3C6LD

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
192
Chain Sequence
FEAQKAKANKAVRHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords TCR 2W20 alpha chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 192
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c6lD01
1AGFA 5ICYB 5IW6B 3QEUB 3AS3A 5C0RL 3QIBA 4YBHA 4M02A 1CGVA 4R4NC 5L6YH 4LSDA 1G7IA 4R97B 5AZ2H 5HYJD 2GJZA 2OXHA 2VNCA 1JPSL 4UQ2A 1UVQA 2OR8A 4GRWF 1FZOB 2GHWB 2X4TA 5D1XA 3AU1A 5EOCH 4X5XB 4J3TA 1PLGL 2Q7YB 4L3AA 5IB2A 1HXYA 3VFMA 3L5WA 1KTLA 2VXUL 4JFPA 3HMWL 4NCC1 2PW2B 1WBXB 4JPKH 1FVCB 5HDLA 1LD9B 1OT1A 5BW7C 3BP4A 1Z5LA 2VQTA 3LD8C 5I2IA 4P49A 5EUOE 2IGFL 1HKLH 1CLOH 4PGEA 1WQVT 3IRZA 2GSIA 1CCZA 3CFKB 5I1IH 1NBQA 3RTQA 1RMFL 5GZNC 1WK0A 1S7VA 5HDQL 3QWOB 1EZVY 4FXKB 5T1DL 3DTXB 5IT2L 5CFHA 3SGEH 2WUCL 5F3HA 3KPQA 1QEWB 3RJQB 2OP4L 4KAQH 5BRZA 2JJVA 4KDVA 1D5XA 1OARH 4I0PB 5ILTH 5CWSA 3DVNB 2EH8L 4Y5XA 3LKSA 3PXJA 1BWMA 1HEZA 3CXHK 2MQ0A 3W9DA 4HK3N 4U1SB 2AGJL 2YSSB 2Y5TB 3HNTH 4FFYH 2DRUA 1FFRA 4QRTB 3O6KL 3KVQA 2X5PA 3MRCA 4OGXL 5DSCB 4HFWA 1Q38A 5B8CB 1VGKB 3SBWC 2AV7B 3HHRB 1MJ7H 1CL7L 3PP3H 1B0RA 2ED7A 1HK6A 4HXBL 1OW0A 2HG5B 4BQ8A 1RUPH 2EDNA 4ZTPH 3KPRE 3DRQA 2BNUB 4CVXB 2QR0A 2GJ6E 1QA9A 2GCYA 2I9TA 1OP3K 4MA1B 5C0ND 4F37F 5E2VL 1I8KB 4H20L 5D72L 2J8UE 3GNML 1T22B 4P2OC 1A9BA 2BVQA 2OJEB 4GQ9H 5JW4Q 3NCJL 1QPXA 3DOSA 3GKWH 1OAQL 4NRXB 5SV3A 2YC1B 1ZSDA 2B5IC 2GT9A 5D7LA 5EUKB 2PXYD 4H88H 4OI8A 3A0OA 2C4XA 3QIUB 4N9GA 5DDHB 2A6IA 5C6PB 4P23A 2GAZA 5CZXC 3WSQH 5EOQH 3W81A 2XNAB 1QBAA 5TF1H 4GFTB 3VGGA 3FO0H 3G6DL 1KXQE 4Q9RH 2A83A 5LCVH 4PLJD 1A7QH 3WD5L 5J9PB 1EFXD 5CJOH 5HPMA 3MNVA 5FM4A 3IXTA 3BXNA 1JMXA 1MFDH 3QO0B 3RA7H 4LLYA 5C70A 2YK1H 5IEHB 1BAFH 1DLHB 2CRYA 3P30H 2N4IA 2GEEA 1IGFH 4JHAH 5JA8B 4LLDB 2E8YA 2P49B 1HH6B 3FB7B 3SDAA 1U8OA 2V2TB 3FQRB 3TESA 1AKJA 2HWZL 2EC8A 4ODSL 1TLKA 4WCYL 3WMSA 2XN9A 1NANI 4X98A 4L4TD 5EZIH 5C0DB 3S88L 3S97C 4KI1A 5JDSA 3TJHD 1MRFL 4L3EB 1JRHL 4LDEB 4Z7WB 1FFNA 1DQDH 4MX7A 3LIZL 2UVEA 4OLWL 5HHNA 3PWLB 4JM2B 4PGCB 5TGBB 1OSPL 4OKVB 3KPSD 3OKYA 2HRPH 3QXAB 2ARJA 5GGVY 3LVEA 5C0BE 5CIPH 3RKPA 4QXWA 2EXWD 1CFNB 4XAWL 2DI7A 2FYYB 5DR5L 1I7UB 5CP7B 4PY8J 5K9KA 1MCCA 4JRYA 1ZT4B 5EU7E 5DK2A 3MSPA 3RIFF 2P5EA 5JXAH 5SWSE 4OD1H 1RFDL 5A3IC 2AJZA 4FQXC 4XCEA 5F88A 5DD5H 1MCKA 1TVBB 5DD1L 2X1PA 4JRXA 1PZ5B 4DAGL 3OZ9H 2AS5M 4NWUL 4AIXA 1F2QA 2Z31D 2FWOB 2CGRL 1FLTX 1IAMA 1YDPA 2J5LB 4M03A 4PGBA 4D9LL 2AEPL 4DTGL 4TSCH 4D94A 1NBVL 5IHZA 1JGEB 2NY5L 4HH9B 2JIXD 3C60C 2D4DA 4G42B 2BJMH 2O5XH 4KI5F 5IB4A 4QRPA 2JTDA 1GC1L 4YFEA 1SY6H 4HS8L 4RX4A 1G9NL 5C9JA 5L8KB 5EOTB 1WIUA 3FT3A 3WO4C 4LGRB 5EO1A 4D9QE 3F12A 4N0CC 4MGXA 5INDB 4XP6L 2IF7A 4N0FA 2FEEI 1PX4A 1JYXA 4KRPD 1RJZA 5DRZB 1T89A 4BZ2L 5ALCL 3ZTNL 5EBLB 4NT6A 1T03L 4CL7A 4JFQA 4LF3B 4DGIH 1DANT 3O11A 1Q9WB 1CXKA 4OZHB 2ESVA 5L2KB 3O41A 3C9NB 1R3IL 1QPPA 4BYHA 3MLVL 4KHXL 4YIQA 1BFSA 4QHUB 5DJAB 3MOAL 1OP9A 1MF2H 1FIGH 2Q8BH 3FB5B 1U9KA 1JHKL 2XWJA 3QDJA 2NXYC 4JY6B 3MRRB 4OAWB 1P4IL 2WBKA 3QG7L 4PRPB 4XHQA 2I60L 3LHPH 5EOCJ 4IMLA 5GS2D 5T3XH 4PJ5A 2GW5A 5HSFA 1L0XA 1FBIH 2VSDA 4UIKL 3B8SA 4JHWL 3IFNH 2GTWA 4BK5A 3OKNB 3JWOH 2IANB 1D6VL 2FDBP 4AEIL 1UQSA 5CIPA 1OTUC 3MRDB 3T4AA 3WNPA 4PTUB 1RIVH 4QXTB 1PKQA 1A6PA 3LN4A 1BZ9A 1K2DB 2EEAA 3JTSB 3IFPB 3PL6A 3MV9D 4QNPF 5EPMB 5I1AA 4BZ1H 1A7OL 3WUZA 3EFFB 5F97E 3WHE0 3IDJB 2PYEE 2CUHA 3EW3B 4KDTA 2V5SA 1NFIB 1XGRA 3VH8B 5CZVL 1IAOA 2NY0B 2BCKA 4Y2DD 4UAOB 4MMXC 3HZVB 3RFZC 2J2ZA 4PRBB 2B2XH 3T65A 2GY7B 3T0BA 5J06A 3M1BB 1SMOA 1X5FA 3DARA 5IBUG 3BPOB 1SY6A 3IFLH 1L6XA 5IVXA 5DLMH 4JN2B 5CCKL 1ZGLA 4HEPG 3LKOB 3NCYP 4MD0B 4GKZA 4ODXA 3BE1L 1V7NH 5AYQA 3SY0B 2MFNA 5IW6A 3QEUA 4RFOL 2I5YL 3FQXB 5CBEB 4YEEA 5DURD 5LG1A 3JUZA 3CMOH 3LQAC 3SGDH 1TQCC 3NA9H 2YD4A 5I1JL 5KZCD 1NGPL 1K6QL 3OX8B 2OS7A 1FZOA 1NL0H 2DQJH 3MXVL 4OFYA 4LBEB 2CKBL 5GGUB 4MHHG 2DQCH 1JPST 4HC1H 4X5XA 2DQTH 4BJLA 2ARJQ 2Q7YA 2E6PA 3GJFB 3MBED 3WIIH 3QPXH 2PW2A 5DF0A 3TBYB 1WBXA 2MQCA 3C2AL 5H8DA 5HGDB 1WT5A 1DL7H 5KSVB 1FVCA 1HXMB 1MCDA 1LD9A 4O2CB 2HFFA 4OFPA 3AS1A 3JTTB 3BVNB 4PREB 3CFKA 5EC1A 4NP4L 1VADB 1T2QH 3JWDL 2X4QB 2CMRL 2YUWA 2AVGA 3DMMB 3LEYL 3UO1H 3QWOA 4OUUB 4RGNC 3DTXA 4RWYH 2IFFL 4KJWC 1UZ6F 4IHOB 2CLVB 4F3FB 4EXPX 1QEWA 3KLAB 3WNOA 3CFCL 4YHZH 3S5LG 3V95A 3VXME 4MJ2A 1VGEL 4UB0L 3JZ7A 5L2KD 3FT4A 4I0PA 3DVNA 1IFHL 1TITA 1Z3GH 5CJXC 1YC7A 1RZJL 5EO0B 3QXUA 1KELL 3IDGB 3KXFB 4U3HA 4OBRA 4U1SA 2YSSA 1DJSA 2Y5TA 3CK0L 3U7YL 3TNNA 3TYFB 4QRTA 1CDJA 5DSCA 4D0CB 2AJYH 1LEKB 3ZZ1A 1EO8L 5B8CA 1VGKA 1J88A 2AV7A 4K3GA 4RMTA 4HPYL 2HG5A 2MHAB 2H41A 4ODTL 3SKOB 3MCLH 2BNUA 4CVXA 5HBBA 2EEBA 3W82A 2R2HB 1RQ5A 5MEND 1IC4H 1I9JH 4I5BB 3EO9L 1I8KA 4P2RD 3RVTD 1FDLL 1U8HB 1EMTH 3FAWA 5CSZB 5JQ6L 1YY9C 1SEQL 3WS6C 1T22A 2OJEA 5E6ID 5IROA 3QUZD 4NRXA 3QEGL 2NY1C 2YC1A 2NY2D 1QFUH 2VXTL 3N1GC 5EZJB 5EUKA 1KIUA 3DSFL 4NQCB 4XTRC 3BUYB 3B6SB 4NNXB 1QNZL 3QIUA 2QV2A 2FBJL 4WFFD 5DDHA 1UCTA 4RISH 1CD1B 4HC1A 4G8GD 1DEDA 3OG4B 1KPUB 4OGYL 5AD0B 4GQPH 1DQML 1HDMA 2A6DB 3CDFA 4QLRA 4M7LH 4IRSC 3CGTA 2D0GA 5J9PA 1WJ3A 4JB9L 4JO4L 1A1NB 1YEKL 3QO0A 3VGBA 1I1FB 5IEHA 1SBBA 5CS7A 1DLHA 3MJ9H 3RUGB 3X17A 3KHOA 2O5YL 4Q9QL 3JVGA 2UY6A 4LLDA 1X5ZA 1HH6A 1F6LL 3FB7A 1LILA 3TT3H 5CEZD 2V2TA 1B4JH 3FQRA 4KTYA 2W1NA 1AE6H 1ZLWH 4OV6F 5C0DA 2AABH 1ZLSL 5DTFB 2DTMH 5E8PB 4L3EA 4RDQF 1I8LC 1CXEA 1L9NA 3CLEH 5GGRY 2W0FB 1X5HA 2OQJB 2GK0B 3PWLA 1XCQB 4NO0B 4C83B 4JM2A 4JGUA 4PGCA 5TGBA 4OKVA 2CO6B 5IEKB 3DV4B 4XMKH 1MAKA 3QXAA 3G9AB 3ROLB 2BNRD 2E9WA 4I3SH 4UILL 2R0LH 1CFNA 4Z7NE 1INDH 2AERT 2NLJA 1I7UA 2DDQL 2H3NA 3ZYOA 4ZNEA 5CP7A 5KAQF 2UV3A 5D7JD 2OR9H 3RWEB 2JELL 3AM8A 3VCLB 1ZT4A 5FV2A 4DW2H 3ZE2E 5E08H 3N1PC 2UWEF 3GMLB 1TVBA 1PZ5A 2ED9A 4FQ2L 1KCVL 2Y5EA 2FWOA 2VDRH 3MXWL 3E6FB 4R26L 2B0SL 1JGEA 4GS7C 5F7FA 4HH9A 4NKOB 5BRZE 3C09B 2RR3A 4G42A 1OLLA 1CG9B 3BDXA 4NM8H 2Y25A 3DECA 4BQBA 5AWNH 2ADGA 1FN4B 2DIAA 3BDYH 4XRCB 2DAVA 2JJUA 2VH5H 5EOTA 5FGBC 4WTXA 3O6FB 1T4KB 4ZO9A 1DVFB 3TEUA 5INDA 1LDPH 3FKUS 2X44D 4OCXH 4HG4J 5DRZA 2QSVA 1JF1B 5EBLA 4HAFA 4J7RA 3WFCH 4ZAKD 1BQHA 1LO0H 3O3UN 4K3EH 4LF3A 3QDMD 4LSVH 4S1RL 2O93L 3TVMB 3V0AC 1Q9WA 4OZHA 3RDTD 3C9NA 3MJ9A 1DFBH 3GJFH 1YMMD 3MRQB 1EGJH 2VL4A 4QHUA 3D85B 5DJAA 4RMWA 1SQ2N 3JV4A 2EXYC 1MCWW 1AFVL 1O7SA 1FNGA 3TV3L 1D5ZB 4PRPA 4OAWA 3MRRA 3B9KC 5TE6L 4PGZA 4HBCL 4H0GA 4JO1H 5GJTL 2NMSA 2ERJC 1MHEA 5D7LE 2C9AA 1YJDL 1J1XL 2XKNB 2VISB 4GXUN 1M7XA 5T3ZH 3N85H 2CRIA 4CU7A 4MLSA 5J6HB 3THMH 3OJVC 1N6QH 1VSCA 4BQCA 2F8XC 3OKNA 5EB9A 2IANA 3UAJC 4OLZL 4PJDF 1KN2H 3OQ3B 3HZMB 3TBWB 1MCBA 1RU9H 3MRDA 1MCLA 1FNAA 3CXDH 3O9WA 1H8SA 4IBLT 1B4RA 4PTUA 4L9LC 5FECB 4OFVA 3ULVL 4QXTA 1YN6B 4KRMB 1A47A 1IGTB 1K2DA 3JTSA 1F4WH 3IFPA 1IAIM 5EPMA 1H3PL 2CR3A 4LHUD 3EFFA 4EOWH 2K1MA 5E5RB 3VMPA 1FORH 4QGYA 2ZP0T 1H5BC 3IDJA 4X9IA 3DBXB 4ETYA 1NFIA 3NMEA 3CSBA 4TVPL 4KQ3H 2XN9E 4AEFA 3QUML 3HZVA 4PRBA 2QJDA 1WBZB 1ZTXL 3FN0H 3LB6C 1QBLH 2AW2A 3NABH 4H0HB 4U3CA 3U4AA 5HHVL 5K9JL 4JN2A 1A6TB 3QEQB 3HE7C 3FFCD 5D7KD 3LKOA 4MD0A 3GBLA 2OL3B 4UTAL 1PG7X 3SY0A 4YXHL 3RX8A 4MA8H 3FQXA 4DKFL 5CBEA 4Z7VF 5KVMC 5AYUH 3VW3H 2DLTA 4M7ZB 5E9DB 3QWQB 4OD3H 1I9IL 1OL0A 3DXAB 2KL6A 4WO4C 1FSKB 5I76B 3EOAB 3QEHA 4JRYE 2EKSB 5INCB 1GOHA 3OX8A 3IJSA 5I6XC 4LBEA 3TWCL 2DKUA 1NUDA 5ALBL 4RGMB 4JRXE 1BVLB 2R69L 1T1XB 2YD1A 1LO4H 4OGAC 3GJFA 1RVFL 1EGJA 3NA4A 1NLDL 3GBMH 3TBYA 5L7XH 3ARQA 5HGDA 2VL5A 3BZFB 5JHDB 1OGTB 5TJWK 1E4WH 5C0AB 3CLFH 3QUKB 2EE9A 1ZVHA 4EIZC 3O2DL 1LGVA 4O2CA 3REWB 4YH6A 2B1HH 4NGHH 3RY6A 4QRPE 4UDUB 3JTTA 4ZS6D 3W11C 2XKSA 3CX5J 4PREA 3TA3C 1F13A 1VADA 3GMNB 4KGLA 5ELIA 2X4QA 2YMXH 4QXGL 4PRIA 3DMMA 4OUUA 5AG8A 5ITBL 4QRSB 1UM4L 3H9SB 4IHOA 2CLVA 2C1PB 3KLAA 1FGVL 4JM4L 3B83A 4HKJB 4HFUH 2OI9C 5JORB 3IU3B 3MJ8B 3LZFL 3EGSB 2D7PA 5EO0A 4JQIH 1P53A 2ESVE 2WP3T 3IDGA 3KXFA 3CAFA 1M05B 2NCMA 4QOKB 2VAAB 1NGQH 5I19L 3TYFA 3E8UH 4TOYL 4D0CA 3R1GL 1LEKA 5C0GB 3EJYD 3MLZH 1T04A 4K94H 1NCBH 4FFZL 4ZODA 3QDJE 4XPAH 1XGQB 1JI2A 3PP3K 5BZDB 4JRWA 2MHAA 2VKWA 3JV5A 4NRZA 3L5XH 1C5DB 1X5GA 4PJ5E 4G3YH 4OZGB 5FB8B 5LWYH 2R2HA 1DTUA 4N5EC 3TN0B 2NY5C 3T0ED 1KJVB 2YPKB 1U8HA 4JY5H 5L6YL 5IHLB 2NY3B 2PO6D 3AB0C 1GC1C 2R1XA 4G8IA 5DZLA 1AHWC 5CD3B 4UNVA 2A6JB 1G9NC 4XVUD 3TZVC 2AK1H 3GEWB 1PKQE 4QXUL 1XEDA 5GS0L 5EOCL 3V7MA 5EZJA 3AUVA 2CDFB 4NQCA 3BUYA 1F6FB 3AROA 3B6SA 4NNXA 1W0WB 3Q5TA 3S96B 1JVKA 1UGNA 1CD1A 2AK4B 2CJUH 2G5BB 4LU5H 4FQCH 3QJHB 1KPUA 1KIQB 5AD0A 1TQBB 4G6KH 2A6DA 1NFDF 4U1NB 2NTFB 2AEIT 2W9DL 1ZANH 1Q1JH 1RJCA 3SO5A 4RAVB 3F7VB 1HKLL 1CLOL 1A1NA 5I1IL 1ZGLP 1I1FA 1QRND 2JB5H 3SO3B 3RUGA 5I30L 2A74B 3SCMB 3MPCA 3P40A 5IVXE 4YXLH 4QHLB 4HUXB 5DRWB 2VZ1A 3CZJA 4KUZH 4KAQL 4DWHA 4NM4L 5ANMB 3UJTH 4J23A 5HHOD 5DTFA 1A6VH 2ICEB 4WW2F 4PPTA 4XPBH 2YRZA 1A02N 3D0VA 2EO9A 2W0FA 3I9GH 4PJEB 2OQJA 2GK0A 4NO0A 1XCQA 4C83A 3HS0B 5CZKA 3HNTL 4FFYL 2E7LA 3FT2B 3DV4A 3QUXD 2YPLB 3O6ML 4AZ8A 1G7MB 4X9GA 4CW1B 4R7DB 2CO7B 2F54B 4ZOCA 2RAMA 1F90H 4KK6D 2RFXB 3RWEA 4ZTPL 3VCLA 1LK2B 4PJ9D 1CLCA 1EHAA 4H5SB 4I13B 3PHQB 5T3XE 1J8KA 1BBJB 1ZOXA 1N0XH 1RUQL 3MLYH 5TQ0L 3LKQB 4Y4KD 3FQWB 4WTZA 4EN3B 4N9OB 1S9VB 3ZYIA 1RJLB 4YX2H 3ARTA 1B2WH 3LS5H 1BJ8A 4CRPA 4H88L 4H1LG 4YC2C 1CG9A 5FUZL 1DBMH 2P8MB 1FN4A 4XRCA 5EOQL 1AP2B 1MY7A 1VCAA 3GBNL 2OL3H 3O6FA 1T4KA 5TF1L 5DMIH 5ICZB 1NMCC 1PX3A 4R4BB 1DVFA 3NOIA 3V8CA 4DFIA 4Q9RL 4XB7A 4LCWB 4XPHH 7FABH 3T0DA 5CJOL 4Q6IB 1UEMA 4GJTB 4U1IB 3QNZB 1JF1A 4KXZI 1BAFL 1BEYH 2WQRA 1CN4A 3QZWG 4UT6H 3TVMA 4W4OC 4LCYB 1IGFL 4JHAL 2HLFC 4FQQB 4L8BB 5F6HJ 5GXBB 3PGDB 3MCKB 3TJEL 3HKFA 3MRQA 3D85A 5FA3B 1KACB 4R90L 5I1HH 5EZIL 5C2UB 4TNVF 1JHTA 4B5EA 2R2EB 4Z7QE 1Z9LA 1CDUA 1D5ZA 1DQDL 3EYUH 2FX7L 3LCYA 1TMCB 3JWDC 5E2WL 4R9HA 2D7QA 4BQ6A 2VERN 2QQLH 5BXFB 3DIFB 4KZEH 1TZHA 2AK4D 2VISA 4LL9A 1E6OH 5DJ0B 3H3BC 2D9QB 5EU4B 1N5YL 1ND0B 5J6HA 5JXED 2Q6WB 4P5MB 1J05B 3MZTA 4NZTL 4ZTOH 3HZMA 1RZJC 2HFGL 3TBWA 1NAKL 4NYLB 4YDIH 1BJ1J 5GGTH 4OIIH 3I85A 1YN6A 4J4PC 4JFED 1OGAD 4OD1L 1IGTA 1LO3H 3HNSL 4Q9CA 2KPNA 2XZQH 2ZUYA 3OZ9L 3ECBB 2BDNH 1FYTB 4U6VH 5I1EH 1N2RB 2EECA 2DI8A 3DUSB 3MOBH 1KYOK 4MA7L 4IEFB 1CXIA 3DBXA 5C1MB 1KB5B 3D1MC 4OI7A 1JYWA 3E2HB 5JIKA 3SE8H 3R0MA 1QFOA 4XNYH 5IB1B 4FG6C 5DHVB 4LQFH 4HG4K 1WBZA 4L3EE 4ONFH 4Z7WE 3GO1L 3HC3H 1A6TA 3QEQA 3AAZB 2OL3A 1G7PB 1SVCP 1MCOH 3PDGA 5CSGA 5ADPH 2F54D 3VG0L 1WGOA 3VWKB 1U6AH 4K3DL 1UZ8B 4G6FB 5E9DA 4YR6B 3DXAA 4DGIL 3SN6N 3QDGB 4ZNEE 5I76A 3EOAA 5C0CB 2EKSA 3N1MC 5INCA 1BZ7B 3RGHA 4EDXB 1NFKA 2P5ED 3UTSD 1P5UA 1QSVA 1HSBB 4LPUA 4IRZH 5C08B 3KLSA 1BVLA 1HWGB 1T1XA 2DI9A 1MF2L 3L1OL 1WTGT 2Q8BL 1JPTL 4XI5D 5LKNA 1IKNC 5DVMA 3CFDB 1QFWH 5HGBB 2Q8AH 1CLYH 1CFQB 2C1OB 3D2UD 5DMYA 5EU3B 3BZFA 3LHPL 5JHDA 1OGTA 3QSKB 2Q7NA 2MPAL 1SHMA 2ZZUT 5C0AA 4FS0A 1R5WB 3WKNA 4UBDD 1GHFH 3REWA 1YEDB 4GBXB 3G6AB 3MA7B 4WW1A 3SOBH 3ARVA 4NOFA 4UDUA 2PUQT 4JG0H 4R0LC 1BQSA 3LD8B 2VABB 1NKOA 3UYRH 1H3UA 3GMNA 2MWCA 1CF8H 4G9FB 3GIVB 4N68A 3WYRA 2VYRE 4QRSA 2FJGB 4JAMB 5D1QC 3H9SA 2R1WB 1OSZA 1RIVL 2V7HB 2BZDA 2C1PA 1YPZB 4L8CB 4HKJA 2EYSB 5GGTA 5DD0L 3DGGB 4BZ1L 3MJ8A 5D1ZC 3Q6FA 3MLWH 3HI6H 4QHMB 3EGSA 3LRSB 4Q7DA 4OZHE 3CUPA 5L2KE 5KVDL 4C56D 1M05A 3P77B 3CDCA 3LKRB 2VAAA 2XT1B 2VXVL 1ADQH 3FO9B 2RJMA 1CGWA 1ITBB 4OF8A 3FOMB 1E4JA 4OFKA 5LBSH 5C0GA 1BLNB 4PRPE 5BZDA 5DLML 1S7RB 5I0ZA 3QPQD 1C5DA 1V7NL 2WBJD 4OZGA 5FB8A 1YEFH 2WWMC 3UC0H 3TN0A 1I7RB 1KLFA 1Y6KR 1KJVA 2YPKA 2Z92B 1IGMH 3NA9L 2IANE 5CD3A 2A6JA 3U0WH 5TDOB 4APQD 5F7UA 2F8VA 4GRLC 2DQJL 1U58B 2QBWA 3RVUD 4HC1L 3KPPB 1RUAH 1JF6A 2CDFA 4JDTH 1FRGH 1W0WA 2B5IB 3S96A 3KG5A 1R3LB 2D7NA 3WIIL 2G5BA 1HCFX 5LJYH 3T2NH 4MQXD 3QJHA 1KIQA 3CX5K 2BVUA 1DL7L 2VMFA 2HLAB 1CICC 4KROD 1X5AA 4NN6C 4U1NA 2NTFA 2Y6SC 2MMXA 3GMMB 1F4XH 4RAVA 4P4KC 3F7VA 1MFBH 2HH0L 1AQDB 5IFAL 1AD9B 3CFJB 1KJ2B 5GGSY 1T2QL 3C2SA 4RMSA 1NC4D 2A74A 5HDBE 3SCMA 4ENED 4X7DC 3UO1L 3W2DL 4QHLA 4RWYL 3ESUF 1DQLH 3VWKD 4HUXA 4U1LA 5CJ8A 4WNQB 4YHZL 2BP3A 4PY8I 5ANMA 1YJDC 1UKQA 3BZEB 4UT9L 1GPOL 1ZLWK 4XCFH 3L3DB 1Z3GL 2VLJB 2ICEA 1HILA 3ZKXC 5C0IB 5HVWA 4HT1H 4MB5A 1MCHA 2ATKB 3SDXB 3O3BB 1V7MH 4PJEA 4PYHA 3NCYS 3HS0A 3RWIB 1IZJA 3FT2A 3OKDB 1ZA6B 4CDHA 2YPLA 3ULVC 1G0XA 2AJYL 1KSRA 4MSWB 1G7MA 1VKXB 1IC7H 4CW1A 2OTUB 4R7DA 4LSQH 1ITCA 1U93B 4HLZH 3ZDZF 3TNMB 2ZUXA 4X5WB 4MAYD 5IIEB 1QYGH 2RFXA 3MCLL 2CUIA 3LPGA 4JJHA 1LK2A 4NUGH 3NFPB 3VWJA 4M5ZH 2BSED 3M8OH 3S36L 2NTSP 3QUYC 4H5SA 5KSBB 3PHQA 1IC4L 1I9JL 2MJWA 1BBJA 5T1KB 5BZWB 1EMTL 4ZFGL 3LKQA 3ULUD 4FQXB 5T3ZE 3FQWA 1B6UA 4EN3A 4KVNH 2DQDL 1S9VA 1KB5H 1RJLA 1RD6A 4KY1H 1QFUL 5DHVH 3T2QA 3OB0H 3T1FA 3ILQC 4P2QD 4GLRI 3ELAT 4YWGL 4PRAB 5FEBA 3C60B 4NBXB 2P8MA 1AP2A 4YXKH 3BPLC 4Z7NF 5ICZA 5IR1B 3KXFE 4R4BA 4WTWA 5M7QA 1A7RH 2X6MA 2XPGB 3VDBA 4M7LL 2ZSVB 4LCWA 1J7VR 4GAGH 4K3JL 1BD2D 5GGQL 3WL9B 3WO4B 4LRIC 3ZE2F 1AI1H 3MJ6A 3HCVB 2Y06H 3QHFL 4U1IA 4JG1H 3QNZA 4KVCH 3PWVB 1MNUH 4OZFG 2QQNH 4MYWB 3FRPG 1ZMYA 3MJ9L 2WWKT 2IPUK 1I9RL 3T3PE 4YK4C 3PWJB 2FSEB 4M61B 4LCYA 3V7AE 3HG1D 5ABDE 4FQQA 4L8BA 4PJCB 1B4JL 3MCKA 3PGDA 5SWZA 3VFSB 1OAYH 1D6EB 3GJFK 5FA3A 3SJVB 2AABL 4YHOH 4JFFB 2R2EA 4W6XB 2Z4QB 4XWOC 3BN3B 5F72S 3V2AR 3CLEL 1OWRM 5CP3H 2NXYB 3WXWH 5BXFA 1NCAL 3DIFA 2QSQA 4NQCE 3SGEI 3VD9A 1QSED 5DJ0A 3FCTB 4LHUG 5EU4A 4I3SL 5F7YC 4CAGA 1Q94B 1YQ2A 4QEGA 1ND0A 4U05A 1MFCH 5TE4L 2Q6WA 1NEZG 2R0LL 4P5MA 2BFVH 2EDDA 3MV7A 3B2UC 2OR9L 2Q1EA 1X5KA 5EC2B 3LN5B 4NYLA 4DW2L 2MQ3A 1RZFH 4PG9B 2XQYK 5E8DH 3ECBA 4K71C 1FYTA 2DN7A 1N2RA 5E5UB 3RUGE 3DUSA 3ARBD 1RAMA 4M6MH 5FXCH 4JKKA 4XNQB 3U6RB 3AY4A 3CU7A 1KB5A 4XP9H 1UM5L 3UYPA 5F7MC 3EYQD 3FMGH 1W8NA 3O3EB 5IB1A 1WISA 3WHXB 5C0JB 5DHVA 1DBAH 3TBTB 5FAAA 1JFQH 5AWNL 4AIOA 2DQGH 3NGBB 4MB4A 5FM8A 2VH5L 1F42A 1JP5A 5B4MD 1AXTL 5I75C 3BW9B 3LH2L 4AIZB 2X4NB 1LDPL 3AAZA 4ZUVB 1G7PA 3D39D 2H2PD 4BQ9A 2V5MA 3GMRB 1EEQA 3NVQA 5GS0C 3N06B 4MNGB 3HTLX 5E6YA 1UZ8A 1LO0L 4YR6A 4EVNA 3IT8D 3QDGA 2F5BH 3MA9H 4WI8A 5C0CA 3ZYZA 4ETQB 5HYQB 3K3QA 1BZ7A 1TQCB 3HMXL 1DFBL 1XGUB 3S98A 3MREA 1EGJL 1HYSD 4XXDB 1HSBA 5C08A 4CKVX 4Y8AA 2NQCA 4HWZB 4MB3A 3CFDA 5EZOH 5HGBA 1CFQA 1G6RB 1PY4A 1R3HA 3AXLB 3PGCB 1IL1B 3FFDB 2HJKB 3HB3D 3KYAA 4U4BA 1R5WA 4LMQE 5D5MF 1MIEH 4ZXBD 3S36X 4PUBL 1INQB 3G08B 1YEDA 3G6AA 3MA7A 1KJ2H 4F58L 5CP3A 3N85L 5BW7A 4PB0H 2VABA 1N6QL 1BREA 4NZJA 3I6LD 4G9FA 1ZA3B 3GIVA 1W2KT 1R3KA 3GM8A 4HDIB 4WFGD 4LLMB 1KN2L 1RU9L 4HZLB 2Z35B 1BVKB 2FJGA 4JAMA 1F4HA 2R1WA 3QRGL 4NZRH 2V7HA 2F19H 5KSAB 1NMBH 1YPZA 4RGNB 1OTTD 4L8CA 4PS4H 1F4WL 2D9CA 2EYSA 2O61B 1D5IL 3PQYB 1MAMH 4HX1B 3RJDA 4HUVB 4QHMA 1XFPA 3BIAX 3C5JA 3LRSA 1U3ZA 4EOWL 5FUCC 3MRIB 1T7WA 3T3ME 2MKLC 1FORL 4JREC 3GI8L 4AL8H 3P77A 3LKRA 2EDFA 3QQ4B 2PKDA 3RBGA 4KQ3L 4JPWH 2BSSB 3FO9A 2XWTB 2RQ8A 3FOMA 1BLNA 3QJFB 3RL1A 3V6OC 4EI5D 3LEXB 1J0ZA 3FN0L 3AS2A 3NABL 1QBLL 3M07A 5J6GB 5C07B 2IJ0C 1S3KH 5CD5C 3SBWA 2FR4B 1JMZA 1S7RA 4NPYB 4N90E 1EJOH 3GSVB 5AAWA 4QKXB 2R0ZL 3MV8B 3Q6GL 4MD5B 4ALAH 2APXA 1IEAB 5AYUL 1I7RA 2EE6A 1KBGH 5K59F 3H2WA 2Z92A 4OD3L 3WS3B 4LSRH 3K1KC 2XQBL 5CHNB 4G8EB 2ZOKB 5TDOA 2R4SH 1J1OH 1MOEA 2X70B 3STLA 1U58A 3KPPA 5IVNA 1NUGA 2VLLB 2NY1B 1LO4L 2YUZA 4Y1AD 1R3LA 4YBLC 1PAMA 1X5XA 4FZ8H 1IJ9A 8CGTA 5FDWB 1M71B 2HLAA 1E4WL 4WY7L 5F7EH 2APFA 3UPRB 3CLFL 3BPNC 3F7QA 3FQNB 5DMJB 2FEDC 1Q0XH 3GM0A 3I3EA 3GMMA 3ARZA 2B1HL 3U9UB 2A9NH 4IRSB 1AQDA 2UUDH 2F53D 1JIBA 1WSST 1AD9A 4ZS7H 1VDGA 3CFJA 1KJ2A 3PIQB 5K93A 5J1TC 1J86A 3QXTA 1TPXC 5C6TH 4UV4L 2VLKB 3QEQE 1A6ZB 2W0PA 3VJ6A 4FMKA 4WNQA 1C1EH 1KTKE 3NTCH 4HFUL 1MJ8H 4NJ9H 3BZEA 3GSNB 3MRFB 4X6EB 5E9DE 3L3DA 5C0NC 3DXAE 2VLJA 5LAXB 2HKHH 1RZ8B 4BA8A 1DLFL 5GS3A 5C0IA 5IG7B 2J8HA 3RWGB 4K07A 3SDXA 2CDEB 3VFGH 3PNWB 3RWIA 3TBSB 2IH3B 1ZA6A 5FOJA 3QO1B 3E8UL 4P46D 1YQVH 4MSWA 1VKXA 2PXYC 3MLZL 2EDBA 2OTUA 1YEIH 1U93A 3HFML 5JHDE 3FN9A 3TNMA 5IVXF 4X5WA 5C0AE 2DBLH 4KDTC 4LP5A 3SKNB 3L5XL 1GGCH 3NFPA 5LWYL 1YEGH 5B38G 3L3KB 5KSBA 2IQ9H 4HW6A 2YD9A 4PLJC 5T1KA 1GGBH 5BZWA 4LVEA 4J3OC 4JY5L 3CIQA 4FQXA 5JOPE 1CDYA 4MAUL 2YXFA 5B21A 2IALB 4M93B 3H9SE 5ITFA 2AK1L 1OD7A 1NSNH 2AV1B 2NW3B 4XPTL 4D0DB 2B1AH 2VZSA 4GS7B 4PRAA 5DEFB 1X5YA 3C60A 4LU5L 2E6QA 4FQCL 3F6IA 3VMNA 3N9GH 1ACYH 2OMBA 4XT1C 1TTUA 5BS0D 4G6KL 4QGTA 4UZGA 5I8OH 2XPGA 3TJHC 4QOKE 2ZSVA 1ZANL 4FQIH 3I84A 3WL9A 5IW3A 1OLZA 4O4YH 1KUMA 1MI5B 3HCVA 1CDHA 3QQ3B 3PWVA 4Y16D 3MLUH 4EDWH 3LQAH 3PWJA 2FSEA 1WT5C 2YXMA 4K7PH 4YXLL 4M61A 5MEQB 4CGTA 3MJGX 2EXWC 4HGWA 5FYJU 1JGVH 5I71C 4PJCA 3VFSA 2FL5B 5EU6B 4LDOB 2C3GA 3SJVA 1G6RH 4AEEA 4WEBH 4JFFA 4UMGA 1A6VL 1IQWL 1FO0L 2XA8L 2VR9A 4XPBL 4RAUB 2Z4QA 2ZSWB 1WBYB 5TDNB 1JZ5A 4HD9A 2Z31C 3A67L 5D4QA 3TPKA 1U3HD 2A77L 1G1YA 3FCTA 4I0PC 1Q94A 1QSFD 25C8H 3DX7B 2AK4E 1G9MH 3O45B 2VLRD 1F90L 1RUMH 1YNLH 4LRNH 5A1AA 3LN5A 3CSYB 3AFLA 1ZT1B 1CE1L 3V6FB 4PG9A 5D6CB 4POYA 4L9LB 4EBQH 1N0XL 4KRPC 3WJLA 1NDGB 2DQHH 2P44B 4JPVH 1MWAL 1ZK9A 4WI6A 4DGVH 2X10A 4YX2L 4FQJL 1B2WL 4MXVE 4XNQA 3U6RA 2R4RH 2FX8H 3N1QC 4LLUB 2X2YA 5EN2B 3MUJA 1CGXA 5ANME 1J0IA 3O3EA 1YNKH 4Y4HB 5CGTA 3WHXA 5C0JA 3TBTA 1DBML 5F1SA 4QHNB 3VFRB 1QFPA 4ELKA 5J4MA 2OL3L 1FNSH 4O58H 5DMIL 2DQUH 3QDHA 3VXUD 3BW9A 4PJEE 4AIZA 2X4NA 4ZUVA 4HJGA 4GUPB 1F45A 1UH4A 5I1DB 2YPLE 3GMRA 3HE7B 4MNGA 4CU6A 4M3JA 1BEYL 2F54E 4UT6L 4G6AD 2NY6B 3D3VB 4ETQA 5HYQA 1TJHL 1L0QA 3KAAA 3RX5A 3MQIA 1XH3B 4WO4B 1T66D 1WIOA 1XGUA 3LEVH 4YHNB 3I02B 3VU2A 1F58H 4XXDA 4ZUTB 4X80H 4OJFH 1T1YB 5I6XB 1IT9H 1S5IL 2HMID 3ROOB 3MRJB 3BKYL 4HWZA 4HWBA 5E99H 3EYUL 5DEGB 2ITDB 3BRFA 1G6RA 3JVGC 4JO2L 3PGCA 2C7UB 4L4VB 1IL1A 3FFDA 3T09A 4F8TA 2HJKA 2NPLX 3NFSL 4NCC2 1EHXA 2XG4A 2X42A 2QQLL 4JM2F 5C8JB 4XGZB 1INQA 3G08A 4JY4B 3F6LA 3QFJD 4MWFB 5IHUH 4JFYB 4WWID 4B53A 1FFQA 1I3RB 1C7SA 4Y2DC 5I1GH 1LO2L 1ZA3A 4HDIA 3TA3B 4LLMA 4Z77B 4HZLA 2Z35A 1BVKA 2FGWL 4LCWE 3P9LB 4RAHA 4YDIL 1PJ9A 5GGTL 5J1AB 5KSAA 3OJ2C 4OIIL 5FCUH 4OZ4B 3GSNH 4G7YH 1LO3L 4M00A 1Y6MR 2P8LB 1EAPB 2O61A 3WFDH 5T1MB 3PQYA 1YEHL 2BDNL 4ZD3L 4U6VL 4HX1A 4HUVA 3LAFA 2ZUSA 3MOBL 2ZJSL 1V3LA 2B4CC 3MRIA 3OKKB 2AEWA 2R1YB 4XX1G 5CJXA 3ET9F 3KNBA 2CLZB 3QQ4A 4DKEH 2VDNL 3SE8L 4XNYL 2BSSA 1CTOA 2XWTA 4LQFL 3QJFA 3OL2A 3MRLB 3LEXA 4FQLH 4ONFL 5D9SB 2R23B 1DSFL 3CD4A 3HC3L 1GGUA 5J6GA 3SE9H 3KGRA 5C07A 3MBEC 4LASL 2FR4A 4NPYA 1XZ0A 2O5ZH 2NXZD 1MCOL 4KKNA 3MV8A 5ADPL 4G6JL 1LE5B 4NQEB 1U6AL 1TCMA 4MD5A 1IEAA 4KHTH 1F4YH 1CGUA 1QG3A 3WS3A 2R9HD 5LVEA 4LLAA 5CHNA 4G8EA 4CVUA 4U0RC 4OZHF 3QIWD 1CDGA 2ZOKA 4MDIB 3WS6A 1JCKA 3AB0B 1S5HB 1AHWB 2X70A 1XIWB 4J3VA 2OTPA 4X4ZA 2IH1B 5DI8B 2VLLA 3TZVB 5GRUL 5FA4B 1FYTE 4OIAA 5IJVB 3H7LA 5C0RH 2Q8AL 1CLYL 4W70A 3G5YB 5FDWA 1K5NB 1M71A 2XY2A 4R2GD 3UPRA 4RNRB 1KFAH 3U9UA 3SOBL 2PN5A 5FUOL 5T5NG 5M94B 4IRSA 3N50A 4PP2B 5DA4A 1O7VA 2WV3A 3UYRL 1NDMB 1CF8L 2CQVA 2F15A 3PIQA 2VXUH 3PF2A 4TNWF 2VLKA 4XNUH 3ZO0A 1A6ZA 3MRKB 2YZ1A 5TH2B 2BX5A 5I1KL 2X4RB 4JGMA 2NY6D 3GSNA 3MRFA 3U48A 3WFBH 4X6EA 2IGFH 4XH2B 4MVBD 5IVOA 5LAXA 3QDGE 5HHMD 2EDLA 3MLPA 5C0CE 3RVTC 1S7QB 5IG7A 2CDEA 2FH6A 5E6IC 1I8LA 3TBSA 3U83A 1ADQL 5IT2H 2IH3A 3QUZC 5C08E 3QG6B 1R5IB 4V1DD 4ISVB 5A2KH 5LBSL 2OP4H 2AEQL 4ORGB 3FOLB 2DMBA 3L7FA 4MCZB 2HKFH 3SKNA 1T80A 5HGGS 5H35A 1K4CB 1YEFL 4NKQB 3UTPD 4IS6B 3L3KA 3TGXA 1RSFA 5A16B 1PFCA 2AGJH 4CJ0A 2DKSA 2WMPA 1IGML 4G9FE 3HE6D 1C8PA 2IALA 4XB8A 3SDDD 5SX4H 1EO7A 3LPWA 3V0VB 1A3LL 5FYJH 2AV1A 1NC2A 1YPZE 5I17B 2NW3A 4GG6B 3PWNB 4JDTL 4PJFF 3WNMA 3OB0K 3IAPA 1FRGL 2DLEA 4EJ1C 5DEFA 3S35L 3T2NL 1XR9B 4MNQB 2WQ8A 4YC2B 5E2VH 2PTVA 4UDTB 3U4EB 5KVEH 5D96B 4QO1A 3MFGB 3GNMH 5FGBA 1QSZA 2FNBA 2EDHA 1NMCB 1F4XL 4GW5B 3VXOB 1MFBL 1MI5A 1KEMH 4MA3B 2HT4D 3MV11 5HHQA 3IDUA 3QP3A 1HNGA 3ZYJA 5MEQA 4LDLB 2XIDA 2ZUQC 1D9KB 1DQLL 3IXAB 1EHNA 3MO1B 2EDRA 2FH8A 4R3SB 2KQNA 5D7JC 5EU6A 1EH9A 4PD4J 4POUB 5DK0B 4LOUD 5HYSG 1N6VA 3PWUB 2HFEB 4S0SD 3RVVD 5HJ3B 4RAUA 2W91A 2ZSWA 1WBYA 2BRRH 1YYML 4GG8B 4OUOA 4YHKL 1E4XH 4Q2ZB 1V7ML 4O00A 3V0WL 4Q97A 4YO0B 4OD2B 1VERA 3I3DA 3SEPA 5J1SC 1ZAGA 4XCCH 1IC7L 2CPCA 3DX7A 1BFVH 4P5KB 4QRRB 2HWZH 4BZYA 4ODSH 4LSQL 1G7HB 3S88H 3O45A 3SHSA 2JJWA 2F9BT 1JRHH 3P0YL 4KUCF 3CSYA 3EKCA 4NUGL 4M5ZL 3M8OL 5MERB 1P7KB 1ZT1A 3LIZH 4OCNC 2GI7A 3V6FA 1UJ3B 4AEHL 5D6CA 4L9LA 1NDGA 2DBJA 3BGAA 4NZUH 4KVNL 3KPNB 4KK8C 3NN8B 4ZAKC 3VXSD 5E2TL 4UV7L 5DR5H 4KGJA 3RDTC 4LLUA 4PIRF 1H5BA 4Y4HA 2BNQD 5HGAB 3KPTA 4PJBB 5CJQH 3LN9A 2VLJE 3QWRA 4QHNA 3VFRA 5DD1H 4YXKL 2KZ1B 3CVIL 2JE8A 3BZ4B 3SDXE 3V6BR 4E41B 1EBAA 4GAGL 5AAMA 4LMQI 1A5FH 2HVJB 4GUPA 3QNXB 4GKSB 3TT1L 2O26U 1IGIL 5BOZG 1U36A 5I1DA 2AEPH 4HGKC 3HE7A 3LPFA 2Y06L 3W0WB 2NY5H 4JG1L 4LIQL 3VG9B 3ARSA 2HFTA 4TQEL 3HNVH 4LSPL 1MAJA 3RUGF 4NO5B 1GC1H 1PQZB 4HS8H 5F9JB 1G9NH 2CIIB 3D3VA 3P3YA 4NHUB 1XH3A 4NQXB 4WO4A 4Z7UB 1EK3A 2ZCHL 5D7SL 4M4RA 4YHNA 3TBVB 1OAYL 5KSBE 4Q74A 4ZUTA 2AJXL 3S34L 1T1YA 1GCFA 1GYAA 2IBBA 3U7AA 2Y36H 4KMTL 1KJ3H 4YHOL 4LKXA 1A6WH 4OZIE 4XC1L 3PV7A 5AUMA 4BM7A 3ZTNH 5DEGA 4AYFA 2ITDA 4X9HA 2C7UA 4L4VA 2DIJA 1UENA 4JFDB 3WIHL 3HC4L 3WXWL 5HYIA 5C8JA 1BQHG 4XGZA 1R3IH 5K9OB 1KGCD 4MWFA 4JFYA 2DL2A 3MLVH 4NQDD 2DQIH 4KHXH 2FRGP 3D69B 1I3RA 2V7NB 3MOAH 1G0YR 5DC4B 3ULUL 4RMQA 3TA3A 3GI9H 4R0LB 5KVFL 2VZ3A 1JHKH 2XWBB 2ZUUA 3P9LA 1P4IH 4WFED 1JJUA 3C5SB 5ICXB 5J1AA 4OZ4A 4Y19B 2P8LA 5D1QB 1EAPA 5T1MA 5E8DL 1YUHB 2HT2D 1D9KD 2ITCB 3S35X 3VD3A 3OKKA 4TYUA 4M6ML 2R1YA 1AXIB 4NZDA 4JHWH 4X6CF 1S78D 5D1ZB 1PEZA 4PJ7B 3QXWA 1KENH 1D6VH 2CLZA 5SWZD 4PJCE 4XP9L 4HLJA 3RY5A 4AEIH 4YFDB 5GS1C 1VFUA 3FMGL 3SJVE 5F7NC 1X5JA 3F7RA 4JFFE 3B9AA 2DQGL 2IQAB 3MRLA 1TVHB 3ZTJG 1FC1A 5D9SA 5IBUB 2R23A 4N0UB 4YUEL 2IAMD 4K23L 2UZYB 3EOBB 5IV2B 4QRRD 2GIYA 4OLVH 4X83A 4CVZB 3H6JA 1L4IA 3UPCA 5CZVH 3QAZC 1WAAA 4CJ1A 1FL3B 4ZS6C 5K9QI 1OAZH 1GSMA 3MA9L 1KIRB 1S9KC 2PR4L 4JR9H 3K2UH 4MDIA 4JVWA 4S1QH 1S5HA 3ARGD 1AHWA 4YEFA 3MRMB 4WI7A 2IH1A 2ZUVA 3BE1H 3TZVA 1A1MB 3BIKA 1CK0H 4GRLB 4HUWB 5FA4A 2I5YH 1EXUB 5IJVA 4H25B 3MGAA 5EZOL 2VN4A 1J8HB 5LXGH 1I9EA 1HINL 4Y1AE 4X6BB 3ZDXF 3G5YA 1K5NA 1H8NA 3HR5B 2C26A 4TRPL 4LHJB 4K8RD 4X5LA 5I1JH 2C3VB 4RNRA 1K6QH 1CICB 4XP5H 1CWVA 4NN6B 5ETUB 1HH9B 4LARH 2ORBL 3MXVH 3FQTB 1JI1A 4LLWB 4PP2A 3CC5B 4XVJL 4CBPA 5C3TA 1NDMA 2WNGA 2ADJB 4PBVC 3EJYC 3WKML 3D5OF 2F53E 2ZWLT 4PTTB 1NBYB 4MXWL 3W0WD 5GRZA 2F19L 1OAUH 3MRKA 1NMBL 3X14B 3S5LB 3C5ZD 5TH2A 4QYOB 4HIXH 4MNGE 4U1KB 2X4RA 1MAML 2H8PB 4XH2A 1ACZA 3T0EC 1N5AB 1UA6H 4XAKE 1S7QA 3JWDH 2PO6C 2CMRH 4G43B 3BD3A 1X4XA 5CGMA 2DKMA 3QHTC 2VUYA 3LKNA 2FLBT 4XVUC 3GHEH 2IFFH 4JPWL 1EBPA 2BY1A 2KUTA 3QG6A 4WV1C 1R5IA 5KTEH 4KMQA 4ISVA 3HAEG 4FTVB 1Z2KA 5D70H 5E5MB 3WJJC 4JQVC 3RWJB 3C08H 3DPBA 1VGEH 4ORGA 3FOLA 4UB0H 1S3KL 3JBG7 4MCZA 1RZJH 1EJOL 4NQTA 2V6HA 4HKXB 2HT3D 1KELH 4HEME 4IS6A 4ALAL 1JWSA 5A16A 4GXVH 1CDCA 3CK0H 3U7YH 1WFTA 5HTSA 4OLXH 3QUYB 1SJEB 1Z0MA 4LSRL 3RPKA 3ALXA 4M3KB 1EO8H 2AXHA 5MHSD 1QKZH 1J1OL 3D87B 4HPYH 3V0VA 3LV3A 4RGNE 5I17A 2Z8VC 5ISZB 3PQYE 1AD0B 5FO8B 2HTKD 3GMPB 5HVGB 2X89D 4FZ8L 1XR9A 4KJPD 4MNQA 3BP5B 4UDTA 3U4EA 4PP1C 1KEGH 1FDLH 5JQ6H 1FG2B 4OTXH 3GIZL 3MUHL 3U46A 1Q0XL 4GW5A 4V2BA 3VXOA 4MA3A 3L3HB 3NCBB 3HZKB 3QUXC 1HI6B 5DJYB 3ZL4H 4XXCC 1QNZH 4P4RB 2CKBA 2FBJH 5C07E 5C6TL 1QFWI 1Q9OB 2FCBA 1L6ZA 3IXAA 4YK4B 4KK6C 3MO1A 1I3UA 3MV8E 4W4OA 1C1EL 2AAVA 5HPOA 1MJ8L 4NJ9L 3U2SB 1YA5A 4PJ9C 3A6CL 4WEUD 3PWUA 5IFJB 4JB9H 2HFEA 4YHMH 4WUUB 2X4UB 5HJ3A 1BECA 1YEKH 2ENSA 2VDMH 4P2OD 4OM1L 4Y4KC 4Q2ZA 2O5YH 1CS6A 4Q9QH 3P4NB 3S7GA 1EEUA 4YO0A 4OD2A 1AGDB 3VXRB 5F6IC 5DJXB 5C09D 4PJ8D 4P5KA 2BOCB 4N5UA 1G7HA 1IGCH 2A1WL 3BWAB 4PRHB 3O4LD 1ZLSH 4ZFFB 2DBLL 2V2WB 4A6YL 3GJEB 5HXMA 4QRQA 1ORSB 4NKMB 4OZGF 5MERA 5B39G 1P7KA 1YEGL 3MNZA 1I1AD 1UJ3A 4IIQC 1GGBL 3QQNA 4J4PA 5F89B 2R2CA 4TUJB 4MJID 3VFOB 3SGKC 3NN8A 2VLKE 4K71B 1P7QB 5FIEA 4RMRA 5T1LD 3OF6A 3UBXG 1OAXL 3DUHA 1QRKA 2JELH 2B1AL 5SV4A 3UDWC 3JXAA 4XCNB 5HGAA 4PJBA 4RIRB 1A6AB 1ACYL 4PV8B 4PY7B 1H9VA 5I8OL 4E41A 5F7HA 1T83C 4FTVD 3IB4A 2HVJA 3QNXA 3WFEH 4O4YL 5I75B 4R26H 3I6GB 1MLCB 3RGVD 4EDWL 4OBSA 1UFUA 4PD4K 4K7PL 4NO5A 5ERWB 1PQZA 2VTFA 5JXEC 5F9JA 1NCTA 2CIIA 3EDJA 1S8DB 4MXVF 4NHUA 1N4XH 4NQXA 2E9BA 4Z7UA 1JGVL 3HN3A 2PTUA 3TBVA 3O8XB 3S37L 1NCUA 4JDVB 5E95B 3IFOB 1G6RL 5KJRH 5JW3H 2H1PL 4WEBL 3MLXH 1OP5H 2OX5A 4I9WE 4M43H 2JJSA 2VZOA 4HWEL 1HHHA 5D6DC 2D0FA 4OCRH 4S1RH 1IKNA 2G75A 3LRHA 4I18C 3IVKB 4JFDA 2W9EH 1IAIH 1IMHC 2GK2A 1UADC 5K9OA 4NN5C 4N1CA 3O2WL 3D69A 1VB9A 25C8L 4MQ7B 3OKEB 2V7NA 4XWGH 1G9ML 1RUML 2HVKB 1YNLL 4R0LA 2XWBA 3EYVB 1LO5B 3KS0H 1JZ8A 5ICXA 4HBCH 4E5XB 2E9IA 5GJTH 5D1QA 2GFBB 2NX5B 1YJDH 1J1XH 4YHIB 4K3HA 1E28B 1YUHA 3QT2A 4KI5D 4XNZB 3UTTD 4JPVL 2JJTC 3ALWA 5LQBL 4DGVL 3VI3E 1G7JA 5E0QA 5D1ZA 3T77B 4PJ7A 5J12C 4OLZH 3MV01 5D8JL 5I16B 3O3AB 5E94B 5EU6E 4JREB 4FRWA 2VZUA 3WUWG 5HYJB 3ULVH 2ZUTA 4PJXB 3OR7B 1QLEH 2IQAA 1TVHA 5FYKD 2AP2A 1FNSL 4N0UA 4QHKI 2DQUL 3DX6B 4I0CC 2NY4D 1DN0B 3EOBA 4JGJA 4RGOL 4KKBC 5IV2A 1RHHB 1F3DH 4UBDC 4CVZA 2YD6A 4TVPH 1BIIB 1FL3A 3VDCA 3AMKA 1FLRH 2L7JA 1U8MB 1KIRA 1ZTXH 1ZE3C 1SMAA 2DOCA 3B5GA 1CTNA 2LAAA 4PJIF 4Q6IC 1F58L 1NCDH 4X80L 4OJFL 1A1MA 1IT9L 5K9QG 1JNLL 4GRLA 4YXHH 4HUWA 1EXUA 1P7QD 5E99L 2VKXA 4H25A 1J8HA 3DROB 4X6BA 3HR5A 4YBLB 2YWZA 3S4SG 2C3VA 2R29H 4NN7C 5ACLA 4OV5B 1CICA 3H9HB 3MNWB 4OF7A 4PB9H 5IHUL 5F9DC 5ETUA 3BPNB 1HH9A 5FYJE 2P5WD 4I3RH 3FQTA 1EVTC 5L88H 4LLWA 3TWCH 3CC5A 1EVUA 2VQ1B 5E7FA 5ALBH 2ADJA 2R69H 3DI3B 5I1GL 3PP4L 1RVFH 5SWQB 4PTTA 1NBYA 1NLDH 4GAYB 4AMKH 1IKFL 1IILE 3X14A 3GSNL 1E0OB 2ICES 3OKOB 1TPXB 4G7YL 3S5LA 3N1FC 4QYOA 3QPQC 2A0LD 1S7WA 2WBJC 3O2DH 4U1KA 3EHBD 2H8PA 1A7PH 1Q9KB 1NANH 4WHYG 4WEMB 2N1KA 1N5AA 4GXUM 3U7WH 1T0PB 3D3VE 1C12B 1U3YA 4G43A 4QXGH 3ZE1F 5ITBH 4DKEL 4NQVB 2W9LA 4JEGB 4APQC 4DVBB 4POZD 5E5MA 4JPIB 4AH2B 4LGPB 4FQLL 3RWJA 3VFNB 4K7PX 43C9B 3SE9L 2AKRB 4L4VE 4MQXC 2O5ZL 4HKXA 5IESH 1QVOB 4KROC 3E2HC 4Y4FD 1XF2B 4NO3B 3K7UA 4UINL 5I19H 4KHTL 1F4YL 4OCWH 3QI9D 3QUYA 2ID5A 1SJEA 2VITB 4LLVB 3OHXB 12E8L 2N56A 1EFXB 3MACL 2EYTB 1QR4A 3RWDB 4ENEC 1C5CH 4P9ML 4M7JH 1BFOA 3MRPB 3ARYA 5DWUH 2Q20A 1UWXH 3VWKC 4P57B 4ZSOB 1KCUL 5ISZA 1AD0A 5FO8A 3GMPA 3ARDB 2E5EA 1QBBA 1K3IA 1UH3A 3BP5A 3R8BB 2FLRT 1DQQB 1JBJA 1GJIA 3F65A 1FG2A 4L4TB 1KFAL 1LK3H 3WCYA 2X4PB 3D25B 4F80A 2YUVA 3L3HA 4QXUH 5GS0H 5F1IB 3HZKA 4M9PA 1HI6A 4LRIA 35C8L 5DJYA 4P4RA 4P2CG 1X6NA 4LP4A 3KPSB 4PLOB 1VHPA 4XNUL 1Q9OA 3OR6B 4FN0A 4GBXC 1I75A 4MAYC 4FP8L 1YPZF 1XAUA 4NQEE 2W9DH 1OWWA 3U2SA 3R4DA 3WFBL 5I71B 1WAAE 5IFJA 2DMCA 4WUUA 3O2DA 1I7TB 1N3NB 2ENYA 4U2ZA 3O0RL 1DCLA 1TTGA 3ULUC 5I30H 4UQ3B 4D0BB 1I4FB 3P4NA 4D8PB 1SM3L 2Z31B 1AGDA 3VXRA 5DHXB 5DJXA 5DQJB 4WFHD 4FXGB 4P0DA 2BOCA 4NM4H 5BJTB 4Z8FH 3BWAA 2QEJA 3RWCB 2QHLA 2JIXB 3NCFB 4LSTH 4ZFFA 1BOYA 2V2WA 2HKFL 3GJEA 4E0RB 1ORSA 1YECL 4BFGA 4LLQB 2FIKB 1MHCA 3MUY1 4HWNA 5L0QB 5F89A 1WFUA 3O6MH 4TUJA 1JTTA 1IC1A 4KRPB 3J8F7 3TO2B 1WITA 3KS0J 3PGFH 4YBQC 3CX2A 5FYJL 3GFUA 4H1LB 1MH5B 5A40E 1EEZB 3PWPD 4XCNA 1MIML 4JN1L 1ED3B 2P24B 4RIRA 1A6AA 4G9DB 4PV8A 5KVEL 1UKSA 4PY7A 1RUQH 5TQ0H 2APVA 3HLAB 4DUWA 4Z7OE 4IDLA 1ZHKB 3IDIB 1KEML 5I8KH 1T6WA 3I6GA 1MLCA 4M5YH 4HH8A 3OPZH 4UT7L 3QZWB 5FUZH 1PGRB 5ERWA 2X1WL 1S8DA 1XF4B 1F3DJ 3GBNH 3S8WA 4HIIA 3JSSA 3NPZB 1JF5A 3DYOA 3O8XA 4CMMB 4P5TD 4FABL 4JDVA 1SJVA 5JPMA 1KG0B 3Q3GB 5C7XL 2XZAH 4X6DB 2BRRL 2BVPB 1U8KB 4HCRH 1E4XL 1LEGB 1FH5L 1P1ZB 3ARBC 3SDXF 3MV9B 3IVKA 1NC2D 5B3JE 4NQSB 3ARDD 4M6OL 4GG6E 3EOYG 1QUNA 1MEXH 5CLWA 4XCCL 1DQTA 3TJEH 1BFVL 4GT7A 2XI9A 3EYQC 3OKEA 4LCIL 4MNQE 4OB5L 4R90H 4RSVA 1T7VA 3C8KB 1JNHB 5IB3B 2HVKA 4MNHB 1FL5B 4Y2DB 2AI0H 3PE9A 1A6UH 3BUTA 1LO5A 1X7QB 4N8VG 1U2CA 1NPUA 2FX7H 5B4MC 5E2WH 4LAQL 3RVWD 3ZHKA 4E5XA 5E00B 3ARED 5GRVK 5KSBF 2X9YA 1QD0A 2GFBA 1EERB 2NX5A 4YHIA 1E28A 2H2PC 4JCMA 2I07B 4B0MM 3PJSB 4JKMA 2RGSA 4NZUL 1N5YH 4I8DA 4HGMA 3LQMA 3AS0A 5DURB 1KIPA 3T77A 1RULH 4NZTH 2FHCA 1IAKB 3D18B 3IAQA 4PGJA 5I16A 2HFGH 3O3AA 5E94A 1NAKH 5MI0C 4IOIB 1X5LA 5DA0B 3U0PB 5HYJA 5KSUB 4U6YA 5CJQL 5F44A 5KZCB 4PJXA 1HYSC 3HNSH 2Y7QB 3OR7A 3GSUB 4M8QB 2EC9T 2EXYD 1KB9J 2EYRB 3DX6A 3V6OA 4P3CH 2XTLA 4ELMB 3T0AA 1A5FL 4MA7H 3B9KD 3FHQA 1J0JA 1DBJH 1RHHA 3MBEB 3TH4T 3HB3C 3QYCA 4JFHD 4U1MA 4NKDB 4YAQB 2V17L 2C4FT 3B9VA 4ZXBC 4QRRE 5F9OL 1F11A 1BIIA 1U8JB 3HNVL 1KCKA 2IMNA 1U8MA 5HHXH 2I24N 4YHLH 1H3TA 43CAA 1UKTA 3GO1H 3BGFC 4U0RB 3DI2B 1OY3B 2ICWI 1RHFA 4HWUA 4BELD 5TPWH 2Y36L 1KJ3L 1A6WL 1OTTC 4F9LC 3VG0H 2BXZA 3KDMB 2VO5A 4K3DH 3DROA 5B22A 3B43A 1N64H 1TJGL 1QTYT 1AGCB 4DFHA 1OQXA 15C8L 3VDAA 4HCRA 4OV5A 3H9HA 3MNWA 5F8RC 5EA0L 2DQIL 4PJBE 4GSDL 4XZUB 2VQ1A 4YDKH 1VFAB 1HHJA 3D9AL 3L1OH 3GI9L 1JPTH 5SWQA 2H45A 4EI5C 4E41E 4MXQD 1S9XB 4TSAH 4GAYA 5F70A 1F8TH 5GRVL 3OKOA 2MPAH 5CSBA 3W0WE 3RZCD 4IRJD 1NFDB 4D9RE 1R0AL 1P6FA 1CFSB 1XGTB 5JDJA 1AO7D 3BEVB 5DRNA 1C12A 2VJXA 1IM9D 2ZOLB 5MENB 4Z7UE 1KENL 3BX7C 3JV6B 4P2RB 3VFTB 4NQVA 2FECI 4AJ0A 2CDGB 3WJLC 5DC0A 5E6IB 4DVBA 4X7TB 1A7BA 4EKXA 4J3UA 3QUZB 4JPIA 4AH2A 3HA0A 1Z6JT 3VFNA 1Z9SA 2E7HA 2NY2B 5DD0H 2Q86B 43C9A 5C86A 2PXYA 4EXKA 2EIEA 4JFDE 4TUOB 3BH8B 1DUYB 2E27H 5DFWH 5KVDH 1JPFB 4LK4A 4HIJB 5DJCA 3QA3B 4BH8B 4G8GB 1UCBH 5C6WH 2GITB 4O9HL 2BVTA 4OLVL 1XF2A 4XVTL 4NO3A 4U6HB 2GTZB 2VLMD 2GKIA 2VXVH 5EORH 2ADIB 2WK2A 3NGBC 3W11D 2VITA 4C55A 1OAZL 3GZKA 4LLVA 3DUUB 3OHXA 3DX8B 1EFXA 4H1LH 3C6LD 4JR9L 3BKMH 3K2UL 4S1QL 4R96B 5DS8B 4HQQL 3RWDA 1MVUB 1RJYB 2VWEC 3F58L 5MP6L 1NBZA 2V5YA 4Y19E 1EIBA 3MRPA 3OKLB 3CFEB 2Y1VA 1LNUB 3DYPA 4ZSOA 1CK0L 2UYLB 5ICYA 5ESVB 3IKCB 3VE0B 1JK8B 5JIHA 5LXGL 2X4SB 3VFUB 4F7MB 1I1YB 1M7IB 1DQQA 1MRCH 1P4LB 4F7TB 2IPKB 4PJ7E 5EU5B 6FABH 4L4TA 1KCRH 4XP5L 2X4PA 4Y89A 4ZO7A 3D25A 4LARL 2DLHA 5GS2H 3NAAH 5F1IA 4P3WA 3NZ8B 4P46C 1UJTA 4N0UE 4Q58C 5FV1L 1CFBA 4OT1L 3K4AA 3KPSA 2VDOL 5EIIB 1P7HL 3OR6A 1WCBB 1OAUL 2BNRB 2GY5A 4HF5H 4NQUA 4HIXL 2ZUQB 3ZKMC 1RZKC 2KH2B 1UACL 4QF1B 4N5ED 2D2OA 5D7JB 2HH0H 2FX9H 1XCTB 1WIPA 3CDGB 4LPYA 5IFAH 1UA6L 1I7TA 2BSRB 2KDGA 4FFVD 5D2LB 1G9MC 2RIKA 5KSAC 5FM5M 4D0BA 4FXKA 1I4FA 3W2DH 3GHEL 4D8PA 2Z31A 5FYLD 5KTEL 2C3WA 5DQJA 2H32B 5D70L 4FXGA 1GGIH 5BJTA 3RX7A 1J8HE 3C08L 5DXWA 4UT9H 1GPOH 1X9QA 3RWCA 2JIXA 1RK0B 3OGOE 1DQJB 1HOCB 1I3VA 3P4MB 4OKDA 5ID0B 4E0RA 4QWWD 1WWWX 5JO5B 4LLQA 1SYSB 2FIKA 4HHAB 5ADOH 4GXVL 1BHGA 3MR9B 4OLXL 5KW9L 2H26B 1W0VB 2EDWA 1SEBB 4Y16C 5DUPH 2B4CH 4MD4B 5GJSH 3TO2A 1QKZL 3E0GA 1MCQA 1U0QA 4Z76B 3BJ91 2J8OA 3O4OB 3KYOB 4K8RL 4ZAKB 4H1LA 3KPRD 1MH5A 3QDMB 4YNYB 5F96H 2GJ6D 1EEZA 3B3IB 4MDJB 3S36H 1ED3A 2J4WH 2P24A 3GMQB 3RDTB 1FFOB 3U30B 3IU4L 5DHYB 1WWAX 2A9ML 1KEGL 4ZFGH 1FAIH 1SBSH 1YMMB 5CINL 4DVRH 3HLAA 3IDMB 4OTXL 2DQDH 2AXFB 5F8QC 1ZHKA 3IDIA 4DCQB 3X3GH 1U3HC 4FTVE 4OZFB 4L8SC 1CGSL 1A9EB 2W0LA 5DJ8B 4ZFOB 3ZL4L 1K8DB 3QZWA 4YWGH 1KN4L 4NBZB 3ULVE 4CMHC 2EDXA 1WEJH 1XF4A 1D5BB 2XNAA 3NCCB 3DJ9A 4KJQC 4ZMAT 3IYLW 3ARWA 4CMMA 2DJSA 4ONOA 3B4NA 4K3JH 4HKZB 1FNEB 5GGQH 5FYLH 4CU8A 3ZLQC 1KG0A 3Q3GA 5FO7B 2CD0A 1OP5K 4YHML 4F37K 3QHFH 4X6DA 4TVPE 4U1GC 4FXLA 4F7PB 2BVPA 1U8KA 2VDML 1CI5A 1I9RH 1JPGB 1LEGA 1P1ZA 3MV9A 4WVRA 2BK8A 3U82B 4NQSA 1CR9L 5HVHB 4LHUB 5ISZE 5ACZB 1AY1L 4NNPH 1NEZB 5FFLA 1S7TB 4NBYB 3PHSA 2DWEB 1IGCL 3C8KA 5IB3A 4MNHA 1FL5A 1WF5A 2OR7A 5BV7B 4PJGB 4Y2DA 4Z7WA 1X7QA 3P4OB 5J89A 1I1CA 5TE7H 5E00A 1NAML 3U79A 5CEYB 4ODWB 4EUPG 1NCAH 4O5LH 2I07A 2V9RA 1U8NB 1C08B 2QADD 3PJSA 3FFCB 3TH3T 1GAFL 5C0BD 5HI5D 4IMKC 4PV9B 5TE4H 2F74B 4CNIB 1JL8A 4BUGA 4Z6AT 2FYYA 4G6AC 2WIIB 1IAKA 3D18A 2IBGA 2WP3O 4IOIA 3ARUA 1KNOB 1T66C 5KSUA 5SWSD 2FGZA 5GS1B 4DQOL 2Y7QA 1BX2B 3GSUA 4M8QA 4WUUE 2HMIC 1RURH 3KJ6L 2D7OA 4KV5E 4CN6A 2EYRA 4M93C 3UROR 3WNKA 4ELMA 4BH8A 5JUEL 3SDCB 4K7FB 1CL7I 4LPXA 3WFEL 3MBEA 1AJ7L 3G6JF 5SX4I 2ZG2A 3VXRE 4OF5A 4NKDA 1T20B 1UM5H 1P84J 4ZYKB 1R6VA 3I3BA 4OF3A 5DUML 3FZUD 5I9QC 4PRHE 3VI3F 3RVXD 1XR8B 3QAZB 3OKMB 1N4XL 2H9GB 1HQRB 1URLA 4XMPH 1AXTH 1ZVYA 3P4LA 4D9QD 2YA0A 3LH2H 4HK0B 4M6NH 3P0GB 4BFEA 4C4KT 3RIFK 5KJRL 5JW3L 5CEZH 3MLXL 4M43L 3B8YA 3FONB 3KDMA 2IBZX 5L2JB 3ARFD 1HHGB 2ATPB 4DEPB 4NJAH 4OCRL 2NZIA 1AGCA 4JJ5B 2MKWA 2NNAB 2W9EL 4Z5RB 5L2KA 1IAIL 1IBGH 1N7MH 3HMXH 3V4UH 3DHJA 4P9HL 4XZUA 3Q1SL 4XWGL 1VFAA 4KDWA 3HUJB 4OLUL 4X99B 3SDYL 3DO3A 3FB5A 1S9XA 4JY6A 4DGYH 4FZEH 1IEBB 1ORQB 1FO0B 3KWWB 2J1KA 2NXZC 4OLYH 5DEZA 4PUBH 1Z9MA 2AJUH 3U9PL 4S1DD 3WE6B 4F58H 1CFSA 1XGTA 1T1WB 3BOVA 4N0YH 3WFHB 4ESKA 2P43B 3BEVA 4O02L 2ZOLA 5E03A 5MENA 3T0EB 3JV6A 2H32H 3WIFB 4P2RA 3VFTA 3QIWC 1JRHI 5J0BA 1X4ZA 3QRGH 1CLZL 2PO6B 2CDGA 3DLQR 2YR3A 5E6IA 4X7TA 1QLEL 3QUZA 1A22B 4WV1B 1D5IH 1JTPA 1NQBA 2YRPA 3NIDE 4Z95H 2Q86A 1CFTB 3ME0A 4TUOA 2LFGA 3BH8A 2LU7A 2E3VA 4ZG1A 1JPFA 2PYED 1MWAB 3GI8H 3QA3A 4HIJA 3BQUD 4G8GA 4R2GC 5FHBH 3EZJB 2GITA 4Y4HC 2YHGA 4U6HA 2GTZA 1ZLUH 3VH8A 2ADIA 5F3BB 1FLRL 3DUUA 3TCXA 2J3SA 2A73B 1NJ9B 3DX8A 3M1BA 1KLGB 4R96A 5DS8A 1MVUA 1RJYA 1QRNB 4WWKD 3PG2A 1NCDL 3OKLA 5EBMB 3CFEA 2E7MA 4QTHB 3ILPB 2NX5E 1LNUA 1UWXK 2UYLA 2UZXB 3G5XB 2R0ZH 5ESVA 3IKCA 3Q6GH 3VE0A 1JK8A 2V9TA 1ULVA 2X4SA 1L7IH 1RIUH 3VFUA 2NY6C 1DEEB 1M7IA 4F7TA 1P4LA 4P99A 4G5ZH 4MVBC 2ZG3A 3MRNB 2XQBH 3QIBB 5FUCE 5HHOB 2R29L 4OZFH 4PB9L 3BAEL 2GJZB 5HYJE 1RIHH 5CMAB 1EEYB 4I3RL 5GGUA 5L88L 1QBML 2D03L 4PJXE 5ACMA 3NZ8A 3HMXA 5E1AB 3IAGC 1M1SA 3GMOB 4XC3L 1WWCA 3SDCD 1A2YB 3V6OE 2E6JA 1E6JH 3QUXB 4Y5YC 5EIIA 1HXYB 4W81A 1WCBA 4AMKL 2BNRA 4B7IA 5KSVA 4U6XB 1HXMA 3AMLA 4WY7H 3BMVA 2YN3A 3CZFB 4R4FL 4QF1A 1BJ1H 1A7PL 1BQUA 5D7JA 5DVLA 1XCTA 3BVNA 3CDGA 1K8IB 1Z5LB 3U7WL 2WSKA 4PJ9B 5D2LA 1F97A 3TO4D 3WDIA 1ZV5A 4DZ8B 4UV4H 2Y4SA 4Y4KB 2AQ1A 2DYPD 4F3FA 2F58H 3K2MC 2H32A 3QCVH 4AY0A 3MRHB 3V9FA 3VXMD 5F3HB 5BV7H 5K33A 4IDJL 5F6IB 4ONHB 4KK5D 4OCSH 1RK0A 5SX5H 1DQJA 3Q5OA 1HOCA 4F9PC 5BO1H 3P4MA 1KTDB 4LAJH 5J56B 5IESL 5ID0A 1DLFH 1TNMA 1BQLL 5B38B 3H42H 5JO5A 4X7EC 1SYSA 4HHAA 1A64A 3MR9A 1OAKH 4P4KD 4YHYC 1WAAF 4OCWL 5EUOF 2HT4C 2H26A 1AQKH 5KVGL 3OB8A 5FGRA 1SEBA 4IIQB 4J12A 4MD4A 4S11A 1CGYA 4NHCL 4W6WB 4Z76A 3HFMH 1C5CL 3KYOA 4M7JL 1MVFA 4ZAKA 1WZ1L 5DWUL 3NH7L 1NCCH 3QDMA 4YNYA 3SKOA 4MDJA 3B3IA 1JV5B 3GMQA 3RDTA 1FFOA 1PW3A 2J6EH 4FQPA 4RDQG 1IEHA 3DNKA 4I5BA 4LOUC 1QA9B 5DHYA 2GCYB 3HRPA 5CSZA 1YMMA 1G6VK 1EFQA 3RVVC 5AEAA 1VFBB 3IDMA 4MAUH 4LEOB 1XIWC 2AXFA 2I27N 1LK3L 5H37G 4DCQA 3HI1B 2PF6A 2FEEL 4KC3B 3DWTA 4OZFA 3FRPA 1A9EA 5DJ8A 4LPTA 4XPTH 1K8DA 4ZFOA 2EO1A 5FOBB 5KAQG 1ZEAL 1E4KC 1PYWB 4YJZL 4N9GB 3ZE0E 1D5BA 1WZLA 5JR1H 5CKAA 5DVOA 2VRAA 4ODVH 2I25N 2X41A 3VRLE 4HKZA 1FNEA 32C2B 2A83B 1NCNA 3OXRB 4XMLH 1ONQB 4JFEB 4F7PA 1OGAB 2VN7A 2OSLB 5IQ9B 3MLTB 2J8UF 4DKDC 1JPGA 1CT8B 3LDBC 3C8DA 2BVEA 4LHUA 4ZSOE 1ROWA 5GISH 4I18B 2ZCKL 5ACZA 4GAJH 2XICA 1NEZA 1S7TA 3HPJB 4NN5B 3OGCB 5DFVD 4Z8FL 3QIBD 4HULB 2DWEA 4YQXL 1N0LA 2B39A 1NCWL 4LSTL 5E8PA 1IQWH 1FO0H 4PJGA 4Y5VC 2XA8H 5F7LB 3S3JA 4L4TE 4HIEB 3P4OA 4I77L 1UYWL 3A67H 3FO1B 5D1XD 5C0EB 5CEYA 4L8DB 4ODWA 5IEKA 5GSVB 2A77H 2EDQA 1U8NA 1C08A 3GRWH 5D5MB 3FFCA 3L5JA 1QLFB 3ROLA 5JZ7D 5GRJL 3KPSE 4PV9A 2F74A 4QRUB 4CNIA 3PGFL 3AGVA 1U2HA 2BVYA 1TIUA 2WIIA 3QB7C 3IDNB 5B3JF 3K0WA 4DN3L 1KNOA 1FZJB 2BERA 5J12B 4FMFA 2EEDA 5GS1A 1CE1H 3GMLA 1BX2A 2P5EB 3RTQD 3UTSB 4KKAD 4W4NA 3LSOB 4M1DH 1H3XA 1OTSD 2J6EA 1EDQA 1MWAH 1YMHB 4K7FA 4FQJH 3E6FA 1ZVSB 5I8KL 4M5YL 1YDPB 2K3TA 3OPZL 3D2UB 5BRZD 4NKOA 4ZYKA 4YPJA 3K1DA 3BD4A 5D96C 4LPCA 3SKJH 3GK8L 3EJZD 3VGEA 5MEPB 3OKMA 3DVFA 2H9GA 1UEYA 1HQRA 4M7KH 2VAJA 4HK0A 5IWLC 4OCYL 2OXGA 4JO3L 3FONA 2XZAL 5I15H 5L2JA 1HHGA 2HT2C 2XACC 1D9KC 4HCRL 4JJ5A 3EUUA 2NNAA 4Z5RA 4OQTL 1S78C 1TJHH 2AQ2A 1MEXL 5GRXG 1S7XB 4NN7B 4C56B 3PDDA 1CQYA 3OAYH 3HUJA 4YIQB 3L3GB 1S5IH 5J57B 4X99A 3RP1A 1JWUB 3BKYH 2AI0L 1A6UL 2IAMC 4JO2H 1IEBA 1ORQA 4RMUA 3NFSH 1FO0A 5D7LD 1RI8A 3KWWA 3MZGB 1HIMH 2XKNA 5ESAB 5IGXL 3SQOH 1A7NH 5DO2D 4KTDH 3WE6A 1T7ZA 3WFHA 4P23D 2WBJB 1MHPH 4JANB 2LAGB 3GRWA 4MS8D 3ESVF 3T0EA 1LO2H 1RULL 4K9EL 3GKZA 2VDLL 1UJ3C 1TETL 2GTWB 1Q0YL 2FGWH 2Z9TA 2PO6A 4AG4L 5FECA 3ARGC 3TFKD 3SGJC 4APQB 2N7AA 4WV1A 4X6DE 3U1SH 1YEHH 4U49A 4ZD3H 4XHJD 5IOPB 4M6AA 2XXMB 1UWEH 3GB7B 4P3CL 1CFTA 3WJJA 1I85C 3MC0A 4I2XB 4OQ1A 2ZJSH 3MV9E 4JQVA 1DBJL 1DDHB 5IBLC 3GSOB 1MWAA 1FP5A 3SDAD 3MODH 1FQ9C 1B88A 4K8RC 1AKJD 1EV2E 2QHRH 2P46B 2FJFB 2ZCLH 4KROB 2VDNH 2XN9D 3TLRA 1MCWM 4FNLH 1A3RL 2EE2A 5F3BA 5HHXL 2VLME 1Q72H 2A73A 5E8EB 4YHLL 2ZPKH 3FB8B 1DSFH 1KLGA 3EZ8A 4Z7UF 3ZSTA 4LASH 5DD6B 1QRNA 3BDBA 1LP9B 5EBMA 3ILPA 1NC4B 5TPWL 3VG9C 2HTLD 3G5XA 1LWRA 3C5ZC 3O3DB 5HYEA 4G6JH 5I18H 2FHBA 1DEEA 2DLGA 2UZIH 3CNKA 1N64L 3MRNA 4MHHI 1CBVH 4JRYD 2EDTA 5HHOA 1MHHB 5CMAA 1EEYA 4X4MA 1RUKH 2OBGA 3W9EB 2JJSC 4YDKL 4JRXD 5E1AA 5GRUH 3GMOA 2JF1A 4XNXL 1TFHA 5GGRB 5DJ6B 1A2YA 5TFSH 3QUXA 3RKDD 4ELME 4TSAL 4XXCA 2WWKO 1W0YT 3ABZA 1F8TL 5DZOA 5CD5D 4U6XA 3EYSH 3QUKA 2HT3C 1IAII 3CZFA 3QQ9C 4NC2B 2RCSL 5FO9B 4MAYB 4QRPD 5FUOH 4EEEA 1K8IA 2XTJB 4RX4D 2HFFB 4PJ9A 4JVUA 7CGTA 4PJ7F 2JCCB 4DOHB 4DZ8A 1KPRB 5EC1B 4HSQA 4Y4KA 3SE3C 2YPVH 3MRHA 5I1KH 5FYLE 4HMDA 5JORA 1FNFA 1TDQA 3IU3A 4C58B 4ONHA 4YGAB 2HTKC 4DN4H 4P2QB 4KJPC 1KTDA 2ESVD 2APBA 3FT4B 3H3PH 2E27L 5B38A 3ORJA 1UCBL 1VFOA 3B9DA 4RMVA 4QOKA 3WHE1 2FEDD 1G84A 5BCAA 1HWHB 3DRTB 3KJ4C 5EORL 1DBKH 1BD2B 3PHOB 2VIRB 4IIQA 3TNNB 2AEQH 3BO8B 3QDJD 3BKML 5FHAH 1XGQA 3V5KB 3SGKA 4PJ5D 1NFDE 1JV5A 3S3SA 2G60H 3BZDA 2IPTL 3T2PA 1J87A 1AH1A 3G04B 3HG1B 1P9MC 3UDWA 1MRCL 3NIFE 5MENE 1VFBA 6FABL 4JLRB 3DSNA 4LEOA 4P2RE 2NZ9C 1KCRL 3HI1A 1T83A 3IF1B 1A3LH 3NAAL 4HUKB 4CDGC 4KPHH 1AGEB 3PL6D 3BI9X 1W8OA 3VGFA 5FOBA 4PJ8C 3EO1B 3QCUH 1PYWA 2AK4A 3T4YB 3S35H 1QSEB 3SE4C 3ULSB 4WFFE 1KULA 5JXEA 1UWGH 4HF5L 4G8GE 4UTBL 4X8JB 1BWWA 1HDMB 5HYSB 32C2A 4JKWA 1I1AC 2FX9L 1U8PB 3OXRA 4P9HC 1ONQA 1B6DA 2ZG1A 4JFEA 2J88L 1OGAA 2OSLA 4YDVB 1NH6A 3MLTA 5IQ9A 1JGLL 3G5VB 1CT8A 5D6DA 1PG7W 4J3XA 5DRWA 3ARBB 4I18A 1B3JA 4UI2A 3EBAA 1X6LA 1GGIL 3HPJA 2PW1B 3OGCA 4GH7B 3RHWK 2QSCH 5CEZE 3ULVF 1SYVB 3AC0A 3CFIC 3NCMA 4HIEA 4JZJC 1YYMH 4BK4A 4YHKH 3BN9D 3FO1A 5C0EA 4OFYD 5ADOL 4RFNC 5DMGD 1JNNH 4L8DA 3V0WH 3EFDL 5GSVA 5D5MA 1QLFA 3RGVC 2JLLA 5EFIB 5DUPL 2B4CL 3D39B 1ADQA 5GJSL 4QRUA 2APWA 2F54A 2JJTA 2BNRE 3IDNA 3OG6B 5F96L 3P0YH 2NLJB 2H3NB 1FZJA 2XTJD 4WI9A 2XYCA 4NC1C 2J4WL 3BKJH 5T3XD 5MI0B 3MYZA 3X11B 4AEHH 2VSCA 3UTSA 1MPAH 1I3GL 3LSOA 5D2LE 1FAIL 1SBSL 4DVRL 4OZIB 1Z0NA 1Q9LB 1FJ1B 1YMHA 2MCPL 4L29B 5E2TH 1ZVSA 3OAUH 4UV7H 3X3GL 4W68A 2YBRB 3D2UA 4Z0XB 2OK0H 4GMSL 1KTRL 1CZ8L 1QP1A 5JA9A 3MYJB 3DYMA 4KU1A 4I0PD 2ED8A 4ZXBB 5H94B 1WEJL 5MEPA 1PKOA 1V8HA 4WI4A 2ADGB 3CVIH 1F00I 3BGFB 3KYKL 3Q2CA 5FYLL 3TT1H 2RB8A 5ENWB 2DM2A 1IGIH 2EDYA 4Q6IA 4JFZH 1A14H 3C6SB 4LIQH 4KI5C 4KV5F 4TQEH 3P0VH 3MRGB 1UXWB 4LSPH 4XBEH 5J11C 1BQHB 2E7CA 3QDME 4RA3A 5DGRA 3MOQA 5HI4D 2ZCHH 1AGBB 2Z8RA 5D7SH 1S7XA 4NNPL 4C56A 2W65B 2AJXH 1X44A 3S34H 4TTDC 3L3GA 4FFWD 4KMTH 1YYLL 1VPOH 2I9LB 1KV3A 1JWUA 1YMME 1BPVA 1U92B 3JV4B 4XC1H 1T2XA 1WTLA 4Z18A 2HRLA 1D5MB 3T0WA 4WHTB 1GIGL 1FNGB 2NY4C 5TE7L 4TULH 4EI5B 1Y18B 3F5WB 3WIHH 3HC4H 4ZOBA 5ESAA 1UM6H 4O5LL 1PVHA 3QIUD 1MHEB 2G2RB 3UP1A 2WBJA 4MQTB 4JANA 5E56A 3ULUH 1J05A 5TQ2H 2E8ZA 5KVFH 1TJIH 3BIBX 5A2FA 4A6YB 3O9WB 2C3HA 2F5AH 4APQA 1FL6B 1RURL 3BWUC 4TNVK 5IOPA 2FO4B 3GB7A 4I2XA 5CGYC 4Y1AB 1DDHA 3GSOA 5GIRB 3STBA 2Y72A 2ZKHH 2FJFA 1ZLUK 3PABB 1CXFA 2XZCH 1OM3L 3DURB 5DVKA 1DUZB 4KH2A 4L3ED 5E8EA 5DC9B 2DM7A 4PJGE 1P5VA 1U8QB 3NZHL 5EIQA 3FB8A 4YUEH 3ZKND 4XMPL 2F53B 4K23H 5DD6A 2NR6D 1LP9A 4JM2D 4M6NL 1DN2A 1HHIB 1NC4A 2FBOJ 4C59B 5CEZL 3O3DA 4RRPG 5D7KE 3FFCE 3VWKA 2A0LC 2AJVL 3EHBC 3U36B 4KZDL 4NJAL 3NIDF 3K8MA 1BM3H 1IBGL 3O8XC 2PR4H 4EDXA 1N7ML 3WLBB 3W5NA 4J6RL 1MHHA 5A2IH 2VQUA 2V2XB 3V4UL 5JHLH 2EIDA 3KYNB 3O2VL 3QEHB 4U3XA 5C9KA 1MCSA 2EC9U 5E8NB 3W9EA 5DZNA 3IJSB 3ALPA 5GGRA 5DJ6A 4PJFB 2R15A 4POZC 4P46B 1HINH 1JWMB 2C1OA 4DGYL 4FZEL 4G6MH 5EU3A 4TRPH 2C4FU 5CAYB 4ZQKB 3KLHD 3CH1B 4OLYL 2R0WH 2VL5B 4BKLB 2AJUL 5FO9A 3OXSB 4GBXA 4MAYA 4Y4FC 2ORBH 4N0YL 3WIHA 4ZFZB 1SJHB 2N7BA 4XVJH 3QI9C 4ZUUB 4WHCA 3BYTA 4XCYB 2JCCA 3WKMH 1KPRA 5JMOC 4MXWH 4PRIB 3V5DB 3HAEB 2A2QT 4XNZC 5L8LB 2YD5A 3GHBL 5JLZB 4PJXF 4QTIH 1MQ8A 4I3GA 4Z95L 3DGGA 4X9FA 3ZMRA 4P2QA 1JGUH 1W72B 4AK1A 5SX5K 1VESA 2BC4B 3L6FB