1BQRA

Reduced pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bqrA00
5B1JC 2YAEA 3NSYA 2J5WA 3H56A 2VM4A 1SHWA 1GR7A 3H4FA 1AACA 4YSSA 2BZCA 3ABGA 3FQYA 2W8CA 1M57B 2PCFA 2VM3A 4FA7B 3D12B 1KCBA 3AY2A 3FQ1A 1TU2A 2GSMB 1AZBA 3FSWA 4RH4A 2BP0B 1PNDA 2CALA 3PAVA 3QJQB 3S8GB 3AW5A 4MFHA 1NINA 3GYRA 4KO7A 1DYZA 3JTBA 3KW7A 1HFUA 4BDVB 4KNTA 4YL4A 3QJRB 1M56B 3CDZA 2FWLB 3S3BB 2W88A 4AKQA 4AZUA 3IEAA 1ILSA 3N55A 1AG6A 1ID2A 2PP9A 2HX7A 2QPDB 2ZONA 2J55A 2QDWA 3ABKB 4YVNA 1SDDB 4CSZA 1A3ZA 3ABMB 4A2GA 7PAZA 1PCSA 1PLCA 1WA2X 2I7SA 3NJMA 5I28A 5I6LA 3OMNB 1BQKA 1SF5A 1A4BA 1W6WA 1HAWA 1JVOA 5ANHA 2DY2A 3NJGA 8PAZA 4ZK8A 1W6LA 2BHFA 1GYCA 1YLBB 2ZWNA 4G7QB 4YSAA 1QHQA 5F7AA 4DP9X 3QJSB 3NJFA 3T6ZA 1E65A 2FNWA 2LLNA 4DP2X 1ET8A 3BVDB 4P5SA 4E9XA 1QNIA 2GI0A 1EZLA 4G70B 3PAUA 4BWWA 2HX8A 2YAQA 2R7EA 1WS7A 1FA4A 4GYBA 4A66A 4YSQA 4A68A 3FS9A 2XX0A 3NJIA 4M4RB 2IDFA 1FWXA 1J9TA 5AZUA 2X88A 2DYRB 3G5WA 3NYKA 1L9QA 3ZBMA 1JZEA 2HRGA 2WO3B 1WS8A 2UXVA 1B3IA 2FT6A 1OCRB 2FTAA 4TXVB 3T71A 1IKOP 1GW0A 2JXMA 5B7FA 1T5KA 5I5JA 4WTQA 4AX3A 3IN0A 2IH8A 2E86A 2XYBA 2HZHA 2GC7C 2XX1A 3PAZA 2I7OA 1W8EA 3KW8A 3NSFA 5LDUA 2XWZA 4KO5A 3X1EA 2Q5BA 1JXDA 1PY0A 1X9RA 3HB3B 1JZGA 1OE2A 4AI7A 1VLXA 5I6OA 5B1BB 4E9SA 5I6NA 1X9UA 4N8UA 4YSPA 5I6PA 4CSPA 4E9WA 2X87A 1AG0A 1JZIA 3NP4A 1OCOB 1XB3A 2NRDA 2H3XC 3S3DB 2GC4C 3IE9A 1SNRA 1IBYA 4HAKA 1BYPA 1AZCA 4M3HA 4BDVA 1AOZA 4Q8BA 3SBQA 1KYAA 1KCWA 3CVBA 2BZ7A 2HRHA 4YSDA 3UAEA 4EF3A 2IAAC 3ABLB 4KOCA 3UACA 1ILUA 2PP7A 1ZIAA 4P5RA 4DP1X 1JERA 1OE3A 4UAHA 2B3IA 4K9JA 1GSKA 1BQ5A 1V54B 5EHFA 4A2EA 1SDDA 1AZNA 1NPJA 1RZQA 4A2HA 3OD3A 1E30A 1QLEB 2DWSA 3X1NA 4HZ1A 3PCYA 1OCCB 1OF0A 1A4AA 3MBWB 1CUOA 2IDQA 1ADWA 5B7EA 3T6XA 2AANA 2MTAA 4GY4A 3TASA 2UX6A 1WAEA 2CBPA 1TEGA 4F2FA 4BWUA 2OCCB 2IH9A 3NJLA 4YSCA 2CCWA 2BW5A 3NJJA 2JKWA 2PPCA 1OOWA 1J9QA 3T6VA 2XV2A 2PPEA 3NSCA 1SHXA 2UXFA 1AZUA 2YAMA 2YXWA 3CVDA 3QJTB 2A3TA 4E9TA 2CUAA 1JZJA 1SF3A 1AZRA 1CURA 3FU7B 1MG2C 1SFHA 4NB7A 1ET5A 1SFDA 1R1CA 3FSZA 3AG1B 1MDAA 2VW6A 2J57A 4GP4B 4YSOA 2H47C 1NTDA 4L0PB 5PAZA 4NAJA 2Q9OA 4HHGA 4HALA 4BK5C 1E5YA 5F7BA 4DPBX 1GS7A 5B7MA 1TKWA 1N70A 2YAFA 2XU9A 1PZAA 1RKRA 2XXGA 3WNIA 4A2DA 4DP0X 1V10A 1AQ8A 5I6KA 1PZBA 1L9PA 4AKPA 3UABA 6PCYA 1NWOA 3FU8A 4AKOA 1URIA 1NPNA 4GP8B 4UANA 4HCGA 2PPDA 2BWDA 4G7SB 1BXAA 4HIPA 4JHUA 4DP8X 2IDUA 4GP5B 1KGYE 2WO2B 3NJHA 4JHVA 2AZAA 2IDSA 3EH4B 2FQFA 2BWIA 5E9NA 2OV0A 1PNCA 4W1TA 1E5ZA 5B1KA 1BYOA 3WKQA 4DP5X 3X1GA 2EIJB 3H4HA 1XB8A 2P80A 4HCFA 4QLWA 2BP8B 1AS7A 2YARA 4FAAB 4KNUA 5TK2A 2ZXWB 2AZUA 3CVCA 1J9RA 4DP6X 2OJ1A 3EH3B 3IBOA 2FQDA 2YAPA 1PF3A 2DYSB 2H5UA 1A65A 1JVLA 4X4KA 4BXSV 2PCYA 2TSBA 3X1BA 3N2JA 1CC3A 1NIBA 1NICA 5D4IA 3TU6A 1AAJA 2BO0A 4BXVA 2TSAA 4HHWA 3V9CA 1F56A 1KDJA 2BP0A 3UAAA 2Y1AA 1NIDA 3GDCA 2UXGA 4YVUA 2IWKA 1OE1A 1BXUA 2HLEB 3CZUB 1L9TA 1JXFA 1M9WA 1ASPA 1PLBA 1J5DA 2QDVA 3AG4B 2I85A 2VN3A 3FPYA 2XXFA 2FQGA 1AS6A 3BQVA 2AVFA 2GIMA 2XUWA 2HXAA 3EHBB 1WA0X 4HCIA 2MRYA 2QT6A 4Q89A 3S8FB 3FU7A 3L45A 1NWPA 3EH5B 2IWFA 2YAHA 4UF7C 3FSVA 4ENZA 2VW4A 3NJNA 1A8ZA 1XMEB 1ZIBA 3QJVB 1IC0A 1PAZA 3WNJA 4F2EA 3ASNB 3PPSA 1AANA 3X2QB 3IN2A 4N4YB 4G72B 7PCYA 5A7EA 4KO6A 3HEIB 1BEXA 2Y69B 4YSRA 1TEFA 2CJ3A 1A4CA 2DWTA 1IUZA 2EIMB 4PAZA 3FYIB 5I6MA 3UADA 1WA1X 3C75A 1DZ0A 1PZCA 3RYMA 5IY5B 2B08A 4E9QA 2PLTA 3ZIYA 1L9OA 4A2FA 2VMJA 1JXGA 2BW4A 3SQRA 3NP3A 4E9RA 3AG2B 1GS6X 4KO9A 2RACA 4YSTA 1MZZA 6PAZA 3ZDWA 1ZDSA 3QPKA 5FC9A 2PPAA 2J56A 5TK4A 4E9YA 2BP8A 3OM3B 1I53A 2PPFA 2PP8A 2YXVA 3DKHA 3FYEB 1UATA 1JZFA 1NIFA 1N68A 2EILB 3FT0A 5B1JA 3S3CB 1ASOA 1GS8A 1PLAA 4A67A 1ETJA 1CYWA 4W9ZA 3TBBA 1E67A 5I5MA 1V55B 2XVBA 1FFTB 3DIVA 2EIKB 1AR1B 1KDIA 1ET7A 3FQ2A 3QQXA 2QPEB 2GBAA 3DTUB 1BQRA 1KBWA 4PCYA 2FQEA 1NIAA 2XV0A 3OMIB 3T9WA 5D4JA 3X1FA 3ERXA 3CDZB 1JOIA 5B3SB 3OMAB 1L9RA 1OV8A 2GHZA 2HX9A 1NIEA 3NJKA 3WI9A 3ZX1A 1NZRA 1KBVA 3NSDA 4F7KA 2CAKA 3CG8A 1BXVA 2YQBA 1IBZA 2IDTA 4YSUA 1ZV2A 3EF4A 3NT0A 2VSKB 3GXUB 1CYXA 3U25A 3TA4D 1MG3C 2VW7A 3FSAA 4JKNA 4G7RB 5D4HA 4GXFA 3FU9A 2N0MA 1BAWA 3PXLA 4DP7X 1L9SA 5I26A 3ASOB 3AZUA 3TBCA 4DPAX 1NDTA 4KNSA 3SBRA 1J5CA 2XLLA 3AG3B 1AIZA 2FJSA 4E9VA 3OQRA 1ASQA 4KOBA 4G71B 1PMYA 4YSEA 4DP4X 4DPCX 2XV3A 5I5IA 1KV7A 2FT7A 4BWTA 1JZHA 2P80D 4WKXA 3WG7B 1AS8A 1SJMA 2YAOA 3JT2A 1XB6A 2EINB 2GB2A 2IWEA 2UX7A 3T6WA 1EHKB 1HAUA 4NERA 2FT8A 2R7EB 1RZPA 1RCYA 3QJUB 2VSMB 1J9SA 1MZYA 1ZPUA 3MX0B 5PCYA 3UGEA 3WIAA 2JFCA 2AFNA 1OCZB 1GY1A 3SBPA 3PLYA 1ZDQA 3WKPA 2DV6A 2WSDA 2UXTA 1GY2A 5AKRA 3FPXA 2ZOOA 9PCYA 3V9EA 4QKTA 5AFAA 5B1AB
chains in the Genus database with same CATH superfamily
4M3KB 1DBAH 2DQEL 4E42B 2OSLA 2K8MA 5TQ2H 1E28A 2DKMA 3BIBX 3C2AH 4PJDE 3ELQA 1CGUA 5LQBH 2QVFB 1ZAGA 1X5GA 3I85A 1SXAA 1ZT7A 4HCRL 4MQXD 1UKQA 2VM3A 1LDSA 3FHAA 4FQCH 4WHYH 4LSDA 3IMRA 5CKGA 2BOBA 3J2PA 4BZ2A 3RVXC 4UU9B 1NC4D 4QT5B 2UYLB 5DJXB 2P8PA 1H9VA 4W9DC 3TO4C 2VITA 2HKHL 3SSGA 5HHQB 5DLML 3HMWH 2WVVA 4WUKL 5HYSB 3LV3B 1RK0B 2DYPA 3ECQA 5DZVA 5ID1B 2P7TA 1DO5A 3UMNA 1UXSA 4FQXA 4MDIA 2XACC 4ZMQA 3MLUH 4GFXA 1LD9A 2Z91A 4OZ4B 4U1KA 4PJEA 4ZMWA 4Y1AD 1GZHA 2QKIC 3QP3A 5D7LA 2X6BA 5ECJE 3GK8L 2VLJB 4P2RA 1H8NA 4Z0XB 5KYYB 1HNFA 2J71A 2Q20A 2J8HA 2H6PA 1AVAA 1FVCB 1A3ZA 3FQRB 4P2OC 4WUUD 1WIOA 4ONGL 4A2GA 4MXWL 3RKDD 5B8CC 3NJMA 5A2FA 3NZ8B 2G4GA 4AEFA 4GRWH 5IB4B 1KGCE 1HI6B 3L5HA 1KOAA 4BGLA 3HG2A 1JVOA 3BKCH 5JIIA 4HWEL 1KTKE 3NJGA 4OLXL 3ULUD 5T3XL 3WTWA 1HJBC 2OAAA 3HFMH 4PJ8C 4QHNB 3MLWL 4HC1A 2EIDA 4YDKH 4DP9X 4M56A 5FA3A 4KKBD 5HHOA 4HJEA 2BNQB 3OXRB 4XN1A 5GIRB 4FI7A 3NTCL 1T20A 2AV1B 1XGPA 3OWEA 1MUJB 4EQ3A 1DBJH 2ENJA 3BCFA 3C87A 2F1EA 1NKGA 3OKMA 4IGBD 3SOTA 2I5YH 3CFKA 5I15L 3WFBH 1NCJA 2IBGA 2ED7A 4PHXA 3MXVL 5GS0D 2AEPH 1WITA 2X9XA 4I18B 3VRJA 4QJ5B 1MIMH 1EJFA 4Y5YB 4X6DF 3UTSE 3IXAA 3ENEA 4RA3A 5CWSA 3W39B 5FYLE 2WUBL 3KYOA 1BX2A 1B0WA 4P9HC 4UV4H 1TG8A 3HG0A 5DJCB 5IWLC 2A74B 3V0DA 2ZCZA 2V3DA 5KS9B 1IC1A 1ETZA 4E42A 1H3GA 2Y24A 4Q14A 3NSFA 2EEAA 4OB5L 4UBDC 5DD6B 4A7TA 1A7NL 3CWGA 4H88L 1HS6A 1E6OH 1ULVA 1MWAB 4PRNB 3TJPA 2PABA 2OMNA 2XA3A 5J8OA 2NSMA 4UU9A 4Y2LA 5C09E 3Q3GB 2ZAGA 4TV3A 2UYLA 5DJXA 1XB3A 4X7DC 4DKEH 5KVEL 2HT2D 3B2VH 4PW9A 2PR9A 3ULUL 3FCBA 4JN1L 4BQCA 5HHQA 5MEOB 5CFHA 3J8F7 2Z6FA 2A77H 5HYSA 3LV3A 3SY0B 4Z7VE 4GAGH 4YQXH 1RK0A 5EIIG 2PCPB 3QYNA 5ID1A 3CVBA 2BZ7A 2XRAL 1NGXB 4NENB 4OZ4A 3L7FB 3NIGB 3QUGA 3V79C 1E3ZA 2V7HB 2R0KH 4DP1X 4JFDE 2VLJA 3SYOA 4Z0XA 1J1XL 5KYYA 4HOMA 1FVCA 1PEWA 2WBKA 1QPPA 3GSNA 2EQDA 3NZ8A 3KPRE 2ZKYA 5IB4A 1R3JB 1MJUH 1S7TB 1HI6A 3COOA 1MLBB 3A3YB 3E2HC 4ENED 5GS0L 1HYSC 4QHNA 5TDNB 2J6WA 5LB1A 4L9LB 5LAXB 1M3IA 3V4VL 1NGPL 4YSCA 1J8KA 3JUZA 2BNQA 5GPRA 2J6EH 3OXRA 5GIRA 2EICA 1OOWA 2PMZA 2J20A 4LPXA 4JPKL 3NRQA 1BVNT 4HXAH 5DJZB 1SHXA 2AV1A 4QJ3B 3CXHK 4AVKA 1MUJA 1X4ZA 3OXSB 2NR6A 4JFWA 3WV0A 1UD5A 5GQBA 3BAEH 2NY3C 4UNUA 2E6PA 3BXNB 2LV4A 2VDNH 3P9LB 5T1DH 3TBVB 4BSWB 2NSXA 4IBZA 1ET5A 2EDBA 3GHBH 3KD4A 1QBBA 4PLJD 2J57A 2PTVA 4EUPB 2H47C 1GGBL 4I18A 3LZLA 2FUTA 3ZDYE 2BDNL 3I6LD 3UTSD 2VXVH 1KXTB 3BQUB 5E6ID 4Y5YA 1J5HA 2ORBH 1NBYB 3GTNA 2F53D 2GKIA 2YKLL 4S11A 1Q90A 5FYLD 5TPWH 3W39A 4R5TA 5DO2C 4ATWA 3T1WA 2WAQA 3BDYH 3NA4A 2A74A 5ETUB 2Z64C 3SPVB 2M2DA 5KS9A 4Y1SA 1A0QH 4LCWB 5HHVH 5EEVA 5DD6A 4NC2B 3WTUA 2EVIA 2ZXCA 4AUJA 2YUVA 1X9LA 1IFGA 2VDPH 4HHAB 4AKPA 2WM0A 1FHNA 5IQOA 1AYOA 1S7RB 4PHZA 3EBAA 1NPNA 4GXUM 1MWAA 4PRNA 4H1LG 3FDWA 5CZXD 4JFZH 2WXMA 2W92A 3ZK0A 5C09D 4JCMA 3Q3GA 3ECWA 3LS4L 4L4VE 5EZLB 1PVHA 5MEOA 4IBWA 2BSRB 3C6LC 2C4FT 4GQZA 3SY0A 2NNRA 4K3HA 3RX5A 2D4DA 1A1MB 3N43F 1KWGA 1U4EA 2PCPA 4NFBA 15C8L 3SDYH 3VYOA 1NGXA 1ICTA 4NENA 3JWNC 4YHYB 2CCLA 3L7FA 4HG4K 2V7HA 3ZJAA 1ACXA 1CL7H 1L7IL 1USZA 1JAEA 4JFDD 2XY1A 4GW5B 4OF7A 1K5NB 2HN7B 4XPTL 3I6KB 2WNXA 4RVBA 1D7FA 3GBNH 5BRZB 1IBGH 3DI3B 3N2JA 3QH3B 4CU8A 3W1ZA 3KPRD 1U93B 4ZO8A 2NY4B 1R3JA 1S7TA 3DUUB 2XV6B 1MLBA 3KR3L 3V55A 5C0GB 5KTEL 3FC8A 4RWHA 2O5ZH 1O9WA 3MROB 3FU6A 4MS8D 5TDNA 4JFSA 1R0AH 4L9LA 5LAXA 1MRDL 1PLGH 5E23A 1L9TA 1Z7JA 4X7TB 1X44A 2ZKHH 4EI0A 2ZXQA 4MJIB 1KTBA 4OF5A 4Z7QF 4MNGE 4JY5H 2E5EA 1BREA 3FTYA 5DJZA 3MBEC 1OGAB 1ZCRA 1JGUL 3OXSA 4CN1A 1JWUB 2MRYA 3QPXH 2VN5A 3BXNA 3JXAA 3P9LA 4NZUH 1UJTA 3TBVA 4BSWA 1QI3A 3KJ4C 4GIPD 4Y9CA 3SEPA 3EJYC 3GIZL 4EUPA 2K4AA 4ODTL 4L3EB 4GUPB 1XH3B 5E0QA 4DEUA 1NM4A 1KXTA 3BQUA 5EMYA 3CBKB 5AOZA 1NBYA 5JDSA 2IQ9L 5KVFL 4D3CH 1MFDH 4PLKD 1LHZA 5DFWH 2FBJH 1TFHA 4J3UA 5ETUA 3SPVA 4AMWA 3TPKA 3GM8A 5HXMA 3V5KB 3IFNH 4P9ML 4QDGA 4LCWA 4YSRA 4PRHB 4PJBE 5KAQF 5SV3A 4PAZA 3FYIB 4HHAA 1S7RA 4Q97A 2R8SL 4MNQE 4ALAC 4JM2D 4GS7B 1PZCA 5I30L 3SZ6A 4JW3A 4NQCE 1MIEH 3O9WA 1PAMA 1FGVL 1OO2A 4G6KH 3TM6A 4OM1L 2O6FA 4RGNE 1U8KB 5ES4B 4L4VD 4M43H 3U0TB 4MJ2A 5EZLA 1QLFB 5CN3A 2BSRA 3E3QE 1LO2L 4N68A 5AOJA 4K3EL 3HR6A 1FUNA 3BPNC 2WIIB 1A1MA 3ZDWA 4MKTA 3LNGA 5FGBC 4JQVA 1DSYA 3ZR6A 3IDGB 1QA9B 2LR4A 1LXMA 4U6YB 1JI2A 1AHWB 1JN6B 2BWQA 1KN2H 2VLME 4GW5A 3BWAB 2HJLB 2WYTA 1K5NA 2HN7A 3I6KA 1U3HB 3H42L 2WYIA 3P0VL 4MYWB 5BRZA 2BSDA 3QH3A 3RP1A 2BP5M 2EIKB 4QUOA 1U93A 3WFEL 1U30A 3DUUA 4L23A 4JVPA 3GKWH 4GT0A 1M7IB 5C0GA 1N9PA 2Q7NA 2MPAL 4OCWL 1LWHA 4UQ9A 1P7QB 1GGTA 2PUQT 2XNAB 1JD9A 3MROA 3QYCA 4AOFA 2BP3A 1BGXH 4NWTH 4F7CB 3UJTH 3PXJA 1Q0XH 4WTZA 4JKWA 1JRHH 4ODHL 5HDBF 3SIKA 4PJ9C 4X7TA 2UVEA 1OLLA 2NUTB 5E4IA 5E8EB 3N43B 4MJIA 4XNYH 4Q7DA 5AW8B 2AMGA 4YSUA 1SOSA 5DUJA 5DHYB 2H9GB 2IOOA 1OGAA 2FSEA 4NHUB 4FYRA 5HD8D 5C3IA 1JWUA 3R19A 4GXFA 2H0FA 5DWUL 2WXFA 2Y1ZA 1ACZA 1CFTB 3RA7L 1OTTC 4FL4B 4L3EA 1XH3A 1DVFB 3OG4B 5DFAA 4MLIA 1ASQA 3EJPA 3OAZK 5C7ZA 4LPCA 1E9QB 1HIMH 1JWMA 5J06A 4LEOB 3ILPB 2LFGA 1HJCA 3FU0A 4F8PA 1RZFH 2IWEA 3QWRA 3V5KA 4N2FA 1AMXA 4NERA 1QYGL 5AW1B 2M26A 4PRHA 4AVJA 2DMBA 4F93B 1DQDL 4Z7QB 4NNYB 1JGDB 5AOKA 1XGTB 3A6OA 3UGEA 2H1LM 1GCYA 3F65A 2J1WA 4Y5XB 1OCZB 1BZDA 3ARGB 4N6QA 5F1IB 5FIEA 3W11D 2J7LA 3WKPA 1BZ9B 4YXHL 4RGND 9PCYA 1M71B 1U8KA 1P5UB 2NY2C 3L3IB 1IMHC 2PW1B 4MNHB 5MP6H 3D6GA 3U0TA 2AABL 2Y7NA 1JHLH 2QTEA 2BNRE 4H25B 5EDSA 1EXUB 1QLFA 3VWKC 1G1YA 1GR7A 1OW0A 2L4OA 3O8XD 4FNTA 3P4MB 4NUMA 5E99H 1YY8B 3ORJA 4XCFH 2WIIA 2NNXA 5HI3D 3EUUA 1C16B 2OR9L 3GC3A 3OZKA 5E6YA 1AI1L 4K5PA 2NYKA 1FPTH 4PY8I 1JYNA 2W0KA 3IDGA 1QA9A 4F5CA 4U6YA 2VLMD 1AHWA 4PJCF 1JN6A 2GSMB 1Z5LB 3BWAA 1TITA 2HJLA 3KDPB 5AVRB 2VDKH 4ORGB 5LAPA 4KKRA 1I3GL 1U3HA 3Q05A 3SBWC 1RIVH 3WS6C 1PKOA 1MFBL 2AJZB 3G7TA 4ABQA 4JQXA 3CTTA 1JGVH 1UA7A 2NY5H 4F2ME 5MEPB 5G4OA 2Z9TA 1M7IA 3EHBC 5EZJB 1P7QA 2XNAA 3O6LL 4F7CA 3RUGF 1ZVNA 1XIWC 1TCMA 1MCWM 2KHAA 2XETA 4IU3B 5KANI 3EH1A 1QAWA 2B59B 1AG6A 3PREA 1DDHA 4XE5B 2X1WL 4NOFA 5DMKB 2QPDB 5E8EA 2NUTA 4Q9BA 2QPSA 1AKJB 3AADB 5DHYA 1NKOA 2H9GA 4U1GB 4RFOL 4NHUA 7PAZA 2NZIA 5KSBF 5E00B 3D4YA 5IESL 5F8RC 5L4MA 1OAYH 2DIAA 2PWFA 5KW9H 3BRGC 5I1AB 3UAJD 1CFTA 2WXPA 2EZ0D 3K6SB 2FX8H 1DVFA 1FO0B 4L5FL 4WO4D 1OP5K 3HG3A 3LKSB 3LEXB 3QJSB 4O2CB 1B3JA 1XCQB 35C8L 4ZUSB 1TDQA 1E9QA 3FQUB 3V6BR 3V4UL 4B0MB 4LEOA 3ILPA 4IRSB 4OIBA 4C4KO 2VDRH 3DARA 5E24E 1H8OA 4I2XE 5HDBB 3OJDB 1PG7L 5GGQH 2UY7B 3OMZA 1F90L 1KULA 3EYOB 4D94A 2BSCA 2K7QA 1JGDA 4NNYA 4WAFA 1YNKL 2AERT 4M4RB 1XGTA 3LQAH 4Y5XA 3ARGA 5AZUA 5F1IA 2X3AA 3EJZD 3CGTA 3L9YA 2C9VA 3GNML 5JIMA 2HRPH 5CD5D 1ZLEA 1EANA 3TEUA 3ZYJA 1WWCA 1BZ9A 1MQKH 4J6RL 1IGIH 4TM9A 1HHGB 2XKNB 3L3IA 1P5UA 2JJUA 2JQAA 2UY6B 3OSVA 2PW1A 2XTJE 4MNHA 4PSRA 1MNNA 1JFHA 4JPVH 3JQOB 4H25A 4KWUA 1EXUA 3EJJX 4N0FB 3HCVB 3AMKA 2DWDB 2E86A 4LCVA 4HA1A 1RMFL 1YY8A 4UAOB 2OM5A 3OTTA 1C16A 2DLFL 4TYUA 3DHPA 3QIWD 2F58H 4J3OH 5JYMA 4OM0H 2Q8BH 5I75B 1RZKH 2EH7L 1VLXA 1N10A 1KXQE 3KWVA 3OLEA 1Z5LA 4JO2L 5E2UH 4MCYB 4N8UA 5GRJL 4ORGA 2X87A 3O3DB 1AG0A 3TV3L 3FQTB 4H8WL 4DNLA 3DMMC 1NANH 2H3XC 4XNXH 2AJZA 4AYMC 1FAIL 4R26L 1LEIB 3RU8L 5LGJB 3LZPA 5KUKA 3BLPX 3HBZA 1U3ZA 5KUMA 5MEPA 3L6FB 4I8DA 5IMMB 1MI5B 5EZJA 1SY6H 2XYCA 3O2DA 4KOCA 1F8TH 1K6QL 4HSQA 4IU3A 1KPUB 3ARYA 2B59A 3CLFL 3V5DB 5JTWA 3O6ML 1JERA 3RB5A 4O2EB 1SJVA 2L7UA 4UAHA 5DMKA 5F1SA 4K9JA 2AXHA 1XCTB 3U1SL 1AKJA 4UILH 2UWEB 3PRZA 2Y0SA 4IHOB 1YAZA 2X40A 3ILQC 2FATL 5E00A 1IB5A 4PJCB 4POUB 2K4WA 3SCMB 3G9VA 3QQDB 5I1AA 4JRFA 4HJUA 3ZGIA 3MBWB 3VG9B 5IT2H 5AOLA 5J12C 1YNLH 1J0IA 4XR8C 5JR1L 4WRLA 3EZ8A 3K6SA 2QPUA 4R8WH 1IAOB 4MB3A 5E9DB 2P4AB 1FO0A 3LKSA 3LEXA 4TLUA 4YXLL 4KMTL 4O2CA 2IALB 4YDIH 1CS6A 1XCQA 4UOJA 4ZUSA 2PWEA 1Z9MA 1NGZB 3T6VA 2ZKXA 3II3A 1RSYA 2E9GA 4WI2A 4IRSA 2BVUA 2FECI 3GFUA 2JKTM 3OJDA 4E9TA 2HMID 1JZJA 3ARFD 1CURA 2BSEA 2YQGA 5TH2B 2UY7A 3I3DA 3EYOA 5CEXB 3ETSA 5L88L 4M4RA 3FSZA 1MDAA 3EDJA 4W9IC 4YH6A 1HXYB 2WQ8A 5KSBB 3DX7B 3QXTA 4L0PB 4UI2A 3AUVA 4N1EA 1U3JA 5J11C 2YRBA 3DJSA 3GLAA 1X5KA 4JE0A 4TNVF 1E5YA 1VADB 3DYPA 1ZLDA 2XKNA 3WSQL 2VERN 2XTJD 2UY6A 4X5RA 5B7MA 3VFVB 4JGNA 3TC9A 1N2RB 5LJYH 1CFQB 1USQA 1JFQL 4N0FA 3HCVA 2DWDA 5CJBA 4BIKA 2HB0A 4N20A 2KMWA 1UENA 1EFXD 1XGYH 1LILA 5FDWB 1ZSDB 4X2UA 2APBA 1U41A 3CFCL 4BFGA 1CL7I 3AXIA 2M83A 3Q1EA 2ZIDA 1UWEL 1FBIH 2R9HC 1JYWA 4HJGB 4UANA 3MX0A 4MCYA 2J72A 3HC4H 4XMXA 3FQTA 3Q5YA 2YZ1A 3QHFH 3JWOL 4TTDD 1LEIA 1MSPA 5LGJA 1WJ3A 2HTLD 5E9NA 3L6FA 4HFUL 2WLYA 4K2UH 5IMMA 2UZYB 1MI5A 3OR7B 3IMBA 3VYNA 3B7UX 2P80A 2R29L 1LK3L 1R19A 4WWKC 4MMYA 5TK2A 5AVQB 1KPUA 2ZT9C 2ADFL 4Q4EA 3V5DA 4WTXA 1UWGL 4O2EA 2ZKMX 1UH3A 3HN8A 1AR1C 5FFGA 1ZVYA 1A5FL 3LH2H 1XCTA 4HK3N 5CEZH 4U7KA 1CF1A 2RJMA 4M62H 4MA8H 4BXSV 1WPCA 2UWEA 4AH2B 5H4YA 3MRLB 4ECNA 4NAMA 5C0AE 4PJCA 3WKML 3SCMA 3L4YA 2CUHA 4L3FA 4NM8H 3QQDA 3BUYB 3FN0L 3ML9A 3MBWA 4WEBL 5IVNA 3H3BC 2Y1AA 3GDCA 4AW4A 4K94H 3L9EA 1IAOA 2A0LD 1VPOH 5E9DA 3R7RA 4YZFE 2DIJA 1U6AL 2BCKB 4GRWB 5C08E 3S0PA 2IALA 3IDUA 4YPJA 5DEZA 4F20A 1OSPH 1NGZA 5A1AA 1HZLA 4XRCB 3N6YA 1FL5B 1WV7T 3SN6N 1HNYA 2B9AA 5I82A 5ESQB 4M48H 2AXWA 2AAVA 3N42F 1NBQA 4PIRF 1UA6L 1SVBA 5EIIB 5TH2A 1MCOL 5ALCH 4Y4HC 3NQKA 4DEPC 1XBRA 5CEXA 5HYJB 3MFFB 4YHKL 1PFOA 4HUNB 4E68A 4L3CB 2KT6A 5KSBA 4CVWA 3DX7A 3PE9A 3S5ZA 3TCTA 5FUOL 5ADOL 2RHEA 1LNUB 1U8NB 4M9PA 1TO4A 4KRPD 1VADA 4P3CH 3QJVB 1BEYL 4J7RA 2MHAB 2ALAA 3PUUA 4M61B 3VFVA 1L7TL 3IN2A 1N2RA 2XQYK 1BLNB 1N6QL 3BGFB 1CFQA 3EGDB 3QUYB 2WOYA 2VXUL 3D52A 1R17A 3FULA 3JWDC 1KB5B 1ECZA 3NFSL 2K0RA 5FDWA 1ZSDA 4XPAL 5J56B 4NUGL 3L5XH 1E27B 1TETH 2O30A 1K8IB 3HJEA 3MJGX 4HJGA 4X4ME 5IQNA 4NUPA 2IPUK 3F7PC 3GEWB 3ZY7A 1PD6A 4IBVA 2DD8H 5CIPH 3FT1A 4R7VA 4DGVH 1EERB 2OTPA 5JYLA 1RP9A 2DLTA 3CC1A 4ODBD 3NA9H 3GZOA 4NS0A 4N0YL 5E8DL 5TE4L 1SXBA 3OZ9H 1QI4A 2R69H 3MRRB 4K07A 4XC3H 1J5IA 5J1AB 2UZYA 3OR7A 4B9JA 5FPIA 3L1OH 4H40A 1I4FB 1QW9A 4RMWA 1U92B 2X4UB 1JRHI 4M1DH 3CQQA 1HWWA 1NFAA 2PCFB 3U79A 2BMKB 4F91B 2VOTA 5FM5O 2WZPD 2G30A 1A66A 5HHPB 1MJ7L 4I4WB 1PQZB 3GBMH 4AH2A 1S9WB 3MRLA 4L8DB 3P0YH 4OZIF 3VWJD 2WN2A 5C0AD 2ZCHH 4LSRH 3VTTA 3UC2A 3BUYA 2XV0A 3K7UA 1KNOB 3QDJB 4ZMAT 5I1GL 4JGJA 5IHUL 5FGSA 1IT9L 2B5IB 2VZ1A 4BFRA 5B4MD 1QR1B 2HX9A 4PVMA 2X38A 4ADIA 2BCKA 1JCKA 1TZGH 4JGMA 1XL4A 3HE7C 5D1XB 2AXJA 2NXZB 1TIUA 3MO1B 4JO3L 4XRCA 1FL5A 1W8OA 2X2UA 1KLGB 3PGFL 2YPVL 3R1GL 4QKXB 5ESQA 2G0LA 4WW2F 3DX1A 4XVSH 4X9HA 5D4HA 2KL6A 3N44F 5C2BL 2P47B 3B3BA 4PRIB 2X10A 4N1HB 2F7IA 3U30C 5EIIA 2DEYX 3D4ZA 1BAWA 3EYQC 1KWKA 5HYJA 3MFFA 1OAUH 4H0HB 1DBAL 1VENA 4L3CA 4KX7A 5TQ2L 3C2AL 5LQBL 4GI9A 1PMYA 2AVGA 1LNUA 1U8NA 4DP4X 1KMGA 4A38A 4B5ZA 2O6PA 5KVDH 2MHAA 2X44D 1NJ9B 4M7ZC 4M61A 1Q72H 2BVEA 4FQCL 1BLNA 4ZW7A 3EGDA 2EINB 3QUYA 5KEZA 1Q1PA 1U8IB 5HDLA 2AF2A 2FT8A 2R7EB 1HC1A 1KB5A 2EDFA 1RCYA 1J9SA 3DETD 5D2NC 1SRDA 4GJTB 3HMWL 3N42B 1E27A 1K8IA 3L7EB 4NO0D 4DWHA 3KH4A 3QZLA 3MLUL 1YCSA 2JXMB 3MCKB 5G55A 2FJGB 1O7DC 3A22A 3MRRA 3PWPE 3RTQC 2R1XB 4G59C 5J1AA 4UZSA 1I4FA 1R5VB 3ARVA 3BWUC 2CXKA 4MXVE 1AOHA 2PCFA 1CICB 2BMKA 2JKRM 2EXYC 4PGDB 5HHXH 2C9UA 2D2CC 3A21A 2Q76B 3BKCL 2Y06H 5HHPA 4I4WA 3HFML 4IIQA 1YEHH 3PAVA 1KTCA 1W80A 1S9WA 4GO9A 2ZX7A 4FHJA 4L8DA 4YDKL 4F7TB 4ZD3H 4FQ1H 1JK8B 2TRHA 3EYUH 4KVPA 1JDCA 1HFUA 4EI5D 2Z93B 3LDBC 3QDJA 1KNOA 1OANA 4EXPX 2FWLB 1M7XA 1H5BB 1NSNH 2V7NB 1DBJL 2MIZA 3AWEA 1DBKH 1QR1A 1CGVA 3D0VB 3UG5A 4PJGF 3KAAA 4XNDA 3ESPA 4NKDB 5LCVH 2I5YL 4NEHB 3WFBL 3STLB 3BT2H 4YVNA 5E5RB 4F37F 5D1XA 3MO1A 2JQMA 1KLGA 4AG4H 2AEPL 5DRWB 3TN0C 1L9MA 3FO9B 1AIFB 1UCTA 2Z4QB 4XNMB 1H6EA 1MIML 2TAAA 4IU2B 1FNLA 1MAJA 4PRIA 4Q6IB 5IBUG 1QWUA 1HAWA 2J6EA 2OP4H 4UV4L 1IM9B 3P77B 8PAZA 3ZL4H 3QRFM 2G2PA 3UCQA 2DW5A 3R4DA 4HSCX 4ZZKA 1CT8B 5HHNA 5M95B 2BRRH 1ERNA 1AMYA 3VXUE 3BVDB 1NJ9A 4PJHF 5LNGA 1E6OL 4QXTB 1BVOA 2VN4A 4DUWA 3CFJB 1U8IA 4OF6A 2R7EA 4DVRH 2MSPA 2ZX8A 4DTGH 1JPSH 1QTSA 4DKEL 1YPZE 3B2VL 2IAMC 2FYVA 2ID5A 4WW2B 1T83C 5DZPA 4W4NA 3DGCR 3L95B 2A77L 2BPBA 1PIFA 4BM7A 3I3EA 1BF8A 1YEGH 4GAGL 3L7EA 5AYTA 4YQXL 1L9QA 5FM4A 2O72A 5IROC 2NX5E 3VSVA 1ADQA 5H37G 1NANI 3T0DA 3MCKA 2JXMA 2ZTBA 3H9YA 1EHNA 2VLRE 4DK5A 2JCCE 4FFTA 1WAAE 2FJGA 2R0KL 3QXVA 4OJCA 4YS4A 3PWPD 4BRJA 1ZGLM 1KIRB 2R1XA 4FKHA 4DGYH 4FQLH 1PD0A 3D4CA 2QLVB 5BCAA 1R5VA 1WT5A 3QZNA 4ICXA 1LL1A 1N5AB 4Y9EA 4UQEA 1CICA 3TNMB 4KH9A 4N6RB 4PGDA 1MJUL 4OU3A 1VCBC 1FL6B 2X28A 2XA8H 5FCSH 1HESA 1CFVH 2Q76A 2RALA 3FCSB 3QULB 4FQXC 4MAYB 4BZ1H 3AXLB 1ZA6B 4OSUH 1GZHC 4F7TA 5HDOA 1BAFH 1JK8A 3AAZB 3ZZLA 4XO8A 5I1KH 2J6EL 4FQPA 4IMLB 4PJDF 2Z93A 5L7XH 1TFPA 2YGNA 1CDIA 1KYAA 5L0QB 3OHMB 4HXAL 4NZJA 3ULVE 1WBXB 6FABH 1H5BA 2V7NA 3ABLB 1E5AA 5GSVB 3BAEL 3SDCB 2ZXDA 3ZRSA 4N1CA 2VDNL 3D0VA 1Z9PA 5T1DL 5CJXC 3MCG1 2D73A 3T2LA 4XVTH 4IK7A 4NKDA 4ZW5A 3RFRA 3GHBL 3STLA 1BQ5A 3JZ7A 3GXFA 1N7MH 5DRWA 3NIDB 4EIGB 2WMPB 2FDBP 3FO9A 1AIFA 2DWSA 2Z4QA 4XNMA 2VXVL 4R7DB 4IU2A 2ZWLT 4GT7A 2G60H 2ORBL 4H8UA 1K3ZA 4I0PB 3LHPH 1LWJA 4Q6IA 5DJ0B 5TPWL 5BVPH 3RURA 1IM9A 3P77A 3BDYL 4ONFH 4TPRH 3MNZB 2VTFA 2UX6A 3WOVA 1TEGA 4F2FA 3GMQB 2FECL 3AVEA 3AU1A 5LBGA 5TD4A 4GLRH 1VEPA 1A0QL 5HHVL 1VFBB 1CT8A 4G8GD 4R84A 2K45A 4V1DD 3T08A 1TLMA 3VXUD 2VDPL 3MZTA 4HJIA 1X7QB 4TF4A 3BSHA 4WW1B 1BBJB 4KK8C 4QXTA 3WJLC 2A3TA 3CFJA 3UIZA 1WFUA 4PJGB 2CKBH 4JFZL 4EMZA 5CAYB 1E3FA 1KZYA 1NC4B 1EO7A 1FE8H 4IBTA 5TE7H 1F4AA 3P2DA 4WW2A 3L95A 4RMSA 3BUPA 4PI2A 5FFLA 1T21B 3QFJB 2JKSA 3SDYL 4YDJB 2YEZB 4BJLA 5DT1H 1CL7L 4BFIB 2GAZB 1KIRA 2WWOA 3OV6A 4Z8FH 3GBNL 1YYLH 4GQQA 1IBGL 2A4CA 2CH8A 1N5AA 3TNMA 5SWSB 1E8ZA 1T0NB 3CMOH 4H7VA 4N6RA 4RMTA 5JNYB 4XPBH 1FL6A 1SHMA 3E8VA 5CSZB 4AMXA 5EUKB 3FCSA 4MAYA 1OHQA 2O5ZL 2F7QA 4TVPH 3H3PH 1WQVT 5K59E 3AXLA 3OKLB 1ZA6A 1R0AL 4XX1E 2IDUA 5ID0B 1F4YH 1PLGL 1BFOB 4G8FB 3H85A 1EWHA 3GT6A 2R56H 2OYPA 3AAZA 2ZKHL 4IMLA 5HY9B 3MV11 1HINH 1EAJA 2NDGA 4JY5L 3ULVD 1XSIA 4HKZB 4OJYA 1WBXA 2EIJB 3SKMB 3DX6B 3SQOH 1AS7A 4GOSA 3FTUA 3FUIA 4BCXA 1BP3B 4GRLD 3CDGB 5GSVA 3SDCA 1MW3A 4KV5E 3QPXL 1MCCA 1AGCB 4NZUL 3E9UA 3QAZC 1A7PH 3B8YA 3VX1A 3WE6B 1IBHA 4E9LA 1I1AD 2R0ZH 3W2DH 2PCYA 5E4EB 3RDJA 4J6IA 4JFEE 1KBBA 4OLWH 4R7DA 2L3BA 5EZOH 1WE5A 2B1HH 4I0PA 4Z7VF 5DJ0A 4D3CL 3W82A 1MFDL 1FNGB 4HEME 3RZCD 2JTDA 2Y2WA 3GI9H 2FBJL 2YEQA 2ZSWB 1I3UA 4M03A 4P2AA 3GMQA 5IQ7H 4DGIH 5JZ7C 3IFNL 3EKCA 4P59H 1A6WH 1M9WA 1OQOA 1VFBA 4PJDB 3ZTEA 3TH2T 1G87A 1RERA 3EJCA 1BFVH 4OAWB 3LKNB 3ZN6A 1X7QA 3AABA 4WW1A 1RJZB 1BBJA 3GSRB 1QFPA 4K3GA 2VSCA 1I1CA 2DKSA 1PYWB 4PJGA 4JMNA 4KY2A 1MIEL 1T1YB 4G6KL 2JI3A 3GLDA 1NC4A 2BVTA 4IKKA 3U9UB 3LH9A 1U0QA 4M43L 2VDRB 4X83A 4KJPC 4U0RC 2KPWA 1UT1A 3ISYA 1T21A 3QFJA 2W9LA 2YSTA 1A8ZA 5IBLD 2DM7A 2VDOH 5E5MB 3S2CA 2LE9A 2VKWA 4YDJA 5G2NA 1HL4A 4ZPVB 2NQ3A 2ARJB 4EIUA 1XF4B 2F54E 2N59A 2YRLA 3WFZA 4BFIA 1ZLWH 5FO2A 1UFUA 2BHUA 1KN2L 2GAZA 3H0TB 1ZMYA 4NO3B 1GOFA 4HIJB 3KLLA 2EIMB 2WSPA 4WO0A 3IS0X 4DGUA 3HZ3A 5JUEH 5F7WC 3PL6D 1O0VA 4WTWA 5SWSA 4CNIB 1T0NA 1KJ2H 3OAUH 3ZDYF 5JNYA 2EVJA 2J12B 2C3VB 3GKWL 3JUYA 4WZ9A 5CSZA 3TJEH 5EUKA 5GHWH 3FNKA 3ZTJH 1UKTA 3L13A 1BGXL 4NWTL 3OKLA 3UJTL 1Q0XL 1YC8A 2YD9A 1RK1B 2BFGA 2VMJA 1JRHL 4NKQB 5ID0A 1BFOA 5F7NC 4G8FA 5K1JA 4E9RA 1GPOH 3FKUS 4XNYL 5HY9A 4Y88A 4HKZA 4FADA 4FN0A 5F7MC 3SKMA 3DX6A 5D1ZC 4IYKA 5IHLB 3OKNB 2ZXEB 3CDGA 1IZKA 2YXVA 4KXZH 5GGRY 5F7HA 1AGCA 5IUSA 4HS8H 3DVIA 1W9XA 2Q3XA 4WJG3 1OTSC 3WE6A 2HPTA 5T5NG 1NEZB 3B9KD 5DK2B 4L37B 1PZUB 3BW9B 3DIVA 4WK2B 1SJXA 1KDIA 2J5LB 5DEFB 3KWTA 3KBFA 5LBSH 4KH2A 4AQOA 4P07A 2WBJD 2H45A 2Z7WA 3UTSB 2VR8A 1GZQB 1HIML 1FNGA 5EA0H 3KLHC 2ADYA 5D4JA 3PDDA 4FNRA 2ZSWA 1ZWIB 5EEYA 1RZFL 1DSWA 1QFWH 4OZFG 3MC0A 1TR7A 4ZO9A 4FNSA 4AYGA 4OLVH 4UQDA 4PJDA 3APDA 3DOSB 1U3YA 3CG8A 3DJ9A 3L4ZA 3NCMA 5ADPH 5HVGB 4OAWA 1UH2A 2DS4A 3D25B 3LKNA 1VACB 1RJZA 3GSRA 3LXBA 2B20A 2VSKB 3GXUB 2DJUA 3BQUC 2NY1B 4PRAB 4TOYH 3TA4D 3FSAA 1PYWA 4H8PA 4XVOA 5A6MA 4G7YH 1T1YA 3DX3A 5C09B 2P8MB 3ASOB 5I26A 3U9UA 5MP6L 5IHBA 3TZVB 1HOEA 1JHLL 2NYYD 5E99L 1H8LA 4UV7H 4Y9FA 4XCFL 4Z7VB 4KOBA 2HCZX 5E5MA 1EFQA 5DJYB 5FGRA 1VDGA 2Z7ZA 4ZPVA 2ARJA 2F54D 4P5TB 1XF4A 1MCRA 5K93A 3MAWA 3O9WC 4IRZA 5ENWB 3H0TA 4NO3A 3FCGA 2XVGA 3Q43A 3RX7A 4YEFA 3ZE2E 2VDKL 4HIJA 4XPGH 5FK9B 4NPYB 3TLRA 4HGMA 3P3SA 1WRFA 1RIVL 3IYLW 3KPSB 1CN4A 1MZYA 1YY9D 3BVUA 3FB8B 3WIAA 4HMCA 4AQ1B 4OFDA 4AIOA 4CNIA 1JGVL 1TZOA 2NY5L 2C3VA 4P9HH 4W4OC 4PS3A 4JQVC 5AKRA 4YHYC 1A7OH 4IKIA 3V6OE 3V9EA 1RK1A 2AI0H 3CN1A 4I3SH 5MI0C 3CSTA 4Z7WE 2FO8A 2C3WA 5J6SA 4J3OD 4GG6E 3ALPA 4GKOA 3B4NA 3PY9A 2BZCA 4PJBF 3HMXH 4MVBC 4TVSa 4F8NA 3CFDB 4RX4D 4Z3JA 1CR9H 4BZYA 4M6MH 2AJYH 3RVTC 3OKNA 1E2VA 3FN3A 1OAYL 3ELAT 1RZGB 3ATDA 5KW9L 3FQ1A 5I8EB 5FXCH 2FNBA 5I1EH 3GS7A 2VO5A 5I8OH 4IIZA 1NEZA 2BP0B 5DK2A 1J0JA 3QJQB 4L37A 2FX8L 4OGAD 5E5UB 4KK9D 3BW9A 3ZDYB 2V37A 4NIYE 5DEFA 1UYWH 3A24A 3UTSA 4AEEA 1GZQA 3ZO9A 2W9EH 1RFDH 2VDRL 4D7BA 3TEYA 1OSYA 1ZWIA 5CJ5A 3WTXA 4ZUWB 4XMWA 5GGQL 1P84J 2ITEA 3H9SD 4MB5A 2X4TB 4PJAE 4KY1H 3D30A 2JI2A 4NNPH 4F7PA 3DOSA 4ZZFA 4ZT1A 4MWFB 5BJTB 3MUZ1 2H4EA 2OLDA 3LQAL 3B7TA 3D25A 1VACA 5DRXB 5I8CB 1QRNE 5EN2B 3VGBA 4XB7A 4PRAA 4NN6B 1UH4A 1GGCH 4AJYV 4JFFD 2HRPL 2X5PA 1UOWA 1ZTXE 1MQKL 4N2BA 4JRXB 3QZOA 3HNSH 5C09A 2P8MA 1DJZA 3BUBA 4NQXB 3TZVA 4JPVL 4L4VB 1OKEA 2VN7A 3PJSB 3PP3H 2MCPH 4MJ6A 1QHQA 2CPUA 1RLBA 4Z7VA 5KYXB 2KZWA 4TUJB 3GQFA 3JV4B 3VH8G 4ETYA 2F58L 4JG5A 5EEWA 3D4GA 4OM0L 5DJYA 5FHAH 1H6TA 2Q8BL 4GS7C 4E9XA 3UOAB 4P5TA 1RZKL 2ZX6A 4ZYKB 3NCCB 1JPFB 5ENWA 2NY6D 2J1ZA 1SOQA 4MS6A 4ANWA 5E2UL 3DHUA 3TT1H 3PPEA 4JG0H 5FK9A 4NPYA 3GSWB 4A68A 1VHPA 2CGZA 2H0JA 3KPSA 1OP3H 1A6UH 2AQSA 3KBPA 1OPOA 4XNXL 3FB8A 3QAQA 4AQ1A 3A4AA 3MTXA 3WAJA 3RY6C 3KPRA 2X2IA 4AIXA 4WJ5B 3VDCA 2MKLC 5IHZB 1SY6L 1H6FA 4S1DC 1WISA 2BIPA 4PU2A 3H9ZA 5CP3H 2Q8AH 4X4YB 1F8TL 4AWJC 4XBEH 3RY4A 3ULSB 1AHWC 4HIIA 2OTUB 4RRPM 2PYEB 3ESOA 4ZQKB 4M8QB 4GKNB 1U3HC 2AQTA 3I3BA 4N9OB 1I1FB 4UILL 3CFDA 3HC2A 4MNGB 4B96A 1AQDB 2JH2A 3S96B 1IGJB 1RZGA 1KB9J 5FEBA 4Z78B 4MXQC 5T1LD 4B9PA 4WI8A 5I8EA 5IT2L 1YNLL 4XXCA 1OCOB 2EC9U 3KYKH 4R8WL 3FUEA 1DN2A 3B9AA 1P4LB 2R4RH 4NZDA 4LCIH 4FX5A 4ZBJA 4YDIL 2F8OA 3D5OF 5LXGH 3JWNH 4WIQA 4GMSH 4MSWB 4BK4A 2JJSC 4GLRI 4FQJH 4ZUWA 3RDTB 1PY9A 2ARWA 2X4TA 1OB0A 2JJWA 4WVRA 3SE9H 1LM8V 3A0OA 1KCKA 2NZ1A 3VFPB 4DH2A 1UZ6E 5BS0E 4MHHG 4MWFA 5BJTA 1IE5A 4J3XA 5I8CA 1T3FB 1DVFC 3OD3A 1QRND 5DRXA 1RUMH 2GY7B 3B1TA 3KXFE 4J28A 1W72H 5EN2A 4AYBA 2IC2A 4MNQB 1QBAA 3FH7A 3KLAB 4RMQA 3FK3A 2ITCB 1YJDH 3FB6B 4GBXD 4NQCB 5I17B 4JRXA 4KBPA 1BJ1J 2IDQA 3GUTB 4NQXA 4OI7A 2E9WA 4Z7UE 2FHBA 1NH6A 1ODAA 4L4VA 3PJSA 4GO6B 4IK6A 4U2ZA 2IH9A 4XAWH 4M8VA 1YN6B 3ES6B 2KC0A 3CDCA 3O8XB 3TA3B 4TUJA 5KYXA 3JV4A 3BAIA 5D6DC 3T65B 1XGYL 4DVBB 4ZFOL 1BZ8A 2ROYA 4D9RE 5I0DA 3EJRA 1FBIL 4ZYKA 2DQTH 4QTIH 1BMGA 5I73B 1P7HL 1CD9B 5CJQH 3GSWA 2O5NA 3HC4L 4LLUB 1TYRA 3QHFL 3C08H 4N8CH 2F7PA 3FJTA 3J7HA 2RQEA 5KVDE 2H0EA 5DRZB 3CZFB 4K2UL 4WJ5A 4X7FC 4KQ3H 5IHZA 1HQ4A 2H6UA 3UBHA 4X4YA 2ZOKB 1VB9A 1YQ2A 2X3BA 4PP1D 4JREC 4PV1C 4B9GA 5F44A 4YC2B 2OTUA 2PYEA 1IL1B 3MNMA 2OTWB 4M8QA 4ZQKA 5IBUB 5FUCC 3LH2L 5CEZL 1I1FA 1T7VA 4WK4B 4M62L 4MA8L 4MNGA 3GI8H 4UOW0 2V8MA 4GG8B 3ZDZF 2EO1A 4ALAH 3S96A 1TTCA 1IGJA 4KVCH 3TBSB 1NWOA 3V4PH 4NM8L 5BRQA 4Z78A 4LSQH 3WBDA 1IZJA 1FIEA 4XTRC 5JMOC 4G6AC 4PY7B 4K94L 3S37X 1VPOL 4AMKH 2CDFB 1P4LA 1WBYA 4JHVA 2VZOA 4U1HB 3FMGH 2IDSA 4GAJH 2JNZA 2FJUB 3KGRA 1OSPL 5CSBA 1PJ9A 5DMGD 5FF6B 4HCFA 4MSWA 5E4OA 4Y2DB 3V8CA 4M48L 3LN5B 3RDTA 4LVNB 4G82A 2GSIB 3U7YH 1BW8A 1TZ8A 5ALCL 5C92A 4QRPE 3VFPA 2DTSA 5BS0D 4APQC 1T3FA 1A7RH 3KXFD 5DSCB 4K0OA 2X6MA 4MNQA 1SN2A 3KLAA 3AS3A 2ITCA 3FB6A 4NQCA 4P3CL 5I17A 2V3EA 4QXGH 3GUTA 2FZ3B 4ILDA 2DQJH 1WYJA 3WLWC 5KYUB 4FNQA 4Y16C 3MA9H 2BNRB 4D0CB 1J1PH 3NUKA 2ADIB 1U8LB 1MEXH 3TA3A 1YN6A 3ES6A 3AQYA 3O8XA 3QIUC 5GRWA 3CV5A 4GO8A 3T65A 4DVBA 5H94B 4D9RD 1VSCA 3KYNB 2WB7A 3B3IB 2EXWD 4KKNA 2PO6B 4P23D 4OZHB 3L5XL 1TETL 4PYHA 3D2UD 5HJBA 4KROC 1QLRB 4YFEA 3L45A 3U1PA 2DD8L 4WSKA 5F7UA 4DGVL 4NC0B 3P2BA 3NCWA 3UDWA 4LLUA 3NA9L 3CX5K 4UTBH 3OZ9L 4UAOC 2GABA 3AB0B 2R69L 3CIAA 4XC3L 2E56A 3FSVA 4C55A 1AGBB 5DRZA 3CZFA 5C6TH 4F2MB 4UTCA 4MASA 3BMWA 3OB0K 2BFVH 3L1OL 4CW1B 3UBGA 2BINA 5I75C 4M1DL 2AQQA 2ZOKA 1IC0A 4F2EA 3ASNB 4RCAA 4OF8A 4N4YB 3ZMRA 1IL1A 3B8SA 2OTWA 1OAZH 1CWVA 1TZIB 1VRSA 4KO6A 3PWUB 4IMKA 2K9UA 1YEJH 2WCPA 4WFFE 3GBML 5JLZA 4GG8A 5FS5A 3P0YL 4KXZI 4I3GA 2DM4A 4KPHH 4WI6A 1WA1X 3TBSA 3UERA 4BFBD 1QFWM 2ZCHL 4LSRL 4N2LA 1P84K 5DJ6B 1SQMA 5BUAA 3PXHA 4JO4H 3ZIYA 4PY7A 1GHFH 4A2FA 5KJ4A 4OCSH 2CDFA 4XX5A 4YLQT 5J9PB 4JKPH 3FONB 4JM0A 3ZLQC 4CVZB 4U1HA 1CO1A 2EKJA 3LD8B 1H3UA 3L3OB 2ZUQB 4KO9A 1TZGL 4S2SB 1AJ7H 4Y0GA 1ZLVK 1BIHA 3L08A 1QFWI 3NOIA 5TK4A 4Y2DA 4IEFB 1E2ZA 4XX1G 4XVSL 3LN5A 4I2XB 3T0EB 2GSIA 3SO3B 3VG9C 4QRPD 4JFPB 3ARFB 4FZEH 4A67A 2F6AA 5EU7C 3L3KB 1GS8A 5GGVH 7TAAA 1OAUL 4W9ZA 3ZDZB 4G8AC 5DSCA 3VI3E 3ALXA 4ZW8A 1YEDA 5EF3A 3FQ2A 2R1YB 2MWCA 3IRCA 5LCVA 3BN9C 4LF3B 5FYJE 3M1BB 2FZ3A 3T4AB 4DKTA 3R8QA 1Q72L 2ICCA 2XTJB 4LAJH 2VXTH 5KYUA 1WAPA 3TONA 2BNRA 5F6HI 4D0CA 1NCBH 3S37H 1C5DB 3RJQB 2W94A 3HBQA 4FQIH 1J87A 5H94A 3KYNA 1EFXB 3B3IA 4ZFQA 2IG2H 3LVTA 3FTZA 1X4YA 2PO6A 3RNQB 4FCAA 4OZHA 1F2XK 3C6EA 5T1JA 1LYQA 4K9EC 1QLRA 4PG9B 1SLVA 1B4JH 4XMUA 4RFNB 4FYTA 4YZFF 2CBOA 3LKOB 4TMPA 2VISB 1AGBA 5E2WH 3JVGA 1KB9K 4F2MA 4G71B 4CW1A 1S2EA 3MJ6A 1M2VB 4PCKA 1QEXA 4N8PA 5AAWA 1JZ8A 1DQKA 3D85D 3K6FA 5HHXL 1SYSB 3GGWB 3SKOB 1WFIA 3LNHA 2FRGP 1U8MB 3L4WA 2Y06L 1TZIA 4LZKA 3PWUA 2A6JB 2OZ4A 3JV0A 4WFFD 2BHZA 3DPDA 4P4KC 1KGXA 1YEHL 4ZD3L 3TFKD 3GIVB 5GS1C 4FQ1L 3EYUL 4P46B 2Z31B 2XPYA 1WC7B 5DJ6A 4C83B 4EOWH 1XWVA 2KZBA 3P40A 3D0AA 3US1A 1E8XA 1XR8B 1NSNL 1JGIA 4GSUA 2JIXB 3VVWA 1DBKL 3BP5B 3QPQD 3NVQA 5IZ7A 3EDFA 1MCEA 3ZMEA 5J9PA 4CVZA 3FONA 4EE2A 1BAGA 2MQCA 1SHWA 5LCVL 5JOPE 5AAMA 3L3OA 4F8TA 3BT2L 4S2SA 1IGCH 3DBXB 4NQQA 4BZ1A 4X80H 1G9HA 2WXHA 4QLRA 1JPTH 4AG4L 1YMHB 3L3DB 4IEFA 4HV8B 1CQKA 3VAEA 1BZQK 4I2XA 3TIEB 3T0EA 3MJ9A 2PKDA 5EOCH 4JFPA 3ARFA 1URZA 2OP4L 2NXYD 4LGRB 3L3KA 1S7SB 5F1KC 3X13B 3ZL4L 3DX9B 4OF3A 1VESA 2K1MA 3QI9B 3HZYB 4KO7A 3UEQA 1IKNA 2NW2B 2QEJA 2R1YA 2BRRL 1QZNA 4LF3A 4JFQB 4GUQA 3CAFA 3M1BA 4XN4A 1P53A 1M56B 1HNGA 1U2YA 1EH9A 2WLZA 4G8EB 3T4AA 1FHGA 4KHXH 2NQCA 4PGCB 3CDYA 4TTGA 1J1OH 1C5DA 4DVRL 3LOWA 4DTGL 2VZTA 5HPOA 5SWQB 2VDMH 1JPSL 4LHJB 3D18B 4ZTPH 1VZIA 1NMBH 4B3VA 1EFXA 1FN4B 1IAKB 4BQ6A 4NX0A 1F3JB 2YO3A 3RNQA 3P4NB 2EVFA 1G1KA 4M1CD 1YEGL 4FD0A 4FFYH 1F6FB 5FV2A 4IRJC 2RMNA 4XHJD 1HU8A 5D7HA 4PG9A 5JHAA 1ZT1B 4KK5D 1BOGB 4EZLA 1MFNA 4GUCA 3BD4A 1PBYA 1WG3A 3OKKB 2WVUA 1D9KB 1CXKA 3LKOA 3QUXB 5F7AA 2VISA 3WDJA 2R2EA 4X8XA 4AQ8C 4DGYL 4FQLL 1F2QA 2B1OA 3BPOB 2B8OT 5I23A 1K5WA 1M2VA 5DS2A 4DO4A 1ET8A 2Q0ZX 4AT6B 4M6OL 1TQTA 3LEVH 3CHXA 1QRKA 5FGCE 3RWFB 1SYSA 2XKUA 3GGWA 4U49A 3SKOA 2XA8L 3G5ZB 5CGYC 1CFVL 1CLYH 1U8MA 3WIFB 1T66D 4PYGA 3RKPA 2A6JA 5A2JH 4BZ1L 3O3EB 2VDOB 1LE5B 5F6IC 5AWNH 4OSUL 2JB6B 2CQVA 4OZFB 3GIVA 2CO6B 3MRQB 1FWXA 1BAFL 5DFVC 4EN3D 4P46A 5C0AB 5I1KL 2Z31A 4JKLA 5L7XL 1MFEH 2MPVA 3LNDA 4C83A 3K5RA 1XR8A 3MUGA 3NAAH 1WZKA 4JY6B 6FABL 2JIXA 1MHPH 3BP5A 4DJMA 3MODH 5B7FA 5I5JA 4I9XA 1DQTA 4XVTL 4BUQA 5C08B 2IH8A 4BA8A 5JOPD 4GKSB 1KLFB 2WTPA 1OCWH 4IIQC 4AQAB 3DBXA 1OY3B 2I60H 1N7ML 4W70A 4ZOBA 4BQ8A 3X1EA 3JYBA 1YMHA 3L3DA 4HV8A 4AIZB 1X9RA 2QSVA 3TIEA 2MKWA 4C4BA 2G60L 3C8KB 3LHPL 5BVPL 4OFPA 4ZOAA 3KNBA 1AQMA 2B5IC 4NOBA 1V3JA 1XT5A 2PCXA 4ONFL 4TPRL 3X13A 1KBGH 3ARDC 4UOW1 4BK8A 3HPJB 3LYRA 3R7QA 1LWRA 3QI9A 3HZYA 3S3DB 2GC4C 1U36A 2NW2A 2ZP8A 3CNKA 1VZHA 2AQ1A 1AZCA 3IETB 4JFQA 3TO4B 4G8EA 2X05A 1HL5A 1JUFB 3VTAA 2IJ0C 4OZGE 4MXVF 2GPZA 4PGCA 4WHCA 2CKBL 2PP7A 1Z9NA 2W91A 5ABAA 4RMBA 5SWQA 4NC1C 1X5XA 3B83A 3D18A 5DQDH 2E6QA 1FE8L 2HAZA 2NZ9D 1FN4A 1IAKA 5TE7L 4OI8A 1F3JA 3P4NA 4GAFB 3L4UA 5BZDB 1E9OB 3HRZC 3N1QC 2Z8RA 3VFNB 3J07A 4HLJA 1ZT1A 1C9SA 1DVQA 4P2OB 1YECH 5IJBC 1BOGA 2YIHA 2ITFA 4NNXB 3OKKA 2ZUUA 5DT1L 1CTNA 3LQMA 5E70A 5D7JD 3CD4A 1D9KA 3QUXA 2XZAH 3Q8BA 4K7PY 4Z8FL 3ZT7A 2V33A 3K6IA 1YYLL 4PJ8B 5F8QC 3FT3B 4AT6A 2AEQH 3PP4H 4E41B 3EOBB 3CMOL 3RWFA 4H20H 3RJDA 4XPBL 2YXWA 1E4JA 3E0GA 5HI4D 3G5ZA 3OL2A 2CUAA 1BFSA 2FIKB 5FV1L 1AZRA 1I9RH 4HETA 3WIFA 1VAHA 3WELA 3IAGC 4TVPL 1PL3A 2I26N 3H3PL 3O3EA 1LE5A 1X5ZA 1TQBC 5LGKA 4OZFA 1F4YL 1VFUA 2NQDA 3DHJA 2CBMA 2CO6A 3MRQA 1K4DB 9CGTA 2R56L 1PDKB 4FFVD 1NAMB 4KKAC 4RGMC 5C0AA 2LAGB 3MNDA 3SJVB 1HINL 5C0BD 4EI5B 3PWLB 3SQOL 4KZDH 3Q8CA 4WNJA 3ABZA 1PZ3A 1T1XB 3BAWA 2WAHA 3SO5A 3LXUX 1HKFA 3JWDH 4J2QA 5E6UB 8FABB 4N2AA 2ICEA 2XU9A 5C0EB 5E1IA 3BDBA 5C08A 3UO1H 2YJQA 4GKSA 3EADA 5F72S 4DPRA 1A7PL 1KLFA 4AQAA 1KYUA 2R0ZL 3W2DL 2G3ZA 1YPZF 3L5WB 1ROWA 3S3PA 4AIZA 5E8NB 1UFGA 4OLWL 1KN4H 5BZZA 3MUY1 3NZHH 5EZOL 2B1HL 3C8KA 4GP8B 2RTTA 3VH8B 1H5BC 2K3TA 4NKIH 3GI9L 3MRDB 3L4TA 3RVWC 1KV3A 5ALBH 2F0CA 4JHUA 4PY8J 3GXNA 5IQ7L 3HPJA 1WAAF 4PWHA 4DGIL 1KF9B 4PGEB 3W9DB 5KVMC 4P59L 1A6WL 3UO8B 2DL2A 2KH2B 1KLUB 2WPGA 3LPOA 4G6JH 5IVXE 1BFVL 3IETA 5DGQA 1OSEA 3TO4A 1THCA 4PG2A 5A2LH 1JUFA 3RVXD 2X0UA 1XCWA 1R5IA 2BVOB 2XWJB 3FZUC 4XN2A 5EBMB 2EDYA 5GRXG 4QHKJ 2X70B 2OJ1A 3HHSB 1TTRA 4CU6A 1DVZA 2FL5B 1SXCA 1T7YA 2ERJC 2A73B 1HHHB 3L54A 5BZDA 1CC3A 2IBZY 1E9OA 1NIBA 1WD9A 4L4TE 3NCEB 3TU6A 2VDOL 1A7QH 4P2OA 3CSFA 4Y2NA 4NP9A 3ULVF 2ENPA 1GA2A 2XVKA 4NNXA 5EPMB 1NUNB 1JV2B 1NC2D 4NCDA 2IWKA 4R9HA 1HZKA 3QDGB 3PWPB 3K2UH 1ASPA 2FE0A 4PJ8A 3AG4B 3Q01A 4WW2C 1IEBB 3P2TA 5JUEL 4YHNB 4N5ED 4E41A 1FLRH 3EOBA 3OAUL 1KJ2L 4POZC 2GEQA 3B2UC 1OGTB 2WTOA 1TEYA 1V3LA 3TJEL 3NDYE 1L0PA 5GHWL 3EOTH 3S8FB 2WKOF 2I69A 3OBAA 3APCA 3EH5B 2ICWI 3IGUA 1K4DA 3N85H 1PDKA 1GPOL 3IS1X 1NAMA 5A7BA 1CFMA 1MFVA 4ZTOH 1P1VA 3EXJA 3SJVA 3C5ZB 5D7IF 4EI5A 3PWLA 6CGTA 4ESKA 5GZOC 2ZX5A 1GTNA 1T1XA 4ZAKD 2H3KA 2QGCA 3GJFK 4MAYC 4JK0D 8FABA 3Q0HA 4HS8L 5C0EA 4LHUB 3CPLB 4Z7NE 1KEMH 3QORC 2X89A 3M07A 2EIZB 2NY0D 5E1AB 3KVPA 1RZ8B 3L5WA 5I74B 5LBSL 3WIHH 3DX4A 3E6FB 1FYTB 4LEXH 3CZJA 4RAVB 3RYMA 5EA0L 3VH8A 2VDQB 3HMXA 2PLTA 4PJ6A 1Q9KB 1QFWL 2H32B 1A9VA 2GFBB 3SKUD 5DZJA 4PGEA 3W9DA 4OLVL 4A6YH 3QR1A 1KLUA 2RACA 2BS9A 5ADPL 4FLOA 5AW2B 6PAZA 5KBNC 1WUNT 2J56A 5F97E 4KKZA 3CVHH 5LXVA 1H6UA 2BVOA 2EEXA 2IH3B 2XWJA 3GRWH 4TOYL 4YBQD 5DD1H 4U4BA 3H2WA 5EBMA 4G7YL 1UD2A 1P5VB 3B7YA 3E1ZA 2X70A 3HHSA 4JVUA 2PXYD 2ZG2A 1H3PH 2FL5A 4HEPG 4PP2B 1YPZB 5K59F 3VXNB 2A73A 4LVHB 4K23H 5J89A 3ARXA 1HHHA 3M1CA 1FFTB 3KBEA 4UV7L 3VFUB 2CIIB 4L4TD 3QUMH 1K85A 5KWYC 1HEJC 4IS6B 3FO1A 5AVUB 3CFMA 1GJIA 3GLEA 1GGUA 4OI9A 4MQXC 1VCAA 2NX5B 2L0DA 3OMIB 5KG9B 5T5FA 2VLRB 4YUEH 3MV01 1CFNB 5EPMA 3ZHDA 1L9RA 3C8HA 1JV2A 4KV5F 4QXWA 3RX8A 4AJ0A 1JHKH 4R90H 4DK3A 1RPQA 3PWPA 3QDGA 4XPGL 5KN5B 5F0PB 1IEBA 5MHSE 4YHNA 1NMCB 2IDTA 1MVUB 4JJ5B 4A2MA 2WXQA 1XF3B 5IJKA 1HYSD 2MNJB 3S7GA 3DGGB 2FSDA 1OGTA 3AT9A 3P3YA 4N9GB 4P9HL 1EIBA 1UASA 1A7OL 1XXFC 1MAKA 4XZUB 1T2XA 3ARED 5C07B 2AI0L 4KGLA 1LGVA 4I3SL 3L5JA 4TNEA 1NDTA 4AL8C 1G7HB 3PIQB 1EBPA 4P06A 3KJ4B 1RP8A 2NY3D 3C5ZA 3HMXL 1CR9L 1D3CA 2VQ4A 4M6ML 3RKDC 1IIIA 2AJYL 1J7VR 3GPEA 2Z34A 1XAUA 5TDPB 4R6UA 4J3TA 3T0WA 5I0VA 2E9JA 3TVMD 1VEMA 4X8GA 3LKQB 1GJWA 5I1IL 4C56E 1CD1B 1XF2B 1MCHA 1SLWA 3ULUC 4LHUA 3CPLA 5I1EL 5KOMC 3DROB 4ADGA 3GM0A 5HPMB 5I8OL 2EIZA 4J27A 1AO7E 4XPFH 1CE1H 1PEZA 1QSEB 4O51B 5E1AA 5PCYA 1RZ8A 1NBVH 4KKBC 1UYWL 3NK3A 2YN5A 3PQYB 3E6FA 1FYTA 4RAVA 5F0MB 2BY2A 2XN0A 1SMOA 4HUUB 3RZCB 2W9EL 1RFDL 4BFJA 4HOZA 1UWXK 3V0IA 4BZ2H 1Q9KA 2H32A 1KXHA 4F7EB 2GFBA 4LIQE 4R2GD 3V4PB 4IGBC 4GH7B 4KY1L 3IDXH 5FFOA 4NNPL 3IU3B 5BRPA 1TJIH 3GSQB 3WNKA 5D7IB 2C8NA 4FLQA 2FWOB 1OARH 1FCGA 1TTAA 4YSSA 1IO4C 4BE5A 1MCNA 2IH3A 1GGCL 3BPNB 5EU6E 4UNIA 3AY2A 5ILTH 1JL8A 2N1KA 2AK4B 1P5VA 3HNSL 2OMVB 3OX8B 4AC2A 4BYHA 1MJJB 3ARZA 4PP2A 1YPZA 1DQLH 3OJMB 3VXNA 2OX5B 4AM0Q 3M6DA 2MCPL 3TF7C 3GYRA 2CIIA 3VFUA 3GB7B 1DYZA 5K9OB 2BLFA 2XZQH 3ILEA 3JTBA 4IS6A 5HJDA 1VERA 1OTUD 3SE3C 3TH4T 3LXAA 4KNTA 2I9LB 4NRZB 4Z7OB 4I85A 2IV9A 5FHAL 3UTTB 2NX5A 2CDGB 2V5RA 5KG9A 1J9CT 4YMPA 2VLRA 2Z4TA 1WAAA 1CFNA 2W88A 3MV9B 4EZJA 1SXSA 4AZUA 1ILSA 4HC1H 3TT1L 4JG0L 3UG4A 1BVNP 2EEFA 5MHSD 2HT2C 1A6UL 4R7XA 3D39E 1JCVA 4PTUB 3T3PE 3AACA 1MVUA 4JJ5A 2QHRH 1XF3A 2R51A 3MACH 4PJ9B 4RQQB 3DGGA 1Y6MR 2IGFH 4N9GA 4YFDB 2VMEA 1RHFA 4TSBH 1OGPA 1Q38A 4XZUA 3REVB 2Q8AL 2Q3AA 4IHBA 1TJHH 2H7WA 4XBEL 2DY2A 5C07A 5A43C 3P3UA 4X0KB 1W6LA 1XH1A 2VE6B 1G7HA 2AQ2A 3PIQA 3QDME 4XGZB 5TTRA 3RHWF 3T6ZA 4HFWB 1XGZA 5TDPA 2VLLB 3ML8A 2AP2A 4C56D 4ENEC 3LKQA 1XF2A 1CD1A 4ZXBD 1TF4A 4KMLB 2MCMA 5LN8A 1J8RA 3KPPB 3DX2A 3U46B 3DROA 1F45A 1GZPA 5HPMA 2BY3A 1AO7D 3KYKL 3B9KB 2V8LA 3QK0A 2VLKE 2R4RL 4OKVB 4JFEB 4LCIL 3PQYA 2R1WB 2X88A 4LLYB 4TN9A 1IFHH 3UH8A 5LXGL 3RZCA 1BPVA 4GMSL 2WKOA 5DVLA 4BCYA 4W9FC 4FQJL 1H19A 5ESAB 1E5UI 1FH5H 3ESMA 3U9WA 3V4PA 3SE9L 3LHAA 2ICWB 4L1DA 3IU3A 4J3WA 3FQWB 5LGHH 3GSQA 5D7IA 3ZE2F 1W8EA 2FWOA 2NY2B 3P02A 2CR6A 3O4LE 2XWEA 5C0ND 1RUML 3JT0A 3OHXB 1W72L 2YPLE 1FH2A 4K3DH 4PJIB 5E6IC 5EU6D 3RIAF 1JZGA 1RJYB 1HYRC 1YJDL 2Y07H 3ZE1B 2AK4A 4UDTB 5KANG 1ZGLP 4JNXA 1HXMB 2OMVA 4CDGC 5B38G 4L9DA 3OX8A 3QNZB 2WIMA 4U2YA 1MJJA 1OOAA 5A3ID 2OX5A 1SOKA 2VAAB 2XN9B 4W9HC 3FFCB 4MMXB 4XAWL 4Z7WF 1IBYA 3GB7A 3OGCB 4P3DB 3GSNH 5K9OA 1FL3B 3GUFA 4GG6F 4A7GF 4LESA 4UINH 4NRZA 2I9LA 2O93L 3UTTA 3SBQA 1KCWA 2CDGA 3OKYA 4HWBA 1S9XB 2P43B 4FCHA 4MBRA 2DQTL 4QTIL 5ELIA 2F54B 3IXTB 5CZXC 5C2UB 3MV9A 4NQVB 4B9YA 3BUTA 2RQ8A 5CJQL 4P5RA 1DBMH 2NDFA 1BZ7B 5F7KC 3VMOA 4LO9A 1MNUH 1UXWB 4P5KB 3D39D 1XIWB 4FF9A 3C08L 4K71C 3NSXA 4N8CL 4PTUA 4QYOB 4UZGA 4Y1TA 3ULAB 4PJ9A 4RQQA 3E6HB 5EF2A 4HZ1A 1D6EB 3A5VA 3VGAC 1OF0A 4KQ3L 1M7DB 4G7VH 4S0SD 2WWMD 4ODUB 3A67H 4H5SB 5D1QE 3REVA 4AW7A 5MEQB 4BQBA 1G5AA 1MFCH 4X0KA 1X7SA 5A2CA 1JTTA 3QDMD 3AY4C 2CXGA 1R3IH 4PJAF 4XGZA 5FWRA 4PS8A 3UPCA 1BOYA 5IGXH 3W57A 3GI8L 5K9QG 4ALAL 1Q9OB 1JWSB 4HFWA 4R5VA 5T3ZH 2VLLA 4KVCL 3V4PL 4B9FA 1A6ZB 3ZKXC 1B9KA 4D9QE 4LSQL 2BHYA 3F7YB 3V0JA 2OMTB 2OA9A 1CJYA 2CO1A 3FU7B 3KPPA 1S9YB 1SFHA 1UZGA 2YBRB 4MS8C 4N2NA 4Y19E 3U46A 3LPGA 4M00A 4AMKL 3B9KA 2IDCA 1JPEA 4OKVA 3TV8A 4BD4A 4JFEA 3VB9A 4F24A 3FMGL 4GAJL 3AXHA 2R1WA 4LLYA 3RPBA 5E8PA 1E0OB 2WBJA 4PBVC 1MWAH 4ODTH 1CTMA 3LXCA 4XO9A 4RDQG 5F7BA 5T33H 2E47A 5ESAA 3U7YL 2ISDA 1LO5B 1G4RA 1T89C 3VI4B 4YEEA 2IADB 3FQWA 1T5WB 1V10A 4LPUA 3QDHA 3O4LD 5DZAA 1A7RL 3ZU8A 1WF5A 2YPLD 1HCZA 2WUCH 3OHXA 5F93C 3ZKMD 4PJIA 4KZEH 4OBSA 2K70A 4WWPA 1RJYA 1MY5A 4UDTA 3F7RA 1HXMA 4QRBA 4QXGL 3ZYIA 2DQJL 3QNZA 4LASH 1BXAA 1KPRB 3PAYA 3MA9L 2ZWYA 4DP8X 2XN9A 3HLAB 3ECUA 1UD4A 3OGOE 4JL1A 1MEXL 4MMXA 4X42A 3OGCA 4PS4H 4P3DA 4R83A 2FJHB 4XVUC 1OWRM 1HXKA 2ZUVA 2VRKA 2ZE0A 3MLSH 3QS3A 3WS6A 3DMMB 1X5FA 1Z9OA 3PFQA 1S9XA 4NN6C 4JM2C 1S3RA 2E7CA 2F54A 3IXTA 3SPGA 1JZ3A 4KNUA 3MOAH 2FYYB 1A1OB 4NQVA 2P24B 4QRRD 3LZOA 4TSAH 1BZ7A 3CVCA 1J9RA 1F1GA 5T1KD 5ACZB 4FDWA 2FQDA 3CE1A 1UXWA 4P5KA 2ILLA 1IC5H 1MRCH 1XIWA 3WTVA 5AW4B 1HCVA 2HFFB 2G3XA 4QYOA 3EOAB 1KT2B 4UTBL 4KK6D 2EVGA 2Z1PA 2EC9T 5C6TL 1D6EA 1NICA 2CHXA 3GHPA 3X3FH 1GC1C 1M7DA 3ZTNH 2DIBA 2BFVL 4TLSA 2VDMB 5D1QD 1P4UA 4ODUA 3QNFA 4H5SA 5A16A 3V0AC 2DICA 5MEQA 4C4UA 1S5IH 3UBXI 1KSRA 1O6VA 3OF6D 3MSPA 1OAZL 1CIUA 5IB5B 4GQRA 2HLEB 4F27A 4N2DA 4EUPH 1PLBA 1J5DA 1YEJL 1UZ6F 2FWUA 2X4RB 1NCAH 4Y89A 1HSAB 2ZXBA 3TBTB 4XAKE 1Q9OA 1JWSA 4KPHL 4AGMA 4NUJA 1A6ZA 3LIZA 1NQBA 2GQHA 5DS1A 5EF0A 4N85A 1KIUB 2P5WE 3F7YA 3ETBJ 5T1LB 2OMTA 4Y19D 3FU7A 1S9YA 2YBRA 4JO4L 4LLMB 3BESR 3V2AR 4AV5A 4GSQA 1GHFL 4AV4A 1OHZA 1I7RB 2D7QA 1FV1B 4OCSL 2D3VA 3BVNA 4X5XB 4Z7UF 5TJWK 4JKPL 4YIQB 4U3HA 3MLTB 1AJ7L 2VW4A 3IPEA 4DETA 1I8LC 2AS5M 1TQSA 4OH2A 3IFOB 1YZZA 3K74B 5HD8C 5HHMB 1GKEA 1LO5A 4POYA 4DOHE 1PX3A 3VI4A 4JQIA 2YXFA 3HHRB 4FZEL 2IADA 5GGVL 6TAAA 1T5WA 2NY7H 2J8UE 3MUHL 1ESOA 4P0DA 2CJ3A 1LP9F 4B7IA 1XH0A 3DX8B 1U8OB 5F7LB 4FXLA 3DHMA 3BFOA 5C0CD 2WKGA 4LLQB 1C5CH 2Y7LA 3DGDA 1A02N 1KPRA 2VXTL 3BAXA 4CVUA 4N2CA 2HLFD 1HEZB 1NCBL 5L2KE 3KGSA 4I1NB 3HLAA 3SQRA 3S37L 2RAMA 3QBTB 3DTXB 4NQEB 2FJHA 3DECA 4FQIL 1XAKA 3LX9A 4NIKB 2IG2L 5ISZE 3DMMA 3VXRB 5KZCB 4MAUH 2VN6A 3W11C 4E9YA 4B5EA 1DQVA 1I85C 4WEMB 2FYYA 1A1OA 1T2JA 2AKRB 3IGFA 4RGNC 4N0UE 3QEQB 1HCFX 4J3BA 4FKEA 4Y4KD 1ASOA 5ACZA 2RFXB 1M4KA 4WWKB 1B4JL 3E3QC 2HFFA 1T6WA 4NXKA 3EOAA 4Z76B 1KT2A 5I5MA 3TA3C 3O8XC 1AR1B 5HI3C 1C8QA 3ATBA 2ICES 5E2WL 5KBDA 4UT6A 2VC2H 5BOJA 3VRLE 3V6OA 1SVCP 3X1FA 3ERXA 4C54A 3SDAD 4AENB 3ZX1A 3WI9A 5DVOA 5IB5A 4XP4H 3UDWC 4GRMB 2X4RA 4XAKD 1HSAA 1QQDB 3CN0A 3TBTA 3D50A 5C9JB 1T4WA 3EF4A 3DV4B 5IKCB 4L1HA 1KIUA 1OM3H 4EOWL 5BMFH 3BYYA 3BAJA 5T1LA 5F88B 2ZOTA 2YMOA 3DSNB 4LLMA 5IEHB 5IR1B 1WHPA 1BD2E 4PRDB 1PJWA 1XVSA 1V8HA 1G7PB 1I7RA 1FV1A 3TBCA 4AEHH 4FG6D 4YIQA 4KNSA 1UOKA 3OKDB 4IMKC 3DXAB 3WEXB 2KPNA 4OT1H 3MLTA 4Y4HB 4DEPB 4E9VA 4HIHB 1IGCL 4RSYA 3OPZH 3WIIL 1FJ1B 3H3KA 3IKKA 4X80L 5BO1H 1JPTL 4O5LH 3VXOB 2XV3A 4M3JA 3IFOA 1X4XA 1P9MA 3M46A 1Z5YD 3RWIB 5EOCL 1JNHB 3F00A 1XB6A 3CZLA 1IGFH 2EZ0C 4GQPH 4LDCA 2F19H 3P3TA 5HVFB 5HBBA 4JZJC 4OCYH 5I2IB 3KXFB 4WO4C 5CR8A 5FW6A 4KJYB 3DX8A 1U8OA 3IMUA 3STZB 3TF4A 4Y5VB 2UZIH 4H44C 1VKXB 2CIKB 4Y2DC 4LLQA 1UEYA 5JHDB 1JGEB 1GY2A 2X1PA 4KTDH 4LVNC 5B21A 1CU4H 4KHXL 5L2KD 1HEZA 4QKTA 4Z3IA 1NGWB 3TIDB 1J1OL 1AC6A 1XF5B 2EAEA 3DTXA 4NQEA 2XWRA 2VDML 1SN5A 1DBBH 3CFEB 3FH5A 3NBNA 4ZTPL 1NMBL 1F13A 3ABGA 3VXRA 4JPIB 3EJZC 5EU3B 4FFYL 1C12B 5CD5C 4H2CA 4FULA 1UTDA 2AKRA 1CGTA 4RA0C 1YDPB 3IFLH 3QEQA 3RBSA 2EDJA 2RFXA 1TQUA 4WWKA 1LP9B 4Z76A 2ZXAA 4M6AA 2YA1A 3S3SA 4CA4A 4Q9RH 1F4XH 1ACCA 5AG8A 3LRHA 5E51A 1XL6A 3UAFA 4TQEH 2PO6C 3NN8B 3LVEA 4HD5A 4KJWD 4D0BB 5GS2H 3LEVL 2WKLA 4TRPH 2BSBA 4E2OA 1CLYL 4OFYA 1M53A 2LW3A 2CNZA 1XMWA 4UUJB 3VXME 2J43A 5AWNL 1F6LL 4GRMA 1EZSA 1QQDA 2C3XA 2P3YA 2X3CA 5C9JA 3DV4A 3VI3F 3JVGC 1PLCA 2E7DA 5DO8A 5IKCA 1MFEL 5I28A 5B1CA 3HE7B 3OLDA 5F88A 1A4BA 3NAAL 1JMXA 5IEHA 3DSNA 2IPUG 1BD2D 4W68A 5EO0B 1MHPL 5IR1A 1S78D 3C12A 3NFNB 3MODL 1G7PA 4Q2ZB 1UT2A 5D2LE 5E03A 5DVMA 3OKDA 3DXAA 3WEXA 4Y4HA 1OCWL 2E4TA 4HIHA 3P9MB 4QD2E 1TZHA 1FJ1A 4LDOB 4ADJA 4BFEA 2I60L 3ET9F 4NQDB 4DN4H 4ZNEE 3QUKB 3VXOA 4DGWC 4N8VB 5BQDA 1COBA 3IJYB 4RZCB 1G1OA 3RWIA 1JNHA 4QPEA 4JRYE 2WCSA 5I71B 3QZMA 1F1DA 3UL4A 1PD1A 4UQ2B 5L4JA 4M7ZB 2X4QB 3D2TA 1KBGL 3UEZA 4ZMOA 3WN5C 1GAFH 2D2OA 1O9VA 3VSTA 3WO4C 2Y5TB 5I2IA 3KXFA 4CC0A 1BVLB 2ZUQC 3L3OC 4KJYA 4LVOB 3HRPA 4AIEA 3ARBD 3STZA 2FEDD 2X41A 4XCCH 4Y5VA 2CE6A 3FCUB 1VKXA 3IKCB 2CIKA 3EFDH 4HJ0D 4ZW6A 5JHDA 1JGEA 2QVIA 5LG6A 3HE6D 2XTLA 2HMIC 2P5PA 1I9JH 3ARFC 1NGWA 2HVJB 3TIDA 3IN0A 1XF5A 2EYTB 2QL1A 3WSQH 4DK6A 3OLGA 3CFEA 4W93A 1IILE 5DQDL 5C70A 1OVZA 3DWTA 3UYRH 4GSXA 2XWZA 4JPIA 5D5ME 3T5WA 2Q5BA 5EU3A 1SXZA 1PY0A 3HB3B 3ZL2A 3QQ4B 2Z65C 4WSGA 3O2DH 5AB9A 1J5OH 3CMGA 1YDPA 3MV8E 1YECL 3S88H 5I6NA 1YNTF 2XTJC 2D4FA 2HUEA 1WO2A 1LP9A 3C6SB 3NRPA 5ITBH 3W37A 2DRUA 2FHFA 5IVOA 1ZY9A 5CN2A 4ABUA 2B15A 2XZAL 4MCMA 1FLTX 3T2QA 4U6VH 3ILDA 3LZFH 3JWOH 3NN8A 4HULB 1YMMB 2R39A 5CGTA 2AEQL 3PP4L 4D0BA 1CD8A 5M7QA 2KKQA 3F85A 1QKZH 4YSDA 4H20L 4KUCD 1CIDA 4BBWA 3LDBB 1I9RL 3VXMD 1FVDB 4M02A 4UUJA 2B3IA 1FO0H 1GSKA 3EO0B 4A2EA 4TTDC 1RZQA 3H2PA 4ZMVA 5G4NA 1DJHA 2HTLC 3F7LA 3SDXB 2DLHA 3VCLA 5ABZA 1CGSH 3PCYA 2DMHA 3F6IA 3HE7A 3FF8A 2OPCA 3DTDA 4NZRH 5EO0A 3PWNB 4KZDL 1ADWA 4U33A 3TN0B 4FERA 2QVKA 4RDBA 4Q2ZA 3JWDL 2QGEA 2B4CC 5CF3A 3WFCH 1CG9B 3UO1L 2OJEB 3NJLA 1F4HA 5CXPA 5IW3A 3GSUB 4HJ1