1MI5B 1KBWA 3VI4B 5FGCE 2R2EB 3UTTA 2EEXA 3IFNL 1CLZL 1NH6A 1J8HE 3CXHJ 4KNTA 4UNIA 4YHOL 4PJGA 1TZHA 3L54A 4Z3EA 1IT9L 5E2TH 1OAKH 2NNRA 4FQ1L 5FWQA 4EKJA 1U8QA 1P2CB 1PX4A 4OM1H 2IAMA 5DFAA 4IRZL 3VXOB 3WHXB 4P4RB 4ABQA 5BOJA 2CUMA 2J6WA 4K3HA 1AVAA 5T1KB 3IM1A 1L6XA 1OE3A 2HX7A 4XB8A 3MJ9H 2A9NL 3F58L 1MQKL 1TLKA 4BWUA 4L8CB 3MBEA 5EU6B 3ZKXB 3SKUD 5DA4A 3TZVC 5A2IH 1EX0A 5I5MA 3GRWL 2DD8L 2IXQA 2EICA 3B9EA 1FGNH 1RUQL 1FHGA 4NHUA 3MCYA 3SDAD 4NENA 4Y2DC 3TIDB 4L29A 4XXWA 5HP5A 1SXZA 2A5UA 3SGDH 5IBUG 1T2QL 2X9ZA 2E8ZA 3TN0B 4FNPA 4JFED 1QLEL 4PJ7F 4J12A 4QXUH 1AQDB 5DA0B 2QQNL 1LL1A 5EIIA 2FR4B 2BVOB 1QFHA 3IDUA 4JZOA 5FV1L 5FXCH 3U6RA 4D7BA 3JT2A 1EGJL 1OF2A 4CU7A 3NCFB 3FO0H 5C0CA 1WISA 4WY7L 3QJSB 1Z9NA 5DVPA 1WYJA 2IANE 4AGLA 5EZIL 5I1JL 3BP4B 2YGOA 1LYQA 3HRZA 5BO1L 1D7CA 4KO9A 4F7PA 2NSXA 1FFNA 3EG9B 1QRNB 2DBLH 1T7ZA 4L8DB 5LCVL 4BWTA 5EEYA 2FO8A 5GS1C 4KKPA 3HBZA 4W6YB 5KZCB 2XKUA 2W0KA 4CNIB 4PMEA 2WTRA 4WF7A 2EYSB 3A6BH 5KVEE 1F45A 1OGTA 4L0ZA 4AZ8B 4QY8A 1R34A 1MIEH 1XF1A 3QCUL 5K1NA 2X4RB 5E6SB 1KGYE 2UX7A 4LKXA 2WYHA 3U48A 4IU3B 3QXTA 4PJIB 4JK0D 4JPVH 1XBDA 3FAXA 5E9NA 4Z7QB 3AY2A 4A38A 4MA3A 2VXSH 4PJCA 1FF5A 3I75B 4PD4J 5F1OB 5ESQB 4W6WB 4OJFH 4ANWA 4DVBA 4LNVA 2CIIA 2FJSA 5IFHH 4X5XA 1ZGLB 3QXAA 3TONA 2RH0A 5AG9A 5HYJD 3L2LA 5F1IB 5FO9A 4ZMAT 2ZCHL 4JJHA 2F58H 3P4MB 4Y2DD 2R7EA 3S6CA 5AUMA 3STZB 2QZQA 4RQQB 1JPFA 3QHFH 3MROA 3NUKA 5F89A 3SPHA 2GEQA 3MUZ1 3NZ8B 1AXSA 2N56A 2PR4L 5LGJA 2DQHH 1OAXL 3QUMH 4P2QE 4JM2B 3U0WL 4FQPA 4FADA 5MENA 1Q0YH 2QELA 3HCVA 2VUKA 1KC5H 3M1OA 4MXVE 3M17A 5C71A 3RGVC 3NSXA 1MLCB 1UUNA 2APTA 5E0QA 4OQ1A 4YDZA 4QF1B 3PP3K 1Y1UA 1RIVL 3DDGA 3KPRE 3IDJB 3CX2A 4X6CB 4CADB 3PNWA 4KH9A 5CBAA 1FORL 3E6FB 4XB3A 2EIDA 4HJSA 2N1TE 1QLEB 3SJVD 2AC0A 1E0OB 2WYIA 2G4EA 4Y19B 1DR9A 3EYFA 5IVNA 2LV4A 5IHZA 4M6AA 4PJDB 3VXSD 3WD5L 4HOWA 2J20A 2VR9A 1RKRA 3DX7A 2GT9A 3UJJL 4E41A 5JOEA 1RK0A 1H6UA 1DL7H 3IJEA 1VA9A 5AL0A 1ZV9A 4WK4B 2COQA 4XOEA 4JO1L 1AHWA 1HOCB 4ODTH 5FYKD 3WOVA 3QPQC 5BQDA 1FE8H 4HPYH 1FNEB 4J3OD 3HUJF 1NGZA 2VM4A 3J2PA 4HU8A 5BZZA 3EBHA 1J8KA 3FKUS 2PO6C 4ORGB 3D3VD 2XPGB 4NKOB 3MRFB 4FQLH 3RDTD 4YIQA 3TO4C 5I19L 3VWKB 1K8IA 4M1CD 2VL5B 1H3PL 4KQ3L 1SBBA 2ZPKL 5K9OA 1Z1WA 3DX8A 1DSYA 2Y2WA 2BS71 5DHMC 4IRSD 4JANA 4ZUVA 4YE4H 4X9GA 4HLZH 3VGBA 3IFLL 1EAPB 4E5XA 5HHPA 1GCYA 4I18A 4ZXBA 3C75A 1CVRA 3BIKA 4JRFA 2EKSB 5E1IA 4TOYH 2JJSC 3DXAE 3FOMB 1S7UB 4GIPD 1RJYB 1KCRL 5EO9A 1EJFA 3DX0A 1A47A 1N0XL 3NFPB 4FQCH 4KROB 4AH2A 2MKLC 1M56B 4OZFH 1PD6A 4QRRD 1BEXA 4WEBH 3IJHB 4HQQH 1OTUC 1X4XA 2ALAA 3F62A 3IBOA 2AJVH 4KY2A 4X4KA 4RISL 2VDPL 2B0SL 4HCRA 2Z35A 3IAQA 5D71H 5JOFB 3UL4A 1C16A 3GK8H 4ONHB 4K5PA 3OSKA 5DQJB 1XMWA 2FEDD 4NO3B 3UIZA 3IJ7A 3V79C 2QSTA 1KBGL 4B50A 3UYRH 1USZA 5EOCL 3HZMB 5I74C 3WG7B 3D39E 2ZP9A 4TF4A 5TE4H 1MHHB 1LO3H 4K3GA 4Y16C 3E3QE 4JBSA 3EYUL 5TTRA 3S7GA 2QQQA 2HLEB 3W82A 5DUPL 3K6SA 2R8SH 1YEDB 3UTZA 2C9QA 5JNYA 4MJIA 1U8JB 4JO5A 5DHVA 3O3EA 3GMMA 4JNXA 5KBMA 3QO0B 4WU5A 5GZND 4DNLA 4F3FB 4BKLB 1A14L 3VQ2C 5J13B 2WBJD 2WLIB 2UXGA 4WSJA 1UWGL 3RWFA 2IBZX 4ODSH 3KM1A 1J87A 5GS0H 2WXIA 1QEWA 1ZJBA 2ZYSA 1KJMB 4O4YL 1QYGH 5GHWL 1JRHL 3QWRA 1FC2D 3RGHA 2CMRL 4WI0A 3QGVA 4JO3L 1U58B 3RWJB 2PCFA 4ZTOH 4DFHA 4EDXA 4ZX5A 4M5ZH 2CXKA 3CMOH 3SGDI 1KJ2A 4B97A 2OKMA 3O6LL 1INDL 4UDTB 5JO5A 4MA7H 1BSIA 5A2AA 2YD4A 5I1CL 1TT6A 5SWZE 1IE5A 4GKNA 4U1JA 4KBPA 2CHDA 5IY5B 2YBGA 4GG6A 1HYRC 3C5ZA 2YC1B 3L48A 4L3ED 1PEZA 1RZ7L 2MFNA 5C0RH 1FGVH 1ETZB 5HHME 4F7MB 3CPUA 1INQB 3QI9B 4MJJA 1KENH 4OB5H 1VFOA 2VRAA 2P5WD 1HH6B 1Y6KR 5T5NG 3SO3B 5C2BH 3WEMA 2J21A 4OGYH 3GWJA 2H0FA 1MFAH 4FNSA 4A6YB 5BNXD 4K7PH 2F54A 4OZFG 2AXJA 3CFEB 3TYFA 1BQLL 3DUSA 1SN5A 4BQ9A 1OGAA 1NTDA 2I85A 4I9XA 4PUBL 1OP3H 1S2EA 3VX0A 3KYOB 3D6GA 2R4RH 1W72H 3NACH 3I3BA 4MAYD 4P07A 4U3SA 2VDPB 3EUDA 3HI1A 2YK1H 5DZNA 4EXPX 1NDTA 3FFCD 1S7XA 4LXFA 5F6HI 2OAAA 4MDJA 1BLIA 1ZS8B 4FNRA 3R7RA 3OB0H 1I85C 1UXWA 4JL1A 4WEMB 4PJFB 4KJYA 1HS6A 1SOXA 4FFWC 5JMRA 4IJTA 4QHLB 5JHBA 2V9QA 3C60C 2ZUWA 4PBXA 4Q9QH 4GAFB 1OZUA 5AKSA 1JZ2A 3TA3A 1T66C 2NUPA 4ADGA 3ARFA 2J44A 3SGKA 2YAFA 1RZJL 4G7QB 4S1QL 2DJ4A 4QOKB 5IEHA 1WO2A 1NC4B 2VLMD 2VN3A 1LTXA 4YDVB 2JI2A 1WICA 3QT2A 4U3HA 4DT2A 2XZQH 2VDLH 3KPNB 3K2MC 4HS8L 5ID0B 4YHYB 2CCLA 2JLPA 4M4PA 3G3LA 3FUMA 1T1WA 2DTML 1HCYA 2ERJC 1J48A 1F86A 2MOVA 1JGDB 4N9GA 4G1EB 4PREB 2OJEA 4ZD3H 2BMKB 4X6BB 1MZYA 3KM2A 2ISDA 1KFGA 1KN4H 3FTWA 1HKFA 1V7ML 4Y8DC 3UAJA 5AZEH 4RWYL 1OP9A 2BP8A 1TU2A 1G6RA 1KIPB 4RFOH 5DGQA 2ARJQ 2NR6D 2XTLA 4J7RA 5J1AB 1JZ8A 5I1EH 1HHJB 4P06A 1A9EA 1NPJA 4OQTL 1E4JA 2JK5A 3NESA 2UY6B 5JXEC 1JTOA 1KYOJ 3M8OL 2AGJH 3QWNA 1AI1H 1PLGH 1RHHA 5EUOA 4HD5A 2NCMA 3SY0A 4ZOAA 5I1LA 4U6VH 2PR9A 1A7PH 1XB8A 2DB8A 4KKCC 4WENB 2NQDA 4FQ2L 2DQMA 4JM4H 1IAIL 2Y5TA 5GGRA 1TEGA 4V1DA 4HWZB 2IDUA 4A2DA 4B9PA 4G8GD 1ND0A 3BAWA 1DBAH 2ROXA 1UWXH 4NZRL 1CGUA 3C87A 4TTGA 3CPLB 4YSOA 4NQUA 1EERB 2OXGB 3CZKA 5EV7A 1MNNA 2GBTA 4M48L 2DEYX 1AMYA 2JJWA 4CSPA 3ROLA 2AJ3B 2N7SA 5JHDA 4PRIB 3KCPA 3NZHH 4B7IA 5CGYD 3L4UA 4XO5A 1KTRL 4KRLB 1ZTMA 1GGTA 4JPWL 4N0YL 1UATA 1L9OA 4NNPL 4MX7B 2OLDA 3GZKA 4G82A 2GUOB 2PP7A 3Q6FB 4O2FB 3ZE0F 5I1IH 5IMMA 1BECA 3F6JA 3QAZC 5HVHB 5DZJA 2IDTA 2BCKA 4LRIC 3PJNA 3MRQB 4GAGL 1XF2B 1SJEA 3H1ZA 1KEGH 5C6TL 2ETWA 2ZXWB 4G9DA 5HPMB 4NCC1 2EDQA 1S7TA 4MQ7B 2X4OB 1MQ8A 4MNHB 4J3WA 4XNUH 1BVKB 4HUVB 4PI2A 5E5MA 1I7TA 4HEPA 4FG6D 4EI5B 3ZU8A 3MRDA 4OD3H 5IMOA 5CFAA 1KV7A 5DMYA 1V8HA 4L2LA 1MJ8H 1YUKB 2XQYA 5DS1A 5D7JC 1QTPA 2OFQA 1H5BA 3ZDYB 2J73A 1TVHA 3QEQE 4OI9A 4F93B 5DC9B 3LVEA 5DJ6B 2VZTA 5EU4B 2IBGA 4NN5C 3I6KB 5F9WB 1HSAA 1GPOH 3B2MA 4POZC 4UQEA 4XCYB 1OARH 3HN5A 1O7VA 1CFSA 5DHYA 5F96L 3TPUA 4Z78B 2SODB 3S35X 3QQ9C 3MBWB 4Q4IA 5EO0A 1EEQA 2BP3A 2VITA 1ZHBA 2A0LC 1CFVL 4HSAC 4XMLL 4PG2A 4LPCA 2YUVA 5HHOE 4QXTA 2DI8A 3TJHD 4H8WH 1BJ1H 2CAKA 3H4HA 5GS0C 3QDJA 3IPBA 3KGRA 3CZGA 4Z8FL 4Z23A 5CIPA 5L88H 3OKYA 4M4RA 1WQVT 2NQ3A 3VI3B 1QI4A 4PJ6A 3WO4B 1C8PA 2P8LB 1K72A 4M56A 2DWSA 3S2CA 1CFTA 1EHXA 1E30A 3BLPX 1EO8H 4P9HL 1BD2D 4CVZB 3KGUA 4I48A 2BRRL 2DH2A 2IDFA 5I1KL 2ZWLT 2ORBL 1ZLEA 1B0IA 1NCDH 3SGEI 1MIML 1N5YH 2JLLA 4YXKH 2R15A 1CDBA 2WQRA 4LAQH 2WSKA 1HJCA 3P69A 1F6AB 3WIHL 1DFBH 4PGJA 3CVHL 4BH8A 4MHHG 3QULA 2BVPA 3VGAC 2R2BB 3M1BB 2IG2H 1T21B 2ITDA 2OYLA 3OF6A 2MNJB 2YZ8A 4HD9A 2R1WA 2W95A 3V6FB 2MH4A 3EFFB 3CLFL 3CFJB 1OT2A 2EADA 3B2VL 4NQQA 4E9LA 1AZCA 4WUUE 1BIHA 2FX7L 4G9FA 1T4KB 1PF3A 3KPSD 3UC2A 1FZMA 4KUCD 3TBSA 1NGPH 4GINA 4EAEA 1JNLL 4POZD 3VXUD 1Q0XL 4I0PA 4DGUA 5CU9A 2Y3NA 4GT0A 3QQDA 3DVIA 2UWEA 5GS2D 3STBA 4RZCB 1W0YT 1FP5A 1GYAA 1MVFA 1P4IH 3HI6H 4DQOH 3IU4L 2BSTB 3N43F 3T8MA 2HH0H 1Y7VA 5FOBA 4JHAH 2BK8A 5AW5B 1CI3M 2EVJA 4EOWL 3BVWA 2A6IB 1MJ7L 2FBOJ 2X4PA 2HLAA 4R3SB 5LWYL 2DLGA 3OPZL 5D8JH 2FWSA 5CHNB 1YDPA 3IWVA 1JZ7A 1L0QA 2OMVA 3L4WA 4E0RB 2FHBA 4A2FA 3HFML 5D2NE 4UT6H 4X9IA 2P5ED 1MFDH 4ZAKB 4L3CB 4PJ9D 3WE6B 4FXGA 1PYWA 3DNKA 4H7VA 3TCXA 1GKOA 3L3HB 4WFEE 5DC4B 7FABL 3QUXD 3HE6A 1W0WB 1HHHB 2XN9D 3H9SE 4ODXB 4JG0H 3N1QC 1DJGA 5LGHL 3GTTA 3QO1A 2R69H 4ZOEA 4BZ1H 2WLYA 2VXTL 1HEHC 1CI5A 3V6ZA 5I1GL 3RA7L 2ZUTA 3ZDXF 5AVTB 5JW3H 1CF8L 4JDVB 2E6QA 3DRTA 4NUMA 2R2CA 5CJOL 4L5FH 3T0EE 2YJQA 1H0DB 3NJGA 1COBA 1EWHA 2A9AA 3O6MH 3UTQA 1NGWB 1T1XA 1DEEA 2BNUB 4XCNA 2Y25A 1NKGA 2LTQC 3ZDZF 1JHLL 4CILA 5T33H 1JZHA 2K45A 2FH6A 3CVHB 1DUZB 4MZRA 3HG1A 4U1GC 2CLZB 5K39B 4RMBA 4MBOA 4KPHL 4AIZB 4NQDD 4B9JA 1HINL 2H32A 4JZJB 1EVTC 2DMCA 2F74B 3FB7B 1CLOL 3CFUA 5A40E 4EUPB 1M57B 4TN9A 1R5VB 1QBLH 2H2SD 4JFDE 1ZANH 4NGHH 3BSZL 4DEPC 4KTYA 4WV1B 4NBYB 5C08D 3T6XA 4LP4A 2DQDL 2Z6FA 2GEEA 2E59A 3BEVB 3L3OC 2VOTA 3W9DA 4B0MM 3WU1A 3D30A 5TDNB 5JR1L 4XWOC 2WSDA 2Y6TE 4Y4HC 2MCPL 3OR7A 4KGJA 4EEEA 1BXXA 1BQRA 2BSED 2J6EA 1T80A 2CDEB 4KKQA 4M3JA 4QHMB 4F15C 3AXLA 3BUYA 2E56A 3P0VH 1MWAH 3O4OB 4YBLB 5GGTA 4KJPC 4XVSL 2EDBA 2XI9A 3WAKA 2R56L 1G43A 1KGIA 4FE9A 1E2ZA 3GBMH 4L4TE 5C0EB 1DBJH 2MQCA 3L16A 3MRPB 4NEHB 1DYZA 4WO4B 5BMFH 1PIGA 4UQDA 3WIIH 2AQ2A 3FU0A 4P4KD 1NDMB 3GXFA 3VA6A 2QKIA 4YSAA 4TSBL 1AHMA 4ICXA 5EFIA 3ZT6A 4CMHB 1IKOP 1CDIA 4ETQA 1SVZA 2NY3B 1E5YA 4LRNH 1HI6A 3DJTA 3MRLA 3WE1A 1JWUB 5IVXA 1A2YB 3DPBA 1S7SB 5I76B 5HD8C 5FM4A 1QFWM 3L3IB 4TLUA 2RIKA 3HUJB 3OSVA 4PWKA 2AJUH 1L6ZA 4QHNB 1R3JA 2MMXA 4KK5D 1PW3A 1ZGLM 4AXWB 1OT4A 1ORQA 2B3RA 4ZPVA 1J5DA 4NWTL 4F37F 4ZUWA 4HV8B 2VLJD 3BYTA 1JZDC 2XKNB 3APMA 3ULSB 2KLSA 2NW2A 4Z7WE 1UCBH 3UO8B 5CLZA 3QG7H 4TQEL 4MZIA 2YD9A 4H8WC 4BA8A 2HTLD 1BEYH 2WWMD 4J27A 4C54A 1OALA 2HXAA 2K0RA 5I16B 1DHKA 3EO9L 2VDOL 2VDRH 1EK3A 4L9LB 1IGTA 2Q2LA 4B9IA 4ZZFA 5BS0E 4FFVC 2YD8A 4HFWB 1Q72L 5HI5C 3IYLW 3WFHB 3EO1B 1J9TA 5LBSH 1T0NB 4Y1AA 5F7LB 2WWKO 4Z7UA 3N41F 3PXLA 4IMLB 3EH5B 4U1HA 5J6GB 4QRQA 4HFUH 2XT1B 4MMYB 3IPFA 1E50A 1MCOH 4BUHA 4M03A 4WI3A 4F9PC 5FYJU 2YGNA 1I3GL 3N44B 3EYVA 2DQFA 1SY6H 3EZJB 4NUQA 1Z6JT 2EO1A 4QAMB 4QXWA 3NJXA 5CZKA 4DTGL 1LEIA 5BUAA 5C09E 3RVTC 5F9OL 3NFNB 4JEGB 4PJBB 4MJ6A 3ARXA 4EXKA 4JFWA 1VGEH 2XSKA 5BRZA 5T1LA 1MWOA 1UWEL 3WTSA 1I7UB 1CG9A 4CMMB 2V7NB 3DROA 3D4CA 4NN6B 5F6HJ 2EC8A 4P2OC 4OGAD 1JNNL 3NCYP 4L1LA 3LKOB 4YPJA 5A43C 4FXKA 3MODH 4Z3GA 2FB4L 5IHLB 3ROOA 3VJ6A 5AAWA 3IFOB 4CC0A 2ZTBA 2Y7LA 1DUYA 5F1KC 1PKQA 4TUJB 2H45A 4GMSL 5DT1H 1RSYA 3CDGB 1RULH 5FO8A 3P11L 3C5JB 1DQQA 1EBAA 1OLZA 3AADB 5CILH 3RTQD 1FL6B 3ARTA 4R26L 2B14A 3EGSA 1KF9B 4B5ZA 2CPCA 2Z92B 3EJCA 2XG4A 5F88B 5FDYA 3G6AA 3QXWA 3LEVL 4H88L 5FYLH 3SJVA 1CYXA 5F7WC 3RFZA 5DSCA 2GC7C 1M9WA 1TTBA 2CGZA 3COOA 4XNZB 2AXFA 3NG5A 4FQXA 4HUWA 3GIZH 4MNQE 3VU1A 2YRLA 5I18H 1OTTC 4RAUB 4OT1L 1AIFA 1HHKB 2VXUH 4LLVA 4XAWL 4ZZKA 2F7QA 1LXMA 4R5XA 3SZ6A 3MCG1 3U1PA 1SEQH 4X99A 1CBVH 5DURB 4OFVA 4F27A 4PHXA 2VDOB 1L3WA 1M6UA 3QBTB 2E4FA 3I6GB 2IH8A 3H3KA 2EE6A 3BZ4A 2JJTA 1JNJA 2HP4A 2P8MB 3RVTD 2EDLA 3C8KA 3FC8A 5IROD 3VFNB 1BZ7B 1H15A 2APFA 4FN0A 1CDHA 4JRYB 4XPGL 4A7QA 2NXZD 5EEWA 2BJMH 3L7EB 3IETB 4G7YH 3DETD 4F33A 3MV01 3R0MA 1K85A 3CZFB 1BXVA 5CM1A 5HSFA 1S8DA 4FI8A 2CKBH 3TNNB 1F1AA 3OWRA 3KLHD 2AK4A 2FYYA 1NC2D 4C4BA 3G08B 1ZVYA 3VTMA 3NRFA 2BFGA 1Y6MR 4LCIL 5EZOH 4D9RE 2EH8L 4AYGA 1M6OA 1CICA 1B9ZA 4BFRA 1U6AH 5EN3A 5FLUA 3MV7B 3RUGE 4XOAA 5F7EH 4A55A 1BQHG 3UDWC 3S5LA 5FUOL 3U25A 2X44D 3NP3A 2W81C 3K2UL 3U4BH 2WB1A 1FCCA 4OF8A 4AUJA 1OANA 1UH4A 2WB7A 4JKWA 3VQMA 1YQVL 1CIUA 2ADFH 2VH5H 2HX8A 4YQXL 2ODIA 3GSUB 3WY4A 3LDBC 1S9WB 4FEIA 2AJSH 4OR1A 1KCWA 4HWBA 3S9DB 5D5MF 3D25B 3S4SA 3VFTA 4LESA 2YEZA 4P59H 4MS8C 4UANA 1IV8A 2PYEB 4ZFFB 4OZHE 3BP7A 4NQTA 4Z7OE 3D9AH 4E41E 5E94A 4AMXA 2RACA 3SDAB 1CDJA 1Y18A 3FCTA 4LHUG 4P23A 1NLDH 1V7NH 1H3XA 4CGUB 2RCSL 1MCCA 5F1NA 2GSIB 4JN1L 3PE9A 1P7QB 2QQLH 4JFEB 2OI9C 3U4EB 2AF2A 4NQEE 4G8AC 3G5ZB 3LIZL 3BO8B 1KB5A 4NLAA 4QRBA 3RZWA 3UG5A 3UBXA 5ICZA 2JTDA 5I71B 1GAFL 4JRXD 3KPMB 3AAZB 4QKTA 5DR5L 4EIBA 5JHLH 2WVUA 3ARBD 4YZWA 3HC2A 3WNMA 5IEKB 4KVCL 1NWOA 4EI6A 1V3MA 4G7RB 1FFOA 2VQ1B 5IB4A 1WEJL 5GIRB 2J8OA 3GHEL 3NFSL 1RZQA 4GKSA 2BOCB 1RUML 2DDQH 3AT8A 4AQAA 2OSWA 5IQ9B 1PIFA 4G6AD 4MD4B 1T89A 4MXVF 1CR9L 1A1OB 1YNTA 3UJIH 3C6SA 4KK9C 1IGYB 1BGXL 3LZFL 4FQQB 4YC2C 4DGWC 3RILA 2QEJA 5AAMA 3BGAA 3FRPB 3DX9A 2QMKA 5LVEA 3DO7B 4YBQC 1KIQA 1EHNA 4QRUB 3SSGA 1ZHLB 3U83A 2P1YA 3CSYB 4NQCD 3CQFA 3HS0A 3NABH 2QGEA 1KBVA 2WPGA 5C0DB 3FONA 4IIQC 1D5BA 3ILQD 4DGYH 4B9KC 3T0AA 1NCWL 3MLZH 1BOYA 5EF0A 4ZNCD 1KYFA 1AZRA 1EDQA 3RY4A 3PP4H 4FQIL 5DD1H 2IBZY 3QFJE 4ZT1A 3QC6X 3QQ4B 2PWDA 4A7SA 3TZVB 4OLZL 1M05A 1FJ1A 1YUHA 4LPUA 4PB9H 3VG0L 2YLHA 4M8RA 3B3IA 5HYJB 5IJVA 4WWKD 3ZE0B 4R96A 4L1DA 3LH8A 4PV8B 4Y2DB 2WLKA 1XCTB 2JIXB 4IBQA 2ZX8A 4QRSA 3VFRA 1AR1D 1EUTA 2FZ3A 2YPVA 1I53A 4TMPA 1PLCA 5IG7B 3EGDA 1QR1A 4K9JA 3PAZA 2YZ1A 3WV0A 3MOAH 1N4XL 2YXFA 3HB3C 1KLGA 5FKAB 2YN5A 5F2FA 1A7QH 1XD0A 5IBLC 2Z7UA 5T1DH 3BQUA 1F4XH 4XP9H 4KV5E 2F0CA 1O5DT 3A22A 2R59A 4PRHD 3AU1A 4BRVA 5GS1B 4N2BA 3QRLA 2HMIC 2BLFA 3IDIB 5J1TC 4JJ5A 2NUTB 5FUZL 3VXSB 5JIQA 3FFDA 3DYPA 4KK9D 4IHBA 1F3DJ 1XMEB 1P1ZA 2GIYA 1D2OA 3T0EC 1KFAH 4J3SA 4LARH 1CGSL 1MI5A 4MMXA 1UYWL 3WS3B 2EO9A 2R2EA 2HLFC 4RMUA 2AEQL 3S5ZA 3KYNB 1J5IA 1NBYB 3S96A 2I5YH 4XNAA 4JFXA 1E3FA 2BP0B 4M8VA 1JPTH 4KI5D 4ZW6A 3D3VB 3IJYA 5HHXH 3RDTB 4D94A 4V33A 2H1LM 2R1XA 1UURA 2NR6A 1PLBA 4P2RD 5IMKB 3II2A 2V9TA 4FQJL 4K15A 4D2NA 4Y5XB 4DN4L 4GQ9H 4NZUL 1AY1L 5CINH 1B0GA 2Y7OA 5JXAL 1YECH 4L8CA 2DPKA 3D5OF 3L95B 5EU6A 5GRVL 4K2UH 2PNDA 4IRSB 4B7LA 3NTCL 2RQEA 1QSEE 4E9RA 2E7LA 4ELMB 2SEBA 1A0QH 3HE7C 3ZHLA 4EZLA 3KR3L 3V4UH 1UEYA 4PP1D 5K69A 3SDCD 4AVKA 1ZOXA 4LAJH 3IRPX 1XV8A 1E27B 5LKNA 5KYYB 1E8ZA 1OPGL 2AV1B 2FGWL 1SGKA 4P0DA 2VZ1A 2EYRB 4R8WH 4JW3A 3KBPA 3GTVA 1AQDA 5IESH 2VKXA 2QQKH 1MAJA 1TPXB 1W91A 4EBQL 4QRRB 3FQRB 5ABDE 4OTXH 3JTSB 5IQOA 1UKSA 3SPJA 4HIXH 4X7TB 1RV6X 3R8BB 1NA8A 2F53B 4DO4A 1BQ5A 3F6IA 2VISA 1XGTB 2ZUSA 5E2TL 4BFJA 5D1XC 1OAKL 3NIDB 4DH2A 2N01B 5CJXC 1LP9E 4D3CH 3ARPA 3SPIA 4UWQB 3C08H 3QXVA 4OM1L 1A4KB 3VSTA 3TM6A 3V10A 1OSEA 2BO0A 4LK4A 15C8H 4H4NA 4PWHA 4YHZH 1EZSA 3B4NA 2CJSA 1EMTH 1MF2H 3MJ9L 4J6IA 4XRCA 3D0AA 5AVRB 1Z9PA 1GJWA 3M45A 4X9BA 5F0JB 3T4AB 1GA2A 3AY4A 1IAIM 4L0PB 3KYMB 4UIMA 2VCOA 4I13B 1JXGA 1VACB 3OQ3B 4QIRA 5IFAH 1KPRB 4JUSA 5IV2B 1FGNL 1PZSA 3QH3B 2ENQA 1J0JA 1RJLA 3QA3B 2HT4C 3OJDA 5FYLD 5BQ7A 4LHUD 1RZ8B 2XOTA 3N1FC 3MLSH 4WGVB 2JB6B 2NX5D 4D0DB 5IBUB 3N1GC 4ZMXA 3REWA 1FIGH 2WBJB 3OG4B 3I75A 2BSRA 3BN3B 3VCLA 3U6XS 5E99H 4LCWB 3DKHA 5B1KA 1OF0A 3FO0L 4WFHD 5DJCB 3QE5A 1WAPA 2M1KA 2P45B 5FYJE 1JF5A 4R4ND 1JDCA 4MQXC 4BJLA 4NQVA 3GYRA 2DBLL 2VDMH 4YR6B 3T5WA 3RVVC 4JG1H 1XVSA 2JTYA 3NZ8A 3SBWA 2ZE0A 3KNBA 5EU3A 1KPUB 3U46B 4W4OA 4PCYA 1XO8A 3P02A 3FUDA 3CC5B 4O2EB 5E5LA 2PW2B 4KTEH 4ZDHB 3A6BL 3CDZA 4X6DF 1X5HA 2EDFA 3T0VA 3FHEA 4GBXC 2Y36L 1G9MH 4XXCC 1J5HA 2QDWA 2E75C 4L3EB 5CEXB 1MIEL 4JO8A 4BUGA 1SJMA 1OB1A 3NGBC 5I8OH 2G5BB 3DV6B 3O2VH 5KSVA 3V5HA 1NINA 3L3GA 4YPGA 1WCBA 3VB8A 1F6FB 2CBQA 3ESNA 2P5WB 1XD1A 3KH4A 4NDMB 4JPVL 4OU3A 5F7MC 1E9PB 5KAQF 1Q90A 3E6FA 1KYOK 3V0WH 2DWTA 2EEFA 5AEAA 2L04A 5KOMC 1NL0H 3O8XC 1H8LA 4XO3A 2YOAA 4JKMA 3GJFK 1AGDA 4NNYA 3UZVA 1CVSC 2X89D 2VXSL 3K4DA 4NPYA 1LK3H 3FCBA 5ALCH 1EGJA 4QGTA 1BZ8A 1S9VA 4KNUA 4OJFL 5JQHC 2YBRB 3BVDB 4N3TA 5ESVB 5IFHL 4OZIA 4Y16B 5JLZB 4MAYB 2X3CA 5JPNA 4AVHA 1J0KA 1QSFD 2F58L 3ECBB 1FNEA 4WU7A 5AZUA 3FFCB 5EZLA 1BJMA 5K9KA 3FRUB 1XT5A 3QHFL 1H8NA 5LCVA 4PWJA 2QGDA 2NW3B 1PFCA 3Q1SH 2VN4A 4JMNA 1FBIH 2IOMA 3VWKA 4H25B 2DQHL 4KU1A 3QUML 5D7IA 3LQZA 1Q0YL 3QDGE 1EXUB 1KC5L 4WNJA 5CFHA 3SDDC 1M7IB 4HK0B 4N0CC 3PHQA 3P77B 1G9NH 1TSHA 4S11A 2BWDA 5DQ9B 3T0DA 1TZGH 1Z5LB 1XSKA 2YN3A 2GY7B 3HS8A 5FLVA 3Q13A 1K4DA 4CW1A 5J7CC 5TFSL 2C9AA 1ZGLP 1EAPA 2ESVD 3T2PA 1HE7A 1JHTB 4ZMLA 3QIUA 4XPTH 3T71A 4AEHH 4PJHE 1EPFA 2EKSA 3L1GA 2YXWA 1F56A 1NCCH 4OUUB 1T20B 4RDQG 1RJYA 3V9EA 4JFQB 4BK8A 1DL7L 2ZCKH 5E00B 1IBDA 4NAMA 5DO2D 2FRGP 4ODTL 5CCJA 1FE8L 4HPYL 4YHNA 3SE6A 1KPVA 4OCWH 5C0AE 5ITBH 3TEZA 1XXDC 3ZZLA 5C9JB 2A9CA 3CSGA 3TIEB 3UTSE 5E9DD 2N59A 4FQLL 2B1HH 5AD0A 5JOFA 4CKVX 5BW7C 3ZR6A 5B1BB 4IDLA 5DQJA 4PJEA 3MJ6A 2DYPA 5D1ZC 3PWPA 4MBRA 4MVBC 1EJ6A 1YPZB 4HIEA 2BIHA 3WN5B 2QV2A 4JFPA 2WLNA 5FX3A 3JXAA 3TH2T 2EXSA 1T2XA 1MHHA 3BPCA 4HG4J 3GJEA 5CJQH 5I66A 2VZSA 3MRGB 1Q9OA 3MX0B 3OX8B 5DEGB 3QZWG 1E6JH 4QRPA 3MRCA 4G8GB 4RBPK 5EC2A 2NSMA 3QUZA 4TOYL 3UAFA 1SBSH 4LLDB 3WUWG 3NQIA 4F3FA 3K1DA 4FQCL 3N41B 4YX2H 3VU2A 3EH4B 3PQYD 5DD0H 3U7AA 3TASA 4RIRB 4WEBL 5CSBA 1QP1A 4HQQL 4ABVA 4MNGA 5FV2A 5D1QC 5KUMA 2AJVL 2H2PC 4FA8A 5DLLA 2O5NA 3M7OA 1IC5H 1B0RB 1YY8B 2EECA 4Z7VB 1J0HA 1LO5B 3VXRE 5IHBA 5GGVH 1DCLA 2FL5B 5D71L 4ALAH 4I85A 3GK8L 4PVMA 4K23H 3BWAA 4FTVE 4UDTA 2J1YA 1YEKH 5KS9B 3TF4A 1BVOA 4Z77B 4EN3A 3ALXA 3QARA 1ZHNB 4XCFH 2ZWSA 5B21A 3UYRL 2VIRA 4FA7B 3JYCA 3QEHA 4TUOB 4BIKA 5TE4L 4M8QA 1LO3L 5E2VH 4YFDB 2X09A 4XCCH 1INQA 1NCBH 3P9WB 1TNNA 2GW5A 3QIBD 4J3TA 3N04A 2YQGA 2JKWA 1XF3A 3PABB 5D1ZD 3ML9A 2VERN 3W0WE 5H37A 4B60A 5C07D 3ZMEA 1VLXA 4ODSL 4AE1A 5GS0L 2VWEE 1WSST 5E2WH 2NMSA 5SV3A 2WINB 5I0YA 1JFHA 1QYGL 3KYOA 4MSWB 4XZ4A 2FGZA 4ZTOL 4YDLB 2VW6A 2F1AA 4M5ZL 3CMOL 4GW1B 2DWYA 4L2YA 1ZS8A 1TIUA 3MFGB 4MA7L 5LNGA 1J8HB 3P2TA 3D0VA 1SJHA 5LNDA 1LVEA 3K2IA 5IJBC 2H7WA 3BDXA 2VR8A 3FHAA 4AIXA 1KBKA 1KCSH 1YNKH 3ESUF 5D1QD 1WWBX 3D05A 5LJYH 3JSSA 1FGVL 2BRQA 2F6AA 4Q2ZB 1HEZB 4O2CB 3MAWA 4DWHA 4WVRA 1KENL 3QRGH 4OB5L 5LAXA 3RP1A 5C2BL 2G0KA 1SOSA 4OGYL 5HDBB 3BP6B 3UGXA 3G6DH 1AMXA 1MFAL 1BD2B 1J9SA 3HG1E 4GLRH 3KPNA 4K7PL 3FQTA 2FIRT 3P2DA 3MU3A 3SPVA 4OZFB 5IJKA 5IF0B 3IAGC 3W5NA 2CUIA 4XO8A 3JWNE 4N2CA 1UD2A 1G9MC 2W65B 5HDLA 2YA1A 1LD9B 4PREA 4TLTA 2RAMA 2EILB 1W72L 2R4RL 2ZOKB 3FUNA 3NACL 3W81A 5J6HB 5BXFB 2YK1L 3OAUH 1NJ9B 3NSJA 5GRWA 2WGNB 3ZZSA 1WF5A 4JFFE 4YDJB 2AW2A 1QW9A 1JNHB 4WJ5B 1Q9WA 2V17H 3ARDD 3MJ7B 1DQLH 4AK1A 1HHJA 3WELA 5F70A 5D7JB 2YGPA 3HPJB 3V0DA 1T0OA 1BM3H 1SF5A 3KPSB 4Q9QL 4A68A 3KYAA 1ECYA 1FWXA 5KG9A 3TVMA 3VXUB 4BELD 4PLJC 5E6YA 2VDQH 1OW0A 1R3KA 4GH7B 4Q6IB 2Z91B 2P7TB 1CUOA 4EJ1C 5E6ZA 2XZQL 1E8XA 2AXGB 2VDLL 4P3CH 2ADIA 2B9BA 2OYPA 2YD0A 5D5MB 3K71B 3ZKQD 3IU3B 1D9KD 1VADB 2N3JA 3MRKB 4NM8H 2YEQA 3FSOA 5L4MA 3BD4A 1G0YR 1G9NC 4YL4A 3KPQB 2GITA 4ZD3L 2E5EA 5DDHA 1A65A 3VFSB 1KN4L 2GIMA 3VE0A 4WW1B 4UDUB 5AZEL 4Y8AA 1PSKH 4RFOL 3RZCC 4JGMA 1ZT4B 3S36X 4AKQA 2BNRB 3DMMC 4F57H 2E9GA 2P5EB 3B56A 4PJ9B 2WQAA 3VFGL 3MDJA 3RTQA 1E7UA 1FSKC 3KGSA 3LQMA 4LCYB 5FA4A 3QUXB 2AGJL 1OP5K 1AI1L 1PLGL 3GB7B 3EYSH 3QCVH 3F7LA 5I6XB 4U6VL 4AYFB 2R27A 1A7PL 4XMKH 2ZX7A 2ICEB 3KJ4C 4XHJD 3MNZA 5HPMA 1ECZA 5IUCA 5IP4A 2EE2A 3RQ3A 4P2QB 4JM4L 2B3IA 4MQ7A 4ZRGA 1CD8A 4K5OA 43CAA 3BXNB 5ENWA 4MCYB 2ZKXA 1IRAY 1IC0A 2A2QT 3UX9B 5HI4C 2JJVA 1DBAL 5JIDA 1UGNA 2JELH 3KPRB 3VM5A 3GMLB 4L8BB 1M7XA 2HFEB 1PX8A 2WLJA 1X7QB 1W72B 1D7BA 3HIZA 1U4EA 4S2SB 3VDAA 2OMWB 3BD5A 5DJ6A 2VE6B 2Z93B 1OV8A 8FABB 1TQVA 3I6SA 3NZHL 1HQRA 4NQDB 2C5DC 3H42H 2VC2B 3IXAB 1MRFH 3U4AA 3VFVB 5DK0B 2MOQA 1SLXA 2VLKA 3ZHFA 4OQTA 1BMWA 1SXNA 4L1HA 1AKJD 1KGJA 1MCRA 5I1IL 1R3HA 1U8OA 3TBCA 3GBLA 5C08B 1I8IB 2G75A 3ISRA 4I7ZC 2EIBA 3DTDA 2WQVA 4LLWB 4QMEA 1KEGL 1N8ZA 2WVVB 3EBIA 5HDOA 2XX0A 4PW3A 4NC0B 4ZW3A 3O6FC 1NBVH 4V2CB 2QR0B 1G7JA 4H2CA 3KLDA 5ICYB 1TTFA 3NRPA 3V4LA 3D1MC 1AGFA 4XNUL 5AVSB 4ALAC 4Z7WF 1MZZA 2G3ZA 4N2LA 2AEIT 1FH5H 2MQGA 2DQGH 5TDOA 4OD3L 2N0MA 4HS3A 3SQBB 1PQZA 5I5JA 4MMZB 2IGFH 1MJ8L 1KOAA 4Y4FD 4YHMH 4F37K 1HT6A 3BJ91 5DUMH 4P4KB 5AOZA 5JW5B 3LEYH 1UD6A 4AKPA 4R83A 1GPOL 3PWJB 2YMXH 4YS4A 1OARL 4I2XA 4PIRF 1ZA6A 5AYTA 2M26A 2BWIA 2QPFA 1T21A 3VFMA 1DBMH 1Z5HA 2R4SH 3RL1A 3QS2A 3CLWA 1HKLL 4H8WL 5ADOH 3CFJA 3DSNB 1KZYA 3ZY7A 2QL1A 3BPOC 1H9DA 2CE6A 1VENA 1T4KA 5IWLA 2BIQA 3D85A 5L88L 1UWFA 4LP5A 4JRXA 1ZVSA 2NTSP 4WNQB 1DFXA 3G9AB 3OKLB 4LVHC 4NXSA 1B88A 2VLJB 3PPSA 1AFVL 1JD7A 2QV4A 1EO8L 1IQDB 2WAHA 2WLMA 4DEPB 2BY3A 2G2RA 1BAGA 2BSTA 5D6CB 1FYTA 3C6LC 4K7PX 2VMFA 1SFDA 1ZY9A 1NCDL 3A0OA 2Q0ZX 3VD3A 2C4FT 3VFWA 1N5YL 4JREC 4YXKL 2FNWA 3PL6C 5BVJB 3LKQB 2EC9U 4LAQL 1W9XA 5EWIH 1PPIA 1PEWA 2DN7A 2FQFA 1JK9B 1DFBL 4ISVB 4NUPA 5GGQH 1IQWH 3ZE2E 1MHEA 2JKSA 2YSTA 1T5WB 3L13A 2IG2L 2X2JA 2XWTB 3SPGA 3WS6A 4F7CB 1DJHA 4PJ7A 5HHVH 1MEXH 4GLRI 3DPDA 3JTBA 3WNNA 1R3IH 3S3BB 4P5MB 2EEAA 4PJ8C 1MVUA 3BMWA 3KEDA 4WI6A 4JQVC 5MEPB 2VDNH 3TA4D 3CN0A 1HHHA 5CP3H 4XXDA 4OFPA 4ODXA 1NGPL 5SWSA 3LN5B 4WHYH 5C0BD 1WS8A 2L3BA 4KNSA 4MD5B 2APWA 4ANVA 5BUPA 1P4IL 3HI6L 4LMQE 2N4IA 4HH9B 2EDOA 4IOIA 5KBLA 2F9BT 1H0DA 3SE9L 5E1GA 1CE6B 1WZAA 4JHAL 2VW7A 5ESAA 5HHMB 3T3PE 4DN3H 5J12B 2AV7A 3MO1B 2X2IA 3DJ9A 5ECGA 2M83A 5D8JL 3VFUB 3CVHA 2Z4QA 3FJTA 1WLHA 3AREC 2CLZA 4MCZA 3KWTA 2GJ6D 2F74A 3WL9A 4YLCA 1W15A 1UWYA 3GKZA 4LLUA 4UT6L 3GSNH 3ZE1B 1MFDL 3C6LD 1N26A 1DVTA 1OQOA 5JW4M 1PMYA 3QZBA 3O3DA 3FB8B 5ANME 1U8HB 5DFVD 1QA9B 1R6VA 2WIMA 4W81A 1MY7A 1A3LH 3BEVA 3PFQA 2YA0A 4JG0L 3U36A 3EAKA 3FQWB 2R69L 3NSCA 5FOJA 4BZ1L 3EO0B 1NCGA 4AK2A 2PLTA 4LSDA 5CBEA 2GQHA 3AFLA 2GHWB 1YMME 1GVIA 1JZ4A 3D09A 4BGDA 5JW3L 2VL4A 4JFYB 1MRCH 3CK0L 2WBKA 3O4LA 3BZ5A 4LSQH 5HY9B 3L9YA 1NCJA 3CFMA 3WJLA 4L5FL 4DESA 4OD1H 5ERWB 5KYWA 3O6ML 4X6DB 4RAHA 1DVFA 4OUOA 2J5LB 5AWNH 2HWZH 4N8VG 1IFGA 2RBLA 1UG9A 1RZKC 5T33L 4MXQD 4WO4A 2DQJH 4CVUA 1MDTA 4OZHF 3BKCH 5LDUA 4Z7OF 5E95B 2HKHL 2NXZB 2FDBP 5DGRA 4WDIB 4L3AA 5HHQA 3BPLC 5C0GA 4MZ2A 4J1UB 3EOBA 1QBLL 3LB6C 2EH7H 4X4YA 1ZANL 4NGHL 1JJUA 2Q5BA 4HBQA 4P5KA 2IQ9H 1A2YA 2ZOLA 3PUUA 1S7SA 4RAVA 4NAJA 1FVEA 4WHYG 4UU9B 4ABUA 3HVNA 4JFUA 4Y2LA 4WJG3 3L3IA 2D9QB 3CFDB 3HPLB 4X80H 3KXFE 4HUUB 4FJYA 5ACZB 3MNVB 1U92B 1X5MA 2ZKMX 3S88H 5AL8A 2JMRA 3E0GA 4KTDH 1M71B 1VDGA 1WBYB 1KT2A 2JJUA 3FF8A 3P0VL 1MWAL 1FV1B 4C83A 2Z31A 5TPWH 2HPOA 3SKOA 3U0TA 1KXVA 3ULSA 4PR5B 2VWEC 1XB3A 2YD7A 4M5YH 3GBML 4IHOB 3NPSC 2VLLA 3LNIA 5H35B 4BE5A 1DBJL 3FYEB 3OHXC 3KAAA 1PD0A 5BMFL 4ANXA 2JXMA 4LSUH 3KPPA 5FO7B 3WIIL 4MD0B 3MRIA 2X4UB 3ZKMD 4ZMZA 4LASH 3CHSA 2Y5QA 4C56B 5E6ID 3WLWD 4OLEA 5D4JA 4LRNL 1M1XB 1ROWA 4AVIA 2BC4B 4OCMC 5J6GA 2WXJA 4UT9H 1NCNA 2Z0UA 4JRWA 1NEZG 3DSFH 5EC1B 1C5BH 5CSZB 5C0ND 3SOBH 2XVBA 1Q9KB 5DJAB 3MUJA 5EEZA 3VI4E 4XPHH 1OP3K 4HGKC 1XH3B 3T0XA 5DUBB 3KPTA 2AJUL 3L2MA 4PJAB 2ZYHA 5B39G 3TU6A 4ZNEE 4LHJB 1MJUH 4FQHA 4NZJA