3C6LD

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
192
Chain Sequence
FEAQKAKANKAVRHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
molecule keywords TCR 2W20 alpha chain
total genus 34
structure length 192
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c6lD01
5I2IA 3QEQA 1JWSB 5T1LD 1NEZA 3CDFA 3Q3GA 4LF3A 5BZWB 2NZ9C 5CEZH 1HXYB 3QEHB 1I3VA 4MD0B 1HQRA 4QRSA 4CU8A 4NWUH 3V0VB 5BMFH 4F15C 3KWWB 1H15B 4OAWA 1U8IB 2VDMH 5JNYA 1OP5H 2HLFC 2IGFL 4R9HA 4LSTH 2GTWB 1UGNA 1C5CH 2NYYD 1U58B 3ALWA 3G6AA 4P5TC 1OTTD 1IM9D 5HHPB 5I8KL 2CUMA 1P84J 1FGNH 2C3VB 3WMSA 5JZ7C 3PQYE 3OXRB 5HD8D 4KVCL 3RWDA 1MCHA 5BS0D 1WK0A 2F5AH 4Y5XC 5EUOF 1HINL 3NCJH 5H94A 3EYFA 4XB8A 4AY0A 4Q9CA 4J4PA 1SJVA 8FABB 3DVGB 2COQA 3JTSB 4M43H 4XPFH 4HLZG 1R5IB 2EZ0C 2NY4D 1CGYA 4WW2A 3S8WA 1CGVA 3MXVH 4L9LC 2JCCA 5KVGL 4GG8A 2D4FA 4E0RA 2X5PA 1U8LB 3QULB 4RFNB 1KT2B 1YEDA 5HD8C 1JNHA 2R2CA 4Y2DB 5AWNL 2FGWH 3CUPA 4DN3H 4XGZB 4OZIE 4AK1A 3TH4T 2AEPH 5FB8B 1UWGL 2DQFB 4Q0XL 3MV7E 5TGBB 3RDTA 4DW2H 4PLOB 1WTGT 4G8FB 1S7VB 3H9SE 1X44A 2NY5C 4U3HA 4U49A 1IFHH 4GG6F 4X6DF 3MQIA 3LZFL 1YNLL 5FYKL 4Z9KB 2VXQH 2RGSA 4J23A 4J8RB 4HKXB 5TE4L 2EEAA 3EYQD 4EBQH 1ZA6A 1HILA 3L3KB 1Q9OB 5F7HA 1ZLUH 4OD3H 1QBMH 4JHAL 3U2SA 1AO7E 4FNLL 3RX8A 5E6ID 4ZNEE 1LEGB 5C0GB 1JCKA 2GAZB 4G6ML 1RZIA 2EXYD 3NCBB 1FO0A 3ULSA 3T0DA 1YMMB 2WBKA 3AB0C 2P8MB 4X9FA 1DZBA 4LCUB 3MRNB 5TE6H 4IIQA 3EO0A 4XMKH 4LMQE 3RJDA 2I24N 2VQ1A 5E08L 2A38A 1W2KT 1NH6A 2OJEB 5HPMB 2WP3O 4N0UA 4LSSH 1V05A 5CSZB 4DZ8A 3ARPA 4M6OL 5ENWA 4PP1D 3BQUD 4LCWE 3C5ZC 5I1CH 1A3RH 1CFNA 2VAJA 2YS4A 4QXWA 3B9KD 1ZTXH 3MJ9A 5C6TH 4BH7A 5AAWA 1K85A 1NGXB 4M3KB 2JKXA 1A6PA 4FQLL 4X83A 4QRTA 1G7MB 4F58H 3WS3A 3GI9L 2O5YL 4PY7A 5DJXB 3QAZC 4NZRL 3OBAA 1MRDH 3EYVB 1Q9WB 1EAPA 3BYYA 2BC4A 2CXKA 2V9TA 1K4CB 3VXUE 2DQUH 2YRZA 2A0LC 4IMKA 1T1YA 4O2EA 3VFGH 5TGBA 3VJ6B 4P3CH 1PY9A 3TCXA 3LD8C 4Y5XA 4QHNB 3BPOB 2VL5B 3QUXC 2WQRA 3DO3A 3QQ3B 2R56L 5I1IL 3VGHA 2F53E 1U8HA 4PJXA 2H32H 1MCQA 2V2XA 3ILQD 5I1JL 1DLHB 1WFTA 3VXRA 2DMKA 1MHCA 5L2JA 3RKDC 2R2BA 4JDZA 3ZKNC 1PY4A 1RJZA 4HS3B 4X7EC 4GAFB 1PVHA 1RK0A 5C92A 3KJ6L 1ZLVH 5IOPA 2E3VA 4ODHH 3LSOA 3SHSA 4ZAKC 1BMGA 5D7JD 1I7UA 3V6OE 3VFVA 5C2UB 5TDNA 1Q0XH 3SKUD 3EO9H 4JM2F 1XCTA 2FX7L 4PRHB 2NY2D 2HJFB 1JP5A 4Z5RA 4OD2B 3QUZA 3LEVL 5TFSL 3W9DA 1F4HA 4G9DA 3QDMB 1A6VL 5HDQL 4WHTA 5GSRB 3HN3A 5ID0A 4WJ5A 5CCKH 3TO2A 4W68A 1EFQA 5F7KC 4HK0B 4Q9RH 3QDME 4LKCB 3EHBD 5E8DL 4QOKD 3RZCA 3MPCA 1MFBH 2VLKD 3N85H 4DKFL 2E5EA 3UC0H 1C08B 4YBHA 5KVEL 4LOUD 4CADB 4HG4J 5GIRA 1J87A 1A6WH 2GY5A 3EYSH 4PJ8C 4RGOL 3OR6B 4LLQA 1HNFA 1U3YA 1ACYL 4JO3H 3L3GB 3IB4A 3S98A 2PW1A 1OAKH 3VXOA 2XWJA 3ARFD 4BSJA 4R96B 1HH9B 1NSNL 2VLRA 2DQGL 3WJJC 2H1PH 2NY4C 3UPAA 4ONGL 5DLMH 2LFGA 3RWDB 1X5IA 4N0CC 3ROOB 5L0QB 3K2MC 1WQVT 2GK0B 3STLA 4BH8A 3OG6B 5DJYA 2BFVL 3U7WL 3QB7C 5CJ5A 1ZVSB 3MUZ1 3NOIA 1RV6X 3MRMA 4HUUB 3T1FA 3U30B 3TBSA 1F11A 5EBMA 1GHFH 5B3JF 1IQDB 3W39A 3GSNB 1OLLA 3LDBB 4KPHL 3PHOA 1KFAH 1QRNE 4NHCL 1J11A 4X5LA 3O4LB 1FJ1A 3QPXH 2MQ0A 3S36L 1QPPA 1CLOL 1RZJH 4RGMC 5C0EB 3MOAH 5L88H 1G9MC 5T1DL 4XCYA 4N8VB 2GTZA 5J13B 4AQOA 1S9VA 4WTXA 4M9PA 4JY4B 3DO7A 1GZQB 2R1WA 3GEWB 1OTUD 3MA9H 3MLVL 4N1EA 4WCYL 1N5AA 4XZUA 5F8QC 3UTSA 5F72S 2DLIA 3K2UH 5C0BA 3HC0B 1F13A 1FYTD 1AXTH 1P2CB 1ZT1B 4MNQD 2FLBT 4L1DA 5IFJB 3I50H 1HILB 4RGNE 2EXWD 5D7SH 1OLZA 3CPLA 1FZJA 2V17H 3KPNB 3QUZC 5GS1A 4CN6A 2R8SH 2IALA 1U3HD 2X70A 4HIXL 4BKLA 3KPSB 4J6RH 2VLKA 4PJGE 2ERJB 4JANB 3BGFC 3UTTD 3U48A 5DO2D 2EDXA 1YEKL 1I9RL 3JV6B 5FB8A 2YUZA 1AXIB 4XX1E 3PNWB 4GW5B 5D7IF 5FKPB 2ZCKH 4HEME 5C8JB 3ULUH 3O6FC 4HH9B 2AK1H 4LPYA 3S35H 1WFNA 3WFCH 2QBWA 5CAYB 4ELKA 2PTTA 2OL3A 1YNLH 5I1HL 5BCAA 4KROB 5HI5C 3S37X 1EMTL 3EYVA 3MLUL 3PABB 4PR5B 2XA8L 4U6YB 1YQ2A 3I9GL 1BD2A 3VXUA 3VFPB 4JREB 4HJJH 1IC4H 4G8EA 4MD5B 4WUUA 4N9OB 4P2RA 4PGEB 3TBSB 4TTGA 1C12B 3ZE0E 3FN3A 1KGCE 3VI3F 3VWJD 1WJ3A 2XTJC 2BY1A 3D3VD 3WO4C 5HSFA 4U1SA 5IBUB 3TNMA 5F6HI 2I07A 3DJ9A 4FQIL 4O2CA 1SEQL 4XI5C 5D5MF 4Z7WA 1ORSA 5EOCH 5ANME 1ZT4B 2YA1A 4F7TA 4OKDA 4DZ8B 5EO9A 4PBXA 1IAII 4WDIA 5DMYA 3U36B 4HWBH 1J1PL 1QTYT 1JGDB 1UA6H 3ILPB 1RVFL 1FVCB 2NX5D 5E4IA 4XHJC 1FZMB 2UZIH 3NCYS 4Q97A 1NGXA 1BQHG 5E2WH 4P49A 5GJTL 4R0LA 4MXQC 1ZT1A 3V4VH 4R4FH 3RY5A 2H45A 3MBED 3D85A 5CHNA 4C58B 2EDKA 4F2MA 4AYFA 4PGBB 1LK2B 3CFDB 4JFYA 3BH8A 5DD6A 4LCWD 5DJ6A 3O3DB 4P5TD 1N3NA 5KOVC 1MI5B 1A3QA 3FQWB 5IWLA 4E41A 3QXAA 3BHBA 4Z76B 2VLJE 2H26A 5HXMA 5I1LA 3G5XA 5E8OA 2D2OA 5L6YH 5C08A 1KJVB 4V2BA 2HJFA 3UROR 1EO8H 5EU3A 1BREA 1GHFL 5IVZB 1GRWA 2YK1L 3D0VA 4AEIL 4ZFGL 1X5JA 2GJ6D 4TSBH 4POZC 3N1MC 3UTOA 1EXUA 5EIVA 4MCYB 5BZDA 1MHPH 4PGCB 4LAQH 4UIKH 4NKMA 4J3OC 2FX9L 1KTLB 1ZOXA 1CU4H 4N0UB 2CH8A 3JSSA 3HPJB 1T7XA 5HYSG 5JPNB 3QJHA 3VDBA 3MMEA 1WWCA 1A6TB 2VLRB 1WSST 5E2TH 4E0RB 4GXVH 1LEKB 1SJHA 4FQPA 1CFTA 2YSSB 4IOIA 3SQOL 1HH6A 1T0NA 5B22A 1CFVH 4KKLC 5D6DC 1YJDH 4OI7A 4LHUA 4PRHA 5IW1B 3EHBC 4J1UA 1JI1A 3UJTH 3SDXA 3OKMA 2OTWA 3DRTB 3IJSB 3IJYA 1NAML 3BP7A 2VDLH 2BVPB 4KKBC 1T0MA 1UB5A 1IAOB 2B20A 4RBPK 2VDKH 1IKNA 3GMRB 4O5LH 1KCVH 2VITA 1CICD 2ZOKA 3ZKSD 4ZNEA 5EOQL 5ELIA 4Y4FA 2W0FA 2DN7A 1XGTB 5GSVB 2M26A 4PGBA 4JFFA 1EHLL 3GSOB 4JO4H 4HKJA 1NBQA 2C3GA 2P46B 4Z7VF 1AO7B 4OZ4B 1X6NA 2UV3A 5JDJA 1G6RB 1OWWA 4LCIH 3EOBA 2X40A 1BVKB 4YIQB 1R5VA 5HPMA 5E8OB 3ARWA 4GKZA 5DO2C 1X7QA 1LO2H 1UXSB 2EDDA 2VQTA 2Y5TA 4FMFA 1U95B 4OLXH 4B53A 4DKEH 3IKKA 2D31A 1QO3B 4JN1L 4JFDD 3DMMA 2JJWA 1J8HD 3H7LA 4XBPB 3NPSC 5GRJL 3MBXL 1V8HA 3CX2A 2YUWA 3KVQA 1R3KA 2HG5B 3PP4L 4OIIH 2ZSVA 1XEDA 5MHSD 3IXTA 1MCKA 3NZ8B 4IS6A 2K9UA 3QIWD 4ODVH 5CINL 4ZTOH 3WSQL 1CT8B 2UWEB 2D7QA 3EO1A 5KSAA 1L7TH 2E27L 1QFUH 1NAMA 1RPQA 2V9QA 3FTGB 3PWPE 3JV4B 5KN5A 3DV6A 4UDUB 1N2RA 1IEBB 5T5FH 5DD5H 3O8XD 3TV3H 4FTVE 1OPGL 1XGQA 3DVNB 5DD0L 1QUNA 3QH3A 5JOFB 3EOAB 1IC4L 4GRWB 5KG9B 1FO0L 4HH8A 4UOW1 1U8KA 3KR3H 4LVHC 1JNHB 1ZT7B 2BVPA 4NQCE 2PW2A 1Z6JT 3ZDXF 4X5XB 3QYCA 4IBLT 4MWFA 1MJUH 4NIKB 2CJUH 2ZSWB 2HMID 2F8OA 4MD5A 2NZIA 3W0WA 2DWDA 3LN5B 3MRBA 2YPLD 1RJZB 5F1SA 1UCTA 2J12B 4WENB 4YO0B 1MAML 4RGNC 1KBGH 3VG9B 4TSAL 4OCYH 4U0RB 5EO1A 3HLAA 5IT2L 4W6WB 5TDNB 4BELD 1S7SA 3OKEB 3QEGH 1NCUA 2YRPA 3X12A 5D9SB 4NQEE 1KCRH 3VI4E 1G7JA 5I74B 4PJ8D 4W4NA 2HRPH 2A1WL 3EOYG 3V6OA 4OD2A 1XR9B 2XKSA 4JFYB 3KS0H 3QIUB 4XTRD 3TO4D 3QHTC 5B4MC 4OT1H 3PL6B 2GTZB 3L5JA 1QD0A 1UCBH 2P8LB 4HUVA 2WWKO 3MLZL 4U6TA 3VRJB 1NAKH 5DA0B 4N0CD 1R3KB 3TPUB 4C56E 4KTEL 1YEIL 2P48B 4NQTA 5DT1L 2NR6D 3BKJL 2YEZA 5BV7C 3A67H 3RZWA 2YD8A 3MRDB 5IEKA 5F3BB 3RHWF 1FAKT 3L3OB 5DUBB 4R7NB 4FFZH 2NMSA 3WCYA 5LBSL 4E5XB 5BOZG 5D96C 1FYTE 3BPLB 4MA3A 1AGDA 4X6CF 1UJ3C 1MFDH 4LSDA 1A0QH 1FCCA 1N2RB 2PCPB 3AU1A 3GNML 2X4OA 3LPFA 3U1SH 3QDGD 4ZQKB 5DJCB 4JFEE 4XT1C 4OCYL 4KVCH 2LU4A 2A73B 4P4KD 5J4MA 5GXBB 3IDUA 2FX8L 4FXLA 1FFPA 5CEXA 1Z9OA 4QRPD 4L8CB 1EH9A 3IDJB 3LH2H 1MCWM 4Q9BA 5T3ZL 4PP1C 4PJHB 5TJWK 5D1XB 2FSEA 1U8HB 2XYCA 4Y88A 5D5ME 1DDHA 3EO9L 3MV9D 4DN3L 1GC1H 3VFNA 1AD9B 4NC1C 4ZAKB 1OGAA 3EUUA 3RL2A 2VC2H 4MA7L 1IL1B 5JOPD 4FTVD 1JNLL 2VN7A 4DGVH 1E28A 2ATKB 3MXWL 1P7QA 3RWGA 4NRXA 4HMCA 3LZFH 5FYKH 3H8NA 3LKRA 1B4RA 1MHHA 2P4AB 3IDNA 4WFGD 1R3HB 1HDMA 2EC9U 3SGJA 4H88H 1K8IA 1H8SA 2NXZB 1UACL 1VKXA 4ZO8A 5HYSA 3QUXB 4QOKE 4PJXF 3K74B 3GHBL 3DMMB 4NGHH 1Q9OA 4RDQG 3CH1B 3GSWB 3TN0D 2BXZA 1A1OB 4HC1A 4EDWL 3REVA 3KYKL 4OSUH 3C8KA 3JUYA 5JHDA 1NFDB 4U1IA 4YFLF 1C08A 5IR1B 4OCSL 3SJVB 4JJ5B 4E41B 5DVNA 4ELMA 1WLHA 2BRRH 4OTXL 1FFRA 3O6ML 2PR4L 3D9AL 3JWDL 5C2BH 2EO1A 1J0HA 4NHCH 2F5AL 3MLSH 4XC3L 1F90L 4PRID 4F9LA 1A6AA 5KVFH 2D7TL 2VUYA 3MNVB 4UDUA 5IJKA 3ZDZE 4NT6B 1B88A 3CDYA 2E9IA 5F44A 3BN3B 1VFUA 3PQYA 2MCG1 1YEGL 4F7EA 4ZXBB 4B50A 2VL4A 4XP9L 3O6MH 1NCWH 5JHLH 12E8L 5EN2A 2JJSC 1FV1A 3GBMH 2PXYD 2CQVA 3HZKA 4P57B 1GGIH 5CJOH 4YHLH 4JFXA 5JW5A 2I25N 1OGAB 2P43B 4LHUG 1JF5A 1Z0NA 3GGWB 4OV5B 2C5DC 1I3UA 4P59H 1V3JA 3JVGA 5C0JB 3QDAA 4PRAA 1MLBA 2Z93B 3EAKA 5H2BB 1JZ8A 3MUHL 2NLJB 1UT9A 2V17L 1ZLWK 1OP5K 5A2LH 4ERSH 3T3MF 1XGPB 4HJJL 4BH7B 4QGYA 2OL3L 3EO1B 3RY6A 5KSAB 1UA6L 5D7LA 2FEEI 2CK0L 2Z91A 1MWAH 1AR2A 4HJGA 5GISL 1OAKL 3ME0A 1IGTB 4OFIA 4NQDA 3NIGF 4TSBL 2NW2A 1OM3L 3Q3GB 4LF3B 2AEPL 3QP3A 4YZFF 4KQ4H 2ESVD 4JFFB 4Y4HD 1FE8H 3GSOA 1XGQB 3DVNA 1I9JL 3TV3L 4TUJA 3EFDH 5KG9A 3WIFA 5D1QB 4Z7WE 5HYEA 1WT5A 3SQBA 43C9A 2UVFA 2R9HC 4U1KA 4H25B 1IRAY 4JANA 3WHXA 4QHUA 1TVBB 4HGMA 1FCGA 2YC1A 5GZOD 3FN9A 5F9WB 1F3JA 4YPGA 3REWA 5E8NA 1YMME 3I9GH 3NPSB 5MERB 4PJXE 4KJQC 5FA3B 2VLJD 5CBAB 4KTDL 1FNSH 4F9LC 1J1XL 4WW2F 5DI8B 3RGHA 1D6EA 1TVDA 4WW2B 1X3DA 5FO7B 2AXGB 3C6SB 2IFGA 3MLWH 3OKKA 2Y23A 4R26L 1Z3GL 4ZQKA 3EYQC 3AROA 5D71L 2R2BB 4JDZB 4PJ5B 3L3HA 1G7PB 1OD9A 3O45B 2ARJQ 4OLWH 3TYGH 2UY7A 4IS6B 3CVHB 2PYFA 3AREC 5AZ2L 4IHOB 5SX5K 4BJLA 1UWEH 2E7HA 5D72L 1NCAL 4EQ3A 1O0VA 2ADFL 1KJ2B 3MOQA 4P57A 1YY9D 3OSKA 3HUJB 3E1F1 3GI8H 2XWJB 4GLRH 4J3XA 1KXTB 1UH3A 4ZO7A 5FYLL 4M7JL 2RR3A 1FRGL 1L7IL 1OT1A 4Z7NF 2XXMB 4YNYB 5T5NG 1N8ZB 4NN5B 3L5XL 3DV6B 3IDYB 5I1IH 5FUOH 3I6GB 2J6EL 3PUCA 4GQ9H 3QPQC 2OSLB 3F62A 4L3EE 4JO2L 1G6RL 2X4UA 2VR5A 2ZWLT 43CAA 3UTSD 3MJGX 2H9GB 1IGFH 1I4FA 3QNXB 3O6FD 4LCWA 1RUPL 3G5YB 3K80A 4O4YL 2GFBB 5GGVH 5DR5L 1A3RL 2JIXB 4PLKC 35C8H 3TCLB 2LE9A 3NPZB 4OI9A 4HFWA 3R1GH 4GXUM 1W8OA 5LCVL 1X7QB 1RIUH 4UBDC 2AK1L 3S35L 4CVZA 4Y4HB 2Z35B 5CEZL 4YQXL 4W6YB 3UZEA 3H9SD 1F00I 2HKFL 4GSDH 3QZWA 1PD6A 4Y8DC 3MR9A 1P7QB 1XZ0B 5GGRB 4TULL 9CGTA 2JB6B 3BUYA 2QSCL 4G8IA 4P23D 1O5DT 5CJXC 1HDMB 1OAQL 2AJVL 1CD1B 2OP4L 4JZJC 1QLEL 2ORBL 4RSVA 2NY7L 3HR5B 3UPRA 3D6GA 3B9VA 3KPQA 1CU4L 3B8YA 4KDTC 3H9ZA 3T1FB 5D93B 1F8TH 4YAQA 5KS9A 2VDRL 1WBYA 4M5ZH 3BZEA 2B1AH 4GAJL 4LVEA 4P9ML 5FECB 1M05A 4U6VH 1QFHA 3ZSSA 3DYMA 4EI6B 1DBJH 1EEZA 1CD9B 3D3VA 2NXYB 4H0IA 4OLUH 5LWYH 2JTDA 5FYJL 1A7NL 1AI1L 4PB0H 1YECH 1P9MC 4R4ND 4YNYA 5BRZB 1QQDB 2PTTB 4J1UB 4LNRB 1N4XH 1NDMB 5HGGS 1X9QA 2D0FA 2WBWB 5H8DA 4MAYD 2IPKA 5DJCA 1KSRA 4N0YL 1I1FA 1BIIA 1CE1L 1BZQK 4EVNA 4XAWL 3HLAB 3S34H 1RJLB 2EDLA 2WBJC 3CDGA 5FCUH 4D9QD 1YEEL 5C3TA 2YMXH 2XRAL 5KZCB 4AM0B 3ROOA 3KPSA 3FB6B 2GW5A 4JPWL 2YZ8A 1F4YL 1HWHB 2ZUSA 3QUYD 1JPGB 2VYRE 4Z7UE 2Y6SC 2Z91B 3QFJE 3DMMD 4OZ4A 5DEFB 1J05B 4YX2H 3MYJB 1ZGLP 2AJXH 1VEMA 5DWUL 1LO3L 2K7QA 1BX2A 3QIBC 1MQKL 2NXZD 4WHYH 1W0VB 1U8QB 1AD9A 2EKJA 5BV7H 1VFBB 5I17A 5ISZA 3CJJA 2W9DH 3S4SB 4TTDC 1I8KA 5IEHA 3SE9H 3WBDA 43C9B 1YN6A 4YHMH 3L3KA 4WHTB 5GSRA 4V1DB 3S6CA 2RJMA 4KC3B 5GS0L 4LRNH 2KPNA 3D2UB 4P2QB 1ZTXL 3JUZA 4X9HA 2CR6A 5C6TL 5ID0B 1IFHL 3S37H 1NCTA 3IDNB 4O2FB 4UT7H 4KY1L 4ZYKA 1LK2A 3OAUH 4ZAKD 1CTOA 4ZOEA 1A8JH 2L7JA 5DD6B 5AYUL 1ZWIB 3GJFH 5DURD 3HMXH 1FVEA 4LSQH 1OW0C 4MS8C 4PD4J 1P2CA 2Q76B 4R7DB 1T2JA 3DTXB 1D6EB 2X1WL 3MX0A 1UM6L 1MRFL 2QSTA 3VFRA 3IFOB 1SEBA 5D7KD 2GJZA 4K8RH 3R0MA 3DX8B 1EEQA 3F7YA 4RMVA 5D7JC 2V7NA 2H3NB 4ODHL 3VXMB 4M5YH 4H1LA 5MERA 3B4NA 5DJYB 5E7BA 1QFWM 3DX9B 1RZKL 2ITDA 1RFDH 4JVPA 5ILTH 5IVXA 3G6JA 5BRZA 2OL3H 4WW1B 1IGJB 2VISB 3UTPE 5I1JH 4PB9L 3B2VL 3MSPA 3PWNA 3K81A 2PN5A 3H9HA 3RVWD 3TA3D 3L5IA 1OAXH 3PHOB 3RA7L 3HS0A 4OI8A 1OP3H 4G6KH 3VFUA 2C26A 4S0SD 2QSCH 2Z4QB 4HUXB 2FGZA 4PJ7A 3QUZD 2DQTH 4M7LT 5IM7A 1G1CA 2P49B 4LLMA 3LVEA 1DEEB 1BVLA 4FQ1H 4JFQB 4U6XB 2BCKB 1W72H 3WUZA 4DVRL 4JQXC 5I6XB 3QO1B 4N8VA 4PJIB 5ERWA 3SKOB 4G42A 4ZPTA 3PV6A 1FSKC 1W72B 2DLEA 1OF2A 1GIGL 5GGVL 5HDBF 5B39B 3RUGF 1KJ3H 3FN0H 4Q6IC 5E9DE 4IRSC 1X5KA 3QQ3A 3KWWA 2I07B 4OFYA 3ARTA 4U7KA 4BSVB 1OOAA 2W38A 4JZOB 4PY8I 4NO0B 5E1AB 4LSVL 1JRHL 2NY5H 3K4AA 3MREB 1A1OA 2QV2A 2FJHB 1JWMA 2RHEA 5GSVA 3UMTA 2NY3B 2EDQA 3NABH 1OSPH 3LS5L 1PEZA 1MCCA 1MY5A 4PJ8B 1I1RA 7FABL 2ADFH 1A9BA 4OBSA 5DHVH 4WFFD 3HZVA 1PLGL 5FA4B 5EORH 5LGHH 1FG2B 2VERN 1FAIH 4A2LA 3D2UD 4X6EB 3T0EC 4MLSA 1G84A 2FHFA 1Z0MA 1JBJA 3IJSA 1YEEH 1GYAA 1RZFH 1IZKA 2Z31D 1ORQB 4OCXH 5IVXE 3KLHD 2L0DA 1BM3H 2BNQA 4HGWB 4HIEB 2W9EL 2BOBA 4GS7C 1S5IH 1KEMH 4DEPC 5E00A 1CF8L 1I3GH 5TF1H 3MLTA 3RZCB 4Y89A 1X4XA 1T3FA 3GB7A 2RIKA 3MA7A 4BUHA 5D70L 1WZ1H 5ITFA 1CBVH 1EJ6A 1MRCL 4LCYB 1U9KA 5FAAA 2FWOA 1AI1H 2QEJA 3PJSB 4JDVA 3MR9B 4U05A 1PQZA 4PJ9C 4U1SB 3TNMB 4NM4L 3WL9A 4PGCA 3MRIB 3Q1SL 1L9MA 1NC4A 5C0RL 5HGBB 3B83A 2BVQB 4Q2ZA 3IFLL 5D7LE 5SWSB 3VH8G 1KN2H 3O6FA 3D5OF 4GAGL 1T5WA 3ECBA 1CDJA 3SDCA 4Z7VB 3SKOA 4PV9B 3AC0A 3V0WL 3RWHB 5A2JH 4LPWA 2BDNL 4N8PA 3RA7H 4NQCD 3LQMA 3LS5H 1ZLUK 3TVMA 4ZXBC 1CGSH 2A6KB 2XTLA 2Q8BL 4KV5E 4HW6A 4G80A 3FKUS 2WINB 2ZSWA 3HMWL 3RP1A 4NNYB 4S2SA 5FIEA 2QSQA 5CEYB 4I18C 4P2OD 2HG5A 4N5ED 1JFQL 3VG0L 3BGMB 3LRHA 4EXPX 5IMMA 2W65B 2VSDA 5GGQH 5EB9A 5K9OA 2W07A 3IRPX 4YX2L 2EYRB 4XPHL 3KYMA 1AC0A 1A0QL 3H7BA 4HULB 1MCLA 5M95B 5DDHA 1OT2A 4P3DA 4TVSa 1B0GA 2NYYC 5T3XL 3TCLA 4EN3C 1YECL 2V2XB 5F93C 2RCSL 3RKPA 4QRSB 3HB3C 1IILE 1JYWA 1J18A 1E4WH 5GJSL 3S3SA 4F80A 1ADQH 1WAAF 2XKNA 4MD0A 3C8KB 5BZDB 3CSBA 4ZO6A 1KIUA 4OFDA 5IGXH 5EH1A 1YN6B 3WHE0 1KN4L 1NGYB 2EZ0D 4P9HL 1CXFA 4WHDA 1A22B 1CFSB 4P2CG 1L0QA 3K8LA 5CLWA 2WK2A 3DMMC 2EEBA 4XC3H 3G6JE 4K71C 1M7XA 2OK0L 1I9EA 4XMLH 1AGEA 3GSVA 3VGAC 5LVEA 2HT4C 4JRXD 2GCYB 5SWSD 4RMSA 1LEKA 3VD3A 1QO3A 3G6JB 5EU6B 5DVMA 1IAKA 1MH5B 5EZLA 2BDNH 2F54E 1VFOA 3FQXA 4RGMB 1F42A 5FYLD 4LEXL 4PJBF 4GRWE 1H0DB 5EU6E 3CSPA 3WIHL 3HRZB 3O6FB 1BFVL 2AW2A 2OQJA 3VD4A 3SCMD 2ADIB 3VFWB 2LAGB 5J1TC 3O0RL 3PL6A 5KOMC 4JE4B 2E9JA 3VRJA 1FC1A 2R9HD 4LPUA 4G80B 3AGVA 4ZYKB 4CJ0A 3JV4A 4MYWB 3T0XA 4S2SB 3RIFK 4OB5H 3WIIL 2YPKB 1VSCA 3QUZB 3RY6C 3FZUC 2FATH 2BNRA 5AEAA 1BOYA 4NC2B 1FNFA 1J9CT 4EDXB 4UMGA 1F4XH 4Z78B 2OR9H 5C0AB 3ZLQC 3QXDB 4OFPA 3WEXB 3OGCB 4MDIA 5H35A 5TF0A 1B0GB 2Y7QB 5SV3A 4JZOA 5IQ9B 1JRHI 5FK9A 1F11B 4X4MA 4YK4C 5EBMB 3DUUA 2EIZB 2PF6A 5TDOA 3UJIH 1WAAA 5EG6C 3CFCL 4XBPA 4BQCA 3BEVB 2B5IC 4DGIL 5E94A 5FCSH 1QNZL 3A6CH 4MA1B 1AGFA 4JZNB 4XCYB 1C16B 3RWGB 3UTQB 3V4UL 1GCFA 4L4TB 2G5RA 1TVBA 4MJ2A 5D7KE 1ZHBA 2XRAH 2PXYC 4N9GA 5JTWA 1JF6A 3OPZH 4UI2A 3OR7B 2K7PA 2ZPKH 4GKSB 4FFVD 5C0AD 2Q7YA 2XG4A 1HKFA 2EDRA 5EOTB 4XWGH 5SWZE 1YN7B 1L7IH 2X1QA 3U1SL 3V8CA 2EH8H 1WWBX 2BNQB 4LASH 5IQ7H 4OCWL 3G08A 5HDLA 1GAFH 4W70A 1N0XL 3WUWG 2BXYA 4NQSB 1QFWH 3PDOB 4LHUD 3PQYD 4YLQT 3PL6C 4XP6H 4OZFG 2MSPA 5BJTB 4DFIA 4JFEB 5I15H 4HXAH 4KJWD 5DA4A 4G5ZH 3ARDB 3GIZH 4UTAH 2W92A 5C0EA 3SCMB 1MCEA 4U6VL 4NKMB 5E00B 4DUXA 4X9IA 2V7NB 4POZD 1JRHH 1YPZF 2OR9L 4G8GD 2V5MA 5EU7E 5C1MB 3RIAK 3NIDE 1N7MH 3QO0A 4JY4A 3KYAA 4RX4A 5EWIH 4GKOA 4DVBA 3RTQC 1VGKB 3LRGA 4DOHE 1X5FA 2APWA 2A83B 1F6FB 1YZZA 2VDLL 5KVMC 1ZV5A 5E8EB 2MPAL 3H3KA 1NEZG 2AJZA 4D9QE 3HG1B 4HQQH 1ADQA 1CDIA 1JV5B 5JW4Q 3L95A 4M4PA 4S1QH 4ZXBD 4JQVC 1DBJL 3BMVA 3T3PF 1T03H 3DX6A 1RZKH 3ECBB 3SDCB 5GHWH 5DJ0B 2DQIL 1S7WB 3U0TB 5HY9A 4RNRA 1KJMA 5A43C 1M6OA 1AFVH 1EGJA 5IMMB 1BVLB 1RIHH 2O93L 2B4CH 1IAOA 2B0SL 3QDJE 4PRIB 3TNNB 3PWVB 2BMKB 3X17A 3WE6B 5ERWB 4JHAH 4WO4C 5AYUH 3ISWA 3UXFA 3PGFL 5I16B 5JO5B 4NM8H 3X11B 5IFAH 3ZO0A 1MJUL 4Q74A 2OJZL 5A2FA 4LU5L 1EEYB 1VFAA 1AXSA 4D3CH 4EUPB 4IOFC 4CMHC 2FJFB 1P6AB 3QUYB 3MCG1 4RMRA 2CSPA 1N59A 1S5IL 4XNZB 3BW9B 3BI9X 3DXAE 1KCKA 3DBXB 3NIGE 2CO7B 5D7IB 1J1OH 1MCPH 4UUJA 3MRHA 3FO0L 4AIZB 4IDLA 1S7QB 2IWGA 2YD5A 2NW2B 4M9OA 4HK0A 4YAQB 5KS9B 4OUUA 3DXAB 4K7PY 4YDKL 4P5KA 3H3PL 1FBIL 3MRCA 2PW1B 1O7SA 3HZYA 3WHXB 3GMMB 5CFHA 3MUGB 1A7PL 1ZSDB 4M6MH 2WINA 3RGVA 4CNIB 5HHOB 1R24B 1R3JB 2ICCA 1UYWL 4TVPE 5HI4D 3VXOB 4YBQD 3RZCC 3HE6A 2XY1A 2DQTL 4PRAB 3LV3A 4JFPA 5ICZA 4X5WB 4HGWA 2X4QB 5C0BD 3O9WB 3VMOA 1UXWA 5CWSA 1CE1H 3TFKD 4KZDL 4W81A 2VLRE 3MOBL 5I8KH 2XOTA 4FTVA 5I1KL 3VW3L 1WV7T 4ZUTA 2BSRA 3NA9H 1A6UL 4QOKA 3RZCD 2ILLA 4LSUH 5EFIB 1GC1C 3T2OA 5IVXF 3CVHA 4JPWH 3V5KA 5LBSH 3QRGH 1E28B 4D0DA 1NBVH 3FB6A 4UQ2A 2VDOL 2AK4E 4D9LH 2BSED 3LQAL 4K94C 4G3YL 4OGXL 1XF4B 3IAPA 3CC5B 3FOLA 4CBPA 4UV7L 1MCPL 2HT2D 3BP4B 3SDDA 1VKXB 5FA3A 1OGAE 4M5ZL 1HYSD 4LVOC 3QDGB 2VDRH 3P40A 2CDGB 2I5YH 2ZP0T 3QNZB 4KY1H 3SGJC 5DRZB 4U1JB 4RMWA 4UDTB 4OCRL 3TEUA 1UB6A 1MH5A 5EZLB 1G7IA 5TQ0H 3R8QA 4DGVL 4XBEH 5EPMB 1WTLA 3HZVB 1JNLH 4KI1A 1VEOA 1E0OB 1EFXA 4KHXH 4PTTB 2BSSA 4V1DA 3TN0C 2V5YA 4I0KA 4PJ5A 7CGTA 2EIZA 1H3PL 4NJ9H 3C6LB 5HGAA 1S9YB 2VLJB 5F1IB 2HTKD 4EI5C 2JIXD 1I1YA 1WF5A 5H94B 5CIPH 4C56A 3IJHA 5CIPA 4PGJA 5E2UL 1I1CA 4NGHL 3HA0A 3RNKA 3WFDH 3MFFB 4KRNA 1NBYB 1AP2A 3FQUA 3T8XB 4FZ8H 5T33L 5CJ8A 5D1QC 4X6CA 5C09B 3C6LD 5F1NB 1R3IL 3NAAH 3L3JB 3HAEA 4PJFF 1Y6KR 1JHLL 4JFFD 3TO4B 4C4KO 3FRPA 4PB9H 1V7MH 2UYLA 3MNVA 4RA0C 3IKCB 4JRXB 1VACA 4MA8H 1AC6A 2GJ6B 4G8EB 4I0PD 3OV6A 4P2OC 2BJMH 3O4OB 2QL1A 3QIWC 1U8PB 2DM4A 3R8BB 3TBTB 4KI5C 3T4YB 4RMTA 3UCRA 2WBJD 3MC0A 3BO8A 4WO4A 3MJ7B 4JHWL 4R6UA 1P6FA 1A9EA 5IGXL 2Z35A 4IJ3C 5CZXC 4YGVA 1J5OL 1XAUA 3BDXA 3GKWH 4FFZL 1I8MB 4E9LA 1LWRA 1INDH 2YBRB 1Z5LB 2YPLB 2MKLC 4ZMAT 4MQTB 2EXYC 5H2BA 3OHXA 2NLJA 2IC2A 5ICYB 5AUMA 4WWID 4LHJB 4ZUWB 1RU9H 4QLRA 1BGXH 5FGSA 4HPOL 1G9NH 2HWZH 5KVDL 3F58L 3O3UN 4QNPF 3P9MA 1MUJA 4TOYH 4NQDB 5LAXB 2HFEA 5IBTL 5C0ND 2OZ4L 4R0LB 4YHNA 3M45A 3WNKA 1FVDA 4JY6B 3EDKA 3WE6A 5E4EC 1ZHLB 3GI8L 4O9HL 4P2QD 3V4UH 4V1DD 4OF5A 5I66B 1RFDL 5ILTL 3RL2B 3SDAD 3BHBB 4QCIB 2O5ZL 2VLJA 2XFXA 5F1IA 3D3VB 4PRHE 3QXTA 1MI5A 4U1KB 3CCHA 1TQCC 2D9CA 3DUHA 2AK4D 5ETUB 3WLBB 4RAUA 3UJJH 4AIXA 1QFPA 2E7LC 4EI5A 4AT6A 3QEQB 4H8WC 4FN0A 4XWOC 4NOBA 2AJZB 3S37L 4TRPH 4W4OC 3GJEB 3OKOB 5DUML 4GRLD 4QHLA 3W9EA 4HS6B 5JDSB 4I5BA 3TA3A 1NGPL 3V52H 5KJRL 2C3VA 5B38G 3DGCR 5BO1L 4JB9L 2G75B 1AO7D 1OTTC 1S5HB 2C1OB 3TT1L 1EHXA 1X5GA 4KK8D 4X5WA 5E1HB 2XN9A 1A4KB 1LO2L 2BNUB 3E6FB 3QCTL 3DOSA 1MIEH 4OD1L 3U46B 5IW6A 5KS9F 3PG2A 3PHQB 5FKPA 3RWFA 5MEQB 4OCNC 1KGCD 3TWCH 2R8SL 4FTVB 3IJYB 2FJGA 4BQ6A 1MVFA 4HDIA 5LG1A 1EEYA 1VFAB 3DRQB 2YPVH 5GS1C 1C5DA 2PYEA 4X8XA 4TSCH 5GRJH 3O4OC 4Z78A 5IHLB 1AQDA 1OAQH 2AJVH 2OP4H 3FCTA 3PWJA 2GSIA 4G8FA 1WFUA 3A0OA 3ARBD 4MDJB 4QEGA 1YQVL 2ZNWA 4NO3A 2HKHL 3T0EB 2DQFA 5LQBL 2CGRH 2VZVA 4FQCH 4QXTB 3RAJH 4P9HH 5FUOL 1DBKL 2DQCL 4HCRA 3BGMA 4JFXB 3J7HA 4YFDB 5JW5B 3BEVA 4ZFZB 2P5WE 4I9WE 4U1JA 3LKQB 4PGZA 5D5MB 4R4BA 4P2RE 4QY8A 3DSFL 5EBLB 1YC7A 5FYJH 5A2KH 2UZYB 1P7HL 3PDDA 4HKXA 3OTTA 4J12A 3O2DA 4PRDB 2ATPA 5DTFA 3QA3A 2CLRB 4JRYB 2D9QB 2J8UA 3MJ9L 4I8DA 1QSZA 4R4NC 4LCUA 1RURL 2LU3A 1XGYH 3KDMA 2AEIT 3GO1L 5DHYA 2D31B 3MJ8A 3VG0H 5IB3A 1AKJB 1NC2B 3ZSTA 1OAXL 4OZFB 3DUSB 1T21B 1DUZA 2A74A 1MHPL 3FFDA 4X6CB 2VZTA 1NLDL 4FXKA 5DGRA 2FHCA 3PWPA 3TBYB 4GW4B 4MHHG 4ODUB 4P2QE 1KCRL 2FRGP 4QHUB 3IJHB 5CIPB 2Y06L 3V0WH 5D1XC 5AZ2H 2R69H 4Y19B 5DD3L 3VA2C 1KCSL 5IT2H 4NQEA 3MLXL 5DC0A 3VXMD 5CD5D 4CAGA 5D6CA 4TVPL 1HHJB 4A6YB 2HKFH 4GSDL 4X6EA 4XVJH 2OX5A 1MCNA 2X4TA 1P7KB 5EZIL 5BQ7B 4ALAL 3ZL4L 1I3RA 2Q8AL 4QWWC 4NRYB 1ZS8A 3QDMD 3MUGA 4GLRI 4ODVL 5CINH 4PJIF 3QCVH 3HB3D 2IADA 3HE7D 1AH1A 3FOMB 1PKQB 4QYOB 3D0LA 3VI3E 2GTWA 1CBVL 1KTLA 4JDTH 4RRPA 3L7EB 2YBRA 2PW2B 3T2NH 3IETB 4JKLA 4EKXA 3I6KA 4R4FL 2EDOA 4XVUC 1FIEA 4ZUUB 4QHNA 3SDXF 4HJ0D 4G3YH 4OGXH 3N9GH 1WIPA 1ZEAL 2HLFD 4DZBB 4ODSH 2ZUVA 4WUKH 5T5FL 1OQXA 2MCPL 1MELA 3LS4H 4PJDE 1WBXB 5F7YC 3DVGA 4XMPL 3PXJA 3M17A 3C08L 5B8CA 1DE4B 3O2DL 4CVXB 3HNSH 2H6PB 5JIPA 2Z4QA 5EFIA 4QTIL 3V6OC 1UWEL 1E4XL 4CVWA 2BRQA 3UAJC 3TLRA 4NFDA 5HHMD 4YDIH 4UOW0 3D2UA 1K8DA 4Z7UA 1BD2D 2YKLH 4APQA 3GHBH 4NFBA 2JIXA 3GK8L 1MCIA 3SKJL 5DUPH 3E2HC 1TPXB 4RAUB 4C56D 4U3XA 2D03H 3LRSA 3JXAA 3V8OA 4YEFA 3IS1X 4R0LC 4NO2B 1F6AA 4ZUSB 3AUVA 5CJXA 4HT1H 5F97E 1S8DA 1WICA 2DQUL 3TPUA 3O2WL 3MCLH 4ORGB 2I60L 4PS4L 3NIFE 4MVBD 1F2QA 2BRRL 3VFMB 3S5LB 3BUYB 2CIKB 1VPOH 5E1AA 2XTJD 1WIOA 2QADC 4LFHG 2O26U 4JPKL 3AAZB 4JFDB 5ICXB 1OY3B 3VXMA 2VISA 4JO4L 1Y18A 4HKZB 4QNPE 5F7FA 2DM2A 3K8KA 1T7YA 1CXHA 3KPQB 2EICA 2GKIA 1G0YR 3OKLA 3U9UB 4I4WA 4LU5H 1TLKA 1YPZB 2XA8H 3ARSA 1Q0YL 5I9QB 5FFLA 3ZTJG 2G75A 1DBBH 4FG6C 2J6EA 3I6LE 4UB0L 5CUSH 3HZMB 1MFAH 2VDNL 3I50L 3IDJA 1CDUA 1YPZE 4KUZL 4P2OB 4FZ8L 3RWJA 4J3SA 1CFNB 4PJGA 2X10A 2E6PA 1B2WL 5E0QA 1HHGA 5TH2B 4KQ3L 3O6KH 5D7LB 4TVPH 2Z92B 1DQTA 3BSZL 4YXHL 1CDCA 4JQVA 3NFPB 4P23B 2HTLD 2E6JA 3FB7B 3VXSE 3WNPA 4LLVA 4S1RL 5GHWL 1UQSA 3L6FB 4TYUA 3VWKA 2XZZA 3C2SA 2XICA 3KNBB 3SQOH 1GZPB 3R06B 4K9EH 2P5WA 4NO5A 4Y2DC 1IEBA 1HQ4A 3PV6B 1NLDH 2C7UB 2FWOB 1I85A 5HGDB 3LMJL 3W9DB 4WWKA 1OAUL 4UDTA 5DSCA 3V5DA 4HCRH 2NY0C 1Z5LA 3GJFA 3KJ4B 5CD3B 4HS6A 1CE6B 3OAUL 5IV2A 1RI8A 4XP5L 3ZE0F 5GGUA 2LVEA 4K94L 5DEZA 1TFHA 4AM0A 1T5WB 4NQUA 4UV7H 3G5ZA 5IVZA 4UAOB 3WFCL 2OR7A 2D7TH 4P4RA 5GIRB 4ALAH 5EZIH 4NQVA 5GRWA 4HWUA 3HNVH 4UTBL 2J8UB 4LIQE 2AQ2A 3S9DB 2ZCKL 5D2NB 3ARVA 5EC1A 3GMPA 1OP9A 4GT7A 1RZJL 1MJ7H 1N59B 5KTEH 1WUNT 1UC6A 2KZ1B 1JGUH 5C9JB 4M6NH 1H5BC 1UG9A 1FZJB 2A74B 2VZUA 3E0GA 4HBCH 1F4YH 2DM7A 3RQ3A 1RULH 4DQOH 4JJ5A 4NFCA 1KB5B 2HH0L 2F8VA 5E8PB 3U0PB 3MGOB 4X0KA 3BPCA 3MRMB 3T08A 4PG9B 3NMEA 5DRWB 3LY6A 1T66D 1F58H 1HIML 3HI5H 1CN4A 1X4ZA 3PWLA 5GPRA 3T3PE 4JN1H 1J1PH 1G6VK 2BNRB 5F9OL 4GBXB 3PABA 1EBAA 1OTSC 4OZHE 4KZEH 3MBEB 1I8MA 2YD7A 5JDSA 2Q8AH 3PDOA 5FUCE 3D0LB 3IS0X 5HYQA 3CXDL 1KCUL 4FQHB 3VWKC 2QQKL 2HMIC 3QHFH 4XTRC 2D3VA 5GGTH 4Z95H 4AEHH 3ZTNL 1EEUA 3AMKA 3LQZA 1F3DJ 3K1KC 4YHKH 5IP4A 5F3HB 5HYIA 4CW1A 3SN6N 3CPLB 2WIIA 4O51A 4H26B 3HCVA 4WDIB 2CO6B 1AJ7L 1QYGL 2H32B 1I8IA 3RUGA 5HI5D 1IAIL 2QQNL 2AXJA 5C0AE 2GYSA 2N7AA 5H37H 3BPOC 2EIBA 1HOCB 25C8L 4TUKL 1YA5A 4U6HA 5I8OL 4ZG1A 2ZUWA 4NQSA 1MI5D 5F89A 3EDJA 3O3EB 5F9DC 4LEXH 5E6IC 5C0IB 3MGAA 4AEIH 4EN3A 4ZFGH 3NACL 3L1OH 2A6DA 2DF3A 3X3FH 3V7AG 2AEQL 2EYSB 4XCNA 1YUHA 3N85L 4FQJL 4F33B 1KB5H 1U36A 3QIUD 1KCUH 4LLYB 2NR6C 2A9ML 4JFOA 4NHUB 4KKAC 4CDHA 2J88L 5J0BA 2VLME 2GCYA 4P99A 3STZB 3RX7A 1MJ8H 3HPLB 5DYOA 1BZ9A 1N7ML 1PX3A 1MCJA 4GKNA 3IDGA 4RRPG 5IK3A 1VFBA 5J6GA 4Q0XH 1XH3B 1C7TA 1NGWB 1OB1B 4L3CB 3S5LA 5DI8A 2E7MA 3RPIA 5JPNA 1DQJA 3MLSL 3Q6GL 2MHAB 2H6PA 1CGWA 1PG7W 2J5LB 4FHBD 1NAMH 4M7ZB 5KANG 4U2YA 2DWDB 5HVGB 1E4XH 5T3XH 5JUEL 3QG6B 1ZVYA 3GI9H 5HYJA 5JA8B 3ULVC 2BERA 1IT9L 1EJOH 5ISZD 3FONB 4W6XB 2NY6B 3V6FA 5J9PA 3V95A 3T0WA 3U9UA 3G08B 1WCQA 3O2DH 5J13C 5IJVB 2VXVL 5E99H 3BUTA 1E6OH 1ZHKB 1H9VA 1I1AA 1JMZA 2CD0A 2YD4A 3D85B 3F7YB 3RY4A 3NFPA 4P23A 3RTQD 4KQ3H 3VFSB 4Z7UF 2ZPKL 4KHXL 1V7ML 1UWXK 3CFJA 1Z3GH 3MBXH 3TZVD 3EDDA 4L4VE 3QUXD 2VXQL 1T04B 4P3CL 4ZUWA 3WHE1 4NRYA 1N3NB 3KPTA 1E6JL 1BQHB 1AQKL 2GFBA 1LO4H 4KK9C 1RULL 4EIZC 4MAYB 1WWAX 2FECI 4OQTA 2H9GA 4GS7B 1VFMA 5E2UH 4X6DA 3BH9B 3KJ4C 1NKRA 1CDBA 3QCTH 4Z7VA 2P5WB 2DLFL 1JZ6A 2N7BA 1HI6A 1TXKA 5T1KA 1XGTA 2NXYD 4MB5A 4OCLC 5CD3A 2Y1VA 1VERA 4LPVA 3OR7A 5D4QA 5FF6B 3LKNA 3IFOA 3E3QC 4G6FD 2Z8RA 4RBPH 1U92A 3M8OH 2KKQA 4PJIA 5T1KD 4M4RA 1DLFL 3SDXE 3WS6A 4OF3A 5A3IC 1T5XA 1R5VB 1EZVY 3GMQB 1GPOL 3CSYB 4Y4FC 4WHYG 2FX9H 2EDHA 3ZYZA 5JIHA 2D7PA 4HK3J 3MODH 4NRZA 1IKNC 1KB5A 2DKMA 2XI9A 3ARQA 4YXLL 2YKLL 4PTTA 3MGOA 3KPSE 4WCYH 1JMXA 4OBRA 1MI5E 4NO2A 4WI3A 4DQOL 4YPJA 3UBXB 1EAJA 1RK1A 1KT2A 1CFVL 4JJHA 5F71A 3FRPG 2C1OA 4U4BA 4L9LA 1P7QD 3DVIA 1TTGA 3ET9F 3QUYA 3V9FA 5I6XC 1SM3L 1B2WH 5I8CA 4QRTB 1FNHA 3OF6D 5IBTH 5FGCB 5BS0A 2MCPH 3QIWA 3L9RA 4JKPH 4XRCA 4X7SL 2HKHH 5C71A 2BVUA 1CXKA 2D03L 3FB8B 1RJLA 3GSXA 4J8RA 5T1MB 4XCFH 3U7WH 4FXGB 4XNUH 1T1YB 2F5BL 4O2EB 1TQBB 2BSSB 1X5LA 3MLZH 4KJWC 3O9WC 1PEWA 1D5XB 3BMWA 3GKWL 4XCEB 1J5OH 2Y25A 4YDKH 3W0WB 3G04A 1NSNH 2O5YH 1RZIB 3IU3B 3F7QA 5FGBA 1Q72H 3D1MC 1VDGA 3WNLA 1TJIH 1YMHB 1RZ8B 3QEGL 5E7FA 1A6WL 1W0VA 4KZDH 3BSZH 1H3PH 3I6GA 4Z7QF 4EN3B 2P7TB 3BD3A 3NFNB 4TNVF 1VADB 2OTPA 3MRPA 4DK6A 4KAQH 3V5DB 4N5EC 4I1NB 5HHVL 2P8LA 1VACB 3GJFB 3WFHA 4UT9L 4N5UA 2C9AA 2M2DA 3VFTB 5MEOA 2NXYC 2VDML 4YUEH 3EJJX 1N5YL 4J7RA 2MQ3A 5J8OA 1ITCA 1DP0A 4QCIA 3PJSA 1SEBB 1FNGB 3T77B 2Z8VC 5FUCC 1X5HA 4FFYH 2Y07H 3VDAA 5I0DA 4GMTH 2DIJA 4WEMB 5GGRA 1CK0L 5F6HJ 3KJ6H 2FBJH 2H8PA 3Q5TA 1FL5A 4KUCF 4R97C 1MVUA 4GKSA 2WZPD 3UTTA 3WIHA 1A5FL 1PDKA 4GKZB 1CD1A 1EUTA 3T2NL 1JTPA 5CZVL 1P1ZB 2CGRL 4JZJB 4PJ9B 2BY0A 1UADC 3BDYH 4HUMB 2BSRB 1KENL 4ODTL 4GRLC 4PJXB 5C6PB 1AP2B 3T8XA 1DQMH 4M00A 5GJTH 3RI5F 4LLVB 5GS2D 1I1AB 1TQCB 1LQSR 1YEDB 3QAZB 3HAEB 3UBXI 1DQLL 2VZOA 3QUMB 1E6OL 4L29B 4MSWB 5E99L 3Q2CA 4GJTB 1UZ6F 3P77A 4HGKC 1JYVA 1A6ZB 3FRUB 1FFPB 5CEXB 2ADJA 3TWCL 4K8RC 4WIQA 1N6VA 2FECL 3DYOA 4JO3L 3FQXB 4HUVB 1RJYB 5D1ZC 4WI5A 4QF1B 2IAND 2ZCLL 1BBDL 3MV7D 5E9DD 4PY7B 4MQXD 1DDHB 4JPIB 3WFEH 1F4WH 5DRNB 2CDGA 3BD5A 1JI2A 1I1FB 1DFBH 3F7PC 1YYLH 2YPLA 4P4KC 2C1PB 1TJHH 3WFHB 4JY5L 2IAMC 1IGCH 4ZD3L 1S3KL 4QTHB 4V2CB 2VOTA 1FLTX 2R29L 3UYPA 4BZ1L 1BFOA 2CR3A 2F9BT 1E27B 1DBAL 4MNQB 4LK4A 3LEYL 1UH2A 1NLBL 3WFDL 3TC9A 2VQ1B 5DJDB 3NCMA 3QEQE 1PZ5A 5J11B 3ARFC 4U33A 1U92B 1RZJC 5C0IA 1GOGA 5TPWL 2Y7QA 4PG9A 4NZTL 3FQTA 2QQLH 5JOPE 2XN9D 4ZS6D 3TO4A 4UQ3A 1FHGA 3MRGB 1XIWB 4DCQA 4KKCC 4JFDA 4OGYL 5F1NA 2WBJA 1A3LL 3NN8B 4YK4B 5TQ2L 2YD3A 1S9KC 1SYVB 4Y16A 4Q9RL 5BO1H 4M3JA 2O61A 4MD4A 5T1LB 2IMMA 4J3TA 1XT5A 5FO9A 4HX1A 3GIVB 5T33H 2IH1B 3F58H 1UVQB 2EE3A 3MRNA 5B4MD 2BNQE 2CJUL 1JN6B 4ZSOE 3T0VA 4JG1H 5GRYA 3MRCB 2FZ3B 3RPKA 2F54B 5JXEA 1VGEH 4YHKL 2DL2A 4L3CA 1LO0L 4QHKI 3QUKB 5ALCH 1T4KB 1ADQL 3TO2B 3P0VL 5BS0B 4HUWA 3RX5A 4E5XA 2YUXA 4MJ4A 1C12A 5KANI 3GMLA 2X4RA 3T09A 3WNOA 3P3YA 3AREB 1KXQE 5KAQF 5KVGH 1WZ1L 4JHWH 4XVTH 3FONA 4LAJH 1SVCP 4JFEA 4WW1A 3KNBA 4FQ2H 1ONQA 4P5TB 3TP4A 1B3JA 1MSPA 1D5MB 2DICA 4NCC2 2GEEA 3TYFB 2A6IB 1JHKH 3SDAA 1K4DB 3OB0K 1MUJB 1WZKA 2W9DL 4AIOA 2X4PA 4LEOB 4L4VB 4GQ9L 1QKZL 2CMRL 1BM3L 2P24B 1KB9J 3U7YL 5CGTA 3OPZL 4KI5D 4U1GB 2NTSP 3KYMB 1Q0XL 1EA9C 2VDPH 3AXLA 3GRWH 3SJVA 4LCCA 3BRFA 5EORL 4JGUA 4OLWL 3TYGL 1BECA 3GSQA 4QTIH 2OTUB 5IIEB 3FFCE 3TESA 3VFTA 4WU7B 5FO8A 4RGND 3NH7L 4G42B 4ZPTB 3IT8D 5FEBA 2DJUA 4I77H 3DETD 5IB1B 5DJ0A 3C8HA 1H3GA 3CFIC 1INEH 4OFKA 1FFOA 1U91A 2R56H 1JFQH 1M7DA 4HIJA 2CXGA 5FYKU 2HVJA 1IC1A 5IFHH 4I2XA 3GSXB 1CDGA 4BYHA 3IVKB 3LKOA 1NGPH 4Y16D 3S35X 3SGDI 1Z2KA 3BQUA 1RK0B 5L7XL 4ZXBA 5FO9B 3UO1L 3IGAB 4YDJA 3OB0H 4ZPVA 2EDTA 3QEUB 2F15A 1AIFA 2XWBA 5IVNA 4DVBB 1KEML 1TNMA 3CNKA 3X13B 4I13B 5E8NB 1G7QA 3NCEB 4AH2B 3THMH 1QSFD 4HUKB 1QRND 1CDHA 1PFCA 1JE6A 1LVEA 4X4ME 3BW9A 1ZA3B 3UDWC 1QVOB 6CGTA 2E7LA 4R97B 1PX4A 3ZYOA 2R4RH 4K3JL 3UBXG 1P1ZA 2G2RA 2PNDA 3QUYC 5B21A 4Y5YC 2VXUH 4J3VA 1DQDH 1KCLA 3Q5YA 2Z8WC 3BT2H 2AABL 1RMFH 5IG7B 4PRIA 1UKQA 3QHZH 3F8UB 5TE4H 5CS7A 4KUZH 4KKNA 4RZCA 4A6YA 2VKWA 2ENSA 4YGAB 3FJTA 3DIFB 3L3IB 4FP8L 1F6AB 4HH9A 4LAQL 4UIKL 3GO1H 1LNUA 5DK0A 2X4QA 2NY6D 5ISZB 3QNXA 2AVGA 2M1KA 3KPMA 1BFVH 5SV4A 5LGKA 1A7QH 1I8KB 5IEHB 2E9WA 3WL9B 3EJZD 2X4UB 4K7PL 2DQIH 5EC2B 2OCFD 1HOCA 1OSZB 4TPRH 4S11A 3RWCA 3QXDA 5I1DA 2FNBA 3R1GL 1NFDF 1FL3A 1WCBB 4K23L 4MQ7A 2F19L 3VXTB 1JTTA 3GSUB 3LN4B 5CBAA 3TBVA 1H8NA 3V7AE 3RWHA 3MXVL 1L6XA 1YMMD 5F7WC 1A64A 4PJIE 5FDYA 4HIJB 2VXSL 3HZYB 5L7XH 1CR9H 1YMHA 3DUSA 1YPZA 3BPNB 3C5ZD 2XZCH 4MJ5B 4YHML 2VR9A 2YWZA 4XPFL 3SOBL 1ORSB 5HVHB 4GRLA 4FABL 2FR4A 5CGYD 3QI9A 3DI3B 1XZ0A 4D3CL 3CD4A 1PGRB 4XBGA 1FORL 2DAVA 1IEAA 3D9AH 1A6TA 3SCMC 4PJEA 4PRBA 4AMKL 2KDGA 3QHZL 5DYOB 1RZKC 3LHPH 4MB4A 5C0DB 1CXIA 1NANH 5DC9B 1KTDA 1U3HA 1BQLL 2DTSA 2BZDA 1MFEH 3VA6A 4M7KH 5IW1A 3P11H 1I3RB 4HG4K 3NA9L 1S7UB 5IB5B 1I1AD 1JN6A 3GBNL 3NIFF 1TTFA 4ORZC 5F6IB 2QR0B 1EEZB 1ZANH 4XX1G 3DV4B 4KMQA 1S7XA 3SY0A 2WV3A 4S1QL 1EIBA 2WP3T 3VD9A 4RFOH 1CE6A 3TT3H 4LQ1A 2VLKB 3QWOB 1A2YB 4JM4L 1JZ2A 5HHXH 3TIEA 4RWHA 3QO1A 4YPGB 3L7EA 4HUWB 5E56A 3W81A 3QDGA 3ZDYE 2BVOB 4NN6B 4IRSA 5DRZA 2AKRA 5FM5M 3HC4H 1JV5A 5IFHL 1WVZA 1A4JA 3OJ2C 3MRFA 5I1AA 2EH7H 4G6AD 2OZ4A 4G7VL 2R0LL 4DKDC 2YD6A 4G8IB 5FYJD 3QXVA 1M71B 4PR5A 4U6YA 3C6LA 5HGAB 3DRQA 4XNXL 5GISH 3MLXH 3IFNH 2AI0H 3FRUA 3BPLC 4GBXD 4IMLA 2DQEH 4KK6D 2O61B 1OAZH 1T89C 3BZ4B 5CBEA 2BMKA 3D25A 1F97A 1K8DB 3HUJA 4J6RL 2IMNA 4J3UA 3BP5B 1J05A 3SPVA 1NCCL 1LEIB 4XCCL 4LVOB 3FQUB 1DEDA 4OZGB 1TZHA 2OXHA 4X4YB 3OKYA 4XAWH 3BWUC 4XPBL 5BV7L 2FZ3A 4F37K 4TOYL 2OK0H 2F53B 3PWPD 3VWJC 1KTKE 3F6IA 4MNGE 3ZKXB 2Q20A 1IKFL 3GBNH 43CAB 3P9MB 4EI6A 3U36A 5C08B 3I02A 4XI5D 2B2XL 2VITB 1ZAGA 1HXMA 3AS0A 2LABA 2MQCA 1U8OB 2DQDL 4U7SA 1PG7L 5J06A 5ESVA 5C08E 1S9XA 3I85A 3KPLB 15C8H 5I66A 1HZHL 4LNRA 3H2WA 3DSFH 3DXAA 4X6BA 5CEZD 3QH3B 1R6VA 2R1XB 2H41A 3OJDB 1RUPH 5EIIB 4K71B 2J1KA 3CCHB 5ETUA 4DTGH 4BZYA 4H1LB 4ZUVB 2CRIA 2R0WL 3CFKB 1XIWD 2J8HA 3SE9L 1KELL 3OZ9L 4EOWH 3FZUD 2GJZB 1NAKL 4N8CH 4D8PA 3MO1A 2PCPA 1IQWL 1D7FA 3RWEA 2VN4A 3OG4B 1BBJB 5E5RB 4D9RD 2VZ1A 3B2VH 3P77B 4G6JL 5CMAB 2AJXL 3OAYK 3GSQB 2ARJA 4C57C 5LWYL 4PJ5E 4OCSH 1TVHB 3RI5K 1K3IA 1WC7A 5DJAA 5JQ6H 5FYJU 3VGBA 4OAWB 3VXRB 4M5YL 3BP7B 4YDLB 4L8CA 4NUGL 4Y2DA 3DLQR 5BS0E 1MIEL 5ESAA 25C8H 4CMMA 1H3TA 4FP8H 4APQD 1SY6L 2HJKA 3PDGA 4LQFL 2WIMA 5D2LB 4BZ1H 5FHAL 3DURA 1Q8MA 1T0NB 3DVFA 5IMLB 2P5EB 2I9TB 1YEFH 4OLEA 4PP2A 2EO9A 2B1HL 3JTSA 3R4DA 5FOJA 1JGLH 3LKSA 1UB6B 1T2QH 2EDNA 1IL1A 4Q9QL 1QLFB 4G6FB 1DUYB 3QNZA 3ZDZF 1L0XA 1TDQA 4N90D 5EC2A 5KSBE 3K4ZA 3AB0B 5C9JA 3T0AA 1CL7L 3L3OA 5E5MA 1CFSA 3BKCH 5DMGC 1BVZA 4MDJA 3C6LC 4FA8A 2HJLA 2XQYG 2GAZA 1EFXB 2QHRH 5F6IC 4MA3B 5GJSH 2GT9B 5AWNH 2ZOKB 4U0QB 5C0FB 4OZIF 3BPCB 1K2DA 3MCKA 2RCSH 3WFBL 2X4OB 1NBYA 4Q6YA 1W0WA 2Y72A 5EU6A 5L2KD 4BZ2L 1U8JB 3FT2A 1Z9SA 4C56B 1G9ML 2AJYH 4YHYB 5ENWB 2FJGB 4XC1L 4RISL 2OZ4H 2OR8A 3AS2A 2D7MA 4D8PB 3P30L 2HVJB 1QKZH 1U42A 1PKOA 1JTOA 1MJJB 1XR8B 2QR0A 4YBLC 4AL8H 4PG2A 5IVOA 1FYTB 1CGSL 3FTGA 1N4XL 4PJDF 2YRLA 2AJSH 1CXLA 3FN0L 5ITFB 2Z31A 5HYQB 4BZ2H 1S7UA 2XXCB 3GSUA 3LN4A 1UJTA 2X4RB 1U3JA 3IDYC 3MA7B 1UKTA 1FVEB 1BOGB 1JPFA 1A9EB 3BESR 4X5XA 4R3SB 2VH5H 5I75C 1EHLH 1EVTC 3SE8L 4Y19A 1LO0H 3U7YH 2X4PB 4Q58C 3HE6B 3NCFB 2B1AL 1CL7H 1IEAB 4G9FA 4WFHE 3HE7B 4H0HB 1T5XB 3GMQA 5HVWA 1I1AC 5SWSA 2XQBH 4MJIE 3O9WA 4H1LH 1OAYH 4FMKA 1SMAA 4M48H 2A6KA 3SGKA 5LKNA 3DETC 3CU1A 5EZJA 5IJVA 1GIGH 4QRUB 5DHYB 1JZ4A 3B5TA 1H15A 2D7OA 4MJIB 4RZCB 3O41B 1ZHLA 4YHPA 4DOHB 3BT2L 1RUKH 3LEXA 5EUKB 1QRNB 2AEQH 4MXWH 1CIDA 3PP3H 1U41A 5DQ9B 3RGVC 4LLYA 2EC9T 2JJVA 1GXEA 1TJIL 3ZHDA 1ORQA 3LSOB 3DV4A 1OD7A 2Q6WA 2BVEA 1M7DB 4F9PA 5K59E 4TUKH 4HD9A 4Z8FH 3MODL 5I8CB 1LE5B 2VO5A 1IGTA 2GITB 4G6KL 4X7CC 1J12A 7FABH 1AKJD 1NC2D 4QKXB 1W72A 4OD3L 5HHVH 1CI5A 4HWEL 1BZ9B 4S1DC 3C5JB 2D7NA 5K33A 1G7QB 4AH2A 3D39B 5C08D 3EW3B 4JY5H 4U7MA 2DQHL 4RGNB 1X6LA 5J6GB 5DUBA 5T1MA 4G7YL 4GMSL 4XNQA 4YHZH 3WUWB 4Y8AA 4PJAF 1LE9B 2VLLA 5EOCJ 5M7QA 1NFDE 5J11C 4PJCA 3W2DL 2FJHA 4OLZH 5AZEL 2ERJC 4POYA 3K1DA 4PRHD 3MLYH 4KKAD 5HJ3A 4FZEH 4CKVX 4P2RD 3ZE1E 1RQ5A 4KQ4L 5HHOE 1Q1JH 1KIRB 1YDPA 3OXSA 3PIQB 3EYOB 5C07D 1R3LA 3QRGL 2OS7A 4L4VD 3UX9B 2XN9B 3MROB 2ZJSH 4M1CD 4I3SL 1VB9A 3KYOB 4ODXA 5ESQB 2O5XL 2X6MA 4YXLH 1CICA 3UP1A 5A16A 4Y1AE 3V4PH 3U2SB 2E8ZA 4JHZA 5L9DH 1GGCL 1MWAB 4KRPD 4M93C 1XCQB 1DQML 2X4SA 3SKMB 2DTML 4LLAA 1RHFA 2APTA 3I6LD 5I76B 5DQDH 3CAFA 3PWJB 3ZDYF 2CUHA 3H6JA 4HUUA 1FFNA 3RVXC 3CU7A 1ACZA 5F8RC 2GHWB 4IRZL 2YWYA 4J2XA 5JW3H 5CJOL 5D2LA 1PJ9A 1WISA 2F54D 3F5WB 2OMBA 2BVOA 3L3GA 4UU9B 4ZUSA 4I48A 3DNKA 4I3SH 4Q6IB 4MSWA 1QNZH 3A6CL 4F8TA 4R4BB 4WI6A 4X6BB 2KL6A 4N1HB 3ABZA 2AS5M 3NFSH 4FFWC 3P0VH 3CZFA 3MV7B 3KLSA 1J88A 4FXGA 3ZMRA 3S88H 4ZFZA 3MRIA 1K3ZA 3HAEG 4KDWA 2PKDA 5HDBE 1NC4B 3EFFB 2YA2A 3DUUB 4GRLB 2R1WB 1NUNB 2FR4B 5H35B 3WEXA 3W2DH 5FYKD 5HYSB 3HC4L 3BP6B 5KSBF 4OZIB 3SGKC 5CMAA 4XH2B 4MA1C 3WN5B 2PYED 4LIQL 1B0RA 1IAKB 5LAXA 1TVHA 1ZSDA 3IAQA 4Y5YB 4QTHA 4TNWF 2APXA 4NOFA 3BQUB 1CLYL 3ARFA 3HPJA 1GVIA 2DKSA 1N6QH 4WNQB 1K5NB 5HYJD 3IDXH 1I9JH 3GSRB 2PYFB 4NQVB 3GM0A 4FQXA 5CWSB 4TQEH 1I7RA 2QQLL 1HEZA 2JLLA 4LNVA 3DO7B 1R3HA 1IT9H 1EJOL 4RDQF 4DWHA 5MEOB 2LV4A 1MRFH 2EKSA 1KYOJ 3L9RB 4Q7DA 4XRCB 4D0BB 3J8F7 3D69A 4GUPA 5IHBA 2G9HB 1CICC 3TZVA 1RUAH 1BQUA 4XNUL 3VXSA 4MAYC 2CPCA 2NZ9D 4HLZH 4K7PX 4MD4B 4HFUH 3UO1H 1D9KA 2C1PA 3GSNH 4RAHA 1MPAL 3FB8A 2VR4A 2PYEE 4GBXC 4BK5A 2BNRE 1LP9A 4X98B 2ICWJ 2BHUA 3HTLX 1EGJL 3CLEH 1BLNA 3BKMH 5TE7H 5J9PB 1J7VR 4XPAH 1LNUB 1KF9B 4JN2B 1LDPH 4IMLB 5I18L 3LEYH 5DJDA 1UJ3A 4HZLA 3D18A 2G60H 1DBKH 2DQCH 3JZ7A 4OQ1A 3ZYIA 1JPTL 3V7MA 4QXUH 4CVXA 4UQ3B 2FL5B 3H0TA 3MTRA 3GUTA 1BVKA 5K9KA 1I7TB 1L9NA 1TJHL 5ITBH 4Y4FD 4Z0BL 1N0XH 5DFTA 4HIIB 2Q7NA 5EOTA 3FQNA 1C5BH 2P5EE 2DI9A 4I18A 4LGRB 3FHQA 4RNRB 2F53D 2P45B 1I7ZB 5EDXA 3BDBA 1UCBL 1IAIH 1QSVA 1QBLL 2GUOA 4OFVA 1BWWA 4KRPB 4QXTA 5D2NE 4DJMA 3T3ME 4H25A 5EUOE 4LCCB 3MV8E 1Q9KA 1DQDL 1G7HB 3V6ZB 4RGOH 3KS0J 2FBJL 4J3WA 2VZSA 1S7RB 3ZT7A 2J4WH 3OKNB 5DHVA 1JWSA 4OZHF 5ICXA 5IQ9A 3O3EA 1MFBL 4DKFH 2CIIA 1KBGL 2AGJL 1UEYA 3D0VB 3B6SB 1OCWL 1D9KC 3NA4A 1H3XA 4WW2C 3BKCL 1SBSL 2Y36L 4WEUD 5ACLA 4ZTOL 1D5MA 2WWKT 1F4XL 4JDTL 4ZOCA 4MAUL 1AGBB 5HHOA 1OL0A 5GRVK 3QZWB 1LO5A 2DQJL 2MFNA 4O4YH 2UY6A 2VAAB 1U58A 1CWVA 4YZFE 1UM5L 3D39D 3UBXA 5CKGA 2ADJB 2K1MA 2L7UA 4GKNB 5HY9B 1Y0LB 1T1XB 5C0CB 5GGTL 3UTZB 4UIMB 5D1ZA 3SDCC 2X9WA 5DQJA 3MV9A 1OTUC 1PSKL 1RZFL 4O00A 3B8SA 2R15A 5CJQH 2ZZUT 3IXAB 5BRZE 1IC7L 4MZ2A 2LVCA 5KW9H 3PE9A 2IH1A 1T20B 5JMRA 5IB1A 1NLBH 3ARBC 4WWKB 3B9AA 4XP9H 5KSBA 4NO5B 1DQLH 1XR9A 4I3RH 3S4SA 4U6XA 2EC8A 2B8OT 1A3LH 4AIZA 4XP4L 4P4RB 2EDJA 1K9TA 3MRLB 3RVTC 4KGJA 2DIBA 5KSUB 5K9JL 1X5AA 1YEHL 4HKJB 3C5ZB 2A77H 1MFDL 2VABB 3OXSB 3PIQA 1XGUA 4M03A 4NDMA 1K2DB 3CXHJ 1K4DA 1MJ7L 5J89A 2F19H 1B0RB 1A7NH 1QOKA 1YJDC 2HRPL 2N1KA 3HAEH 4WJ5B 1QRNA 1V5JA 2Y07L 4FQLH 3RAJL 3TF7C 5DJ2A 2V5SA 3L3DB 3M1BA 1T0MB 3P4OB 1S7WA 3CFEB 4HT1L 1S3KH 5FKAB 1XIWA 3O6LH 4S1SL 2W0PA 3QDHA 4UILH 2FD6L 4Z7UB 1D6VH 4KV5F 5T1KB 3QSKB 3GSRA 4Y16C 3KLDA 3V4VL 4LLQB 2VB5A 1KCVL 5I8EA 3AY4C 4O5LL 2APBA 4WTWA 1J10A 3RVUD 3WS6C 1FG2A 3TBWB 3WFEL 1MFAL 2VDNH 1IGML 3SDDD 1EDQA 5GGTA 4XXCC 3P0YL 3QCUL 4H5SB 4KK6C 2DD8H 4Q6IA 4JPVL 1FRGH 2XACC 3D39A 2G9HA 3CSYA 5SWZD 4V1DE 2WLYA 5TQ2H 2CKNA 5MEPA 1T83C 4HAGA 5DQJB 1OAZL 4LCIL 4FQIH 1QSEE 4JRXA 4KHTH 2XT1B 2AV1A 2SEBA 2FSEB 1P4BH 5E8DH 5E2JA 4G9FD 4M1GL 3U0WH 1TZIB 4I0PA 4L9LB 1K4CA 2DYPD 5DGQA 1TIUA 2WIIB 5CSZA 5D2LF 3QFDA 1WBZB 4PTUA 3TVMC 5CZVH 2H3NA 5J56B 2HJKB 3QEQD 1CT8A 2CLVB 2UWEA 3CIQA 4Y5XB 4L29A 4AENB 1FZKA 1NFIB 1PKQE 5KSUA 3VI4F 3ULUL 5I76A 3ARDD 5I9QC 4L8SB 2X9XA 2FH8A 1RVFH 2VDOH 1G7MA 1JYXA 3BD4A 2ZKHH 2E27H 4M62H 5CEYA 4PS4H 5IESH 1CD0A 1J86A 4PBVC 5F88A 5IWLC 1ZLSH 3X14A 2DMCA 5J12B 3WO3B 3QJHB 2EDWA 1NFDA 2ARWA 1S7XB 4QGTA 3SY0B 4DFHA 4W4OA 3QBTB 4R2GC 4JFQA 4HIEA 1HIMH 1I75A 3EYFB 1GGCH 5I8EB 1U8PA 3TBWA 2YN3A 5EU5A 3OB8A 5J7CC 1XH3A 4S1DD 4NKIL 2D0HA 3BVNA 4DN4L 1EMTH 1FNSL 1ZGLB 3E2HB 1AE6H 3IDGB 1FQ9C 3QG7H 1ZA3A 4HAFA 5E6ZA 1G9EA 3ULUC 2KBGA 4R7NA 1FDLH 4Y5YA 2IADB 4R2GD 1UZ6E 5DZOA 4ONOA 4HV8B 3U9PL 4EN3D 5IVXB 1P5VA 4WVRA 2I60H 2WBJB 1JWMB 1FYHB 4KPHH 5I30L 5F7DA 1HHHB 1QSFE 4X6FB 5DD3H 3BIKB 4I18B 4JG0L 5I1GH 4HK3N 5E24E 4NKIH 1OM3H 1G7LA 4JFDE 3N1FC 1KEGL 3QI9C 1Q38A 3PHSA 4JRYD 3VFUB 2E6QA 4Y1AB 2XY2A 4XXCA 4OZGA 1JYNA 1FVDB 4JY6A 2VDKL 4OLYH 5CP3A 3C60B 4PTUB 5DK2B 4ESKA 1H8OA 4BM7A 1O7VA 4H88L 4I48B 2XG5A 1BJ8A 5J3HD 1BBJA 1T0PB 3L7FB 5F70A 3N1GC 5MI0C 3CVIL 3ESUF 3MRJA 2AABH 3DX9A 2GSIB 4PYHA 4H20H 4P3DB 1KC5L 3CK0H 5INCB 4K9EC 2CDEA 5SWQA 4Z7VE 3HNSL 4BQBA 4G6MH 1S78C 5C7XL 1PG7X 4MA7H 2FYYA 1TITA 5KVEH 4WI7A 4PJ7F 3FT3A 3TVMD 4QRPE 3O6KL 4LCYA 4EZMA 1V3LA 1JUFB 2VNCA 3HS0B 3LB6C 3V52L 5KJRH 3IXTB 1QEWB 1U93A 3WN5A 5SWSE 2V6HA 4WI8A 2UUDH 4YDLC 4LSQL 1S9VB 3LKQA 4YXKL 1CLZH 5I1LB 2XQBL 3H9SA 3HFMH 1AXTL 4L3EB 4N8VG 3F6LA 4HIHB 3RNQB 3QCVL 4DN4H 4DKAA 4XCFL 1LK3H 2JB5L 4C59B 2AV7A 3MJ9H 4ISVA 2X2YA 3QUXA 3HI5L 2WANA 3SKJH 5ALBH 3I3BA 2CLRA 1Y6MR 4UTAL 1II4E 2P1YA 2UZIL 3EZJB 5SWZA 1XF1A 4FFVC 4M61A 5EUOB 4KKCD 2WUBL 1SHMA 3TBYA 4WTZG 5E5UB 5HGHA 4Y5VC 3QUMA 3AM8A 5EBWA 1SJHB 3QT2A 4IHOA 3MREA 3NTCL 5JXAH 5KTEL 5CP7A 1QZ1A 3L5HA 3KXFD 2J2ZA 3R0NA 1D5BB 1TPXC 1EHNA 4UINL 3P30H 4ZDHB 4F57L 4U1LA 3MRLA 1N64L 4ODSL 2UUDK 3BEWA 3F65A 4JB9H 1REIA 4ONFH 3V4PL 1FFQA 5B3NA 3BKJH 3W5NA 3B2UD 5GGRY 5D9SA 3KPLA 1A4JB 1BZ7B 3VFGL 1FSKB 2HH0H 2UVEA 1RU9L 4R8WL 1IGYB 2A0LD 1J1XH 2E7BA 2XPGA 5ADOH 2UWEF 5T1LA 2DB8A 1ZS8B 4G43A 1X5YA 1YNKH 3UJIL 3QO0B 4MQXC 2YZ1A 1QLRB 3QI9D 4M6AA 4RWYL 4NSKA 1MFCL 2OMNA 3MO1B 1CK0H 1P69B 3IAGC 3BKML 3GM8A 3LS4L 1CIUA 3QXUA 1DR9A 1Q94A 1WEJH 5I74C 4F15B 5C8JA 3CXDH 4H8WL 5T3ZE 4C54A 3JWOL 2Q87A 4G7YH 4GMSH 1UM5H 1ES0A 4KTEH 1WC7B 2KQMA 5DJAB 5T3ZH 1T21A 4LHQB 5FOBA 3BQUC 5FHBL 1FZKB 1NFIA 2CK0H 5KSBB 3S5LG 4LLWA 4HWZB 1E4XI 1HN1A 2C3HA 1M7IB 1U6AL 3C5SB 2A9NH 4MX7B 1T66C 4OT1L 4LLUB 4CADA 1ZVHA 2IJ0C 3O8XC 4ONFL 3ZE1F 4HSQA 4E42A 2VIRB 2AGJH 1F45A 5DFVD 4LEOA 4NQEB 3NVQA 3BN9D 4XVUD 3MV11 4GW1B 1BGXL 1P4BL 1GJIA 4MNQE 1XF3B 3O4LE 2CIIB 3JWOH 5DQ9A 3T0EA 3CZJA 4PUBH 1XF2B 4O2CB 5D1QA 5DJZB 3MBEC 5EIQA 1GGIL 2Z9TA 4NQXB 4IRJB 2NY3D 4HJ0C 1H3WM 5EBWB 5JUEH 3CVIH 1YC8A 2A2QT 2CIKA 4Z0XB 4Z7OE 4QY8B 1QFUL 3G5VB 1F3JB 4UB0H 5CUSL 4XBGB 4ONHA 2ZCHL 3QWRD 1D9KD 4FQCL 3QEHA 4Y19D 4NP4L 5M94B 4KRMB 2IBBA 2GT9A 5ACMA 5KN5B 4JRYA 4GUPB 1IGCL 1FPTL 4ZD3H 4O58L 3PP3K 2EYTA 4GAYB 1WBXA 3GSNA 5GS0D 2PO6D 2FEDD 2A6IA 2HT4D 4QRQB 3O6LL 1BFTA 2HLAB 4YBQC 1R3JA 1AR1D 4X7SH 4NRZB 4XHJD 4HV8A 4X6CE 3ETBF 1YY9C 1H0DA 3Q48A 3WYRA 1UM4L 3S88L 5HVHC 2G60L 3O3DA 3QQ4A 4KJPC 3ZTJH 1GOHA 3MV9E 2QQKH 2GSGA 3K7UA 3FFDB 3X13A 3QPXL 4KK8C 5FYLH 2R2HB 1I8IB 4XPAL 3RUGB 3MNWA 4HF5H 4X7DC 4Y2OA 3RWJB 1MEXH 4U1NA 1BWMA 1FYTA 2MNUA 1PSKH 1B4JL 1NDGA 3LIZL 3EOTL 4MVBC 1QBML 3OKMB 3FB7A 5KBNC 2A6DB 4UTBH 3V5KB 3N9GL 4QRRD 1MHEA 4PLJC 4L4TD 4KKBD 4BA8A 4CDGC 5IV2B 3MMEB 1GPOH 5INCA 1P84K 1QYGH 3FOMA 4QYOA 4XMKL 4Z7WF 2KZWA 4PGDB 2BNRD 5F7EL 1NUFA 3HI6L 1CFTB 1R0AL 1S7QA 3MGTB 4BQ8A 5EOCL 4UU9A 1RUML 1XF3A 3U0WL 1LHZA 1BAFL 6FABH 2EIDA 3ULUE 3MLYL 1AHWC 4NPYB 4CL7A 1X4YA 1MNUL 2EXWC 5A3ID 1INQA 2EH7L 4ZNCD 1ETZB 5ANMB 4NUJA 4PRPA 2YOCA 5JW4M 4L5FH 1T1WA 4Z77B 3RU8H 4D0CA 2W60B 1GGYA 1YJDL 2DLFH 2Z31C 2V9RA 1L7TL 1XMWA 3EGSA 2P5WD 3OGOE 2XIDA 3D39E 4I9WD 2NQCA 4LIQH 4MQ7B 1IGIL 3QNYB 3N1QC 4M1DH 1ODAA 5CGYC 5ADPL 1YY8B 5TFSH 3ULSB 5JMOC 2MOVA 2NTFA 5JORA 2F74B 2X1XR 3RNKB 4QT5B 1FIGH 3ZL4H 1LE5A 3B2UC 2ED8A 1QR1A 2X89A 3VWKB 4ZDHA 3DIFA 4X4ZA 3RTQB 1KEGH 4P5MA 1AGFB 1DQQB 4IIQC 1RAMA 5B38B 4OQTH 4NNXB 2CRYA 3G9AB 4XPTL 3RGVD 4UZGA 5D7JA 5D7IE 1U93B 2HAZA 3B9EA 2F54A 3FFCD 1TQBC 1JPFB 5CILL 4UIMA 1KC5H 4D2NA 2NX5A 3VRLF 4R3SA 2K3TA 3A6OA 3VXME 4RA3A 4U1NB 4L3AA 4ODWB 5GGUB 1JL8A 1SEQH 4WI9A 3BO8B 5F1KC 3D69B 4P9HC 3DGGB 1R5IA 2OI9B 3KGRA 4X6FA 5AG9A 3ULVD 4YHOH 3ZDXE 3EOAA 3SDAB 1KIRA 5ALBL 4L8SA 4UNTA 3WD5L 5F3HA 1G0XA 1U8LA 3QULA 4P5TA 5D7LD 5BW7A 5BJTA 1LP9F 3FQWA 5ICYA 4FQQB 2IG2H 1IM9A 2VDQL 1LP9B 4JKPL 2YN5A 1MCOL 4NSKB 3DX7A 5I30H 4K23H 4NQDD 1FNAA 2P8PB 3LKRB 3GFUA 3ARYA 4FFWD 2AKRB 1A6ZA 3U9PH 3VD5A 1IMHC 3PWVA 5KW9L 1VGKA 5BV7B 1ES0B 3K4DA 3RWIA 2AXFB 2VE6B 3O2WH 4ZFOA 5LQBH 3X12B 4D0BA 3B43A 1HCVA 3NACH 1G7JB 2GITA 1MCFA 2ICWI 2P42B 1N6QL 1BIIB 5CLTA 2J7LA 3ARZA 3D48R 2XTJB 1T80A 3M1BB 3WUWA 2DTMH 4J4PC 1OVZA 1BJ1H 4XC1H 1A7BA 5F7NC 1NCCH 1EUUA 4IRJA 4LARL 3MRBB 1G9MH 5IKCB 1S9WA 3QWOA 3QEUA 4JFOB 1ND0B 4ELMF 3MLUH 1IE5A 3ARGB 5DS8A 4PJ9D 2NY0D 4LHUB 5C0FA 4NWUL 4ZS6C 2ICWA 1HHHA 4NQXA 2ZOLB 3ULVH 4JN2A 5IHUH 8CGTA 1IAMA 3FL7A 3BIKA 1WEJL 3IRZA 3LQAH 1QVOA 3ESVF 5I1AB 4Z18A 5DFVC 1NGWA 5EPMA 1HSBB 5F9AC 1KCSH 1AXSB 4KK9D 3OHXB 5E6IA 1MFCH 5ICZB 3KYNB 5IJKC 1QHOA 3BKYL 3QISA 4XCEA 1CCZA 3NN8A 3MACL 4NYLA 5TF1L 1VCAA 1YEHH 1EO7A 5HHXL 2IQAA 3RRQA 3MRKA 1WZMA 2JJTA 1TCRA 5C86A 3U0PA 4TN9A 4K8RD 5HYFA 1CTNA 4NKDA 1MCSA 2Z31B 4KH2A 1C1EL 4KDTA 2FX7H 2BFVH 4FRWA 3RVVC 4FQQA 1UZ8B 5C9KA 1G9NL 2E9BA 3GIZL 4ZOAA 4F57H 3VFRB 1R24A 4Z0BH 4UQ2B 1AHWB 3P11L 1JNNL 1ED3B 4S1SH 3RBGA 2BSTB 3JTTB 5DK0B 2UYLB 4XPGH 3EFFA 3FO1B 1UXSA 1NL0H 4NHUA 3QQ9D 2ITDB 1J0ZA 2VMFA 2IQ9L 3LHPL 3TBVB 4LLDA 3S36H 2EDBA 4MNGA 1HI6B 2EDYA 4FS0A 2MPAH 2DD8L 5HYJE 3MJ7A 1X5XA 1WCBA 4PRPE 2UZXB 4X80H 4NO0D 3TH2T 3TA3C 5LGJB 1Q94B 4N0YH 4MJ5A 2ITCA 3LDBC 4RISH 2NW3A 1HYSC 4KXZI 4XB7A 4L4VA 4PRPB 2CDFA 4D0DB 1HK6A 2JELL 4PJAA 1A6VH 1BFSA 1RUAL 2H32A 3O3AA 3T65B 4GG6A 3PGFH 4ODBD 3MNWB 2CKBA 2J88H 1JGVH 2QTEA 4K55A 1KTDB 4NQDE 4OLUL 3WS3B 1JJUA 5C0BB 1EK3A 1QLFA 4NN7B 1PBYA 1OCWH 1ZGLA 5DVKA 3BWAA 3FT4B 5J1AB 3WO4B 5TE6L 1I7ZA 1SJXA 2ICES 2DMBA 5C07A 1HSAA 2OYPA 4OJFL 3LQAC 3O11A 5E9DA 3HR6A 2DI7A 1LDSA 5DJ2B 5FV2A 4AEFA 1EX0A 5JQ6L