3C6LD

Crystal structure of mouse mhc class ii i-ab/3k peptide complexed with mouse tcr 2w20
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
217
structure length
192
Chain Sequence
FEAQKAKANKAVRHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TCR 2W20 alpha chain
publication title Crossreactive T Cells spotlight the germline rules for alphabeta T cell-receptor interactions with MHC molecules.
pubmed doi rcsb
source organism Mus musculus
molecule tags Sugar binding protein/immune system
total genus 34
structure length 192
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2008-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c6lD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 3c6lD01
1XZ0B 2Y7QB 4YE4H 5T1KB 2WANA 3D85D 3QZWG 1HQ4B 1UM4H 2UWEB 1N64L 3BVNB 1Q38A 1FAKT 2EIBA 1QFPA 1R3IH 1UB6A 4M93B 1MIEH 2EC8A 4EN3D 4BQ9A 4PP1D 4JG0L 3O2DL 3RA7H 1CDIA 3ET9F 5DD3L 1DUYB 5M94B 4C56D 5BV7H 2WLYA 1NEZG 3ARWA 4FQQB 3A6OA 3MGTB 5K9KB 3D6GA 4HS8L 4O4YL 1TNMA 2AK4A 2YPVH 3OX8A 3DUHA 3IDIB 4LSUL 5I1KL 1A7PH 4WUUA 4K23L 1ZA6A 2VLJA 4GOSA 4UUJB 3NCJL 5C6TH 1K8IB 2Y9RT 3ULVL 1RJYA 3NCYS 1FNAA 1P6FA 5HD8D 2NMSA 3ZE2E 3GSQA 2CKBL 5SX4H 2N7BA 3F12A 5IQ9A 2O5XH 2RCSH 1P53A 4D2NA 4KJPD 4IRJB 1JZ8A 1FG9C 1R5IB 2IH1B 5DK2B 4C54A 3QT2A 4WGVB 4J12A 4KZEH 2GAZB 4J8RA 5EUOE 1DFBH 2WBJC 5DMGC 1KIRB 1N8ZB 3QEQE 5B3JE 5C0AB 5IIEB 2VQ1A 3WHE0 3X3FL 4PJCF 2GTZB 5C9KA 3MA7B 1WAAE 5HGHA 2X7LA 1CK0H 3S96B 4KKLC 2EZ0C 4KY1H 2R8SL 3K2MC 1INEH 3RAJH 3BZ4B 4HZLA 4JFFB 3IDYB 2EYSB 3H9ZA 1PLGH 4M1GH 3S88H 3GIVA 1KJ2B 5FEBA 2AQ2A 1AGCB 1G6RL 4YHZH 1TCRA 4S1DD 1JGVH 5HYIA 3JWDC 3KPRE 5HVFB 2X4UA 4KHXH 1ACYL 1J0ZA 1WF5A 1RFDH 5DHVB 1AI1H 4ALAL 1MVUB 5C8JA 4LCIH 4U3HA 5J3HD 1CZ8L 3SDCC 5DHVH 5DT1H 5L88H 1GGTA 5MP6L 2C3XA 1LO4H 1V3JA 3PQYB 4Y4HC 3WIHL 1UKTA 1QBLH 1Q9LB 4EOWL 5JXAL 3GUTB 1UFUA 2X70B 1FNHA 1NC4A 5BS0A 1W0VA 1L9MA 4NZUL 3BP6B 1BQLL 1TJGL 4H8WC 4XP6H 4LU5H 3G08A 3Q6FB 3F62A 4N8PA 4AEFA 2HFEA 4MA7H 5IF0A 5IMLB 1ZVYA 3BPNC 3KPSE 3QA3A 5EOTA 1T1XB 1B0WA 1CIDA 4QRRD 1E6OH 2NX5B 2NY7H 3A0OA 5IGXL 4XVTH 3FN0L 4E42B 1QSEB 5F88B 5KSBB 1HYSD 1OTTD 2FWOA 4LCYA 1R3HA 5F1OB 1ED3A 3NFSH 4PUBL 2JK5A 4GW4B 1R3KB 5DQ9B 5I71C 3D25B 3CH1A 2GYSA 3LKQA 4TNWF 3WN5C 3QULB 3WXWL 4NO2A 2VDKH 4XMLH 5F7KC 5CBAA 2PR4H 3G9VA 5DD1H 1VPOH 1WICA 2J6EL 3P30H 3JWOC 4XPTH 1YY8A 1R6VA 4L4TA 2PYFB 4XGZA 5HJ3A 5FYJE 4N1EA 1QVOA 1EUTA 1KJVA 3SO3B 3RWCB 2DQHH 4JM4H 3X14A 5FAAA 3AAZA 1R3IL 1P4LB 2ESVE 4OD2A 5FECB 4NO3A 4FXGA 5A2IH 1RSFA 5FYLH 2NQCA 4H5SB 2ZUSA 1QA9A 3QQ3B 1N6QH 4MA3B 3LPGA 1FN4A 5H94A 5JA9A 3NA9L 2KL6A 4QF1A 1U6AH 3KXFE 2ITCA 4I13B 3CLFH 5KS9B 1A7PL 3FAXA 4O02H 5I8KH 1QLRA 3LVEA 3U36A 5C6TL 2EH8L 2V2XB 4WUUB 4BSVB 5L7XH 1A9BA 5IMKB 3ARXA 3SDAA 4U1GB 4HFWA 4KRLB 1TMCB 2RCSL 3GSQB 5D7IE 5DO2D 3BZDA 4W6WB 1F4XL 4DTGL 1ORQA 3H3KA 3TO2A 1BOYA 4YHNA 2DWEA 4LVEA 4BH7A 1DFBL 4XT1C 3BP5B 4IDJH 4XCYA 4BZYA 4CVXB 3T8XB 4PJGF 4KY1L 4MZ2A 4IOFC 4QHLB 5IP4A 2UZYB 3RAJL 1BJ1H 4RRPA 4WV1C 2I07B 1A21A 1P7QA 3CDYA 3L5JA 4QNPF 4WI5A 3EDDA 4LP4A 3UTSA 4M1GL 4AY0A 3FRPG 5K9QI 1VGKB 3QRGL 2EIDA 4X4ME 5JHDD 5D1XA 1Y18A 3QHTC 4GG6B 5CSGA 4YHZL 2HLAA 1JGVL 2IG2H 4U1MB 1QR4A 4IHOB 4KHXL 4M1CC 1OAXH 2YD3A 4M62L 4TVPE 1HWHB 4FA8A 1RFDL 2X4UB 1HSBA 5E03A 1UWXK 1FQ9C 3HA0A 3HR5B 1OSZB 1ZS8A 2YSSA 1RZKC 4I77H 4LCIL 1G7HA 5DUPH 5HI3C 3FO1B 1T3FA 4WWKA 5DT1L 1KEGL 3ZMRA 5L88L 4LARH 4HLJA 3PV7A 2FHFA 2F8VA 4LPUA 1QBLL 1X4YA 4GAJH 4RDQF 3HE6A 3UTQB 2CIIB 1HNGA 3HS0A 1G7LA 1KLGA 1NC2A 4CGTA 5BS0B 3I84A 4LU5L 2J8UE 2P47B 5HDLA 1DE4A 5DJXA 3ARGB 1EBPA 3G08B 4MA7L 4K55A 3ZE2F 5IF0B 1E6OL 4Z7VF 2X4QA 2NY7L 5EWIH 5B4MD 2ZOLB 2N4IA 2X2YA 3PG2A 2IEPA 3B3IB 3U6RA 4KUCF 3QYCA 2VN4A 2OL3B 5GS0C 2NY3C 3LCYA 1NBYB 3NFSL 2AK1L 1BP3B 4L8BB 43CAB 3QFJA 1JZ4A 1A7NH 1ED3B 3LRSA 3VXMB 2PO6A 2VDKL 3CH1B 1M71A 3LKQB 2PR4L 3QXAB 3BQUD 4M4RA 4XMLL 4XPGH 1PGRB 5FGCB 3U9UB 4U1LA 4JPKL 4URTB 5DD1L 4DFHA 5CBAB 2YPKB 1VPOL 2XRAH 3BDBA 1P7KA 3P30L 1CFTB 4XPTL 5I0DA 3ZDXE 1GIGL 1YY8B 4RDQG 5DMKA 1I7RB 4OD1H 4UT9H 3TBWA 4IS6B 1P1ZB 3T3PF 2BNQE 2DQHL 4JM4L 4UDUA 1FIGH 3U0TA 3GMQA 4OD2B 5FYLL 2DQEH 1IKNC 1KJMA 3N85L 1N6QL 1A4JB 5IJKA 3VI3E 1HHJA 3MXWL 1QA9B 4YWGH 5SV3A 1BEYH 1FN4B 1U6AL 3QXTA 1YJDC 4I48B 1AP2B 4O02L 5I8KL 2ITCB 2WBWB 2X1WL 2D03H 2IQAA 4RGNC 3RZWA 2EEDA 5E7FA 5HI5D 4YBQC 3U36B 5SWZA 3VWKB 3RVVD 2F53B 4LDEB 4BH8A 1GHFL 5F9OL 4YUEH 3ARBC 3RNQB 5T5NF 4L9DA 5EFIB 4EIZC 1N4XH 1ORQB 3TO2B 3QDJE 4YHNB 4M7JH 4CU7A 1IAII 4BH7B 3G5ZB 1TJHL 2W0PA 2CLVA 4WO4B 4Y16B 4BSJA 3DVNA 3D3VB 3QXDA 4F8QA 1D5XA 1JWSB 1U8NA 4PJ5D 4Q0XH 4XVUC 2IJ0C 1JJUA 4UTAH 3IDUA 4GMSH 4KROD 4LPCA 1PSKH 1FVEB 3DNKA 4IRSA 4JFHD 2YEZA 4JM2D 5DZNA 1XIWD 1UKSA 3RUGF 4F80A 4E0RA 1XGQA 4QYOA 1UJ3A 2IG2L 3DVGB 3O4LA 1OAXL 15C8H 5EC1A 3SDCA 3T0VA 4XAWH 1HSBB 4GBXC 2W9LA 4QOKE 3MRBB 1GAFH 1Z9SA 4I77L 4TNWK 5DUPL 3SGDI 1CL7I 1ZT4B 4KKBD 4LARL 5DS8A 5JW4Q 1RZ7L 2CRYA 4Y5VC 4HKJA 4GAJL 2JIXA 3L9RA 3RWHA 2VRAA 4YO0A 1WFOA 2OXGA 4KDTA 1I3VA 1G7LB 4PJCB 5T3ZE 2H6PA 3IDMA 3NABH 2A6KB 3OL2A 4PJ7E 4V1DE 4JLRA 4RMTA 2BVQB 3BX7C 3RX8A 2LAAA 4OFIA 3QDGD 1DE4B 3EZ8A 5DJXB 3MNVA 2XZAH 1BBDH 4JRYA 5D7IF 5FM5M 5EWIL 1PQZA 4M6NH 2Z31A 3KLSA 4MXVE 3V6OA 2X4QB 3HNTL 3QNYB 2IPTH 3RWEB 1H0DA 3H3BC 3U6RB 4CJ0A 3U83A 2Z8WC 4MAUL 5H2BA 1A7NL 4DQOH 4ZXBB 5ISZD 3T1FA 4XPGL 1ZVSB 4PJ9C 3NIGE 2X4OA 2ZCLH 5CWSB 3WS6C 2XRAL 4KJYA 4HX1B 4OLZH 5HYSA 1WISA 3KLDA 4UT9L 4R2GD 3SPVB 5HVHB 1CXFA 4KJWD 4PRHE 3TBWB 1OB1A 1FIGL 2ADFL 1YEEL 3NZ8B 3MV9D 1MCEA 2R4RL 3T0EB 3IJHA 4Y4FD 4N1CA 4ZUWA 5HDOA 3GMQB 4HDIB 4ZNEE 5DSCA 2AI0H 4W68A 3OXRA 4JY6A 4YWGL 5I1CH 4TSBL 1HHJB 4ODUA 4RA3A 3RGVC 1WBXA 5EUOA 4OD3H 1BVLB 3QEQA 4Y5XB 3S3PA 1N6VA 1WAAA 3D0VB 1BOGA 1CICC 3V5KA 4PBWD 1GSMA 1KIPA 3U7WL 5SWZB 1GYAA 1A4KB 1JGEA 4OM1H 4N5UA 1IGIL 1Y6NR 3WFCH 3GNMH 5TFSH 3W0WB 5HGDA 4AIOA 1N4XL 3CFKA 2FECL 4LGPB 3MRMA 1I9RL 3WBDA 3CFEB 2ZKHH 3KPRA 4P5KA 4F7TA 2CDEA 5D8JH 3PV6B 5TQ0H 4P2OC 5TE6L 3EFFB 3QXDB 1F4WH 4PJDE 5HPMA 4UTAL 1PSKL 2OR8A 1JE6A 3VXUE 4HK0A 1BD2B 3W11C 3UBXA 4D0CB 3CFBB 3CXHJ 3QPXH 3UYPA 2D4DA 2LQRA 4NKDA 4WI2A 4HFUH 1JN6A 2AJUL 3MSPA 1XGQB 1A1OA 4YHML 5HHMB 4HKZB 2GJ6B 1JUFA 2XWTB 4XAWL 1GAFL 1G0YR 2D7TH 3IDGA 3OSKA 4NWTL 1RUAL 2WWKT 4GUPA 1JL8A 3DXAE 3KPSA 3KYKL 4HH8A 4CBPA 5DS8B 1AR2A 4KI5F 3CXDH 3FHAA 3D39E 4PJ8C 3RY6C 5DA4A 1INDH 3IDMB 5FYLD 4PJGB 2FATH 4NRXA 3BKCH 1A6UH 4EZMA 4GQ9H 4OCWH 4L9LA 1HN1A 4JLRB 1EXUB 5E0QA 2XZAL 1BBDL 3BGAA 4JAMB 2PXYD 3KR3H 3EDFA 4M6NL 4QT5A 2HP4A 4DZBB 4KJQC 1PQZB 3B83A 4QXUL 2IPTL 2L7UA 2JTDA 3MNWA 2AK4D 3SJVE 2ESVA 3DTXB 1NMAH 2Y4SA 4Y1AE 5JZ7C 3BPCB 1K2DA 1KCLA 3ESUF 2ZNXA 4M93C 2XA3A 1EEZA 2VLJD 3FQTB 4QRSA 1EMTL 3O6FB 3T1FB 3O6MH 1E4WH 2ZCLL 3QWOA 4OLZL 1LDPH 3E6HB 4S1SL 3OKYA 5A16A 1T22B 5HYSB 2CUHA 1VKXA 4X0KA 3KXFA 1NLDH 1MAKA 2Z35A 1CGWA 2XFXB 2GTWA 3ETBF 3MUJA 4PP2B 5J1AA 3QUZA 3U30C 3IJHB 4RAVA 2H26A 2AI0L 5A2FA 5F8QC 3R06A 1U3HA 5D7IA 4QRPB 3CX5J 3OXRB 4Z7VB 2K7PA 4IRJC 3LKOA 1LEKA 1A7OH 4ODUB 1F2XK 3KNBB 3G6JF 2AV1B 1PEZA 4YGAB 4LPXA 3QEQB 1IM3A 3CU1A 5D6CB 3RZCC 4DK3A 4UB0H 1U8MB 4UU9B 1QLEH 1ZWIA 4NQDB 3D18A 1J8HE 4UBDC 7FABH 4MLSA 3TZVB 1BOGB 4R7DB 3TN0C 4YHYB 2ENSA 5DHYA 3WFCL 4HIHA 4HUXA 4O2FB 4R4BB 1J1XL 1JGEB 3IVKB 1YEKL 3IDYC 3C6SB 5C0RH 3O2WH 5K93A 4X4MA 3LKPA 5C0GB 4OF8A 3HE7B 5HHXH 5TE4H 2ZKHL 5IROA 4HIXL 1R24A 1IT9H 3S34L 3DX8A 4YFLF 5D8JL 3UX9B 1MRDH 4P5KB 5TQ0L 1KIQB 5ICYB 2HKFH 2CDEB 1F4WL 4F7TB 3EW3B 4JO4H 1NC4D 3AC0A 5IEHB 4RFNB 2ILLA 2VDOH 5HGBA 3WNNA 2B0SL 3TWCL 1BQHA 4EUPG 2RIKA 1IZKA 3WJJC 1FNGA 2VZ1A 5D7JB 5GS1A 3ZL4H 4LLDA 1X3DA 4HFUL 2R0KH 2FCBA 2CK0H 2H3NA 5CILH 4NKDB 5EU5B 1T83A 4GS7B 3KYMB 1JUFB 3ARDA 1CVSC 3FT2A 1R5VB 1RZKH 2I9TA 2JLLA 4LEXH 2LVEA 1A22B 1CGTA 1P4IL 3BGMB 1T0PB 4NUJB 3QUYD 5A2KH 2D7MA 3CXDL 3MLVL 3ILQC 4L8CB 1G7MB 1XGUA 2QJDA 3BP7B 1P7HL 1A6AA 2LU3A 4L4TD 1INDL 3QIUC 3OF6A 5ITFB 1MUJB 1QFHA 2ZG2A 1KCUL 2C5DC 3BKCL 4GQ9L 4ODHL 4OCWL 7CGTA 1BMGA 1TIUA 1OTUD 1U9KA 3QIBC 4OZ4A 5FUCC 4G9FE 4L9LB 1AKJA 1PY9A 2B4CH 2KDGA 1JI1A 3MRRA 4Y4KB 3EUUA 5A3IC 1BJMA 4L3EE 3MV8A 2XT1B 3RUGB 4QT5B 4ZS7H 4P3DA 1BGXH 2BNQA 4QO1A 3GM8A 2V2TB 5E2VH 3RGHA 4OT1H 3GO1H 5IMMB 5CBEA 1JTPA 1K2DB 4X7EC 3DGGA 5FYJH 4HHAB 3SE3C 1E4WL 5ICXB 1MREL 3OHXA 1EEZB 3EYVB 5EPMA 4FZEH 4DGIH 2CLZA 4QRQA 3SDAD 4X7FC 2GSIB 3ELAT 1ZLUK 4X0KB 2DM2A 2R0WH 2Z35B 1OTSD 3LS4L 1WC7A 3ARZA 2XIDA 3FRUA 3ISWA 3MRPB 3QUZB 4MAYA 4RAVB 2ICEB 3QUMB 5LAXA 4U1GC 1U3YA 1F42A 5D7IB 1R5WA 5DYOB 2A6DB 1ORSA 1OLLA 1DDHB 3UO1H 1A7OL 1P7QD 4NNYA 3VD4A 3LKOB 3QDJA 4N0YH 2Y23A 3UTSD 4RFOL 5IR1A 1EVUA 3SO5A 4PJFE 4UB0L 5CD3A 5D1XD 2H2SC 3TBSA 4LLWA 2JB6A 1ZWIB 1FL5B 4C55A 2B39A 3D18B 1OT1A 1LO3H 5INCA 4PRPE 4QWWC 2BVUA 4LLUB 4MYWB 1XGTB 3C2AH 3UDWC 3C5JB 5KVEL 4I9WD 3ZDZF 5E8DH 2X44D 2VXTL 4HUXB 5C0RL 2E7HA 3B9KB 2VAAA 3O2WL 2DKUA 3SKMA 3ZHLA 3EOBA 4WU5A 4WWKD 3T4AA 5HHXL 5TE4L 1OGAB 4IDLA 3O3EB 4HUWA 3C6LA 3K3QA 3W9DB 3L95A 4PB9L 5T1MB 2DQDL 5ACLA 1MRDL 1FDLH 3HE6D 4Q6YA 2YC1A 2HKFL 1HXMB 3CFCH 3DX8B 4JO4L 1T5XB 1NC2D 1A64A 2R0ZH 1LE9A 4M4PA 4CVZA 4G6KH 1DLHA 4HUVB 5FXCH 1L0YA 3ZL4L 1DVFB 3V5HA 1A0QH 1U8JB 1MRFH 5FCUL 5GS1B 1EZVX 1S7TA 2R0KL 4ODWA 2CK0L 2CQVA 3H42L 1FH5H 4Q9RH 1IC4L 2H3NB 3IU3A 1HINL 2CH8A 1QHOA 2NZIA 3H7BB 1O7SA 3QEUB 4ORGA 5J6GB 2QADD 4OUOA 3IGAA 2NY6D 5HYEA 2JELL 4PJ7A 1Z9OA 4V1DA 4FHBD 3DUUB 2F54E 3ARDB 1NPUA 4G6AD 2VUOA 5CJQL 4JKKA 4LEXL 4Q9CA 3ARGC 3O8XA 3QFJD 3KYNB 4PPTA 3RY6A 5DJ2B 2Z4QA 3CK0H 3NTCH 2PO6D 4A2LA 4CKVX 4G7VH 3ES6A 2Z8RA 2QSCH 1BJ1J 5FHBH 2F8XC 5EBLA 2APVA 1ZLUH 4NNXA 1FSKC 1KFAH 2Q3ZA 3T0AA 5IJVB 3CNKA 3VFTA 1HEZA 2F58H 4OZ4B 2B4CL 2XNAA 1TJIL 1AKJB 4YHLH 4I3SH 1A7QH 3NAAH 4FFVC 3MRRB 5FA3B 1LO2H 1YN6A 2FJFA 3PHQA 2N56A 5EBMA 3NFPA 1P9MC 3MV8B 4NKIH 5ACMA 3VFRA 4ETQB 1G0XA 3GJFK 1BGXL 3ROOA 3MODH 4PRHA 4P3DB 3MLZH 1T21A 1O5DT 2G75B 3GO1L 4OT1L 4P9MH 4ZNEA 4LHUB 4B5EA 4PG2A 4ELME 5KSAB 4DGIL 1MQ8A 2FH8A 5CP3A 3FONB 5CEXB 5DMGD 1T1WA 1Q94B 3F6IA 5IT2H 1ZGLA 5C0EA 4XP1H 1NAMA 4U7KA 2R0WL 3CPLA 4NT6A 4KKLD 1JYXA 2EZ0D 2UYLA 3EIFA 1HCFX 2XPGA 3DSNA 1NCDH 3FRUB 5GGQH 4ZMAT 2FLRT 4MAYB 3VWKC 2C1PA 3RZCA 4G42A 4OCRL 3HFML 1Q1JH 1Z0MA 4G6FD 1H9VA 3CCHA 4ZNCD 5F3BA 2BNRE 3JVGA 3QUML 4RQQB 4N0YL 4IRSD 1CXLA 5IK3A 4MSWB 2HJFA 4RX4D 3LV3A 2RJMA 3WYRA 1RJLA 1HH6B 3O4LD 5EZOH 4PJDA 1LO3L 1XAUA 1R3JA 3QO1B 3SDCD 3W2DH 4RGOH 3VXUA 4UNUA 1Q0YL 2GW5A 5DJ6B 3O3AB 5E8DL 5E9DE 5IMOB 2VL5A 2CIKB 4PGEA 1CTNA 3ZYZA 3QDME 5DMYA 3CVHB 1OP3K 1W0WB 3V8CA 1KN2H 3OB0H 1V7NL 1KC5H 4JVPA 1FDLL 2JIXD 4PRNB 3CFCL 3CVHH 1IGMH 1I1FB 1OAZH 4JE4B 1MCKA 2HKHL 3MFFB 1NCAL 3HCVB 3RWJA 4K7FA 2GUOA 3DXAA 1ND0A 2E3VA 1A0QL 3F65A 1MRFL 3TYGH 5E6IB 1SJVA 4YHKH 4UQ3B 4MQSB 3G6JB 4JRYD 4I0CC 4Q9RL 3OKEA 4JO1H 5KVFH 4ODWB 3GJFB 3D39A 3P0GB 3DO3A 2Z31D 2XKSA 3MLWH 5E70A 1SJEA 1ES0A 3KPPB 5DGQA 1JGDB 5JW3H 4Z7OE 3IGAB 1GGIH 1S7UA 3CMOH 1W2KT 4OLXH 1TVBA 5F7UA 4FXLA 1QFWI 3CK0L 3NTCL 4HULB 4Q9QL 5F89A 1C5BH 4G7VL 1TZHA 2QSCL 5JUEH 5JLZA 3MBXH 4NZRL 3VXSB 4RISH 3IFLH 3BWAB 3LN5A 2BNUB 4OCXH 3SJVA 3ZSSA 4Y1AA 4D8PB 1KFAL 3HI5H 4CADA 2F58L 5JIPA 3SKNA 4L8SA 4YHLL 4I3SL 1A7QL 1YNKH 3NAAL 1D3CA 4MGXA 4HBQA 2QQNH 4NKIL 1YN6B 2FJFB 2X4TA 1MJJA 5H35A 3DIFA 3MODL 2G2RB 5MENB 3STBA 1V3KA 1ZHBA 3P4NA 3N1MC 3FB6A 2OP4H 3FN3A 5HVHC 1GJIA 4ODVL 5J13B 2A74A 3LPWA 1JHTB 3DETD 4P9ML 5K59E 3T0EC 4NP4H 1X4XA 3K4ZA 5E1AB 3RU8H 1P69B 4OCYH 4U2YA 4HEME 4HAGA 2FX8H 2FO1A 3NOIA 3IF1B 1EHXA 1T1WB 1CE1L 4MD0A 5ID1A 2W65A 2EE2A 4Y5XC 4OV6F 5CP3H 1YMHA 1YNLH 4IOFD 4Z8FL 4NT6B 4U1KA 2CLRA 1J8HA 4YK4B 3BO8A 3DHJA 3KPRD 2VDQH 1GGCH 2H9GB 5GGQL 1EAJA 1CR9H 2FO4A 1KJ3H 1HHIA 3DX6A 1Q1JL 3TEUA 4G42B 3BN9C 1QR1A 1OP5K 2IBGA 1F58L 1RIVH 3D9AH 5GZND 4I2XE 4M1CD 2YD9A 5HYJE 4WDIB 1CD8A 3FO2B 3UMTA 5IK3B 5K9JL 2Q6WB 3DX9A 2G5BB 2OTUA 3ILPB 1J5OL 3PGDB 3BDYH 2W1NA 3ROLA 2BK8A 5HI3D 4ZPVA 1R3JB 4KU1A 5E2JA 3QEHB 2A9MH 4Y8DC 5FHAH 3TYFB 2VL5B 1OGTA 1SEBA 2HVJB 3MV7E 1RUPH 4QHKI 1U95A 3KPSD 4XNUL 5JW5B 2CKNA 4AEHH 2ZWLT 3GSRB 4N5ED 4K3JH 3CVHL 3WFBH 4J3XA 3VGEA 1MHHB 5LKNA 4IMLA 1EGJA 2KUTA 3VFGH 2WINB 3OR6A 3NCBB 4LOUD 3TYGL 3CSBA 4K07A 3MGOA 1GPOL 1AGDB 1LEGA 3E0GA 3VXNB 4HIIB 4JO1L 3V9FA 5L2JB 4OKVA 3MLWL 4ONHB 1JHKL 5JW3L 1DEDA 3A6BH 3ZHDA 3WNKA 4ESKA 1KPVA 1GGIL 5FYJD 3EFDL 1S8DB 4OFYA 5I0ZA 3CAFA 3KS0J 3WLBA 4OLXL 4Z76B 4ODXA 2ESVD 5IV2B 4G9FA 2XY1A 1E4KC 1TVBB 1C5BL 4UMGA 2SEBB 2EE9A 3LRHA 5JUEL 3SE8H 3REVA 4L3EA 1TZHB 3NCEB 4RISL 2BDNL 4NPYB 5JLZB 3PIQB 5FK9B 5MEQA 4OCXL 1IFHH 3TO4B 1GCFA 3EO1B 3DX7B 1F02I 3KXFD 2OK0H 3HNVL 1UKQA 3HI5L 2V5SA 5JW4N 4GXUM 4BFEA 1NSNH 2NY0D 5C6PB 1YNKL 2MQ0A 3O6FC 2Y1VA 4K7PX 4X6DF 4L8SB 2A9NH 1U3HD 4UT6H 2QQNL 2L0DA 4O58H 5D7SH 2WP3T 1J10A 1EJOH 4POYA 2X4TB 3B5TA 2OP4L 1MJJB 3DIFB 4YBQD 2PCPA 3FQUA 1HE7A 5CP7A 3RDTA 4NP4L 4N0UE 5DRNA 1HOCB 1NEZA 2HT3C 4APQA 1F4YH 3ZO0A 1VFUA 2OS7A 3G6AA 4NZTH 1EO8H 4GKSB 4WFFE 2D7OA 5GGRB 4D0DA 1XGRA 5I1DB 4P4KB 4HIJB 2B1AL 5I66B 2W65B 3FO0L 4FFYL 3A6CL 4H25A 4LCWB 1CU4H 5FGSA 3IB4A 1JTTA 4U1KB 2VDQL 1ULVA 1J8HB 1GGCL 1S5IH 4PRPA 4TVPD 1LWRA 1GC1L 4FABH 3TZVC 3WEXB 1AHWB 1KJ3L 4UAOC 2EDNA 2FEDC 2ZUTA 2VE6A 2FO4B 4LP5A 3VRLF 4YHYC 1HHIB 2NZ9C 1MI5B 1FZJB 4Y19E 1RIVL 2XQYK 3VA2C 3CSGA 2EXWC 2O26U 4XHQA 1K3ZA 3HE7C 1N5YL 4LFHD 3KPLA 4KFZC 4XNYL 3G04A 2FYYA 3BDYL 2H2PC 1MF2H 4EXPX 4NKMA 1MLBB 3VGFA 2APWA 3WD5L 5E5MA 2YUXA 1NQBA 4RFNC 3AGVA 3MV01 5FHAL 3QJHA 3TV3H 1S7QA 1RUPL 5D7JC 2VLRE 4AEHL 4WI3A 5F93C 1KBGL 1J7VR 3O4OB 1JVKA 3WFBL 5AG8A 1MFNA 4ZFGH 1ZHLA 3GSWA 4GS7C 1XCTA 3VFGL 3OF6D 4JFEE 3NA4A 2F54A 4BQ8A 4KI1A 2F74A 1M6OB 2FSEB 2HRPL 1BLNA 1EGJH 4S0TD 1S5HA 5GJTL 4M6OL 1IQDA 2FRGP 4UTBH 4WTXA 4TUJA 4EXKA 1AD9B 1LEGB 1MWAB 3TIEB 1MCSA 4WRLA 3KG5A 5CSZB 5HHQA 1WBZA 1IEBA 3REWA 5FF6A 2ZSWA 4PJ9D 2BNQD 5C07D 4PREB 3DARA 5I1HH 1CD9B 4P2RB 2YRPA 4DW2H 5FYKU 4C58B 2FGZA 4BZ2H 5L0QB 2BMKB 3GMOA 1HIMH 5DJCB 4PJXE 4Y4KC 4MXQC 1U8OB 3GZKA 3OAUL 2NY1C 2MHAB 4HUKB 1EZVY 3EHBC 3MYJA 5MEQB 1IC5H 2M8XA 3VFVA 5BZDA 1C5DA 3C9NB 1D6VL 4Q6IA 2OK0L 1CXHA 4KQ4L 3D1MC 2DQGL 4ELMA 5D7KE 3CDCA 1CDCA 2FHCA 3TH4T 2QR0B 2A9NL 1UB5A 2Q76A 3EYOA 5GGTA 3SDXF 3FB7B 3O6KL 4YXLH 3FTGB 3AS2A 5D7SL 2IMNA 4CRPA 1BWMA 1Y0LB 1NGYA 1UM5L 3H9SE 3KLHD 1M7DB 2HN7A 3IDJA 3QH3A 4XMKH 3QDJD 4J2XA 1H8OA 4HMEA 2DIJA 3TVMC 3CMGA 5GGSB 3ZTJH 3WS3B 5CP7B 1F4YL 1FFOB 2D9CA 3DO7B 3O11A 3GHEH 2F5BH 4M5YH 1Q72L 1YYLL 4NZTL 2MMXA 1SVCP 1EO8L 5IFHH 5HHPB 3V5DA 5ENWB 2R23B 2FIRT 2BNRA 4OV5B 4K9EH 4BFGA 1U92A 5DD6A 3X11A 4N8CH 3UROR 4P2OD 2R1XB 3HUJF 4UNVA 2V9QA 4JFOA 2AVGA 1CU4L 3S3JA 4NJAL 3BP4A 3C6LD 1S5IL 4JFYA 5DFVC 5FM4A 4FABL 4KK6D 3ULUE 5A43C 4QTHB 2GSGB 5E9DA 1ZT7B 3TA3B 3OXSB 2BOCB 4QOKD 3DOSA 3B9KC 3QDMA 5GSRA 4IRZL 1DL7H 2H8PB 4PTUA 1YPZE 4JQXA 1JPST 4NN5B 1A3RH 1MF2L 3AREA 3D87B 5T3ZD 3ARTA 4HKBB 4NKMB 5I1EH 1NLBL 3C5SA 4LAQH 4PGCA 4V1DD 5EU3A 3ZKXC 1SHMA 4D9LH 5IB2B 1MH5B 3FB8B 3QJHB 1HILB 5BW7A 1DVFC 3O8XD 3QNZA 1YNTB 4Z18A 2JB5H 4Z77A 2H1PL 2EIZB 4F7PB 3MLTB 4HLZH 4P3CL 1JZ6A 5I1GH 2A6JB 3V6FA 3VWJB 5I76A 3OKKB 1XF5A 1D6EA 5BQ7B 1XCTB 4P59L 5DEGA 3Q0HA 1FV1A 1VGEH 4CUCA 5KTEH 3V2AR 3MOBH 4KJQD 3VXTB 1S9WB 1FPTH 3EOYG 4O9HH 3B2VL 3JZ7A 3MR9B 4N9OB 4WHTB 4DGVL 1MWAL 1E27B 1IEBB 5IBLD 4WW1A 1C16A 4PRHD 5GRJH 3RVUC 4W4OC 4HIEA 1IGTB 4JDTL 3KPNB 3QDAA 4MQ7A 4X5WB 5DRXB 4U49A 1JGLH 2RFXB 1I8KB 1BM3H 4PLJC 3RWIA 3OKMA 3GMOB 2IGFH 1F4AA 5CHNA 2JCCF 1SM3L 2APTA 1K9TA 4TN9A 3VDBA 4X9GA 4Y89A 2EXYC 3T65B 1A9EB 4PRID 3VFVB 43C9B 2C3WA 3QP3A 1OVZA 3PABB 3BDXA 1I7UA 4M8QB 1QG3A 1SEQH 3UAJD 2DLFL 5KSAC 2GJZA 5F9JB 5J56B 3TP4A 3VXRE 3UBXI 4R3SA 3W39B 4CU6A 1UB5B 5IQ7H 3RZCD 5E1HB 3JBG7 4KI5C 4UIMB 5E2UL 4F7EA 3AXLB 4XMKL 4UBDD 4XNZB 5KVGH 1XEDA 4WJ5B 5GGTH 3IDJB 3GIZH 3HRPA 4MMZC 3X3GH 4M43H 3CGTA 4KMLB 4GW5A 5C0JB 5I74C 3TN0D 5MEOB 3KPOB 3F5WB 3IKCA 3GHEL 4M5YL 4PJIF 1JCKA 4HH9A 1L7IH 5IHLB 3MREA 2ZUWA 4JKWA 4LL9A 4G80A 1DBAH 5TDPA 5DD5L 3V5DB 3VXUD 4I2XA 2APBA 4LSSH 4N0CC 5C0NC 4N8CL 3PXJA 5HYJA 4PV8A 3V0VA 2FZ3A 4OQ1A 5GGVL 1YEJH 3N06B 4JFOB 5F7DB 1XF3A 2ARJB 1JGUH 5D7LB 1JMZA 1XR8A 4KAQL 1YQVH 2R0LH 3KYOA 4X6DB 1HYRC 3CSPA 3GKWH 3MUGA 5EU7E 1RUML 4I0PB 1F3JA 4PJXF 3MV7A 5C09D 3DXAD 3QDMB 2BOBB 2E7LC 1DL7L 4IBLT 1PVHA 4YDIL 1IGYA 1I1AA 1VADB 3D39D 4HPOH 2E9WA 5BO1H 4PLNC 3TBYA 5HDBF 5I1EL 1FE8H 2V7NA 1E0OB 1XFPA 3C5SB 4AZ8A 1FNLA 4IIQB 2K7QA 2OJEA 1YEGH 1QP1A 2JB5L 4H1LB 1MY5A 1UWEL 3HLAA 5FGRA 4DOHE 3QIUD 4NRYB 2OI9B 5MERA 5I1GL 4L5FH 4U6YA 4L8DA 4F7MA 5JHLH 1CE6B 4HV8A 3QIBD 1OSPH 2O5ZH 2FX7H 5I76B 1YY9C 5IW6B 1D6EB 2CDGB 1H15A 1LO0H 4I8DA 3SJVD 3OKOB 4Y1AD 5KTEL 4WEUD 2UVFA 1FV1B 3UJTH 2FIKA 3V4PH 3WCYA 1EEYA 4KH2A 4N8VA 1F00I 1FPTL 4O9HL 1RZ8B 4KK8C 5M7QA 2HFGL 1H5BB 1OP9A 3T2QA 3HPLA 4QRUA 3IETA 2DQUH 3BD5A 4EI5B 4OCMC 1BZ7B 1IGFL 5LBSL 1WFNA 1UXSB 4GG8A 4X6CF 3RTQB 3EGSA 2APFA 4X83A 4XWOC 3QUKB 1JGLL 4MQ7B 3FOLA 4JDZA 5F7EH 4U1IB 5C0CE 1BM3L 1UZ8A 1FO0A 1J86A 3L7FB 5FM8A 1DQJB 5C0DB 3H3PH 4X98A 1JF1A 4DZ8A 1MFDH 2N1KA 3JUZA 4DKDC 5DFWH 2D7QA 1U58B 3C8DA 3F7PC 1YPZF 2IANE 4YDVA 5D71H 4N0UA 2ZP0T 3P0VH 4LLQA 4W70A 1IL1A 3PE9A 3WFHA 1JNNH 4LPVA 2GK0A 1BX2A 4AG4H 1SEQL 2QHLA 3DVIA 5GRVK 4OTXH 1YZZA 5ICZB 2GJZB 4P9HC 4ZAKB 5IQ7L 5T3XE 1Q9OA 2PYEE 35C8H 4GRWF 1JRHI 5I8EA 1TITA 8FABB 3VFNB 1NFKA 5KVGL 3PDOA 2FH6A 4PLKC 4OZHF 4M43L 1JZ7A 4QWWD 4DN3H 1GC1C 1VHPA 1BIIB 1N59B 3BAEL 4YK4C 4GW5B 1OQXA 1FL3A 4YNYA 2PNDA 3GBNL 4V2BA 5LCVL 1OF2A 1UEYA 1L7IL 2XTLA 2DQFA 5TPWL 1DBAL 3QXUA 4Y19A 12E8H 3I6GB 4LLYA 4K7PY 2NXZD 1HHKB 4NN6B 2FLBT 4LSSL 3LKNB 4ISVB 5KSUB 4K3DL 4Z0BH 5EULV 4EDXA 4YXHH 1DBJH 3QQ4B 4NQXA 5FGBA 2MCPH 5EU7C 5GQBA 2FZ3B 3O9WA 1W72A 4XH2B 3BJ91 3OTTA 1JGUL 4RNRB 4WI9A 4A6YA 1VERA 1CD0A 1EFXA 4M61A 1DN0A 1YQVL 5E2TH 2PW2A 1XR9B 4G5ZH 5E56A 3KYOB 3SDXB 4L4JA 1VFBB 1LEIB 5IWLA 3MCKA 2HVKA 2VLRA 3N50A 5AZ2H 1YYMH 3MJ8B 4JFXA 3O6LL 1HDMB 5C0FB 1L6ZA 5T5FH 3EOAB 2ED8A 1TQBB 3M45A 1IGYB 4HPOL 1T1ZB 4JFEA 1F8TL 4MCYA 4Z7UE 1FE8L 1N5AA 2V7NB 4LLMA 4JRXB 4LLVA 5F6IB 5TE7H 4ZQKA 1RJZA 4G9FD 3SCMA 1QBML 3ABZA 3K81A 2OJEB 2XQBH 4L5FL 2WZPD 5DR5H 4OLVH 2CDFB 3HUJB 4L3ED 3GM0A 5MERB 5CKAA 4U6YB 1OSPL 2O5ZL 2FX7L 3JTTA 3EOTH 1LO0L 1MCQA 4JR9H 4MNHA 1NGZA 1OARH 2DLGA 2XWJA 1QSZA 1QBAA 3RL1B 4PJXA 4X6EB 2FIKB 2QSVA 1LK3H 1ITCA 3UZVB 5GHWH 4W4OA 3QPQD 2DQUL 4QRUB 4LNRB 5BZWA 3TO4C 1ONQB 4PGBB 4MWFB 2VWEE 3RDTD 1KEML 4NCDA 3E3QE 1UM6H 4FP8H 4JDZB 4APQD 4ZDHB 3UZQA 5I17A 3H3PL 3CIQA 4YR6B 2BSSA 1MFDL 1XGYH 4Z7NE 2BXZA 4XCFH 1JF1B 2VXSL 4DZ8B 3H9SA 3GSUA 4LMQI 1EEUA 2OJZL 1FO0H 4ETYA 4WHDA 1X5IA 4NOBA 5D71L 3P0VL 3UYOD 2BRRH 3PWNB 4RIRA 1JNNL 3SDDB 2FEEL 4N0FA 3B9DA 3H9HB 4F57H 3BD3A 4LQ1A 1KPRA 4PY8I 1D9KC 1MAMH 4PRPD 5EDXA 5IESL 2DWDB 3VGBA 1OPGH 2HWZL 2F8OA 4YHIB 3OPZH 2QQKH 1AXSB 35C8L 1MCWM 5EZJA 4XCNB 4XMPH 4JANA 4P4KC 1UWGL 3TNMB 4P23C 2V17H 4EBQH 5D93B 4QTIH 1U8PA 2WWMC 4LPTA 2IALB 4GMTH 4MVBD 1RU9H 4DN3L 4X6CA 4TRPH 2XKUA 4BA8A 4KKCC 1D5ZA 4F7CA 1X5HA 1IM9A 1S7XB 3LD8C 1LE5B 4U33A 2WUCH 2AV7B 5JDSB 1OD7A 1OF2B 4PB0L 4U1NB 4CU8A 12E8L 2JJTA 3ARVA 4HJ0C 2D31B 4LRIA 3F7YB 4WI7A 2D2OA 4N0RA 1E4JA 3UC0L 4EI6B 5FCSH 5I30H 4Z0BL 2JCCB 4PBVC 4YXHL 3MLUH 1VFOA 1BVKB 3VGDA 1YPZA 3PP3K 3FT4A 1INQB 3B2UC 5KVDH 5HVWA 4U6HA 1WVZA 4P2QE 1FZOA 4UDTB 4A6YB 3QR2A 5FO8B 4FQLH 4M61B 5DJ8A 1W72H 1QBBA 2F54D 1L4IA 4GXVH 4DKFH 1U8HB 4A6YH 1F2QA 1F90H 5I16A 4JZJC 5AZ2L 1Y6MR 1U91B 4FXKA 1ACZA 2VLRB 4NN7B 3TH3T 3O4OC 4EUPA 5AD0A 4FQXA 1BHGA 3P4MA 3GHBH 2HG5B 3P73A 1C12B 2P5EB 3E2HB 4PJIB 3QUXB 1A6TA 2EDRA 5F6HJ 1NCTA 1EH9A 4MJIB 1V7MH 5C92A 5TE7L 3GGWA 4LLMB 1RZGA 5EC2A 3CZFA 2A2QT 2LU7A 4JQVC 5D2LE 2ED7A 3VFPA 4WNQA 5E8OA 2XQBL 3RWGA 3C8HA 1HH9B 1C08A 1PZ5A 3PL6C 3EO0B 1VEMA 2LVCA 4RMRA 1W8NA 5J57B 4U0RC 4JR9L 3JTTB 5IBUG 5I2IA 1L0QA 4LF3A 4JZNA 4MNHB 5DF0A 4NO0B 2D7PA 1YUHA 2XWJB 4Y2DB 2CJUH 1H3UA 3QI9A 4M6AA 5L0QC 1A7BA 4PJXB 3OB8A 5GHWL 5CJ5A 4DVBB 3VDAA 2W07A 3I2CH 2Z92A 4ELKB 3VXQA 4YFEA 4B41A 2BY0A 4J4PA 4X6FA 5JMRA 4Z5RA 5BVPL 25C8L 3WJLC 5SWQA 4XP5L 2XTJE 4J3OC 4M00A 4JPWH 1UM6L 4FP8L 4XCEB 3VXRA 5E8PB 3QFDB 4XNXH 4MHHI 5EIQA 2MNUA 3UTTB 1RJCA 4M6MH 2BNRD 3H9SB 4NO5A 2C9AA 1FO0L 1KTKE 3N1FC 3LRGA 3S5LA 1CGSH 2Y25A 2WMPA 2C1OB 1RUQH 2EDTA 3DMMB 4JQIH 4F57L 1HNFA 1FL6A 5HHNB 4MJ2A 1K6QH 5IB5B 1OPGL 1KPRB 3OG6B 5KJRH 2QQKL 2YRLA 5MEPA 4XPHH 1HI6B 3HAEA 4XMPL 5DQDH 3QCTH 1J1OL 5E9DD 1K5NA 3MRKB 5F44A 2V17L 3FO9A 4QTIL 1FHGA 4GMTL 5D2NB 1RU9L 3TJHC 1B0RB 1U8PB 1I8IB 1DQQA 4NM8H 4TRPL 1NBVH 4G43A 4X6CB 4NC1E 3ARED 4NRZA 4F7CB 1PAMA 1SQ2N 3ZSTA 2KQNA 4GRLB 1FGVH 3ARRA 3TA3C 4RWYH 5D1ZA 3JV6A 4OZFB 3IAGC 3ULUH 1X5JA 3MLUL 2NLJA 4WWID 2EYTB 4MD4A 3WDHA 3O3BA 5C3TA 4OLUL 2IPKA 1YPZB 4OZFH 5KVDL 4NHUB 5C2BH 4OCSH 5JR1H 5J11B 4BELD 1RZIB 3NGBB 2XN9E 2V7HA 4Z7QF 4FQLL 4YH6A 5D1QB 1IJ9A 2KZWA 3C8KB 1W72L 4GXVL 2FB4H 1ZSDB 4A6YL 4GRWB 1A5FL 4I3RL 4R4NC 2G60H 3NN8B 3EDKA 4FXKB 1T5WB 5I1AB 4U3CA 1CGXA 5IVXF 3HZKA 4OZHB 5E2WH 5C0BB 1RK1A 1A3QA 3GHBL 1A2YB 3L3HA 1CQYA 1T4KA 3BKMH 5M95B 3P4MB 1FVCB 3P73B 2NYYD 1DQTA 3O0RL 1NJ9A 3JV5A 4I18B 1RD6A 3OG4B 3SY0B 4EUPH 1VFAB 3WO4B 1KLFA 5KAQF 3E6FA 5ID0B 4F9LC 1IC7H 5K9OA 2VR5A 1KN4H 3RWGB 1U8QB 3IDXL 3MOQA 4WFEE 3TFKC 1KB5A 1G9EA 1PZ5B 1N3NA 4KQ3H 1K8DA 1D5MA 3NIFF 4W6YB 2VUYA 3EDEA 3ZKQD 3EYSH 5C0CA 3IDNA 1KENH 1B88A 4MNQA 1FC1A 1G7QA 2AKRA 4PG9A 1SJHA 1J05A 2I9LA 5CGTA 2DM4A 1N2RA 2BX5A 3I2CL 3G5XB 3NZHL 5B8CB 5CS7A 2IANA 3P77A 5T33H 4YC2B 2HT3D 4JGMA 4O2EB 1FFPA 4Z0XB 4G6ML 4NNPL 5EZIH 4JPWL 3VE0B 1F97A 4EN3A 1RAMA 4XNXL 5ISZE 5KAQG 3BEVA 2XZZA 2PYEA 3OR7B 4RMUA 4KMQA 3BGFB 4M6ML 5DRZA 1VFMA 2HTLC 5IEKA 4U1JA 1JNHA 4XNZC 5E00A 5HYJD 5JXEA 1RUQL 4GKNA 4JQIL 1TNNA 3V0WH 5GGUA 3X17A 3Q3GA 2L4OA 4LBEB 4P23A 1K6QL 4LQFL 3BKYH 5KJRL 4NOFA 1E28B 2IFGA 4JG1H 3QCTL 5DQDL 1QSFE 1TPXB 2UUDK 1WTLA 4XNMB 5INDA 1C8PA 3HAEB 4GJTB 3K4DA 5D2LF 1CFNA 1K5NB 4XAKE 4MA1B 4NDMB 3MV7D 1QFOA 3ZDYF 3FMGH 4YLQT 3HAEH 4NM8L 4QXWA 1NBVL 1ZHNA 2JJSA 4J7RA 4X7TB 1I75A 4L29B 4XBGA 1A6ZB 1I1AD 4NBXB 4IEFB 1PFCA 4NRZB 4RWYL 3RBGA 2VDPH 2DRUA 2X1PA 5TH2A 1P6AB 5DZOA 3HZYA 4HBCH 4I0PC 4XXDA 2XV6B 1PYWB 3D48R 2NLJB 1KTDB 1LQSR 4NCC1 1PG7X 1FYTB 4NQVA 5C2BL 2IPKB 2BSRA 4AMKH 3DURB 4MDIA 4CVUA 3I75B 1TQCB 4EVNA 3HRZB 4Z7UA 5I1JH 3GJEB 4J3TA 2PW1A 2J5LB 1YEIL 5LGJB 2FB4L 3H2WA 1LK2B 4JFZL 1X5ZA 3K46A 1RQ5A 4H0IA 4IIQC 2G60L 1UZ6E 5C08B 3C60C 1UENA 3SGKA 1I8LC 4BKLB 2VZVA 5E2WL 3BKML 1RK1B 3TT1H 1OY3B 5TF0A 3S7GA 5JTWA 3WNLA 5DUMH 4LCCA 4EKXA 5SWSB 1QRND 4MXQD 1Z6JT 4PJHE 4TUOB 2ADJB 2C7UB 3PL6A 4XRCA 2NY1D 4PJAF 3TF7C 1IC7L 3E6FB 1IAIH 4KK5C 4ODTH 4K2UH 2KKQA 5DRWA 1KN4L 5ITBH 3AMKA 1C5CH 3PHOB 5K9OB 3V0AC 1H5BC 4OIAA 2M2DA 1KB5B 3OJVC 3WIIH 3TM6A 3S4SA 2P7TA 1N3NB 4ZS6D 3VI4E 3QHZH 2X1XR 4O51B 3RTQC 1MPAL 3HG1E 1KB5H 2OR9H 4OIBA 1KENL 2ITDB 5DJ0B 5JIIA 2MTPA 4MNQB 4J6RH 2QKIB 2AKRB 4PG9B 4X6BA 4WFFD 5EOCL 2I9LB 4ZFZA 1SJXA 3TVMD 2ADGA 5T33L 4WW2F 3RVWD 1U8LA 1DEEB 3NFNB 3FQRB 1E6JH 4HS3B 2PTTA 1FFPB 3D85B 1CL7H 4OAWB 3IXTB 5GS3A 4F37F 5HHOE 4J1UB 4EN3B 2JJWA 5CIPA 4OF3A 3A67H 4ZAKC 4HC1A 3BH9B 5HXMA 4MJ5A 2VLLA 4C56B 4Y19D 5DRZB 5D5ME 4YX2L 4JM2F 1AFVL 1ZV5A 4R4FL 5T3XH 4X4ZA 3V0WL 3I9GH 3MRDA 2D0FA 1DLFL 3O9WD 1UCBL 5DJZB 1EFXD 2AABH 4JG1L 4K71B 1G7PA 4S1RH 2ZSVB 5JOFB 3RFZC 1AQDA 4OZIE 2OQJA 3TESA 4AT6A 5HI4D 5L2KD 4JFDE 4LEOA 4J3VA 4WHYG 2BRQA 2VXUH 2XXCB 3F7VA 1DJSA 2Z93B 2VQUA 2C3VA 3NCMA 4M5ZL 3PWLA 4P2QA 2NTFA 4OF6A 4JFED 1YQ2A 2VDPL 1JPSL 1DQLH 1AIFA 3LKRA 2AJXH 3V6ZA 1KNOA 1L9NA 4HBCL 1CFSA 2YD4A 3W82A 3WE6A 2EKSA 3WNMA 3SCMD 5IW1B 3FFDA 4AMKL 3P4OA 4R26H 1A6PA 1M7IB 2WUBL 5DLML 3RKPA 2BSRB 3MBEA 1TQBC 2LFGA 5I1JL 3MNZA 1IEAA 2GT9B 4BK5A 2CR6A 1MHCB 5F97E 3OKDB 1GXEA 1CDUA 1H3XA 5CMAA 4ERSH 3BW9B 3BE1H 5D2LA 1RI8A 5EOQL 1RVFH 3L3GA 3P11H 1L7TL 1LMKA 3KPTA 3MRFA 3TT1L 1NFDE 1X5YA 3BFOA 4AM0A 4ZUSA 1PKQB 2R1YA 4E5XA 4YGVA 4G6JH 2BP3A 3O3UN 5F8RC 4FFWC 5D7KD 1IAIL 4ODTL 3ZKNC 1TZIA 4K2UL 4RWHA 1RULL 5ITBL 4JKPH 4PJBE 4Z7WF 1C5CL 3FB5A 3QJFB 2EXYD 5TDOB 1MNUH 3LQAH 4QRRB 1JHLL 4DGYH 3WIIL 2GFBB 3CSYA 4TTDC 2OX5A 4RMSA 5E6YA 2HT4D 3QHZL 4NSKA 5DC0A 3S4SB 3GSOB 1UQSA 5GGRY 4W6XB 4M8VA 1KB5L 2HT2C 1YN7A 5DWUL 2DYPA 1MELA 2VL4A 4WGWB 3DVFA 4WEMB 5H8DA 5HYQA 4R9HA 1GZQA 4ZSOE 2ZOKA 4FTVE 4AIXA 1ROWA 2IAMA 4X6BB 4PRDB 4OLYL 3DV4A 4ZFZB 3GSXB 2ATPA 5IVXB 3U46B 1OWWA 2KPNA 4UZGA 4G8GE 1E6JL 1WCBB 1CGUA 4Y5YA 3SDDC 1CL7L 4PV9B 1ZHKA 2PTTB 4LGRB 5KSVB 4CW1A 5D6DA 5FO9A 3ULUD 1IM9D 3FQNB 5C0ND 3KGRA 1B2WH 5CIPB 1C1EH 1CXKA 2DLTA 5I1LA 2KBGA 2K1MA 2DQCL 2Y06H 1K4DB 1NBZA 4PTTA 5AAWA 5D93C 4LK4A 5CIPH 3PNWA 3BT2L 4M9PA 4HC1H 4F3FA 2P24A 3L3DA 4IOSD 4K8RC 2AABL 5KSBF 4S1RL 2X4SA 3IFOA 3LB6C 1KSRA 3NPSB 5FV1L 2EDFA 4OZGF 1CF8H 4LEOB 4NZJA 3W9EA 2BHYA 1RY7B 4HQQH 4FQXD 5TDNB 4OM0H 2P8MA 3SGEH 2V2WB 1WT5A 2AJXL 1BJ8A 3AM8C 3UTZA 3WFEH 1DSFH 2HAZA 1RHHA 1DQMH 4ZUUA 3ARUA 4ZUTA 1XIWA 2OM5A 4NN7C 1FZKB 5JHDB 4R26L 1MFEH 4HZAA 3FFDB 2WAHA 3P4OB 4NQSB 1KTLA 3WUWA 3O45B 3F8UB 3GMRB 2ICWI 3MRJA 2EEBA 2GI7A 4HXAH 2NR6C 3MNZB 5J12B 3E2HC 2XWBB 3QUXC 3Q5TA 4ERSL 1BAFL 3ARFC 3BE1L 4YIQA 4K94H 5CMAB 3WIFB 2DB8A 3U4AA 1T2JA 1FJ1A 1RVFL 4PRBA 5D2LB 2E5EA 5I6XB 4OI7A 3QI9D 2NXYD 3P11L 1WBYA 2ZPKL 3L1OL 5C0IB 4CMMB 3L3GB 1I7TB 5EO9B 3DI3B 3CFJB 1WZMA 4LIQH 3PWJA 2R1WB 4XWOD 3FCTA 3V4VH 4ZUVB 2E7BA 3WHXA 4IMKC 5KG9A 4FQ1H 3E8UL 1JWMA 4AM0B 4ZUSB 4LSQH 5B39A 4J4PD 4F37K 4YGVB 5ETUA 4H26B 4Y2DC 4Q2ZA 5GSVB 3RNKA 5DK0A 4JKPL 3RWFB 1OW0C 1TZIB 3VXRD 1S78D 1S9VA 5GGSY 1KLUA 4PR5A 4F9PA 3LQAL 4JZOA 2BXYA 4PIRF 1X7QA 4JY4B 3VFUA 2LTQC 1N26A 3CSYB 4X8JB 2BZDA 1JPGB 4JHZA 4R0LB 4V2CB 2A83A 1UQSB 2Z8VC 1JV5B 5GGVY 1W0YT 1YN7B 5ISZA 1YEFH 4ZODA 2Y5EA 3HB3C 5HYQB 1AD0A 1GZQB 3SEPA 3BQUB 2ZOKB 1I85A 2DD8L 4MDJB 4I4WA 5B21A 3ULSB 2JJVA 3PGFH 2NY5H 4HCRL 3SBWA 4QXTB 3DUSA 2IADB 3QQ9C 3LKSA 1Q9KB 3DMMC 4LPYA 3KDMB 1MFCL 1WLHA 3HTLX 3GI8H 3GMPB 4PJAB 5FO9B 2GHWB 3S36H 3LEVH 4F15B 1B2WL 1QSFA 2F19H 1C1EL 2XA8H 3RP1A 3VFWA 5D1ZD 5I73C 1PD6A 1U36A 2AXHA 1NBZB 5D2NC 4PTTB 2VABA 1IAKA 3GSVA 4RAUA 4HC1L 2ATKB 3PNWB 4MJ6A 5FYJU 2YPLE 4J3SA 5FO7B 3VFSB 4UILL 4F3FB 4AH2B 2P24B 4KRPC 2AEQH 4F58H 2XZQL 3SQOH 1T20A 3VFMA 4ZOAA 3TCLB 2ADIB 4GRLC 1CLYH 4OSUH 3MROA 4CN4A 1B90A 2NNAA 2X4SB 4H20H 3VXPA 1ZOXA 5C3LD 5IB4B 1WIUA 3MACL 4LASL 4LSPH 4FS0A 4WW2B 2UV3A 1OCWH 1NKOA 2Y6SD 5F7NC 1LO5A 4LVOB 1X5GA 3NGBC 3QIWA 1AC6A 4Q9BA 1KIUA 3I6KB 1RUKL 2FL5A 2AJZB 5D1QC 2CMRH 5F7HA 4PJ5B 2QEJA 3ZE0E 3WFEL 3SHSA 4KROB 1WZ1H 5DD0H 2YZ1A 3UTZB 1NGPL 4L3CB 4JM2B 1MFEL 4U1SB 4ZUTB 1XIWB 3CC5A 3T77B 1DP0A 1CFVL 4HXAL 3WUWB 3GI9H 5I75B 3QXWA 2BFVH 4GXUN 3MRJB 1GOGA 3UJJL 4JHWH 4PJHA 2DTMH 4K94L 3TBTA 1D5IL 4XI5C 3N1QC 4FG6D 5C0CD 1FC2D 5E8NB 1FJ1B 1KG0A 4YHPA 4LIQL 5EO1A 1OQOA 3V4VL 2IH3B 2AEWA 3PWPE 4NQEE 3FCTB 3L3OB 2IAND 2NY2C 4GRMB 5L8JB 1UC6A 3HG1A 2IBZX 1TVDA 1JWMB 5HBBA 2VITA 2PTUA 5B39B 1MCIA 2CSPA 5ETUB 4LVNB 3RNKB 5BV7B 5IOPA 3QDGB 4HGKC 2PXYA 3ZZ1A 3M07A 3MFGB 3O41B 5T3XD 2PYED 5B8CC 2ICES 3ZKMD 3PWVA 5DEFA 4KTYA 4QXGH 4XB7A 4P4RA 4YC2C 5ESAA 2DJ4A 3RPKA 1D9KD 2P5WE 5JXED 3VA6A 4N90E 3UPRB 4KKNA 3RHWF 5JPMA 5HHOA 4DCQA 4P23D 4CNIA 2WWMD 4U3XA 2AXFB 4DAGH 5J9PA 5EBGA 4DFIA 3BEWA 1UGNA 3BGFC 4OCNC 3ZYOA 3LOWA 5D5MA 2G9HB 5C1MB 3PGFL 5T1LA 2NY5L 2R39A 4HEPG 2NCMA 4PS4H 2HFFA 4KKCD 1AXTH 4R2GB 3Q48A 3C08H 1Q9WB 4HT1H 2DTSA 4M7ZB 3OJ2C 3MV9B 1H8NA 4HJ0D 4YDKH 3BJLA 1WSST 5FDWA 3U0PA 2IFFL 4Y4FB 3S36L 3LEVL 3T2NH 1DBKH 3FAWA 2F19L 2HYMA 4OZIA 1RIUL 5I8CB 4Z7WB 2XA8L 5CJXC 2DQIH 2OTWA 3B2UD 3IFNH 2P8PA 4JFDA 4U1HA 3QNXA 3AS1A 3VG9B 2EYRA 4MA1C 3WFDL 1MJ8H 1VSCA 5AEAA 4C4KT 5EOCJ 5F1KC 2DQJH 5IKCA 1VCAA 4B50A 4F58L 3SQOL 4NYLA 4KTEH 5FIEA 1T20B 1FRGL 2VJXA 3FJTA 4AEEA 2V9TA 1CLCA 2NNAB 3ARYA 3VXPB 4LSPL 4EQ2A 4Y8AA 1OCWL 3QCVH 5C86A 5BVJB 1NUNB 4YBLB 3MA9H 3W5MA 1NGWA 1F6AA 1EIBA 2EDWA 4OQTA 4S2SA 1G1YA 1TQCC 3NVQA 4IOIA 3DRTB 5KW9L 3TH2T 4P5TC 2CMRL 4G8FA 5D72L 2FL5B 1IBGH 5DC9B 3U4BH 1OAKL 3QB7C 2VLKE 5DD0L 5F1NB 3PL6D 4U6XA 3VXOB 5J8OA 5SX5H 4PY7A 3S35X 1MHPH 1NFDA 2EECA 4XXCA 2OXHA 4MCZB 3GI9L 3TJEL 5JW4R 1KCRH 1WWWX 1JK8A 5BCAA 3GB7A 2AS5M 5ANMB 2DTML 4JVWA 1YECL 1XF2A 3LN4B 5AZEH 4S1QH 5KANG 1YEHH 5CZVL 5HSFA 1XH3B 3QUYA 2C4FU 4OFVA 4OZGB 2P4AB 1KG0B 4ZFFA 5GRXG 8CGTA 3TPUB 3B8SA 3L5WB 3W81A 4YE4L 2X4NA 4X99A 4I5BA 1UM4L 2LABA 3FZUD 2VITB 3KJ4B 1AH1A 4ZSOA 1MIEL 4FTVA 4A2MA 1UB6B 5ESVA 5BRZD 3RA7L 5GZOD 5IOPB 2Z91A 1AO7E 2PXYB 4LRNH 4YPGA 4HJGA 5BV7L 4QXGL 3HI1A 4XNQA 3PWVB 2W0KA 4G8GA 3SGJA 1UG9A 3Q5OA 3RPIA 2YPVL 4UV7H 3LQMA 1CFQA 1J11A 2AK4B 4J23A 1M1SA 3C5ZA 3OX8B 3DLQR 3CUPA 3T0DA 4DAGL 2AP2A 1ZA6B 2VLJB 4PP1C 1RJYB 2O5XL 3BIKA 5IQ9B 3F12B 1FNFA 4D94A 4PS4L 1AXTL 2BC4A 1GVIA 2C3GA 4RGNE 3C08L 4KZEL 3QCUH 1EERB 4J8RB 4YDKL 1QFWH 2X4PA 1OAQH 4P2QD 3T2NL 1DBKL 1G9MH 2VQ1B 3UEZA 3U0PB 1CK0L 3S37H 4K3GA 4K71C 5HGHB 2X7LB 2DQIL 1INEL 1I7ZA 2V5MA 3IFNL 2WIMA 5CD5D 4R96A 2OTWB 1FFNA 3MRLA 4KJPC 3BPLB 1OHQA 1KXVC 1T6WA 4HZLB 1PLGL 3VGHA 1HXYA 1MJ8L 2EYRB 3S88L 4XP9H 1CG9A 2OBGA 3GIVB 5EU6E 1RPQA 1RIHH 1XF4A 4KTEL 3MBED 1TCRB 4ONFH 3U82B 3DYOA 3IRZA 3KPQA 3CVIH 1EX0A 5CEZE 1AI1L 2G5RA 1U3ZA 2IC2A 1IKFH 2C4FT 3V52H 3NACH 3JV4A 5C8JB 3QCVL 3FT3A 2CO7B 1LO4L 1II4E 1T7ZA 1NDMA 1HQRA 5GRZA 4S1DC 3OKLA 4IOIB 5KBNC 1QQDA 3P2TA 2DAVA 5DJAA 1IBGL 1NC4B 2J1KA 3U4BL 1LDSA 2VDRH 1W0VB 4XP6L 4OQTH 5A1AA 3MZGB 1HKFA 1YDPA 5I18H 5J3HC 1I8MA 4YEFA 2VB5A 2HFEB 1FNEA 3QA3B 3TIDA 5EOTB 3S98A 3UYRH 1KCRL 4XVTL 5IFAH 3P9MA 2D7NA 1JK8B 3GB7B 5EUOF 3D2UA 3RHWK 4MX7A 5B3JF 5IG7A 3AY4C 3P4LA 2CR3A 2XTJD 4XZUA 1MCLA 5FDYA 1R3LA 1TENA 1WAAF 2FWOB 2DYPD 4LCYB 3F7RA 4S1QL 1PKOA 1R3HB 1YEHL 2JK5B 3OAZH 5DGRA 3B9AA 3QUYB 3U4EA 4NQCE 4NO2B 4XBPA 2D4FA 2IAMD 4B53A 1N6UA 4L4TB 5HYSG 4XGZB 1Z5LA 5JOPE 5HJ3B 5E6ZA 1I9JH 5C07E 1IAIM 2ARJQ 4X99B 1QVOB 1OTTC 3KAAA 2W0FA 1KJVB 3X14B 4E41E 4MZ3A 3AAZB 4ZSOB 4NO3B 4FXGB 1YMME 4LRNL 4HXBH 5ESVB 3SKOA 1EV2E 3ULVE 3RVTD 5DJDA 1ZLSH 1KTRL 4XNQB 3WHE1 5H94B 2E6JA 4R90H 4UV7L 4QF1B 3RPIB 1S7SA 3CLFL 3HMXA 3J7HA 2ZNWA 2EDJA 3DROA 1NUDA 4DJMA 2N7AA 5L7XL 4JDVA 1QLRB 1QOKA 3D0LA 1A9BB 1J0JA 1NMCB 1UXWA 2WBJA 3SDAB 2NY4C 4BSWA 4HFWB 5MI0B 4XPAH 4BQCA 4LSTH 4PRAA 1JWUA 2BC4B 1UADC 3QCUL 2EDQA 2YPLA 1W8OA 2DWEB 1QFWL 5CJXA 1OAQL 4IDJL 2XN9D 3EYQD 1R0AH 3S37L 4XCYB 2GEEA 2BVOA 1RZJH 3I3DA 5EN2A 5HDQH 5DO2C 2Y5TA 1I7ZB 3LDBB 2XACC 1GOHA 2OLDA 4R96B 1P7QB 3OV6A 1WFTA 4YDLB 3VJ6A 4XP9L 5I9QB 3UTSB 4WVRA 3SN6N 5MHSE 1KPUA 3UBXG 4RX4A 5D1XB 1Y18B 1FIEA 2VOTA 1X9QA 1QO3A 1H3TA 1T89C 1PDKA 4LMQE 2R56H 2HLAB 4ONFL 1BREA 1XF4B 2WM0A 4OUUA 1CXIA 1LP9E 3LEXA 2YBRA 2B2XH 2COQA 3PP4H 5AG9A 2LU4A 3C60D 4XWGH 1MHEA 4Y4HA 3VMNA 4FNLH 3V52L 1G9NC 4CAGA 1ZS8B 5IFJA 2YSSB 3KLAA 3BUTA 1TETH 1G7HB 2WIIA 5L6YH 3JV4B 1T3FB 4WFGE 4WWKB 5AWNH 2YD6A 1S7WA 5T5NG 1MCWW 4WFED 1S7VA 1T80A 3M17A 5JPNA 4KUZH 3HE6B 2DI9A 2GCYA 3HS0B 5J12C 3MCLH 1KLGB 1NC2B 3OKLB 1QKZH 4Z9KB 4OQTL 1ZEAH 3I50H 4P46C 5I18L 1WITA 5I6XC 1TCMA 4QKXB 5BXFA 1NCUA 2F5AH 1I8MB 1CT8A 3PWPA 1I3UA 4NQEA 5IFAL 1NCBH 1QTYT 1F3RB 2QADB 4QGTA 5F6HI 2NY6B 3WN5A 3BH8A 5IG7B 2E9JA 3EYFA 2VISA 5FFLA 3K8MA 3BWUC 5D4QA 3QFJB 1CLZH 2X40A 3U7YH 3LRSB 2PO6B 3MLRH 1M71B 1CN4A 4MQXD 4IJ3C 4U1LB 5B4MC 2W91A 1P7KB 1QEWA 2UWEE 2P1YA 4FFZH 4OD1L 2P5WA 1FZMA 5GIRA 4R0LC 5DMKB 1BFOA 1I9JL 4UI2A 2EC9U 3ULVC 1J12A 3S97C 4UDUB 5JO5A 4OF0A 2W0FB 3U0TB 2DQEL 3FHQA 4DN4H 2W9DH 6FABH 4HXBL 3BQUC 1QSFD 1KJMB 2IF7A 3CLEH 2MPAH 1BEYL 4XAKD 1ZLSL 1ZT1A 2GQHA 2ZUVA 4OBSA 3AU1A 4R90L 1DR9A 3AS3A 4GAFB 5FB8A 4PRIE 2D03L 2CRIA 4UINH 2IBZY 2IQAB 3LZFH 2VKXA 2C4XA 5H37G 2X1OA 4JDVB 3BRGC 2YA2A 3D0LB 2O93L 2J8UF 3FL7A 3HMXH 5EO0A 4YUEL 3AS0A 4XPAL 4BH8B 3N1GC 4NKOA 5C0AE 2Q20A 3DYMA 4NFCA 3QAZB 4M7JL 4PRAB 4GLRH 1ZGLP 2X1QA 4WV1A 4QRTA 2CLVB 3LS5H 3QIWD 1RZJL 4JFFE 3DVNB 5IM7A 1BECA 4N68A 4Q0XL 5HY9A 1D5XB 1U8NB 4GMSL 2FJGA 4G6FB 3S8WA 1AGBA 3MO1A 2YA0A 4IRSB 4WW2C 4YZFE 3OGOE 2YEZB 4GKZA 4LFHG 5ALBH 2R56L 3ZDXF 2CRZA 4E0RB 5LXGH 3JWDH 4QYOB 1UJ3B 3O4LB 15C8L 4TULH 3PP4L 3VFOA 3LEXB 5EC1B 3SDCB 2VLKA 4FNLL 1MHEB 3OBAA 5DTFA 2I60H 3PQYE 1TETL 5L6YL 3BUYA 5AWNL 5C09E 1F45A 3VI3F 4JM2C 5ESQA 4L4VD 2DIAA 1ZA3A 4OIIH 1ZKAA 4HKJB 4DKEH 1WJ3A 4KUZL 2JIXB 1S7VB 2A1WH 3L9RB 3RWHB 2EC9T 4YO0B 3MCLL 5JNYA 3NABL 3IFPA 2H6PB 1ZXQA 3GRWA 3HG1D 5ELIA 1JI2A 3J8F7 3BPNB 4H8WH 3ECBA 3ZE1E 3I50L 1G7JA 3HHRB 1T66D 4OGAC 1U8IA 3CX2A 4G3YH 4KKBC 3KWWA 2F5AL 3MNVB 4JRYB 1CT8B 1ZANH 2VSCA 2HT2D 2R2BA 2X42A 1NCBL 2Z31B 4LHJB 1IAOA 5FUCE 3WN5B 3R1GH 5IUSA 1H0DB 5HTSA 3BH8B 1IARB 4DQOL 5HHOD 2ZJSH 1CLZL 1FLTX 5H2BB 3U7YL 2EDXA 1AO7A 4LHUG 1KT2A 2QQLH 2DMKA 4KDVA 3MLRL 4UT7H 4GW1A 5J0BA 3SGEI 2X4OB 4XHJD 3JWOH 4KJYB 3BZFA 2VDLH 5T1LD 1QEWB 2BSED 1IKNA 3G5YA 4PBXA 4M7LT 1BFOB 3CJJA 1OB1B 4JCLA 4DN4L 2H41A 2W9DL 1KV3A 6FABL 1S9KC 4BFBD 4KV5E 4X5XA 4ZUWB 5DSCB 4UOJA 3CLEL 4JY6B 5I1CL 3U7AA 3SDYH 2BVEA 5F3HA 3H0TA 5KS9E 4JFDD 3T3ME 4OD3L 4R2GC 5GRYA 1WBXB 4NBYB 4KJWC 5EUOB 5AAMA 1JPFA 4M7ZC 5FB8B 3ARBA 4UINL 3H8NA 3I85A 4Y4FC 5CZXD 3AB0B 3T08A 5SV4A 3HMXL 4PJ7F 4POZD 3V5KB 3P40A 4OM1L 1IQWH 1KIPB 3BYTA 4RAHA 1N0LA 3GNML 4N1HB 5EO0B 5TFSL 2EICA 4KPHH 3VG9C 2BSTA 5HGDB 5GS2D 3CFKB 2FD6H 4MXVF 3LHPH 3MLYH 3HZVA 3MRMB 3L3JA 1KYOK 2VZ3A 4WV1B 5F70A 3KPRB 1S3KH 2YMXH 1ZMYA 1H3WM 5HPMB 4GG6E 2HLFC 2ZZUT 3U2SA 2FJGB 3NIGF 4HK0B 2W9EH 3QPXL 1UACH 3UBXB 2NR6D 2LAGB 4YBLC 1ITBB 3T09A 1ADQA 3IXAA 3B5GA 4GBXA 5LXGL 3ARFD 3JWDL 1AR1D 1IGJA 3EZJB 4GKZB 3X12A 5B38A 3HC3H 1JN6B 4TULL 1A1OB 4U05A 4Y5VA 2BVPA 32C2A 2J8UA 2D7TL 2I60L 4O2CA 3IDGB 2GKIA 2WK2A 4OIIL 4GUPB 2EH7H 3KPSB 4DKEL 1TDQA 2Y07H 5BS0E 3QO0A 1HHHA 1I1YA 2XKNA 5IVZA 5JNYB 1ETZA 2FATL 4H8WL 4O00A 1A6UL 4CN6A 3DGCR 1KULA 4NRXB 4ODBD 4FQHA 4G3YL 4FTVD 5A2LH 4YXKH 4NQCA 1U8IB 3GRWH 3KR3L 1G6VK 1A7RH 3CDGA 1ZANL 2BCKA 3QXVA 2ID5A 4TOYH 1YC8A 2P8LA 4G8GD 1D5BA 1AGFA 4PJ9A 5C07A 1T04A 1U93A 3VXME 3R1GL 1K3IA 5GS0H 1A3LH 1NMAL 3WS6A 3MNWB 3SO3C 4E41A 1RMFH 3KJ4C 3MRHA 1VACA 5FGCE 3C5ZD 2ESVB 4GAYA 3MMEA 2ED9A 4PJDF 1X5LA 3O6ML 4UT7L 1FG2A 4QRSB 1Z9MA 1MJ7H 3QQ9D 1LDPL 2X89D 3BESR 3QWOB 3OGCA 2VDLL 2CKBA 1BFVH 3STLA 2D9QB 1NLDL 5A16B 1VKXB 2XG5A 3KXFB 3ME0A 4G8EA 5LGKA 1A1MA 4P3WA 3L6FA 2GY5A 2GTWB 3RGVA 5C70A 4M3JA 1S7RA 2NY0B 5J1AB 5HGAA 2H26B 4X5XB 3R06B 1U3HB 3SDYL 3RQ3A 1EVTC 3T4YA 4KRPD 3L3IA 1CICA 1LEKB 5E7BA 2GITA 5KZCD 1YJDH 1A1NA 1HSAA 3MRNA 1CIUA 1QLEL 1JPFB 2VMFA 1IM3B 2F53E 5F1IA 5DI8A 7FABL 1FORH 4I0KA 1JNJA 4YDJA 1A8JH 2V5RA 2DI7A 4NIKB 3B6SA 1IQWL 3LPFA 4K3EH 4P99A 4CDHA 1SMAA 5DHYB 4HIHB 3BPLC 3O3DA 3V7AG 4P2OA 3HR6A 3D3VE 3LHPL 3LKPB 3MLYL 1OD9A 4XBEH 1RZFH 2FR4A 1IT9L 4XPBH 3L3JB 1R24B 1LP9A 4UIKH 1FVDA 2W59A 2DL9A 2HFTA 2A38A 2YMXL 1TZGH 2VDOL 4QOKA 4AENA 5HGBB 2IPUK 3MRIA 4TVPH 1ZE3C 5GRUH 1BQHB 2W9EL 3HI6H 3U2SB 1UACL 5CEZH 1FNGB 3P9LA 3L3KA 3M8OH 4UQ2A 4LLDB 1UH4A 3LSOA 5IBTH 5CILL 3IXAB 4OFDA 3HC3L 4XI5D 5CJOH 4C59B 5FKPA 1JRHH 3D2UD 3SE4C 1ADQH 2DBJA 3IJYA 1RZKL 2J8UB 5FKAA 1MLCA 3FT2B 2F9BT 3TNNA 2I9TB 3U48A 4PJ8A 4KVNH 1PG7W 4KWUA 2NY2D 3OB0K 3PGCA 4PJCE 3S6CA 5EIIA 3MRQA 1DUZA 2HJLA 3VD7A 1SYVA 3QO0B 1XGUB 3HN3A 2XKNB 3D69A 2WNGA 2J6EA 1CS6A 1A6AB 1E4XH 1RURH 4C83A 5IVZB 4BUGA 4UV4H 5J6HA 4ZD3H 4ODSH 3IU4H 5T1KA 1A7RL 1S9XA 4P2YA 5F7LB 1ZLVH 1HQ4A 3CDGB 4I1NB 2M26A 4ZS7L 1N64H 2JJUA 4FMFA 3CD4A 4G9DA 3AUVA 5E2VL 5GS0L 1A3LL 3OJDA 1MOEA 1AGFB 4PJ9B 2BNQB 5C07B 1U93B 3RI5F 4WI4A 1RMFL 1DUYA 3FQXA 5E4EB 3MRHB 5FYJL 1BIHA 1OTUC 1T6VN 4FQQA 5CBEB 3CFDA 3MGTA 3DGGB 4FZEL 4MNGE 3OHXB 4M3KB 5EPMB 4HS8H 4O4YH 2WBJD 3VCLA 4D3CH 1ZLWH 2CLZB 4QRQB 3T0EE 4UUJA 1K8IA 3VH8A 3STLB 4PRIA 3NCJH 4BFIA 4S0SD 2YPLD 1VA9A 2CKBH 4IRJA 3WV0A 1WC7B 3H6JA 1R5IA 2IH1A 3QRFM 5CGYC 3RVXC 1NMCC 2GAZA 2BY2A 1KIRA 1N8ZA 5LAXB 3SDAC 5C0AA 5MI0C 3UO1L 4KC3B 1R5WB 2KZ1B 1ORSB 3MA7A 4NNYB 3S96A 3QDJB 5E24E 3TN0A 5IR1B 1OTSC 1HZHH 5CD3B 4WO4C 3FFCD 3BZ4A 5FYKD 5SWZE 4JFFA 5F1IB 4FZ8H 4Y16C 2AAVA 2EYSA 3TBSB 4LLWB 2JB6B 4GFTB 4JJHA 3W0WE 2W0LA 3C2AL 1KJ2A 4K3EL 5INCB 1F5WA 4EEEA 4Y4HD 4PGZA 2NW3A 2R2HA 5F7WC 3CFIC 3SKMB 2VAAB 3KHOA 1QFWM 5EZLA 5HHVH 5I9QC 3WUZA 3EOBB 3MUY1 4WU5B 3T4AB 4P2OB 4P5TD 5DHVA 4XPBL 5D1XC 1MVUA 4HUWB 3C6LB 4UIKL 3L95B 3WJJA 4XP4H 5JOEA 2R0ZL 1BD2E 2YC1B 1FVDB 4G6KL 1CZ8H 1LE9B 2VZUA 3NCFB 2J3SA 3PQYA 4QOKB 4CVZB 4TVPL 1Q9LA 3GUTA 1DLHB 5GRUL 5C09A 3HI6L 4H0GA 5CEZL 3MRIB 4JRWA 2X70A 4WWKC 3V5HB 5HHME 3P9LB 1A14H 3L3KB 1FH5L 2GJ6E 1S7TB 1QHPA 5E5UB 3LSOB 3PWPD 5L8KB 4NQED 3Q6FA 4NZUH 3HE6C 1X6NA 1TJGH 2BHUA 3IU3B 4ORGB 1JRHL 2WWKO 1ADQL 4M7KH 5IMLA 2O5YH 1NUGA 1WEJH 2AXGA 4PJ7B 4V1DB 5T3ZH 4JVUA 4E42A 1MY7A 3VMPA 3O8XB 3QIUA 2Z4QB 5F88A 3PGCB 3ES6B 4PJGE 5FHBL 3QIBA 1R3KA 4GW4A 3D25A 4MLIA 2QADC 1E4XL 4PJFF 2NY6C 2P5WD 3D69B 4QNPE 5EBLB 4N90D 2AJYH 4UV4L 4HUNB 4NNXB 4G6AC 2EDEA 4ZXBC 2PYFA 2J6EH 4BM7A 3VFTB 1HEZB 3Q5YA 2PO6C 3QWQB 1B9ZA 1LO2L 2XNAB 2MCG1 3VG0H 2YWZA 1S9XB 3RWCA 2XQYG 5FECA 1P4LA 3PHQB 3BPOB 5EBMB 3SE3A 3BISA 3NFPB 2WLZA 5J7CC 3MLZL 3VFRB 3ZTJG 3ROOB 4PRHB 3R8QA 4G9DB 4H5SA 3OJDB 1T21B 3QQ3A 1IRAY 4MA3A 1VESA 5HVGB 3FQXB 2X9XA 3EBAA 1OL0A 1MCNA 3NA9H 5AUMA 3CFDB 4D3CL 5KS9A 5IJKC 1U2HA 5GPRA 3VCLB 4JREB 5IT2L 3WO3B 2V2XA 3LEYH 4XP1L 4BSVA 3U30B 2EH8H 4BZ1H 5IMKA 1ZGLB 3VH8B 5C0EB 4QHMA 1NAMB 4PRIB 4PGDA 4BFIB 3CPLB 4QRPE 4PJEE 2UYLB 1NCDL 4Z7VE 2XPGB 3ESVF 1NAMH 4CL7A 1F4XH 3V6BR 4DTGH 3TC9A 2C1PB 3BP5A 3RZCB 4X4XA 5JQ6H 4Q74A 3CCHB 4NQDE 4LVHB 4CVXA 5F3BB 3T8XA 3QAZC 4OGXH 4QHLA 3UDWA 1HZHL 1U41A 3TN0B 2I07A 4FZ8L 2HJFB 3LV3B 5EZOL 1RJLB 3AMLA 1VGKA 3W2DL 4PJDB 4RGOL 1NL0H 4GG6A 3QRGH 2VLKD 3VW3H 2O61A 3VXUB 3ZKSD 4U1MA 2NW3B 3T3PE 4GAGH 2R2HB 4IHOA 3MJGX 1OT2A 4HLZG 4IRSC 5HHVL 3BZEA 4PGEB 4JGJA 1KJ2H 5EZLB 4M62H 1KN2L 3HR5A 1OSZA 1KC5L 1IGML 1OAZL 4KHTH 1UJ3C 4XP4L 3CZJA 3FO1A 5D96B 3G9AB 3TGXA 3K0WA 5DURD 1KEGH 1T7YA 4ELMF 2EO9A 3UTQA 2CIIA 3RWJB 4K7FB 2GUOB 5C09B 3DXAB 1ND0B 4YHKL 1A14L 3SE4A 4NHCH 5BJTA 5KVFL 2RQ8A 3IYLW 5GS0D 2NY3D 3OKEB 3D39B 3ARGA 3RI5K 3OJMB 5TF1H 4M7KL 4DEPB 4KDTC 2O5YL 1SJEB 1ES0B 1TVHA 1WEJL 3CMOL 4NC0B 5T3ZL 1S7UB 2AXGB 5ACZA 2ZOLA 4AJ0A 1ZTXH 3B3IA 1AO7D 5F89B 3QIUB 3MBXL 5HPOA 2OL3A 1NBYA 3IFLL 4WTZG 4L8BA 43CAA 2Z31C 4HKXA 1H3PH 2GK2A 3V6OC 2AK1H 3VXMA 2YD7A 2DKSA 3QIBB 3LN5B 3QXAA 2AJYL 3U9UA 3L5HA 3SJVB 1QRNE 1QNZH 2YPKA 4Y1AB 1CFTA 4JPKH 4U31A 1P9MA 4Y2OA 3RUGE 4CADB 3LIZH 1G1CA 1I7RA 3SKNB 1I4FA 3QZWA 4IS6A 5E95B 1P1ZA 3VG0L 1GIGH 4RGMB 2APXA 3OQ3B 1VENA 4RGND 5H35B 1P4BH 4CDGC 3P4NB 1ZHBB 1KB9K 4BJLA 3FB6B 1A4JA 2A74B 2NY4D 3N85H 3ARBD 3RU8L 3MXWH 4OCYL 3WDIA 3QISA 4B7IA 4FQJH 2FX8L 1BFSA 4I48A 2DQTH 4LAJH 1EBAA 5AUMB 1AP2A 2Q1EA 5AYUH 2PUQT 3LEYL 5IW3A 4POUB 4BZ1L 4MD0B 2NW2A 5ID1B 4PJFA 3VWKA 1YNLL 3PJSA 3C2SA 5CJBA 2F53A 3QHFH 5EU6D 4QHMB 3DETC 4XVUD 4PGDB 1YMHB 3RNQA 2CLRB 1GHFH 5F9OH 3AB0C 3BO8B 1CR9L 4Z7OF 1NAML 5EFIA 5CEZD 3G5ZA 2LE9A 3DX6B 4WO4A 5EUKA 5JQ6L 1TJHH 3D9AL 4Y16A 2E9BA 1U42A 3D3VA 4FMKA 1QR1B 4X4XB 1JWSA 1X5KA 4OGXL 2QSQA 5BMFH 5KVMC 4UOW1 4GBXD 5EB9A 3DX9B 1FVEA 2OTUB 3UXFA 1NBQA 3ROLB 1OLZA 1NL0L 4XC3H 3BSZH 3VW3L 1OGAE 4ZPVB 2A9ML 1HK6A 4D0BA 3DVGA 4XPFH 2NXZB 4GAGL 2O61B 5L2KE 1OGTB 5GZNC 1KJ2L 1SEBB 4H1LG 3ZLQC 3BZEB 3NCYP 4DUVA 1U95B 2DS4A 4K3JL 3MRBA 4KHTL 3EJZC 3MYZA 1ZT4A 4IMLB 4P46D 5K59F 1MFBH 1RZ7H 3RY5A 4KXZI 5LQBH 3OR6B 3DHMA 2RHEA 4PJCA 1X5AA 4NHCL 3MGOB 4NQCD 1T03H 2A6KA 2CD0A 5BJTB 1J0HA 4N5EC 2BVQA 4OKVB 5TF1L 2Y72A 3A6BL 1LHZA 2YUVA 3U79A 5IB1A 5JOPD 1KPVB 1TVHB 2B4CC 4PJEF 5I19H 5EBWA 4JO3H 1J87A 4E41D 3WLBB 4GLRI 4LOUC 4ODXB 3QNYA 1F4HA 3HC0A 4G9FB 5ACZB 4L9LC 1ZTXL 2J4WH 3MUHL 3HNTH 1OWRM 1YMMD 3RWEA 3SE8L 3T2PA 3I3EA 3REVB 3ULVD 4L3EB 1FSKB 1H3PL 1IFHL 4ZXBA 4MAUH 4HKXB 1ZVSA 2OL3H 1QNZL 4RMQA 5CWSA 3MQIA 4HX1A 4QLRA 1NSNL 1VB9A 3LIZL 3LH2H 3MV11 3RGVD 5EG6C 4MNGA 5EIVA 3SPVA 1EHLH 4DUWA 3MV8E 2MKLC 4M7LH 5EA0H 4UT6L 4NQTA 1I4FB 3QZWB 3NZ8A 4O58L 4ENEC 3T0EA 1EJOL 2ADFH 1YEEH 1DN2A 4MS8C 2R4RH 5DMIH 2DLIA 4HDIA 1P4BL 1CICD 3BMVA 2PCPB 3L7EA 3FQUB 2J8HA 1FFQA 3RDTB 5DRNB 1NEZB 2NY0C 4KI5E 3QUZC 4TSBH 5DMJB 4APQB 4FQJL 1BVLA 4Y5XA 2DQTL 1U3HC 3G6AB 3N0PB 5AYUL 1TLKA 2VZTA 4D0DB 1XGRB 3SKJH 3D0VA 2X6MA 5MHSD 2R29H 3QHFL 2NW2B 4PJFB 4E9LA 1J0KA 3ZT7A 1CI5A 4H25B 4CVWA 3PJSB 1A4KA 4JHBA 3U7WH 1N7MH 4R6UA 3W0WA 5IB3A 1UWXH 2OMNA 1IGIH 2XXMB 4CJ1A 3W11D 4PRPB 5F9AC 3CFEA 2VE6B 4Z78A 1I9RH 4JY5H 4D9RD 5EUKB 4ORZC 1TTFA 4WFGD 3PV6A 3EFFA 3BYYA 2R2EA 5BMFL 5F7FA 5TE6H 5IROC 3KPLB 3G04B 1BD2A 2FYYB 3FRPA 4GT7A 1I1RA 4D0CA 4XC3L 3CFBA 4OKDA 3BSZL 3WNPA 5E5MB 2E8YA 4XPFL 4HUUA 3TV3L 1MCJA 1ZAGA 4D0BB 1KYOJ 4ZPTA 5ECJE 3IKKA 3MXVH 9CGTA 2AJUH 4HKZA 1S7QB 4WY7H 4PJ8D 2GJ6A 5GS1C 2XWTA 4YHMH 4ZFGL 1T83C 3N9GH 3RY4A 1ZHLB 3GSWB 4OGAD 1MFBL 4NWTH 1RUAH 1F6FB 2Q8BH