4Y5VB

Diabody 305 complex with epor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
SQSALTQPASVSGSPGQSITISCTGTSSDVGGYIYVSWYQQHPGKAPKLMIYDVSRRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCNSYTTLSTWLFGGGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
molecule keywords diabody 305 VH domain
total genus 25
structure length 111
sequence length 111
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2015-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vB00
2FX8H 4F7EB 4OZFA 1KELL 2HLAB 4UV7H 5F7LB 3PIQA 1DVFB 3HMXA 4QHUA 1IGFH 1D5MA 3ZT5A 1FFOA 3L3KB 2NW3A 4EDWH 3C60A 3O3EA 3MRBA 4XVSH 3OKKB 4WW2F 2EKSB 4HD9A 1NDGB 3GSQA 2EO9A 1XGYL 2BJML 3W5NA 5DJ0A 3F12B 5GGTA 2R1XA 4UNTA 4L8BB 5FYJU 5C07E 5DR5H 4X6DB 2I9LA 4LHUB 3TBWA 3GI8L 1I75A 1F2QA 1EAPB 2W91A 2X2YA 1UM5L 5B39G 1F3RB 4R3SB 4JVWA 1U92A 4LSSH 4PRPE 1OAKL 2Y07H 3EJZD 2BVOB 5H2BA 4WUKH 2ZPKH 3T77B 1JGUL 4YHLL 3MA9H 3C60B 1BD2D 5L9DL 1KF9B 4CMHC 5EBWB 3FJTA 3HC4L 4QF1A 5CD3A 4NKIL 3TH4T 1BQHB 3MBEA 4TNWK 4RFNC 4Z7QF 4HS3A 5IBTL 3MNVB 5I8OH 2XZCL 2BOBA 4Z7NF 1U8HB 1UH2A 1XIWC 2AJXH 3PGFH 5DJ0B 5GGRA 5LQBH 4NQEA 3HE6D 4YFLI 1FV1A 1AGCB 4ORGA 2GSGA 4Q9QL 4V1DE 5I19L 4MNQD 2ZSWB 4U0QB 2P4AB 4PJHE 4PRHE 2MOVA 1AH1A 1FZJA 3IRPX 1FJ1B 4R4FL 5DXWA 43C9B 2QQKL 4N1CA 1F02I 1UB5A 4YC2B 2FX9H 3ULUC 3QFJE 1GAFH 1UT9A 1NCWH 3HZKA 5ESAA 5F89A 3TIDB 3LSOA 3RZCC 1N3NB 3BZ4B 5FHAH 4UUJA 4Z9KB 1A7OH 4HJGA 3STZA 4JFDB 4OAWA 5C09E 1QBAA 2Y36L 4U1LA 5T1DH 2ZUQB 5F97E 2AK1H 3MRGB 5TDOA 2HH0L 1KEGH 1U93B 1GGCH 3BT2L 1Z3GL 1VADA 4GUPA 3IFPA 5F6IB 2ZCKH 1IARB 3KXFA 3GJFA 2OBGA 3ARFD 5E8PB 3P0YH 3UROR 3GMRB 4KY1H 2VN7A 2F8OA 1KUMA 2G2RA 4LSQH 3TLRA 1ZWIA 3HAEH 4D0DA 3N1MC 1ACZA 4FQCH 1G9MH 3SE4C 4G6ML 5DD1L 4MDJA 4K94H 4P9HL 5T1LD 3BPOC 4KJQC 1ADQH 2QSCH 4XWOD 1T7YA 2IADB 2AQ2A 3O45A 1WSST 1YJDC 1RSFA 3JWOC 3M07A 3O41A 4JPVL 4XPFH 3BSZL 5HDBE 4YPJA 2CRYA 3K74B 4GMSL 3EOAB 2V9TA 5IB3B 3RWEA 2GTZA 3NCYS 3UJIH 5C0CE 1RJZB 1K8IB 3HC0A 2Q8AH 1PKOA 2WINB 4NKQB 3IYLW 3HRPA 4Z5RB 4NQCE 4YHOL 3VFNA 2V5MA 5GGRY 3MRCA 4UOW1 2BK8A 4LSRL 1IZJA 2GQHA 3ARBD 3PWJA 1OAQH 4OD3H 5BOZG 1LEKB 2BY3A 5DJ6A 1EFQA 3V6ZB 3QQ9D 2YPVL 2FL5A 3V6FA 4NHCL 1E27B 2LTQB 3EO9H 2VUOA 5K9JL 3SDYL 4YDVA 5FUCE 2FEDC 3QA3A 1N26A 5C0DB 3VD9A 3NIGF 2NXZB 4J23A 3B9DA 5JPMB 3RU8L 1A9BA 4WEUD 4PD4J 4QRTA 1RJLA 1A6VH 1I9RH 1MCEA 1KACB 2DQTL 2GTZB 4F7PB 3D87B 2ESVA 1OSZB 3QI9B 3Q6FA 4X5XB 4FN0A 5D7JA 5FV2A 2VDNL 2V6HA 3CUPA 3L3JB 2I24N 5F9OH 3VMNA 1ZK9A 1MF2H 1IKFL 1OL0A 5KVMC 3RTQC 3ZMRA 1RUPH 2YZ1A 2RBLA 2DJ4A 5IK3A 5IJKC 5GGTH 1X6LA 2QADB 4OZHF 3UC0L 2PYEA 1MLCA 3EZ8A 3NACL 3U4BH 3QQNA 5IVZB 4P4KB 1E4XI 1TZHA 4QRPB 3PDDA 4GKZB 4IRSD 1AXTH 5MERB 4R7DA 3C87A 3UTTB 3WIIL 5CJXC 4HPYL 3DO7B 3ZE1F 3RWHA 1HXMB 2VITA 4Y4FD 2FGWH 3QUYC 4ZAKD 3O4OB 5ANME 3MLVH 2X4RB 4GQPH 1FGNH 2UUDH 5GGRB 4YXHH 3LKOB 4OGXH 3PP4L 1Y18A 1X6NA 2P8PA 1BQHA 1SJVA 3MBEB 3DXAA 4UV7L 5I18H 1UB5B 2UY7A 43C9A 4ODHH 3ZKMC 3UPCA 2B5IC 1D6EA 2XZAH 5BVJB 2ZUVA 3G5XB 1R3HA 5F1NB 1C8PA 4JZOA 2GSGB 4Z7UF 2NXYD 1JHKH 3BZDA 4U1IB 2HAZA 2IMNA 3QG6A 4N8CH 1MI5E 3IU3B 1CZ8L 2EDEA 5EIIA 4JFFB 4ONFL 3LHPL 4U6XA 3WKML 4GLRH 4PJFF 4LP5A 3S4SB 4M7ZC 4HWZA 1BREA 3Q6GL 4CU7A 3VG9B 4QOKA 2E27H 1QFWI 5HGHA 1S5IH 4X9BA 5KVDL 1QSEE 4D9QE 4CMHB 1UZ6F 2EC9T 2H32B 4I77L 3GEWB 2X1OA 4A2LA 5DQDH 5HXMA 1FNGA 1I8LC 4AEHL 4PJGF 2NY5L 1B90A 1WK0A 4JDZB 3I50H 4I3RL 4LIQE 3MTRA 5L2KE 2NY4C 4G9DA 1QNZH 3FL7A 4MMZC 4U1HB 3RVVC 3KVQA 1U2CA 4ZFOB 3TBWB 2EYTB 5EH1A 2J5LC 3C5SB 4U6XB 4TNVF 4X8JB 2R1XB 4KKCC 4DQOL 1V7NH 3GNMH 1RUPL 2Z31B 3K8KA 3UTPD 3EOBB 4PJEA 2VLKB 2WWMC 1CE6A 8FABA 3NABL 1HYSC 4JPWL 2VLKE 5L6YH 1VESA 4R4FH 5C0JB 4ONGH 4G6JH 3PHOB 3OB0H 5T5NG 1T04A 5C0GB 4PRBB 4U0RC 5ESVA 1KLGA 4IIQA 2AEQH 1AI1L 5AZEL 1I4FB 4XCYB 4F7MA 3OZ9L 5FYJL 1KCLA 1IT9H 1BZ9A 4QT5B 4XRCA 3RA7H 3OB0K 2G75A 2GITA 3B3IB 3L7FA 1YEGH 2Z92B 3K1KC 3MCLL 4MNHB 1YEIL 1PLGH 3OR6A 1R3JB 1V3LA 4B7IA 2NW2B 5I1IL 3VGFA 4B53A 2R2HA 3QQ9C 5DI8A 3U6RA 3SE3C 5ENWA 1CFQA 4Y88A 4OLZH 5J1SC 1FNHA 1ZE3C 1MCOH 3O4LB 4MQ7B 4JM2D 4RISL 2OMNA 2R39A 3RWDA 3G08A 4PBVC 3UTTE 4LKCA 2JCCF 5EOCJ 1CLYH 4I0PB 2NX5B 1FC2D 1YMME 4PV9B 4EJ1C 4LLVA 4FP8L 4MA7H 3ZKNC 4OQTH 4Q7DA 1S78D 5F7DA 1FNSL 1KB5B 2XQYK 4HF5L 2QSTA 3KPSB 2O61A 5K9QI 3S34L 3MO1B 5EUOF 3Q6FB 4X5XA 3T2PA 4OV5B 5DSCB 2OJZH 2EYSB 5EO0B 2IMMA 5JHDA 3DV6A 3A6BL 4LGSB 1B0RA 4OZFH 3QZWB 3GMOA 1NKRA 3QO1A 3S35L 1G7MB 3QXDA 3EOTH 4I77H 3HZYA 2AJYH 3CCHA 4QOKD 1GOFA 4PV8B 3IFOA 3FT2A 4EUPH 4CN6A 1RZGA 1GGBL 3TC9A 4CW1A 1G9NC 2M26A 3ULUF 1QSFD 3ZE0F 4X80H 1G7QB 5SX4I 3NBNA 4Z95H 5SX5K 3K8LA 5DJYB 1HHKB 3H9SE 3STLB 2ICWI 5KSAA 4JQVA 5CJOH 3KYNA 3QDMA 1EHXA 5HVGB 3O4LD 3LS4H 2HJLB 2BSSB 3WDHA 5HHPB 1FZKB 3CZFA 1RJZA 4HJJL 1P4IH 2OR7A 5IW6A 1H3GA 1EPFA 3BEWB 5KSAD 1A7QL 3GMLA 4YAQB 2Q76B 3HZMA 5C1MB 1QBML 3T8XA 2X40A 2FR4A 2HLFC 1OAZH 4BKLA 1W2KT 2QADC 4DN3L 5GS0C 4BUHA 3HE6C 1ZHKB 1TETH 3P0GB 1KB9J 3KXFD 1P5VA 3CDYA 2HFGH 3PE9A 3RX7A 1MHCB 4Y7MA 4X6EA 1JGLL 4JR9H 3V7AG 3B43A 3BEVA 2H26B 2QR0A 1T89A 1A3RL 1T80A 2YC1A 4H1LG 5K9OA 2WBJA 5BVPL 2PXYC 2DOCA 5I73C 1UCBL 1GYAA 5CEYA 4MXWH 3SE8H 2FGWL 3DETD 1MFDL 4YIQB 5EFIB 3DURA 1SJHA 3IDUA 3RKPA 4WV1C 4FHBD 4KKCD 5E7BA 3SE9H 3ESUF 5HHMB 2DDQL 3MRQA 2NY2D 3VFWB 3MLWH 4PRID 3TF7C 1EJOH 5DLMH 3OSKA 5C0CB 4GS7B 4NUJB 3TIDA 2A77L 5IJVA 2B5IB 3CFDA 4PGEB 3C6LB 1DLHB 1H9VA 4YHKH 5TE6H 3BD4A 1JGEA 1KNOB 4XTRC 3ARED 4LLMB 5BO1L 5H35A 5EC1B 3SGKA 1LP9F 2NX5E 1Q8MA 3S37X 3VXQB 4ZUTA 3VG9C 4GLRI 1BQLL 1T20B 4G6KH 4RFOH 1ZANH 3KYKH 4XBGB 4BFGA 3VGEA 1OAXL 4TOYL 2YC1B 2XRAH 3OKNA 2PXYA 2X4SB 1TZIB 3T2OA 5MENE 5KSVB 1BFOB 3INUH 1RUAL 5DJZB 5A2FA 4JKWA 1NMCC 2EH8L 2NNAB 4M5ZL 3O6FC 5C0EB 2XN9E 4P9ML 3VFGL 1KCKA 4N5EC 3D9AL 5FYKE 3UYRH 3T0BA 4F7CB 2JJTA 5D96B 4X6DA 4HUVB 5ITBL 4PLJC 1DQJA 3IAPA 4R7NB 4NZDA 1QBMH 4KK8C 3TVMD 5CINL 3BP5A 3DX7A 4DTGH 4F15C 3RL1A 2W38A 4MYWB 4BZ1L 1GZPB 5IESL 5IVOA 4QLRA 4K7PL 4HWBA 5IB4B 5MEQB 1WWWX 5EOTA 4LLUA 3D2UB 4EBQL 1WIUA 1DQML 3WFDH 1NGPL 3L9RA 2YXFA 1ZLWK 1QFOA 4IM8A 4HIHB 3CFEA 4YBLC 2ITDA 4AIZB 1NFDE 4P5TB 5I0ZA 5KJRL 2E7LA 2HJKA 1LQSR 1UWEH 4WY7H 2GTWB 1A4JA 4MD5A 6CGTA 2XFXA 2OMBA 2A73B 3SKMB 5C0BE 2L4OA 3K0WA 4JFPB 1OP3H 2XWTB 5DD5L 3P11H 3V4VL 3GMOB 2ATKA 4QHMA 4HCRA 1TTFA 4WENB 1QLFB 3RVUD 1TQCC 5CGYC 3WUWB 3WNLA 1X9QA 4RISH 1ZTXH 2I9TB 1U8KA 2A74A 4I0PC 5A16B 3UMTA 3DUUA 2IQ9L 2OK0L 3QEQB 1QOKA 4B7LA 1MEXH 4XI5D 3REVA 4MD4B 3MRPA 3Q5TA 2NY3D 3MROB 4NQCD 4OQTL 1S3KH 4JN1L 4MCZA 1CFVL 1ZKAA 3EYFA 3O6LL 4I13B 4EQ3A 3GSVA 1I3RB 2CRZA 4H20L 2O5YH 1M05A 5C07D 3ARBC 1A14L 4G8EA 2XKNB 2MSPA 3CXDH 1DEEA 4P5MA 4PJBB 4BK4A 3R8BB 5I8KH 4R97C 4JRYB 1LWRA 4KROB 4PJGA 4KDTA 3TNNB 5LQBL 2YD9A 5FM4A 5HI5D 1DDHB 5FF6A 4PJIA 5ALCH 2NY2B 4M6NH 2C7UA 4GKNB 4WWKA 3QEHB 3QEGL 1S7UA 5E2VL 4M00A 2Q1EA 5C0CD 1RUAH 4FQLL 1H5BB 1A4JB 3D3VE 2QQKH 1QKZL 4NC2B 4JFHD 1YEEL 1CICC 3V6BR 4I5BA 3IF1B 4OB5L 1A7PH 4Q58C 1U8JA 5I0DA 5E2JA 3FB8A 4PJBE 5A2IH 4JFZH 5E5RB 3CK0H 3P9LA 3MGTA 4Q2ZB 1MRFH 4JDVB 4LF3B 1NGYA 4OFYA 3O9WA 1A7QH 2XTJB 5EC2A 3BH9B 1WQVT 5GGVH 3GO1L 4NN7B 4OFKA 2NY3B 4HUUB 1UWGL 4NQCB 4G42A 2IANE 4MXVE 1RUQH 4AG4H 4AEIL 2LFGA 2CK2A 1MFNA 2R4RL 4QHNB 3SDDB 2XNAA 4MNGB 1R5WB 4ZG1A 3MNZA 3OAYH 4JQXA 1A5FL 3BAEH 3G6AA 4PIRF 4PLOB 1OGAE 3T2NH 1RZIA 3FRPG 1G9NL 3DGCR 1BQSA 2X70A 2XWJB 4OI9A 2PXYB 5HDQH 5T3XH 1F6LL 4HWBH 3VXRE 1OAYL 2WANA 4JREC 2AW2A 2GT9B 4XMPH 1C5CH 5EU5A 1JZ5A 1EFXD 4P57B 5HVHC 3IDMA 5C0AA 5JXAH 3T09A 4F3FA 4JFED 1ORQA 4YWGH 2AJZB 3BP6B 1UACH 3KR3L 2AV7B 5HD8D 5I16A 4I8DA 3HAEA 2Y36H 4XX1G 5EC2B 2KQMA 3L5XH 1ZOXA 3NFPB 3IDNB 4H8WL 3MLRH 5IB2A 1ZHLA 1YY9C 5JXEA 4WU5B 4XP1L 2JJUA 4JDVA 3K1DA 2FJFA 4U05A 3QCVH 3JWDL 4YE4H 2WUBH 3NA9H 3P0YL 2ZG2A 4POZD 1KXVC 4P59H 5SV3A 4GBXB 1OPGL 4RRPG 1RMFL 3HC3L 3IXAA 2VKXA 2K7QA 3WO4B 4LCWD 5D6CA 2X4RA 3GIZH 4QCIA 3PV7A 1Q0XH 4AH2B 4YFEA 4G3YL 2X4TB 3MFGB 3IU4H 1KCUH 1NJ9B 3RVTC 1H8NA 2ADJA 2NTSP 4YX2H 1XF3A 4WHTB 2R69H 4P4KD 2CRIA 4HT1L 1MF2L 2IAND 5K9OB 2DQCH 3V4PH 3RVTD 4R8WH 2P42B 3IDYC 4GQ9H 4LGRB 4U49A 5BQ7A 2J3SA 3D1MC 3HC4H 4JY4B 4RWYH 5L0QC 4J1UA 1IGCL 1RZIB 1CS6A 5EZLB 2CJUH 4OJFL 4P5MB 4ZFOL 4G8GE 4X7DC 3LRSA 4XXDA 5EOQH 4PRNA 3HG1E 3VD7A 4EVNB 3JWOL 1G7HB 1KELH 1N4XL 4HKXB 1S9KC 4I2XB 2YMXH 1TNMA 1U8IA 2FEDD 5SWSE 5IHZB 2IAMA 5AWNL 1S78C 3EO9L 4I2XE 3BH8B 5HPMB 1FCGA 3LEVH 3RRQA 2DWEA 1BAFH 3VFSA 4JG0L 2LABA 3LKRA 1LEGA 4PRAB 2EC9U 2ZOLB 1T0PB 5C0IB 2VLJE 4PJAE 1U91A 2YD8A 4OZGF 4DOHB 4FQIH 2ILLA 1QFHA 1G9EA 4G8GB 3TZVC 4GSDH 3QUXA 4TN9A 1DBBL 1V8HA 3KPRE 5D5MA 2JELL 4MJ5B 3G9AB 5FCUH 5DRWA 1DBJH 3KPOA 4WFGD 4FTVB 4WW2B 1H5BA 5CJXA 2J2ZA 5F9DC 3BPLC 3VRIB 3ARDB 2DWDB 5HHOB 3MRCB 3MYJA 1TQCB 4HCRL 2Q6WA 3SCMD 1IAKA 1FVCB 3MUZ1 3VWJC 1A1NB 2DTMH 4CN1A 4R90L 3MJ8B 1K8IA 3HC0B 5J12C 2D4FA 4KKNA 5BZWA 4ZTOL 3QIUA 4X9IA 3ZSSA 3QCVL 4YZFF 5I9QB 3BESR 4K94C 3SKJH 1MCBA 1T66D 3HMXL 1TVBB 2QEJA 3UP1A 4MJ6B 5JHDD 3ZO0A 3TJHC 4F7CA 4D94A 3WFCH 1FP5A 1F8TH 4WFFE 1U95A 2ORBH 1MI5D 1J9CT 1PY4A 3QWQB 1EHAA 2X9WA 4NQXA 4NWUL 2VXSH 2QQLH 4HK3N 1RU9H 1A6UH 4R26L 1JNNL 1ZEAL 5F7MC 5SWSD 3ES6A 5M94B 1CWVA 4NQTA 1R3JA 3DJ9A 1Z0NA 2JF1A 4JFPA 4S0TD 3M17A 3CVHL 1NMCB 2GITB 1JHKL 4HJGB 4FTVD 3EYOA 3GI9H 4QGYA 1XR9A 1VGEH 2W60B 3DUUB 4MAUL 5GRXG 1YY8B 4PJ9A 2Q20A 3CFEB 2ICEA 4HC1A 4KXZI 4M1CD 2H8PB 3OGOE 2R9HD 1CIDA 4HEPG 1G0XA 1N6VA 2Y5TB 1M7DA 1P53A 3AC0A 1BOGA 3ALPA 3GHBH 5CAYB 2Y6SC 2G5RA 1IKFH 1EMTL 2JKXA 5DMKA 2NY3C 2VR5A 4OGYH 4YHZH 3CZJA 1CGTA 4UBDC 1RZ8A 4JO1L 4JRXB 5B8CC 4X7EC 1YMMB 4Y2OA 4YUEH 1HZHH 3RY6A 4TPRH 5E8OA 2VH5H 2NY0D 2WAHA 3MNVA 4JFXA 5B3JF 1QR1B 3H9HB 4M48H 5CBAB 4E42A 4M6AA 3QNXB 4TUJA 5E9DE 5T1MA 3B8SA 2C1OB 4RZCA 4PJ9D 4DZBB 4ZMAT 1CXEA 4KVCH 3BUYA 2DMBA 4PJDE 4WU7A 3G5ZB 2F8XC 4WUUA 4JDZA 3WUZA 4ZUWB 1KCRL 3NH7L 5DQJA 1W8OA 4N0FA 1DN2A 3CVHA 5F71A 4NHCH 4QOKB 2Z91B 4WJ5B 5HVHB 1X5XA 5LGJB 3DOSA 4OLYL 2C26A 1WZLA 2A6DB 4GRWE 4XBGA 1Z5LB 4HKXA 1FLRH 1FLTX 2ITCA 5IHLB 1UVQB 3ARSA 4M6OH 1OTUD 3GI8H 5ISZD 3EO1A 3P4LA 3BWUC 3ARUA 4MS8C 1MJ8L 4W4OC 1QRNA 4P3DA 2ZNWA 2EIBA 1CXFA 4UINL 1N6UA 3S35X 1X4ZA 4J1UB 5TQ2L 5IFHH 1A3QA 3QDJD 5BQ7B 4LRIC 2R2BB 4BM7A 5GZOC 1QRND 4NO0B 4DGIL 1Q9OB 2EDOA 2V5YA 3PQYD 1C08A 4PD4K 4U1JB 1LO5A 2W0KA 5IR1B 1R24A 1G7JA 1A6UL 1TJIL 2YBRA 1IEAA 2AP2A 3CFJB 4LASL 4U7KA 3U30B 3WSQH 4O4YL 4BQ8A 4K8RC 1QSVA 3DROB 4QRPD 1CG9A 2QQQA 2BZDA 5I1HH 3L3OA 2VITB 4M7ZB 2F74B 1KOAA 5IOPA 5J57B 3B2VH 4YIQA 5EFIA 5FDWA 5CEZD 1X44A 4Y5YC 5BMFH 1RZFH 2WUCH 3BIAX 2DBJA 2WV3A 2FBJL 4QRPA 4XPHL 3OBAA 4PGEA 3LKNB 4IMLA 5FV1L 2A0LD 3ARQA 3ULVD 1ZHLB 3S8WA 4LSUL 2NLJB 2W9DH 2EDWA 3KPNB 1VFBB 4I0KA 3QUMA 4N1HB 4C4KT 1MIML 4PJDF 1B4RA 3KDMB 2LVCA 3GGWA 3N0PB 4J3XA 5FGCB 3BP6A 3L5WB 4I48B 4DOHE 3A67H 5GS0L 2J5LB 2XTJC 2P45B 5HYSA 1YNKH 3PABB 3PXJA 4GKOA 3UCRA 4JO1H 4P57A 3OKEA 4S1QH 4M62L 5IG7B 2WBJB 5LGHH 3LDBB 2L0DA 3C6LD 1FRGL 2YPLE 5ADPH 4WFHD 2CXGA 1T7VA 4OCXL 3U7YL 3NMEA 4FQIL 2DQHL 1F4XL 1BX2B 3T65B 2PYED 1T2QL 3WKNA 4K94L 3SDAD 4JREB 12E8L 4V1DA 3LKSA 4KTEL 1VDGA 2E7LC 2CPCA 1EX0A 3STLA 4PRHA 3BPLB 3H8NA 1T3FA 5DUMH 4JCMA 1MIEL 4LCYB 3PNWA 3WXWH 3VG0L 5I8EB 5I71B 1O5DT 1EUTA 1OAKH 3RTQA 1FLRL 1QLEH 3OKMA 1RZGB 5IEKB 2DI7A 1E4XL 3LV3B 2JK5B 1MJ8H 2R0LL 3QXDB 4RMQA 2Q86A 4R2GB 3TM6A 5T1KD 3DIFA 3GKZA 5CBEA 4WFED 1YC7A 5EO0A 3RVUC 1TPXB 4EKXA 3P2TA 1HWGB 4WTWA 5T5FL 4UIMB 5KS9F 4G80A 3UEZA 2RAMA 4AZ8A 4N1EA 2VQUA 2BVYA 2Z31A 1G7QA 4S1SH 4ZFFA 3VXOB 3WS3B 2P49B 2Q8BH 5SWZE 1J05A 3IFOB 4HG4J 3WO4C 1SY6A 4YHML 5GRZA 2D31B 4PJFA 3AS3A 5HGDA 4LVNC 5KW9H 4NKOA 5DC9B 5DVOA 2FIRT 1X4YA 5EU3B 1JMZA 1U8QB 2C1PA 2UV3A 5EZIH 1HKLH 4I9WD 3PHSA 4QYOB 5JW5B 3RL2B 3L1OH 3U0TB 4RMSA 2Z93B 2OTUB 2UWEB 5FGSA 1I3GL 3MZGB 2IFFL 4YR6B 3QCTH 4HZLB 4GUPB 4NBXB 1YNLL 3IGAB 1G0YR 5DHVH 1CDBA 3EDFA 4JGUA 3P4OB 5IB5B 2EXYD 3DO3A 2HTLC 3MRPB 4HLJA 5DMGD 5D7SL 4XRCB 1ZAGA 4IOFD 5FKAB 3FQNB 1A8JH 4K8RD 3W11C 7FABH 4U6YA 3SCMC 3LH2L 1A21A 4HJJH 5F1NA 5D9SB 4NCC1 1QLFA 4GXUN 2VLMD 5DI8B 3NIDF 4ODSL 2E3VA 1ZA3B 2WP3T 3GJFH 4G6FD 3CSBA 3KPRB 4MA7L 4XVUD 3BPNC 4ODXB 2FDBP 1P7QB 1FH5H 1RK0A 1JZ6A 4Z7VB 1XGPB 5IMMB 2BHZA 1I7TA 3ET9F 4ETYA 4JO4H 4WI8A 3INUL 3U0PA 2XWBB 3HPLB 2P5WA 1L9MA 3GMPA 4Y19E 4OZHA 2BOBB 1IAOA 3L3HB 3MLPA 4OCMC 1N64L 4JY6A 4D2NA 5IT2L 4ENEC 4MS8D 4OF3A 2DQDH 1CF8H 2DBLL 4NN5B 5DT1L 3P4OA 3FZUD 2ESVE 3QBTB 4URTB 5HHOE 3O8XC 1DBMH 4KH2A 3UTZA 4J6RL 1LO0L 1NEZA 2FX8L 5I6XB 4ZQKB 1CLOL 1S9VA 5T3ZL 5TPWH 4S10A 3REWB 1WICA 2FRGP 5BS0B 3MXWH 3ZHLA 2A6KB 5E5UB 4AEEA 2I26N 5IB4A 1QYGL 4HGKC 2BNRA 3VWJB 1YEIH 4LU5L 3EOBA 1I1AC 1X5GA 5DS8B 3PG2A 1N2RA 1U8QA 2YOCA 3CFCH 1GPOH 2WQ8A 2K7PA 4HC1H 3RGHA 1AXIB 2M2DA 5I8KL 2M8XA 1QFWH 1S5HA 4LHUA 2JJWA 3RNQB 5MP6L 1I1RA 4LPXA 2NNAA 1CU4H 9CGTA 2VZSA 4GW4A 3S96A 3ROOB 2ID5A 3GM0A 3T3ME 4DCQB 2GJ6E 1XCTA 2VDLL 3GK8H 4F7TB 2VDRL 5HGHB 3MNWB 1T66C 1MWAL 3VXMA 3LRHA 1KENH 1KIQB 4TQEL 1JIBA 3OTTA 1FO0B 2GJ6D 3FT3B 2HN7A 1U8LB 2CDGA 2FECI 3UZQA 3L3HA 4Z78B 4K3DH 3TWCH 5FO7B 2EIDA 1W72H 2DMKA 3BW9A 3GMMA 1EGJH 5HI4D 5AUMA 1RK0B 1JWUA 4Y5XA 2F58H 1RZ7H 4E9LA 1RK1B 3KWWA 2NYYC 3IDXH 3DO7A 2Y7QB 4NPYA 4TPRL 4YDIL 4Y16B 4G6JL 3O3AB 3IJSB 4JFDD 5DEGA 2SEBA 4PRIB 2HMID 1B6UA 4JFYA 5F7NC 4W4OA 3MA7A 1IBGH 5I1AB 2D3VA 1J0IA 4K23L 3PV6B 4OD2A 3SJVD 4QOKE 5DLML 3O41B 4LLAA 5D96C 5JHLL 2D4DA 1ZGLM 1AGEA 5DJCB 3DURB 1B4JL 2GK2A 4Z6AT 4HWBL 4LLDB 1DBAL 2BRRH 1RY7B 2ADIA 2OX5A 3RDTD 5LWYL 1KT2A 2UWEA 5CJBA 1TTGA 5JMRA 4XP6L 4TTDD 4EXKA 4B5EA 3U0TA 5DD6A 2Y06L 3UAJC 5C70A 4PBXA 2C3VB 2I60L 3A0OA 3RUGA 3TYGL 1QRKA 1A7NL 2B1AL 5C92A 3HI5L 2H41A 3OG4B 4KJWC 3QAZC 4ZAKA 1C5DB 4KZDL 2PW2B 2F74A 3I6LD 4O5LH 3R06B 3FTGB 2F54E 4ZNEE 1OHQA 2VDMH 1IAMA 5IW1B 3PV6A 4IIQC 1MCKA 2OL3L 4OFDA 4OM0H 4U3HA 1OSZA 5ETUB 4PTTB 2Z9TA 1QR4A 3V4UL 1YEJH 1QZ1A 1U6AL 3AS1A 5E94B 4KDTC 4O4YH 5E6ZA 5KS9E 4JQIL 1GRWA 1UG9A 5LBSL 4Z5RA 2CO6B 2DM3A 5KSBE 3CNKA 1AFVL 5JPMA 4JDTL 4D9RE 2BNQD 1BHGA 1LP9A 3B4NA 3RHWF 3NZ8A 1S9XB 4UNVA 4WHDA 1RZFL 1JWUB 4OLVL 4NBZB 3W5MA 5D93C 4O2FA 4YFLF 5FOBA 3R06A 4CW1B 4HDIA 1TCRA 1LMKA 3U30C 4IRJA 1AD0A 1BEYL 1QUNA 1UVQA 2E5EA 3S88H 3H9SB 2AJXL 2V7HA 4GAYB 3VXUB 3WHXB 3FFCB 1IQDB 3HNTL 2P47B 1NCTA 4OT1H 4OLUH 4PY7A 5DTFA 3Q6GH 5KSUA 5JZ7C 5CCKL 4R97B 3NVQA 2DI9A 4K7FA 3GHEH 3L1OL 3H3PH 1HE7A 1WFUA 4N8PA 3OZ9H 4QRUA 5FYJH 4IDJH 4XPBH 5EG6C 1VKXB 4JAMB 2FD6H 2DKSA 2OL3A 4HGWB 1OAXH 1GGUA 5F7DB 4N8VB 1K8DA 3FO1B 3BI9X 2IAMC 4HIEB 4LLVB 3C2AH 4NKDB 5I30H 3MRGA 2AS5M 3ARDD 5IJKA 3MCG1 3BXNA 1CI5A 3IVKA 1JZ3A 1XGRA 3SCMB 1ZWIB 1FZOA 3B2UD 4LQFH 1MHHA 3MOAL 3N9GH 4NO2B 5IQ9B 2WBJC 5E1AA 1AIFA 2X1PA 4HWEL 4X99A 1T89C 1UYWH 2BSTA 1DVFA 4PJXB 2ZWLT 1CGSL 4TSBL 4FFYH 5FM5O 5IV2B 4U6VL 1B0GA 5GRVL 2C3XA 1OCWL 4RA0C 1CG9B 3ZL4H 3GSNB 5A2KH 4QRRE 1BM3L 4PRPD 4L4TA 3KYMA 1XAUA 1IC7L 2O5ZH 3UAJD 1NGPH 5I6XC 3MLTB 1HDMB 1CFNB 2GIYA 4KZDH 1RZJH 1G84A 5DWUL 5JW4M 4ZUUB 1K5NA 3EBAA 1C08B 4U1JA 4M61A 1C5BH 1INEL 1XF1A 5LGHL 2GYSA 1OLLA 4KK8D 3VDAA 2GUOB 4P2QE 2BSTB 5CIPB 3NOIA 4FFWD 3IFLH 4H26B 2CDEB 1JNLH 4P46C 4RGNE 2NR6C 8FABB 3U1SL 4WDIA 3GBLA 1O7VA 5KSBB 1U92B 1C7SA 3PGDA 4K71B 3SKOB 4GG6A 3V52H 1NCCH 3C6SA 1FFNB 4FP8H 5FA4A 1F13A 5I1LB 1KJVB 5J3HC 1U36A 2BNQA 4E5XA 4UU9B 2OTPA 4GW5B 4LCIL 3LAFA 4ZAKC 5FB8A 1ZGLP 3SQOL 3F6IA 4WHYH 2IQAA 3CXHK 1G6RA 4TVPD 3VFPB 5CILH 1I7RA 1MWAA 4U2ZA 2J6EH 1I7UA 5CWSB 3WIHL 1E6OH 4JM4L 1HKFA 1EBAA 4WUUB 2DM7A 2OLDA 3I85A 4JANA 1UWGH 4AEHH 3REWA 1SBSH 1JBJA 3MRDB 5TE4L 3ZYZA 4CMMA 1RIUL 4E42B 3KNBA 3BIKA 4M43H 3WEXB 3LQZA 5FM8A 1NLDH 3O4LE 1AR1C 2DKUA 3VRIA 4HK0A 3TVMA 4JB9L 2YK1H 3KJ6H 3TA3D 5LAXB 1EGJL 4WV1A 5KVFH 3VXOA 3CSYA 4N90E 1WWCA 1FL3A 2VL5B 1KLUB 2J1KA 4OD1H 3WYRA 3IRZA 2ARJB 3OKKA 1FSKB 2H2PD 2ZUSA 1TJHL 2MCPL 1A3RH 1VENA 4XAWH 1XH3B 1RUKL 4OZ4A 3PQYE 4KZEH 3SO3B 4XB8A 4QXUL 4LFHG 2VXSL 4NQSA 4KRNA 3HA0A 3LV3A 5C0BD 4JHAH 1H3PL 3QISA 3OX8B 3DUSA 1N4XH 4NDMA 4GRWB 3RTQB 4WNQB 5L2KB 3P3YA 1IGIL 4BQ9A 2YZ8A 1G6RL 3CFKB 4KQ4H 1X4XA 1KEMH 1M71B 1BZ7B 3UBXB 1ZLUH 4Y8AA 3D0LB 5T33L 2Y72A 3TIEB 1ZVSB 4L3EA 3ES6B 4OF6A 1A0QH 1P7KB 4OLYH 4ISVA 2Y5EA 5C71A 4V1DD 4R6UA 3O2VH 2Z93A 4I0PD 4PRHD 3TT3L 1T0MA 4EI6B 1MCOL 5L7XH 1MHHB 4NO2A 5SWQB 4D3CL 1XEDA 5F9JB 4LSPH 2V5SA 4U6TA 5D1ZD 3TPUB 4NNXB 5ACZB 4HLZG 2FSEA 3SGEI 2HP4A 5INDA 1XF3B 4L8SB 3EFFA 2KZWA 2N56A 4WFEE 5D2LE 4N8VA 1JPFA 3TNMA 5B8CA 1MJ7H 1DZBA 4YUEL 2X1WL 5T1KA 2OI9C 4WI2A 3VXMD 3W11D 5DZOA 1TVDA 2XQBL 4PRIA 5DMGC 1NFDA 5ID1A 5C0FA 1OTUC 3LEXB 2Z31D 3O3AA 3VXNB 3HZVB 1PZ5B 2EDBA 4Z7OF 2MCG1 4P46A 3RZWA 2HT4C 5F3BB 4BH8A 3KWWB 4J3SA 4GAGL 1CL7L 3MRHA 1GHFL 3IB4A 5TE4H 3I6GA 1R0AL 3EJZC 1F11A 5DRWB 1C1EL 1IEBA 1FIEA 4F3FB 3QFJD 2NTFA 5A40E 5DJDA 4P2YA 5L8LB 3MJ7A 5D7KD 5MEOB 5CKGA 3CSGA 5C9JB 2ZOLA 4ZPTA 4X5WA 5ISZB 3WJJA 1HQRA 3H3KA 3QULB 2YRZA 4FXGB 3FOLA 1DBAH 2BRRL 5TF1L 3X11B 2CO7B 2GY5A 3MV9E 2LE9A 5D70L 3ROOA 3MNZB 1A6WL 3RX8A 3I3BA 2DB8A 3BOVA 3K4DA 1GAFL 3QDHA 4S1DC 1QTYT 3BN9C 1C5DA 2PR4H 4DW2H 4AENA 2HKFL 3D85D 1UB6A 5EO1B 5F7YC 3EGSA 1RHHB 4D0DB 3KPSE 4PYHA 3V9FA 5CINH 4DTGL 1KBGH 3QQ3A 4JJ5A 4WJ5A 1KEGL 1NDMA 2ERJC 4NT6B 1OB1A 4ZS7L 3VGDA 1AC6A 1WTGT 1IGTB 3AB0C 2LAGB 3VWJA 3U4EB 4LPWA 1AO7E 3KPSD 1J8HE 3GJFB 3D3VA 5B38B 4XMKL 3HE7C 1JF1B 1C12B 3CIQA 3DHMA 4DEPB 2CLVB 3D69B 4NZTL 3RBGA 2W9EH 4HXAL 3OKDB 5CZKA 1J8HD 1S7XA 3DROA 4Y4KA 3DYPA 4G5ZH 1T22A 4DKFH 1ED3A 4U6HB 4JFYB 4B50A 5C0BB 3X14B 4X9GA 2H1PH 4IRSA 3RAJL 3WJJC 5CIPH 3UTSB 4Z0XB 1N59B 5E0QA 2WQRA 5GZNC 1MJUL 1E6JL 1NUFA 4ORGB 1FYTD 5AUMB 2BCKB 2R1YB 2IQ9H 2OK0H 4KFZC 5IMOA 2UZXB 4OZGA 5JPNA 2GSIA 4MA8L 3GIZL 2YEZB 3FFDB 4KUCD 4H1LH 1J1PH 4IOIA 3D85B 2BVEA 1I1AD 3VMPA 1P5UA 2QADD 1GHFH 1JNHA 1NCBL 3MLUL 4XNMB 4NO5B 5F93C 4YBHA 4FQQA 1CGUA 2VXUH 3SDAB 4O2CB 4QO1A 3ZKXB 3LQAH 5AYUH 5EZOH 5JORB 5I30L 5BV7H 1WZ1L 2VAJA 5HD8C 2AEIT 5GXBB 3GB7A 4UNUA 2YD4A 25C8H 1RV6X 3FCTB 3DRQA 1MCRA 1MFEH 3W9DA 3BHBA 4TUJB 3MUGA 3EHBD 3VE0B 1T1WA 1Y0LA 5DHYA 2YK1L 2PUQT 2X6MA 3SKMA 4G42B 1CK0H 2YKLL 4XZUB 1E4WH 1IGYB 3FN0H 5J1TC 1KPRB 2GTWA 3D2UD 4PGDA 1ZLVH 2APWA 3EYVB 2P8LA 4KPHL 1L6XA 3B9VA 3EYSH 4HG4K 4L8DB 2D9QB 4U1GB 4HS8H 4X7FC 2VUYA 3DIFB 5CBEB 5J13B 4ZQKA 1MQKH 2XQYG 4XNZB 4YHIA 4APQD 3NAAL 3DX9B 3SE3A 1LILA 4ODVH 4PPTA 5CGYD 3HPJB 5HHNA 4J7RA 1WAAA 1T1ZB 3F8UB 2R0KH 1WIPA 1U2HA 1JNLL 1IGYA 3E3QE 3N85H 5EIQA 3MLRL 4H8WH 5IFHL 3K7UA 4Y5VB 1UJTA 1D5ZA 3IJYB 3QWOB 1QFUH 3EDKA 2BVQB 4Y19D 3PWVB 1Q9KA 2P8MA 2DQHH 1EZVX 3MZTA 2MKWA 4P9HC 1TJIH 1NC4D 4XBPA 3M1BA 1KIRB 5I1DA 2AXFB 1ACYH 4HWEH 5JW4N 4XMPL 5E99H 2WBWB 3JTSB 2DQJL 3WJLA 2ZCKL 4I2XA 4H0HB 4GW1B 1BBJA 4WVRA 5IG7A 4OZIE 4TVSa 4YHLH 3BP4A 1FYTA 1JGDA 3QIUD 5B21A 1TVBA 5C08E 1OP5K 3TVMC 2X41A 5T3XD 3VXQA 5TGBA 3GBMH 4Q74A 3RP1A 4DKEH 1AJ7L 2VLKD 3QH3A 3BO8A 3QUZC 4GG8B 3I6KA 4MQTB 4P48A 2NQCA 5EU7C 2YWYA 5DEZA 3G9VA 1I1AA 1HOCB 1LK3L 5JXEC 1P84K 5E70A 3TV3L 5A1AA 1X5IA 2Q8BL 1QD0A 3L5IA 25C8L 2YUVA 1UA6L 4CVUA 2DKMA 4YDIH 1XGYH 3B9KB 1PD6A 3NCMA 1S7XB 3X3GL 4NNYB 4MJ5A 4J12A 3V52L 1QO3B 4LSTH 1RHFA 3ZZ1A 3GSXA 1HEZB 2R69L 1XGTB 3P4MA 1FSKC 2NY4D 4TUKH 5FA3B 1UC6A 1CU4L 1VGKB 2Q86B 3SY0A 1S7QA 5DQ9B 1NC4B 1LEGB 1WTLA 2FHCA 3OJDA 1K4CB 4HXBL 4OCRH 3VXSE 2ZPKL 4P2OB 4RFEB 1LO4H 5HPMA 4RDQF 1PJ9A 2MPAH 4YO0A 2EDRA 1I8KB 3NCEB 1FPTH 2VXTL 3Q5OA 4PYGA 4PLKC 3VI3F 4KAQL 1A2YA 1F58H 3WJLC 3MV8E 1J0HA 5CJQH 1HIML 4DAGL 2D7NA 2VLRE 2ERJB 5ICXA 1CDHA 5D7LA 3UTTD 3SJVE 5ITFB 1I8MB 3IFNH 3P4NA 5J1AB 3HE7B 1HQRB 4UBDD 2FGZA 5EU6E 5I19H 4QY8A 4R96A 5CUSL 3O8XA 3ILPB 5DJ8B 2MHAB 3BVNA 5FA3A 4Y5XC 1D5XA 4MAYB 5ADPL 1HEZA 3L5HA 3RY6C 5HI5C 1JZ7A 1LDSA 4G9FD 3LS5H 1QO3A 2CK0H 3ARGD 4AM0B 1S9WB 3OAUH 5GS3A 1I8KA 4QCIB 1IGIH 5TDPA 3VH8G 1Z6JT 1X7QB 3OR7B 1PGRB 2ZCHL 4LLMA 1NGYB 5DMKB 3QIUC 3V5KA 1CR9L 1JGEB 1VGKA 2OYPA 1OD7A 3B5HA 2JCCA 1PKQA 1URLA 5JQ6L 5D2LB 5DSCA 4EUPG 3WLBA 4NNYA 5E9DA 3S7GA 4ELKA 3A6BH 2CUHA 1ZSDB 4MWFB 1GVIA 4G8IB 4LGPB 4PJDA 4QTHA 3CFJA 1R3LA 2AXJA 3I3DA 4Z0BH 5C3TA 1G7IB 1UA6H 5EDXA 2IWGA 2JB6A 5HJ3A 1MAMH 4QY8B 4U31A 4GT7A 3VU2A 3BEVB 1F3JA 3RKDD 5EZJA 1KIRA 2DQFA 5I8CA 2V17L 3H42H 5L8JB 4Q9RL 4FG6D 2NY2C 2XA8L 5I8OL 2V2TB 1MFEL 1TZGH 5GRYA 4NFDA 1V3JA 4K3HA 4NQEE 2F5AL 3C09B 4H25A 5E8EB 1JGDB 2PXYD 3BZFB 4X6CE 1MRCH 4LK4A 1HKLL 1I9IH 5JUEH 5ICYA 1SVCP 32C2A 1J5OH 3RWGB 5GJSH 2WNGA 3OKLA 4WI7A 2QKIB 1EFXB 1X5FA 2Y6SD 3CFKA 3P9WB 2QQNL 2AI0L 4CDGC 1CFBA 4P5KB 4ZO9A 2AK4B 4YHNA 5F7HA 1RUML 5M95B 4FRWA 4HXAH 4ALAL 1F5WA 5LCVL 1SYSA 3LRGA 4WEMB 3P77A 4GRMB 4W68A 2ZUTA 4XC3H 4XCCH 5DF0A 4PGBB 4PRBA 3BUYB 4KQ3H 1P7HL 2CDFB 4ZSOA 2YPKA 3TT1L 3OXSA 1XGTA 3P4MB 4UDTA 4QHMB 4KDWA 2HMIC 3CLEL 1S7RB 4GXUM 2CMRH 4PS4L 4W81A 2GKIA 2ADGB 5L6YL 2HG5A 3B9KA 4NKMA 4O9HH 2Z8RA 3CSYB 5KSAC 5L88H 4Y8DC 3KXFE 1YECL 4CU6A 3N85L 4QRPE 3FB5B 3FT2B 1NANH 1VFUA 1AXSA 3OG6B 1T1WB 2XZQL 1I1FA 3U48A 2X4OB 5GS2H 4GKNA 3F7QA 2RB8A 3JV4A 4FXKA 1XIWD 5SWZD 1LNUA 5K59F 1BVLA 2APTA 3ULVH 1UKSA 1FQ9C 4YHPA 3G04B 5F3HA 2ZCHH 3WFEL 1MCJA 1MOEA 3GRWH 1ADQL 1RZKL 5D4QA 5JDJA 1DEEB 4M7KL 2W60A 4LRIA 1JTPA 4CBPA 5I1IH 3NA9L 2WUBL 3CDFA 3F5WA 1T6WA 5CP7A 5KVGH 4XMKH 3TA3B 2X44D 3WDJA 3OKLB 2F58L 3QEUB 3KJ4C 3DMMB 4P2RE 2DLTA 1DQLH 1NGQH 4NIKB 4NRZA 4FABH 1L0XA 1U58A 1BGXL 3TCLA 3UTSE 1ZT4B 2R4SL 2CIKA 1DJSA 3I02A 4LHQB 3WBDA 4Z77B 5MHSE 1KIUA 1KIPB 3TBTA 3QUMH 5H8DA 2X4SA 1ZEAH 4L1HA 5EU6B 3QWOA 2FZ3B 4KRLB 4MMXC 3EUUA 4Z7VE 3ARBA 1EHNA 5LVEA 3D39D 3DX6B 1G9MC 3EZJB 1KJ2L 4PGCB 3MLTA 4KHTL 1MUJB 1YY9D 4FMKA 1YEHH 5JOPE 5DJAB 1ZHBA 2GSIB 2D9CA 3MLZL 3EO0B 4Y4KB 3RPKA 3IDIA 3IS1X 3LHPH 3VXUE 4UT9L 1AI1H 3GUTA 5HYJE 3B2VL 2FYYB 5IV2A 4ZD3L 3D69A 5SWZB 3MJ8A 2FH8A 5C0JA 1BQHG 4WGVB 4S1DD 4CVZA 5HHOD 4WU5A 1L4IA 1WAAF 4S1RL 5SV4A 5C0CA 4XP5L 3KLAB 4XCCL 1OF2B 2FIKA 1UM4L 1Q1JH 3KPOB 4JHZA 1L7TL 4C55A 3HE6A 5GIRA 1JWSA 2OR9H 2R15A 4L8CA 5EULV 2BY2A 3UJTL 2LU4A 2W92A 1KN2L 4UT7L 5F1KC 5C0AB 1T83A 3S37H 5CEYB 5AG9A 1Q9WA 3AFLA 4KVCL 1GH7A 1NFIB 3FFCE 5FUCC 4Y4FC 3BPCB 3WIIH 4OFYD 1GGTA 4FXGA 2D0HA 5JORA 3EYUL 4PJ5B 5EWIL 4GAFB 5D5MF 1AJ7H 2FCBA 1IZKA 5C9JA 1IM3B 1RJLB 4D0BB 2V7HB 4YXHL 1JE6A 3D3VD 3WHXA 5DJDB 4HV8B 5DZLA 2VO5A 2P24B 4CVXB 3EAKA 2EO1A 4Y4KD 2YEZA 3QDJB 3QG7L 1JWSB 3VFOA 2IPTL 1JUFB 3BEWA 2XXMB 4C58B 2P44B 3RTQD 5IFAL 3N1FC 1LD9A 5L2KD 4RGMB 4ZXBB 3SE9L 4O02L 3QDMB 3PWUB 2UUDK 1KENL 3KYNB 3C60C 3L95A 4KK6C 3DNKA 3GSNH 3QUML 1CBVH 2EDKA 3F7VA 3RWEB 4LARH 3MRLB 3P73B 4V2BA 4AH2A 3BZEB 5FUOH 2VDQL 4LSDA 1XF4A 1XIWB 1AFVH 1T5XB 5T3ZD 5DC4B 3B9KC 4JFOA 3WIHA 3RFZC 3H7LA 3GI9L 4ODSH 4LCWA 2MMXA 2KBGA 3U4EA 15C8L 2FBJH 2PO6D 4LDEB 1A6ZA 5FECB 5ACMA 1I85C 4M43L 35C8H 1CDGA 4J3WA 1F3DJ 4WTZG 3OJ2C 2ENSA 4M7JL 1FO0L 5E8PA 2B2XL 4Z8FH 1KFAH 2YD5A 3IFPB 2QJDA 2BOCB 3U2SB 4FQ1H 5DWUH 3HS0A 2VC2L 1OTSD 5AZ2L 2DD8L 2V2XB 4N9OB 1RZJC 3VXME 5DVMA 4S1QL 5EU5B 3CUPB 4WIQA 3OKOA 2F5BH 1T0MB 3B2UC 3W0WE 3H9YA 4S11A 3KYOB 1K3ZA 1JYWA 1U8NB 2DQIL 4MNGA 4KHXH 5EPMB 5HYIA 5E8DH 4GAJH 4ZTPL 4KGJA 3LY6A 5FUZL 3DBXA 2EZ0C 1IEBB 2N7AA 4Y5XB 2Z92A 3WN5B 5C3LD 1NSNL 3S36H 3ZDYF 3QDGB 5DUML 5GHWL 3F62A 5LAXA 2FH6A 1T2JA 4KRMB 1MJUH 4O51B 4X6DF 4HHAA 1CQYA 2IANB 1U3JA 2EYRB 3QO0B 4TULH 5DDHA 2WM0A 1NMAH 4EDWL 5GS0D 3DV6B 1G7PA 4L8DA 3ARTA 1Y6NR 3UO1H 1J12A 4EEEA 5J6GB 3EOAA 2HT3D 2VLKA 3JV6B 2CLRB 1KLUA 4M5YL 2NR6D 4YQXL 4K9EL 1MFAL 1R5VB 1I9EA 2UWEE 5GZOD 4S1SL 5DR5L 2QL1A 5EU4A 2OR8A 1YNTB 2MQ0A 5JW3H 1P2CB 3LQZB 3GKWL 3MUGB 4MHHG 6FABL 3VFTB 4NRYA 2CK0L 3RGVD 3AMLA 3LN4A 5FK9B 2UYLB 1A1OA 5I1JH 3HG1D 1FNGB 3T0XA 2WLZA 4APQB 1J5OL 5KSVA 2EICA 3GHEL 2FJHB 3MCKB 5FHBH 2EDJA 4Y1AE 5EB9A 1CFVH 1SEBA 3T4AA 3KPPA 3RX5A 4EZMA 4KDVA 2CUMA 4XCNB 1UZ8B 4IRJC 4QGTA 1HNGA 2VLRD 2D7OA 2EDXA 4Y4KC 1BZ7A 3UBXA 5I1EH 3C09C 4JY6B 1QEWB 4PJIF 5DYOB 4MA1B 3RVXC 2XWBA 3U0PB 5KSBA 4CAGA 3TFKC 1BP3B 1A64A 1P7QA 2CMRL 4PS4H 3WFBH 3KPRD 1MFCH 3RDTC 3MV8D 5A3ID 3ZLQC 4P4KC 2VN4A 4JKPH 4M61B 1DLFH 3DXAB 2NZ9C 2VWEE 2P8PB 4F9LC 1QFUL 1ED3B 4U6HA 4N5ED 2X4NB 5HYSG 2B4CH 2BFVH 2VDML 4UOJA 5CEXA 2MNUA 3QUYB 5IMKA 4OF0A 3GSNA 1ZVHA 4HK0B 4AIZA 3MUHL 3UJIL 1BVKB 1U6AH 4U1KB 4Z7NE 3O2DA 3HNVL 4Z7QE 1T4KA 4GKZA 3E6HA 1SEBB 3MJ6A 4WTXA 5CKAA 4JFQA 2FJHA 3RL2A 1YUHA 4GJTB 2EE3A 1CYGA 4APQA 1UQSA 2HVJB 1GOGA 3VFPA 5BXFB 4G9FA 1HQ4A 3S3JA 1R0AH 2QBWA 2A9MH 1CE1H 4GW5A 4ENED 1WWAX 1NL0L 4PJ8B 4DVBA 3MQIA 2OJEB 5EO1A 3NAAH 4Y1AB 1MNUH 3HRZA 5E24E 5C0EA 3CMOL 3HUJE 1MCCA 1IC4L 4L8BA 5ADOL 4HDIB 3S9DB 4XTRD 5AEAA 5CSGA 5FOBB 5E2WL 4NCDA 3GMLB 1BFOA 3FO2A 4JPIB 2GFBB 1M1SA 2OXHA 4P2OA 4MHHI 1MCLA 4K7FB 3G5XA 3MV8B 4LCUB 4X5WB 5ISZA 5D1XA 4FTVE 2VZUA 1R5IA 1NC4A 1QKZH 3DX8A 5KANG 1M7IB 3TBSA 1HHGA 3BYYA 1ZT1A 3HR6A 2D03L 3VWKC 3FT4B 5IKCA 3CU1A 4NWTH 5E4EB 2VJXA 4NKIH 4O51A 4JRXD 4DN4L 5B38G 1VACB 1FYHB 4P4RA 3CK0L 2BMKB 3BGMA 4L4TB 4BFEA 1U42A 5HVFB 2RJMA 4IRJD 3LKSB 3UZVB 1CXIA 1HXMA 4XAKD 2R1WB 4GH7B 1A6VL 4QKXB 4L3CB 3FB7B 4H20H 1VCAA 3LVEA 5ICZB 1HXYA 4Q97A 3IKKA 2DLFH 1HILA 3GSUA 5IF0A 5JMOC 5E7FA 5IVZA 2C3VA 4N90D 2VDNH 4I4WB 3GMQB 5DFVD 1CXLA 5E2TL 1LK3H 2AJUH 4J4PC 4OZIF 2FLBT 1DUYA 2OTWB 3NABH 1B4JH 3EJYD 5INDB 5GGSB 4MDJB 3U46B 2NX5A 1GZQA 3BD5A 2UVFA 4NNXA 1S7SA 2C3HA 2J8UA 2DLHA 2VISB 1OT1A 1R3IH 4OV6F 4KI5E 1IEHA 3FOMA 1A6ZB 5FECA 3O4LA 4L3ED 1HILB 5IF0B 2VIRB 1CZ8H 5CP3H 4CADA 3U9PH 2PN5A 4G6MH 4P9HH 3D0VA 1XR8B 2UVEA 4YXLH 5C2BH 4R4BA 1T5XA 3O3DA 1P4LB 4S1RH 4ONHB 5ALBH 4L4TD 1QQDA 1ES0B 3V8OA 1CE1L 3QHZL 4EUPA 5IVXB 4NN5C 1NL0H 4ELME 4DZ8A 3KPLA 3MRLA 3IT8D 4ESKA 1RUQL 1S9XA 4HEME 2SEBB 4GSDL 4FZEL 3T0WA 2CDGB 4YJZL 4F8TA 5I1CL 2WIIA 3MODL 4OFPA 3DX9A 3ZDZE 3VFNB 3WO3B 5E99L 4M1DL 4ZOEA 5C09D 2AQ1A 4FQJL 5C8JB 3HI1B 3TBVA 2ZNXA 3ORJA 2XTLA 4XVJL 2DQEH 4POZC 1RK1A 1E28B 3WFHA 5C86A 1ZV5A 1OTSC 4E0RB 2DL9A 3EYVA 3GBML 3NFNB 1U8HA 1C1EH 1J1OH 4NJ9H 3TVMB 3BWAA 4OBSA 1JL8A 3VE0A 2HN7B 1HI6B 5HYJB 3QO1B 2HWZL 1I8LA 2NXZD 3D39E 3SJVB 2A83A 3WS6A 1D9KD 5E2UH 3CC5B 2IALB 4G9FB 1I9IL 1LK2A 3C08L 4PBWD 4TVPE 2OS7A 4DJMA 1CN4A 5TJWK 5HHQA 4QHKJ 4LVEA 3AAZB 1MFBH 4HUXA 3B6SB 1YEGL 3MCLH 1Z0MA 4DZBA 3MSPA 1YEEH 1QP1A 3BGFC 5GQBA 1U8MB 1CL7I 5BV7L 4K23H 1FFNA 4U1NB 1QVOA 3HE6B 4JFDA 3FQUB 4OAWB 4MNQE 5DS8A 4OZGB 2VXQH 3RUGF 2UWEF 4PGJA 3MV9D 4MQSB 4LVOC 1R6VA 4ODXA 2H2PC 3QSKB 5CSZB 2CDEA 2VE6B 4CJ1A 3ZYIA 1N59A 4AQOA 1H0DB 1X5LA 1CGXA 3U9UA 1GCFA 1AHWC 2V9RA 4MDIB 1UKTA 1MCNA 1DQQB 5DMYA 1NEZB 1Q38A 4IRSB 1VGEL 1K5NB 1IC5L 3OR6B 4KPHH 3NGBC 3BFOA 3L7EA 2JIXB 2G75B 3BSZH 4KI1A 5I1GL 3EKCA 3MRRB 1QVOB 1WISA 3OF6D 1YPZE 1P1ZB 3UO1L 3ZDYE 2LQRA 3HNVH 2FLRT 2EIZA 2X4UB 4UAOB 4GS7C 4NUGL 3WXWL 1PG7W 1HHIB 1JK8A 1F4YH 3M45A 2RCSH 1F2XK 3S36X 4F7TA 2Q7NA 2F5BL 4YNYB 4JG0H 4NM4L 3D25A 4JFHE 5TH2B 2IALA 3MFFB 4AIOA 4I18B 1QG3A 4U1NA 5IB5A 3W39A 1S5HB 2EDDA 4H1LB 3S3SA 1NUGA 5L2JA 4G9DB 3SGKC 1ACYL 2XXCB 1MJ7L 3A6CH 4JAMA 1VKXA 5JQHC 5HYEA 3TJEL 3KAAA 1NDGA 5C08B 3G5YA 2H32A 4J3UA 3QIBD 4XMLL 3ZDXF 2R9HC 2C1PB 2G60H 2XN9B 5F8QC 4HCRH 4MCYA 2Y23A 2EYRA 3QO0A 4GFTB 5DTFB 4AMKL 2L7UA 2ENYA 2YR3A 5C0RH 1LEIB 1A9BB 5FYJE 1OGAA 2PR4L 4DW2L 5MENB 1QSEB 1ZLVK 4FQ2L 3EYQC 1XCQA 4FQHA 3LMJH 3GSWB 1KBGL 3KPLB 5DFWH 3SBWC 4GXVH 4YHYB 2FL5B 4OGAD 3T3PE 2GCYA 3W0WB 4X6BB 1UM4H 2AK4E 4G8GA 2I25N 4W6YB 3NCJH 3JVGA 1JNJA 2WIIB 4N8VG 5DD3L 1SYVA 2F5AH 2EH8H 2DYPD 4ZFZB 3CH8A 5E94A 4IS6B 5DC0A 2P5EE 1IM9B 2IAMD 2VZ1A 3AS2A 3HMWL 4OCSH 5BRZA 5JW4Q 3MV01 4G8FA 1OW0A 3ZSTA 2YN3A 1EJOL 3VXRB 1QQDB 3LEYH 3ZHDA 3RY4A 3GBNH 1GGCL 4MLSA 3TN0D 1HINH 2AV1A 4WHCA 4KHTH 1EO7A 5EU6D 4MQXD 1BX2A 4M1CC 4PJAA 4PLJD 5ELIA 4OGZA 5E00A 4TUOA 3MOBH 2DIAA 4RAVB 4WWID 2JELH 3DSFH 5HJ3B 1BWMA 4LCWB 4LSPL 4MA3A 1J1PL 2Q7YB 3OHXB 2VZVA 3L3OB 3NIFF 5FXCH 3BPOB 4JHBA 3K3QA 3I75A 5DFVC 3BZEA 4YDJB 2YUXA 2BHYA 5D6CB 4Z7UB 1JHTA 1BJ8A 3W0WD 1IEAB 4DN4H 3F7VB 4ZDHB 2H1PL 3VXTA 4JVUA 2EDYA 3TP4A 4XNXL 2XPGB 4L3CA 5IBLD 3SDXA 1GJIA 3BKCH 4X6BA 3WIHH 5JOFA 5ERWA 4UQ3A 1FFRA 3AREC 2E7CA 2QHRH 1FV1B 5ESQB 2R0LH 3QPQD 4HAFA 3VFUB 1FL3B 4NQEB 4JG1H 3BW9B 3GMMB 3V6FB 4QXWA 4GQ9L 15C8H 1RUMH 1H5BC 1G9ML 1C7TA 4X4MA 3HNSL 1K85A 3EYSL 5IBTH 2H45A 2ZUWA 4LSTL 3WEXA 1MSPA 4MAYA 3UBXI 5CD3B 1IM3A 1Q94A 4PG9B 2MHAA 3BVNB 3QUXC 5F1IA 2F53E 4U1SB 1NEUA 3QXAA 3L3GA 1TQBB 1CD0A 2DQTH 1T1XB 3MRMB 4DVRH 3WIFB 4JO2L 2VDOL 5C08A 4HSQA 1QBBA 4BQCA 1IAII 1FVEA 5K9QG 2FO1A 5DRZA 3RBSA 5D7LB 3W81A 1S9YA 1T1YA 1ODAA 1F45A 4OZFG 3UYRL 4HV8A 4M9OA 1KN4L 3ETBF 4U1KA 4YDKH 3W39B 2DQIH 4NQDD 2CGRL 4F57L 5IMKB 2ZUUA 5JNYB 3FRPA 1K6QH 3MFFA 4PJ5A 2G2RB 3VXSD 1N2RB 4Y89A 5EO9A 3D25B 3OB8A 1DBBH 1ND0B 1N6QL 1PBYA 4JFQB 5D7IA 4RAHA 2QTEA 3NZHL 3O3EB 1OQXA 2DQJH 4P23B 5LXGL 4FZ8H 5J3HD 1VADB 3K80A 1PYWA 3FRUB 2IPKA 3QNXA 2JLLA 1JRHH 3ARGA 4HW6A 4HIIA 1I1YB 1IAOB 35C8L 5I1GH 3BN9D 1KCSH 1OP5H 2CR3A 4HKBB 5EBMB 2E7BA 3DYOA 2WP3O 1GC1H 2NY5C 5SWSB 4A2MA 3Q2CA 3BQUC 1WJ3A 2H3NA 3QUXD 4OF5A 2HVKA 3OL2A 2XZQH 1ND0A 3G6JB 1YY8A 4Z7WE 2Q3ZA 2ATPA 3I02B 3RVXD 3PQYB 4BSWB 4LPUA 3FQUA 4MA8H 4XAKE 3X3GH 2LTQC 3M17B 3EYFB 4Y2DA 4RMUA 4J8RA 3V5DA 5FO9B 4HIEA 4MJIE 4LBEB 3RPIB 4EIGB 1RULH 1MFBL 1BVZA 2D7MA 5DFTA 5IUSA 3D18B 3IAGC 1P4IL 3OXRA 1U0QA 3EOYG 5JW5A 4R3SA 4ZFGL 4G7VH 3AVEA 4X4YB 3PL6C 3TZVD 4RZCB 5C0RL 4BH7B 1KN2H 2CLZA 3K8MA 4NHUA 4UT7H 3AGVA 1D5ZB 4LSSL 3ZTJH 2D0GA 3C5ZB 4EQ2A 5CBAA 1KCUL 1PX4A 4NRXB 5JUEL 1HH9A 4MD0A 4PRPB 1UH4A 2JB5L 3MA9L 2FD6L 4MD5B 2IPUK 2JCCE 5DVLA 1RZ8B 4KI5C 5IMLB 1PKQE 3TEUA 1V7NL 3GNML 1E28A 3C2AL 1SJXA 1S7RA 4HIHA 3UDWA 3VH8A 5DD0L 3TBVB 5C8JA 1PY9A 1A1MB 1QRNE 3SDXB 3SKUD 1U91B 5CD5D 1QFWM 4PGBA 2DRUA 4QRQB 3MYJB 2Q6WB 1BJ1J 1FE8H 2EXYC 2DWDA 1N6QH 1J11A 1AXSB 5JTWA 3FO9A 3L6FA 2GAZB 3RGVB 2EDLA 4FXLA 3HCVB 2NY7L 2RFXA 4RGNC 5IVXA 2RCSL 2YPLA 5BJTB 5D5MB 3O3DB 1TETL 4HX1A 4GOSA 4OCXH 3UXFA 1WV7T 2B39A 4AL8H 3V4VH 4PB9H 3DRQB 2XY1A 3B83A 2AJSL 3CSPA 5D7LD 1CICD 4RQQB 3BRDA 4JLRB 2VDKL 1YN7B 4TRPH 3BT2H 5FUZH 4BELD 1N5YH 1MCSA 4M7KH 3OGCB 4JQVC 1XGQA 2PTTB 3ULUH 3CX5K 3SGDH 4JHWH 3CLFL 4LBEA 1U95B 3RPIA 2V2XA 1KB9K 1T20A 5EN2B 1T7ZA 4MJ6A 2ARJQ 4KJQD 2BOCA 1AR1D 2AERT 4H8WC 4DKAA 1KC5H 1CGYA 2O5YL 2V2TA 4LMQI 2XV6B 5BRZB 4N0UA 4MJIB 3MA7B 4NM8L 4NYLB 3U0WL 3AREB 3W9EB 4OTXL 3B9KD 4CVWA 2KQNA 2X9XA 3CFDB 2VLLA 4JFOB 2Y7QA 4Z7WB 1UWXH 2ADJB 4PJFE 3VXUD 3VDCA 1NAMB 4LRNL 2GCYB 2ESVD 1J86A 4XHJC 4ZFGH 2X4QA 2X4TA 4YK4B 4DGVH 6FABH 2KH2B 4X4XB 5EORH 4U2YA 5DA4A 2AKRA 2OQJB 4AM0A 1MHEA 4CDHA 1F6AA 3FQRB 4ODBD 5IEHA 1RQ5A 2DF3A 3QUXB 5EUOA 5FGBC 3FAXA 2RR3A 1KB5H 1U8OA 3ZKSD 4D9LH 5I1KH 3PDOB 4P46D 1P6AB 1B0WA 3LKRB 4PRAA 1LD9B 1AE6L 4XBEL 4KKAD 3T3MF 2DWEB 4TTGA 1JUFA 1NDMB 4HS8L 4U0RB 3T3PF 3VMOA 3RU8H 4JJ5B 4ZO7A 4NJAL 1J87A 4XP6H 3IAQA 3SDDA 3VRJB 2P24A 1H3PH 4PRNB 3KPQB 1NPUA 3RZCA 4D0BA 1JHLL 2YMXL 3X12A 5HVWA 2GK0A 4MNQB 3RA7L 4PJ7A 4I18A 3E2HB 5BW7C 2P5ED 3OAZK 3SDDD 3CH1A 2FB4L 3V7MA 4U7MA 1N5AA 5B39B 1UQSB 1P9MA 3O9WB 5T33H 2P48B 3NCYP 5T3XL 1FC1A 1FFPB 4RAUB 1A6TB 1DQMH 3G5ZA 4JM2F 5GGQH 1JK8B 3IDJA 3PDOA 1JN6A 4OZHE 3OWEA 4W6XB 1FORH 3UTZB 5BVPH 2VDKH 2APFA 4P5TD 4TRPL 2DQDL 1CF8L 1JGVL 2DBLH 4RDQG 5CHNB 5DT1H 4KMQA 1BLNB 5I1CH 4LEOB 3GUTB 5GS2D 3TYFA 2A6IB 1OLZA 5I73B 3KS0H 4Y5VC 1UKQA 3RWFA 5DJAA 4KKLD 2CKBA 4FQXA 2NPLX 4ZTPH 4DUXA 2BVTA 1YDPA 1MUJA 2VL4A 3EDDA 5CJ5A 2PTVA 3IKCA 2BNRE 3P11L 1QYGH 5JOFB 1QLRA 1U3HD 2WMPA 2XG4A 4EI5B 5IFJB 1TLKA 4XP1H 4ZS6C 4KJYB 3PXHA 4PJEF 3S34H 2E7MA 4LHUD 5FEBA 3PWPE 4F2MB 3KS0J 3FZUC 5D72H 1RZKH 4OGXL 4ONOA 1NC2D 3DXAE 2D0FA 3SKJL 4AIXA 3ESVF 1AKJA 3C8HA 5IIEB 1INEH 1KB5A 3QP3A 5DYOA 3EOTL 3GSVB 3V79C 4X7TA 4PGCA 4UINH 2FNBA 3DLQR 1LO2H 2VLME 3QXUA 4JN1H 5CLTA 3WNKA 3DXAD 4NZJA 3FB6A 3QUZB 1R3KA 2PO6A 1E0OB 1VHPA 3OJVC 4YR6A 3NN8A 1VB9A 4D9QD 1EA9C 4BSJA 3RIAF 5J8OA 4ZUSB 4LOUC 4YHPB 3O3UN 1R5WA 4U7SA 4J2XA 4J3TA 1WFOA 1YYML 3LPGA 3DETC 4UZGA 1LE9A 5BV7C 2BNUA 3ARZA 3THML 2J6EL 3O6FB 4HUUA 1D5IH 4LAQH 1AQDB 5L2KA 4NDMB 2HJKB 5I1DB 4OLXH 1J0KA 1UEYA 1KLGB 1OAYH 1KCVL 1G7PB 1Q9KB 2P8MB 1PQZA 4HLZH 3UC0H 1IC7H 2O5ZL 5K9KB 1IKNC 1ZA6B 4NNPL 4KQ3L 4NO3A 4ZSOB 1QA9B 3D2UA 4TTDC 2AJUL 3GJFK 2E9IA 2O93L 2JK5A 1KPVA 2GJJA 4P23C 5CUSH 4UTAL 5IEKA 2DYPA 1KJ2B 5E5MB 3MRJB 1AXTL 4LCWE 4O9HL 1NSNH 3S36L 4YBLB 4F8QA 1KV3A 3L3DB 3MUY1 5L88L 3O6FA 1NBZA 5FDYA 4MD0B 5F6IC 5D1ZC 4FOMA 5I71C 5IVNA 4JE4B 3WDIA 1EO8L 5ID0A 1RD6A 3MR9B 1B9ZA 4JM2C 3MLWL 4YGVB 4TULL 1JFQH 4DGYL 4P2CG 4QRRB 3ZDZF 4PJHF 3AM8A 3O0RL 3TJHD 5CFHA 2IBZY 1M05B 1Q0XL 2Z4QA 4AYFA 2HJFA 4G3YH 3CJJA 1EFXA 1MFAH 3CGTA 5CILL 5GGSA 2FWOB 4EN3A 5ICYB 2BNUB 3V4UH 5FA4B 3HS0B 2AJVH 3MROA 4PRDB 1UGNA 4ZNCD 5KS9A 1BPVA 3VFMA 4OLEA 2DQCL 4MX7B 1CGVA 4M7LH 1ULVA 5A16A 4WCYH 3ARYA 4I4WA 4LSUH 4XVJH 2DQEL 4Y5YA 3FQWA 4JEGB 1N7ML 3U7WH 1JNNH 1Z9OA 1IM9D 2QHLA 3CPLA 1U3ZA 5J11B 5DUBB 3QIBC 4JO3L 5HDOA 1DLHA 2J4WH 3MLYH 3PWLB 3WL9A 4U1MB 5FYKL 4JFFD 2VC2H 3ABZA 3NA4A 4KVNL 5FDWB 1FDLH 3RUGE 5JHDE 1ZGLB 4ZYKA 1FRGH 1ZHNA 3ULSB 4BJLA 4RFNB 4P9MH 3VFGH 4DK3A 2A6IA 1EK3A 3T0EE 5KG9B 3OKDA 4MAUH 4G43B 1EBPA 4XB7A 1NKOA 2CLVA 1QACA 3FRUA 1D5XB 2Z8SA 2F54A 3QJFB 4ZNEA 4PB0H 4LLQB 2FHFA 4X80L 5DJ8A 3QB7C 1NMBL 1D5BB 5E1HB 4Z7OE 3B9EA 5D1XB 2ZP0T 1F90L 5GGSY 4HUKB 5DJ2A 3P4NB 5J1AA 1T7XA 1QHOA 3WHE1 3V0WL 1MY7A 3QDME 1JF5A 4PJXE 5C08D 3P0VL 4CVXA 4JVPA 4GRWF 2NY0B 3CXHJ 4H0IA 4Y1AA 1Z5LA 2FR4B 1ZS8A 1TJGH 3O9WC 3T8XB 5HHVH 3O8XB 4FFWC 2ICWA 3BX7C 4POUB 4GXVL 1HHJA 1WBXB 2MFNA 4RNRB 1AHWB 5F1IB 3R8QA 4ZUWA 2EEDA 3CDGA 4QHNA 2YD1A 4L29B 3ULVF 4QTIL 1V7ML 3BDYL 4MJ2A 3HUJF 3T1WA 1BD2A 4HBCH 3C9NA 3KLHD 1OARL 4E41D 2ORBL 1RVFH 1UXWB 3JWDC 2YUWA 2J12B 4MSWA 4LSVH 1CLOH 3MBEC 4PJHB 3VFUA 1ZHNB 4EI5C 1FAKT 3D39B 1WT5A 3ZTNL 3IDGA 4GMTH 4LPYA 5DJ6B 2K1MA 3HZYB 4ZPTB 4IRZH 1S7QB 3ZKND 1DE4B 4RGOL 4LLQA 4Y2DD 3MX0A 4CVZB 2F54B 3QJFA 4DGIH 3PDGA 1IFHH 4PTTA 3MOBL 2WK2A 5KG9A 1IJ9A 1QPPA 1OM3L 5JR1H 5HDQL 1K4DB 3HC3H 3OPZL 3IXTA 3I6GB 4LLWB 2O61B 3EO0A 2YA0A 3EYOB 1ADQA 3MXVH 3ARPA 2APXA 1IILE 1XGUB 5IWLC 4YH6A 2IADA 3AS0A 3WE6A 3DX6A 4N0CD 4WWKB 1T21B 2FWOA 3U4AA 2HFFA 1DDHA 5FF6B 1J88A 4N8CL 2UZYB 2BVPA 2HJFB 2OP4H 3TZVA 4WHYG 4XPHH 3MRNA 1BF2A 1PEZA 2P43B 4YHZL 1AY1L 5CJOL 3MPCA 1JWMA 3HUJA 5IB1B 4OJFH 1AQKH 4PB0L 5EBLB 1UH3A 3AMKA 1GZQB 1JV5A 3VFMB 5KVFL 3LKPB 4NN7C 1ZVSA 3FONA 4IHOA 7CGTA 4XP5H 1IGMH 5EZOL 1AGEB 5DJCA 3UZEA 1FN4A 4YZFE 3IETB 1F97A 2DD8H 4GAGH 4GRLB 2RFXB 5CLWA 4YAQA 2Z4QB 4UUJB 3NCJL 1R5VA 1YJDH 2UY6A 4ODWB 4F7MB 5J6GA 4KMTL 2BNQE 3ARFB 2N1KA 4PREB 1FGNL 1LNUB 1S7TA 1J0YA 1JGLH 2ARWA 4U3CA 1QSFA 1YEDB 1W0YT 1RZJL 1MCPL 1FH5L 2G9HB 2BERA 4AT6B 1IL1A 1NAMH 4HBQA 4BFBD 5D1ZB 1E4KA 5J89A 3VI4E 4KI5D 1FVDA 3QUKB 4NQDA 4OKVA 5D72L 2GY7B 1AGDB 4XCYA 4JM2B 4KY1L 4F9PC 4K3GA 1SBBA 1DBML 1FBIH 4IIQB 1OAUL 3C5ZA 4F37K 1JHLH 4GKSA 4Y4FB 4OFIA 4WUUD 1NUNB 4Y4HC 1ERNA 3VXMB 3QRGL 1KCRH 4MVBD 2DLEA 1QBLH 1XCTB 1DQDH 1I7RB 4RIRB 1NGWA 2Y9RT 4ODWA 5J12B 3JWDH 4GW4B 1B6DA 3CD4A 2PO6B 4KC3B 1HH9B 4PRPA 3RNQA 4H0GA 4HH8A 4M7LT 3BZFA 4C56E 4OFVA 3C6SB 3OPZH 3BHBB 4NQUA 2BRQA 4K3EL 4XXDB 5GGVY 5EIIB 2VKWA 3PUCA 1MH5B 3QDJE 1CQKA 4HWNA 1CLYL 5EZLA 5EZJB 4JY4A 1R3HB 1MWAH 1TVHA 3KPMB 2EDTA 2KKQA 2V5RA 2R29L 3SDAA 1CL7H 1D5MB 1CD8A 4F80A 5I2IB 4ELMA 3PP3H 2DMCA 1P6FA 2IFFH 2E6QA 3LN5A 5A43C 3SPVB 1OY3B 4H5SB 2X7LB 3MREA 1HINL 2NY4B 1YDPB 4X7CC 4WW1B 1LDPL 4QWWC 4PJIE 4WEBH 1K4DA 1XGPA 4HIIB 4OCNC 3FN3A 3JWOH 5D8JL 3H3PL 3MRIA 4MGXA 3BKYL 4XP9H 4PGZA 3CFBB 4FQLH 1C12A 2VMFA 1ZA3A 4R7DB 4WO4B 4KJYA 5E9DD 3QPXH 4ODTH 3BKML 1DE4A 1TZHB 2ZSVB 1MAJA 4KTEH 3R1GH 3FHQA 3BRGC 2CKBB 1K2DB 3D39A 5FKAA 5TDPB 4TNVK 4JFZL 1JPSH 4X8JA 3VFWA 1CICA 3FN9A 5CHNA 4WGWB 1J8KA 1BIIA 1E4XH 1HCFX 4CU8A 1Y6MR 4LNRB 4C83B 5KTEL 1V5JA 3G5VB 1PG7L 5LBSH 2MTPA 3MBXH 3DVGA 1DEDA 4WTZA 4PJ8D 2YD6A 1F58L 2W9EL 1HSBA 3C8KB 2PYEB 4JFDE 5KSUB 1OSPL 2H6PB 1V7MH 3BDYH 3MJ7B 2EEBA 4NQVB 5MEOA 1LO3L 1CDCA 1DQDL 1L7IL 4MXVF 4MXQD 4WI6A 2D31A 2W0FB 1XFPA 3QFJB 5KW9L 3U0WH 3MV9A 3NFNA 4OM1L 4HJ0C 4OIIL 2WLYA 1F11B 1T7WA 5E95B 1QLEL 4NC0B 5FYKH 3WIFA 2XZAL 4JZOB 4DVRL 1CLCA 4BH8B 5C0AE 2IH1B 4XVTH 1EO8H 4XWOC 3EFDH 4OZGE 4PJBF 5FGCE 2HRPL 4Z95L 4PY7B 4ZUVB 3DPBA 4NZRH 3OAUL 2IJ0C 1I7ZB 1NCAH 3GSXB 2WINA 2AEWA 1OQOA 4NWTL 2YA2A 2LVEA 3IDIB 4I5BB 4XC1H 1EAJA 4UQ2A 5JO5B 4G6AD 3BP7B 4M4PA 2AGJH 4WWKC 1ES0A 3MRHB 5HYFA 3V6ZA 5C6PB 3SE4A 5FYLE 1DBKL 2FHBA 4LHJB 3VD4A 3QEHA 1G7MA 3QFDB 4NGHH 5JDSB 5IQ7H 5CEZH 4CADB 2OP4L 5CJ8A 5L9DH 2IPUG 3PJSA 2A6JA 1FIGL 2CIIB 1TMCB 1HIMH 2HTKD 3RUGB 4DAGH 4OV5A 1JHTB 4XPBL 3BKYH 4QRSB 4YX2L 3I75B 5EA0H 3LQMA 5FIEA 4PJAB 1DANU 4PLNC 5HGBA 4PRDA 1CTOA 2J4WL 2XRAL 3MLYL 3HB3C 4L8SA 1DUYB 1SY6H 3D0LA 5INCA 5HY9B 1C5BL 5DD0H 1PW3A 3JTSA 4ONGL 3KDMA 5EORL 3T4YA 3F5WB 5D7JB 1UCBH 3RDTB 4HPYH 4WNQA 2R23A 5LGKA 2AXFA 3O2WL 3LSOB 3NPSC 4HBCL 2ESVB 4M5ZH 5IM7B 4R0LC 4HPOL 2DDQH 3TO4D 3U7YH 1CFQB 3HI6H 1BVLB 1NLBH 3KXFB 3PWVA 2R2HB 1FZJB 2PF6A 4FXKB 4JZNA 4Q6IC 4DKFL 4EDXA 1QFWL 1YMHA 2NW2A 4OCRL 2XWTA 2W59A 4OGAC 5D6DA 4XI5C 3L7FB 3QHFL 4XH2B 5IMLA 3FB5A 4KK5D 2VLJA 4JPKH 3GSWA 3OF6A 3MV7B 1FNEB 4PP1D 1EV2E 3A67L 5GS0H 2AXGA 1DSFH 5C2UB 2P1YA 2CKNA 2ZCLL 4TSAL 2WSKA 1SYVB 1LEIA 4NHUB 5TPWL 1Q9OA 1CXHA 4NO3B 4S2SA 5E2WH 3RKDC 4WY7L 3ULUL 4X4YA 3BIBX 4LCUA 2BNRD 3C6LC 4WI4A 3CDCA 2FATH 1I7UB 5CWSA 2P8LB 4I9WE 1A6PA 4LPVA 4OLVH 3T0ED 5GISH 2IQAB 1KC5L 4PY8I 1D6VH 4E5XB 3J8F7 1QSEA 3QDAA 32C2B 3SBWA 1HNFA 3KNBB 4ZTOH 1F3DH 5HSFA 4NQVA 3WSQL 4QF1B 1E4JA 3PWNA 3LS5L 2ED8A 4AQ1B 4H25B 3MRDA 3W2DH 4YXKH 3PGDB 2CUIA 4ACPA 3BGAA 4JN2B 1KGCD 5JA9A 5I1HL 1DFBH 4OIBA 4HGMA 2JJSC 1EEYB 5J9PA 1MWAB 1AGBB 3WFCL 1ONQB 1MPAL 2DQFB 5I8CB 4NGHL 1GGBH 4D0CB 5E4EC 2I27N 1BGXH 2WBKA 4OUOA 4NO5A 1SHMA 2AK1L 2R56L 3K4ZA 5JHLH 3I84A 2VERN 4EI5D 5EBMA 4XP4H 5DO2D 1CICB 2A1WH 1WFTA 4M7JH 4JFFA 3N1QC 1SEQH 2DLGA 3QUYA 2FIKB 1X5YA 5ALCL 2I07A 4WO4C 5DK0B 1S7VB 1JF6A 4R4NC 4D3CH 2V7NA 4F15B 3CVHH 1LO4L 1FL6A 3MV11 4ODTL 3BKMH 3U9UB 1IE5A 4ZUUA 4X4ME 5IFJA 4X99B 1X5HA 1OAUH 4R4ND 2ED9A 4DEPC 4OZHB 4KHXL 3KYMB 4UOW0 3RWFB 3LIZL 1MLBB 3TO4A 1I1YA 2HH0H 1W72A 1S9WA 4OLZL 4D9RD 5BS0D 1RPQA 4IMKA 1MRCL 1MVUA 2B7DT 1NCDH 2XA3A 4RMVA 4K7PY 5EU6A 3UTTA 4KRPD 1UZ8A 2A38A 3BDBA 3V5HA 5I2IA 4KUZL 3D3VB 2EXWC 3EW3B 3BKCL 3MXWL 1A3LL 1LK2B 4ALAH 2PYFA 4NZTH 1MFDH 3E6FB 1WF5A 3H7BB 3MLXH 5GRJH 2CIKB 1L0QA 5FAAA 3LN4B 3SDYH 3I6LE 1P69B 1Q94B 3O4OC 1AC0A 4PG9A 1UM6L 2NXYC 2R0ZH 1MCPH 3VXSA 4NCC2 1YNTA 4HZLA 4P0DA 1N5YL 4WI3A 1J05B 4OQTA 3EYUH 4Z7WF 1N8ZA 5HHQB 3X13A 4E41A 1K9TA 2ZKHH 4QRUB 4UI2A 3QULA 4UIMA 3GKWH 3X11A 1T1XA 4JM4H 4QHUB 5FFLA 1X5ZA 5E2UL 4WEBL 4K7PX 3GM8A 2WWKO 1NCAL 4QRTB 5GRWA 3DARA 3H9SA 4ONFH 2HKFH 2VAAB 3F7YA 4Y4HA 4Z0BL 1AD0B 1TCRB 3HLAA 5E8NB 1K6QL 2EH7L 3OQ3B 3U4BL 4F9PA 1E27A 5DRXA 3IJHB 2PCPB 3H9SD 1WCBA 1P4LA 1BEYH 3S88L 4JCLA 1YMHB 3PWJB 4PG2A 3OXSB 3RWIB 2AJVL 5J06A 3FQXA 2EDNA 4HS6B 2DTSA 3QZWA 4FFVD 4FZ8L 1WGOA 3VXTB 7FABL 3KYOA 1QNZL 1P4BL 3THMH 4MJIA 3BE1H 5DD6B 1GIGL 4UT6L 5BV7B 1NFKA 1U8IB 1WC7A 5IHZA 1A7OL 4PJCE 4TNWF 3KLSA 3MRFA 1W0WB 4R4BB 1FZMB 1KN4H 4YDKL 4XBEH 2Q7YA 3BP4B 1RFDH 5GGTL 3AROA 5EN2A 3I3EA 3NPSB 5H37G 4GW1A 1B2WL 5JOEA 2IF7A 2IFGA 1JMXA 1XGQB 2PTTA 1QFPA 4OCYH 4EI6A 5JXAL 4Q9QH 4U33A 2QV2A 1UYWL 1EERB 3WHE0 2ICCA 4HFUL 2B1HL 1P7KA 1YMMD 1KLFA 3NGBB 2BVQA 1EVUA 1BWWA 3WE6B 1FAIL 2R1WA 4HIJB 2X09A 3MRFB 1XF4B 1XIWA 1OTTD 2PCPA 4MNHA 1BM3H 4D8PA 5GJTL 5JO5A 4WWKD 3QAZB 3IXTB 4LLWA 5GGQL 1WFNA 5MEND 1Y6KR 4GMSH 5TE7L 3ULVL 5GSVA 4X6CA 1XF5B 4ZFZA 3Q0HA 3ULUD 1HXYB 2JCCB 5IKCB 1CVSC 1TJGL 3TBSB 3S3PA 3B8YA 5IB2B 4JRYD 5DZNA 3VFRB 2A9NH 1S7VA 5DRXB 3HAEB 1UADC 4DQOH 4PGDB 2AJZA 1FNSH 4HH9B 4FQHB 4Z78A 4RWHA 2E8ZA 2AK4D 4JPWH 4NRXA 1G7JB 1R24B 4CN4A 1OGAB 5MENA 4L29A 4UTBL 4CMMB 3VXRD 3V6OA 3W9DB 4OM1H 5IBUB 2R2BA 3IS0X 4JANB 5EOQL 4LKXB 3QEGH 1YN6A 3VD5A 3BPCA 4DCQA 4XX1E 2Q8AL 4YBQC 1G6RB 5ITFA 1G6RH 1ZS8B 2ZZUT 5L0QB 3G5VA 3LEVL 4LNRA 4C83A 2X4UA 4X7SL 3VXSB 1P4BH 2BC4A 1MVUB 1NLDL 1A2YB 1I9JL 4Y2DB 2EKJA 4OI7A 3FQTA 5MEPA 2O26U 2P5WB 1HQ4B 5TH2A 3PP3K 4HQQL 4PR5A 2BSED 5GSRA 3E6FA 2MJWA 4UIKH 2PYFB 3O0RH 2Q3AA 3G6JA 3OJDB 4OZIB 2J88L 3OMZA 2J6EA 3NZHH 1KJMA 1MQKL 3K2MC 1KXQE 1HHIA 3UTSA 1T4KB 1S9VB 1L7TH 2C1OA 3O6KL 5C0BA 3QNYB 1U8JB 1RURL 5EUOE 3GIVA 4PJ9B 3X3FL 5HBBA 5E6IB 1AY1H 3LIZH 4XXCC 3MLVL 1J8HB 3AU1A 3P9MA 3ARWA 2X5PA 4JRYE 4Z7VA 3V95A 5IMMA 4LLYA 1WBYA 4JFEE 1NBVL 3MGAA 1B0GB 4BZYA 1U41A 3GJEA 2X10A 5DUBA 3ZKMD 4KUZH 3C5JA 5F9AC 5KVGL 3O3BB 4HUXB 3CU7A 1WZMA 3KPPB 3WNPA 4EOWL 3UTSD 4XCFL 1ONQA 4MXWL 5IM7A 1FNFA 3KPTA 4G8EB 4IOFC 1A1OB 2NXYB 1KG0B 5DRNA 1MH5A 4JHWL 2IGFL 3T4YB 3H2WA 1QEWA 3CXDL 1LGVA 3MC0A 1UJ3C