4Y5VB

Diabody 305 complex with epor
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
111
structure length
111
Chain Sequence
b'SQSALTQPASVSGSPGQSITISCTGTSSDVGGYIYVSWYQQHPGKAPKLMIYDVSRRPSGISDRFSGSKSGNTASLTISGLQAEDEADYYCNSYTTLSTWLFGGGTKVTVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords diabody 305 VH domain
publication title Tuning Cytokine Receptor Signaling by Re-orienting Dimer Geometry with Surrogate Ligands.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/immune system
total genus 25
structure length 111
sequence length 111
chains with identical sequence E, H
ec nomenclature
pdb deposition date 2015-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y5vB00
1BOGA 4PJCA 4OFIA 1VHPA 3LN4A 1RK1B 4KUZH 2PW2A 4PV8B 5E8OB 4G6ML 4Y4FC 1X5LA 5CEXB 2GKIA 2VISA 4JM2B 3STZA 4MWFA 2A9NH 2W07A 3ZE2F 3LKOA 4LEXH 1OB1A 1CT8A 3TYGH 2KBGA 3GBNL 3IDNA 4UAOB 2VDNH 5D7JD 4KJWC 1MVFA 3MROB 2HKFH 2XWTB 4JG1L 1FHGA 3U9UB 3SE9H 3HZVA 5E8PA 4M7LH 3LPGA 5L2KE 3VWJB 1VGEH 1RI8A 4P57A 1XGPA 3V5KB 1TZGL 1AKJB 4HV8A 4P5MA 5DC4B 4CBPA 4Z18A 5F7UA 2DMKA 3QFJE 3EOTH 3ULSA 4XPGL 4DEPB 4KQ3H 1U8KB 3WBDA 4EKXA 5JW5B 5T1DH 2R1WB 3RWIB 2DDQH 1BFVL 2XKNA 3UTSE 4G80A 2AKRB 4HKZA 1X5ZA 2WANA 1U8NB 3V0WL 4PJHF 2HP4A 3RY6A 2E5EA 5FUCE 4WWKC 1NLBH 5CBEB 3GSRB 1HHGA 4XAWL 4Y1AB 5I30L 2BOCA 2X09A 1R3IH 3MMEA 1Z5LB 3SKOB 1GOFA 1Q9LB 5ALBH 2L7UA 4YHIB 5JOFA 4QHNB 3T77A 3TVMC 1AR1C 3MODH 3QJFB 1QFPA 4IRSD 4JRXD 1ZEAH 3IJHA 3CVIL 3E3QE 1FRGL 2V2XB 4LL9A 5M95B 5EO1A 1EEZA 3VI3E 3U4EB 1AGEA 1PEZA 1U36A 5F93C 5DI8B 4LEOB 1JUFA 2FX7L 4FQXB 3RIFF 2VXQL 4LCYA 4RDQF 4V2BA 1ZT7A 1QBML 1Z0NA 5I8KL 3DETC 4Q0XL 3BDYH 4PRIA 4X4YA 3UTPE 1P7HL 1G0XA 2IG2L 5HDBE 3WL9A 3U0TB 5CBAA 3ARGC 4R8WH 3VFMB 4J1UA 1KJ2A 1T6WA 5F7KC 4ZS7L 3SCMA 5ID0A 1QBLH 4NP4L 3JV0A 2BVOB 3KPOB 1AQDA 3X12B 4R4FL 5H35A 4WI5A 1DANT 5CGYD 3CFIC 5E4EC 3DIFB 2UV3A 3OJMB 5IG7A 4G9FE 2CSPA 5T1KD 1HILA 4WV1A 3TO2A 3TPUB 2CDEB 4OZHB 3DO7A 2J4WL 1S9YA 3WIFA 3VFOB 2VXUL 1E27B 5ABDE 1JBJA 2H9GA 4G6FD 4YBQD 4OGAC 1FNSL 1VDGA 2OL3B 4D0BA 5EIIA 3WFEH 5I1LB 4KC3B 3J8F7 3QQNA 3U46A 2F53A 5MEQB 4GG6E 5I1JL 1EMTH 5JZ7C 1KULA 4XBGA 1CQKA 1L6ZA 5DHVB 1CICA 2V17H 2X89A 4F33A 1JZ2A 1J0ZA 2P8LA 3QQ4A 3Q6FB 4G5ZL 4U0QB 4OBSA 1SBSL 2VZUA 4W81A 2EC9T 2CKBB 1EZVY 1T83A 3WE6A 5IMLB 4L8DA 4LVEA 5IM7A 3BP6A 3EYSL 3KYMA 3SBWC 1RULH 2CR6A 2XRAL 4G8GA 3LKPB 4QOKB 4P4KD 1VFBA 3QFJD 3FJTA 1PYWB 3CDCA 5LGJB 4OI7A 4QRSA 4KKBC 4AENA 3VJ6A 4PJHB 3I3DA 1D9KB 1CD1A 4NJ9H 4PJBE 2AJ3B 3D39E 3KJ4C 1L7IL 3I3EA 2Y6SC 5F1OB 3HI6L 3WN5C 1CTNA 2VAAB 2P5EA 4DZBB 3BGAA 3TZVD 4M6NH 1OL0A 3G5XB 1GYAA 1HXYB 2QQNH 4UV7L 1ROWA 1UH2A 2UWEE 1JIBA 4QRQB 5JHDA 3FO0L 5JUEL 4ZFGL 3UPCA 3FT4A 3VFRB 3CC5A 2ESVB 2D9QB 1T4KA 4MJIE 3UAJD 1MWAA 5JIPA 1KBGH 1ES0A 1H15A 2ADGA 3EO1A 4JZNB 3P77A 4PJFA 4ZSOB 1FYTA 3AVEA 4OT1H 4GUPA 4R2GD 3C8KA 1MSPA 4HUWB 4UDUB 4YC2B 3O3DB 4XCNA 3UTPD 2X4QB 3VRIB 4XBEL 2XV6B 1WFOA 4JKPL 3O6KH 3P0YL 3FAXA 1BOGB 2PW2B 5K9OB 3E6HA 1A6WL 4I18C 4IM8A 1MQKH 4W4NA 4KGLA 2VISB 1MUJA 3STZB 4G9FD 3LKOB 1OB1B 1CT8B 1P6AB 3GFUA 1OP3H 4MNHB 2W92A 1L0YA 3CX5J 1IRAY 3IAQA 5E95B 4APQC 4PUBH 2ATPB 4OLWH 3O0RL 2NXZD 4JFHE 2R4SH 1WF5A 3HZVB 4P2RE 3ARYA 3VFSA 1JZ3A 1FJ1A 1B2WL 1FGVH 1MY5A 2EEAA 2ZCKL 4PB0H 3B3IB 1OAYL 2DTSA 1XGPB 4P57B 4WO4A 1UCTA 4Z5RA 5SV4A 1N3NA 2OTPA 6FABH 4P5MB 3QAZC 2X1PA 8FABA 2AI0L 2R2CA 3ULSB 2WUCH 3JV5A 1S7XA 1UWGL 5I1DB 2FNBA 2GSIB 5IMMA 1D5IL 1NGXA 2NY3C 3PJSA 3OKOA 1WZ1H 2XKNB 4HKZB 3KG5A 4NNYB 2QSTA 2ERJB 4R7DA 1CI5A 5HI5C 1WIPA 5I71C 3QUZA 1A7NL 1C7SA 1HHGB 1PG7X 2BOCB 4JO4L 3FQXA 2AERT 7FABH 3MMEB 2AV7A 4NCC2 2BZDA 4MA8H 3W9EA 2FD6H 4RAUA 5JOFB 3T77B 3PWUA 5JXAL 4PY8I 1KPRB 3N1PC 4XBPA 2HJKA 4NC1C 5DO2C 3IJHB 5F7EL 5SX5H 2IBGA 1EEZB 1AGEB 2VUOA 4HBQA 1JUFB 4LVHB 4F7MA 3HZYA 5FHAH 1PY4A 3NAAL 4U7MA 1AIFA 2IBZX 4NBXB 1QLFB 3EYUL 4PJFF 1M7IA 1QG3A 4PRIB 4X4YB 4JO3H 1QNZL 3WL9B 5CBAB 1YMHB 1QFUL 1C8PA 3EJYC 4J1UB 3VXSB 5FEBA 1KJ2B 5A2LH 3MOBL 5I1GH 5ID0B 3SCMB 1V7MH 5DD1H 1AQDB 1AD9B 4MJID 4PLNC 4MMZC 5H35B 4LHUD 4N5UA 5C0EB 3QUMA 2QKIA 5KVDL 5IMKA 5IG7B 2Q87A 1A6TA 5HYJE 1HILB 3Q2CA 3MA7B 4WV1B 5JW4R 1AFVL 5D71H 3TO2B 2AJZA 2XQYG 3DO7B 5BZDA 4LVNB 1S9YB 5T1LD 3WIFB 4FABL 5TGBA 3H9SD 1AXSA 4L8CA 1PQZA 3MQIA 2H9GB 4DK3A 4LDLB 3H6JA 3HN3A 1H3GA 4LCWA 1ODAA 1P9MC 3SQBA 5EIIB 3WXWH 3MZTA 1NAML 5IK3A 3U46B 3I6LE 2R1XB 3VXUE 1CVRA 15C8L 1MNUH 1A4JA 1QLEL 3C5ZA 4Q2ZA 5CSZA 1I7TA 2H1PL 4XBGB 1N8ZA 1CICB 4HHAA 4LGPB 4F33B 1GIGL 2Z9TA 3JTSA 3QQ4B 4EXPX 3BESR 1JGUL 3GSQA 1KN4L 2M26A 1W72L 4JFHD 1P4LA 1CXLA 4M1DL 3B2UC 4O02L 4G8GB 2YPLD 3DHJA 4DKEH 1VFBB 4JPIA 3TNMA 4TSCL 4GJTB 4IRJA 4JFQA 4QRSB 5FKAA 5KSAB 3ARDB 4NZTH 2BOBA 1I8LA 4MXWL 3VJ6B 2YZ8A 1CD1B 4NO2A 3OKLA 3BX7C 3FZUD 4X0KA 5ANMA 1NCCH 1PKOA 2YSSB 2P5EB 4PRHB 4R6UA 3C6LD 3T2NH 4MLSA 5A3ID 3I6KA 3GGWA 2Z92A 5EC2A 5AD0A 3RUGE 4NKIL 2DF3A 3UDWA 5IGXH 3DOSA 3OR6A 5T3ZH 3ET9F 4L9LC 1T4KB 4P59L 1OTTC 3O4LE 3LV3A 1MWAB 4MNGE 1VFAB 1H15B 2ADGB 5BW7C 3DRTA 3EO1B 3P77B 4PJFB 1FYTB 5E24E 1EIBA 3QCUL 4NQVB 1KLGA 1MF2H 2X4UA 3QHZL 3DX6B 1GCFA 1S9VB 1VESA 2DQUL 4X9BA 1PG7H 1GC1L 3HNSL 4XCNB 2R1YA 2ID5A 4LSUL 1B90A 4MX7B 3KYOB 5CJBA 3MJ7A 4P46D 4AEFA 1SVCP 2MKLC 1F02I 4XHJC 4U6HA 4AM0A 3P30H 1F5WA 3E6HB 1GPOL 1CU4H 1ADQA 3VGFA 4OLUL 4QXTA 4BQ6A 1E4XH 4JREC 2BK8A 4V1DE 4YK4C 4BFBD 4DKDC 5HYJD 2D2OA 3TF7C 4JZJC 1IE5A 3EHBC 2NX5B 4NPYB 4NCC1 2WBJC 1Q72H 4TTGA 3HKFA 3DV4B 1MLCA 2A6JA 3VMOA 4U1JA 5T5FL 5B38G 3BWUC 5T1MA 3RU8H 5GGTH 1H0DB 2P42B 3VFSB 4LP4A 4JY6A 2QQQA 2EH8H 3HRPA 4WO4B 5DGRA 4OIAA 4Z5RB 1PLGH 4J6RL 1N3NB 4PS4H 3I6LD 2DJSA 4M48H 8FABB 5IV2A 1BJ1H 1RD6A 1S7XB 4KVCH 3Q6GL 4L5FH 5F1NB 5HHMB 3ZZ1A 3WLWC 4P5TD 1SJXA 1S3KL 4XP1L 2NW3A 2VDLL 2VDKH 3PJSB 3AMLA 3OKOB 2E7BA 1GHFH 1KNOB 2ADJA 3BQUA 2P46B 3NCMA 3FQXB 3S9DB 4D9RD 2NY5C 4HFUL 3FB7A 1RJZA 1YEKL 3BKML 1KC5L 3SBWA 1YDPA 4C4KT 2DYPA 3LQAL 3RWDA 2A77H 4XBPB 2FBJH 1F4WH 4NWTL 3DYOA 3GMOB 2HJKB 2MPAH 3EDDA 4XP4H 4CW1A 5D1QC 4JR9H 5GRWA 1FAIL 4S1DC 3MOQA 3LN9A 3TO4D 1J0YA 1GJIA 2P1YA 4DGIL 4F7MB 1WGOA 1AXIB 5L88L 4MA1B 3S96A 1V7NH 2Z31D 3HR6A 4J8RA 1I7RB 1M7IB 2OCFD 1EVUA 3LHPL 5B39A 5CMAA 1HK6A 1NANI 3WO4C 4PLJC 4EJ1C 1C5BH 2IANA 3QWOB 3MRHB 1HKLL 3X3GL 1MI5A 4XC1L 5SX4H 3QUMB 2QKIB 5C71A 4NQDE 4D8PA 5IMKB 1A6TB 1LO4H 3EYFA 5MP6L 3IFOA 2AJZB 3I3BA 4LBEA 1I7UA 2IAMD 5TGBB 3KR3H 1AXSB 1UM6L 4L8CB 1DBBH 1NMAL 2Q20A 2W60B 4HIEB 4DTGH 1S7UA 5ENWA 2DM4A 4LCWB 4Q9QL 4LQFL 4MXVF 1QPXA 5DYOA 1EO8H 2HJLA 2AGJH 5GS0C 4RAVB 4X99A 5IK3B 1TZHA 4JPKH 4N5EC 1CBVH 4ZPTA 3MLWL 1A4JB 4I18A 3BPLC 1L9MA 3C5ZB 4PGBA 4Q2ZB 4V1DD 5CSZB 4TOYL 1I7TB 1N8ZB 3GSWB 2E8ZA 1CE1H 5ELIA 3DXAE 4HHAB 3JTSB 3LRGA 3WD5L 2H6PB 4K7FA 3GSQB 4UTAH 3FN9A 4K3EH 4LP5A 1P4LB 4DGVH 1G1YA 2DQTH 3L5WA 3KYKL 1SMOA 4XXCA 2YRZA 3DX7A 1KELL 5C0BE 4JPIB 3TNMB 1MRDL 2FHCA 2XG5A 4JFQB 4PP2A 5FKAB 5DVNA 3RZCC 1EA9C 2BOBB 3LRHA 4NO2B 1RIUL 3OKLB 5DR5L 4H8WL 2PCPA 4X0KB 1NCBL 1OGTA 3CSPA 2Y07L 1P6FA 4XHQA 4U49A 3TWCH 3GSNH 4KAQH 2K7PA 2KZWA 4MB5A 5CINL 1VERA 3LEXB 1IEBA 3I6KB 1B6DA 4K9EC 4K9EL 1WFNA 3SN6N 4PLKD 4W70A 2Z92B 5EC2B 5AD0B 1LO0H 3PWPB 1D5ZA 3KLAA 5KJRL 1AGBA 3QWRA 5C08D 2V5MA 2ENYA 3QEQB 2HRPL 1JF5A 5DJ2A 5DMIH 4BQ9A 3OR6B 1NCTA 4NN5C 1MHPH 1VCAA 3VFTA 1GOHA 3LV3B 3SO3C 1EDQA 1DL7H 1UC6A 5ESVA 3DO3A 4XPAH 3DRTB 1ZANH 2ZUTA 3PV7A 5LQBL 3DYMA 2X4UB 5D7JC 3P9MA 4WI2A 4OZ4A 5JA9A 4JPWL 4YHOL 4ELKB 2Y06H 4HPOH 5F6HJ 4MZ2A 2HFGL 1RVFH 1SY6H 2D7TH 4NO3A 4L9DA 5EORL 3PDGA 3MJ7B 5C0AA 1FVDA 4QXUL 5C0GA 1IAOA 4AM0B 1FNGA 3QNXA 2MQ0A 4KGJA 3VH8G 5D72H 5HHOE 3EO0A 1P69B 3UO1H 1OAZH 1V05A 4O2FA 4K3GA 4LQ1A 2OK0L 3QO1A 4LPYA 4H1LG 1MLCB 2A6JB 4ONFL 4U1JB 5KW9H 2DL9A 5T1MB 3NFSH 3CFCL 2B4CH 3ZYIA 2VMFA 2OSLA 4X6CA 4JY6B 5IEKA 5HXMA 3PDDA 3HAEG 4PRPB 4EI5D 1HDMA 2JJVA 4M7KH 3UJJL 3U9PH 4LHQB 3W39A 2F54A 1JMZA 1JL8A 5IV2B 3HE7A 4P2CG 4IRSC 1NAMA 2ICCA 4EIZC 4M5ZL 2NW3B 3DXAD 3VXOA 4AEIH 4P2OA 3H9ZA 3T1FA 3PNWA 2OBGA 1EBPA 5J13C 4XP6H 3IJYB 1CCZA 2ADJB 4FQ2H 4H88H 1TCRA 3BQUB 1DQTA 1JFQH 2R69H 3NA4A 5BS0E 3KPRA 1W72A 2R2HA 1UYWH 2B1AL 3FB7B 2XFXA 3UPRA 1REIA 3D3VA 1A14H 4WCYL 4XI5D 5D70H 3ZDZE 2DYPB 3ORJA 5TH2A 1FQ9C 3RWDB 3NZHL 4NWUH 5L9DH 4LSSH 2EE6A 2R0LH 5EIQA 5CGYC 5J12C 5IQ9A 4D3CL 1WSST 2HT4D 2JELL 1DBKH 2XIDA 3LKQA 5DA0B 3HS0A 5CEZL 1OP5K 2AJUH 3VXQA 4UBDD 3C60A 1UXSA 3S96B 5IB4A 3UJIH 4J8RB 2NY2D 4UOJA 4M1GH 4YBQC 3ZDXF 1I3GH 5B39B 5CMAB 2ZG2A 1BQLH 2DBLH 4S0TD 4TPRL 4BZ2L 2IANB 4LSRH 4EXKA 2VXVH 3SJVE 5JDJA 1MI5B 1NGPH 5JW4M 4OZFA 7CGTA 1EEYA 2COQA 5SWSB 1ZV5A 43C9B 4D8PB 3MV7A 4LLAA 3O2WH 3EYFB 3IFOB 4OD1H 1I7UB 2M1KA 4B53A 4EDXA 4L4TE 1IL1A 4HWZA 4LCIL 3ZDYE 4J3VA 1S7UB 3BEWA 5GRVL 4OIIH 3NTCL 4PGDA 5ENWB 2X10A 2QSQA 4F7EA 2PNDA 2HJLB 2WMPA 4P4KC 2VLRA 1BVZA 2NZ9D 3IKKA 4X99B 1YNTA 5HHOD 3WNNA 4RZCA 4X6CF 4ZPTB 3FTGA 1YPZE 2ITDA 5CJ8A 1UZ6F 5FUCC 5AZEL 1T03H 2XZZA 4XCCL 3TZVC 2WBJA 4K7FB 3I50H 4DGYH 5A2IH 1KTDA 5L7XL 1K5NA 4MAYB 5C6PB 4NKQB 1FZMA 5GIRA 5FYLE 3L5WB 2YR3A 3DX7B 4I4WA 5IFJB 3FFCE 1TNMA 3WUZA 3GEWB 4GLRH 4KU1A 5TE6H 3REWA 4LARH 4L4JA 5EN2A 3E3QC 3UAJC 3WKML 4ONGL 4KRPD 3STBA 4K8RL 2PCPB 3ARSA 1Y6KR 3DUUA 1OGTB 4M9OA 4R2GC 5FUOH 4HGMA 2AXHA 4XNUH 1YNLH 2FZ3A 3FMGH 3NCCB 1DQMH 3K2UL 2P5WA 4LSDA 3W11D 3SHSA 1X44A 1IEBB 1EFXD 1XGTB 1YQ2A 3QUYD 1RZ8A 3NIDE 2WQ8A 4QNPF 1GGYA 1QSED 5F21B 3GDBA 4JFFA 1D5ZB 3KLAB 5CGTA 1AGBB 4Z78A 4YDIL 2Y1VA 5DJ2B 3MACL 3QPXH 5TJWK 1C1EL 3VFTB 2HMID 2FJGA 3ARQA 1F4YL 1WLHA 3SDYL 4LKXA 1ZS8A 4WI7A 4GBXD 5ESVB 5E1HB 5ITFA 1IEHA 2C4XA 1YMMA 2VDRL 1S8DB 32C2A 3QEHA 3U0WH 1N7MH 3LS4H 3DMMD 3GMNA 1QLRA 3P9MB 3ZYZA 4OZ4B 1Q94A 2CRZA 3BE1L 4PPTA 1YEJH 5IW1A 4MAUL 3MCKA 5TE7H 2NXZC 2YRPA 1U93A 3EFDL 1CL7L 4NO3B 3NIGF 2HTKD 4QHKJ 4NO0B 4FTVA 3PL6A 4J3SA 4X6EA 4WFGE 1FVDB 3L6FB 3RWCA 3QDJA 5C0GB 1JWSB 1FNGB 3QNXB 3KGRA 2DQGH 2JCCA 4JM4L 3A6OA 1DQDL 3L5XH 4K71B 3RIAK 4YHMH 2I27N 3U0PA 1A2YA 4WY7H 3RBGA 3EO0B 5C3TA 1HIMH 2NY5H 5B8CA 4O2FB 3FN0L 4GAGL 5BV7C 4UT6H 3BP7A 3QO1B 4JGUA 2BC4B 2PW1A 4J3XA 4PRAB 4L4TD 4HIJA 3TV3L 2P47B 4UU9A 4ZAKA 4X6CB 4ZUUA 2YD1A 4D9QE 1LHZA 3F7PC 4P9ML 5E5MB 4MNQE 1HDMB 3W39B 1KIQB 2F54B 1U8QA 1XGRA 2ZCLH 3MLXH 3HE7B 1HH9A 1NAMB 4O51A 1QFWL 2L7JA 1N4XL 2QBWA 3VXOB 1Y18A 4MQXD 3F7YA 4L3EA 4P2OB 1YN6A 2W9EL 3T1FB 1ORSA 5EU4A 3PNWB 1RZGA 2EH7H 1MHHA 3D2UD 3H3PH 1RU9L 1TCRB 2CRYA 5IBTH 1ZTXL 3GMMA 4MD0A 5FYLD 4JG0H 2FWOA 3PIQB 3KPRB 3O3BA 5CILH 1NUDA 3UPRB 3JZ7A 4M62H 3FFCD 4YXLH 1FNFA 1Q1JL 4J2XA 2AJYL 3F8UB 2YUXA 5TH2B 3VFGH 3LMJH 2KQNA 1Z0MA 1OTUD 5B3JF 3PGCA 4U05A 1BGXL 5EU6E 3RZCA 5IQ9B 4K2UH 3T0EA 1CDHA 1B6UA 5IT2H 3LKQB 5HTSA 1U0QA 4PJIF 4E41A 3HS0B 1VENA 5I2IA 2OJZL 3IDYB 5DJXA 3TA3D 1DTUA 3C60B 3UP1A 1UXSB 3G6JE 5DJDA 5GS0H 1J1PH 4N0YL 5J6GA 1GRWA 4Z7VE 3V6OE 5IB4B 1NC4A 3MV8D 3KWWA 2OR9H 3IJSA 4RA3A 1A6ZA 3TIDA 3QEGL 3NABL 2ZJSH 5T5NG 5C0JA 1IC5L 4URTB 1LEKA 3TESA 1G7IA 1OSZA 3V52L 5E2WL 4HWBH 4OZFB 4Z7UE 2MNUA 5CP7A 1NC2B 3MV7B 3U48A 4TQEH 1YEIL 3UZVB 5A2KH 3O2VH 3HNTL 4OGXH 4OLEA 5KZCD 4OLVL 2UZIH 1IL1B 2J12B 1OGAE 2CJUH 3QG6A 3BEWB 1BP3B 5EO0A 4MA3B 4PGDB 5DC9B 4U1KA 1TDQA 4F7EB 1KXVC 2VLRB 1MRCL 1YNTB 4RA0C 2YUVA 5CSBA 4PD4K 3V7AE 5GGRA 4RZCB 1E4KC 3WJJA 3BPNC 4ORZC 1AR2A 1G0YR 5C6WH 3FZUC 2ITDB 1A3QA 4S1QH 4KUCD 4L8SA 3GIZH 1U3ZA 3LQMA 1I1AD 1AHWA 3CMGA 2B39A 3C6LC 2NY1B 4UDTA 1BZQK 1T04A 1KTDB 5KVGH 1K5NB 2VDPL 1Z9SA 5A3IC 3SDAD 4D9QD 5IW6A 1F3RB 5GIRB 4RGMC 1OAXL 4R0LC 1JMXA 4QF1A 4LIQH 3JWOC 1ORQA 2LABA 4I4WB 4RAHA 4HQQH 2ZZUT 1MAKA 2H2PD 2HLAA 3REWB 4YFDB 5DS8A 1LK2A 1AE6L 5EN2B 4OCSL 5KS9E 3K74B 1J1XH 3MOAH 5HDOA 4JRXA 4X7SH 2WLYA 3TJEL 3DUUB 1F6LL 4F58H 4F57L 1T2QL 3ARBA 2H26A 3D18A 1RMFH 2YPKA 2RR3A 2FZ3B 4XH2A 4BH8A 2P5WB 5F9AC 3GKWL 1NSNH 1QSFE 5TQ2L 1RZ8B 3N1QC 5CEYB 3UTTB 1OP5H 4JFFB 4P46C 1DN0A 1DQJA 1T5WA 4I3RH 4Z78B 4GS7B 2EKSB 2JB5L 4FG6D 1U8OA 2FJGB 5EU6D 1X6NA 5F89A 1ZS8B 5ITFB 4AG4L 5I74B 3RWGA 1YMMB 1DVFA 5E2VH 32C2B 3QEHB 3GMNB 4JHAL 4R7NA 2W0FA 3N50A 1S7RA 3LZFL 1Q94B 1WWWX 4C56E 5IW1B 3MCKB 2VZTA 4GSDH 2FGWL 2X2YA 4LLWA 1U93B 2Y9RT 2A0LD 2VO5A 3AB0C 3QNZA 4FTVB 3PL6B 3U6RA 4X6EB 4PJ5E 3RWCB 3PQYA 1TJHL 3F7QA 2DQJL 2P8MA 3BOVA 1ERNA 4P5TC 3U0PB 2R9HD 1J8HE 4OFKA 5MENE 5GQBA 5B8CB 5CJQL 5DD0L 1B3JA 2EDHA 1NFDA 1Q9KA 4YFLI 1A9BA 2PW1B 4HWEL 4WU7A 1F4AA 5FKPA 4JJ5B 5DMJB 1R3JA 1OGAD 1T0PB 4YBHA 4UU9B 5E00A 3CCHA 3S37X 1N6QH 2DD8L 3DWTA 4ZAKB 4JEGB 4GT7A 4HZLA 1NUNB 4ZUUB 3B8YA 5L2KA 3N0PB 1P4BL 4ZXBB 1I8MA 2HH0L 3BRFA 2Q3ZA 3R0NA 2H32A 2X05A 1YECL 1U8QB 3F12B 2IF7A 2DAVA 3VXRA 3QFJA 2E7LC 1HH9B 4O51B 3PP4H 1JPGA 1KB9K 4HCRH 4JGJA 4P99A 2XQBH 1GH7A 4MXQD 1Y18B 5D1ZD 3F7YB 3TO4C 4L3EB 5H37G 1YN6B 3RJDA 5EU4B 3UTSA 3MUJA 1RZGB 3BW9B 3DECA 4IJ3C 1FN4B 3O11A 1MHHB 3SKMB 1OHQA 1S5HB 2YK1L 1ZLWK 2Z31C 4MD0B 5LCVL 4H26A 3FONA 2FWOB 3O3BB 5GRJL 1MFDL 4JJHA 1SM3H 4F80A 2V6HA 3U4AA 2ARJA 4H0IA 3CK0L 5JIHA 5HHXL 2FRGP 1B0RA 1J86A 4Y4HA 4M7JL 5I2IB 3WDHA 1EHNA 3I2CL 3THML 5DJXB 3D9AH 5ID1A 2IAMC 5DJDB 2OI9C 1NPUA 4XX1E 3UTZA 1QSFD 4FP8L 4UIKL 4NZJA 3TM6A 1KG0B 3IJSB 1A6ZB 4KFZC 2APVA 3MR9A 3TIDB 2W0KA 3W0WE 3GSOA 5DJYA 5C0JB 3I6GA 3PGFL 1LEKB 1JPTH 4M4RA 2EE2A 1FNAA 1I1YA 3V7AG 4Y2DA 5JLZB 1G7IB 5E8DL 3F5WB 1M6OA 3TIEA 3Q5YA 1H8OA 1CL7I 2YMXH 1RY7B 4OCXL 3OHXA 4Y1AE 5CP7B 3FQWA 3MJ8B 1EUTA 4OQTH 3IDIA 5D8JL 1KYOK 1OPGL 1S7WA 1MFEH 4C56D 2DQEL 3JWDC 1IZKA 1HZHL 3MUGB 3QG6B 4B41A 4ZMAT 2GQHA 3RVTD 5EO0B 1NFDF 5I17A 4U1KB 3U4BL 3HFMH 4PJ5D 3PE9A 4B7IA 4LGRB 1CS6A 5DD6A 5LGKA 4M7ZC 1KCKA 2Z0BA 4GXVL 5GGRB 4HAGA 2Y5TA 5MEND 1BOYA 4GG6A 4ALAH 4NQEB 3S3PA 4HKXA 4JLRA 3OAZK 3OX8A 3ARZA 3N1FC 3NFNB 1P84J 3BT2H 3D87B 3K4DA 4L8SB 4BQCA 5F9WB 1RJLA 3GSXA 1AHWB 4UDTB 1GL4B 3KXFA 1L9NA 2OP4H 5LXGL 1QFWI 5D96B 4KJYA 3MV9A 4KY1L 4OSUL 1A1MA 1DEDA 5IW6B 5I18L 1MVUA 2VDOL 1OQOA 1AGCA 4OZGA 4PLKC 4DOHB 2AK4A 3B83A 2FLRT 4L1DA 5I1AA 4FQPA 3N9GL 1LO3L 2CH8A 2EYRA 1ORQB 2IGFL 2R4RH 4HLZG 5JR1H 5F96L 1N64H 2HLAB 1B9ZA 5DS8B 4OZHE 5HHVL 3FO9A 3SKNB 4XMPH 4LLUA 3ZT6A 4NIKB 3D39A 4O5LH 5KN5A 3EOAB 1EJOL 1U8MA 3GJEA 2BRQA 1BQUA 2A73B 1BQSA 2H26B 3ARBB 4KZEL 3D18B 5KSBF 3V9FA 4XH2B 4BH8B 2DI7A 3CVHH 3FO2B 3S37H 4I77L 5EOTA 4FQ1L 1WVZA 1EXUA 4JM2D 5ACMA 1FFOA 1DBAH 4JFPA 2C1PA 5BV7H 1DN0B 2BY3A 3W5MA 1T5WB 3H3KA 1HHIA 2KPNA 3NCYS 1JP5A 4R26H 5FM4A 3ZL4H 4KQ4H 4FQLL 2CMRL 4QO1A 4Z76A 3B9EA 3RGVB 5F89B 1MLBA 4X80L 4MD5A 1CDUA 2J8UF 3RWGB 2XWJB 1DVFB 3VWJD 2FHBA 2XA8L 5FUZL 2EIEA 2BSED 3QB7C 1UWXK 4R7NB 1KB5L 2W0FB 4QOKE 1AKJD 1S7RB 3EFFA 2PKDA 3ZE1F 3NCBB 4MMXC 1UCBH 4LLWB 2AW2A 4OF0A 2FECL 2C7UB 4PJHE 2OQJB 3QSKB 3QNZB 4OJFH 3U6RB 2A6IA 4EI5C 3MNVA 1TTFA 4HSQA 2KH2B 1C7TA 1IM3B 3PQYB 4M4PA 4X7CC 5A1AA 3JUZA 3ZHKA 2P8MB 3AREA 4DVBA 1JYVA 1I9JL 1CK0L 4Y1AD 3H42H 2HAZA 2ARWA 4XPTH 4A6YL 4ZPVA 1E28A 4PG2A 1B4JH 1NFDB 1F6AA 4NGHL 1A9BB 4WU7B 4F8QA 3IB4A 3LKSA 5FKPB 1CLCA 2DQIH 3MLRH 1HE7A 5HGHB 1NDMA 1DSFH 1R3JB 4YWGH 3SDCD 3V4VH 1FH5H 2MKWA 2ESVE 2G9HA 1OCWL 4HZLB 1IGFH 2X1OA 4P23A 4P2RA 5L2KB 3G9VA 4NBYB 1I8MB 4XI5C 5F97E 3R1GH 4ZSOE 1RSFA 4FQXD 5EOCH 3VXRB 4OZGF 2EDLA 4CU6A 1JPGB 4DAGL 4N0FA 2B20A 2X4TA 3FQTB 3Q0HA 4EUPH 4DVRL 2R0ZL 3GUTA 4UBDC 1HYSD 4OFYA 1T22A 4XX1G 4UILL 4XPHH 4H26B 3FONB 2NY2C 2DS4A 4LVOB 4UT7H 2FB4L 2VQ1A 3PDOA 3MBXH 1OF2A 1U8LB 2FLBT 3D0VA 5HY9A 2GAZA 1G6RL 2ARJB 4TSAH 5ETUA 3ULVL 1NDGA 2FX9H 5KSBB 4U33A 4G6KH 1U42A 4NHUB 3L3GA 3MA9L 1B0RB 4Y4HB 2Q8AL 1BVKB 3MREA 5I75C 1IMHC 2BSTB 1OARL 2R23B 2VQTA 4P3CL 5F44A 1KPVB 5ID1B 3S36X 1YYML 5CHNA 3SOBH 3UTZB 4JQVC 4OLXH 4OZIA 4U7SA 3BH9B 5ISZA 3GSOB 5DJYB 2BVQA 2J8UB 4BFEA 4QHMB 4IDJL 3I6GB 4P46A 2NZ9C 1U3YA 2DI8A 4UIMA 4Y2DB 3OB0K 3TIEB 4KWUA 1CR9L 1M6OB 4OBRA 5GJTH 2R8SH 4ODSH 1UA6H 1E6JL 3GM8A 3GI8L 1SEBB 3KPNA 3FQWB 1CG9A 3HLAB 1S9WA 3JWOH 5ICXA 1HINL 1IC4H 1KJMA 5C6TH 3GO1H 3AUVA 4QOKD 1S7WB 4OCLC 1HSBB 5CCKL 1INEL 3EAKA 1KCUH 1D9KD 1PG7W 5CJXA 5I17B 5FGCE 2NY0D 4LHJB 3ULUL 2NTFA 5TF1L 5IESH 5IROC 4JO1L 4AL8H 3PV6A 3ALWA 2AABL 3VXUA 2Y5TB 2EDNA 1FPTL 1IT9H 4HKXB 2VWEE 4JLRB 4KRPC 3OX8B 4P5TA 4NM4L 2O61A 2NXYB 3L3OB 4K7PL 5HDQL 2VH5H 4QHLA 4QTIH 3GSXB 3I9GH 3VXSE 1T6VN 3KXFB 2Z8VC 3W11C 4KJYB 3MV9B 2ESVD 3QUYC 1A1MB 1Z3GH 1JI1A 1NFKA 1YEDA 1MVUB 1DN2A 4OZGB 1AGCB 3UXFA 1OM3H 2AK4B 5I1AB 4FQJH 3HR5A 3DURA 1K2DA 4LSTL 2FX8L 1ZLWH 2BNRA 1DFBH 2DL2A 2HMIC 2IH1A 3GM0A 2Y7QB 1HOCA 3T0WA 3FO9B 4GBXC 5E08L 1Z2KA 1YUHA 2BVPA 3H7BA 1NCNA 4LLUB 3D39B 5JHLL 2IEPA 3DMMC 1CGYA 3NGBB 3MGTA 1U8MB 4NHCL 5LGHL 1S5IH 1HNFA 2I07A 4GW4A 1CXIA 2BFVL 4JE4B 2WBWB 5GRUH 3GIVA 2HTKC 1OAUH 1FFOB 2Q7NA 3PHQA 3LEVL 4JFPB 2C1PB 2HTLD 2J5LB 3TCLA 1BBJA 4OFDA 3AU1A 2ADFH 4OZIF 1R3KA 3RVUD 1JV5A 4JY4B 3HC4L 3W9DA 5C7XL 3AY4C 4Z76B 1TENA 4NQUA 3O4LA 5ACZA 1MLBB 4MNGA 5HVHC 4MD5B 3LRSB 3W2DL 1CFVH 2QADB 4QHUA 2D31A 3BHBA 3LD8C 3SO5A 2DMBA 4G8GE 2ZP0T 1ZLSH 1WBZB 3ETBF 3OPZL 4CU8A 1RZ7H 1F90L 2MCG1 3ZT5A 3VG0L 3LIZH 2A6IB 3MNVB 4XPFH 3BN9D 3VXME 5T3XH 4ZTPH 2EDDA 2BDNH 4LK4A 1ND0A 3AREB 2XPGB 3EZJB 2P5EE 4ZS6D 4N9OB 4PRHE 2V9TA 3IU4L 2ADIA 4HKBB 1QBBA 4MQXC 1E28B 3AS1A 5I1KL 4YGVA 3B2VL 1F6AB 3NA9H 3S36H 3UPAA 2AQ1A 1J0JA 4ZOAA 1KCVH 4KVNL 3K0WA 1NDMB 1XF3A 3V6BR 4OLZH 1U8IA 5GGVH 3OAZH 1R5VA 5ALCL 4P2RB 4P23B 3OZ9H 1EAPA 4OM0L 4MDIA 4N8CH 1CFSB 5IFAL 1HHKA 2ZKHH 1AY1L 4PJFE 1FYTE 4WFED 5GJSL 1BPVA 1OTUC 4HIHA 3KJ6L 3VH8A 4N0FB 3BPOB 2X4TB 4YJZL 4HXBH 1SY6A 4PRID 4UQ3A 1JZ4A 3GUTB 3TA3C 3VXSD 1T22B 2DLFL 2G60H 5EFIB 2JB6A 3SCMD 4F8TA 4H1LA 5HYQA 4WUKH 4LLVB 3MUZ1 3ZHDA 1AI1H 4XP9L 4JDTH 5F9OL 2ZUWA 2VLJA 3PDOB 4LPTA 4D94A 5TQ0H 3HAEA 1OF2B 4LAJH 2NX5E 5HY9B 2N1KA 2GAZB 1AJ7L 1G7LB 2ICWA 3JWDH 5JW3L 4LU5H 3EUUA 3SKJL 4X7DC 1N59B 3L3GB 1G84A 1TJIL 5IBLD 2E6PA 3MREB 4EBQH 3O2DH 1FLRL 5DVOA 1FBIL 3MRRA 4QXGL 2AEIT 4XC3L 5HI3D 4FQQA 4HC1L 1YEHH 4OZIB 2F53D 1QEWA 4ZDHA 3FB8A 4WDIA 2DQDH 5TFSH 3QFDA 2XN9E 3M07A 1DR9A 2WUBH 5ISZB 1UWXH 2BVQB 1CICD 2F9BT 2X89D 5ADPH 4HMCA 4UIMB 3INUL 4U1NA 1C12A 1H3UA 2FECI 3C87A 1BBDL 4HS8H 4JN1H 4PGJA 1VGKA 4NQDA 3A67L 3KPNB 1CG9B 4XXDA 5E8NA 5ICXB 4NKOA 3V5DB 1KJMB 3GHBH 1I1AC 1ZE3C 4G8GD 3SE3C 1MRFL 2F5AH 3QXWA 1Y0LA 1KB5A 3I02A 3QHFL 3SDAC 3UTQA 1EHLH 1A1NA 1BLNA 1JJUA 4DQOL 1U41A 4HJGA 1KEML 2LE9A 1PY9A 1OLZA 1QOKA 5JQ6L 2H2PC 4ZFZB 4EI5A 2QJDA 2P5ED 4NDMA 5HD8D 5HYSG 4D0CA 3NH7H 4PRHD 3PV6B 4FQHA 35C8L 1X5XA 1DCLA 3VXUB 2HT2D 1UXWB 3ALPA 2IADA 1CD9B 4A6YA 1H3PL 2O61B 4TNVK 2AJSH 4GKSA 4QHLB 4LPVA 5BXFA 1YA5A 3KDMA 2AEPL 1OT1A 1JZ7A 5HGBA 1OAKL 3RHWF 3O45A 1WIUA 2DTML 2RJMA 1CYGA 1YEDB 4P0DA 4I5BB 2DJUA 4PIRF 4XPBH 5J11B 2AAVA 1CE6A 3HR5B 3ILPA 1FYTD 1K2DB 1J05A 3VXTA 1C5CL 3V7MA 4K7PX 5C0BA 4FG6C 2BNRB 4AQ1B 1F00I 4KMTL 4YXHL 3BH8A 2EDEA 2YC1A 4IMLA 4N0UB 3O6LL 1G7QA 3MX0A 3VXNB 1UKSA 4PYGA 1UM5H 1QACA 4GW4B 5E5UB 1AO7E 3CFDA 4NOFA 1IGJA 3GIVB 3MLTA 2A0LC 1LNUA 4XVJL 4DN3L 2FATL 4OV5A 3PHQB 3T2PA 1QYGL 1MCEA 5FECA 2NX5D 1SYSB 2O93L 3AU1B 1R3KB 1JHLL 1JV5B 2RHEA 3W9DB 3T2OA 2DQHL 5I8OH 5E2UL 3SE4A 1PZ5A 1G6RA 3FT3B 3O4LB 1D5MA 5ACZB 4MNGB 2BRRL 2R9HC 4ZO6A 3ZT7A 25C8H 3QCVH 1PSKH 4QHUB 2IPKA 4FQIH 2BSSB 1H9VA 2B1HH 3BHBB 3OB0H 4WO4D 4TUJB 3B9KA 5HSFA 5AWNL 2EDJA 4OGZA 2M2DA 2VDMH 3H9YA 5HHMD 1C08A 3CMOL 1F8TH 1WEJL 1KLUA 3GHEH 3CXHJ 2X9XA 4GMTL 3TBTA 4JPVL 1AQKL 1ND0B 3K7UA 4AJ0A 5MHSE 4X4MA 5FYKH 1NMCC 3P0VL 2YA1A 1IGYB 4RGOH 5K33A 3BI9X 2ADIB 4U6TA 4MXQC 3S35L 5D1ZC 2XZQH 4O2CA 4HK3J 4YGVB 4KHTH 2EDQA 2AV1A 1JNLL 3BGFC 3PWPE 4F37F 2ZSVA 4OD3H 1BEYL 3SQOH 1TETH 3TYFB 1XF3B 3QEQE 4DZ8A 4U1GB 1R5VB 4ORGB 4KKAD 4Y7MA 1EAPB 4MD4A 5H94A 1HHKB 4K94H 5C07E 1MEXH 1ZAGA 3GMLA 3HPLA 4PJXA 5IROA 4HIHB 2MFNA 1YNKH 3LQZA 3VH8B 4S10A 5AYUH 1U8HA 4Y16A 4UQ3B 4YEEA 1JGLH 1V3KA 4PTTA 5EOQH 1TVDA 2JB6B 2VE6A 5KVFH 3CFJA 2BNUA 4H1LB 4O4YL 5HYQB 5GZOD 3BDXA 3LN5A 1TPXB 5BS0A 3FQRB 4KZDH 2Q1EA 3HUJF 4MJ6B 3UJTH 2X4PA 2VLJB 3P11L 4FQCL 4XVTH 3TEUA 5GSRA 1CXEA 1T2XA 3QDMA 3F58L 1FYHB 1VFOA 5A2FA 3TBYB 1H5BA 1FSKB 4YLQT 3FQUA 5ACLA 2ICWB 4MZ3A 4Y5XC 3GJFA 4MXVE 3DX9B 2EECA 1X5FA 4XMLL 3CDGB 4GBXA 4LCWD 2F58L 3IAPA 5DEGA 3MRRB 4AY0A 4PRPE 2PETA 3EO9H 3ULVF 2IPTH 3DUSA 4FQQB 4NT6A 4PP1D 1ZGLM 4RGNB 1LD9A 1JZ5A 1QEWB 3FB8B 3RVTC 2QQLL 2E6JA 3C5ZD 4LSQL 3NCYP 5DJZA 3L7FA 1ZSDA 1MIEH 4ERSL 4ZFOL 1BJMA 1C12B 3SDXA 3SJVA 3U83A 4WI6A 1KFAH 1GAFH 1VGKB 4NQDB 2YOCA 4XXDB 5E8NB 3L1OH 4NKOB 3EBAA 5DVLA 1XCTA 1Y0LB 1KB5B 4M5YL 3VGAB 3I02B 3ZSSA 4IRJD 4BFGA 2KKQA 4NNPL 4HJGB 1VPOL 4OTXL 4QEGA 1GGBL 2DLGA 2JJTC 5A2JH 3LKRA 3ZHLA 5IR1A 5F1IA 5IJVA 5MHSD 2E7HA 2LTQB 4NDMB 1IGTA 4D0CB 2BY1A 2CO6B 4WWID 1A6UL 4FQHB 5EUKA 3SE8H 3GMQA 5ILTL 5I1IH 1FGNH 4ODTH 1YPZA 2IADB 2RCSL 5FCUL 5J4MA 3ULUF 4A6YB 3MCG1 3PWPD 1UG9A 4UQ2A 2ZCHH 4PJXF 4Z95L 4YAQA 4S1RL 5BXFB 2QR0B 3KDMB 3QEQD 3O9WA 3R8QA 5BRZE 5HGBB 4HWBA 5IHLB 2IANE 3O45B 1YJDL 2HFTA 4JM2C 4MJ5B 3QG7L 1MI5E 5KANG 1EGJL 1GGCH 3BVNA 3RI5K 3ILPB 4YQXL 5SWSE 3QCTH 1J05B 1FIEA 3VXTB 4UAOC 5C0BB 4GMSL 2YBRA 2YC1B 3V0VA 4MCYA 2DQCL 1G7QB 1OOAA 3E8UH 3VWJC 1EZVX 3HUJB 4H0GA 2AXFB 5KSUA 3LEYL 1U91A 4XCFH 1D5XB 1BQHG 3CFDB 1P4IH 4DEPC 1KIRB 3BJ91 5IQ7H 1IGJB 4JHBA 1F4HA 3HC3L 4EOWH 4MJ4A 2DWEA 5FECB 3IVKA 1DLFL 3HC0A 4CADB 5JMRA 2OM5A 2JIXA 4NC2B 3WHXB 3T0AA 2NQCA 3O6ML 1D5MB 3GI9H 5FYLH 1E4JA 3JV4A 1IBGH 4M6OH 4UB0H 5CUSH 2IPKB 4PRPD 1UKTA 2M8XA 4GQ9H 3SDXF 1GXEA 3B9KB 3SDCC 1UZ8A 2QHLA 3MCLH 3BEVA 4ODWA 5EA0H 1C08B 1UEYA 2VC2H 4F9PC 1KLUB 1RUKH 3TBTB 2FCBA 4FQXC 5I19L 5FHBL 3BQUD 5KOVC 2Y36L 3V6ZA 5F3HB 4HXAL 3WV0A 2DBJA 5EWIL 1MHEB 1T5XA 3MRGB 1HYSC 4NN6B 4BA8A 2OTWA 2ZSVB 1UM4L 2DYPD 2HWZH 4RCAA 3SE3A 3LVEA 1A47A 2E9IA 2GSGA 3NACH 5GHWL 1E6OL 4HF5L 5J1AA 1K8DA 1INQA 1K8IB 2Z4QA 5H94B 1LDSA 4KK9D 3V4UH 4MNQA 1BF2A 3L5HA 3ZDXE 1NL0H 3HPLB 2VLKB 5F7DB 4PJXB 4K07A 1X5AA 2Z91A 3LQZB 1NGQH 1UVQB 2CDGA 1TVBA 1U8HB 4Y16B 4TVPE 4Q9CA 4UOW0 3DSFH 3ARWA 3P4NA 4LMQE 4PTTB 3MLSH 1EAJA 4XP5H 4OLYL 4O58H 1BD2A 2BNUB 2IAND 4HT1L 1QZ1A 3LN5B 3ES6A 1MI5D 1IAIH 1P5VA 2XG4A 2X4PB 3QJHB 1HQRA 1FNEA 4M6MH 5EZIL 5GSRB 4YBLB 2A1WH 1URLA 3QDMB 4U1MB 5J1TC 2YXMA 4DN4L 3FQUB 2CKBL 3GJFB 1CQYA 2WBKA 2VITA 5EUOF 2J1KA 2F19H 1WBYA 1BZ7A 2RFXA 5DEGB 1NBYA 3HMWH 1UZ6E 5LBSH 4NT6B 2F54E 4Z7VA 3V6OA 5IHZA 4IMKC 4YX2L 1D9KC 2C3HA 1KACB 5F70A 5GS2H 1ZGLB 1DDHA 2NY0C 1LK3L 4X8XA 5DJZB 2W0PA 1MJUH 1ZSDB 3IFNL 3OJVC 3S88H 3OSKA 4JVUA 43CAA 3BMVA 3SDXB 3RVVD 4G43B 3BKCL 4Y5VC 5IIEA 4G6JH 3REVA 2C9AA 1W0WB 2DLTA 5ADOH 3KPRE 2UZYB 1DQQA 5F7HA 5TDPB 5JW4N 1XCTB 2GITA 3K4ZA 3MLUL 2O5YH 1XIWA 3MLVL 1RUQL 4GW5A 3ZLQC 2AJVL 1CZ8H 4IRZL 4Y8AA 5CJOH 1JRHH 5GGUA 1CIDA 1UFUA 5IR1B 5F1IB 1YC7A 5IJVB 5I1EL 4ZOEA 1B0GA 4QNPE 1IGTB 5KAQG 4ZUSA 5EUKB 4IOIB 5JOEA 3GMQB 4JY5H 4OCRL 4PB9L 1I9IL 3MNZB 4K3DL 1YPZB 2MQCA 2E27H 5JMOC 4YAQB 2MHAB 3BRGC 3QWRD 3SDDA 3O9WB 4NUJA 4DFHA 4BK4A 4GOSA 1CGSL 4WI3A 1CGTA 5KOMC 3M17A 3VGHA 2NY7L 3HG1E 4HJJH 1BHGA 2HTLC 1DE4A 4NRYA 3BVNB 3ECBA 3V2AR 1PZUB 1RHFA 3RVUC 5IFHL 3QIWA 3VFPA 3NIGE 5FYJH 2YBRB 3KPPB 4I1NB 5KS9A 4MCYB 5EU7E 2OR7A 1NEZG 5KSUB 5EZOH 4XTRD 3WLBA 3I75A 3WKNA 1U91B 3PWJA 2QEJA 1JYNA 4XVSH 2WW8A 5D2LA 1X4YA 1QSFA 5ICYA 2DWEB 5EUOB 4XWGH 3WJLC 5ICZB 3IVKB 4FHBD 1BJ1J 3EGSA 3MXWL 1A0QH 4YUEH 3GSVA 2ERJC 5HJ3A 2JIXB 4Y4KB 4ZS6C 2BNQE 4XRCA 3OBAA 4IHOA 5B3NA 4LSPH 5IB5A 4BFIA 3DNKA 3JV4B 4IS6A 1UQSA 1A1OB 4Z0BL 2D7OA 2YZ1A 5A43C 1A7RH 5DQDH 3QH3A 3D25A 1SEQH 3S4SA 2F54D 4HPYH 4C56A 3HE7D 1U3JA 2VIRB 3BEVB 4FFYL 4ODWB 4PTUA 3MLYH 3U7WH 2BJML 2EIZA 3GKZA 5H8DA 4P2OD 1X5GA 1OAQL 4PJ5A 3VD5A 1A7QH 3MRCA 4PGCA 4LVHC 3PABA 1YYLL 2VWEC 3CVHA 3V6ZB 3DROB 2B2XL 1J8HA 2Q76A 3KPRD 2XWBB 4Z7NF 1K3ZA 5IJKA 4FFZL 3UTTE 1T5XB 3T0VA 5DK0A 3D3VD 5B3JE 3T0DA 1QRNA 5IVXF 3SCMC 3VWKA 1NFIA 1N0XH 4PJIE 1I9RH 2O5XL 3FOLA 1BECA 1KOAA 1ONQA 2FJHA 5J1AB 1K8DB 5SWQA 5L2JA 2Z4QB 3QXDA 4LLMA 1FIGH 2C3WA 4MNQB 1YMME 2O26U 4WV1C 3W5NA 2JJTA 4FXGA 2R0KL 4XNXL 4LVNC 4YDKL 3EOBA 3C60D 4CDGC 1EUUA 4HS6A 2F5BH 2Z91B 4W6WB 1VFMA 4LRIA 1KIPA 2HYMA 5IBLC 5F71A 1QO3A 3A6BH 1UWEL 3RIAF 1WWAX 5C0FA 2IPUG 1BD2B 3SGEI 4POYA 4HBCH 1IC7L 3QXVA 3GSUA 5HI3C 4PJAF 4YE4H 3CH8A 1A7OL 3ES6B 2VNCA 3RJQB 4HULB 1U8PA 1HQRB 1FVCA 1FNEB 2R29H 4NZRH 3MV7D 5CLWA 1CICC 1EGJA 2FDBP 3WIIL 1RQ5A 3LSOA 4JQIH 1QR1B 5D2LF 1VACB 1FO0L 3MROA 4CMHB 1T83C 2VITB 2VLLB 2H41A 2XWTA 4J3OC 4OB5L 5GPRA 1CGXA 1WBYB 3BKYH 2J88H 4JKWA 1BZ7B 5TPWL 2JE8A 2V5YA 3KPLA 3C8HA 4Y0GA 2VLRD 4N90D 3V5KA 4NM8H 4U0RB 4Z7VB 5IHZB 3WFCL 3HNVH 1DDHB 3MSPA 1NQBA 4TULH 1MFBH 3BAEL 1J18A 2WZPD 3W0WA 4GRLA 1KXQE 1MCPH 5FO9A 5HD8C 1A5FH 2QSCH 2NY1D 4JFEE 1A3LL 4Q6IA 43CAB 5E99H 1N2RB 1PX4A 4KPHH 4E0RA 2FL5A 1U8NA 5E2JA 1IM9A 2IFFH 2HT2C 2F8XC 1I1CA 3MRBB 5IIEB 3REVB 5CBEA 4X9GA 3M45A 1DQQB 3C5SB 1A7PL 5I73B 3HTLX 1Q9LA 2GITB 3IXTB 2OZ4H 4YHIA 2APXA 3NFPA 5D7SL 5HPMA 4GW5B 1CF8L 1A6AA 3RWEA 4EDWL 4OZFG 3VFWA 1MJ7L 5GGUB 5DUPL 3CXDH 3GK8L 2J7LA 1NCAH 4RRPG 4ZO7A 2V2XA 3WFBL 5I1CL 3U4EA 1R0AL 4HUMB 1B0GB 3HHRB 1NAKH 1XGYH 1H3TA 3ROOA 4ZUSB 5IVXB 2HJFA 4HK3N 2P5WD 5E6YA 5D2NA 5IB3A 1CLYH 5F6HI 3ZYOA 2IQ9H 3HMXL 3UTTD 1IGMH 3UYOD 5HDLA 4BJLA 4JFFD 4I0PA 3U0TA 1LDPL 3SDDB 4NUJB 3TZVB 4X83A 1W0VB 1JZ8A 3OAUH 5J0BA 1NMBH 4AT6A 3QHTC 4XMKH 3M17B 5MEOA 2OS7A 1YMMD 1DE4B 2BHYA 1J11A 4K55A 3IFLH 3DIFA 3ECBB 2VAJA 3M8OH 1N5YL 4K23L 3QIWB 4H20L 1ZLUK 1X4ZA 1L0XA 2CDEA 5CD5D 4ETYA 2GY5A 1G9MH 4JO2H 3B9DA 4PJAB 3DVFA 2I60H 2DICA 1RZJH 4FTVD 3PL6D 2ICWJ 3TGXA 4WHYH 5EU3A 4WO4C 1T7YA 3QDJD 3I75B 4ZTOL 4BSJA 1KTLB 3PWJB 1LO2L 1D5BA 5D2LB 2ED7A 3GRWH 4Z7QF 5ICYB 4MB3A 1X5JA 1E4WL 4KHXL 4LLDA 4NQEE 3WIHH 4XB8A 3RY5A 3EGSB 3FT2A 4KJQD 3GSVB 5D6DC 3V4PH 3H0TA 5HJ3B 2WWKO 1JHKL 5DLML 5FM8A 4XRCB 3BP5B 4IHOB 1IKNA 1LILA 1F4XL 1FC1A 1KENH 4ZAKD 2CKBA 5IB5B 4BFIB 5DMYA 4IS6B 1DEEB 1UQSB 5E9DB 3VRLF 1K6QH 5IMLA 2YD6A 5D5MA 4DOHE 4ZXBD 1UGNA 5J9PA 3S4SB 3D25B 2VXSL 4D9LH 3CPLA 4HGWA 3MXVH 5K9JH 2EIZB 4PJHA 4KKAC 4BM7A 4F7TA 5HGGS 1INDL 4L3ED 2OL3H 3VA2C 1T7XA 3L5IA 4G7VH 3MFFA 4PGCB 3BPCB 4NOBA 2XTJB 2I5YL 3PABB 4U31A 5KVMC 3N85L 4MA1C 2B0SH 4UTBL 3CVHB 5HYEA 1U58B 2Q76B 5E2TH 4Z7WF 1S7TA 1NBVH 5JIKA 1DBJL 5DHVH 5DK0B 1JCKA 1QRNB 4GQPH 4YXKH 5I76A 3VWKB 5GZOC 4LASL 1HXMB 1RURH 3BMWA 4I13B 1IGIL 3FOLB 1RK0A 3L95B 2CPCA 4RFOH 3GBML 3QUML 1ONQB 2FJHB 4AMKL 5DD5H 3T0ED 2K7QA 5L2JB 5SWQB 3QXDB 4E41D 2X5PA 4FXGB 4KTDL 4ZSOA 1Q0XL 5E6ZA 3VW3L 3EOBB 3DBXB 4LSVH 1NGWA 5CEZE 4HS6B 5IP4A 1A64A 1MJ8L 1NC4D 1CLZL 1QO3B 2NY6B 2YPVL 2A9MH 5C0FB 3MO1A 1IILE 3GSUB 3PQYE 4PP1C 5K9OA 3CLEL 2DKSA 3TT3H 1L7TL 3C5ZC 4P4RA 1R3LA 1U8PB 4RNRA 1FVCB 1UACH 5BMFL 3DRQB 4WEBL 4X6DF 4MNHA 2CGRL 3LSOB 3SGDH 3HZKA 1NFDE 5GS1A 3GNMH 4K3JH 1MAMH 1YEGL 1JPSL 2DQFA 4OCYL 3E2HB 3HI5L 2X4OA 4YDVA 3TNNB 1AH1A 4N0CD 2ATPA 4EN3A 1DQLL 4RWYH 5MERA 4N9GA 3C2AH 3KPLB 4H0HB 4GG8A 4UINL 2MMXA 3B3IA 3IDJA 3QQ9D 5CZKA 3T8XA 4IRJC 3ZMRA 1RUPH 1CDGA 1I8LC 5D5MF 3VXRE 1YN7A 5JOPD 4KXZI 4NQED 1KCSL 4DCQA 5L0QB 5I1DA 1TQCB 2GSIA 3W0WB 4ZYKA 3MLZL 4GRLB 4LPWA 3MUY1 3UMTA 3WJLA 5FO9B 5JPNB 4TSBL 1M71A 3GB7A 4Q6IB 1OD7A 4NNYA 1Q0YH 2CRMA 2WNGA 1A7BA 4E0RB 2FL5B 1IM9B 5IW3A 3ZKMD 3LH2H 3RA7H 3UDWC 1S9KC 3ABZA 1U92A 1RZFH 4OUUA 3NFPB 1RFDH 5HPMB 1KPRA 1A6AB 1MREH 5EULV 3RWEB 2GIYA 3VFWB 2NYYD 5KSBE 4L3AA 3TT1H 4KI1A 5D1XA 1GGIL 1N5AB 5KVEL 2DM3A 5DT1H 3O2DA 2I9TA 5FDWA 3ARBD 1WAAA 2IWGA 4NJAH 2AEQL 3ME0A 5BO1L 3ROOB 3ARFA 3O8XA 1SHMA 2HJFB 5GGSA 2XKUA 5D2NB 5IB3B 4C55A 1QLFA 2ZPKL 3RNQB 2D7MA 5LWYL 2VDQL 5J6HA 3RX7A 1OWRM 4I0PB 4QHKI 1PJ9A 2WAHA 1BAFL 1YMHA 4I0KA 2J8UE 5DRWA 3VXSA 3WYRA 3C6LB 1SBBA 3RX5A 1ADQL 3WXVH 4ESKA 4PRBB 5K59F 5ITBH 1AD9A 4AT6B 4NRZA 5C0EA 3ZE1E 5MEOB 1DVFD 1VEMA 4NUGH 4CVUA 1FORL 1RZKL 5IBUB 5CEZD 3MA7A 1J5OH 3MRIB 3OR7A 5HYSA 5DD3L 5DWUL 1YEEH 4R90L 1FG2B 2AJXL 3WNKA 4ZUTB 4X98A 1JPST 3FN3A 5EU3B 3LS5L 3WO3B 3PQYD 5DRXB 2P4AB 4YHKL 2HKHH 4X6DB 1D5BB 3WFDL 4NQSB 1JGVH 1JK8A 2R1XA 3K80A 1G7HA 3WNPA 4HJ0D 5C2UB 5C86A 2VLME 4LLDB 2XZCL 1A3RH 3FT2B 3Q5OA 4YHZL 1KJ2H 3H0TB 1JNNL 1IGCH 3BQUC 4UV4H 3KXFE 3AM8C 3Q1SH 1FO0A 3MV9E 4OM1L 5L2KD 1PKQA 3IDXH 5D5MB 3UC0H 2QHRH 4OZGE 2AK1L 3BP4A 2AK4E 1QKZL 5J9PB 2HVJA 4WW2A 4CUCA 4M8QA 1WIOA 3O6FA 4J3UA 3CPLB 2UVEA 3VXRD 4HGWB 2VSDA 2MCPL 1ZKAA 1FL6A 2D7NA 3WSQH 5DQ9A 5KSAA 3ARDA 2JK5A 4MQTB 1LVEA 3CSYA 4F7TB 3G6DL 3AB0B 4KK9C 3CZFA 4ODHL 1HWHB 3VXMA 3UTSD 3MFFB 4NBZB 5AZ2L 5HHQA 2YSSA 3FRUA 4HMDA 3CLFH 1KGCE 4MLIA 4PRHA 1TZIA 5DEZA 2CR3A 3LKNB 5FFLA 4LAQH 1S7TB 1WAAF 4JFZH 3BD5A 4X8JB 3U7YH 3QBTB 4NQXB 2VL5A 4ZUWA 5I76B 3KYAA 1KXTB 5LG1A 2AP2A 3ZTNH 4YPJA 1RK0B 5BOZG 1RZIA 1NCDH 4RMQA 5JO5B 1MIMH 1VFAA 4Y4HD 5A40E 5K9KA 4K8RD 4UT9H 1XAUA 2C26A 1RAMA 1DBML 1H3XA 4FZ8H 4NQVA 1NGWB 2PR4L 2LAAA 4J4PA 4I3GA 3DX6A 1S9VA 3TPKA 4IEFB 3BZ4A 5EU5B 1KSRA 2P43B 3HMXA 4MX7A 3KYOA 3MV01 1A6VL 2CQVA 3MO1B 1ZLUH 1JNJA 4PBVC 4JHZA 4Y2DD 3IAGC 3BSZL 4HIXL 5F6IB 4U3HA 4Z9KB 4WTXA 4NNXA 4P4RB 4S1SL 1R3LB 1T66D 4RNRB 5BVPH 4UOW1 3TBVB 2IC2A 2ZOLA 5IMOA 4F3FA 3HE6B 2QQKL 2XT1B 3QULA 5J8OA 2NX5A 3HZKB 4KROB 4NPYA 5GS1B 3DV4A 3RVVC 3EJZD 4NZUH 5CIPH 3T4AA 2DQFB 5T3ZE 1MWAH 2W9DL 2X4OB 4YDVB 4NRXA 4EN3B 1TFHA 1H0DA 3BUYB 2GTWB 3MYJA 4XXCC 5MERB 4N9GB 1Q38A 4GG8B 3IDJB 3BKJH 3A6CH 1RJYB 4EQ2A 3T8XB 2OI9B 3MYZA 1YEFH 1IARB 3X11B 4JFDA 1J1OH 1YN7B 3Q5TA 2R0WH 2VLMD 5F7FA 5F1NA 4DCQB 2XN9A 1UJTA 1J7VR 4WW2F 4ZYKB 2NXYD 5IB2B 1Q9OA 4D2NA 1FCGA 3IRPX 5GGQL 2O5ZH 2IQAA 1M71B 3GB7B 1RIVL 3QRGL 3KXFD 5DFWH 4DKFH 5D6DA 1KNOA 1CFQA 3MV9D 4L1HA 4WU5A 1Z9LA 1T20B 4W6XB 2JJSA 2RIKA 1IKFL 1OSPH 2AK4D 1ZGLP 4U6VL 3S6CA 4Y89A 3VDAA 1O7SA 4BZ1L 4JVPA 5TE4H 1U92B 2YKLL 3C08L 3FHAA 5L6YL 4YDJA 4OUUB 1MPAL 1ACYH 1KEGL 3L3DA 3GMOA 5I9QC 5FGCB 2X1WL 3X3FH 3D39D 5D1XB 4ZD3L 5KTEH 2GT9A 2I9TB 4NFCA 4YZFF 5DK2B 5FDWB 1J0KA 1KGCD 1CLOH 4R9HA 3ARFB 3O8XB 1TTGA 1TNNA 4FNLH 3RAJH 2YRLA 1MFAL 5GGSB 1HQ4B 4TVPL 5DMGD 2VXTH 3UYRH 4OZIE 2EDYA 3P4OA 1I7RA 4H25B 5J6HB 3KHOA 1I1FB 1IQDA 4G3YH 4KH2A 4XTRC 5ISZE 5I15H 1ZK9A 3U1SL 3NCJL 5DRWB 2XXCB 5C0DA 3RPIA 4IIQA 1NLDL 5C2BH 4K71C 1OQXA 3QWOA 3MRHA 1F2XK 4NRZB 3F65A 1P2CB 2QADD 5HBBA 3DPBA 1RIHH 1D6VL 2GW5A 2NLJA 4MSWA 5C08B 5GXBB 3EIFA 2F74A 3OR7B 5HYSB 5KANI 4MA7L 1NGZA 1ZMYA 2VZVA 4H5SB 3KLHD 4ZQKA 4HIEA 1BM3H 2W60A 4QKXB 4FZEL 4X98B 1AXTL 3MRLA 4G7YH 1KN2L 4JKMA 3TN0A 1LO5B 3D69B 3FB5A 1FDLL 1MCOL 3QYCA 1UH3A 3HE7C 3ARED 3CAFA 3PXHA 5CZVH 1AO7A 4NQCE 4RAVA 4RBPK 1F3DH 4M43L 2OXHA 1JK8B 4KTEH 1G7HB 2Q3AA 5J89A 1IQWH 4P2OC 4TUKL 3GSWA 4EIGB 2KL6A 1FE8L 4Q9RL 2PTUA 1SYVA 4OCWH 4L4VA 4YHYB 2Z35A 4O9HL 5T3ZD 1KJ3L 2GYSA 2H6PA 5DJCA 3S34L 1FO0B 1TJGL 4M9PA 4P2RD 4P23D 1WT5A 1PKQB 3BP4B 4OGYH 3T0XA 2HVJB 1MCDA 4GAJH 4WW2B 4M8QB 5C0RL 1Y6NR 3BN3B 3O6FB 2BNRE 3TBWB 1BQHA 1FL6B 1I3VA 1MCWM 5DQ9B 3ZO0A 1MFCL 4F2MA 4N0UE 2R56L 2JK5B 1BWWA 1GGTA 4AEHL 3CSYB 3CZFB 1HI6B 3VXMB 3IDYC 5HHQB 4OFYD 1RUML 3C60C 3FRUB 1QVOA 1TZIB 4G6MH 4AIOA 4ODVL 3UBXB 3VRJB 3LEXA 2NNAB 1U6AL 3KS0H 2NR6D 2VKWA 1RHHB 3G04B 3PWPA 4XB7A 4TRPL 2VL5B 2ENSA 4ZUWB 1C16B 2G75A 5BZWA 3GBNH 4RISL 5HVFB 1NKOA 2J6EL 1F58L 3QEQA 2XY2A 1RZIB 1PBYA 4JG1H 1F3JB 5K9KB 1HEZB 3M1BA 1NCWL 5FGRA 5C07A 3BDBA 1K85A 2YXFA 4LRNL 4P9HC 4P9HL 1QR4A 3RVXD 4ENED 1PW3A 1TZGH 5I1HL 5IVZA 5EU7C 4ELKA 1GC1C 4G9DA 3BZ4B 4HX1A 4XPGH 3QEUA 2CXGA 1YQVL 2MJWA 1RPQA 5I0ZA 5ISZD 4JDVA 1IFHL 1BFVH 4LF3B 2CLZB 2PYEA 3V0WH 5IHUL 2WM0A 1SMAA 4PR5A 4NNXB 1JVKA 4XAWH 5I30H 2JJUA 5T33L 4PG9A 2ZOLB 5IMOB 4F3FB 5FOJA 3V8OA 4BSVA 4WEUD 3QULB 3T3PF 1P7QA 1RUAL 1EHXA 2NY1C 1OT2A 4PY7B 3T4AB 2FH8A 4NRXB 2R39A 1OWWA 4XNYL 1N6VA 3CVIH 3MYJB 1FRGH 2A6KA 2VB5A 2PO6A 4PRPA 3WEXA 2XZAL 3MRPA 5DUML 2FX7H 2VXQH 4JFDB 3VXUD 2G5RA 1QBMH 5I8KH 2XN9B 2MQ3A 4Q0XH 5GISL 3X17A 4DW2L 4PJ7A 2IG2H 4F9LA 1Q9OB 3TJHD 2IQAB 3S5LB 3IJYA 5DJ0A 4Z8FL 1IAIM 3R8BB 4ZS7H 2ORBL 4NP4H 4ELMF 1CFQB 2AVGA 2IMNA 5C70A 4WU5B 3AM8A 4R4FH 4JHWL 2DKUA 2DKMA 2VLJE 4GS7C 1U2CA 4YEFA 3BD3A 2CIKA 3PHOA 4YDJB 2BNRD 4HZAA 1HN1A 5TF0A 2J4WH 3LQAC 2GJ6A 3L3DB 2FJFB 4Y5YA 5D6CA 2VXUH 5I74C 2Q8BL 4NC1E 3T0BA 2GT9B 2J2ZA 1FNSH 5D93C 1FZOB 12E8L 3HPJB 5BQ7A 5CD5C 2D7PA 5DEFA 5DFVD 3OGCA 4WHCA 4RGNE 1MOEA 2APTA 1NBQA 3P4OB 4LFHD 1LEIA 3PL6C 5I1JH 3RP1A 1IQDB 5C0DB 3RPIB 3MJ9L 4IIQB 2X1QA 3RVWD 2B8OT 5BRZA 3T4YA 2D03L 4G5ZH 3TBSB 1G7MB 1UT9A 1XGQA 3O4LD 3QUYB 1SBSH 4PJEE 3UEZA 4UNTA 4EQ3A 4M3KB 3QDGE 5B8CC 4JB9L 3OAYK 4R96A 4C54A 4O2EA 2OMBA 3WS6A 2A2QT 5SWSA 4GFTB 2NLJB 5CSGA 2YHGA 4MSWB 4KJQC 3EYSH 43C9A 5AAWA 4KK8D 2XRAH 3RL1A 3OXSA 2F74B 3RWHA 4S0SD 5DHYB 2ZNWA 5HYFA 2KZ1B 4ZAKC 1NGZB 3IFPA 5CJ5A 4YHLL 2H3NA 2CK0L 4ZQKB 5DTFA 4PD4J 4ZXBC 3U36A 3MRLB 5KBNC 3TN0B 1L7IH 1ZLVK 3FB5B 2E9BA 2Z8RA 3HI6H 4Y19A 1QD0A 1V3LA 1AO7B 1TQBB 4TNVF 3NN8A 4I48A 4HEPG 4FOMA 1FVEB 5EOCJ 1KCRL 2H45A 4UV7H 3RTQA 1G9NC 1G9NL 4KUZL 3FO0H 5JUEH 1F42A 3ZKXB 4ZFGH 1SYVB 4N8VB 4L4VB 2YN3A 2Z35B 5F1SA 5DJCB 2G5BA 4MVBD 2E6QA 4MAYA 3VG9B 2ITCA 4PJ7F 2A9NL 4LFHG 4LEXL 3TYGL 4N1EA 1NEZA 3DI2B 3S3JA 2VDNL 3BIKB 5IFJA 1WUNT 1MCLA 3OF6A 2B5IB 1NANH 2HKFL 1BQHB 3H3BC 4F2MB 3SE9L 3T0EC 4ELMB 1CDCA 4M7LL 4PJGA 5DMKA 1VGEL 4XBEH 2I24N 4H8WC 4JFXA 1OY3B 3VD7A 4JKPH 1AP2A 3HUJE 3P0YH 5JA8B 4MQSB 2Q86A 1QVOB 3RX8A 3EOTL 1A6WH 4KQ3L 2VJXA 1O0VA 1XGTA 2VLJD 4JANA 1UJ3A 5T1DL 3LDBB 2P44B 2DDQL 4A2MA 5IVNA 4B7LA 2G75B 5BZWB 2V9QA 1FC2D 1K4DA 4Y8DC 1NLBL 5E5RB 4LMQI 3N06B 5GS3A 3ULVE 1R3IL 3O0RH 2RAMA 2YD8A 3M1BB 5C07B 5ALBL 1B2WH 1IC1A 1OW0A 1S8DA 4NO5A 4GAYA 2NZIA 2WWKT 2ZCKH 4GRWH 1OAYH 3MODL 4POZD 5IVZB 4RGND 4WNQA 4G9DB 2AI0H 4N0CC 1ZEAL 4HX1B 3QEUB 1UWGH 2WSKA 3ARXA 1D5IH 4NO0A 4JDVB 5GGSY 3QQ9C 5KAQF 5D7KE 5JPMB 1CGWA 3L6FA 5F1KC 1JWSA 2PYEB 4YO0A 3WJJC 4X4ME 1J87A 4PR5B 4ETQA 3BDYL 5FAAA 3BISA 1A7NH 4JO4H 4NQDD 4KKLD 3H7LA 4PG9B 4WVRA 1XH3A 4DJMA 4L8SC 4BSVB 4R8WL 1P7QB 5F9WC 1AHWC 1ULVA 1TITA 3L3KA 2ILLA 2LAGB 3SY0B 1QBLL 1IAMA 3K1KC 2BC4A 2DI9A 4NCDA 4RBPH 5D96C 3WMSA 4PRAA 5JXAH 1YY9D 1MCJA 2RBLA 3ZKMC 4P49A 1I85A 3KLSA 5F7EH 1EFQA 1ZHBB 3S7GA 2A6KB 3PWLA 1Y6MR 1KB9J 2FHFA 4B50A 2PO6B 3WEXB 2X70A 5E5MA 3ULUE 2X42A 3MRPB 1KIQA 4HUVA 2MTPA 2VLKE 3EDEA 4PJXE 3NAAH 4UNUA 1JI2A 3L3JB 2NYYC 4P5KA 3EYUH 3AROA 1JWUA 5AG8A 4PJ7B 5M94B 3ARBC 1QNZH 2DIBA 4M7LT 3WFEL 3C8DA 1QFUH 5DJ0B 3RDTA 3MOBH 3AC0A 2N7AA 4PJGF 3PIQA 1EMTL 5E4IA 2V17L 5KVDH 4KMLB 2CIKB 5C0BD 1LEGA 1AFVH 3PHOB 3QDME 3U30B 1WTGT 5EIVA 2GJ6B 4FABH 2NCMA 4Y5YB 5D6CB 4ZODA 3G6AA 1DVFC 5JQHC 3NVQA 4NC0B 1RULL 4OF3A 4MCZA 2CRIA 5BQ7B 2JKXA 1U3HB 3KPMA 3V5HA 5DEFB 3PWVA 1NAMH 3OGCB 3WDJA 4RIRA 4NJ9L 3FQNB 15C8H 1LEIB 1QLEH 4U1SA 2H1PH 2W1NA 3NPSB 4JAMA 1GIGH 3T4YB 5BRZB 4M6NL 3TCXA 1FG9C 1XGQB 1KYOJ 3QNYA 1J0IA 1JGUH 2J6EA 4KRNA 3SDXE 2V5TA 3ULVD 1KN4H 2QQNL 4HJ0C 4NFBA 1W72H 3HG1A 1CGUA 4LPUA 4R96B 4O2EB 4M1DH 1NC2A 4RRPA 3L9RA 1LE5B 4O02H 3ZTNL 3RL1B 2H2SD 3OXSB 3B9KD 3RWHB 2V7HA 1QSVA 5E6IA 4TSCH 4RQQB 3IFPB 1KBGL 2DWDB 2H3NB 3CFEA 1JPFA 3QIUA 4MXWH 5FM5M 5DTFB 3U36B 4MA3A 5D7KD 4OT1L 2D0FA 5DRZA 1S7SA 3EYQD 4Y19B 1A02N 3ARRA 3G5YA 5C0ND 3NN8B 4I48B 4HUKB 5EBMA 5F7LB 3O6KL 3RTQB 1BMGA 2R2EA 4NKIH 3K1DA 5DUBA 3RNKA 2HFFA 3O41A 3LB6D 2AXGA 2BNQA 2DIAA 1MQKL 3RI5F 2G5BB 2NW2A 3EYOA 5CP3H 5INDA 4LVOC 2ITCB 4P59H 4YH6A 1MCCA 1NEZB 3ULUD 3QCUH 1JNHB 1VFUA 2VLKD 4F15B 2JLLA 1M1SA 3QHZH 4PUBL 2DQUH 4X9IA 5E03A 4OLWL 1GC1H 4Y16D 2R4SL 5LJYH 3HNSH 1QP1A 1X5KA 4Y4HC 1FGVL 1T1XA 4PJGB 5DMKB 1JF1A 4K8RC 4JFXB 4LSUH 2CXKA 4PB0L 1AP2B 3QQ3B 6FABL 2Q86B 1GPOH 2WUCL 1HHHB 5BS0D 1UKQA 1ZT1A 1MCFA 4OLUH 1FCCA 4JANB 1UJ3B 3QDAA 5CEYA 3UTTA 5DVMA 1WZ1L 4HK0A 2QV2A 5GRVK 5EUOE 3UYPA 3QDMD 4Y2DC 1FZKA 4R97C 2EKSA 4PJIA 4IBLT 1K4DB 3D0LA 2FSEA 5T5FH 5ESQA 3STLA 1QFHA 5FOBB 1HCFX 1T66C 1P1ZB 5EBGA 7FABL 4MA8L 2FD6L 1FL3B 4NO5B 4LIQE 1QQDA 4GAYB 1DLHA 3EJZC 5KG9A 1R24B 4J6RH 1XR8B 3P2TA 1UENA 4WNQB 3OAYH 2EE9A 1F97A 2YD3A 3Q6GH 1S3KH 4XP1H 2VDLH 1CN4A 1QUNA 3B4NA 1XF2A 3AS2A 5FHAL 4LCCA 4YO0B 5TDNA 3SJVD 3MJ9A 4JN2A 4ETQB 1TXKA 4JO3L 3JXAA 2YD2A 1XH3B 2NXYC 4HFUH 1ZLVH 5L8LB 1YEKH 3L3KB 3MBEA 3SGJA 5I1GL 3BKMH 1KC5H 1V7ML 3BXNB 4MJ2A 5DD1L 4JJ5A 3LQAH 3RRQA 3AXLA 4NWTH 3TFKD 2PTVA 1XGUB 1FAIH 3PWLB 4ZXBA 3T1WA 2IJ0C 5D71L 2X70B 2PN5A 4KK5D 4DGIH 1B88A 3F12A 4HUVB 1ZHNB 4XNQA 2BERA 3D1MC 5L88H 4R4ND 4P5KB 4JFYA 3MJ6A 1JWUB 3ISWA 3NGBC 3LHPH 4GXUM 4ZUVB 1VEPA 1YY8A 5DZNA 4JFEA 3BW9A 3WXWL 1BD2E 2ZSWA 3O9WD 1FN4A 3RDTB 4OCMC 5DMGC 3SKMA 3WHE0 1S5HA 3QI9A 1HKLH 1MNUL 3X3GH 4XC1H 5E0QA 5GSVA 2J5LC 1T1WA 5D7IA 2ZUQB 5MP6H 1LEGB 3RBSA 4CVXA 4LPCA 1YC8A 1ETZA 1UM6H 4L8BA 1NMAH 3G6AB 2QADC 1EVTC 2XICA 4Q9QH 1DJSA 1A22B 4MCZB 4DWHA 4LQFH 4DKEL 3KPMB 4GRMA 3V5HB 3AS0A 2XQYK 3PWVB 3EOYG 4NZTL 4E42A 3T2QA 3KLHC 2IFGA 3BGMA 4RIRB 2E8YA 3MLWH 4U1SB 1KG0A 4N1CA 4TOYH 1NCCL 2BVUA 4JAMB 3AREC 2JIXD 2P7TA 4Y4KD 3T2NL 2AS5M 3RZWA 5JLZA 3WD5H 3F5WA 3QNYB 4N8PA 2FEDD 4PG2C 3HG1B 2X9YA 3W81A 4PJDF 3OG4B 3KYKH 3MJ8A 5IGXL 2C3VB 1X7QA 3L9RB 2FIRT 1WFUA 1KELH 2WK2A 3CD4A 2V7HB 5T3ZL 5E6IB 1MRDH 2N4IA 4P23C 3CFEB 1KV3A 1JPFB 3QIUB 3MUGA 1RIUH 4PREA 5DR5H 4H8WH 4WFGD 1MF2L 1NCBH 3EDFA 5DRZB 4Z7NE 1S7SB 1J0HA 2Y07H 2P8PB 3GMPB 1PG7L 3G5YB 3PGDA 1QFOA 3BPOC 5CINH 5IVXE 4OI8A 5HGDA 4NQEA 4K9EH 5EBMB 2R2EB 3NFNA 3IRZA 5DUBB 3RNKB 4LPXA 2HFFB 3CFBA 3O41B 5KJRH 3DGCR 3P30L 2AXGB 2BNQB 1CU4L 3VFNA 2HRPH 2QSVA 2VQUA 2NW2B 3EYOB 5INDB 1E4XL 3B8SA 5KSVB 1V5JA 2NR6C 4MNQD 2BXYA 1Q72L 5LQBH 5C8JA 3SDCB 4RX4A 4JPWH 5FIEA 3C6SB 5DK3A 4YHOH 5GGTL 3RU8L 3QUXA 4U3XA 1DP0A 2X1XR 3SKNA 4PJAE 5D7IF 2HFGH 1T1XB 2EH8L 1JF1B 3HRZB 5INCA 5EORH 3VCLA 3EOAA 1BD2D 1PLGL 4QT5A 4PS4L 2A73A 4QXUH 3RVXC 4ENEC 4M48L 4KVCL 3FO2A 4L5FL 2XA3A 1ZT1B 5D2LE 2VRAA 2VDKL 3MRMA 5C0CB 3SEPA 4HK0B 1GHFL 1N6UA 4E5XA 3OB8A 2OK0H 1FZKB 4OF6A 2PXYA 4PJIB 4RWHA 3D0LB 4ONFH 2FSEB 5ESQB 3STLB 3RGVA 4QRPA 1F45A 3CFCH 4PJCF 4P2QA 5E9DE 2XWJA 5FV1L 4WEMB 4PRDA 1QQDB 1DLHB 3UJJH 5KG9B 2A77L 4LOUD 2FBJL 1F4WL 1S7VA 3K46A 2MPAL 5F72S 4XP4L 3WFZA 5CJXC 4JR9L 2EDRA 4M5ZH 4U4BA 4Q9BA 1WICA 2C7UA 2OQJA 5C9KA 4W4OA 1Q9WA 4PJDB 5DXWA 1XF2B 1IM3A 3IDGA 2XTJE 2P24B 4LCCB 5TDNB 3D5OF 1V7NL 4JN2B 2DJ4A 2XNAB 4ZFFB 1JYWA 4PJ8A 3TJHC 2B1AH 1EK3A 5ESAA 4EEEA 4YIQB 3MBEB 1QRNE 4WCYH 1C5BL 1W0YT 1XIWD 2CD0A 2W65A 5HGHA 3QWQB 5AEAA 3AXLB 4FS0A 3NZHH 4LLQA 2W91A 5J11C 2X41A 5IHBA 3MPCA 4D3CH 1LO4L 2JELH 3VI4F 5CEZH 3P0GB 4PJ9A 3BRDA 5DQJA 5I0DA 2APFA 3KR3L 4POUB 1XF5B 4XNQB 1DBBL 2EDBA 4DTGL 4JFYB 2NY0B 3FQTA 1GVIA 4ZO8A 1ZVHA 1EO8L 5IWLA 1YY8B 2AGJL 4JFEB 3SDDD 3W82A 2ZSWB 4TPRH 4BZ2H 1QPPA 1QBAA 5DFVC 4JPKL 1CBVL 1KUMA 3QI9B 2V2TA 4Y5VB 2EZ0D 2DLHA 5GSVB 1CE1L 1T1WB 4OAWA 5D7IB 1MCSA 3FCTB 3QIWD 2NMSA 3RVWC 4CVXB 2UVFA 1U8LA 4UTAL 4K3EL 5CIPA 4P3WA 5C09A 1ETZB 5EPMA 4L8BB 4DGVL 5KSBA 4LCIH 2DQTL 3LOWA 4NHUA 2V5SA 4Y88A 3MRKA 1EH9A 4NSKB 3UZQA 3LPWA 3NTCH 4G8FA 1LP9E 1BVKA 4XNMA 3DSNA 2BSTA 4KK8C 4Z7QE 2R23A 2H32H 1KPVA 6CGTA 4GRMB 5I8CB 2HN7A 4E42B 4HIIA 3H9SE 3BGMB 4G6AD 3WFHA 2IBBA 3BH9A 1WC7A 4Q74A 4PJCB 2J8UA 3GSNL 3LN4B 3TWCL 4KAQL 4QHMA 3VRLE 5E8EA 2P7TB 3SGKA 3GBLA 2WINA 5AZEH 4XCCH 1WJ3A 2PTTA 5L7XH 4MWFB 4KI5F 5E9DD 3QISA 1LO0L 1SEBA 3HLAA 1X7QB 4HH8A 4Z7OF 3IDNB 4XZUA 4B0MM 4XWOD 5JXEA 5DMIL 5CKGA 4WGWB 3VGEA 1MHPL 1HSBA 4U1GC 4MVBC 4CN1A 1DL7L 3D6GA 3WKMH 1QHOA 4XPAL 5E8PB 1ZANL 2IALA 4PREB 4ONGH 4K8RH 1ZXQA 4KDTA 4MB4A 1WCBA 2XTJD 4Z7WE 2YPLE 4HV8B 1I1RA 4UNVA 1S7QA 1LWRA 2Y06L 4HPOL 4M1CD 3PGDB 3C9NA 3K2UH 5HGDB 1J8HD 1RVFL 1SY6L 2D7TL 5D2NE 5K9QG 1X5IA 1QRND 4G80B 3CFBB 3L3OA 1XT5A 4YDIH 3VWKD 3VFNB 4X9HA 1TPXC 3MACH 3QIBA 3O4OB 5D72L 1C1EH 3SDYH 1F4YH 3UO1L 1OAZL 1ITBB 2EIBA 3K2MC 4U1LA 2VDRH 3R4DA 1FSKC 3ELAT 3ZKQD 5C8JB 4U7KA 5KW9L 3NFSL 2B4CC 3VDCA 2B4CL 2CK2A 3BE1H 3QUXB 2Y7QA 4MAUH 4F7PA 3EFDH 1CL7H 5EO1B 2NY6D 3N1GC 5INCB 3VCLB 4M7KL 3U9PL 3S4SG 4QT5B 4POZC 3ZKND 1W2KT 5CZXD 4LCYB 1ZT7B 4RGNC 3RKPA 4JM4H 4X6DE 1DQDH 4AEIL 1U8JA 3FOMA 3MRMB 1OD9A 4JQXA 3FN0H 4GAGH 2L4OA 4XP6L 4E5XB 1ZT4A 2PXYB 4FQ2L 4H88L 4X4ZA 1JFQL 4JY4A 1WTLA 2R69L 3ALXA 3Q3GA 3QR2A 3TV3H 4QRPB 4KKLC 1UYWL 3LRSA 4P2QB 3RHWK 2IMMA 5D5ME 4QCIA 4P9MH 1A14L 4PRDB 5D70L 3BIAX 1YY9C 3VGAC 5J3HD 1S7VB 4NWUL 3AFLA 5L9DL 4LSSL 5GRYA 2R0LL 1WBZA 1HHJA 1QFWH 2YUWA 1DBKL 1N4XH 3W0WD 4GRLD 4D0BB 2AJUL 2W9EH 3L7EA 2LTQC 1Q9WB 3IDGB 3DVGA 3WDIA 5ERWA 4BSWA 1RU9H 2XPGA 1IM9D 4Y4FA 2F53B 3UJIL 1ZTXH 3KPQA 4M1GL 3KNBA 3I85A 4HKBA 1I3GL 4EI6A 4PJ8B 1R5WA 1BQLL 2DBLL 5ESAB 4N1HB 2P8LB 1BX2A 2WLZA 1Q1JH 4LSRL 2VXVL 2AJYH 2W65B 5DURB 1NGPL 3WE6B 4LLQB 4L8DB 3T3MF 1BGXH 5IM7B 3BP6B 4N0RA 4D9RE 3KYMB 1FV1A 3O2WL 1CFSA 4OD1L 4PJ9B 2OJZH 3VGBA 5DQJB 1E4XI 4AENB 4X5WA 1MAJA 4BUHA 4N0YH 4HD9A 2FBOJ 4LHUG 4CAGA 3MZGB 4OIIL 3AS3A 1ED3A 2ZUSA 2ZNXA 4I0PD 3C5JA 4HH9A 5K59E 3QEGH 3NABH 1KCLA 4UUJA 1IC5H 5T3XE 2P49B 5EFIA 5FA3A 2NY4B 5DDHA 3V52H 5E2WH 2V2TB 4YGAB 4LLVA 1P7KA 3C2SA 4WWKA 2MOVA 4EUPG 3ILQD 5CLTA 4HG4K 5JHDB 4OAWB 4DUXA 4HUXA 1YEIH 1T03L 3FT4B 3CC5B 1SJHA 3I50L 3E6FA 3HNTH 4DGYL 3SE4C