1BQRA

Reduced pseudoazurin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
124
structure length
124
Chain Sequence
ADFEVHMLNKGKDGAMVFEPASLKVAPGDTVTFIPTDKGHNVETIKGMIPDGAEAFKSKINENYKVTFTAPGVYGVKCTPHYGMGMVGVVQVGDAPANLEAVKGAKNPKKAQERLDAALAALGN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PSEUDOAZURIN
publication title Crystal structure determinations of oxidized and reduced pseudoazurins from Achromobacter cycloclastes. Concerted movement of copper site in redox forms with the rearrangement of hydrogen bond at a remote histidine.
pubmed doi rcsb
molecule tags Electron transport
total genus 35
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1998-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1bqrA00
2ZXWB 4AKPA 1MG3C 1X9RA 5I26A 3AG4B 3ABMB 5TK2A 1OCRB 2XV2A 1NIEA 3ZIYA 3EHBB 3S3BB 2IWFA 5AFAA 2FWLB 4DP0X 1AZBA 3QJSB 1B3IA 2J55A 3FQ2A 4JKNA 5B3SB 1L9PA 2XV0A 1OOWA 3FSVA 1SFDA 4A2GA 2ZONA 1BXVA 5I5JA 1HAUA 2IAAC 3NJNA 2TSAA 1CURA 4HIPA 4QLWA 1W6LA 5D4HA 1ASPA 1SF3A 4CSZA 1SHXA 3TA4D 1PLAA 5A7EA 2OCCB 3UACA 2QT6A 1JXFA 2BP0B 3GDCA 3QPKA 1NWPA 1QLEB 2XXGA 3ERXA 4YSEA 1PF3A 4A66A 3X1FA 1DYZA 4DP7X 2I85A 3NP3A 9PCYA 2XWZA 4KNTA 1IBYA 1AIZA 3WG7B 3NSFA 3PCYA 5I6KA 2JFCA 1GSKA 3CG8A 4AX3A 4BXSV 1ZDSA 4PCYA 5B1JC 4BDVA 4KNSA 1AS7A 1X9UA 4N8UA 3CVDA 5B1KA 3T71A 7PCYA 1JXDA 3BQVA 4YSTA 5F7BA 4A2EA 2DYSB 1AZCA 1A4AA 1ASQA 3X1NA 1DZ0A 1SDDA 2IDTA 3NJIA 4UAHA 1QHQA 3WNIA 3HEIB 3FSZA 1R1CA 5I5IA 1KDJA 1JZGA 4G7QB 4M4RB 2Y1AA 3KW8A 1AZUA 1IC0A 3UGEA 2XYBA 3AG1B 1NIFA 1JOIA 1PLBA 3N2JA 3T6XA 3TBCA 4E9QA 2FT8A 3T6WA 2BHFA 4YSDA 4NB7A 3MBWB 4HALA 1GY1A 2PLTA 2XV3A 4DP6X 2IH8A 3WKQA 3FU7B 2BZ7A 2XLLA 3WI9A 4E9WA 1OCZB 1ET5A 5FC9A 1AZNA 3NSCA 1NIDA 2BZCA 2GIMA 4NAJA 5PAZA 3AG3B 1ILSA 5B1JA 4DP1X 5I6MA 2FTAA 2IWEA 2VM4A 1A3ZA 3FSWA 3QJTB 3IBOA 1RKRA 1N70A 2VW6A 1AG0A 2HX8A 2IWKA 3OM3B 4DP9X 3PAUA 2AVFA 4WKXA 3QJVB 5I28A 3GXUB 1L9RA 3JTBA 3UABA 2H5UA 4W1TA 3WIAA 1GS6X 3X2QB 8PAZA 2X87A 4HZ1A 2BP8B 1WA0X 2VW4A 4P5SA 1XMEB 2FJSA 3AZUA 1MZZA 2UXGA 2VSMB 3D12B 2EIMB 5IY5B 1L9TA 2JKWA 1L9OA 2XXFA 2MRYA 2YAHA 1KBVA 4UF7C 2P80A 2IDFA 1WAEA 4HCGA 3PAZA 1PNDA 1ZIBA 4MFHA 1AG6A 3EH5B 1ASOA 2Q5BA 1GS8A 1V55B 4UANA 4NERA 2EINB 4YSQA 4A2HA 1OE1A 2GI0A 1W8EA 3G5WA 2XX0A 1HFUA 4DP5X 1TKWA 3T6VA 3ZX1A 3TASA 1OF0A 3JT2A 1OCOB 5AZUA 1ADWA 1J9SA 6PCYA 3U25A 3FT0A 2BW4A 4GYBA 4AI7A 1ET7A 4HHWA 1RZQA 1OE2A 1FWXA 1E5ZA 2AANA 1JZJA 1KGYE 4GY4A 1JERA 5B7MA 5B1AB 5LDUA 1BXUA 3S8GB 3FPXA 1BXAA 1PY0A 3FQ1A 3WNJA 1GR7A 1V10A 1SF5A 4KOCA 4KO6A 1GW0A 3L45A 3OMIB 2R7EB 2I7SA 1J5CA 1L9QA 3CDZA 1SHWA 1F56A 3QQXA 3NSDA 2E86A 3SBPA 2H3XC 4GP4B 4YSPA 2UXTA 2CBPA 2MTAA 3QJQB 4A68A 1KYAA 3C75A 2BWIA 2IDQA 4YVNA 3FQYA 4BXVA 1WA2X 2XX1A 4BDVB 4HCIA 3UAAA 3PAVA 1ILUA 3QJRB 2IDUA 2VN3A 4P5RA 7PAZA 1ID2A 3OMAB 4Q8BA 2PPCA 4GXFA 1SDDB 1FA4A 1KDIA 1NTDA 2UXVA 3IN0A 2VSKB 3BVDB 2OJ1A 2YARA 2CCWA 1MZYA 4DPCX 3DKHA 1PCSA 2YXVA 3NJLA 1W6WA 2XUWA 1E5YA 1AS8A 2RACA 3WKPA 2CAKA 3AG2B 3MX0B 1RCYA 2CJ3A 4EF3A 1MG2C 1CC3A 4DPBX 2A3TA 1NIBA 4F7KA 3UAEA 4G70B 4FAAB 3ZDWA 5B7EA 1AZRA 3NJJA 1WS8A 4Q89A 2AFNA 1AS6A 3UADA 2J5WA 5I6PA 2GC4C 2YAQA 1MDAA 1J5DA 2WO2B 2J57A 3X1BA 1M56B 4BK5C 2CALA 1V54B 4WTQA 3OD3A 4E9YA 4X4KA 3NSYA 4TXVB 2DWTA 2YAPA 1M57B 2VMJA 4A2DA 5I6LA 4N4YB 2FNWA 4KO5A 4YVUA 5EHFA 2YAFA 1JZFA 2HZHA 4KOBA 2UXFA 2ZOOA 2I7OA 3FYEB 4DP8X 2HLEB 1AACA 1BYOA 4BWUA 4YSOA 5F7AA 2Q9OA 1AR1B 4G7RB 1GS7A 2UX6A 4GP5B 1OCCB 1A65A 2FQEA 2XVBA 2TSBA 1UATA 2VM3A 2XU9A 2YAOA 4YL4A 1WA1X 5PCYA 5AKRA 3NP4A 5E9NA 2PPDA 2QDWA 3V9CA 4E9TA 2OV0A 1EZLA 2EIJB 3AY2A 2YAMA 1KBWA 1PZAA 4F2EA 1J9TA 2BP8A 4DP2X 2GC7C 3ABGA 4A2FA 3PXLA 1AQ8A 4CSPA 3KW7A 1BQRA 2DV6A 1JVOA 1I53A 2PCFA 2PP7A 2VW7A 1KCBA 1VLXA 3GYRA 1TEFA 3NJFA 2UX7A 3EH3B 2IH9A 1T5KA 1E65A 1KCWA 2HRHA 3IEAA 1ET8A 1IKOP 1A8ZA 3NJGA 1GY2A 1SJMA 2HRGA 4K9JA 1FFTB 4KO7A 5I6NA 1NPNA 1AAJA 4BWWA 4E9SA 1JZIA 1BQ5A 1J9RA 1BAWA 3DIVA 2BO0A 4YSCA 4BWTA 5D4JA 1J9QA 3QJUB 4M3HA 3CDZB 2H47C 4G7SB 1HAWA 3FU8A 3FU9A 2W88A 2BW5A 2EIKB 4RH4A 2QDVA 3CZUB 2HX9A 1NDTA 1URIA 1NIAA 1JZHA 2AZAA 3ASOB 1JXGA 1NPJA 4AKOA 4DPAX 3CVBA 4YSUA 4W9ZA 2YXWA 1XB3A 3TBBA 3TU6A 1PMYA 2BP0A 3FS9A 2R7EA 1IBZA 1ZIAA 2YQBA 5TK4A 2IDSA 1E30A 2B08A 2AZUA 2PCYA 3NJHA 1EHKB 2HXAA 4YSRA 3FPYA 1ZDQA 4YSAA 5I6OA 1CYXA 4E9VA 3NJMA 1ZPUA 4JHUA 4E9XA 2GHZA 1OV8A 2N0MA 1NICA 1QNIA 2PPEA 3S3CB 1PNCA 2DY2A 2X88A 3ASNB 1PLCA 3IN2A 3NT0A 1A4BA 3SQRA 4QKTA 2PPAA 3AW5A 2P80D 5I5MA 1RZPA 4KNUA 5B1BB 3EF4A 4ENZA 3S8FB 1TEGA 3N55A 2B3IA 2GSMB 3FYIB 1ZV2A 3FSAA 2W8CA 4E9RA 3CVCA 1BEXA 4L0PB 1JVLA 1KV7A 3OQRA 2LLNA 2FT7A 3SBQA 2FQDA 3OMNB 3PPSA 1PAZA 1GYCA 3HB3B 1PZCA 4ZK8A 1SNRA 3X1GA 3DTUB 6PAZA 2NRDA 2Y69B 4HAKA 3H56A 3S3DB 3ABKB 1N68A 1BYPA 4KO9A 3EH4B 4PAZA 4YSSA 1E67A 2CUAA 5B7FA 1AANA 3FU7A 1ETJA 1L9SA 3IE9A 2EILB 2YAEA 1AOZA 2FQGA 2QPDB 3RYMA 3SBRA 1SFHA 1JZEA 1XB6A 3T9WA 3PLYA 4GP8B 1XB8A 3H4FA 1IUZA 2JXMA 5D4IA 3ABLB 4AZUA 2QPEB 3H4HA 1OE3A 2FQFA 1CUOA 2BWDA 3T6ZA 2J56A 4AKQA 3V9EA 2PP9A 4HHGA 2GB2A 2DWSA 4DP4X 3NJKA 4G71B 1NZRA 2WSDA 4F2FA 1BQKA 5ANHA 2PPFA 3X1EA 1NWOA 2WO3B 1A4CA 1PZBA 4HCFA 2ZWNA 2GBAA 4G72B 1YLBB 4A67A 3ZBMA 2FT6A 1WS7A 3NYKA 2HX7A 2PP8A 1CYWA 4FA7B 2DYRB 1TU2A 1M9WA 1NINA 4JHVA
chains in the Genus database with same CATH superfamily
1ES0B 1T83C 1XFPA 1GGIH 3MV7B 4PJ5A 1RJYA 2ZXWB 4QRAA 3II3A 5B3JE 2FX9L 4H1LH 1SJHB 2EYSB 3PYCA 3U1SH 4RWYL 2VOTA 3F05A 4OLVL 2F5BL 1OSZA 4K73A 5AW2B 4ZFOA 4ZODA 4FNRA 4WI9A 5AFAA 3OPUA 4HPHA 5T1KA 5A6MA 4P06A 4MQXD 4XNDA 1AD0B 4JFVA 3FSVA 1I7UA 3M8OH 1NGWB 3HAEB 3BWAB 1JGIA 4N6QA 4FADA 4EN3C 5F21B 4W4NA 5D72H 3NIGF 3TH4T 1KACB 5FFOA 3CFDA 2AK1L 4ODVH 4C83B 2QVIA 3QEUB 2JF1A 3P77A 3V0DA 2H0PA 5IQ7H 2JB5H 5D1ZI 5FKPB 3UACA 1D9KC 3QNYA 5JW4N 4X80H 2OJZH 2J6WA 4Z3TA 3ZDXB 1BBDL 1DE4B 2PCPB 2FBRA 1CGSH 3GKWL 1ETZA 3QUYA 3UG3A 3UZEA 5AB1A 3EYOB 1KLFB 3PHOA 3VXTB 1CFBA 1NUGA 3CDGB 5JMOC 2I85A 3VE0B 4OD3L 4NENA 3FTYA 1X5FA 2H6PB 3BPOB 1TJGL 4BQ8A 1PLGH 3EGSB 2FGZA 2EKSB 4QJ3B 5LNGA 5EIVA 1K4DB 3ULAB 3RVTD 4HHAB 1DFBL 3SKNB 3FONA 5E4EC 4QAWA 1CS6A 5B1KA 1F90L 3D0VA 1NCAL 1JXDA 1KJVA 1LP9A 5DJCA 3RGBA 4TOYL 5IBTL 5I15H 3GXDA 1FVDA 1ASQA 1FNSL 1HH9B 3Q9PA 4DK3A 4GW5B 1NUFA 3WNIA 3C8DA 4N8CL 4JL1A 4I0PA 4TUUA 1KDJA 1WWWX 2FYYA 4G6AD 3VJ6B 3NRQA 5D7LB 1PKQB 4DGIH 2AQTA 2A7BA 3ATDA 1TJHH 2QQKH 2OCFD 3KW8A 3N04A 5HGAB 3SD5A 1FZJA 1SLWA 2NLJA 2F7PA 4OLYH 4TRPH 3TNMB 3SZKC 5MI0B 2IDCA 4CMHC 5EV7A 3VD9A 5DC2A 4ENED 4O02L 4OTXH 2CIIA 2GJZA 1EZSA 3K81A 2VWEE 4I3GA 4KTEL 1OP9A 3H7LA 5C6WH 1XGRB 3QUGA 1FRGL 3BC9A 4RNRA 3D51A 4FMKA 4HULB 4MRBA 2XVKA 5HBBA 1EO7A 1DBBL 1ILSA 5JYMA 4PGCB 1W16A 4QKXB 1KJ2B 3GSXB 4Y5YA 5ICZB 1KCUL 1N70A 4YL9A 4KZCA 5E2VH 1BZ7A 5I16B 3QQNA 4FS0A 2F8IA 3BRDA 2Y22A 3QE5A 4FABH 2N7AA 4HGMA 4WW2B 3ESNA 5J5EA 1PZ2A 4WHTB 1AE6L 4W1TA 1R5WB 2R23A 5EBLA 3IGKA 3QCVL 3SE8L 4NRZA 3NN8A 4PREB 4QY8A 2NY7H 5AW9B 4QRFA 5I6XB 1FE8H 1T5WA 1TVHB 1LDSA 1Q0EA 4PY7A 1RUQL 2VLKB 3UC2A 3WJMA 1TU2B 4XBGA 1ROCA 5FHAH 4FQLL 1RZFH 3WIFA 2N1KA 2N7BA 4F57H 3L08A 4HEPA 4AWJC 5ABAA 2OMVA 1YJDL 2WLKA 4AH2A 3TN0C 3GMMB 3IS0X 4GKSA 4K9EL 4KK6C 4YSQA 1D7CA 4OZHF 1KELH 4KHXL 1QATA 2X41A 3ZX1A 3B2UC 5FK9A 4JM2C 1OLZA 4Z5RA 2UZYA 2BW4A 5T8IA 3HLAA 5IWLA 1AGFB 3RA7L 3MRJA 5D6CA 4F5CA 4XTRC 5C08B 1CYGA 3JZYA 2ZAIA 1AH1A 4H0GA 1T0OA 4URKA 1M1SA 3A6OA 1E4KA 5A43C 5A2LH 1UHVA 2NY4C 4QGYA 1LE9B 3N43F 5AENA 4R26L 4UQ2B 4QRTA 3ULSA 3QFJE 3BCDA 4JKLA 5I9QB 4CW1A 3VU2A 2IGFL 3HN8A 2BY0A 4LCWB 1WO2A 4ZSOA 4RFNB 5E6YA 3CDZA 2WYZA 4NZRL 1JTOA 3WELA 3ZVVA 1U3HB 4Y1AB 1S9VB 2J7LA 4G6MH 1Z5YD 2HRLA 5FYKL 4J3UA 2YJQA 3D09A 5GRZA 4OIIL 4NQTA 3QEHA 5LCVH 4BDVB 3MBED 1ZOXA 2AF2A 3CQQA 2QQNH 4P5RA 4AYFB 1TFPA 3KWWB 4Q8BA 3K0YA 1YPZE 4AM0A 3RDTB 1FA4A 2GJ6D 4NT6B 3RQ3A 1DVFC 4PJGB 3QJFA 1U41A 1DVSA 4LSTL 5D7SL 2VSKB 2J4WL 4UZUA 1IBFA 1BFTA 4HKXB 5BOJA 2DQGL 3OKKA 5J0BA 2HJLB 5DWPA 1I85C 3VXPB 4XXCA 3SGJC 4U3XA 3IAQA 5KSAA 3ZKND 1NCJA 2AQ1A 2C3VA 2JKXA 2P1YA 1WYJA 3FCTA 4JUSA 4LCUA 2GPZA 2WWOA 3WJLC 5EU6B 5ICXA 1T22B 2AJ3A 4BJLA 5MP6H 2YN3A 4AOFA 3GJEB 3KYOA 1SEBB 3RNKB 2E9IA 3VQ1C 4KKBD 2GJ6E 4C56B 1G0YR 3HJEA 4Q0XL 2DJSA 3DUHA 1E8XA 5D1ZB 5F1IB 2P9RA 3GMNB 3IGFA 2E7HA 2MOQA 1L7IH 4PRPB 5C0BB 5JW5A 3KXFB 1TNMA 5IQLA 4RISL 2J5LB 1FLRL 4NC2B 3VTAA 2MNWA 4WHCA 4RWYH 5L0QB 4OLVH 3SKJL 2F5BH 5IESL 3D9AL 3GJFB 4YGVB 5EU5B 2FJFB 5GS0D 1FL5A 2Q76B 7CGTA 3Q8FA 4GMTL 3RL2A 5B22A 2IF7A 3WS6A 3IJEB 2X4QB 4Y2DD 4OKVB 2ZYIA 3NCBB 1ML0A 4NBXB 1BVLB 4WUUB 4HAGA 4UZGA 5E8DL 1Z9PA 2XU9A 1XCQA 1AKJB 3N41B 3CJJA 4PHZA 4Y7MA 3VTTA 4PR5A 1F5WA 3PDDA 4ZOEA 4XXDA 3V9CA 2AK1H 4IBZA 1ZT1B 3SDDD 4P2RB 5SWSA 3L3KB 3ES6B 3N1GC 4NN7C 4BQ6A 4HIIB 3P3TA 3WFZA 3P4OA 4GS7C 4GSQA 1BBDH 1BQRA 2I07A 5I8EB 1ZLSL 3ARBA 5ERWB 2I9TA 3T2OA 2VW7A 3GKWH 2X3BA 3MJWA 3P3UA 1E5CA 4OD3H 5EOTA 1E27A 4R3SB 3UXFA 3MJ6A 4WHYH 3RURA 3VD3A 3RE0A 5AOZA 1QWHA 3ISYA 3X14B 3DLQR 4K9JA 3U2IA 4KO7A 4JFOB 4JFYA 3EGXA 2D7QA 2AXFA 4Y16B 2HJKB 1F90H 5IK3A 2N3JA 3MCKA 2O6CA 4QXVA 5EIIB 1NAML 3WNLA 3VDBA 4TOYH 5IBTH 4AVIA 3DGCR 1FNSH 1RHHA 3LNIA 1VKXB 4AJ0A 3ZE1E 3MJ9L 4N8CH 4UDUB 5DJYB 5H2BA 3GI8L 1P6FA 1BX2A 2A74C 1RAMA 3LKPB 3VFMA 2BP3A 1LILA 4NGHL 4EQ2A 3PXHA 3P02A 2Z31B 3L95A 5FS5A 2FZ3B 1P4IL 3F3HA 4NP4L 3L9RB 5EO9B 1DUYA 4PP1C 2UZIL 4OI7A 5F2FA 1WITA 1NCCL 3U36B 3KBPA 2VMDA 2DEXX 1ZGLA 4O02H 4QYOB 1IFHL 2Y5QA 4KTEH 4QXWA 3HVDA 3MUZ1 2W80C 4KKRA 1FRGH 4HSAC 3O0LA 2IPUK 5E1IA 1A6VL 2D4DA 2RGSA 1IGJB 3PABB 3UIZA 5TQ0L 4BK8A 1C12A 5EU7C 4P2OB 4BFEA 1KCUH 1IAOB 1NICA 3BH9B 4HUNB 3VH8A 2F53A 4OIBA 5DLML 1YNTF 4F8TA 3IDMA 1D7DA 5L8LB 3PNRB 4R2GD 1JHLL 5IMLA 3AT0A 1ORQB 4Y2LA 1AE6H 3VFOB 4PHXA 1NMBL 1TEGA 2YGVA 3QCVH 5H37G 2FYVA 3SE8H 1CDUA 4R4NC 1IE5A 1I8UA 3AS0A 2WSPA 3BJ91 3WKYA 2FK9A 4J3OC 2GSGA 3WNPA 1JHKL 3C08L 1RUQH 4AVHA 4HPYL 1NFDB 1ZJBA 3VB9A 3MNVA 3U6RA 5JZ7C 3LS4L 3TZVD 4FQLH 4H1LB 3SBQA 2VNCA 3GHEL 3OMNB 3HB3B 1JDAA 3B3IB 4HUKB 3MRCA 4LSSL 4E41D 5JIQA 1R3IL 1YJDH 5CBEA 1UH3A 4FYTA 1CD0A 2XQYG 3FB8B 5CFAA 4ODSL 3WTTA 3ARFA 4K9EH 3EH4B 4KO9A 5DVNA 3U30C 4ZX4A 4LRIA 5AOMA 2CUAA 3WIIL 1CG9A 1TYRA 2ALAA 2F1BA 4KHXH 2A73B 3QA3A 1UFUA 1EJOL 3C6LA 1ZHNA 2FQGA 1TCMA 3SDCC 3T04D 4FL4C 5C9JA 1MOEA 3GXIA 4OU3A 1QBBA 4PJFE 1H8LA 4NN6C 4ZAKA 3UPCA 4DERA 1N5YL 3RA7H 1E9QA 3PGCA 3GTNA 1KTCA 1IJ9A 3CZEA 4E41E 5KW9L 4E5XG 2GK2A 4PRNA 5JHDE 1NMCB 4TNFA 3ZL2A 1OF2A 3RGVD 1WF5A 1BQKA 1UEYA 2YQ3A 4R26H 3REVB 3U48A 1S7QA 4PG2C 4EI5D 2IGFH 1PD0A 3SCMA 5LXVA 1UEMA 4KK8D 5CCKL 5DJDA 4X83A 3M7OA 4DH2A 4NZRH 1I7TA 4WI6A 2EIDA 4ICXA 1PGRB 2GTZB 5FYKH 3D2UD 3PP4L 1DBKL 1YMHA 4RVBA 1A6AA 1IFRA 1IGTA 4L4VA 4OIIH 4OKDA 3ZKXC 2XC8A 4PJBB 4Z7VF 3BW9B 2J1WA 1H3VA 1MCSA 1KMGA 4NQEB 5TF1L 2IO5A 1JFHA 4O51B 5IR1B 2FIKB 3NCJL 3PHAA 3NIFE 2ORBL 4U6XA 3U7AA 2TAAA 2IV8A 4UQAA 2D0GA 4LCCC 5KN5A 2YPLB 1G9ML 1XGPB 3KHOA 8CGTA 4XMVA 5L2KA 3ZTDC 4LSTH 2H26A 5D7SH 2VDLL 4C47A 1SFDA 2J4WH 5EIQA 4FI7A 2DQGH 3NJNA 5DS8B 3DROB 3CUPA 3GMOB 2H41A 3KJ4B 4XWOC 3RIFF 3O9WD 3ESMA 2CKBA 3O41B 2Y72A 2JQZA 3PWPD 3RVXD 1Z9NA 2OPCA 3RX5A 5E2TH 5KZCB 4QGTA 4UB0L 1QBML 2R2EB 3FO2A 2VLRE 4WK4B 4GFTB 1KCLA 3GDCA 4XCYB 2ZP8A 4Q0XH 3VMPA 4GBXC 3QIWB 3UYOD 3B34A 1KEGH 2WO4A 3KLKA 1S2EA 1JF5A 5CFHA 3U9PL 4ISVB 3QQDB 3R7RA 1QABA 1MLBA 4AGMA 1E9PB 4RISH 1JK9A 2J8UB 3PWPE 4N2IA 3WN5A 4J3TA 1FLRH 3PJNA 2VLJA 2CKNA 1UQSA 4Z3GA 4F91B 1KXVA 1LO5A 3AS1A 4MS6A 3SKJH 4L9LC 4LDEB 3B9KD 5IESH 3VMOA 3R4DA 4OFIA 2VZUA 1RV6X 2AQ2A 4GMTH 3LTVA 5CXPA 4CSTA 1QHQA 2ZUUA 5IJKA 1AY1L 1SXZA 3FQNA 4MNQB 5TH2B 5E8DH 3UMTA 3VACA 4BEIA 3VD0A 2FO1A 5AOLA 5DK0B 5K9KB 1PLBA 4EVNA 2YD8A 1NA8A 2HYMA 3EG9A 1NL0L 3RWIB 4HSQA 4P8QA 1CXLA 4YSDA 4A6YL 2J43A 4G8EA 3IJSA 5DFWH 2R9HC 3CZKA 4LHJB 1DQJB 2YPVA 5KBDA 3INUL 1DQLL 4K94L 1Y1UA 2B1OA 2G9KA 1DVXA 4K3EL 1ET5A 3A23A 1ZLSH 3CFKA 5E94B 4BKSC 1KGCD 1MIMH 3F6LA 1KPRB 3E2HC 3RY5A 3AG3B 5HHMD 3UTTB 5I6MA 4Q4IA 3UMNA 4WJ5B 4XMZA 4FNPA 5ISZD 4QDGA 2HX8A 3OM3B 1CFTA 5F71A 3QORD 3DTXB 4RGOL 4CC0A 3OR7B 4MCZA 2AMGA 2AXJA 4DOHB 1NAMH 3SQOL 1XBRA 1WE5A 4LGSB 3QDMD 3VXMB 1OLLA 4Q9BA 4Y4FB 4TPRL 1KGCE 1WFOA 2GIXA 1G6VK 2JKJA 5B38G 2W9EL 5HHME 3GI8H 4OVUA 4ZTOH 2YAHA 3L6FB 2V8MA 4YZFE 3UPRA 3EYQC 2CO2A 4OCLC 4XMLL 3IMRA 1UVQB 3VA2C 1TG8A 3VGBA 4BFBD 1P4IH 4NP4H 1QASA 4MAUL 2UZIH 1W8NA 2I27N 2ZXBA 1YNLL 1NCCH 4WEBL 5HSFA 1KN2H 4LK4A 3NESA 3IFOA 2MOVA 1HWGB 1BLNB 1HDMB 3D0LB 3QDME 2XZAL 1TTRA 3B9VA 1B90A 1FIGL 1IFHH 4XH2B 2Q6WB 4OFYA 4NXSA 4N0UB 2DQDL 4W81A 4UQBA 5T3XL 2F6AA 1G7LB 4OSUL 4KY2A 1CT8A 1A6VH 5CWSB 4IIQA 4FNTA 3RP1A 3V6OC 3RPBA 2DH3A 3HRZA 5TQ0H 5LGJA 3MRHB 1DJGA 1KG0B 1BFOB 2L7QA 1CU4L 3B9AA 4FNLH 4P59L 2DQIL 4ERSH 2NY3C 3KLSA 4M61A 1KCRL 2HT4C 4KX7A 4P46D 5DLMH 2DYPD 1XCWA 3E3QC 5E6IA 1TJIL 4M8UA 1JHLH 2AQPA 1S3RA 3D06A 1NCNA 2Z7UA 3QHTC 4ZPTB 3W57A 2ZOLB 3D18A 4RMRA 1NSNL 1GR7A 1NMBH 4OF7A 5BOZG 2CLRA 1XH3A 4L05A 2BZDA 5FYJD 5I76B 1REIA 4OM1L 2B59A 1SXAA 3KPRB 3C08H 3FXIC 4DKEL 1JF1A 4HPYH 4KROC 4O2CB 4NCC1 4XN9A 3Q5TA 2X4TA 3A5VA 3FB7B 2MTAA 3LS4H 3QJQB 4GSRA 3GHEH 3ZMNA 1EXUA 1R3HB 3WDHA 3BQUB 4X6CE 3EJYC 4LSSH 5IMMB 5K9OA 3ZHNA 3ARPA 1H3XA 3JV0A 1HHHA 4Z0XA 4M1CD 5FYJE 3Q8CA 5FW6A 5HY9B 2ESVA 3EO9L 1SDDB 2H32H 4EMZA 1EJOH 1H8NA 4NS0A 1ZA6A 5J6GB 2ICEC 4WKZA 2AEQL 1FV1A 5HI5D 1UCTA 1N5YH 3KYMB 4PJEB 5FGCE 4MJ6A 4Y4KA 4XE0A 2KUTA 4PJHB 2Q7YB 3C87A 4WJG3 3WJJA 4QRPE 1KYDA 3QQ4A 1ZTXE 1TQTA 2V8LA 1KTJA 2AFNA 3T77B 5JIPA 1QUNB 4LBEA 1F6AA 2ZWKA 1CLOL 4KXBA 4F37K 5CCKH 1MDAA 4HXAL 4RZKA 4JRXB 4L8DA 3O6FB 4A38A 3B7YA 1KTLB 3DXAA 3J27A 5BUGA 4Y5XC 1Q38A 1Z0NA 2GHWB 3UDWA 2F54B 3ULUD 1DBKH 1BF5A 5IB4A 4X9FA 5B1CA 3NEXA 3KWVA 2VMJA 3ZE0E 3EFOB 1DEDA 3GBML 2J88L 5JTWA 3OTTA 4ZUWB 3QXAA 2ED7A 4RAVB 3L5WA 5DJZB 3NCJH 3ZYJA 1MEXL 2ORBH 2YK1L 4LPYA 5DHYB 4ADIA 3U4BL 3FTXA 2YSSA 4YHOL 4RDQF 1G9MH 1GH7A 2C7UB 2X10A 2EDBA 4IKLA 2BMKB 1CDCA 4G59C 2VDLH 3VD7A 1DSWA 1JPSL 3N3EA 3NIFF 1WZKA 4AK1A 1JZ4A 3WHE0 1F3DJ 3OC8A 4JVWA 4GSDL 4M6ML 3LNEA 4XNBA 3SE4C 1HH6B 1KCVL 3FB5B 4F8PA 3MUUA 3PQYB 4YHNB 2YSTA 1KBWA 1PAMA 1GSMA 1QBMH 1JK8A 4UB0H 4O02B 2RFXA 4XN1A 1MCHA 2VXQH 5JNYA 4LB8A 4WWNA 1F4AA 2EKJA 1NOLA 5JW3H 3ARXA 2JCCB 1EHNA 4FYQA 1MCWW 5AW6B 1EZVY 2WOBA 3U9PH 2OK0L 1T5KA 4ANUA 1OP5K 5D5MB 1NFIB 2X3CA 3IEAA 4FFWC 2HVBA 4HKZB 1NDMA 1TUPA 4OGAC 3DI3B 4L1TA 5KYXA 3O3EA 4IGBA 2BCKA 4DPRA 1NPNA 2DBJA 3TVMD 4D0BA 2BSRA 3WLBB 4AEHL 5KSUA 1N12A 2WN2A 1JJUA 5CEXB 1IARB 1I8MB 4WWKC 5IB2B 1UM6L 4ADGA 4TQHA 3OGOE 2F1EA 3MGTA 2WLHA 3FU9A 4IDJL 2X9WA 1G7MA 2YLHA 2EIKB 4FHJA 3K6DA 3VWKC 4I4WB 2AV7A 3IMWA 2GK0A 2QKIC 1A7NL 3FU5A 2F5AL 4QWWD 1NL0H 5HHQB 1OK8A 4A6YH 5FM4A 1S5HB 3CFEA 2ZOTA 4DO5A 3IJYA 1PMYA 2NXYC 3INUH 3FUDA 4LSVL 1DQLH 3DURB 4K94H 1ZIAA 3ARWA 5BRPA 4PW3A 4K3EH 3IMBA 1E30A 4TLKA 2KI6A 3JBG7 3HBQA 3U0TA 1DBAH 5GGTL 1N26A 2QSCL 3NJMA 4X0KA 2VZ3A 4ZNEE 4AXWA 1I3VA 4PJ8C 1KIRB 2OSWA 3ZLQC 3Q06A 2O5YL 3BH8A 4NKMA 4RGOH 4QRRA 1CGWA 3ARDC 1A6TB 5DQJA 5EU3B 5J12C 1E28A 5D1XB 1BZEA 3ENEA 3S8FB 3WYRA 2VN4A 4QCIA 1A4JB 2Y06L 3SQOH 1XT5A 2OM5A 3ME0A 2H4EA 4RESB 1N9PA 4GQZA 2AQRA 1XO8A 3MC0A 5E03A 3V4VL 4M8VA 2OYPA 3FFCD 2C9PA 2BC4B 3O2VL 4FLQA 1ZXQA 4BSVA 4CMMB 3GLEA 3SO3C 1BD2B 4XMLH 4H88L 5KBKA 5MENA 4K5NA 2E6PA 4TTDC 1BGXH 4B96A 5AB0A 4MAUH 1MCNA 4JFFD 5DK3A 4ZK8A 5KBLA 2BXZA 3MV7D 1X6NA 3B3BA 4YO0B 2DMCA 4JY5L 5E0QA 5EPMA 5K39A 4WEBH 4O2EB 4OFPA 1HJBC 4YZFF 3ARSA 3ZR5A 3WV0A 4GKNB 2FX8L 4GLRH 4HJIA 2XZAH 1FIGH 1QLEH 2ERJB 2WZ6A 2DQDH 3SDXE 1I8KB 3KM2A 3JZ7A 2L0DA 3FFCE 5T3XH 4S2SA 3QYNA 3RVVD 4OSUH 3O3AA 3F5WB 3I9AA 5DFTA 1TOXA 3B2PA 1XB8A 4PVNA 1QLFB 5IQ9A 1WC7A 4O00A 4JFFE 1OP3K 4P59H 3ABLB 2DWEA 3MV7E 4L1HA 2DQIH 3WTXA 3IDYC 1HHGB 1T3FA 1KCRH 3CVHL 4H40A 4F7CB 4HHGA 2JKSA 5LBGA 1MCFA 1TJIH 4PSRA 1RZJC 4LCYB 4RX4D 1AZZC 1MFEL 3B7SA 5IB5B 1U8QB 2O72A 1NSNH 2AXGA 3AQDA 5I1IL 4ZO9A 3N50A 3APMA 4PQXA 4H8UA 5KG9A 1B6UA 1ZPLA 4DKEH 2HG5B 3RWGB 2V9UA 3NJVA 3RI5F 4PJXB 3RTQA 2XZZA 3QUHA 1JWMA 4AKPA 2BCMA 5JPMA 1KPUB 5I26A 5D7HA 3QUYC 3UZEC 3Q01A 5DK2A 3P0YL 1YYML 1D7FA 3GGWB 4U1KB 2Z4QB 3D2TA 2E8YA 1GW6A 4BZ2H 4ZXBA 3I9GL 2EABA 1EO5A 4X6CF 3EO9H 3VXUA 3HC2A 4JKNA 5DDHB 4MA1C 2OL3H 4P2AA 4TLUA 4PTUB 4N5UA 4ZQKA 2NR6D 5GSVA 5TE6H 2AEQH 5J3HC 4IHOA 3P69A 2VRQA 3TV3L 1OZUA 1O6SB 3QJOA 5CHNA 4I0PC 5D7LD 5AVTB 2R1WA 2WJ7A 1IGFL 5DYOA 4BRJA 1KYOK 5F9JA 1I7ZA 2OMYA 2APXA 2QT6A 2XPZA 4OCNC 1JV5B 2AJZA 2F15A 4IS6B 2LTQC 4S1SL 3OKEA 4N87A 1CLOH 1CDGA 4MD0B 2OP4L 1JPTL 1PF3A 1W0VA 4KNTA 2RJMA 5H37A 2IADB 1SEQH 1PKQE 2GY7B 4NAQA 5D7LE 1P7BA 3PCYA 3T0EB 2JFCA 2X4SB 3LZPA 5I17B 1UJ3B 2LQRA 3J2PA 4K5PA 2H3NA 3GBMH 3UYPA 4KNSA 4Z7QF 4M7LT 4Y5YC 1HCFX 3FCUB 4PCKA 4X4ZA 4Z7VA 4LLDB 1NAMB 4LLWA 2YK1H 3LMJL 1PFCA 4EUPA 1UZ6E 3U4BH 3QZNA 1M05A 3ZE0F 1GXEA 3ETBF 1F0LA 3LQMA 1RK1B 3MTRA 4WNJA 5F1OB 1Z5LA 3JYCA 2X42A 5TDPA 3V6BR 4IRSA 3DECA 1JZGA 4A7VA 2XYCA 4M1DL 4XC3L 1FZMB 2R69L 1JPSH 2VR9A 1AXSA 4ODUA 4RGND 3VRLE 2VLKD 4GSDH 4M6MH 2PMZA 4TKWA 5IM7A 1MCDA 3G08B 4H5SA 1EK3A 3E6FB 2XJKA 1KCVH 3L1FA 3ULUF 3VD2A 1G0XA 4NB7A 2NYZA 2IALB 4U0RB 4M6NL 1KC5H 4XNZB 1ZS8A 2PWEA 4HH9A 4X7TB 2BZ7A 2EECA 2EXYD 1IKFL 4U49A 4YLCA 3P4NB 5DI8B 5SV4A 1SN5A 2CDFA 4RGNE 1TVDA 5HYSA 2J8OA 1GGYA 2WZAA 3TS8A 2A6JB 3SE6A 2Y6TE 2VLKE 4BH7B 5F9AC 2JXMB 4ABQA 6TAAA 1IBBA 1WH0A 5E00A 1AHWB 2E59A 5IWLC 2BVPA 1PIGA 5C08D 1OTUD 1A9EB 2R2HB 2GJ6A 3M1BB 2B2XL 4I48A 1QSFA 3VAEA 1Y6KR 8PAZA 4KKCD 3P4MA 1OK0A 1E4KC 4FQQB 2QMKA 4JHWL 3Q13A 4FX5A 2ZP9A 3I3BA 3RKDD 3N1FC 3PS6A 1M7IB 5G4MA 4RGMB 4NJAL 1BEYL 1O6TA 4IMLB 4IDJH 1N6VA 4LCWD 3K2KA 4PJCE 3TA3A 3CU1A 4D8OA 2JKIS 2ZPKL 1BLIA 4GLRI 2Y7LA 3CFIC 1U3HD 3KBHE 4KJWD 4Y1AD 1BMWA 3VFNA 4N0CC 5C08E 4HU8A 4M03A 4LEXL 1CD8A 2F5AH 4R97C 4FQ2L 1T66C 1A3LL 3BZEB 5ENWA 5BZXA 1QTYT 4LSVH 2NOYA 1G7JB 2F58L 3LNGA 2ITCB 2H32B 3CZJA 3EO1A 3KS0J 3VI3F 3VXOA 3OJ2C 4LCWE 3VGAB 1MAJA 2WWKO 5CMAA 2YD0A 5L4MA 3LRKA 4P2QB 4JFDD 5E51A 5GGTH 3RDTD 4HUVB 3BP6B 5KJRH 2QSCH 4HMDA 4NQVA 3WHE1 1T0NA 1BXXA 3BKCL 4QO1A 3GBLA 1VACA 4HV8A 4B7LA 1S9YB 2I69A 2UY6B 2V5TA 4PP2B 2H0EA 3BIKB 4XXCC 4FQJL 4CVWA 3DX3A 5KSAC 5I1HL 2XTLA 3M07A 3O6LL 1SF5A 5EU6D 3KD4A 3HPJA 2Y06H 5E8EA 1Q9KB 4WFFD 2NY1C 4H0LC 5KYYA 2V6HA 1CJYA 2D7OA 2NUTA 1CFSA 1AXIB 4JFDE 4FFYL 4ICWA 4C56D 3O2VH 1J7VR 2V4LA 4WO4B 4Y7OC 3CSYB 3BOVA 2GTWA 3ECQA 1C16B 5CGTA 4ZYKA 5BRZB 4JGNA 4MHHG 4L8SB 2NTFA 1SMDA 4PRPD 5C0BD 1OAQL 4ONGL 2GJPA 4IRJB 4V1DB 4AV0A 1QA9B 2XX1A 2Z92A 3KXFD 1XTLA 4IU3A 3K3QA 4JY5H 1G4RA 4JW3A 3GB7B 5EU6E 4XHJD 5IZ7A 4U1NB 4CVUA 3GS4A 2A4ZA 4WFFE 4L3ED 2WYIA 4ZOBA 3Q2CA 4G1MB 5BZDB 5HPMA 3LIZH 4R84A 3C60B 4LVHB 4YDJA 4C56E 4LOFA 4PY8J 4ELMA 2VDLB 5HHOA 4UM9B 4ELKB 3IWUA 4KXCA 1CN4A 4EDXB 3WS6C 3WFHB 2WXQA 4PRPE 4NPJA 5C0BE 3SDXF 5IQMA 2AJUL 4WUUD 4IMKA 3EGDB 3KXFE 1J8HA 3CVHH 1CC3A 1QWUA 5DJAB 1AKJD 2QV4A 1AZVA 1WZAA 5F7FA 4OCYH 3WUWA 1MFEH 1L4IA 3ROOB 3LD8B 3L3JA 4L3EE 3PWNA 4OAWA 1VHPA 4KFMA 2A77L 2JTYA 2BOBA 4P2RD 1WTLA 1RSFA 5I1IH 4XODA 3UPAA 4HGWB 1EDHA 1T1ZA 1A1MB 4HYTB 1FYTB 3LB6D 4WGKA 4HXBL 1A5FL 4WUUE 3ARBC 3ZOAA 2DWTA 3QO0A 4A1RA 2L3BA 5A6LA 2V2XB 3P0YH 1CXHA 3LZLA 4BE5A 2ITFA 4K07A 1XIWB 4KO5A 1YYMH 2FR4B 1U3YA 5EHFA 4APXA 1MNUL 3P3SA 4HWNA 1BQHB 3A4EA 3I9GH 2VDOL 3BEWA 4Y16D 2G5BB 1J86A 2FRGP 4OF8A 4UQ9A 1J8KA 3FO9B 3BAWA 1LVEA 5F88A 4QRBA 2FJGB 3MA9L 5JXAL 2ZCKH 2BNUA 3QIUB 1HT6A 1AI1L 3NP4A 3TV3H 2XWJA 2C9SA 4GXUN 1FLTX 3ZDXF 1IGFH 1S7RA 5TDOA 2P7TA 2Z31D 4A6YB 5F0PB 3C5JB 4K8RD 1AGEB 2BP8A 5FCUL 4CVZA 5IBUB 3AS2A 4CSPA 4S1SH 2DV6A 2XBTA 1CI3M 3GUFA 1KCBA 4H8WC 4Q9RL 2OP4H 3QEGL 1JPTH 4Q6IA 1JWUA 3K1DA 4E41A 3WU1A 4QTHB 4YDMA 3TXAA 1J05B 3PJSA 3BRGC 2OSLA 3G5YA 1GTNA 3VCLA 3UJIL 1FZKB 1WAAE 4P2OD 5D9SA 2F74A 1HQRA 5I18L 2ZX6A 5F7NC 1WISA 3JQOB 4NYLB 2V2TA 1BAWA 5IROD 2BO0A 3HC0B 4IJ3B 3LMJH 1JNHA 1OWRM 3OJDA 4X7EC 3P30L 4XVUC 2KT6A 3K6SB 2BNQB 5JOPD 1BJ1J 2LU3A 1MWAA 4X6BA 4XC3H 1UD6A 2W88A 3PL6B 1F3RB 1QFWL 2A9ML 2R69H 4JHAL 3PY9A 4XCEA 4MLSA 1HZLA 4AGPA 5HDBB 1NIAA 5B8CB 3OKOB 4XNMA 2IPKB 5LGYA 3M1CA 3DGDA 2DTSA 4XNQB 4XO8A 3IK2A 2YD7A 1FH5L 1YEFL 1YCSA 5D7KD 4HIJB 4M6NH 2NW3A 5KSBB 2K78A 4NAMA 5IEKA 3VRLF 3BP7A 4PRIB 4PBWD 5I8OL 4NRXB 2G3ZA 1IKFH 2JB6B 4DO4A 2CJSA 4UTCA 3T4AA 3HG2A 3DBSA 2HKFL 3NJHA 4MYPA 4Z7UA 3ARFC 5J11C 3X11A 2Y7QB 2ICWJ 3EH1A 4LRIC 4YSRA 4BFOA 2H1PL 4EN2A 1H6TA 4WW2F 5TGBA 3FOLA 3C6LC 1T6VN 1HSAB 3HR5B 5D2LA 5E0FA 2P8PB 5C07A 2VZVA 1RP8A 2BSED 3WOVA 1X5GA 2I24N 3BUTA 4ZAKC 3ETBJ 4NO0B 5E9AA 4KKAC 3GMQA 3DX1A 3S4SB 4XPTL 1S7SB 2B2XH 1RZPA 4PD4K 5K33A 1L7TL 4ZUTB 4GRWH 2D31A 5C0GA 3ZMEA 3UOAB 4JHWH 2HFFA 5BZWA 1F41A 3ZZ1A 2K1MA 2GVYA 1JUFA 3O9WA 2AEWA 2HTLC 1S7VA 5FECA 3VQ2C 1BEYH 1VEOA 5K9JH 3HHSB 4N2DA 3SCMC 2FT7A 2ZPKH 1IGIL 3GSWB 1PD6A 5K59E 3CK0L 3RX7A 4XN2A 4HK3J 5F6HJ 1KJ3H 3IDIB 2X4UA 4LEXH 1G7PA 4JFEA 4GRLB 4FQ2H 5A2AA 1A3LH 3W11C 3BGMA 1U8HB 2DKMA 4B50A 5I0XA 2HT3C 1QRKA 2F58H 2XWCA 4NQED 5J13C 1TDQA 1UB5A 3H1ZA 5FAAA 1I1AB 5AW3B 5CEZL 4M4PA 4QI3A 1OAZL 1MHCB 3C5ZA 2OR9L 2YPLD 4ZFZB 5TF0A 5DA0B 3B9KA 1NC2B 5CLWA 5JIDA 1P4BL 3RWDB 3FCGA 3H4HA 4A7SA 1QEXA 4KBPA 1UACL 2IXQA 2DWXA 4PJBE 2ZX9A 3WE6A 4FQJH 2EICA 5I1HH 2P5PA 4NQEE 2WTPA 5FA4A 5KZCD 1NPUA 3TEUA 3AMKA 1RERA 1YLBB 1QQDB 3DJZA 4UQ3A 2FT6A 4UAOB 5EZLA 1F42A 3S5ZA 4FNSA 2YPLE 4X8JB 4FA7B 4FFYH 5IV2A 1NINA 1O6VA 5E5MB 3B83A 4FHKA 1MFNA 3QIWD 2ZZUT 1PFOA 4L2LA 1I1YB 2UZPA 3P9WB 3QZWB 1DJXA 4RAUA 3U1PA 1OAQH 4ONGH 2V7HB 3IDGB 4F20A 3UTSA 1YQ2A 4L1DA 2QGEA 4PJGF 4FFZL 4I18A 1GJIA 4CNIB 5IJDC 5AUMB 3FMGL 4G9FA 4U3HA 3WN5C 2FHBA 3FQTB 2Q8AL 2V5YA 4LKXB 3VVVA 4F27A 4GIOA 1KXVC 3QJSB 3G5VA 5HGDB 1GYWA 5D2NA 2I60L 4FQHA 2WTRA 2WLLB 3ZGIA 2ALWA 3LKOA 2E7LC 1QPPA 2F8OA 4N0YL 5ISZA 3LN4B 3OKLA 5J9PB 3QORA 1CGVA 1SLUA 2IAAC 3BISA 5I8CB 5IMKB 2TSAA 1HEZA 5D7JA 3NFSH 3OLEA 3BXNB 2AJUH 5IJKC 5DVLA 4JAMA 3U9WA 1HVXA 3QDMA 2FVNA 4V2BA 1YHPA 1I1RA 3GS7A 4OLXL 1RK0B 4KMLB 3DOHA 3GIVB 1N5AA 2CMRL 2V9QA 2A77H 3GXTA 2X1QA 3K6OA 2WWMC 3KPNA 1RZ7L 4XNAA 4HXBH 2VJXA 1A5FH 2HLAA 4JDZB 4N2KA 1PVHA 3NSFA 1PDKA 1UYWL 3QI9A 2ZXEB 4P23A 3UTTD 1XZ0B 2EZ0D 1JRHL 3HUJB 4N8UA 1NCHA 4QXGL 4OZFH 4AGQA 2P44B 1MNUH 2N4IA 1ZY9A 2WLNA 4HIEA 4KXAA 2F7IA 3N41F 2IDTA 4GI9A 1PIFA 2VDOH 1UT2A 4FXKB 4N9GB 2BVOB 3SKOA 1ZT7B 5L2JA 2ZXCA 3G5ZB 3VXMD 3QUZA 4Y4FD 2DYPA 2Q86B 4X6CA 3MA9H 5JXAH 5ID0A 3FQWA 3UGEA 3UTTE 4MXWL 1AI1H 1WIUA 1NIFA 1DJZA 4J27A 3T6XA 3TBCA 3O4OC 4O4YL 1AD9A 3UZQA 4E9QA 1YN6B 1VSCA 2NX5B 3FDWA 3FTGB 3TEZA 2PO6A 3UZVA 3W39B 3REWA 4K7FA 3W81A 2J1YA 2B3RA 3V0EA 4OGYL 2IH8A 2R56H 5FCUH 3TBWA 4J6IA 3WKQA 1TQSA 5DEGB 4DOHE 5GXBB 3H9ZA 1YVLA 4F8NA 3VXME 4Q9RH 3QEGH 4L3FA 4UDTB 3HKZA 4NUGL 3MRRA 3WMPA 3VFPA 5B1JA 2BVEA 2KC0A 4PJ7B 1IQWL 2G9HB 4X7DC 3FSWA 1DVZA 5F3HA 3MRKA 3O3DB 5CGYC 3C6EA 3BPNC 2RH0A 3MOQA 3VU1A 4D0DB 4Z7NB 1JP5A 1USZA 3PAUA 2R1YA 5D96C 3STZA 5I28A 4IIQC 4RA3A 3UJIH 4E0RB 4JN1L 3CMOL 5I18H 3ZO0A 3HRZC 1DN2A 3GSVB 3T0VA 4WWPA 3WD5L 2XRAH 5GZOD 5KS9E 4JX0A 3UBXG 2P26A 2ICWA 4FJYA 4MMYB 4BE6A 4TVSa 5E6IC 5JORA 4IBLT 3IM1A 5DQ9A 4ZMYA 3V4VB 2EIMB 2WC7A 2CGZA 4N0UE 3WMQA 1L9OA 2IPUG 4U1MA 4FG4A 1YQVL 1QFWH 4JLRA 5HJ3A 3JWNG 4JHAH 2FH6A 4UF7C 2X44D 3KPRD 4XMWA 4KKLC 4R7NA 1PZSA 2QGCA 4LSUH 2XFGB 2ZJSL 4MFHA 5CCJA 2PKDA 2DD8L 4IKJA 1HSBA 5CN2A 1YEJL 2IPTL 2CRYA 1FFNB 1FH5H 1V55B 1YEFH 1KLUA 1LD9B 2B9BA 3BHBA 3IXTA 5GRYA 2PN5A 3BQUD 4Q6KA 4LEOB 4L1BA 4JDTL 5AYQA 3SPCA 4MA8L 3ZJAA 5HVHB 4N26A 2DLEA 2ZOWA 2J8HA 5I8OH 2X6BA 3ESOA 5C2UB 1IAIH 6PCYA 2H1LM 2HKFH 3TONA 3CZGA 1YRKA 1FWXA 1LEKA 1WUZA 3KPRE 3WO4B 2NY6B 2XQ0A 4JHZA 5LG1A 4F7MB 4Z7AA 3WUZA 4KZDL 1M6OB 2A2QT 3NAAL 2FEEL 2HFEA 1I3RA 2OQJB 3CVHB 2XA8L 4OUUB 1MW1A 3VFUB 4XPTH 1NFDF 4MZ2A 2ZSVB 4X9YA 2K4WA 3SBWA 1L7TH 4RMUA 4Y4KC 3QO1A 1LMIA 4KO6A 4GB9A 1R3LA 5F9WB 3OMIB 2C9UA 4OCRH 3WJJC 3PWJB 1HU8A 5EFIA 1CZ8L 1P7QB 3H9SA 5HHNB 3ECBB 4D8PA 3T2QA 3EDFA 4S11A 3ZDZB 2XN9D 4LLQB 1OGPA 4KXZI 4JRXD 4MMXB 4QMEA 1IGIH 4UOJA 5E95B 4J12A 2D73A 2BWIA 3LPWA 2BVQB 4BXVA 1WA2X 5FUCE 1FL3A 1G7HB 2F54D 5AEAA 4OFKA 3UDWC 2FWSA 4PJHE 4AIZA 4G6KH 1G9NL 2VN3A 4JY4A 5EUOA 5DJ6A 1R5VA 4KMTL 3HKFA 2H2SD 5K59F 1TMCB 2WMPB 2PXYB 1E6JL 3MGAA 3L4YA 3PWUA 4GI6A 3OJMB 4P4KA 2J6EL 2MCMA 5BZZA 3O2DA 5CEZH 5DS2A 5ALBL 4D94A 1OAZH 5DC4B 1MCIA 1NDGB 4U3SB 2XN9E 5CCHE 5MEOB 4TUKL 1SOQA 1U58B 2OR9H 4JRXE 4EIBA 3QSKB 2XUWA 3VI3A 1P4BH 4YBHA 5E7FA 3UBXB 5IKCB 1IGML 5JIMA 3MRQA 5E08H 3E6HB 2CJUL 4HZLA 1UACH 2G3XA 4G70B 5CJXA 4FTVB 2DLTA 3VD4A 2EXTA 3NJJA 4YIQB 5JO5B 5DTFA 4ODXB 3OGCA 2DQCL 2EXWC 4M8QA 4U4IA 3QXDA 2JLPA 3DC0A 1OP5H 3V0VA 2XG5B 2B9AA 1G6RA 5GPRA 2WO2B 5LBSA 4PJBF 2GIYA 2ZYRA 4Y9FA 4S10A 2I5YL 4L29B 1AGDB 1DVTA 5HGGS 3TFKD 1JHTA 1ZANL 5CILL 3GTTA 2WCSA 2WYHA 4BH8B 4BKLB 2ZKHL 1TQUA 2XN2A 1DEEA 2X4NA 3BEVA 1S4IA 4WENB 4JANA 4ADJA 3S36L 1WV7T 4FFZH 4KVPA 1JGVL 3FT9A 4LVNC 4PRBA 5E1AB 4KOBA 4UTAA 5LAPA 2Q8AH 1Q1PA 4GG6B 4MB5A 2FECL 2V17H 1SJEB 2FSEA 3LHPL 4J2QA 2E9JA 2I60H 1AR1B 1VF5C 1HL5A 3IRCA 5BPPA 1WD9A 3NUKA 5DFVC 5DHMC 3WDJA 1PSKL 2FQEA 1D6EA 2YBGA 4N0YH 4P48A 4DO6A 2JCCE 2QR0B 3LKSA 5AYTA 4YL4A 2BNRB 2JNZA 2R59A 4AL8L 2E47A 5DVPA 5TE7L 2K6YA 3DIFB 1HX0A 1WZ1L 5D5ME 4ZUUB 5TPWL 4YLBA 3KDMA 1X4ZA 2ZTBA 4PV9B 4OLXH 3ZE2B 1EO8H 4AUYA 1CMOA 3EBHA 4NM8H 4R90L 3AU1A 1SDAB 2CMRH 3IJ7A 2BY1A 1H5BB 1JVOA 2J8UF 2R1XA 3UAJD 3QDJA 1VLXA 3DX8A 2ADYA 2WB7A 1B3JA 4NX0A 3L16A 5GGVH 4AGLA 1ES0A 1RZ7H 4N0FB 4LLVB 2AK4B 1BREA 3IJ9A 2EYSA 3EUDA 2P8LA 4XGZB 1UYWH 2VQ1B 4K3DL 2EEFA 4DEWA 1A8ZA 4OJCA 4CA4A 1BM3L 1V3KA 1JRHH 1U8NB 4QXGH 4LPWA 5E2JA 1UD3A 3JWDL 3OAYK 4J4PD 1QFWI 4BWTA 2X0VA 4GRWB 4X98B 5EOCJ 5G5DB 4BFNA 5D1XD 1S6NA 4ZMQA 1AD0A 5IJCC 3DSFL 4JJOA 1ACCA 3BVTA 1NGWA 1NM9A 3B9EA 4QOKD 3BWAA 2CR3A 1XSJA 2UVFA 3BWUF 3KMDA 1FG2B 1GGTA 4UQEA 5JOFB 4HWZB 2VL5A 1NDTA 1YEGL 1F4XL 1F58L 2AZAA 4MXWH 4RX4A 3OKMB 4L18A 2HUHA 5FYKD 1N0LB 3BP5A 4ZUSB 3F7LA 4O4YH 4C83A 4WWID 4Y1SA 1BD2D 4PS3A 3QEUA 3TTSA 5IHLB 1PTZA 2Y5EA 2ZG3A 5FKPA 2YXWA 2V9RA 1XB3A 2OMXA 4U1GC 4V11A 3TBBA 3HI1A 4MWFB 4OGYH 2IIJA 5BO1H 2B0SL 1EX0A 2PCPA 1OP3H 4LQ1A 4JREC 3EYOA 1KLFA 2PCYA 4QOKE 4NUGH 2IBGA 3FPYA 1T7ZA 4PJDB 4LAQL 3FUEA 3VE0A 4HEMA 2H6PA 1IQWH 2O5XL 1SXCA 1QAWA 5DC9B 5FYKE 2EKSA 3KCPB 1D9KB 4UYPA 1K4DA 1DO6A 1BD2E 5ESQB 4HHAA 4K23L 3SKNA 5H35B 3SQRA 2ED6A 3D52A 4JN1H 3CMOH 2Z93B 2WXGA 4ZO7A 3WD5H 4FKHA 5IGXL 2B3IA 2BINA 2CHZA 1HH9A 4R0LB 4MD4B 4GW5A 4Z8FH 2VWEC 3HMXL 3B7RL 3W1ZA 1QPKA 3VJ6A 1PKQA 4G6AC 4OCXH 5J1AB 1YQVH 4XX1E 3BSZL 1K4CA 3PPSA 3POCA 2LV4A 5HGAA 2Y7NA 3TNMA 5CCGE 1XSOA 1S9WB 3VSUA 2ZJSH 4GAFB 4NNXA 5ACMA 3X1GA 1MCOH 2DD8H 3RTQC 2AI0L 4QPEA 4KK5D 1YEJH 3RVUC 3S3DB 5JPMC 3DJRA 3FB6B 4FQ1L 2EYRB 1ECZA 4FG0A 5DUBB 4KVNL 3L4XA 5ETUA 4TNWF 3Q6GH 4JDTH 3MLVL 1Y7VA 3NK3A 1FCCA 4XBMA 2WZPD 2QPDB 3RUGA 3LRSB 1T04B 2VR4A 4KKQA 5GGQL 3GSRA 4JKKA 1Q0YL 1J0HA 4PGCA 4ZXBC 4CMHB 1FFPB 3LSOA 3LKNB 1QFUL 1MFUA 5ICZA 4PJXE 5D4IA 4KZDH 5AB9A 4AZUA 2GG1A 5I16A 1DP0A 3NAAH 4AKQA 2G30A 1RZIB 4M5ZL 2XA8H 3V9EA 4WW2A 4WHTA 5D93C 3MRLA 2CU9A 3HG1E 3JV4B 4K3HA 5ACZA 4I9WD 4HCFA 4PREA 3F12A 2OJEB 4FOMA 1TKWB 1NBCA 1TVHA 1W72L 1CZ8H 3ILPB 3WXVL 2VLKA 1TU2A 1AOHA 4ZBJA 4YSEA 1RUML 1AFVH 2A6DB 3A24A 1EGJA 1LMKA 3AG4B 3GSQA 1Q94A 5TK2A 3RVWC 2YQ2A 2WKGA 2FE0A 2DMKA 4D3CL 5DT1L 2KS0A 1P6WA 3GMMA 3T0ED 3I02B 3JYBA 3I6GB 4OZFB 1MHPL 4I9WE 1G9NH 4DP0X 3K71A 3GDBA 4P07A 4KMTH 5LUMA 3V7AE 1E6JH 3OSVA 1LLAA 2W65B 4PJEF 2VDOB 2J6EH 1NOFA 4UT7H 1QUPA 3LXAA 3D1MC 1SJVA 2ADIB 5ALBH 4PJHF 4MCYB 5G2NA 2DH2A 1E4XL 4PG9B 4TUKH 2COQA 5FOBB 1BOGA 1F3JB 3TN0B 1O75A 2C9QA 3LKRB 5C0FB 4IRSC 2WM0A 2XN0A 4XWGL 1IGMH 4LEEA 2CJUH 2X89A 2LAGB 1EH9A 3F7VB 4L5FL 4UQ2A 1XV8A 4JM2B 4B9KC 2MQGA 4IRZL 4R6UA 1IT9H 5DF0A 5EUKB 3QGVA 5K5YA 2P5EA 1SQ2N 2E9GA 5JOEA 3X1FA 3BRFA 1U3HA 4Y1AA 1S9VA 2PABA 4U1IB 1MJUL 1MFBL 2CR6A 1JRHI 5IREA 5LN4A 1ZANH 4PB9L 5CILH 3GINA 4DEUA 4B95C 5FYJU 4PWFA 4B9CA 3C2AL 2ZKHH 1NUNB 1U0QA 1KV3A 4KPHL 4BDVA 2ODIA 4BSWA 3BKJL 2GABA 3L9YA 3RWFB 4WNQA 1W0WA 2UWEA 7PCYA 1UXMA 2OZ4A 1LK2B 2WXKA 2H2PD 4AYFA 4YMPA 3P4LA 3W37A 3X1NA 3S6CA 4CSSA 4NLAA 3LHPH 4PJGA 2VDMB 1U8KB 1PSKH 3JV5A 5ALCL 1TTGA 2AQSA 4M4RB 1QSVA 7FABH 2L7UA 5C0IB 4FNQA 4KWUA 4WEMB 2Z8WC 3O3BB 4ES9A 3H2WA 2L4OA 4AL8H 2Y3NA 1P5UA 3KPMA 3A67L 4YOKA 1VZIA 3OV6A 3ZKNC 3DJ9A 3Q5YA 5TE7H 1NFKA 2JV6A 4B9PA 1KJMB 1T22A 3EDEA 1WZ1H 5TPWH 3TA3C 2EAEA 5BUPA 2F9BT 2JCCF 4ZFOL 5I5RA 1DVFB 3VXSB 2ZP0T 1N6QL 5B39B 2PLTA 1X7QB 1FNEB 1L6ZA 1RD6A 2NNFA 4R90H 3RNKA 3TBSA 4C56A 1FGVL 3CZSA 3MV9B 1CE6B 1YEIH 3EHBD 4LLMA 1UADC 2DQUL 2J44A 5D5MF 1N10A 5D1ZA 3UCRA 5I1AB 3GMNA 2GAZB 2VO5A 3D6GA 5F0LB 1KIQB 1MJJB 3HW7A 1JN6B 1PYWA 3KXFA 3GXNA 2BP5M 3LXBA 4AIOA 2VW6A 4IBYA 4P2QD 4WKXA 3I6LD 4PGDA 2J12B 3GJFA 1BM3H 5FX3A 5CBAA 3L3GB 5C92A 3OF6D 5GS0C 3PF2A 1NGZA 1RIVL 2BPBA 2JI3A 3JWDH 1TO5A 3L4CA 4LDCA 5ANMB 5AWNL 3F6JA 4OKVA 1S7TA 4YLQT 2VSMB 2EXSA 3UJTL 3MGOB 2G75B 3DSFH 1BVLA 1DSFL 4WUUA 5IVOA 4IBWA 3K72A 1QO3A 3NBNA 1AKJA 1SQMA 2HN7A 1YEGH 4P2QE 1F4XH 1F58H 1M7XA 3I6LE 2FB4L 3ISRA 3GXFA 4E9LA 2WQWA 3NJXA 4WO4D 3Q2WA 4JG0L 4NSKB 4P2RA 1CE1L 4WU7A 5BS0B 5LHDA 4UANA 2MEJB 5DD0L 1KULA 3TJPA 4HIIA 1OE1A 4IRJD 4V1DD 2OYKA 4NLHA 2B0SH 3A47A 4WLCA 2W0PA 1QKZL 3APDA 5ERWA 4NQCB 5HVGB 3PV6B 1UKQA 4HFWA 3GRWA 1HE7A 5EO0A 4C4BA 4J3OG 5ECGA 2VXUL 3OXSB 2FEEI 1OTSC 5FUOL 4AI7A 1SPDA 4KDVA 3ML8A 2XKNB 4JDVB 4N2NA 4JKMA 3AUVA 3ORJA 4XRCB 2O5XH 3C60D 2EVJA 1JERA 4UM9D 5GZNA 1HXYB 2XICA 4KRMB 5LDUA 3DGGB 3X14A 4GS7B 4K23H 3CXHK 1E8YA 4FN0A 4ODTL 4Y16A 4AQZA 2HJKA 1GRWA 4WI5A 3QG6B 4V1DE 1KPVB 4PRAB 4IMKC 1WUNT 5HGBA 5IGXH 1EA9C 3F8UB 2G5UA 3L45A 3LEXA 5DRNA 3T3PB 32C2B 5DJYA 4UDUA 1SHWA 4MJIA 1F56A 4LKCB 3LKPA 5I1KH 2H45A 4UCFA 1ZHBA 4U7KA 3BSZH 2Z31A 1OTTD 1K2DB 3L9RA 1FYTD 2XWBB 4U6YA 3E1F1 4YR6B 3N9GL 1M3JA 2AI0H 3U36A 3VFRB 2IV9A 2W0KA 2VDPB 4FQ1H 4YE4L 5DD6B 4S1DC 4KVNH 1U95B 2IFFH 3MLVH 1XIWD 1KDIA 1U91B 1JGDB 3R06B 4JQIA 3FT4B 5GS2D 4JO1L 3SSGA 4Z23A 2OJ1A 5BVJB 1OIOA 1N2RA 4F7EB 2WNXA 3CZNA 5AQ0A 3JTSA 1IGJA 3PABA 2CO1A 4LLYB 3DARA 3PIQB 1UWFA 1FYTE 1QFUH 1MUJB 3D25A 1IAOA 3BH9A 1AKPA 3HG5A 2WCPA 5IROA 3IU4L 1GZHA 4F7KA 2CG9X 4KGLA 1ORQA 3QIUD 3EW3B 4HCRA 2WXNA 4IU2B 3VFOA 2XFXB 1S9KC 1WCQA 3ZY7A 4PJXF 4ZFFB 5C0DB 4O2FB 3SEPA 4HVBA 2GJJA 1ZLWH 3H7BA 1IM9B 1W72H 1NFDA 3WXVH 2X40A 1YA5A 4HG4J 2NQCA 2QADD 2OMTB 1RUMH 4K2UL 4P3DA 2H6UA 1UOKA 4MDRA 1MJ8L 3C09C 1EEQA 1LGVA 4RLDA 2HVJB 4U3CA 4F80A 3D39B 1AYRA 1BAFL 3M88A 4Q6IC 2FECI 3LNDA 3SHSA 4D3CH 4N4YB 5DEJA 4MKMA 5DT1H 4FA6A 3MRMB 4RMBA 5HYJB 5AZ2H 1MHPH 4WK2B 4LPUA 3MDJA 4ELDA 3O45B 1XR8A 3SPVB 2YD2A 3NA9L 3BKML 2A73A 1ZE3C 3UP1A 4YSOA 3CPUA 5F7AA 3CMGA 1NJ9B 3RWJB 3TLRA 4AMKL 1ZT4B 1UATA 3NSXA 3NQIA 1E8ZA 1UENA 3X17A 3DUSB 1Y1DA 2A83B 2B1AL 2BNQD 2DLHA 3P9MB 5AKRA 4U6VL 1SM3L 3PL6D 3U30B 3HJ0A 4XWGH 5F96H 4PPTA 3NOIA 1L3WA 4Z95L 3RFZB 4FL4B 4N2HA 2YXMA 4IRZH 2JMRA 4YBQC 3PXLA 5B4MD 5I73C 1A3RL 1G0DA 4XOBA 3L1GA 5KVGE 3VFWA 35C8L 1LYQA 3T65B 4FXGB 4KK8C 1H8OA 2GTZA 1MJUH 2Y24A 4NRYA 4PRID 3VSVA 1MFBH 2BNQE 3ZTNL 1B4RA 5BV7C 5T3XD 4PB9H 3ZO9A 4AW4A 3T4AC 3JSSA 5CKGA 4N90D 1K9TA 4F9LC 3BW9A 4DN4L 3C2AH 4LNRB 5F6IB 1GY2A 5HDBE 4KPHH 2VE6A 4UBDD 3BKJH 3UTPE 2NYYD 5IR1A 2FIKA 2XVLA 1FF5A 3DIVA 2B8OT 3BZ5A 1A25A 2J73A 4NO0D 1YNKL 5IVXB 5KSBE 1QHPA 1UA7A 2DI9A 2YPLA 3UTZB 2EDLA 2Y1YA 3O6KH 1INQA 1G9EA 4U7MA 4K15A 4MCNA 1EFQA 1BG1A 4J2XA 5KYUB 2ZE0A 3L3HB 5GSRA 4JPIB 5ALCH 5T3XE 2R15A 3ARYA 1KB9K 1GC1L 5DS8A 3GMOA 2X70A 4N90E 5F3FA 3A67H 3O9WC 4AGNA 3RVXC 2X1OA 4PJ9A 2ZUQB 3CV5A 1A3QA 3CVIL 4L48A 3VRIB 1MI5E 2WANA 4IM8A 3SB3A 2AQNA 1RZKC 4QJ5B 4XCYA 1FGVH 4OW6A 4GRLD 1KGWA 3QIWA 2DQUH 4LHQB 2WP3O 4FHBD 2L04A 1L9NA 1MIEH 1A4KB 1H8SA 5IVZB 4WTZA 3R18A 2CLVB 2VYRE 3QQDA 4ISVA 2WCGA 4GAAA 2Q2LA 2ENQA 3NZ8B 2FEJA 4M93C 1I1AD 2J8UA 4I7ZC 4YPJA 1X5HA 1HKFA 3C5ZC 3BZDA 2AGJL 3HZKB 1INDL 3D4CA 3R19A 1NC2D 2DIJA 3KEHA 3B9KC 2WUCL 4PB0L 1RIVH 3TT3L 3BDYL 5AWNH 5K69A 4LMQI 4PLKC 4X4MA 5JUEL 4OV5B 2ZXAA 1E9OA 4MKTA 3OR6A 3UJTH 3I75B 2WOYA 2XBDA 1DSFH 3NRFA 1WGVA 4MNQA 3A21A 5TH2A 1KV7A 2SODB 4L9LB 2YFOA 3HFML 1MHHA 1PU0A 3D85B 3WE1A 3AT9A 5I23A 5DK0A 4QT5A 2FB4H 5IQOA 4JG0H 3EJPA 1EAJA 1CE1H 5T1MA 5DD0H 2W95A 5E4IA 3S2CA 4EI6B 1DQJA 4Y2NA 1EDQA 5IIEB 5JXED 1ETJA 1TJXA 2EILB 1I9EA 3AITA 1QKZH 1AOZA 5E94A 5AALA 4I18C 1SY6L 1I4FB 3CC1A 1KPRA 2YN5A 4BIKA 4Y19E 4L8BA 5FUOH 2NDGA 1XB6A 3T9WA 3UTTA 1RMFL 4JY6B 3H4FA 3F2LA 5D2NC 3ILQC 4WJ5A 4RA0C 3HC3L 2JKTM 3DTXA 3OR7A 2QTEA 4ODTH 12E8L 1B0RB 1NZRA 4FI6A 1UWYA 4H8WL 4Y8DC 5D7JC 3D3VA 3E2HB 3X1EA 1HYSD 1YMMB 3NK4A 3AUWB 5T1LD 1NBQA 1A6WL 1R17A 4Y4FA 1ICTA 4IBVA 4DVRL 4G72B 2APWA 4LHUG 1E4WL 3MNZB 1Q0XL 1J0YA 2PP8A 1MVFA 2ADJB 3CDYA 3L6FA 3C9NA 3V5HA 3T0DA 1CFMA 4ALAL 3VNYA 4DEPC 1MG3C 2AMUA 2JSFA 1XD1A 2Q10A 5LCVA 3WAJA 3N9GH 3S88L 1ZV9A 4X6EA 2X4OB 4QEGA 4KRLB 2OS7A 4KI1A 1HDMA 1T2XA 4YE4H 3QI9C 3VGHA 4J8QA 1E4XI 4P23C 2Q6WA 1AQHA 1KTKE 2NY0B 3ZZLA 3TURA 3BN3B 3VTMA 5GGVY 2VKWA 5DFAA 4ZRGA 5GS1B 1G7LA 1FORL 2EUWA 4JO1H 5FA3A 3ZRCC 4A2GA 3RG1C 4GUOA 3MJ7B 1P7KA 3HE7D 1NCOA 1SVZA 2HKHL 3O11A 1VFAA 4IIZA 4B3EA 4DAGL 1JF6A 2Z8SA 4LSQL 1BFOA 4R96B 2IOOA 5GZOA 5AYUH 5TJWK 2W0LA 3QUZC 1PCXA 1ZA3B 2XQYK 3IU4H 1BVKB 3LN5A 5KVEL 4ZPTA 1UURA 1HZKA 4ACPA 2RQ8A 4LO9A 4LL1A 3TF4A 3HUJE 4HJUA 3HS9A 4NPKA 3DDGA 2X09A 1F02I 1FDLL 1XGTB 3HG4A 2PO6C 3OWEA 3KPRA 1FP5A 4A66A 1DYZA 1U3NA 4XP6L 3IF1B 1MKFA 2LLLA 1AIZA 3FB7A 3MV8A 3GWJA 3E1ZA 4K2UH 1W2KT 3EZ8A 3EYFB 1R3HA 4PYGA 3BQUA 3JUYA 4FXTA 1BAFH 3QFJB 5IMOA 5B1JC 4Q58C 3QWOB 3L9EA 1MFMA 2YZ1A 1S9XB 4M1CC 5CSZB 5C8JB 3NPSB 5HY9A 1FG9C 4KROB 2WY3B 4WIQA 3NA9H 4Z18A 1SDDA 2X2JA 1Z9MA 3BKMH 4JRFA 1A7QL 3ABZA 3FHAA 5J6GA 1Y0LA 4AMKH 2JH2A 4PN6A 3MRFB 4W70A 1CFNA 5JIKA 3ZHFA 1M2VB 3KYMA 5HI5C 1WRFA 4PJEA 2B1AH 1ROWA 4WNSA 1OANA 4U6VH 2XZQL 4UOQA 4DN3L 1WQVT 4PV1C 2Z35B 2X4PB 5IW6A 2FT8A 3F85A 2IAMB 4OGXL 5DVMA 4FQPA 4Z95H 1YPZB 1HOCA 2J3SA 3FN9A 2XV3A 1JCVA 5HHVL 5FDYA 3T77A 4LZKA 4XT1C 1OCZB 3QEQA 3O6FA 2OMZA 1Q4NX 1IEBB 4LPTA 2IWEA 2VM4A 2F54A 4KX8A 4L4TA 3HMWL 3ULUC 1QFWM 2C1PB 1OB0A 4F58L 2WB1A 2CBTA 4DP9X 4DN4H 2VITB 3N85H 4ZUWA 2NY6D 1TQCB 1KGXA 1V8HA 4RAVA 1JS4A 2IH1B 3O4LB 5DJZA 3GSOB 2VQUA 3E8VA 3H54A 5BUAA 3US0A 3TF7C 1YNKH 2PETA 5HDBF 3MROB 3QUXB 3CFCL 5G55A 5IY5B 2JKWA 3U79A 3WFBL 3CCHA 3MLYH 3SBWC 4WFGD 1NCIA 3LIUA 5DO2D 2ZUSA 1IAIM 5TDNB 1FSKB 2PW2B 1GC1H 2P80A 5C0EA 1P7QD 1RIHL 1UXWB 4G43B 5IOPB 4BYHA 5KSBF 2HT2D 2BRQA 3G6DL 2DLFL 3TOPA 4F2MB 1HH6A 2JI1A 1HQ4A 5GJTL 3FCSB 4JZNA 1QLRB 5FYJH 5D7IE 5AAWA 3RVTC 3FB5A 2ZNXA 3PQYA 3IXAB 4JQXA 4YHNA 3CVIH 1V3MA 3EXLA 4HX1B 3VB8A 3G5WA 3G6AA 1EBPA 1MVYA 5ESAB 4WSGA 5ILTL 1K5NB 3JT2A 3O2WL 4YNYB 3TPUA 1OCOB 4TUOB 4WFGE 3QXUA 1H15B 2PXYD 3KPLA 3GMPB 3TNNB 3BN9C 5HI3D 4B6ZA 1LEGB 4P4KC 4P3WA 5D5MA 5ACLA 1GKOA 3ZDZE 4HKZA 1XF3A 3GZPA 2X6VA 1ZTXH 2JKLA 2AGJH 1INDH 3MCLL 3C12A 4Y2DB 3S8GB 3W38A 3MVSA 1UZ8A 3WLBA 1P2CB 1S3KH 3MCG1 1JPFB 3HVNA 5EZJA 5KVMC 1EUTA 2WUCH 1RK7A 3DPDA 3TYFB 4PB0H 5CEXA 2ZCLL 3TT3H 1I8MA 3BDYH 3W9DB 4AJWA 2R7EB 4UOW0 5JUEH 4FTVD 3NG5A 5CJXC 1W72B 3QQXA 5BJTB 3ZHKA 2VISB 5DJ8B 5F1KC 2H3XC 3S8WA 3SDDB 5EU4B 1S7XB 3HFMH 1KXQA 2D0FA 3P3RA 2NNAA 3AB0B 3VI4B 2IDQA 1KY7A 2BS9A 3HFFA 4YVNA 3MLSL 1DFXA 4QHNA 4A39A 1YDPB 3T2PA 1ILUA 4P5TD 3V2AR 1S5HA 3W0WD 1TSRA 3KAAA 3Q3GB 3ZE1B 1JZ3A 3FUFA 4NKIL 1VCAA 4FTVE 4AE1A 3BVNB 4LPVA 2PWHA 1NLBL 3DRTB 3DURA 4I1NB 3ZL4L 5K9QG 2UXVA 3WEXB 2CA3A 2QLVB 3HHRB 1SY6H 2C3WA 2JK5B 2B15A 2ZG2A 3T3MB 4ZQTA 1UGNA 4HC1L 3IMUA 1RMFH 1PCSA 2ISDA 1AR1D 4ZD3H 3VYPA 3HBZA 3G5XA 3HC3H 2CJ3A 1BZQK 3TV8A 1TPXB 5CJ8A 4YDVB 4ZZKA 4GRMA 4G6FB 4PWIA 2ZOKB 2VC2L 1SN2A 2DIEA 2BNRD 3W0WE 1MJ7L 1A6TA 5EU3A 3L3IB 4X5QA 12E8H 5D1XA 1JMZA 2NY2B 4H8WH 5CKAA 3BUYA 1UWEH 1A4JA 2QMJA 3KPSB 1AS6A 1E5AA 1EAPB 3TCTA 1A6WH 3RHWK 4DVRH 4PJIB 1J5DA 4GG6E 1E4WH 4U1HA 1KXTB 2VRAA 3QR1A 3UG5A 1Q0XH 3IDNB 4GNKB 1AP2B 1FIEA 1ZK9A 2G0LA 4LP8A 3ARDB 4PLJD 4A7GA 4ALAH 3FRUB 2HTKD 3NVQA 4MDIB 5J12B 1SOSA 3AS3A 3OAYH 3Q43A 4YQXL 3J07A 2BNRE 4AZ8B 4PWEA 1VIWA 4HKBB 3S88H 2AK4D 1DL7L 4O2EA 3FN3A 5CU5A 1MVUB 1X6LA 4GKNA 4N2MA 3GS0A 4PV8A 2GSIB 2UXFA 3K2MC 3ZE2E 4BWUA 1U8JB 1I8KA 4CADB 2EDYA 3QDGB 4ODHL 4OGQC 2NW2B 5IF0B 2Y6SD 3KCWA 5HHPB 1HXMB 3L2NA 5FA4B 1QLFA 5EZLB 2CE6A 1RJYB 2HKHH 3DO3A 1WA1X 4OD2B 4DAGH 4LSQH 3WENA 2AK4E 4AVKA 3MACH 5KVEH 3AY2A 4ZFOB 1PZAA 5IB5A 4HW6A 1H9DA 3T0XA 1E40A 1G1KA 2QQLL 4PJFB 5T1KB 3TZVB 3D34A 2QHRL 1NKOA 4GRWE 4W93A 1MRCL 4KJQC 5CNHA 2HG5A 2SEBB 3RWGA 3ROLB 4XP6H 3IDYB 3MLXL 4L1LA 5E9DD 5JHMA 3HUJF 3SJVA 5JHDB 3MXWL 1E2ZA 5HDLA 1E5UI 1XF4A 1P1VA 1R5IB 5E1GA 4IOSD 3FKUS 5E1QA 4NFDA 5CAYB 1JWSB 4XAWL 3GGWA 1F4YL 4U1KA 1D9KD 2WBJA 4IKKA 4NQSA 4ZW3A 4MD5B 3QNYB 3IFLL 4HEPG 4AYID 4R4FL 3IBEA 2E27L 1A7QH 1ETZB 4UQDA 5F89A 3VWJB 1EHAA 4PTUA 5E5UB 3PHOB 5E9DE 4DESA 3BYTA 3HHMA 3B5GA 3FFOA 1WWAX 5HJDA 2V9TA 3RGVB 4PJDE 4QRSB 2XZQH 5E2UL 4DN3H 5CR1A 4GIPD 1YC8A 4ORGB 3DYMA 4OGXH 3CVBA 5KANG 3VA6A 1T20A 1F4HA 1WFTA 4MA1B 1CGYA 1KJVB 3CHOA 5MHSE 4M7KL 4PJ7F 4YWGL 5MI0C 3D2UB 5HHVH 3CXDL 1FVDB 4IS6A 2XNAA 3GBNL 4HWBL 1T7XA 1J8RA 5TK4A 1FPTL 4MD0A 3V4PH 4Z7NF 2CRMA 4RSYA 5AAMC 1YSOA 1JPGA 5K1JA 5ELIA 2LR4A 1CFQA 4IEFA 3TL5A 5F97E 3LKQA 2JCWA 4BUQA 1OV8A 1ZVSA 3HMWH 2AXHA 4PI2A 1QNIA 1WBZB 4FGMA 5EZOL 3T0EA 5I17A 1UJ3A 2NLJB 1CDIA 3KH4A 2VLRB 1A4BA 5EH1A 5CR8A 2LTQB 4WW1A 4UMGA 1NCDH 1TT6A 3VSTA 3QXVA 1WTGT 3GD1C 4F7TB 5E4AA 4OF5A 4GKLA 3FH8A 1KN4L 1NAMA 3AC0A 5DMIL 3K80A 1C8PA 3TC9A 4WW2C 3NABL 2VDNL 4RNRB 3CFCH 3HAEH 3WFBH 2VDQL 2KBGA 3PWVB 5I6XC 2LLNA 1BWMA 1X4XA 2FQDA 2VJ0A 3FUIA 4Y5YB 3IS1X 3NFPA 1C5CH 1IVLA 1BZ7B 1IIIA 4G80A 5GJTH 3S3JA 2PYEB 3WFDL 4NN5B 5GGRY 1BYPA 4YFLI 1J88A 1FFRA 1J1XL 1TLKA 2R23B 4OQTA 3UX9B 3O8XA 4IW4C 4X7TA 3IJ8A 4JGJA 1X3DA 5ILTH 4ECNA 2ZUXA 2CDGA 1T5WB 3P4NA 4A2MA 2APSA 1HIML 1XR9B 3WJMB 2Y2WA 1S7WA 3IDJA 4XBGB 3ECWA 5E8OB 3N40P 4BH7A 5F7WC 2JXMA 3N40F 4NZFA 1IBDA 3AREB 3D05A 2N0KA 1OE3A 3LPFA 1ZCRA 2E4TA 4CDHA 3TN0D 5LJYH 3MCLH 1A9EA 2K6ZA 4KXDA 4V2CB 3T2LA 5BVPL 1OTUC 3M1BA 4MDJB 4GKSB 1VENA 2X1XR 4PCTA 4XP1L 3BUBA 2CDEA 1NWOA 4KKCC 2C1OA 2ZCLH 3ZDZF 4YBLB 4KNQA 2DQ6A 3B2UD 3G7TA 4NIKB 1NEUA 4K5LA 4JM2D 1BPLB 5FK9B 2LAAA 1HJCA 1M7IA 3MO1B 2C7FA 3QJHA 4N2EA 3RKDC 1ITCA 3KW7A 3HLAB 4IMLA 4JHVA 4XTRD 4XE5B 1GJWA 5D6CB 4UT9H 5LN8A 1RULL 1QI3A 4MASA 1OCRB 5DMKA 1U3HC 4KJWC 1CICA 1RPQA 1SHMA 1CBJA 2O61A 4KC3B 5C6PB 3ULVC 4P9HH 3BZEA 4NKIH 1H6EA 5C6TL 3F04A 4AYDC 2BIQA 1G7JA 1OD9A 3IVKB 1NLBH 2H32A 4F15B 3ZL4H 4YJZL 4U0QB 4Y5VB 1L9PA 5BO0D 2XV0A 3VFGL 1CQYA 3D07A 1RVFL 3EO0B 5I75B 4HC1H 2C4FT 1QEWB 4IBTA 4HISA 3BP6A 3TO4A 3DX2A 3K1KC 4HMCA 4PW9A 3SZ6A 1N18A 3OF6A 2JIXB 3EOBA 1T1YA 2WAHA 2XY1A 2Z0BA 3CQFA 2EUXA 1S9YA 1SHXA 5I74B 1PLAA 2VC2H 4G8FA 1NC4B 1MJ7H 3GZQA 2WPGA 1HI6A 1J48A 1B2YA 4RAHA 1P5UC 3I84A 3OMZA 5CLZA 1LO2L 2R2BA 4P5KA 1IAKB 1NWPA 3PGFH 4MA3B 3WBDA 1Q9KA 2FH8A 1DVFD 1EEYA 4NZ8A 3RWCB 3VXSD 4YHML 2UZXB 2EDMA 4OD1L 3E9UA 2WNKA 3MV9D 3RU8L 1J12A 4P3CL 3F7RA 4ES8A 4WO4A 3CSYA 3OKKB 5BRZA 3EYVA 1DN0B 2BIPA 2ROYA 5D1ZC 4YQXH 4C54A 3QW9A 4GG6F 4IRJA 2C3VB 2EDTA 1MF2H 3FNKA 3SY0A 1AS7A 2NY1B 3QC5X 4TNVK 3S35X 3LQAC 3JWOC 4U1NA 2VERA 4CL7A 4C58B 3AVEA 1DBML 3VXSE 5FV1L 1DDHB 1E3FA 1HWWA 1MRFL 2YGOA 1DVQA 4G1MA 3D33A 4ODHH 4UOW1 3NPZB 4HD9A 3MV9E 4P46B 4IOIA 2MNJB 4UM9A 4ELKA 1R9FA 4EDXA 3MLWL 3WFHA 3ILEA 3ZE2F 2XYBA 3AG1B 1T0MB 4LOVA 2DWYA 1JZDC 2IG2L 1TQWA 1GGBL 2QELA 3MJ8B 3ROOA 1RIUL 1R4XA 4TSAL 4CU6A 3FCBA 2VXQA 3RL2B 3VH8G 4E9WA 3FQUA 5BS0D 2QQLH 3B56A 3E0GA 4GPVA 2DJ4A 3GSNL 5ANME 2QHRH 1A1MA 4PW4A 1MRCH 4CBPA 3Q2VA 2PTTB 1K3ZA 3MLXH 1UZGA 2FTAA 3LB6C 1OVZA 4NQCD 3JUZA 3NEEA 4BCYA 4XOEA 1WPCA 3MXWH 5A2FA 5AG8A 4QRPB 4PR5B 4AIEA 4MXVE 4LHUA 4GRWF 2AVFA 2MJWA 4CAGA 4X50A 1CO1A 4WEEA 1XIWA 3KEDA 4XAWH 5SWSB 4WF7A 2FR4A 1F4YH 2HG0A 3HZMA 1QTPA 3S35L 1F4WL 3MBXL 5BS0E 4J8RB 1WA0X 4OQ1A 3VQLA 5DHEA 4YN3A 1BQHA 5GZNC 5H4ZA 3HS0B 2VSDA 3IFLH 2C26A 1I9RL 4R4FH 3GPSA 4FJZA 2E27H 4Y16C 2I9TB 2OMWB 3FO9A 4LDLB 4NQCE 4XO5A 4XXWA 1ERNA 1R47A 3GK8L 2K3HA 5EOTB 2W0FA 1ZIBA 1M1XB 1MW0A 4NKDA 2Q5BA 2Z31C 4JFYB 3PAYA 3EGXB 4A6YA 2AXFB 1AGEA 1XVSA 5LO7A 4K8RC 4PJDF 3N1MC 4HMEA 4M7KH 3I74A 4YWGH 3CXDH 3BUIA 2DQJL 4ORZC 3GBNH 4HWBH 1MRDL 5DMGD 5H2BB 1FNHA 1M42A 2GBVA 3T3PE 1BX2B 2JELL 2QSQA 1QNZL 3DX0A 3GI9L 5DYFA 4OF6A 4JCWA 2AANA 1UD5A 2M26A 4NIYE 3UBGA 3K2UL 1J05A 1T21A 4UWQB 3GUTB 4TVPL 2VN6A 2VMFA 4H0IA 1UH4A 5DZAA 4KVCL 3TCLB 1FZKA 2Y7SA 1NMAL 1HEHC 1XBDA 1ZGLB 3T09A 4NYLA 1OGSA 25C8L 5AW1B 1V10A 2ICCA 3HC0A 1KN4H 1TF4A 5DMIH 5IROC 5C7ZA 1GZHC 1N19A 2I7SA 5LDSA 2EYTA 3K6SA 3NABH 2VDNH 3MOAL 3BUQA 3NSDA 1XX9C 3PL6A 2E86A 3HZYA 4W9LC 4AQAB 2UXTA 2X0UA 3KPTA 1SXBA 2JQMA 1IM9D 1KYAA 4WI0A 2IPKA 2R51A 4ZW7A 4P57B 3DI2B 3WKNA 1EZUA 5FUZL 3IDMB 3UAAA 1HXKA 5C0AA 2OW7A 1J0KA 4HIJA 1YY9C 2IDUA 2FHCA 1MCJA 3HB3C 1J1XH 4Y0G