4ISVA

Crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPKFVMELKKDGSHSTGDGIPDRFSGSSSGAHRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1C2 FAB LIGHT CHAIN
publication title Linear and extended: a common polyglutamine conformation recognized by the three antibodies MW1, 1C2 and 3B5H10.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2013-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvA01
3MXWH 4KJPC 4NDMB 4YBHA 3FOMB 1U8JA 3SOBH 1UGNA 3RKDD 3ULUL 2DICA 4LVHB 5DC4B 5GSVA 1TLKA 4MVBD 3MA9H 5IVXF 1IGYB 1UM4L 4M6NH 4NZRH 3BZFB 1ZGLM 3GMQB 1VEPA 4K8RL 4NBZB 5E8EA 2H26B 1U8QB 4U2YA 2OP4L 3C5JA 5DF0A 1YECL 4BFEA 3KPQB 1I3VA 4HIIB 2FJGB 3EGSB 1AKJD 4CVXA 3O3UN 4KXZI 2DWEB 1MY7A 3ILQC 1HQ4B 1T2QL 3MREA 1MVFA 1L0XA 1K4CB 1CDUA 1F90L 1JPTL 3ZE2E 3HA0A 2DLEA 5C8JA 4KRPC 1PQZA 3U48A 3NA9H 4HKXA 4BELD 2FJHB 2QSCH 4LHUA 1BZ7B 3T0BA 4NO5A 1JHTA 3IU3B 3M17A 4I48A 4UT9H 1OTUD 3ARQA 5HYSG 1G7LA 1U3JA 5FAAA 4WNQB 3DGCR 5TDOA 3SPVA 5J3HD 2D31B 4HSQA 4UNUA 4QNPE 3AREA 1E6OL 2VLRE 3P4NB 2YR3A 1CT8A 4ZAKD 4GBXD 1F13A 5ANME 3BWUC 3UTSE 1Q0XH 2ADGB 3BVNA 3MV8A 2JCCA 1A8JH 12E8L 3PHSA 3OQ3B 4RWHA 4PJFF 5F6HI 4LCWD 3MV9A 3B5HA 1KIPB 1PFCA 5CS7A 1QACA 1X6LA 3K4ZA 4MQTB 3OB0H 4JFHD 3W2DL 3UTPD 2E27H 3RQ3A 2FEEI 4EI6A 5E4EB 1AGEB 4WU7A 3MGTA 1QR1A 1R24A 4YDIL 3IDJA 5IW6A 4XRCB 3WIHL 4EUPA 4X6CF 1UVQB 4JHAL 3VXPA 5BZWB 3BWAB 5E8PB 4JGMA 1H0DB 1PKQA 2VSCA 1S7WB 3K8LA 1ZLVK 5JOEA 4MA8L 5C0BA 5I73B 1HSAA 2D3VA 4DKFH 4FQ2L 5FGCB 1KYOJ 4X99B 4XPBH 4FXGA 2NXYD 1AKJB 2AEIT 4NNPH 3VRJB 4GG8B 3HZKA 5DXWA 5F7EH 3RWIB 3ULUE 4L4VA 3IS0X 4U6YB 1I7UB 4Y5XA 4LCCC 4QHKI 4IEFB 5I76B 1INEH 3BOVA 3KS0J 3TZVA 4Y4KA 1BQHB 2WP3T 1KPVA 4XVSH 4LSPH 4GMSL 2WIMA 5LQBL 2P8PA 4P3CL 5JORB 2H1PH 3B5TA 5CJXA 2VLKD 5IR1A 2B4CH 1NCWH 4BM7A 4P46D 1B2WL 4Y19B 1PZUB 1U8MA 4C58B 1FVDB 1I8LA 4XWGH 3NTCL 4LCIL 4F7CB 3WNPA 1GGUA 5GGSA 1S7SA 2AEWA 4MXWH 4U6VH 1KFAH 5DJ6B 3MC0A 4N8VA 3EO0B 4OD1L 1I9EA 4GBXB 4OLUH 2J6EH 4PJXB 3H3BC 3IYLW 3B9KA 4Z6AT 3OKDA 4HMCA 3FB6B 2DQGH 3B2VL 4F2MA 1I4FB 3VMNA 1GC1L 4IIQA 2IWGA 4ZOAA 5D7JC 3Q6GL 1KIRB 4X7TB 1MCJA 4GG6E 5J6GB 3MUY1 1ZANH 4Q9CA 3WLWC 2D03L 4RAVB 1R0AL 5E2TH 4MJIE 1R3LA 4NFCA 1FFOA 3SY0B 2AJSH 4U6HB 4WWKC 4EN3D 4C56A 4LRIA 4KHTL 4Z7WE 1A6TB 2W07A 5CUSH 4V2CB 2AJYL 4KY1L 1GIGH 2BVOB 3U36B 2QADD 1LK2B 4KJYB 4U1HB 1WAAA 3CVIH 4ZPVB 3MBXL 3A6BH 3MXWL 3GJEA 1J1OH 1NPUA 1OGAA 2XNAB 2NZIA 1VPOH 2F54B 5SV3A 3TJHC 3MA9L 4M6NL 4NOBA 3D5OF 1X44A 3VFVB 4PD4K 1QA9A 3NAAH 5ID1A 5JO5B 4NJ9H 2LAGB 3UEZA 3OHXA 1XGYL 3SKMA 1MCLA 3SDDA 3MTRA 4NQUA 5GZNC 3D6GA 5CSZA 5C0IB 5KJRL 2R4SH 1Y6MR 3PWJA 4OTXH 4RX4A 1E4XH 5DDHB 3BEVA 3EJZD 4EKXA 1T7XA 4OGYH 4QGYA 1WITA 4YQXH 5HYSB 2BSRB 4DOHE 3PGDA 1G6RH 5BRZB 5IB4A 1E0OB 3QUMA 3WJJC 4IRJD 1NGPH 2VLLB 1DJSA 4EVNA 4Y7MA 2AABL 1KG0A 2QJDA 5IEHA 1HYRC 3ES6A 3FO1A 3HR6A 2KDGA 2QSCL 1J0HA 3JV5A 1IKNA 2R4RH 4JFDA 4UT9L 1W0WA 1CVSC 4X6FB 5GZOD 1PEZA 3UZEA 3WFZA 3MNZA 1PZ5A 3PGCB 1A1MB 5AEAA 4HUXA 4XXDA 1FFNA 4RQQA 3IKCB 4NJAH 5TH2A 4I0CC 5JA8B 1L0YA 3MNWB 5HPOA 1Q0XL 43CAB 4HXBH 2BERA 1NC2B 1DSFH 1G1YA 4N0RA 4F57L 2A9NL 5B21A 4EN3B 3VU2A 1VSCA 3D0VB 4QRQA 3HKFA 3D0LA 3IXTB 2X4QB 2QADB 3BIKA 4F8TA 1OTSD 4FABH 1CE1L 1Q94B 3VWJD 1WGOA 3VG0H 3FT3A 3N0PB 3QG7L 1GRWA 3VGFA 2E27L 2EO1A 4NO0A 3GI9H 5EIIB 1F6LL 4K9EL 4JY4A 1E4XI 4HKZA 4LVHC 3QJHA 4OQ1A 5E70A 1TENA 1ZS8A 3CX5J 3LS4H 4JRXD 4DKFL 5HD8C 4DVBB 1RVFH 1JPGB 2NY5C 3M1BB 3DX8A 3TO2B 4D9LH 4PJDE 5FYKH 2YPLB 2VR9A 3SKOA 3W0WE 1FZJA 2Z8WC 2F9BT 2HJKB 1HWGB 4MJ6B 4JFFD 4WUKL 4XVSL 5HI4C 3MJ6A 4X9FA 4ODUB 1F00I 1OAZH 4HIHA 3BRGC 4ONFL 1NEZB 5D1ZC 5C2BH 4MNHA 5C92A 5JPMB 5EBMB 4JG0H 4Z5RA 4XPAL 4YXHH 2ICCA 1NCWL 4FP8H 4XP5H 4LCUB 4J8RB 3D1MC 5INCB 1JJUA 2ZUXA 4U1GB 1ORSA 3I75B 5D2LE 3DHMA 5C6WH 4MXWL 1KFAL 2WSKA 3EOYG 4OLUL 3ZKND 2J6EL 4YBLB 1ONQA 5EUOE 5FUZH 4M5YH 1MLCA 1PG7W 2YD2A 2Y1VA 4OUUB 4HWUA 3CFDB 5E2VH 4ZUUA 2VOTA 4N5UA 1KN2H 1XZ0B 3INUH 4WDIB 3T0DA 2UYLA 4U49A 2A83B 1UA6L 1FNSH 1A21A 5FM4A 1PX4A 1QLFB 4NO3A 2YBRA 4PRDB 5E2TL 1IAMA 3RIAK 1G9NL 1SVZA 3HC0A 2AJSL 5ISZA 2EXWC 3KYMB 3PV6B 4EBQL 3VWKA 4G6KH 4X83A 3OXRB 2BVEA 3RKDC 2VLRD 1GIGL 2QLVB 2G75B 4MVBC 5KVFL 3VFNA 3A6BL 3F7YA 4MD5B 2GUOB 1IL1A 3EW3B 3LD8B 1VPOL 4JRXB 1D5XB 3CFJB 2J8UA 1T7YA 1T3FA 4FTVD 3BIAX 4WJ5B 4CDHA 5I73C 4NJ9L 2BNRB 4APQD 3NCEB 4H1LA 1RJYA 5IEKB 4CU6A 4OZHA 4YEEA 3MFFB 3SKNB 4OD3H 4OTXL 4PJCA 1E4XL 1X4YA 3CUPB 1FZKA 2HLAB 1W8NA 2E6QA 4OGYL 4YQXL 1ZHKB 3W5MA 1G6RL 2G5RA 1WWWX 1PAMA 3O45B 2BK8A 3CDFA 1N0XH 1NGPL 2W65A 5D7KE 1VADB 3MRRB 3V4VH 5I30H 1MFAL 3WJLA 4Y2DA 2GTZB 1OTUC 4TVPD 2DTMH 5IFJA 2CKBH 3FQTA 4GRMB 1A6WH 2ENYA 15C8L 5DQJA 3T3MF 4JB9L 4JZJB 4ALAH 5EN2A 1S7TA 4RGNE 5J3HC 2CLRB 4LQFH 4UIMA 3OR6A 1RZKH 4YGVA 4YHIA 3ULSB 1EHLH 2CXGA 1DQJA 5A16A 2X4UB 4ZAKC 4GBXC 2B1HL 3I6KB 5FA3B 3PIQB 1HHJA 3VA6A 1HIMH 4JJ5B 3GGWA 3DSFH 4NJAL 3ARGA 3QI9A 3U83A 1Q1JH 1ZT1B 3SJVA 3ZSTA 1NQBA 1HOCB 2GJ6E 2ERJB 1U91A 1DP0A 1DSFL 1M4KA 1P9MA 1ZA3B 1T5WA 2VLRB 1BLNA 5FUCE 1QBBA 1CFVH 1TETL 1J0JA 4F58L 3O3BB 1U8NA 2HFFB 5ANMB 3UTSB 3PWVA 3C2SA 2APWA 2A77L 1BF8A 3GI9L 2DQUH 1WBXB 4FTVB 2VAJA 3U9UA 1AP2B 4RISH 5H35A 3C87A 3WEXA 2AGJH 2K3TA 3BPNC 2X89D 5DO2D 4Z76B 3LKRB 3LCYA 2NXYC 2M1KA 4M1CD 3LS4L 5D2NA 2OJZL 4Z7NF 5CEZD 4FMFA 1RZIB 2I9TB 1UWXH 1C5DA 3UX9B 3R0MA 1I3RB 4D9LL 3QDGA 4XCCH 1GOHA 1OF2B 1U95B 2GHWB 4DGYH 1IE5A 3MLSH 4BZ2H 4JFED 2FL5B 2OL3H 2VLJE 1YMHA 1OAZL 2GCYA 2IANE 4P46C 3AMKA 3X11B 3NZ8B 4GO6B 4JG0L 2LTQC 3MRGA 3WL9A 4YXHL 5B3NA 2F8OA 4XP5L 5FFLA 2XICA 3RWEA 3JWDC 5DJ8A 5DJDB 2VXQH 1UZ8B 3VXSE 4LHQB 2E9BA 4WI4A 1FL6B 1ZVSA 3TC9A 5FUZL 4M5YL 1S3KH 3KPLB 5DD5H 3HFML 5T3XL 1DQLH 3MJ8A 5E2VL 1XCQA 5DRNA 3P4MA 1KN2L 4WU5B 1RU9H 1U3YA 1ZSDB 3INUL 4U7KA 1IAKA 2X40A 2CGRH 5IK3B 4U1MB 5I1LB 2VQ1B 2B20A 4EN3C 3H3KA 4MDIA 5E5UB 2ZG1A 5LBSH 3DVIA 4M8QA 4NKOB 4UINH 5JW3H 1QVOB 5HY9A 1EBPA 2QADC 4KJWD 3VXME 4CMMA 3S9DB 1A7NH 2BDNH 3GBLA 3WHXB 4G6KL 4LL9A 1I8MB 4P59L 4YC2B 4GG6B 1LO5A 1MCQA 2EO9A 2Z93A 1P1ZB 5IHZB 4LPUA 4L3CB 4ENED 1QHPA 1T4KB 1ZAGA 2OS7A 4X5WA 3AU1A 3EJZC 5EUKA 1U8IB 3DVNB 3RWDB 4JFEB 1LE9A 4OD3L 2Z8VC 4JAMA 5IOPA 3DV6B 4MLIA 4N68A 4IRJC 5FXCH 1WFTA 1MFDH 3ZE2F 3VD7A 3ZKSD 4M1GL 1OP3H 2FHCA 4LMQE 3GSQB 2UZIH 3C08H 5E56A 5I30L 3FQNA 5GSRA 3V4VL 2Y9RT 1KB9K 2DTML 3MRHB 5GZOC 1P4IH 2CKBL 2VZSA 4LIQL 4WUUE 1A6WL 4MA1C 5GRVL 3DI3B 3E1F1 4ZODA 3B9DA 5TE7H 4B7IA 4HS3B 4MA3B 4QNPF 4LQFL 4DOHB 4KTEH 3W0WD 5GISH 4U1GC 3P0VH 1RZKL 3O2DA 4LLVA 1FFRA 1TMCB 4MB5A 4B50A 1EHLL 3DXAA 2KQMA 3DURA 5DRWB 1CXEA 4ZUWA 4NQSB 4F7MB 1HIML 2GITA 3VMPA 4JCLA 4P2QE 1NANH 4JVUA 5MI0B 5F1NA 2RGSA 1J10A 3EOTH 1QQDB 2C7UA 3JXAA 5HGHB 1XR8A 1OTSC 3BW9A 1WSST 5EU7E 3O3DA 2EH7H 3VWJC 3RKPA 3D3VA 3T2QA 1WQVT 1U93A 4JFQB 4M7ZC 2Y4SA 4OCWL 1KBGH 4X98A 5T3XE 2XQYK 3OAZK 1D5ZB 5KOVC 3QNXB 1FNEB 1YEJL 1U58A 2XFXB 4M62H 3QQ3A 1LILA 4WEUD 4MS8D 1EAJA 1YNTB 1I7TB 4UT7H 3R1GH 2ZKHH 1LQSR 4RISL 3TO4D 4NP4L 2AGJL 1VGKB 1QO3B 4J3TA 5D93B 2GJZA 2L4OA 2BOBB 2AERT 1HHGB 3MV7E 4KWUA 4I2XA 1ADQL 1TZGL 3ULUF 2Q8AH 5EC2B 2PW1B 4FS0A 4LNVA 4Q2ZB 4NNYB 4R0LA 3V5KB 3FOLA 4XCCL 3WYRA 4LEXH 1LGVA 1FZMA 2Q76A 3CPLB 5HPMB 5C08D 3JV4A 4R3SB 3PF2A 4MD0A 3S37L 3VH8G 4Y1AA 4BZ2L 2OL3L 1FLTX 4JE4B 4XC1L 3QNYB 1G0DA 4D8PA 1FG2B 3V0AC 3W0WB 3AUVA 2NNAA 1HXMA 3BUYB 5HJ3B 5T33H 1V7MH 2VXQL 3CD4A 1K2DB 4MXQD 1EGJL 5GIRA 4F7TA 4RWYH 5E9DE 2R2BB 4XNQA 4LU5H 2YXMA 2HA1A 1S3KL 5DD5L 3P2TA 5IFHH 1OM3L 4GG6F 2OXGA 3EAKA 3DX6A 4P4RA 4MA7L 3SE3A 1RU9L 5D2LB 2ERJC 3AC0A 5F8QC 4EOWH 1P7QA 2HJFA 4I77H 4LLUB 4H88H 2AJXH 1L7IH 4I8DA 2DM3A 3FONB 4YDJA 4E5XA 5ITBH 3HE6A 5HYFA 2DBJA 1LP9E 4QRTA 5B3JE 4CJ1A 2FX8H 2YKLH 2BDNL 3TO4B 1F45A 2VIRB 3AY4A 2DM4A 5I17B 3GB7B 2E7CA 2JJVA 4D0CA 2FBJL 3DROA 2EDNA 2MWCA 5SX4H 1J12A 1Z6JT 2SEBA 3RUGA 5IVOA 1ZTXL 5FB8B 4APQC 1IAOB 4JQVA 3MCG1 1H3VA 4U3HA 4ZFFA 1MAKA 1MFNA 3CFCL 4HUUA 4QOKD 1NAMH 5B38G 2Q7YB 5JLZA 3FQXA 3TBYA 4JM4L 1QLEH 5KSAB 1HEZB 4L3EA 3V52L 4W6WB 1MCCA 4U0RB 4ZFZA 5CEXA 1QRNA 5MEQB 3FCTA 1ZVHA 5FGBC 1PX3A 3PWLB 4RNRB 1A5FL 2UZIL 3T77A 4I1NB 1FO0L 3C5ZB 4O2FB 3MRJB 4YFEA 1DBAH 1P4IL 3FN3A 3QIBB 4L8BB 5DK3A 5TDNA 3DETD 5IM7A 2F74B 4NGHH 1BWMA 4PRPA 5TE7L 3KPNA 3L9RA 5I1JH 3X17A 1LO2H 4KTEL 4GRWH 3MRMB 3P0VL 3N1MC 1U2CA 5DI8B 3BISA 4BSJA 1OAKH 5L2KA 4XB8A 2FNBA 4NM8H 4JRYD 3WN5A 2CQVA 2YD7A 1R3JA 2I60H 2A6DB 5EO9A 2VLJD 2NMSA 4G8GD 3QDJD 4MCYA 2DIAA 3O3EB 4RGNB 2EDJA 1C7SA 5AWNH 1PGRB 1CVRA 3PWUA 1UJ3A 5IWLC 5SX4I 1ZGLB 3CX2A 3CFEB 3NBNA 2EH7L 1P84K 4M00A 2OYPA 1LWRA 4J4PD 3KJ6L 4KRNA 1MCOH 5SWSA 3RGVA 3ZLQC 2PTVA 1KBGL 5J13B 5C0RH 1R5WA 2VB5A 1AD9B 4S2SA 1T21B 1QLRA 3A67H 4WFHE 4M62L 2R8SH 5FHBH 4ORZC 4PV9B 5DO2C 1T7VA 4WIQA 2NY4D 4UT7L 1SEBA 3R1GL 2ZKHL 4M1CC 1J0IA 1K4DB 3QZWG 4ZO7A 1BPVA 3ZT7A 4QY8B 3PDOB 2OTWB 5KBNC 1VA9A 5GPRA 3H7BA 1PSKH 3FRPA 4PJDF 2L7JA 3DNKA 3VH8B 4AMKH 5CAYB 4XCYA 4WGWB 3QUKA 5GGRY 2Q8AL 5DJCB 1BREA 4KUZL 2DQTH 3MR9B 4XPHH 1RIUL 3ME0A 2UWEA 4W6XB 5GS3A 1NCBL 5IF0B 2WZPD 1BFTA 1XT5A 3RWCB 3W5NA 4E41E 3LKSB 2IQ9H 2BC4B 1MHCA 2CIIB 3JZ7A 4M61B 2HT3D 4U1JB 3V5DA 3BESR 5EU5A 3AAZB 3WFEH 5EZJB 5D2LF 3T4AB 1TPXB 4UDUA 5A2JH 3JVGA 3HLAA 4PPTA 4UILH 1N64H 5DHYA 4PJGA 4YPGB 2NXZD 4TRPH 1SY6A 4JRYB 5T33L 1V7ML 3LKQA 1WIOA 4ODHL 1CG9A 1JF5A 2VLJB 2IANB 5DRZB 1K8DB 4ZD3H 1VFAB 3QDJB 1OP5H 2VJXA 3CSGA 4WV1C 5F1IA 2VDRL 1J05A 5IB3A 1BP3B 4LU5L 5TDPA 5DK2A 4YFLI 4CU7A 5SWZD 4PUBH 1C08A 3QEGH 1XGQB 3A6OA 1TIUA 5MI0C 5T3ZD 3GIVA 1KN4H 4L4TE 1C12A 4KRMB 2E6PA 1VACB 4HH9B 1J8HD 4EOWL 5KSUA 5FYKD 1RJLB 4EDWL 5BVJA 5KSBA 3VXSB 4KJWC 5INDA 1G6RB 5B39A 2WM0A 2X70B 5I16A 2AJXL 1L7IL 1NCAL 1X4XA 1RUMH 4DGIH 2QSTA 3GKZA 5ITBL 2NLJB 1TTUA 5F9JB 2YKLL 2NY4B 2P43B 5F3BB 5L6YH 4KKBD 4HFUH 4MQSB 5T1KB 3I6LD 2EDKA 2AAVA 3VMOA 5JHDE 5B38B 1CN4A 4Q7DA 4PR5A 2F15A 4ENEC 5J9PA 1TTFA 4K3GA 3BXNA 3V6ZA 4ZPTA 5LAXB 3VXMB 4KI5D 4J3XA 3QEQA 4OD2B 1OB1B 2H32A 3LIZL 4LSVH 4TULH 1KCRH 3REVA 3PHQB 1ZHBA 1QSEA 3MX0A 3LQZB 2GW5A 3MLTA 2EDQA 4ZO6A 3VD4A 3H9SA 1GYAA 4GKSA 4L8SB 1J87A 4IRSB 5F9DC 4NWTL 1S9VB 3UTTD 1OT2A 5I9QB 5LXGH 3FQWA 1LDPH 4V1DA 1J11A 1MIEL 1LDSA 1EFXD 5D1XB 5FYKU 5C0EB 5I2IA 3MV7D 2F8XC 1CI5A 1LHZA 1M7IA 1EO7A 3U2SB 3P0YL 1H3GA 5D6CA 5F7MC 1DBAL 1YYLH 4ONHA 3ARBD 5BJTA 4F7EA 2IBZY 4NGHL 4Y16A 3T65A 1FG9C 1T2XA 1UXWB 4MDJA 1CIDA 1F3RB 1URLA 5F3HA 5EDXA 4Z0XA 5JDJA 5HHOE 3HG1A 1VKXB 2ZUUA 4XXCA 1GZPA 4BK4A 4M7KH 2I60L 1J8HB 4WUUB 4NNXA 3VCLA 1NBYA 3V8OA 1D6EA 3UTQA 3RAJH 2OMNA 4PJ8A 2YRPA 1FFQA 1AO7D 4OCNC 1GOFA 1IC7H 2JB6A 1MWAL 2ZSVB 1BFVH 5EU4B 3IFPB 5MENE 3FN0H 3QZWB 3P77A 2EICA 3D2UB 4HS8H 3K7UA 4MS8C 3WBDA 1LD9B 5C0RL 2ZOKA 1X7QB 2B2XL 3VE0B 4NCDA 3TO4C 3PP3K 2G2RB 1PG7H 2JE8A 4ERSL 5FHBL 2R8SL 1I8IA 1MCEA 2A0LD 3SKJH 3WFDH 3QG6B 4YNYA 3M8OH 1XF3A 2Q6WA 1KLUA 4XCEB 1NBZA 2ICEA 1FSKB 4LASL 3C6SA 1BIIA 3ARYA 1T0NB 5EU6A 2JELH 3MUGB 4OT1H 3RX8A 1MJUH 5ICYA 1PSKL 3KLAA 1KF9B 4AMKL 4NHUA 1CD9B 2D7PA 3BQUD 3UTTB 1F58L 1YMME 3S4SA 4P57A 3U4EB 1HWHB 2DYPB 1HILB 2DQTL 4XPHL 4OUOA 5DRXB 4AIOA 4EDXA 3U4BH 1JE6A 1OWWA 5ESAA 4HK0B 3MV7B 3RU8H 4UUJA 1QNZH 1RUKH 1SJEA 1NJ9B 3DOSA 2CRZA 3FQRA 4RRPG 4U0RC 5IT2H 1FP5A 3X12A 1KB5H 3NCJH 2VKXA 1U3HA 2QQQA 2BCKB 4R7DA 2P5EE 5ADPL 3CH1A 1JN6A 4BYHA 5C07A 3M07A 5FKPB 4MXQC 2MQCA 3L3DB 5E6IB 4LHUD 2EIZB 1H8SA 1N64L 3MMEA 3T0EE 1RZGB 3LKOB 2XZCH 3ULVH 3T8XA 4BSVB 3H6JA 4RFNC 3GSXB 4PUBL 4X9GA 5ICZA 4NFDA 5JW4M 3ZDXE 4ODTH 2BSED 4NWUH 3TVMA 3MV8D 1KN4L 3QO0A 4K7PY 2X44D 2YD5A 2Z91A 3IDIA 2NTFA 3EDDA 4MNGA 5E9DB 3MV9D 4PD4J 3UJTL 3S5LG 1RUML 1T6WA 3G6AA 4DGIL 4R2GB 4YO0A 5DJYA 2CKBB 2B4CC 3LN4B 5L6YL 4HFUL 3TIDA 3MZGB 4QTIL 2J2ZA 2YN3A 5F72S 2JJTC 1X9QA 1BJMA 1GGBH 9CGTA 2OQJA 3SDYH 5DFTA 5KAQG 1LP9B 4OCYL 3X13A 1SYVB 4X5LA 4ZDHB 2EIEA 1IC1A 3S35X 3MCKA 4GKNA 4XP1H 1ITCA 2WQ8A 2F53E 4LSVL 1N5AA 4CDGC 4RA3A 2VL5A 5EBLB 1DQDL 4OZ4B 5KS9A 3SDCA 4BZ1H 3QXDA 4DCQB 1OAXH 5DC9B 1AJ7H 1MJJA 4Z7VE 4CUCA 3V6OC 4L4VD 4WFFD 1FIGH 1MNUL 3E6FA 2ZG2A 1AXTH 1MQKH 4DKAA 3MLUL 2A38A 2ZNWA 1U8KA 3VG9C 3FFDA 2AKRB 3EYOB 3DETC 5DYOA 3GSNA 4WWID 5LCVL 4WW1B 5T5FH 4ZTOH 1TPXC 2VQTA 2IQAB 1SVCP 4O2CB 4YDKL 3IFNL 5DEGA 1PDKA 5GJTH 4NYLB 5A3ID 5EORH 4JLRB 4NQCE 3EO1B 1CFBA 3RPIB 4L29A 2BRQA 2QKIA 1V3LA 3B9KD 4PJAA 5GGSY 2D9CA 1JV5B 4M7KL 4X4XB 2AK4E 1MUJA 4Z95H 1YUHA 3HMXH 3HZVA 1OQXA 4J4PC 3LN9A 2MCPL 1BFVL 1BVLB 2OL3B 3QQ4B 4JN2A 2AJZA 3BIBX 5C9JB 1QSFE 1S9YA 3CDYA 2FD6H 2RCSH 3BH8A 1DBJH 3O9WC 4RFOH 2VRAA 3I6GA 2NY4C 5F9AC 1ZLVH 4L1HA 1ZVYA 1PG7L 1NBVH 3SKJL 3WFDL 5BQ7A 2FCBA 1MFBL 2QQKH 3M8OL 5HVWA 2XA8L 3GNMH 4XPTL 1OOAA 1YC7A 4YK4B 4G43B 4KVCH 3BAEL 2JELL 1U2HA 2RBLA 4OT1L 1M1SA 1FL5A 1N59B 3NIGE 4FFZH 3SDDD 1B6UA 4BSWB 2BVPB 3VFOB 1YPZE 3MNVA 1KJMA 2HG5B 2I26N 5HHPA 2HT3C 2A6JB 3KXFA 2KKQA 2CLZA 5DC0A 1QNZL 1RUKL 3GSUB 3LRSB 1NAKH 1WC7A 4TNVF 4BFBD 4QEGA 1DUYA 3F8UB 4P5MA 3O4OB 4MB4A 1EO5A 4KPHH 4LKXA 5L0QB 2NXZC 5CD5D 3ROLA 3IETB 4U05A 1N8ZB 3KYNA 4OBRA 1YYML 2CLVA 4LP4A 5F96H 4KGLA 5F7HA 3WO4C 5CD3B 2FATH 4E41B 1R5IA 3CFKA 2CUHA 1SJHA 1ED3B 1JGLH 2I07B 3FB7A 1UWGH 5FO8B 3OKNB 3S5LB 3KPOB 4UI2A 4QXUH 4ODTL 1WIUA 1G7PB 3RZWA 2EDLA 3RNKB 4QO1A 3VXUA 5FYLH 1D5IL 4G7YH 3L5IA 5AD0B 3FMGL 1LP9F 5B3JF 1XAUA 3C2AH 5E08L 3D87B 5GS1C 4YWGH 4J1UA 1NFIB 3TH4T 4KKBC 3DGGA 1IQWH 2NY3D 1FJ1A 4NC2B 4WWKA 4BH8B 4D94A 3CZJA 3HC3H 3MRKA 4L4TB 3L95B 2CUIA 2X2YA 3TCLA 5DS8A 2ESVA 2A1WL 1X5GA 5E5RB 4KI5C 5EU7C 5B4MD 1X6NA 1GGBL 4IMLB 3TM6A 2A73A 4NZJA 3KDMB 1ES0B 4G6FB 3VXQB 3SDYL 3V0VA 1FSKC 3H42H 4PJFA 3HI6L 3QUYA 4OGXH 4OLEA 3U30B 3VD3A 4L9LA 5GRZA 5E5MA 4XP1L 4N0YL 3QO1A 3K0WA 4U1SB 3C9NA 1V3JA 5JHDB 4JO3H 4P2YA 1JF1A 3G5XA 5GQBA 4FQHA 4LRNH 4BZ1L 3WNLA 1K9TA 1OAXL 1M7DA 2A6KA 1FIGL 1AHWA 2R1XB 3QXWA 1E4WL 5D72H 4X6CA 2Y06L 1D5MB 4NPYA 3C5SA 4QT5B 1AXTL 2R15A 2BSSA 1MQKL 4PV8A 3AS2A 4WY7L 4K94H 3RY4A 1RZJC 3ARBC 5LGHH 3D85A 1IM9D 4XI5D 1KENH 4ZTOL 1AR1C 1YMMD 5CSGA 4Z18A 3T2NL 5IG7A 3RBGA 4ZSOE 1CFSB 3R4DA 4P9HH 2FO4B 4FFYH 2AVGA 2XWJB 1J0KA 3FT4B 4JDTH 4JQIL 5GJTL 2DQEH 3QEHA 1B88A 1MH5A 5EORL 2R1YB 2P5WA 5TJWK 4OI8A 1RY7B 1MI5A 5I71B 4JZOA 3CDGB 1KJ3H 4KDTC 4Z77A 5ABDE 3UYPA 1C16B 3OJDA 1E27B 3SDXE 1ROWA 3HMXL 3DMMD 3N1GC 1D9KA 1NL0L 3B5GA 4RBPH 1OTTD 1JPFB 1NGXA 2XN9E 1CCZA 5HHOB 4I9WD 4XNZB 5H2BA 4PGEB 3GSVA 2VWEE 3JTTA 5ISZD 2F58H 2YZ1A 3D39A 1DBJL 3LEXB 3ZKMD 4ZUSA 2A0LC 1ZT7A 3TNNA 3GMMB 3F5WB 4HX1A 1ZWIB 3UO1H 4AJ0A 1NBVL 4UBDD 4NDMA 2QQKL 5MENB 4R4FL 3FOMA 5C0ND 5LWYL 1X5JA 2EZ0D 3GMPB 2YS4A 5EOQL 3B9VA 3BQUC 1IGYA 3RIFF 3PJSB 2XXCB 4I3SH 2D4DA 3BZFA 3HRPA 5I1KH 4OIIH 2CPCA 3GMQA 1I7RB 3AS1A 2OTUB 2HVKB 3CU1A 4A2MA 2H26A 4FFZL 3UYRH 1A6AB 3HN3A 3WKNA 3L5JA 3MXVH 3KPQA 4BJLA 4TSAH 4KKAC 3HNVL 1QP1A 4HIIA 3QEUB 2FJGA 3EGSA 3KPRE 1IM9B 3G6JE 2DWEA 2P24B 3EYFB 2LE9A 1HQ4A 1YMMB 1J5OH 1K4CA 5EH1A 4PGDB 4LLQB 4U1KB 4KPHL 1YEKH 32C2B 3SDAD 4Y2DD 3MROB 1JCKA 4PJHE 5F21B 5F96L 2FJHA 1BZ7A 4LDOB 3IU3A 1F3DJ 1FE8L 1TJHH 5C1MB 4XCFL 5KAQF 1NAMB 2P5EB 4WNQA 1W72H 1UWGL 2D31A 4TVSa 2YD8A 1TVHB 1L9NA 3DMMB 5EBGA 3P4NA 2DL9A 3ARGD 3P30L 4E9LA 1FLRH 1KCKA 3LV3B 2ADGA 3G08B 4LP5A 5FYLL 2VXVH 3U0TB 3C2AL 5ENWB 4YWGL 1NGYB 3U46B 3K2MC 1KIPA 4W4NA 4PJ9B 2Y7QB 5K93A 3HC3L 3ZHDA 4HWZB 5D70L 5J6HB 4S1SH 4Q6IB 4U7SA 4MX7B 2MQ3A 3DYMA 1AGEA 3QISA 2AI0H 4GRWB 4PRBB 3MYJB 3U9PH 3GBNH 4XRCA 2ID5A 3K74B 1UVQA 4OF7A 3VDCA 1MFEH 1FGVH 4YK4C 1Z5LB 5BZWA 3MA7B 5IQ9B 3BWAA 4YUEH 5E8PA 2IBGA 1H0DA 3CFBB 3TA3B 1S7WA 4WEBH 5DFWH 3KJ4C 1DANU 5DURD 2WUCH 4KROB 4EIGB 3GBML 5IKCB 1KB9J 5CP3A 4JO3L 3LEYH 1MWAB 4X99A 4HEME 4IOFD 1AKJA 4Y5XC 3VRJA 4GG8A 4LRNL 3ZL4L 5F1OB 4Y4KC 1QSVA 4OF8A 4J2XA 1OAUH 2A6IB 3BKYL 3DV4B 3RWIA 1G84A 5LGJB 3BKCL 4U6YA 2EKSB 1I7UA 1X5XA 5D72L 3GRWA 5I76A 3SDAB 4XTRD 5CJXC 1BQHA 5T1DL 2WLZA 3RVXD 4HPOH 4K94L 3T2PA 3DYOA 3O4OC 5I15H 4KDVA 5LGHL 5JORA 4Z7VB 1KENL 5A3IC 3ARZA 4RA0C 4Y19A 1FVDA 4P9HL 4FFYL 2EE6A 1RI8A 4ODBD 4JDTL 5IB5B 4X7CC 3B9KC 1L9MA 4F7CA 4ZXBD 4NCC1 4HUNB 1YN7B 4BQ6A 5DJ6A 3EO0A 4GBXA 4AL8L 4IIQC 4PJXA 2F5BH 3AS0A 1KTLB 4HH8A 3FB6A 5FK9B 3SGKC 1I4FA 4D3CH 2AEQH 5K59E 4UV7L 4PJIB 1G7MB 2NZ9D 3FO9B 3EJJX 4JR9H 4NQCB 4M43H 3ZKQD 1KIRA 1CR9H 4BKLB 3W9EB 4X7TA 1HHHA 1P2CB 4IHOB 1IGJB 5J6GA 2VDMH 1DBML 1RJCA 4HWBA 3MGOB 1FGNH 2HFGH 4MZ3A 4HUMB 4WHTB 1IC4H 2AK4B 3SY0A 3KAAA 4OZIE 4U6HA 1ODAA 4PIRF 5I74C 4JG1H 5F88B 1A6TA 3U6RB 4NFBA 4G9DB 3HAEG 2BVOA 3U36A 1LK2A 5FYLE 4KJYA 4U1HA 4ZPVA 4CAGA 1QSFB 3F7QA 3O11B 2CMRH 2XNAA 3Q1SH 2F54A 5IHLB 5JMOC 2VITB 4WHCA 4NQDE 3SDDC 1FNGB 3VFVA 3U30C 4XPFL 5JO5A 1XGPB 5J06A 1N6UA 5C0IA 4XMKH 2ZUSA 1VFBB 5DDHA 2J5LB 1AE6L 5CD5C 3OKMB 2VZVA 5HYSA 2BSRA 3N50A 2J12B 4J3WA 5BRZA 3IAQA 1EVUA 2E6JA 2VLLA 1YEKL 4WI9A 4FQIL 5L2JB 1X3DA 4ZXBB 4IBLT 5BVPH 3IF1B 4F80A 3V6FB 1TQCC 4TTDD 5HHQB 3W9DB 1LO0H 1IM3A 5I18H 4LVNB 1FAIH 4X6FA 1IAIH 3DXAD 4HULB 5E8OB 3NZHL 3ZDXF 1YEIH 1VERA 4H8WC 2A9MH 4DWHA 3PGCA 1QOKA 1WWAX 2CDEB 5I71C 1A1MA 1CFQB 1L6XA 3IKCA 3TBVA 2B0SH 3DSNA 3O41B 5BCAA 1TJIH 3RX7A 2LV4A 1TVBB 3FO0H 3BEWB 3MNWA 43CAA 3UXFA 1VFMA 1NC2A 4L5FH 1NFDE 2NY3C 5HDQH 4GW4B 4L8CA 4EN3A 3IDYB 3D0VA 1N6QH 3D3VD 2VABB 3IXTA 2X4QA 5T1DH 1EMTH 1Q94A 3KR3L 3WDHA 5B4MC 1RMFL 1YDPB 2C3VB 2C1PB 4FXLA 4HG4K 5EIIA 5DLMH 1LEIA 4E42B 4F37K 4Z78B 4YFLF 4R7NB 3VW3H 2N7AA 4HQQH 3L3HB 4TUJA 2GY7B 1RD6A 5H94B 4YUEL 3ULVD 4PP1D 4NC0B 5I66B 5EWIH 5HVFB 2WUCL 4Z7VF 4OZFH 2EEBA 1N0LA 4HW6A 4DVBA 3LEYL 2J8OA 1JPGA 3N9GH 3M1BA 3TO2A 5FUOH 1I9JH 2YPLA 3QDMD 3UPAA 1XR9B 1IAII 1J1XH 1EUUA 2HJKA 3ZKXB 3P40A 4MJ6A 3D18B 4XI5C 5DMIH 1QYGH 1FVEB 4XNUH 3BGMB 4ODUA 2HKFH 1NEZA 5I15L 1E4KA 1EEUA 5EBMA 5JPMA 1JGDB 5DVMA 4LCUA 4G7VH 4J8RA 4XHJD 3I9GH 5EPMB 3L5XH 3MJ9H 5INCA 3OGOE 3I75A 4NKIH 1WCBB 3NCFB 3QCVH 5DQDH 1BD2E 1CZ8H 2OI9B 1ZEAH 1C1EH 5CILH 4D0DB 4OUUA 2ORBH 3CFDA 3DMMC 3OAYK 5MERB 4PYHA 4ZSOB 5I1GH 1OTTC 1XZ0A 4WDIA 1RIVH 3IVKB 4M43L 1CR9L 2A83A 1RHHB 3ZKMC 2G60H 1KB5B 3VWJA 1QLFA 2VDML 2VN4A 4PRDA 1FGNL 2HFGL 2P44B 1FZOB 3HE6D 3CFIC 3NCYS 4R96B 4UBDC 3KYMA 3PV6A 1N7MH 1L0QA 3GMRB 3OXRA 3SDXB 5C0NC 1MHPH 2XTLA 2EZ0C 2WNGA 3HMWH 4Q6IC 2G75A 4R9HA 3GO1L 4QF1B 2FYYB 4BQCA 2BNQE 2X7LB 4MD5A 2JCCE 1OD9A 2CMRL 2GUOA 4JRXA 3NIGF 4QRSB 5I19H 1A3LH 1D5XA 3BZDA 2K7PA 5AZ2H 5F7LB 3CFJA 5J89A 3BHBB 1XMWA 4WJ5A 4YHNB 4UTBH 1YPZF 1VEMA 1E4JA 4MHHI 3QDMB 2BNRA 1S9XB 3DO7B 2R29H 5IEKA 43C9B 1MFCH 3MFFA 3SKNA 4HLJA 4HAFA 4L3ED 1L7TH 4JQXC 4HJGB 2V9TA 3CUPA 3LPWA 2HLAA 3PGFH 3SDAC 4OV5B 1QRND 4Y2DC 3B3IB 2ED9A 1WBYB 5ACLA 3O45A 1NMCB 5F97E 5MHSD 1VADA 3MRRA 1EEZB 5C0BE 3E0GA 3S35H 2GTZA 3QRGH 5BVPL 5IBTH 2HVJB 4GRMA 3BMWA 2GFBB 5IFAL 2ICWI 5TFSH 4JZJA 1LO0L 4JY6B 2CLRA 3SO5A 1AI1L 3ULSA 5JHLH 3VRIB 5KVDH 3ARGC 4JM2B 5L2KD 2X4UA 2F5AL 2A9ML 3I6KA 1K5NA 5FA3A 4PJHB 3PIQA 2ZOLB 4JJ5A 1P9MC 3IFOB 3V6BR 1OGTB 4N90D 4X8XA 1TJIL 1ZT1A 3FO0L 4C4KT 4EXKA 1S9KC 1HOCA 3TNMB 3O2VH 2NY2D 4L5FL 5HDQL 4K2UL 1ZA3A 1T66D 5DVLA 4PG2A 5ALBH 1ZA6B 1X5IA 2VLRA 5SWSD 2V5SA 3RGVD 4MB3A 3O3BA 2HFFA 5ANMA 3UTSA 4YHLL 2XIDA 1B6DA 5DLML 3QT2A 5LVEA 3GDBA 4Y4FD 5J12B 3LQAL 3S7GA 1WBXA 4FTVA 1AP2A 2M2DA 5ALCH 5D2NC 4K07A 2O5YH 3VW3L 4AEFA 3G5ZB 4JGUA 5IV2B 4Z76A 3LKRA 4IOFC 5GRUH 3K46A 1FQ9C 2XY1A 2PR4H 2AXJA 2NX5E 3CLEL 2ZP0T 4XAKE 1XH3B 1H3XA 1RZIA 4C56E 4EQ2A 5FV1L 2I9TA 1A1NB 5DWUL 4YIQB 3N9GL 5LGKA 1I3RA 4XTRC 5FUOL 1I9JL 3IDGB 3RVXC 1QHOA 4FQ1H 5IIEB 1OGAE 2FLBT 1OF2A 3CX5K 1NCUA 1U95A 5I8KH 3OB8A 5IB2B 5FGBA 5DMIL 2FL5A 1FCCA 1NKOA 4XNUL 4M3JA 3U1SH 3HZMB 1U8HB 3X11A 3NZ8A 2XYCA 1NKRA 4ZXBC 3OR7B 5MP6L 2YOCA 4G7VL 4LLAA 3A6CL 5HHXH 3MJ9L 1RK1B 5DJDA 4ZTPL 2X1WL 4LVNC 1BECA 2BXZA 2CR3A 3OWEA 1VB9A 3QCVL 1CZ8L 1FL6A 2NZ9C 1ZEAL 2QR0A 1C1EL 5CILL 3SDXF 3GJFH 3KPLA 2NY2B 2WBJB 1B90A 2ORBL 3ULVF 1JGUH 4WU5A 1ZSDA 1RIVL 3LOWA 5IK3A 4U1MA 5JIKA 1MPAH 5I1LA 2VQ1A 4K7FB 3RWHB 1MJ7H 4CJ0A 1CQKA 4LGPB 3GEWB 5KANG 4JFDE 4NKOA 2BHZA 3OJMB 1QVOA 2W9DH 1CU4H 3F7VB 4Y4FB 4PRID 3WHXA 4I3RH 2HRPH 2V7HB 5AAWA 5E2WL 1MHPL 4KV5E 3HMWL 4U3CA 1JWUB 1B9ZA 3H3PL 4P23D 4GG6A 1QTYT 4HFWB 1JYXA 4D9QE 4TUOB 4OI9A 1HQRB 2AK1H 1X5YA 5I19L 1P1ZA 1EJ6A 3QEQD 5IHZA 3EJYD 1T04B 4L3CA 2XRAL 1JP5A 1T4KA 3PV7A 3NMEA 1QSED 3UPCA 5JNYB 4ZO8A 2MPAH 3G6JF 2R29L 3CK0L 3H9SD 2Q8BL 1NUNB 4J3OC 4MMZC 1U8IA 1MFCL 3DVNA 3RWDA 2J88H 4JFEA 4NQDB 3DV6A 1L7TL 4YDVB 4JM2F 3PGFL 4V1DD 4NRXB 4PJHF 8FABB 1CICD 5HVGB 5FECB 3GSQA 4PRAB 4TTDC 1OD7A 5BV7H 1A22B 2YZ8A 4K3EH 2HJLB 3QRGL 4O2EB 1IZKA 3EFFB 2D7TH 1WZMA 4NC1C 3IDUA 1Q9LB 2P42B 4Y16D 5TFSL 4HS3A 4MA3A 3NPSC 2DBLH 4O4YH 1KC5H 5KVDL 2XZQH 2OI9C 4KDWA 4UQ3B 5FDYA 5GJSL 3L7EB 4NQSA 4F7MA 1KXVC 3MODL 4BUHA 2XWBB 4EUPG 1CGUA 3NFSL 3EOAB 3BKMH 4X4MA 2IGFL 4XC3H 1QQDA 3QFJE 5HHNB 5HGHA 3O2VL 4KHXH 4PRIB 4ESKA 2ZUVA 3S36H 1KNOB 1NCCL 4P23B 4JFQA 1BD2D 2X42A 3GZKA 4NRZA 3O0RL 1D5ZA 4G80B 3UTZB 5E7FA 3QNXA 1FNEA 2XFXA 1NFDB 5CBAB 4F15B 2DM7A 3P9LB 1YNTA 1I7TA 3ULVC 4H20L 2HFTA 4PP1C 5FYJH 5ALCL 4GLRH 4K3DH 4OLZL 2LABA 1VGKA 1QO3A 2O5YL 3IJYB 5IBUG 3STBA 2GJJA 1JGVH 2BOBA 1HHGA 1P53A 4HDIB 4QGTA 3DX9B 1JYNA 3RL2B 1CBVH 2CR6A 2DI7A 4H5SB 2W9EH 5EC2A 2PW1A 4Q2ZA 4NNYA 2E7LC 4FG6D 4YHKH 3V5KA 4EJ1C 1ZHLB 2DKUA 1T89A 1CICB 4N8VG 3CPLA 2BNQD 5HPMA 3GI8H 1G7HB 4FQ1L 4R3SA 3ZT6A 5DEZA 3O2WH 5DQ9B 3ZO0A 2UY6A 2E5EA 3KLSA 1U3HD 3I2CH 3QNYA 4XHJC 3MLXH 4WFEE 3QJFB 3UTOA 1FG2A 1FN4B 3I50H 3W0WA 4YX2H 3O6MH 5BZDA 4LSQH 5E6ZA 4WO4B 1HSBB 3X3GL 3CSYB 3NABH 4X0KB 2Y36H 1YN6B 2YA2A 5HJ3A 2WANA 2CK2A 3BYYA 5DJ2B 4LNRB 5K59F 4NN5B 1U9KA 1S7QB 2R2BA 3IXAB 4QRPD 2FWOB 4LLYB 3C5JB 1JFQH 1UB5B 3ZTNL 3HNSH 3BX7C 5D2LA 2UY7A 4KKNA 5GRWA 2GK0B 1QRKA 3HE6C 1BD2B 4GLRI 4OZIF 1MPAL 4N0UB 4LLUA 2CIKB 1WICA 1B0WA 1MJ7L 2YD3A 3AVEA 1RZ7H 1VEOA 3FONA 3RWFB 3AY4C 3B83A 1ZLWH 1YNKH 2W9DL 2Z35B 3FJTA 3WIFB 3L1OH 1F11B 4G6MH 4LPCA 2HRPL 3TO4A 4PGJA 5TPWH 2YPKB 2QSQA 2VIRA 1DFBH 2VKWA 5EOTA 4PJ7B 5IQ7H 5I17A 2AEPL 3GB7A 3SJVE 4H25B 1JNHB 1W72B 2AK1L 4P3WA 5EFIB 5JXAL 5A43C 5FB8A 2W9LA 1IAOA 1OPGL 4S11A 1DQTA 4YGAB 1KTRL 1KJ2H 1HI6B 1KEML 1N3NB 5IESH 5HVHB 2FECI 2ADIB 3O3AB 5CCKH 2BNQB 3SDCD 5E2JA 2MPAL 4RGMB 4NBYB 2YK1H 2GAZB 1IC5H 3T0AA 6FABL 1HEZA 1SM3H 5F9OH 1CD0A 3QIWB 2XZAH 2AW2A 5MEQA 2FIKB 3PE9A 1F5WA 1KLFA 3PWLA 4M7LH 3HUJE 4RNRA 1FFPB 2P46B 4Y5YB 2GSGB 3C5ZA 3ALPA 4O2FA 3MRJA 4AIZB 2ENSA 4K3EL 2GK2A 4FA8A 1CDBA 3QIBA 4L8BA 1G9EA 3EKCA 2F74A 4GKZB 2APVA 4KTYA 3WN5C 3QDGE 1N6VA 3MRMA 4QRPB 1AD0B 1KC5L 1MHHB 2BOCB 3HE7B 3Q2CA 5DI8A 4YXKH 2CUMA 2XZQL 3X3FH 3O2DL 2XWTB 3BP6B 4TN9A 4GQPH 3MRIB 5J1AB 4D9RE 1UJ3C 2A6DA 1NFDF 2NY2C 2P1YA 1T66C 2VXSL 3PABB 3HZKB 1YEHH 3O3EA 4RSVA 5JW4Q 1W0VB 4XC3L 5GS0H 1GPOL 3UROR 5D4QA 4U4BA 1Z3GL 1ZGLA 4OZFG 3RGVC 1NGWB 3CFEA 3TT3L 2PYEE 4UMGA 2W0FB 3TFKD 5IBUB 2HWZH 1PYWB 3JV6B 3MJ7B 4MCZA 2KUTA 4UT6H 4Y4FC 5EA0H 4HBCH 1AD9A 4KK6D 2VDOH 1T21A 1G9MC 1P69B 2WBKA 4PV9A 5LJYH 3FO2B 5FYJL 2J6EA 2BSTB 1K4DA 4MHHG 4N8VB 5C0CE 1CDHA 4QY8A 1JGVL 3PDOA 3TWCH 2OTWA 1UM6L 2I5YL 4ZOEA 4DEPC 3VJ6B 4WTXA 2AJVH 3VH8A 3MRDB 1UCTA 4ONOA 5L8KB 5TQ2H 3RVVD 3KPTA 2W9EL 2PF6A 2AQ1A 2R0ZH 5DJCA 4YHKL 4FQQB 3MR9A 2VDNH 2XTJE 2YA1A 1PY9A 3V6OA 3K1KC 2AQ3A 5E00B 5HGBB 1NSNL 1A6ZB 5DTFB 4FZEH 2BX5A 5M94B 5CINH 5IF0A 3WLBB 3RWCA 1OSPH 2NX5B 3O2WL 2XQYG 3LKSA 4OCXL 4C56B 2BC4A 1B0RB 2CIIA 3MZTA 4M61A 4HGMA 4U1JA 2J3SA 3MLXL 3AAZA 3L5WB 2YMXH 2V5MA 5EZJA 4Y4HD 2D0FA 1JTOA 3I50L 3NFPB 3LRGA 4KVNH 4LSQL 2P4AB 3NABL 4YPGA 4IRZH 4JRYA 4GAJH 1KPRB 1J1PH 2X1OA 4TSBL 3WNOA 4QYOB 2R2CA 2VLJA 1FYHB 4PJBE 1JYVA 5DRZA 1K8DA 3ZE1E 1VFAA 3QDJA 3UZVB 3CDCA 1IGFH 4NN6B 4C4KO 1XGQA 1T22B 3DBXB 1A7RH 1JFQL 4J4PA 1VACA 4HH9A 3VXSA 1G6RA 4F3FB 1RUPH 2X70A 4R97B 2HT2D 4UOW0 4LSDA 2OSLB 4L8DB 1RZ7L 1EBAA 2BY2A 1DN0B 5CJ8A 3S37X 4P23C 3T09A 2NLJA 5F9JA 3L1OL 5JIPA 3KWWB 4XGZB 4F9PC 4G6ML 5F3BA 3ULUH 2JCCF 4RCAA 5T1KA 3QXVA 5TPWL 1ULVA 2DQJH 3BPOB 1CLZH 4HJJL 5IQ7L 1ZKAA 1EAPB 2ITDB 5GGRA 4F15C 5B38A 3AFLA 3EJYC 3LB6D 4PJ5E 3QFJD 1FC1A 4GXVH 5J1TC 4K8RH 5LAXA 3VXMA 3QUYD 1OB1A 4GT7A 1FFNB 4Q9RH 1Z9OA 4JZNB 1HYSD 5IESL 3PHQA 2IAMB 3ESUF 3LQZA 1RJZB 5AG8A 3WKML 4TPRH 3F7PC 3HI1B 4KUCF 2YK1L 4L8SA 4O5LH 5IVXB 4IRSA 5FYJE 4Q74A 1F90H 1S9VA 1CICC 3QB7C 1GHFL 1SM3L 4N0CD 1HH6B 4LFHG 5F9OL 1AH1A 4P4KB 2XZAL 1MAMH 2AXGB 3JBG7 4Y4HB 1SEQL 1LEKB 3ORJA 3GHBL 3MLRL 4M7LL 5IGXL 1CXHA 1QUNA 5D1XA 5C0EA 4I2XE 4Y16C 2ZCLH 1CLCA 2P8LB 5I6XB 1JWMB 3FL7A 3U2SA 5I1IL 5HSFA 1A7BA 5E95B 4ZUVB 4KMQA 1B4JH 3WD5H 1E6OH 3VXRE 4DFIA 1UXWA 4OZFB 2P5WD 4QHNB 2Q86B 1KGCD 3X3FL 2ZG3A 1VKXA 12E8H 4Y1AE 4WTZA 1J8HA 4WUUA 1VDGA 2DLIA 1D9KD 5C0FB 5GS0L 3U0WH 4QCIB 3F6LA 4DW2L 2ZSVA 5AAMA 1V8HA 5EU4A 5HDBE 2MMXA 3IFPA 4QXTB 3QZWA 3LMJH 4U2ZA 3D2UA 3D39D 1JZ8A 2VR5A 4YDIH 3V5HB 3QCTH 4UT6L 3BO8B 3WIHH 1LD9A 1SJXA 2QHRL 3VE0A 1X7QA 3QFJB 4OSUL 2VDOL 2G2RA 1T03H 4OZGE 3QG6A 2XKNB 4NZTH 4MA8H 3RJQB 2KQNA 4XCEA 2UZYB 3ARFB 5HHME 1T0NA 2EDHA 3MUGA 2PXYB 4FG6C 3TWCL 4X8JA 4X80H 3B8SA 3IJHB 1H8OA 1T1YB 5TQ2L 1T83A 3UTTA 4OF6A 2ICWB 2IH3B 2UUDH 3H9YA 1DLFH 3U4EA 2R0ZL 1Y6KR 2DYPA 2CSPA 2VTFA 1HILA 1LO4L 1NCNA 4GMTH 2V17L 4RGMC 5JUEL 5DRXA 2CK0L 3SHSA 4ODWB 1BVZA 3E2HC 4FQCL 5HTSA 4G9FD 1CS6A 1U3HC 4HK0A 1FC2D 3MV7A 5CINL 1NJ9A 1OSPL 4HLZH 3RUGE 3QAZB 3IAPA 1B2WH 3QUZB 1QSZA 2BCKA 1RZ8B 5D8JL 4PBXA 4Y5YC 2YMXL 1EHAA 1S78D 3JWOL 3QNZA 1TZIB 3ZYIA 5FKPA 3L3DA 4N9OB 5E6IA 2EIZA 2APXA 2MQ0A 4R8WH 4Z0BL 4HHAB 4IRZL 4QRRE 4XBGB 4TTGA 5C3TA 2HKHH 1QFWM 4NQEE 1RZGA 4HUVB 3LKOA 4P5KB 4WGVB 4BSVA 4MJ4A 3OB0K 4FQXB 5D1QD 2HAZA 4FHBD 3RY6A 1IGFL 2H41A 4P9MH 5FM5M 4GSDL 3GSXA 4JKPL 4KDTA 1YZZA 5ID0B 3B9EA 2N56A 3FRUB 1A7RL 1K6QH 2X1XR 1F4WH 2V2XB 1MHEB 4KHTH 5E9DA 4WHDA 1RUPL 4IJ3C 4PRPE 4A2LA 3F6IA 4KY1H 4KV5F 1C8PA 3NCMA 1FNAA 2JJSA 2DQHL 1O7VA 2CKBA 2WIIB 3LN4A 1JIBA 1AXSB 2QSVA 2DQJL 1CLZL 1T20B 1MCWW 4ZG1A 5M95B 3MGAA 2GY5A 3V7MA 5J8OA 4GXVL 3ZHLA 1XGYH 3BQUA 1LP9A 1SYVA 3BD3A 3S34H 2PYED 4ZDHA 3FQUB 5H8DA 1JWSB 5I8OH 3SDCC 3NGBC 5KJRH 1UENA 5F89B 4Q9RL 1S7UB 4G9FB 4XVJH 5EBLA 3SGJC 2DDQH 4OZ4A 5KW9L 4TPRL 4DCQA 4KK8D 4O5LL 5I1HL 3TBSB 1GVIA 2VZ1A 2FSEB 4AENB 2Y72A 4GFTB 1OSZB 2AABH 2H3NB 1BLNB 1MAML 3CZFB 2OR9H 3WMSA 1CDCA 1FVCB 1S7VB 3HR5B 2AKRA 5BS0D 3EYOA 5DEFB 2ZCLL 4WW1A 3T1WA 4HS6B 1CFNB 1DL7L 2IQAA 1EXUB 4Y19D 4O2CA 5D1QB 1M7XA 2XTJD 3RGHA 3GKWL 1B4JL 2H45A 2P49B 3WD5L 4U1LB 4NYLA 4JLRA 3HUJB 1EV2E 3EO1A 3RPIA 2NY0B 4QLRA 2IBBA 4ELME 4LOUD 2OXHA 1JV5A 4F57H 4NN6C 2A9NH 3LZFL 4HG4J 4X4XA 2IADB 2JIXD 4CVZB 1XIWD 3OF6D 3QDGB 2LAAA 3AB0B 3TFKC 3G5YB 1QFWH 3U0WL 4DZBB 1CE1H 4DK3A 2OL3A 3QQ4A 3QG7H 2DS4A 5C9JA 1KXTB 1WWCA 2O5ZH 3ECBB 4PGCB 4LK4A 3LMJL 1VESA 2Z8RA 4KH2A 1RHFA 3QCTL 4K9EH 3TPKA 3L3IB 4ZUTB 4K23L 2EEAA 1T03L 4N0FB 2J7LA 2UVEA 5FV2A 5DMGD 2PYEB 5ITFB 4MJ5B 1JZ2A 4NZTL 2L0DA 3ZSSA 2F54D 1JK8B 2XA3A 1DLHB 1FV1B 4G43A 2VLME 3GJFB 5CJQH 4OAWB 1N59A 3MJ8B 4X80L 2Y23A 2RJMA 4I18B 3GSOB 4KKLD 3EIFA 2AJUH 1DLFL 1WFUA 4BSWA 2BVPA 4GMTL 1GGCH 3VFOA 5J0BA 4WUKH 5C0CB 2HG5A 4M7JL 1G1CA 4ONFH 2A6JA 5BS0B 1FAKT 4PJ5D 5DUML 2BNUB 3GSUA 3LRSA 4KQ4H 4XPAH 2Q1EA 4Y4HC 1EUTA 5BRZD 3S96B 2ED7A 2XTJB 4Z8FL 4X6EA 4I5BB 1F6AB 3IETA 2BVUA 5I6XC 1N8ZA 2CRMA 3B2UD 4FQJH 1QFWI 4R8WL 5CD3A 3WUZA 4E41A 2XV6B 2HKHL 4XAWL 2OX5A 3GSRB 5H37H 2I07A 2JIXB 4PGBB 3SE4A 1KTDB 1XIWB 1NC4B 3OKNA 3S5LA 4P9ML 2G5BB 3KPOA 2CO6B 3P73B 1UA6H 3ARXA 5DMKA 3SGKA 3AU1B 1WWBX 1G7PA 4GXUM 2HT2C 3RNKA 1K6QL 1G9NH 5AD0A 1NC2D 4PJBB 1F4WL 1FYTE 5CWSB 4C54A 4EBQH 3TESA 4AYFA 1NFIA 5BV7B 1NMBL 4CMHB 5KVFH 2ZPKH 3FFCD 4BH8A 5IMMB 2H9GB 2VH5L 2YRZA 1ZT4B 3L95A 2XT1B 3LB6C 1HHIA 2BHYA 3QUYC 1INDL 5DZOA 1AIFB 4JVPA 4IMLA 4L9LC 2FX7L 2NY7H 3CH8A 3KDMA 1ES0A 5GGQL 3VXQA 1UXSB 1NMAL 1HYSC 4PB9L 5AG9A 3S34L 2Y5EA 3B6SB 1XF4B 5I8OL 2H8PB 2EDOA 3JSSA 1ZGLP 1AQDB 1AHWC 5FYJU 5JHDA 4XVJL 1PJ9A 4N0CC 2DDQL 4PJ5B 2YPLD 1XGRB 5HI5D 4UTAL 3HUJF 3H9HB 3WFHB 1X5HA 5CBEB 2R1XA 1C5BH 3RTQD 1MFAH 4M6OL 3T3PE 1HZHL 1D5MA 4QT5A 3QAZC 2OR9L 5EU6E 1Y18B 2X9YA 1QBMH 4CVWA 15C8H 5K9OB 4JB9H 3O4LE 2E8YA 2MCG1 3CSBA 4AM0B 1DBKL 3NH7H 3GSNL 3BE1H 4X9HA 1CFSA 2B1HH 2KPNA 1Z0MA 2FO4A 2XWJA 3FT4A 4FZ8H 2R1YA 4NQXB 3DVFA 4I2XB 1MOEA 3BH9B 2IH1B 4X4ZA 4CBPA 3L6FB 3CDGA 3NCCB 1D9KC 4BFGA 2ADFL 1C16A 4JPIB 1E27A 2GT9B 5C07E 3VXRB 5CZVH 1QFWL 1TETH 4OQTH 1YQVL 4HUWB 4EI5D 3FFCB 4LCYB 4F58H 3V8CA 4PY7B 1JPFA 4QRRD 5HHOA 2A77H 2C1OB 4M9PA 2O5ZL 4PGEA 2Y6SD 4UNTA 2C3WA 4O9HH 3WIIH 3GMMA 3F5WA 3K1DA 4KC3B 1ZWIA 5HDLA 4MYWB 2DLFH 5JOPD 3S88H 4OLWH 3STZB 5MENA 3BZ4B 2OJZH 3PQYE 3GMPA 4R26H 4MNGE 5K9JH 1S7XB 4DVRL 3PJSA 5CJQL 4NBXB 4DGVH 1I7RA 3LN5B 4OZGB 2BNRD 2OTUA 2HVKA 2AJUL 3RTQB 3N1PC 1A6AA 3O8XD 1GGCL 3F58L 4H0HB 2NY5H 2ZUQB 2R69H 3WSQH 1U36A 4R90H 3ROOB 1IM9A 2P24A 3AGVA 3KS0H 2NTSP 3L3GB 3EYFA 5AUMB 4KQ4L 1S78C 4YAQB 4JANB 1YMMA 5D96B 4AH2B 4PGDA 4LLQA 4U1KA 3VXOB 32C2A 1OW0A 3MROA 1DEEB 1FIEA 2OJEB 4P2OB 3A0OA 4PJBF 4HIXL 4JEGB 3ZE1F 4FQJL 3OGCB 5D1QC 2YPVL 1PG7X 5DSCB 1KJ2B 3HFMH 5T3XH 2FGZA 1IT9H 1NAMA 2P5EA 2I9LB 1TVHA 3DMMA 3UDWC 4EI5B 3VXTB 4QRRB 1G7JB 4NQEB 3LV3A 3Q3GB 3G08A 3MRPB 3AB0C 2YWYA 3U0TA 4LMQI 4LEOB 4LBEB 4XHQA 2MOVA 1V5JA 5ENWA 1NGYA 2NW2B 4P59H 3U46A 4ELKB 2R0KL 1UWXK 5E4EC 3REWB 2ZPKL 4PJ9A 3VXNB 1BWWA 2Y7QA 3PWPE 3UTSD 1BAFL 2BVYA 4HWZA 4JDZB 5J6HA 4Q6IA 4WCYL 4MX7A 3B4NA 5TDNB 1MSPA 1T7WA 4PRBA 3MYJA 1UJTA 4XX1E 2NY7L 3CVHH 1Z5LA 3MA7A 5IQ9A 4JFOB 3CFBA 3TA3A 3B9AA 3O8XB 5EO9B 4KK8C 5IKCA 4I18C 1NH6A 2WAHA 5I75B 1MELA 1RQ5A 3AS3A 4PTTB 1AR2A 1Y0LB 4M1GH 1LK3H 4M5ZL 5DJ0B 2A6IA 3DV4A 4RAUB 5MEPB 5LGJA 4JQXA 2EKSA 4MAYB 1C5BL 2B5IB 3SDAA 3LHPL 1J9CT 2OTPA 4NSKB 4WI3A 4LIQH 3BZEB 1QBML 1TZHB 4A6YH 5E2UH 2R39A 2WLYA 4Z7VA 3ULUD 1E6JL 3V4PL 3NH7L 5KG9B 3ALXA 3ZDZE 3BE1L 4P5TD 4ZOBA 5IB5A 1A1OB 4FZ8L 4LOUC 1VFOA 3DARA 3TYGH 3G5VA 4Q0XH 5KSVB 3KXFE 1YN7A 4KJQD 4K8RD 3DRTB 2ZWLT 1XIWC 3RIFK 4NRYB 2NPLX 5GGVY 1KTLA 1KULA 1J0YA 5FK9A 3RZCB 4N5ED 1MCHA 3P9MB 4PJIA 1G7MA 5HDBF 3SGDH 4L3AA 3FO9A 2W60B 3HI5H 1XF5B 5CZVL 5I0DA 4BKLA 4OCWH 4OQTL 5CHNB 3S6CA 3W9EA 4N8PA 4ELMB 1P2CA 4IHOA 1IGJA 1BQLH 3VFWB 3ZT5A 1H8NA 1YEJH 3MGOA 5BV7C 4WHTA 2NYYD 2AK4A 4OZGF 4CMHC 2V2WB 2PTTB 2CH8A 5DMGC 5EO1B 5FO9B 1UKQA 1UYWL 1WJ3A 5F88A 4O9HL 3ARTA 3U6RA 3WIIL 4JPVL 4NP4H 4G9DA 2DLFL 4FFWD 4HLZG 3G9AB 3S88L 3PDDA 4OLWL 1QSFA 4MJID 1OP3K 3O11A 3VXUE 1CG9B 2JK5B 1ADQH 1TZGH 3QPQD 4HCRH 4X4YB 3RWGB 2VITA 4R26L 4KKLC 5K9JL 1N2RB 5EBWB 1FNGA 1OHQA 3BT2L 4OBSA 5E7BA 5CIPH 4LAJH 4DGVL 4YDLB 3OTTA 5HI3D 3S37H 3N85L 1XGPA 5J1SC 3RUGF 3GUTB 2NY5L 2ESVE 4WI7A 2R69L 2GKIA 4XC1H 5CJOL 2UV3A 4EEEA 1U42A 1R3IH 3WSQL 4HWEL 3QA3B 4R90L 2X4RA 3OKMA 2BVTA 1FDLH 2BJMH 3B8YA 4P5TB 1K8IB 3B2UC 4RMRA 2G9HB 3IFLH 2EYRB 5JDSB 2EECA 1OAQH 5L2JA 3SGDI 4ZXBA 3RI5K 1EGJH 1ZOXA 3IF1A 1GGYA 3MRNB 3V6FA 5ESVB 3O81A 1WUNT 5HHQA 5IROC 3W9DA 1U8LB 4WW2B 4ZPTB 3WFCL 2ARWA 3BPLB 1IT9L 4UV4L 1OM3H 5E8OA 1RZFH 4EXPX 4MA7H 2CDEA 1CFQA 2HLFD 1RFDL 3O41A 3MUJA 1TVBA 3MV11 1BBJB 3BEWA 4I3GA 1DQQB 3IDNA 4KFZC 2V5TA 4LSRH 4BZYA 4GW4A 3DO3A 3C6LD 1BVKB 3W39B 1EFQA 2VABA 3RVTD 4AY0A 2Q3ZA 2FBJH 4MJIB 5E6YA 1YDPA 3KPSE 1FYTB 1CL7L 1ZTXH 2C3VA 2C1PA 5JA9A 5FDWB 4Z7WB 2APFA 3TBWB 4U6XA 1AQKL 1TTGA 4E42A 1IFHH 2YSSB 4Z78A 1IILE 4YHYB 3CVHL 1JHLH 4R7NA 3CFCH 5HGGS 1BEYH 3L3HA 5H94A 1MCWM 5I66A 2DKMA 4JM4H 4XMPH 2YXFA 5HI5C 5GHWH 3V52H 1NCDL 4U1IB 3RTQC 1LK3L 1YY8B 3D9AL 1EPFA 1S7RA 1X5LA 1A5FH 1XR9A 2ZZUT 3RWJB 1FO0H 3N1QC 4NOFA 1E4KC 3D18A 3K80A 3C8HA 1FVEA 3BKJL 3BGMA 1FHGA 4H0GA 1AGDB 4QHUB 5T1LB 2XQBH 2DMKA 4A6YL 5E2UL 4XX1G 5FEBA 5F71A 1BX2B 1JGDA 5AZEH 2CDFB 4ELMF 1MF2L 4KGJA 4YBLC 3EO9L 5EPMA 5FOBB 3TEUA 1UACL 4HAGA 4U1NB 2XOTA 3TYGL 1WCBA 4Q0XL 5EOCJ 5E03A 3R8BB 3O4LB 3LKNB 3KLAB 3QXUA 4LF3B 4POZD 5JW4R 5FO7B 5IUSA 1MCSA 4AZ8A 1XFPA 4D0DA 1TVDA 2I25N 5MERA 4EI5C 4ZSOA 3C6LB 3QXAB 6CGTA 5C0AE 1VGEH 3KJ6H 3IVKA 2OK0H 2Y6SC 3HI5L 3QUXB 3EHBD 2AQ2A 2D7QA 5L7XH 3MRLB 1RHHA 1KB5A 1BQLL 1EDQA 4P48A 4KMTL 2N7BA 1XGUA 1FZOA 4PB0L 3EDJA 1ZLSH 4R96A 5ILTL 7CGTA 5E8NB 1JTTA 1MEXL 3CC5B 2Z31B 3GMRA 3SDXA 3LD8C 4RZCB 4M1DH 3ARDB 4NT6B 1F8TH 4QF1A 2FYYA 4QHLB 2YRLA 5DJZB 2X7LA 1HNGA 4HKJB 4D0BB 4QRSA 4HCRL 2IBZX 5D5ME 4KUZH 3BHBA 3QBTB 1RIUH 4Z7QE 4YHNA 3O8XC 1NCBH 5KZCB 5SX5H 3QDMA 2E7LA 1S9XA 1D7FA 3DO7A 1BJ1J 3ARVA 5H37G 1IEAB 3OJ2C 1ZV5A 3C60D 3PQYB 4XB7A 43C9A 4Q9BA 4WW2F 4LPYA 5KSAD 1DE4A 4HJGA 3WS6A 1R3IL 3BP5B 1LO3L 1TQBB 4KRLB 4PJDB 4J3VA 4Y5VB 4LAQL 4OV5A 3B3IA 3QCUH 2VDKH 1TJGH 3O6FD 4MGXA 1FDLL 1WBYA 2BJML 2EDBA 1EEYB 4JFXB 1I9IH 3ZKNC 4JZJC 3IFLL 3C5ZD 1EEZA 4ODHH 1OAQL 1YJDC 1PW3A 2CD0A 3QIBD 4O51B 2HVJA 2GFBA 2VDRH 4RMWA 2ZCKH 1MCKA 4TUKL 1YEFL 3HPJB 3JWDL 3VRIA 4X5XB 1LE5B 4JM2A 5D7KD 1RZFL 2YN5A 4J23A 4GKNB 3RVUD 1C5CL 1F2XK 3ZYJA 4LIQE 2B7DT 1TCRB 3SN6N 4PJHA 5DZLA 2ZOLA 4EDWH 1CXIA 3IFOA 1OGTA 4Z7WF 4PG2C 4RGND 5EUOB 1NCAH 2BFVH 3EZJB 4LKCB 1RUQH 3TNMA 1OCWH 2IPUG 4LSRL 2AV7B 4OV6F 2FLRT 2HH0H 1ZA6A 3G6DH 1JMXA 1MRFH 5HYQB 1XGTB 1B3JA 1WCQA 2AXHA 4TOYH 1TNNA 4PJXE 2GJ6D 3CLFH 2O93L 1QPXA 3OKKB 4LCWE 2D7OA 5T1MB 3LIZH 1JUFB 1IFHL 1MREL 3GMOB 1FRGL 1JHLL 3GHEL 1BEYL 4Q97A 3G5ZA 3PWPB 5IV2A 3C60B 4JFHE 3UTPE 2DQDH 2YA0A 4XMPL 4NWTH 2EDEA 2JJWA 1XH3A 2X4SB 3HMXA 4YDLC 5GHWL 1A1NA 3BMVA 4YIQA 3T3PF 3IDGA 2OBGA 1MIEH 3ISWA 3O6FB 3OKEB 4KTDH 1KACB 5IIEA 3OKLB 3MPCA 3P0YH 3ULUC 3HZYB 5C0JB 5IB2A 4OLXL 4ZS6D 3WXWL 4AEIL 4P5TC 1DUZB 3R8QA 3HZMA 2XQBL 5F6HJ 3AM8A 5MEOB 5JW5B 3MLYH 1OVZA 1MLBB 2X5PA 3VD9A 3OR7A 1MVUB 5DJXB 5AZEL 4KJQC 4K8RC 3STLB 3Q48A 1IGMH 4ZQKB 1RK1A 2IMNA 4NZDA 2IAND 4S1RH 3BPLC 3OZ9H 4N5EC 5BXFB 1TNMA 2ZSWB 1KPUB 4NKMB 2VLKE 4RMSA 1MWAH 5DD1H 3TJEL 4XBEH 2BVQB 1WT5C 3EYSL 2GSIB 5DVNA 1VGEL 1BOYA 2OK0L 1S9WB 1EHNA 3QULB 2NYYC 3VXSD 5L7XL 4LCCB 4K7FA 3CSPA 3RWHA 2B2XH 2GJ6B 3PP4H 1JGEB 4YC2C 4ERSH 2DQIL 4FFWC 3M45A 3F7VA 1IQDB 3MOBL 1ZLSL 4Y4FA 1QZ1A 2J8HA 5C71A 1T2JA 5F7WC 5T1KD 4QHKJ 1CF8H 4LASH 3QPQC 1JWUA 4M1DL 2W0LA 2WV3A 1F8TL 1INQB 4HFWA 3EYVB 1QFHA 2VL4A 4TUOA 1HQRA 4YHYC 3VXMD 1F58H 3FB7B 4OCRL 2ZUTA 5CGYD 5ADOH 1NDGB 5I1DB 3S8WA 5HI3C 1T04A 1UM5L 3F12B 3BYTA 1OAYL 5F93C 3LY6A 3OV6A 5D7JB 5JNYA 1YC8A 1LEGB 1CK0L 3K4DA 1P7KB 3V79C 1RSFA 4XP9H 4HZAA 4IRSD 2VQUA 4NQDA 4PRNB 5DD6B 1D6VH 4YDVA 1LVEA 5ADPH 4JFPB 2Z4QB 4NRXA 3QCUL 2VDKL 1TJGL 1BFSA 2FJFB 4WWKB 4P49A 8FABA 3RFZC 5D1XD 5FECA 4PRAA 5L9DL 1I9IL 5EUOF 4LPWA 2CDGB 2ESVB 3FB5B 2HJLA 4O2EA 3RHWF 3EFFA 1U92B 2C4XA 3DUSB 5M7QA 3LS5H 2A73B 1Q9LA 3T4YB 2ZCKL 2BY0A 1QKZH 5CP7B 5KTEL 2HLFC 4UQ3A 3QHZL 4XBPB 3L7EA 1FORH 3EDEA 5HGAB 4WUUD 4FRWA 1RURH 2XWBA 3C6LC 3UJTH 2IG2H 3EOAA 3L7FB 2BFVL 5DUBB 2YUWA 1RUQL 1OCWL 5HHNA 3RVTC 3VFPB 2HH0L 3R06A 3ALWA 4PRIA 1UWEH 3D2UD 1MRFL 3G6DL 1KNOA 4QTIH 4P2QD 4P23A 4DN3L 4ORGB 4TOYL 2EE2A 4F9PA 1B0GB 4LSSH 3JTSB 4G80A 3UTZA 4P0DA 4ZNEE 2P45B 2ARJB 4OCYH 1NFDA 4OM0H 3CLFL 5CBAA 1G7IB 4HGWB 3MLWL 5D93C 3G04A 3P9LA 5IHUH 1WFNA 1GC1C 3QDAA 5SV4A 3IJYA 4GW5B 1DQDH 3P4LA 5T3XD 4MXVE 1QFPA 3VFSB 4PG9B 1BFOB 4HDIA 3DX9A 1T89C 3RL2A 3KPSB 1HNFA 2DQDL 3FTGB 4H5SA 1MNUH 4RMVA 2DYPD 4OF3A 5D7SL 2B39A 1UFUA 4JPWH 5KN5B 3FAXA 3MLUH 2YD1A 1CLYL 4KTDL 1CICA 4RMUA 3EFDH 1G7HA 5LCVH 4JKWA 4Y5VC 5DQ9A 4DAGL 1UG9A 4HZLB 4Y0GA 4YDKH 3ZDZF 3IFNH 3HS0B 4TVPL 3TF7C 3QJFA 1FN4A 3MLYL 2OMBA 4WO4A 5E6ID 1HSBA 2PCPB 5A2LH 3CSYA 4X0KA 4ZFGH 1IGML 1YN6A 4MWFB 4POZC 4JFFE 1UCBL 5HXMA 4S1RL 2R1WB 1CGTA 3OZ9L 5DJ2A 4LNRA 1S7QA 4PREB 3PWNB 5GGVL 3OSKA 3IXAA 5DD1L 3EHBC 4F7PB 1R3KB 2MCPH 2FWOA 4G8FB 4XBEL 1A3QA 4LLYA 5EOCL 1A3RH 3U7YH 1MRCL 1UB5A 1FNFA 4P2QB 2GK0A 4ZO9A 1BD2A 5E9DD 5ELIA 5ICXB 4N0UA 1S5HB 2CIKA 3PP4L 2VISB 1KLGB 3RWFA 3S97C 4R2GD 2E7MA 2Z35A 5D1ZB 3WIFA 1MFBH 1OP9A 2XA8H 5HGDB 1F11A 1SYSB 2LVEA 4XPTH 5C0AB 5DMYA 5IMOB 2YPKA 2Y07H 3BAEH 3LDBB 1CF8L 1I1FB 5ECJE 2DQFB 3KYOB 4PJ7A 1M71B 4IM8A 3UYOD 5GGUB 4X7FC 4H25A 1A7QL 1JNHA 2DD8L 1W72A 3LKPB 5EFIA 3EUUA 4RGOL 1JBJA 5ADOL 5F7UA 2X9XA 5CEZL 4YEFA 4QXGH 3UJJH 3C60C 1HI6A 2JB5H 3CIQA 4ZMAT 1N3NA 4JO4L 5KSAC 1RPQA 2ZNXA 3RL1B 3O3AA 2ADIA 3O6KL 2BNQA 4IOIB 1H3TA 1I1RA 3HAEH 3WUWG 4ZYKB 2VNCA 4XP9L 2GAZA 3O6FC 2JKXA 5D5MB 1D6VL 4FTVE 3QIWA 4P3DB 1R5VB 4K71B 3MLVH 1AFVH 4K9EC 3C5ZC 2FIKA 1YYMH 3VFMB 3QIBC 2AJ3B 1FFPA 2XKUA 4UDTB 4Y5YA 5IB1B 3UPRB 2GSGA 2VC2H 4AIZA 3CVHB 5K9KB 5D71H 1NLBL 3K2UH 3RVUC 5EU3B 1SJVA 4F9LA 3LS5L 4GKZA 2VDQL 4GRLD 2R23B 2O61B 1QKZL 3MJGX 4KI1A 4FOMA 4QRPA 1AD0A 1MHHA 2BOCA 3HE7A 5IJKC 3DYPA 4RGNC 4G8EB 2XWTA 2WBWB 3BP6A 1XCTB 1ZLUH 1D5IH 2VXTH 1FORL 3FMGH 2XG5A 3MRIA 4TVPE 5J1AA 4BH7B 3BRFA 4M02A 2RB8A 5E08H 1RURL 3PABA 5DGRA 2RAMA 2GYSA 2IG2L 2X4PB 2OCFD 2YUZA 1W0VA 2DAVA 3IJSB 5C70A 4GW1B 4U6TA 4G3YH 5IP4A 1NGWA 5J13C 3MLZH 3FHQA 2OZ4H 1UWEL 2EDTA 2W0FA 4BUGA 4A6YB 3WS3B 5GRJH 3MRQB 2A1WH 1IBGH 1PYWA 4CL7A 3Q6FA 3JV6A 3MJ7A 3TPUB 1AGFB 4TQEH 1WZLA 4LSSL 5J4MA 5DHVH 2JTDA 5IJVB 2KBGA 5FUCC 4OM0L 2HTKD 3HI6H 4F37F 5IHUL 4JY5L 3FO2A 4QXWA 4N0YH 2BSTA 1CD1B 1BGXH 4Q9QH 1T7ZA 2WMPA 4ZAKB 1NEZG 1CE6A 4G42B 2RR3A 3VJ6A 4WFHD 4C55A 3AXLB 3MRDA 4QRUB 4XP4H 2FX9H 1G9NC 1ACZA 4LCWB 4HC1H 1E4WH 3SGJA 2WW8A 5CMAB 4FQQA 2Y06H 5EO0B 4M48L 4JPWL 4WY7H 4C83B 5E00A 5HGBA 4MD4B 5CEYB 1HHHB 3THMH 1A6ZA 5DTFA 2P48B 4ZS6C 3EFDL 3W11D 3WLBA 3SQOH 5BMFL 1ZMYA 5CEZE 2NX5A 5ETUB 4WI6A 3BUTA 3DUHA 3T2NH 2VR4A 1B0RA 3PHOB 4JQIH 4GRLB 1KUMA 1JL8A 3L5WA 3SCMD 3NFPA 3HHRB 3SOBL 4LARH 4ZFGL 4E41D 5DK0B 3BPNB 1KPRA 3UAJD 4JFEE 5CIPB 4QYOA 2ATKB 2NXYB 2YD6A 4ISVB 4NZRL 3E6HB 2FRGP 5D7IE 4ODXB 2CJUH 3UBXI 1NL0H 2PNDA 4WEMB 1T22A 4F8QA 2FEEL 3DBXA 1A3RL 3U7YL 5B8CB 2F19H 1U8OB 3KPMB 1GGTA 4HMDA 4YHOH 3K3QA 3MOQA 4RIRB 3VFUB 2NW3B 4F3FA 1A9EB 2VLKB 2OSLA 4L8DA 4X9BA 4OFYD 4P46B 1I85A 3PL6D 1DN0A 3EBAA 1NLDH 2IFGA 1NDMB 2W59A 4R4FH 4L4TD 3KWWA 4XGZA 5LWYH 2LTQB 1QBAA 3NA9L 3QQ9D 2Y07L 1U6AH 5EOQH 5CGYC 1EAPA 2ITDA 5D5MF 1IM3B 3WUWB 4X4ME 4Z7QF 1OLZA 1IRAY 4G6FD 3JV0A 2FIRT 3QH3B 3V7AE 2KL6A 4QXGL 1HCFX 3UJJL 2Q20A 4L8SC 2JB5L 3HNVH 4JZNA 3TBVB 4PTUB 4IRSC 5JHDD 2IAMA 5F7DB 5I9QC 1A14H 1RJZA 4H0IA 3TLRA 4AT6B 1G0YR 2APTA 3HI1A 2X4NB 2IEPA 5IVXA 4L8CB 4LLMB 4RMTA 5D1XC 1HH6A 3WDIA 3MYZA 3MLVL 4P4KA 1AFVL 2AXGA 4NUGH 3W82A 2WWKO 4Y4HA 2EE9A 2GEEA 1LEKA 3SCMB 2ARJQ 4ZOCA 4MZ2A 1FE8H 4WFGE 2P8LA 2VC2L 4RBPK 1JWMA 4XCFH 5E24E 3DRQB 5D71L 2KZWA 3KNBB 1LEIB 3K2UL 4ZUVA 1BBDH 1H5BB 4HIEA 5JQ6H 4S0TD 4TUJB 4YHPB 5F44A 3P30H 4WI2A 4X6DE 2Z92B 4OKVB 4OZFA 4QHNA 2BMKB 3BSZH 4G5ZH 2WINB 2Q86A 1JI1A 3OJVC 1REIA 2VXTL 1NCTA 4XPBL 5T3ZH 2EIBA 4NNPL 5JOFB 4YBQD 2ATPB 4CGTA 5F7EL 1FO0B 2DJSA 3X14B 2PN5A 4XNMB 1HHKA 2VYRE 3PL6B 5C0FA 4IRJB 4QCIA 4G3YL 1UT9A 3MLZL 4PJXF 1INEL 4RAHA 2OZ4L 3DTXB 5D70H 5HHOD 3TT1H 4QXTA 4LSPL 3I02B 5GRJL 2FHBA 1IBGL 3S98A 3V5HA 1OT1A 2H1PL 3BO8A 4TQEL 2R2EB 3OL2A 3QFJA 2Z9TA 4I0PD 2B4CL 2Z0BA 3MJ9A 3LDBC 1W2KT 3IDXH 4MA1B 2XG4A 5HYJE 1Q9WA 2DF3A 5F8RC 4XWGL 4W81A 5MEND 2XKNA 4F33B 3GBMH 4U6VL 1BGXL 3ARFA 1T83C 3OMZA 4Q9QL 2QL1A 2JF1A 2PXYA 3ZL4H 3BKYH 5C0DB 2DQGL 3IJHA 2ICES 1T1YA 4XP4L 2FX9L 3BKCH 2ICWA 2IH3A 1CFTB 4HC1L 4N1HB 5CGTA 4URTB 4ODWA 3TIEB 4HIJB 3THML 3CAFA 3OBAA 1ZANL 3VWJB 3WNNA 1T0PB 1YNLH 2QHLA 3SQOL 4K71C 1EVTC 1K3ZA 5C09E 1T0MA 4M7ZB 3MV01 4NCC2 1FNHA 4NUJB 4OCSH 5E6IC 5J56B 5B22A 3S36X 5CUSL 3QUZA 3RDTD 1RZJH 2V9QA 1RZ8A 4LLDB 1IZJA 1TZIA 3CVIL 3QWOB 3E8UH 2EC8A 5E1HB 5C08E 3K81A 1J1OL 4AL8H 4LARL 4HHAA 3RY6C 4XBGA 2UVFA 2XXMB 4HUVA 4P5KA 3KGRA 4KU1A 4UV7H 4FQXA 2P5ED 3NAAL 4UOJA 3MRCB 2CJUL 2XY2A 4BA8A 5ID0A 1T1ZB 3WNKA 1DBMH 3D25B 3T0ED 2F19L 3FRUA 4JFFB 1ZHNB 2R4SL 5I8CB 3GK8H 4YHOL 4R2GC 4KZDH 2V2XA 1MHEA 3IAGC 2JJSC 5A2IH 1AC0A 4MSWB 1EA9C 3K8MA 4I0PB 5HDOA 4PJ9D 1H9VA 1RZKC 1KJVB 1NLDL 5GGTH 2WIIA 3TH3T 1QEWB 1AXSA 3T0WA 4LLWB 3ET9F 3WCYA 1U6AL 1T20A 3P4OB 3N1FC 4PJEE 4MNQE 1AGBB 2R4RL 4G6JH 4XPFH 3TA3D 1U8QA 2EDRA 2C9AA 3FQUA 5EZOH 1JWSA 1K5NB 3CXDH 2XPGB 4KROD 5F89A 1H3PH 2APBA 1S7UA 4G9FA 1BMGA 4OI7A 1A14L 5E94B 4HXBL 1AE6H 1BIHA 3TBSA 3VD5A 2FSEA 3U0PB 5C7XH 1Z9MA 1CYGA 2C3XA 4XWOD 4HJ0D 3BPCB 4N1CA 4AENA 3RDTB 4HPYH 4ZFOL 4FQIH 1T80A 1OSZA 2F53D 2H3NA 3PUCA 4Z7UE 4NUGL 5FIEA 3CZFA 4FABL 4QOKE 1E28B 4OFVA 1FVCA 3VG0L 1S7VA 3HR5A 1PKOA 2Y5TB 4MAUH 5DEFA 3TN0D 4GRLC 1G0XA 3VDAA 3L3KB 4HS6A 1CFNA 4YFDB 3NZHH 1EXUA 5D1QA 3V7AG 2WK2A 3ETBF 1BBDL 5JQ6L 4FQLH 3V6OE 4U1LA 1P5VA 4APQB 3HUJA 4GUPB 3DIFB 2WWMD 2RIKA 4GAYB 3BSZL 4G5ZL 3DWTA 3T0EB 4UNVA 4JKMA 3QHTC 4JDVB 4K7PH 4JHZA 1RVFL 4PRHE 3UDWA 5JTWA 5T3ZL 2IADA 4TNWK 4CVZA 5DVOA 5B8CC 5FYKL 1WBZB 4NQCD 5ACZB 3G5YA 3LPFA 4DZBA 3KR3H 1F02I 2FZ3B 4JRYE 3TT1L 1RMFH 5KANI 3GMLB 3KLDA 1X5AA 2BY3A 3ECBA 4PBWD 4PGCA 3KPPB 2AK4D 1R3HB