4ISVA

Crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSRQHSTYTIEWYQQQPLKPPKFVMELKKDGSHSTGDGIPDRFSGSSSGAHRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords 1C2 FAB LIGHT CHAIN
publication title Linear and extended: a common polyglutamine conformation recognized by the three antibodies MW1, 1C2 and 3B5H10.
pubmed doi rcsb
source organism Mus musculus
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2013-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4isvA01
4X4YB 3D87B 5DMIH 3DV4B 5FKPA 1MEXH 3IF1B 1MLBA 2DQEL 4AM0B 3UTTA 3B5TA 1Y0LA 5FF6B 2YK1H 1YECH 1T0PB 3PIQA 5B3JE 5GGSB 1MJ7H 1U0QA 1G7MB 3QDGB 4U3HA 4U0RC 1CDUA 3RDTC 3A6CH 1KPRB 1G9NL 4Y8DC 5I18L 4XNYL 2NY2D 4Y4KB 4F7CA 1TZGH 3RL2A 5IB2B 4ZPTB 3WHXA 1A9EA 4K71B 2W9DH 1KC5L 4NBYB 5IOPA 3V0AC 4F2MA 4UNVA 5JUEH 4DEPC 1EK3A 2VDOL 1PKOA 4NYLA 4K55A 5K33A 1T66D 2HFEA 3L5HA 5DJZA 3U4EA 4BFEA 4ALAH 3TA3C 2IANB 4U6TA 4HAFA 3W5MA 4L3AA 5ISZA 3QEUB 4KRNA 4U1HA 2W91A 3TYGL 1CGUA 3QJFA 1YYMH 3O4LD 3KPSD 4GRWE 5DUPH 3BPLC 5CIPA 2I24N 4B5EA 1AQKH 2IQ9H 1IEAB 1JPST 3O11B 1HNFA 4YH6A 1XMWA 5I1DA 4WHYG 1MI5B 2UWEA 4CMHC 1FNLA 4PTTA 3FQWB 4O2CA 4RQQA 3UO1L 4MNQE 4GW1A 3OZ9L 2EDRA 2EKSB 3WNLA 4EDXB 5IB3A 1U3HA 4M3KB 4XBGA 1FFQA 3QCTH 4HIEB 2IG2L 4K9EC 4PG9A 3S5LG 3GBLA 3NACL 2CLZB 4I4WB 1TNMA 3HRPA 5GGRB 4V2BA 3T2OA 1U92A 3NABH 2X1PA 4Z7QE 1RZ8A 4YFEA 2XWJB 1YZZA 4QXUH 2CJUH 2JELL 3X3GH 5MP6H 5E03A 2R0KL 2ZCKH 3QIUB 5D1ZA 3VGGA 3O3AA 3IU4H 2VAJA 3L7FA 1MAJA 4OIIH 5BQ7B 2C3HA 2ICES 1CZ8L 4Y5YB 4UV4H 4PJ9B 1A7RL 3QCVH 4XP5L 1FH5L 2ZSWB 3HZMB 4FFVD 1DEEA 3HKFA 4TOYL 5D5ME 2GTZA 1R3KB 2IADA 4LHUA 4KI5E 3IRPX 1WV7T 3G6JF 2N7AA 5C0AB 3SKJH 3CCHB 1QFHA 1I85C 3REWB 1MPAL 4BH8B 4I0KA 3BKCL 2HJFB 3DX8B 4ORGA 4YC2B 2H2SC 4F7PB 4QHKI 3O6FA 3BKML 5C0DB 4HK0A 1ZEAL 2J8OA 4TSBL 1U3JA 3RP1A 4ZXBC 1LP9A 5C0FA 3WIIL 4JY6B 1KLGB 4YDJA 5AEAA 2F53A 4IDLA 1MHCB 4XP9H 3WFDH 2LE9A 3ZKXC 3PWNB 1NMAL 2YKLH 4JM2D 3GIZL 5EC2A 1JGUH 2P1YA 3BUYB 4X6CB 3VD3A 3GSXB 2AI0L 4KH2A 1UVQB 1DBBL 4IM8A 3BT2H 4CADB 4R96B 1P1ZA 3GSVA 4DQOL 3AY4A 3PABB 3V7AG 1CLCA 4PJ7A 5DVKA 1WTLA 4KROD 3BIKB 3QI9A 3VDAA 1GH7A 2EH8L 2JKXA 1HSAA 5E4EB 3OF6D 1NCTA 3INUH 5GGQL 3IDNA 4OCWH 5D71H 4BJLA 3FAWA 3OB8A 1EXUA 2HVJB 4MS8D 5ICXB 1KIQB 1SJEA 1RURL 1ZSDA 1D5XA 4OD2B 5ITFA 4NKDB 2HTLD 2DDQH 4C56E 3B5GA 1CXIA 1KJ2L 5CCKH 5DURD 4NRZB 4QHUB 3CFCL 2XACC 3G5VA 2FB4L 2DLFL 4PGCB 1CWVA 5DJDB 4NPYA 3LS4L 1AGDA 4RBPK 4U33A 4WI7A 5SWZE 4NHUA 3RL1A 3TH4T 2BY2A 2V2WA 4UIKH 4FQ2H 4D3CL 1ZOXA 5AD0B 4R4FL 2HTKD 3V6FB 1A3LH 2MKWA 1PX3A 1VDGA 1KTKE 3I02A 4L8SB 4XPFH 3VXSD 4AYFA 4U1IA 4M7JH 1ED3B 2BNQB 3MNVB 2FR4A 2WUCH 5C0GA 5D1XB 2YD5A 4QTIL 4L9LC 3QNXA 4OKVA 5F7EH 4LIQE 1CGSH 1VFMA 1YEKL 2CKBA 4NT6B 4NN5B 4UDTA 1S9YA 3MRLB 5F9JB 1W72L 2W38A 1GAFL 3BESR 3GMNA 4LNVA 4U4BA 4JZJB 5LGHH 3A0OA 2X4RB 3KPOA 4WO4D 3UTSA 4DVRL 3TJHD 4EKXA 1NFIB 4J6RH 1L6XA 1H15A 2BP3A 4PRHA 4P5KB 4MQXC 3IDJB 3OSKA 4PJEB 1UKQA 1SJXA 4DFIA 1NGYA 4GQPH 2EDBA 4I0PC 3AREC 1S9XA 1A6PA 3VRIA 3HS0A 4KUCF 1GGBL 2VTFA 4ONHA 3IS0X 3P4OB 4LNRA 4U6HA 1S8DB 4WVRA 5HHQB 3RNQA 1REIA 4HC1L 4PJAB 2F5AH 3TPUA 4ONGH 1UQSA 2Z93B 4AT6A 5JXED 3W5NA 3EOBA 4UOJA 3THML 4C58B 1T0MB 1Q0YL 4Y4HC 4IHOB 4X6DE 4XTRD 4OD1H 5IMOB 4OV5A 3MC0A 4X5WA 4YPGB 4G6MH 4K3EL 3BHBB 4RMWA 3C5ZA 5J13C 5CILL 3MRCA 4U6XB 1MCWW 3QHZH 3RVXD 1VFOA 4FQHA 3MXWH 2JJSA 3BEWA 4NQXB 4XNXL 1T5XA 5CMAB 1QR4A 2BMKA 4Y1AD 3MLSH 5DD0H 2EYSB 2XN9A 3ES6A 1D5MB 2BSTA 3C09B 4PRPD 4ZFOA 5FO7B 1EGJA 1LQSR 4Z7WA 4LL9A 2P5EE 2XIDA 3RWFA 4E5XA 1IAOA 5I2IB 3ZT5A 2IH3B 3LD8B 4M6MH 5JHDD 1K2DB 3MCLH 1MRDH 3KXFB 3QXDB 5HYIA 4JQVA 2X2YA 4P2QB 1BVZA 3QULB 1BOGA 5D6CA 4EN3C 3AS2A 3HUJE 3NFPA 5D96C 3GMMA 5KW9L 2L4OA 1A3QA 5KS9A 3FCTA 5T3ZH 1MHHA 3S88L 1EV2E 1RK0A 1UZ8A 4IOIB 4G5ZH 4YK4C 1X3DA 2QKIA 4QF1A 4HUVA 4CAGA 5MEQB 2WM0A 2X70B 1XGPA 5EUOB 4TVPE 3B4NA 3HZVA 3HRZA 3W39B 1OW0A 4TVPL 2OCFD 4NO3B 1MQKH 2IH1B 5J6GA 5EPMA 3JTTA 5C6TL 5DQJA 1JJUA 3D2UB 1I4FA 2GSIA 5ICZB 1EJOH 3ME0A 5EG6C 2W59A 2FX7L 4OZHB 4AENB 1I7RA 4F33B 4ZUWB 2NY3D 2R2HB 4XPAL 3T3PF 2OTWA 4L4TE 3W82A 3DXAB 4HMEA 3ZDXF 1Z3GL 3QQ4A 4GW5B 5CUSH 3HMXA 1ZVHA 1WZ1L 1SM3L 1RIVH 1VADB 2Q8BL 5FCUH 2BVPA 2R23A 3WUWG 5E5MB 1MELA 2VDRL 3KYOB 3LEYH 3TBTB 3ILPB 4F15C 4G9FA 1CICC 3OAYK 4PLNC 5GRUH 5EO0B 1AGFB 1U95B 4YGVB 1G6RL 1QTYT 4IJ3B 4MXWL 4A2MA 5IHZB 3C60D 3X12B 1CFTB 1CE1H 1H3UA 5BS0A 2BXYA 2OL3L 1CDCA 3WLBB 3SY0B 5IW6B 2OK0L 1B2WH 4HIIA 3IDIB 2BNRA 1ZA6A 2GCYA 3NA9L 3WCYA 1YDPA 3BI9X 4X83A 3OKKB 1J8HB 1X6NA 4OQ1A 2VXUH 3BQUD 2XA3A 1UM6L 4QRPE 1EO8H 4XP4L 2AGJL 4BKLB 5MEOA 4JRYA 1GSMA 1OT1A 4XCNA 3TBSB 4MJ5A 4MSWB 5T3XE 3K2UL 3E3QC 3MOBH 3OB0H 4QRUA 1ZANL 3RKDC 3HC3L 4P2RE 4MNGA 2PO6C 3ZSTA 4D9LL 3MO1A 4CU7A 1ONQA 3DHJA 5EUKB 1MREL 4O02L 1IKFH 1EEUA 4FP8H 1JV5B 3TNMB 5I1AA 3RAJL 3RZCD 4PJDA 3LN5A 4JJ5A 4RIRB 2BDNH 3DMMA 2VLJE 3KPTA 4RMTA 1I9JH 2CDFA 5DJCB 1N5AB 2Z8VC 3QDJE 1O0VA 4G6AD 3UJTL 1P69B 5JHLL 2B1AL 3HZYA 5F7DB 5TDPA 4ERSL 4BELD 4XNZB 3SCMC 3WJJC 1UXWA 1FNGB 5CKGA 1T2QH 2VL5B 2XG5A 3SOBH 3JUYA 3LKQA 3HG1B 4GH7B 4OGZA 3OL2A 1JTTA 4N8VB 1JPSH 2JF1A 2MTPA 1RUAH 2XXCB 4R3SA 3GBNL 4N0UA 1P84J 1U8PA 1QNZL 1U8LB 4I9WE 4WW2C 1F8TL 4U1SA 1QSEA 3PWLB 5JOEA 3WS6A 3IKCA 4NNPL 1EMTL 4YBQD 3JV6B 2ZWLT 1HHGB 1L7TL 3IJYA 1EEYA 4QO1A 1NCUA 3QIBC 1PYWB 4X6CF 1OB1B 5MI0C 5E1HB 4FQXA 2QTEA 4OQTL 4WFEE 4PJIF 4H0GA 2FHCA 5I1CL 4EBQH 2NPLX 3GGWB 3VXTB 1J1PH 1R3JA 4HUXB 1ZHNA 1JTPA 1S7UB 5C8JA 2HT3C 5ISZD 3OKLB 4MMXC 4AEIL 4BQ9A 1B88A 5C70A 2DM2A 4N8CH 2VXSH 5E95B 1S7XA 4HFWB 2A74B 4Z7VA 4JRWA 1T1XA 1UM4L 2FLBT 5JTWA 4PGDB 1XR8A 5DD5H 4RAVA 2F19L 4QGYA 4FFWC 3OMZA 5IQ7L 2VDKL 3LDBB 2WW8A 1HI6B 2MCG1 1UWGH 3BZFA 5D7SL 3IB4A 5ADPH 2BSSA 3RUGE 2EDLA 2G5BB 1CL7I 1A7NL 2X4NA 3BD3A 2X7LA 3BP4A 4JB9H 3VE0A 1U3HD 3TFKC 2ADIA 3MRQB 3QUXC 4NWTL 4G80B 3AAZA 1E4WH 4P59H 1IZKA 2CIIB 3ZTNH 2XOTA 3GHEL 1INQA 5C08E 3T0EA 2EIZB 4N90D 5D7LA 4LF3A 1B6UA 4K3JH 3KLHC 1HH9B 1TJHH 4R26H 5C0CD 1M7XA 2E7LC 5TE7L 1KPUB 4LCIL 1EIBA 2ATPB 4P99A 4GG8B 1KB5A 4L4VA 1U8JA 4ZDHA 3HMWL 4PJ8B 1NH6A 1MQ8A 4NZDA 1NBZA 4LAQH 4LBEA 3H9SA 4ZFZB 4NQDA 3IFPB 3LKPA 4UILH 5LG1A 1BX2B 2I27N 2IPKA 2DLIA 4PJGE 4PJEF 5HGBA 4M1GL 1G7IA 2VN7A 3NAAH 3FL7A 4GKSA 5I1KH 4DKFH 4WEMB 3QQ3A 3SGEI 3NCCB 3TT3L 2J12B 1SY6H 1RZGB 3O6FD 4DAGH 4Y16D 1N64H 1ZHKB 4LKCB 1RZJC 2VIRA 3U4AA 1WC7A 2IFFL 4LSVL 1AXTL 1FRGL 4M61B 3IJHB 5AZ2H 5F7YC 2OMNA 5ERWA 4Z7OF 3FB6B 5I75C 5LKNA 1TMCB 3OKMB 2ESVA 3VXUE 2YMXH 3RWCB 2VSDA 4PJCE 4WTZA 1HN1A 4L3EE 1OAKH 3BD5A 5C6PB 4NO0D 35C8L 3JWOL 3MV8A 5I16A 3QI9D 5MHSD 5E8PB 5E2WL 5D7IB 1N59A 5E56A 1EO5A 2X4QA 1T2XA 3G5ZA 3U9UA 4ODHH 2NXZD 4M93C 3TBWB 5DZOA 1FDLL 2V9RA 4Y2DC 3BQUB 4D8PA 1JHKH 4FMFA 2FCBA 1HILA 5IR1A 3L6FA 1BVLA 4P5TC 4F8TA 1HQRA 2OI9B 4LPTA 1RUPH 3ULVE 2AJUL 1AGEA 2QADC 2ADFH 1NAMA 2ZG2A 1ZT7A 2XA8L 4DFHA 5IIEA 3ULVL 5I8OH 4L29B 5C07E 3FRPG 5CD3A 3MRNA 2E9WA 3IU3A 2CR6A 5DS8B 3T4YB 1EA9C 1AC0A 3BGMB 3PQYD 3T1WA 3GMOB 4YQXH 4FQCH 4F58L 3PWPA 3RZCB 3JV5A 4LVNC 3QZWA 3ISWA 1M71A 3MRPA 4B53A 1CTNA 1FNAA 2OJEA 3MYJB 1CD0A 1H8NA 3GRWH 3VDCA 3KPRA 5CGTA 3OXSB 3CDFA 3ZE1E 3SE3A 5DFVC 4JJHA 5SX5K 2BVQB 4WGWB 4BM7A 5J9PA 4KDTA 3W2DL 2D03H 1Q8MA 3M1BA 1FZJA 3N1GC 5FKPB 2LV4A 2B1HH 4MA7L 5D7JC 1MLBB 4LMQE 4N1HB 1L0QA 2XTLA 4OZHF 1I9IL 2F5BL 5LQBH 3UTTB 2H9GA 2GSGA 5B8CB 3SGDH 5GISL 1JZ2A 3WV0A 3LKOA 3PIQB 3R06A 3CFDB 5DVOA 5KSBE 4OGXL 3HC4H 5HHXH 4TRPH 3BN9D 1U36A 1BQLH 1YMMD 4RGND 3SDDD 5BZDA 4IOFC 1XZ0A 2NNAA 2O5XL 1ZXQA 3RL2B 3WHXB 5CGMA 1J0JA 1A9EB 2ZZUT 1IARB 5IOPB 4HK3N 4PJHA 3WLWC 4F2MB 3BW9B 1YEIL 5JIIA 1UM5L 4FTVE 3TESA 3X17A 5T1MA 1MIEL 4NYLB 3MCG1 2HFEB 2WBJC 5D1QC 3U7YL 2DOCA 5DJZB 3U4EB 1CN4A 5GGRY 5C0JA 5ISZB 1IBGH 2CRZA 4U1HB 5BW7C 2OQJA 1KB9K 1OHQA 3LY6A 3PWVA 3QJFB 5IGXH 5DVLA 2PXYA 1MCBA 2JB5L 4P9HH 3CVIH 3LAFA 5I1DB 3SDXE 1WZLA 1UC6A 2UWEB 3RGVA 4PTTB 2VLLA 1R24A 1NEZA 3P0YH 4RQQB 5IF0A 4O58H 4R6UA 2I5YH 1JPTL 3GFUA 4GW1B 5J6HA 3G6DL 1GL4B 1D9KC 4OAWB 3O4OC 1N6UA 5IB3B 1U3HB 4XBGB 1NCWH 3EAKA 4KAQH 1T20A 3PJSA 5F7FA 5CLTA 4PG9B 3TO4D 4XMPH 3CLFL 5DA0B 3OHXA 3BP7A 4H0HB 4HS8L 1U92B 1OGAD 1RZ8B 1C16A 2FX8H 2NY6D 5C0CB 4E41A 1KJMA 3U0PA 2ARWA 1U8KB 2JJWA 2MPAL 3QQ9C 4M5YH 3L7FB 4MJIE 4P57A 1ZGLA 3MJ8A 1GGUA 4KRLB 3MRKA 4XC1L 1HHJA 1KCSH 3BZDA 4GXVH 3HE6D 4PREA 3R0NA 1H9VA 4OLUH 4JO1L 3QUYA 4HULB 1J1XL 3NPSB 4LHUB 3MV7E 5FYKH 3TYFA 5ACLA 1I9EA 3CSPA 5EZIL 2VUYA 1DSFH 1KCUH 1LMKA 2DN7A 4H8WL 4ORGB 3TWCH 4N0CD 2HFGH 2OTUA 3RTQA 4L8CA 3O6LL 4KJPD 1JUFB 3O6FB 4HKBA 4Y16B 4NKMA 5C0FB 4LOUD 3DJ9A 1IGTA 4ZYKA 5I73B 3TT1L 2F53B 3EDDA 1T04A 1R3LA 2EDNA 3UTZA 4YHIA 1VEOA 5HYQA 3CSYA 1VACB 3WIHL 3MFGB 4XVJL 3MBED 4P46A 5EC2B 3UTOA 4G9FD 1KFAH 1EH9A 3L5IA 3PP3H 3U48A 2A1WL 1P1ZB 3GSVB 1P9MA 2PYFA 3ZHKA 4PJ7B 3QI9B 1Q0XH 1HSAB 4MD5A 3V6ZA 3BJLA 1MCIA 1MIMH 1QSFE 1TZIA 3IDNB 5HYJE 1G9MH 1DQMH 4F80A 5CJQL 3VD5A 5JW4Q 3BEVA 1EXUB 3HHRB 1KEGL 3REVA 1CXHA 1SJEB 1ZSDB 4OLWL 1D5XB 2EYRA 1GGIL 4ISVA 4WGVB 1F6LL 4Y4KC 2IAMD 1CBVH 3PUCA 3CDYA 4KMTH 4FXGA 4C55A 4K71C 3G5VB 1NUDA 2H45A 1X5KA 3QWOA 4NPYB 4W6YB 1AGDB 2X4PB 4XMKL 4NHUB 3W0WD 5FM5M 3RPKA 1TVDA 2DICA 2Q3AA 3GSWB 4PBWD 4YJZL 3QG7H 1RZIA 5HHMD 3WL9A 4U1IB 4J4PA 5TPWH 3V9FA 3DMMD 2FR4B 5E8OB 4BSVA 5C0GB 2V7HA 3Q6GH 3VGEA 4OGYL 3QNXB 1HXYA 1FL3A 3DETD 1UZ6F 5HVWA 4HWBA 3VGHA 3KPQA 2Z9TA 1S9YB 3VWKD 5F97E 4FG6D 4RFOL 5IJKA 5CIPH 3MUHL 2XWBA 3S4SG 4KU1A 4I3SH 4PRIE 3KPOB 3UTSB 4ZODA 2NX5D 5TDNA 4BSJA 1H15B 3NCYP 4PRHB 5IT2L 3Q5YA 1NGYB 1QSED 3QNZB 5C0EA 4KHTL 1S9XB 3VRIB 3HS0B 3OAZK 4HUUA 3ALWA 2DL2A 3SJVD 4ONHB 1WICA 2HP4A 4LNRB 4IRJA 4U6HB 3RA7L 1M7DA 3EDKA 3RNQB 5T1KD 4KDVA 4G6JH 1F4WL 3TPUB 1Z5LA 5FO8B 1LO4H 3K8LA 4EI5A 1UQSB 4AT6B 3QIUC 1MI5E 1A14L 3S36H 3S37L 2BY3A 5KSVA 6FABH 4OV5B 5IEHB 4OZIB 4PJBB 4KK6D 4X5WB 4Y5YC 5D7IF 4PJ9C 4BZ1L 3H7BA 3F7VA 4M4PA 3C5ZB 1ORSA 3MRCB 4S1SH 4DTGH 4PP2A 5JMRA 3FQRA 4ZUUA 2MQ3A 2VISA 3BEWB 5H94A 3U79A 3SQBA 5CZVL 1MFEL 1T5XB 4FQIL 4ELMF 2BMKB 4D94A 4U7SA 2IPUG 3RKPA 2Y5EA 1NFDE 4DJMA 4YC2C 2XN9B 4YGAB 3ES6B 5SX4H 1N2RA 2O93L 2BSTB 4YHZL 3GO1H 4ZFOB 5FXCH 3V4PH 4GAJL 3H42H 4Z7WB 2ZJSH 2D3VA 2HWZL 3RWFB 4E5XB 1IAOB 5HPMA 4QWWC 4OI9A 3PDOA 1JTOA 1Q1JL 1NAKL 1QYGH 3ARFD 4HIXL 3WNNA 2W92A 4GLRI 5D6CB 1BOGB 1F2QA 3U46A 5KN5A 5E8DL 1FFOA 3NFPB 1MAKA 2F54D 4O5LL 4NRYA 1NSNH 1GXEA 1GZQA 1X4XA 4WJ5A 1MFNA 1G1CA 2OM5A 5TQ2L 3FCTB 2UVEA 5GZND 1MHHB 4MA8H 1I8LA 1RK0B 1CR9L 2QKIB 4QF1B 4HUVB 1QSVA 1F4AA 2MCPH 3QEQA 1ZHLA 1YEFL 4YHLH 3HRZB 3UX9B 3LQAL 3N1QC 3WHE1 4KQ4L 4NQEA 4CUCA 2Q3ZA 3P9MA 1MCNA 5EPMB 2DQTH 4CNIA 4NQDD 1F45A 4Q9QH 3MA9H 4M9OA 5DQJB 5F6IB 1UCTA 2DQGL 1CFBA 1I4FB 2DAVA 2GSIB 5DZLA 2IC2A 4R0LA 1VERA 1KBGL 1MH5A 4I2XB 1TENA 2QSCL 4Y19D 1PG7L 2AV7A 4TQEL 3G08A 3P77A 2QQKH 2OTWB 4LP5A 4V2CB 3QQ4B 2DBLL 4KY1H 4R4NC 4MXVE 4L8SC 4D2NA 4M8QB 5BV7L 2BVPB 2R23B 15C8H 3TO2A 4K8RL 3SDAD 4Q9RL 1RZKH 3O3DA 5F3BA 3O6KH 2OBGA 1KLUA 1JGLL 4G9FB 5TF1H 2R29H 1UACH 1AFVL 1L9MA 3T2PA 4NN5C 3WHE0 3X3FL 5DLMH 3M17B 2DTSA 2Z91B 2R2BA 5BS0B 1Z0MA 4JZJC 4OCYL 6CGTA 3MV8D 4HIIB 1X6LA 1FAIL 5FM5O 2BNRB 1ZA6B 2GCYB 4G8GE 1DL7L 3KJ6H 2EDKA 2CKBH 3FO0H 4XP6L 3DYMA 4XPBH 1QACA 1NCAL 1K8IA 5DXWA 3O6MH 3KHOA 5KVFL 3S3PA 2NQCA 1T1WB 3PGFL 5MEOB 5M94B 4JRYB 5I1LB 4XCNB 3SKOA 4MJ5B 4OTXH 3WSQL 3U82B 1DBAL 4QRUB 4F8QA 4H88H 3MO1B 1T6VN 5DC4B 1ONQB 3SN6N 1AR2A 2J88L 3RVVD 4DGIH 5HGAB 5I1AB 4U1GC 5HHMB 3PWPD 4PJDB 1SYVA 1TTGA 3LN5B 3DMMB 1FAKT 2CDFB 4U6VL 4ZAKD 5TDPB 3HZYB 3DI3B 5JIKA 4GFTB 2ZUXA 3D9AH 1UXWB 2AXJA 3TVMD 1DUYA 3F7PC 4C4KO 2HRPL 3LKQB 1OAYL 1TCMA 2E9JA 1JYNA 3C09C 4J3XA 5J1TC 5IK3A 2VDML 1BM3L 2ED7A 4LASL 2JJTA 4R3SB 4N0UB 1DANT 1T1YA 4WUKL 2MOVA 3LD8C 3T2NL 4K7PX 4MNQA 1NC4D 2D4FA 2Q1EA 1MCEA 3DLQR 1QSEB 4KV5E 4MVBC 1CT8A 1A1OA 3IKCB 4MQTB 4U1SB 5F9WB 5IP4A 4YFDB 1KXTB 5D9SA 3T0WA 1LP9F 5DEGB 3IDXH 1RJCA 3O4LE 5EFIB 3KPSE 1A9BA 1EEYB 3ARRA 3D18A 3MXVH 1QHPA 1OM3L 3SE9L 2E7MA 5GGUA 4FZEH 2CR3A 4FQXB 3U4BL 5E8EA 5SV4A 2D0HA 3N1PC 5GGTL 5JW3L 4PJ7F 3V5KA 1EBPA 2ENYA 2NYYD 2ZPKH 1IAKA 1R3JB 4KGJA 1ZHNB 4BQ8A 5C8JB 2C9AA 4KQ3H 3A67L 1GPOL 1S7XB 1VESA 4Z7VB 3GBML 1T1XB 4RAUA 5DEFB 3MLVL 1XR8B 1FGNL 2P49B 4RAVB 5D5MA 1DQDL 5J3HD 1UENA 3ZYZA 1BZ7A 1DCLA 1F4HA 4PD4K 3RGVD 3BZFB 1T03H 2R4SL 4QRSA 3PXHA 2DS4A 3HR6A 2BSSB 3T4AA 2ZUTA 2ZUVA 4UTAH 1N6QH 3MV01 2X4NB 4QXWA 5IV2A 1B3JA 1NCDL 4WU5A 2X7LB 3BP4B 4ZTPL 5I8KL 3LEVL 4NFDA 4NGHL 5CEZH 3PDDA 2ADIB 3HMXH 3AAZB 2F54B 4N8PA 1BHGA 4IJ3C 1T89C 3CIQA 1INQB 3T0EB 5JA8B 1KIUA 3C6LD 2IFGA 5D7LB 4LF3B 4JQIL 1NGPH 4U6YB 1B4JH 4K94L 4G6FD 3UYRL 2OZ4L 4DUXA 1AHWC 1PDKA 1KB5B 2OLDA 1U8JB 4L4VB 4MS8C 4ODTL 4ZDHB 5AYUL 4DGVH 4AL8L 3QP3A 1NBZB 5I1HL 3WD5L 4LBEB 5DRZA 1UB5A 4MA3A 3DIFA 4NQDB 4YHKH 3Q1SL 3LKPB 4JKPH 1KJ2A 3DVIA 4C56A 5CGYC 1E4KC 2J4WH 2IPKB 2Q20A 1MWAL 4U49A 43CAA 5HGBB 5E6IA 1FZKA 3MRBA 4YDIH 4MXQC 5KVDL 5DEZA 4GKSB 5D8JH 5EU3A 1CDIA 5B4MD 3VFNA 3UPRA 1I1AC 3MBXH 4ZNCD 3BZEB 5IUSA 1RY7B 2XTJD 1MCPL 3KDMA 4WFHD 5DJ0A 5SWZA 3RTQD 3LQZA 2EIBA 4XHJD 5GXBB 1CL7L 4HGWA 4K23H 4AMKH 2YA2A 2VIRB 1SVCP 4GKZA 3TNNA 5FEBA 1WC7B 1X5AA 4O2FA 4F9LC 1VKXA 1SYSB 4LLYB 3OAUL 4XNZC 5F3HA 4YXHL 5DGQA 4NM4L 2J2ZA 4CMMA 4P46D 2JJVA 5HDOA 3RIAF 5FYKU 4P2CG 1JWMB 4P0DA 3D25A 5CHNB 3MV8B 2FATL 1W72A 5I16B 1FIGH 5IVZA 4J3WA 5F9DC 1C5BH 2NR6C 4F7EA 1N59B 3VGFA 1A7PL 2X4QB 3G5ZB 3U9UB 5ALBL 1WUNT 4HW6A 5HD8D 4KKCD 2YUWA 3K1KC 1HILB 4J3TA 2Y7QA 5IR1B 3L6FB 3VXSE 4Z7WF 3U0TA 2XWTA 1BVLB 1NDGA 5MERB 3JV4A 1G0XA 1HQRB 1T3FA 1NGQH 1AGEB 1AY1H 2X4TA 1NAMB 4M1DH 4WY7H 5IIEB 2Q8AH 5CD3B 3C87A 1V05A 4F7TA 3MRNB 5IW3A 3IU3B 5EWIH 3RVTD 5GS0D 1U8QB 1JPGA 3BKJL 5KS9F 1FCCA 1QBML 4TUOB 3PWPB 1JNLH 1K4CA 5EA0L 3U36A 3UPCA 3MLPA 4X6DA 1M71B 3MRPB 5KANG 5SWSD 4Y5VB 3TN0D 2OJEB 3RVXC 2OXGA 3S35X 2RR3A 3KPRB 3OQ3B 3ARBD 2VYRE 5K9OA 1QFOA 2VXVH 4LLWA 2FZ3A 3BDYL 5DRNB 3LDBC 5HSFA 5J9PB 3O8XA 3P0VH 3M1BB 2B0SH 4LPXA 3ARDD 1FZJB 2DLHA 4G6KL 3CFKA 1Q94A 4MAUL 2H9GB 2GSGB 5F7LB 1MJUL 4LHUG 3LKOB 3EJYD 3KS0J 3ZDYE 2P5EA 3R06B 1CLOH 3IXAA 2VDLL 3PWUB 3HC0A 4OM0L 5J89A 2A6DB 1KN2L 5LCVL 1F58H 1S7RA 5BZDB 1KJVA 4P2OD 2NNAB 4JG0L 3QXUA 4NWUH 3TZVD 3HUJA 3LIZH 2A6JA 2ZNWA 1NBVH 2D7TH 3EIFA 3GMLB 4PJHB 2ADJA 4RDQF 3CAFA 4TNWK 4Y1AE 1XGRA 1UB6A 4GBXD 2G2RB 5D93B 5HI5D 5FGBA 2GIYA 2NY0D 2YS4A 1ULVA 2WAHA 4PJ8C 5T1MB 3LEXB 2IBZX 4PRPE 4DOHB 4YXLH 1JBJA 5FAAA 4B50A 4YR6A 5C0JB 4P9HC 1G84A 5I8EA 2OQJB 5JHDE 1QZ1A 1PSKL 3PWVB 1KB5H 4MDIA 4QHNA 3E8UL 1UADC 4MJ4A 5IJVA 1FZOA 1P2CA 4B0MM 1MVUB 4JHZA 2PXYB 5BVPH 4HDIA 3DSFH 5DO2D 5HHVL 1UJTA 2KDGA 1JE6A 1C5CH 1CF8L 4LSQL 2R0WH 3RGVB 2VWEC 2VLLB 2BX5A 1M6OA 5E2UH 1R24B 1IC4H 4QT5A 5DMKA 1NEZB 4GW4A 5FGCB 3SPVA 3I85A 1WBYA 5AUMA 4L4TA 5IF0B 1Q9OA 2IGFH 3A6BH 3RY5A 4ZFGL 1A6VH 5J6HB 3H9HA 3WUZA 5D6DC 2Z4QA 4HFUH 3GNML 4LLMA 4NC0B 4ENED 1M4KA 2X1OA 1FFRA 2X89D 1LO2L 1T20B 3PJSB 2CK0H 3LRSA 4LRIC 2DQIH 4NJAL 5HYSA 3OHXB 3BP7B 3QEHA 5ILTL 1E4XH 1JI1A 1G6RA 4Q6IA 2UVFA 1X44A 1C16B 3F6LA 4G6FB 2UUDK 4KJYA 2OL3A 4E41B 1KJMB 3QWQB 3U0PB 3ZO0A 2VH5H 3QEQD 1EPFA 1JP5A 4P57B 3V6OE 1ZGLB 3K8MA 1JWSA 5E4IA 3M07A 3MRKB 1HHJB 1DVFA 3BAEL 4QRPA 5CJ8A 1UH2A 5GGVL 1G7HA 1XIWC 4NQSA 3QUYB 1RU9H 5BMFH 4GRLD 2VXQL 2A83A 3TYFB 1KACB 3IETA 5F1KC 5MEND 4K3HA 1OAQL 3DX7A 1B6DA 4P2RA 3UJJH 3S96A 3NIGF 2OTUB 3RTQB 4Y7MA 4L8CB 3QT2A 3BOVA 3WFEL 4XVSL 5IFHL 4HKBB 5JORA 1OVZA 4JFZL 5BZWA 4I5BB 3MUGA 4NKMB 4E42A 1P5VA 1IGTB 4OZ4A 1YC7A 1T04B 1R3LB 1LILA 4G8EA 3UTZB 1F13A 4JDTH 4YHIB 5HYQB 2HRLA 1OCWH 2VLJA 3ARQA 1BFSA 4P46B 3QDJA 5JR1L 4XCFL 4M48L 2EO1A 4DGYL 2B2XH 5KZCB 1JYXA 1FNEA 5I19L 4X7FC 1G9MC 3EOTH 4FN0A 1C1EH 2PYFB 2Q76A 4JFOA 4Z7VF 4MD5B 4KJWC 3V6ZB 2XZCL 4NNYA 1CGWA 1F6FB 4JDZA 4FNLH 2P46B 1TZIB 1FFNA 1OAZH 5DUMH 3QRGH 3P9WB 1UCBH 5L2KE 1HKFA 4R8WL 3BEVB 1W8NA 3VG0L 4YBQC 2EYRB 2CUHA 4ISVB 2Z35A 3CC5A 3NCYS 3ALXA 3VMOA 4APQD 3VI3F 4MWFB 1IAIH 1WWCA 4FXGB 4YEEA 3U7AA 4OCRH 2JCCB 4ZTOH 4XAWH 3LN4A 1J86A 4G7YH 5FUOH 1D6VL 1FZMA 4FQ1H 4OQTA 3HNTL 1BF2A 2YD3A 4WI9A 4OCMC 3SDYH 4CN1A 1XGQA 1T83A 3GIVB 3GK8H 1RZIB 5SWSB 3DURA 3WL9B 1KENL 4Z77A 5D70H 4ZG1A 3TN0B 2GK2A 4BSVB 3VD9A 1WAAE 3MRFA 1DEDA 2IBBA 5DSCA 4KK8D 2V17H 1HXYB 5F6HJ 2DQCL 3WIFB 2DWDB 4OLYL 3I6KA 1ND0A 5CS7A 2WUBL 3FONA 3NN8A 4YHNA 2AK1H 2XWBB 1Q9KA 3QUML 2HVKB 5TDNB 2F74B 1BD2E 1Q9WA 3MLRH 4XPGL 3TV3L 1H0DB 1CVRA 3RUGA 2BXZA 1U3HC 3EHBC 3PP4L 5JOPD 3EO0A 2AAVA 3U0WL 1V7ML 4MQ7A 5C0EB 2NY5H 3VI4E 4HUUB 1P7HL 4OIAA 1LVEA 1FVEA 3TZVB 4IRJB 1M7DB 3F8UB 2LU3A 5I6XC 1CFNB 4UT7L 3PHOA 2XY2A 4YX2H 2I9TA 5C08A 5F7HA 3F7RA 2EE2A 1I3RA 5FKAA 1EFXA 5D1ZC 1MRCL 2UYLA 1WEJL 3VW3H 3I2CH 5B38A 2P43B 3STBA 1X4ZA 4RDQG 4YHML 5KSVB 3EFDH 3V52L 4OIBA 5K9JH 2WANA 3QXAB 3NZHL 4HT1L 4WW1A 3EJZC 3H3KA 4ETYA 3H7BB 3F7VB 5F9OH 4PP2B 3FQRB 5TDOA 4ZUUB 3NPSC 2BJML 2VISB 4PJ5D 5C2UB 5H94B 5I15H 3F12B 5EU7E 4RGMC 2HKFL 5DMJB 2HMID 4PJGA 1L9NA 4N90E 4LGRB 1MFCL 2VDNH 2WWKO 1N2RB 4HG4K 3O6FC 4U7KA 5C0CE 5I73C 5HPMB 1NCCL 1MCJA 2W9EL 3PDOB 2HG5B 3RY6A 4OCNC 5IMKA 4MNHA 5A16A 3H3BC 3U46B 3D85A 4WCYL 1FFOB 1HIML 5TQ0L 3VU2A 4NRYB 1HNGA 3AY4C 3VXUA 4G3YL 1GZQB 1J0YA 5L8JB 5TE4L 3QI9C 4PJCA 4L3EA 1N5YL 5JXAH 2J6EH 4NQVA 5F1OB 4JKLA 2APFA 2DRUA 1ZHBA 1V5JA 4ZS6D 2Y6SC 3QEQB 1CXLA 1IGML 4NP4H 4Z0BL 3FN9A 1W0WA 5ACZA 5JW4N 1KULA 1CK0H 3NMEA 4NQEB 2I07A 3P9MB 4CNIB 2MKLC 2DIAA 1KSRA 3OV6A 1EAPA 5HYFA 2EDFA 3QPXH 1T7YA 4J3SA 1BF8A 4R0LB 1MH5B 4W70A 2AV7B 4LHJB 1P4BL 2FWOA 4RWYH 3G08B 5C07A 4Z7NE 3P77B 1UJ3B 1BFVH 1FO0A 3EYVA 1RZKC 4JR9L 4PFEA 2BZDA 3H9YA 4YWGH 2CMRL 1I7UA 3ARSA 5HYEA 4PJHF 1CGTA 3STZA 3TO2B 1XGTA 5E6YA 5FUZL 3O3DB 1N4XL 5GJSL 3QA3A 5F3BB 4HWZA 1KLUB 4LDLB 4RZCB 3UZVB 1UYWL 2FSEA 3FFDA 1FSKC 2FHFA 3D39D 3IFOA 2R2BB 3VMNA 4DKEH 1MEXL 2G75A 4NN7B 1IRAY 3EOYG 1P4LA 5FYJD 1LNUA 2YK1L 3PQYE 3STLA 2A9NL 4QXGH 1K8IB 1DUZA 1OAUL 2W0LA 3BN9C 2AXFA 1IGFL 4X6BA 2VZTA 5CINL 1QFWM 1O7SA 4APQB 5KSBA 3SKOB 1K6QL 1NLDL 3ZDZF 5AZEH 4YIQA 1DQJA 3CK0L 4UTBH 3UTPE 3BISA 2E8ZA 1ZVYA 1U41A 5LBSH 4Q6YA 1Z9SA 1TTFA 5GS1A 2FEDD 4FTVA 3ETBF 5ICYB 3C5ZC 4LDEB 5EIQA 1FPTL 1YYML 4HAGA 3OKOA 1CXEA 5A2FA 2ZOKA 2DM3A 4P4RA 2JJSC 3LH2H 4J7RA 3TP4A 3TCXA 1YMME 4RGNE 1DUYB 4GRWB 4X0KA 5DGRA 5TFSL 2EH7H 1JGEB 2Y06H 2AJVH 3WFCH 3SDXA 3BWUC 1DBKL 2VLKE 5IK3B 1T1YB 3HLAA 5JIPA 4MNQB 3JWDL 1LEIA 1GGCL 4JQVC 1IC7H 1CT8B 1A1OB 3QCTL 1EVTC 5D9SB 5ETUA 4OZIE 3KR3L 3G5XA 2Y23A 4PJBE 2UY7A 4NQCD 3HFMH 3EO9H 2R0LL 4TNVK 3S9DB 1GC1L 1KNOA 1JF6A 3IJSA 2GHWB 3NABL 5D7KE 2E7CA 3D18B 4HUKB 4KZDL 3C8KA 4HIHA 1VGEL 1ZLUK 3O2DH 2CJUL 5GGUB 3EYSH 1FV1A 5E8EB 2ZCKL 3IU4L 3UDWA 3V5KB 1OW0C 4Q0XH 2VLRD 1NPUA 3F7QA 1MJJA 2HT2C 4WTZG 1IAKB 1ORQA 3MA7A 2YD8A 4DKAA 3MOAH 5IB4A 4MJIA 1X5XA 3QCVL 2IQAA 2OR9H 5HY9A 3W9EA 5F6IC 4JFDD 4MJ2A 1T1ZA 5BCAA 4PJ5B 5CZXC 5TE6L 4UBDD 1OY3B 3LN9A 4M1CD 3BIAX 5DUBA 5D5MB 3BYYA 1RFDL 1UWXK 3MV7A 4WWKA 1R3IL 4KK9D 1OGAE 4D0CA 3BWAA 4QRSB 4DW2L 3MREB 5IB1A 3QISA 4LOUC 3ALPA 3B8SA 3T4AB 1WFNA 4L4TD 1RIHH 5C09D 1IEHA 2QQNL 5BOPA 1OP5K 3MLZH 4N5UA 5IV2B 5DT1H 4RX4A 2YKLL 4WU5B 4YHYB 2ZUQB 3SGJA 1JGUL 3O81A 4KJQC 4M9PA 3WIHA 4V1DD 3BT2L 4HIJB 2PR4H 1IFHH 4X7CC 3QBTB 2R56H 3QZWG 2PCPA 1NUFA 3CXHJ 5DJAB 4BUGA 5FM4A 4TSCL 2ZCHH 1ZLWH 5C0RL 4I2XE 3INUL 3RVWD 4OCXH 4OCWL 3JSSA 4HKXA 5CFHA 4I8DA 4OCSH 3UBXI 1QSFA 5HYJA 3FMGL 4XPHL 4LVHB 5DRZB 1UB5B 4MA3B 3DIFB 4Z8FL 3B2UC 3WFBL 2DQEH 4G7VL 3OR6A 1KJ2B 43CAB 5E6IB 1ETZA 3DX6A 5EULV 4YPJA 1XF2B 1HE7A 3T3PE 5EU3B 3VFNB 3UPRB 1G9NH 3L3JB 5I18H 2N4IA 1YY9D 3K0WA 4XNYH 5KANI 4P2RD 4PLKD 3KDMB 5DJ0B 5SWZB 2JE8A 3LQZB 1UEMA 4JGUA 1XGUA 3B9AA 4HGWB 3DMMC 4GKZB 3TNNB 2X42A 1JWUA 5CZKA 4O2FB 4NC2B 2WUCL 1VKXB 1NGWA 5KOVC 5F3HB 2VDOH 2VLJD 2GQHA 4HJ0D 4CMMB 1RSFA 4Z5RA 2FHBA 3M8OL 4EIZC 3W11C 1U58B 4FFYL 4Y5XA 4LSUL 3NCBB 3FRUA 3JVGA 3D25B 3TYGH 1W72B 4CL7A 2NLJA 5IVZB 1R5WB 5L0QB 5LGHL 3V8CA 2DMCA 3QDHA 4JREB 4F7EB 5ID1A 4GRWH 3V0VA 1QOKA 4OI8A 5DHXB 2IMNA 2V5YA 5IB2A 4WHTA 3W0WE 3EYOB 1XF5B 4PRIA 5FV2A 3TEUA 5F9WC 3WS6C 2Y7QB 1BJ8A 1CD9B 1H3TA 1YEGL 3U0TB 2XWTB 1NDGB 4LEXH 3UO1H 4NJ9H 2F8OA 1T3FB 1NEZG 2X4TB 3OZ9H 5IVXB 2E27L 4ONGL 3DUHA 3IYLW 3WE6A 4Q9CA 4F7TB 4FQXC 2VRAA 2EO9A 3H3PL 2IG2H 3NACH 4NSKA 1JPGB 1S9WA 4UQ2A 2FECI 1MI5A 4M7LT 1HINL 3U36B 4X6DB 4WFED 1OTTD 4ZUVA 2NX5E 4R2GD 4ZPVB 1RZFH 2JELH 1CG9A 2EXYD 2AK4D 1I1FA 5K9OB 4EDXA 1F4XH 4TUKH 1B4RA 4LLWB 2FZ3B 4PRAA 3KLAA 1LD9A 1BQHA 4H1LH 3SJVE 2DL9A 2NXYD 3MLSL 4Z18A 3O8XB 1CZ8H 1A7RH 2X10A 3I3EA 3MMEB 3QUKB 1NFDA 3QH3A 4TOYH 2J8HA 3CFKB 4OBSA 1SEBA 3IDUA 3RHWF 3KS0H 3JV0A 3U6RA 3FN3A 3ZE0F 4F57L 1MRDL 3VJ6A 1MPAH 2P5EB 4K9EH 1BQUA 3RPIA 3BKCH 3IXAB 3HC0B 1S7RB 3BKMH 1KJVB 5HI4D 1ZEAH 4TSBH 2E5EA 3T0EC 5GZNC 3HUJB 2A6JB 1Z6JT 5K9QG 5CLWA 1MAML 1NMAH 1ZLSH 4GJTB 2ADJB 3L5WA 4EUPH 1XGRB 1UB6B 4PJIE 1OP3K 2ZUYA 2AI0H 4YAQB 1YYLH 2H32A 3LKSA 4C83A 4DQOH 1HKLL 3REWA 3L3KA 1MQKL 1HZHH 2EH8H 4YR6B 5I8EB 3O0RH 5C0DA 1HHHB 3ZYIA 1XGYH 5DMYA 4MDIB 3CDGA 1EJOL 4JY6A 1UEYA 5IJVB 1P2CB 4JPWL 2K1MA 4HDIB 3GM8A 3I50L 3PWNA 2MHAA 2F54E 1RURH 4Y8AA 1YEJL 4Y4FA 3SEPA 1KJ2H 4CU8A 2YWYA 3MUZ1 1JHLL 1M6OB 4R96A 1XT5A 4QT5B 2DQJL 4GW4B 3SPVB 1WBYB 5AUMB 4L4TB 2XKUA 2FB4H 4JVUA 2DLFH 4ODUA 4WTXA 2O5YH 5FCUL 3H9HB 3LEYL 3LS4H 1PW3A 1NANH 4LLMB 2ZUSA 4WI4A 4P3DA 25C8L 5GRUL 4D3CH 4RFEA 4R4FH 5FOJA 1OLZA 3LRSB 1ZLUH 4PGEA 4QHKJ 5HYSB 3QEHB 2Y9RT 1T4KA 3ZKMD 5FUCC 1G6RB 4YDVA 4NKDA 2KZWA 5DFTA 3G6AA 1WZKA 3KG5A 4ODVL 2XY1A 4Y19E 2H2PD 2OL3B 1PLGL 3MCKA 4K3DH 1FYTD 4LSDA 2A0LD 4OD3L 2RHEA 4WHDA 4G8GA 4LIQH 4PB9L 3DNKA 1D5ZA 4HZLB 1TVHA 3N50A 4NHCH 1EO8L 1W72H 1GAFH 4EI6A 3B9KA 4ZD3L 1DVFB 4HS6A 4QRPB 3VCLA 1EHLH 3RVUC 4NZRL 1WCBA 3MOBL 4MHHG 5I1IH 4EIGB 2A83B 5D1XA 1R5IA 3ARUA 3SO3B 3DX7B 2IJ0C 4P2RB 1IKFL 4FP8L 4NT6A 1RMFH 4XPTL 2DJ4A 3CFEA 5JORB 4MGXA 5BZWB 1MFAL 3MUGB 4E42B 5CJBA 1YQ2A 4OZ4B 4Z7QF 4Z7OE 4G8EB 1S7TA 2VLJB 3THMH 4A6YL 4UNTA 3QDJB 3SE3C 4OCLC 2AQ2A 3DYOA 2D0FA 1T2QL 1FNEB 1NCNA 1A2YA 2ICWI 3IDJA 4KDTC 3SOBL 1BECA 3QFJD 2Q76B 2NY4C 4K3EH 2DQFA 4JFOB 5CILH 5F8RC 3H6JA 4NNYB 4JDZB 5HHQA 3OXRA 4XT1C 3LMJH 4GRMA 4P49A 1FFNB 4KI5F 2VZOA 4M6OH 4FXKA 1TLKA 4I18A 2JJUA 4XBPA 3MACL 4MB4A 1KYOK 2Z35B 2Q87A 3CC5B 2O61A 2FBJL 5KVGH 4JFQA 2H8PA 4PPTA 1QLFA 5CJ5A 3GUTA 1M7IA 4POZC 1CD1A 1C8PA 1QD0A 3O4LA 1TJGH 3KPSA 4LK4A 2WIIA 3LN4B 5D93C 1FZMB 4EBQL 4UOW0 5GGTA 1S7VA 2COQA 5IVNA 1YPZF 3DWTA 4FTVD 4R2GB 4Z77B 3DURB 2SEBA 4QTHA 5L6YL 4YE4H 2KPNA 3AS3A 4N8CL 3ET9F 3MRFB 2AK4B 5DSCB 2YOCA 2PXYC 4JY5L 3S3SA 5LGKA 2FO4A 4TVPH 3GMPA 3QXDA 1T21A 3D1MC 1ND0B 3RGVC 4CDHA 3FB5A 2OR7A 4JHBA 1UWGL 5C6TH 4RNRA 5I8CA 3NN8B 4YHNB 4H26A 1EERB 2NY5C 5ADPL 1Q9KB 2D0GA 5FDYA 2FX7H 3FO9A 4NZTH 1Q9WB 4IOIA 2YEZA 5C3TA 3RUGB 3V2AR 4XPAH 4JB9L 2V9TA 3EO0B 3FHAA 4DOHE 4MQ7B 4HLJA 2P45B 1E4WL 3MTRA 3QO1B 4P59L 1I3GH 1Z3GH 5TGBA 2F8XC 1TCRA 1I3VA 1E28A 4WI6A 4PBXA 1WZ1H 1FVEB 4NO3A 4X80L 1SM3H 4H20L 1NC2D 2NZ9C 4AH2A 5FYLD 3PHOB 2VDRH 1OTUC 3KJ4B 5C08B 1TJHL 1I8IA 2CO7B 5ICZA 1I3RB 5FKAB 1EFXB 2OZ4A 2UYLB 3CH1B 1G6RH 5B38B 3E1F1 4RSVA 2XG4A 3CJJA 4JHWH 4OZFH 3NH7L 4LAQL 1QPPA 5FGCE 2OL3H 3ARGD 2OK0H 4P4KD 4WW1B 4MJID 2MNUA 5D2NE 2YC1B 3NA9H 1A4KB 1ITBB 2AKRA 3QUYC 4LPCA 5TDOB 1EUUA 1M05A 1Z9OA 4X9HA 3CGTA 4JEGB 3TBTA 4YZFE 4U05A 4JM2A 3MR9B 2FYYA 2I25N 3BPOB 3GMRB 3ILPA 4DKFL 4XP4H 5I1KL 3PDGA 3BH8A 4MZ2A 2VXTL 4NZJA 4QRTA 1BVKA 4YGVA 3RTQC 4J3VA 2APBA 1LK3H 1ZMYA 1ZANH 5T3XH 3N0PB 5ADOH 1MCLA 1V3JA 3HC3H 3IDIA 3OF6A 3RBSA 5AZ2L 5IMKB 4MNHB 5EH1A 4P46C 4YLQT 5A16B 1A6UL 4O02H 3OKKA 3D85B 4X6DF 2Y72A 3LOWA 3RAJH 1P9MC 1EZVX 5HPOA 3VXUB 4PJCB 1AGBA 4L3EB 4IEFB 5T1DH 3UJTH 4KC3B 4MSWA 2B1AH 4N0YL 4NQVB 4ERSH 5JHLH 1VENA 1HK6A 5K93A 5E08H 2E6JA 3FKUS 1ZHBB 5HD8C 2FGWL 4LQFH 1RPQA 3E6HA 2XTJE 4WFHE 1OOAA 4GXUN 2QSTA 1W0WB 1ADQH 1C08A 4OLZH 5ACZB 5HYJD 1FG2A 2AABL 3D0LB 2X05A 3TNMA 5HI3D 4N0FB 3GBNH 1EAPB 3VXSA 5B39A 5INDA 2AJXL 5I8OL 1F8TH 2D9QB 5JA9A 3MGTA 2FWOB 1EMTH 1ODAA 4LCWD 2FRGP 5C07B 1JZ4A 3Q5OA 2ARJA 3UCRA 4YQXL 4FQCL 1L7TH 2V2TA 5C0NC 1Y6KR 2C3VA 1MVFA 1I7UB 1J5OL 3VRJA 4FHBD 3RIFF 3VG9C 2R2EA 1XEDA 5HTSA 4J4PC 1H5BB 1JFQL 3HE7D 3STZB 1N3NB 1XGTB 4WO4A 2EIDA 1EBAA 3GRWL 4OQTH 2GJ6D 3V4UL 3QA3B 4M7LH 4PP1D 4HWZB 1A6ZA 1SJVA 5DA4A 4YXKL 3Q2CA 2FSEB 3FFDB 3JXAA 3WO3B 1CGYA 3IRZA 3IFOB 5KSAD 4AEIH 4CU6A 2H6PB 5IJKC 1KOAA 1HHGA 2PF6A 4H1LG 2ITCA 3QSKB 2G75B 4BH7A 4NBZB 3T77A 2JCCE 5ECJE 1P4LB 1LNUB 1PYWA 1YMHA 2BHYA 3STLB 5IQ7H 3RNKA 5GS0L 5JQ6L 2VDKH 5JXEA 1DUZB 3MRIA 2HYMA 2AXFB 1OD9A 2L7UA 3HC4L 4TRPL 4X6BB 5CEYA 2DQDH 2XQYG 5EN2A 4MA1B 5D7SH 5SWSE 3BKYH 3QUZD 1JIBA 4IRJC 3UAJC 1A7NH 4HX1A 2PTTB 3ULUD 4YIQB 4EI5C 1DQJB 4M7KL 4XB8A 4NWTH 1IC5H 1J10A 1V8HA 5EU6D 3DSNA 2M1KA 4Y1AA 2WP3O 3GHEH 4EUPG 3QIWD 5GS1B 4FTVB 1P7QD 2LU4A 1JZ6A 3IDYB 5DK2A 5BVJA 4PJFE 5IM7A 1IBGL 3JTSB 4PRPA 4PYHA 1FBIL 3OKOB 5TE7H 3FO2A 1QFUL 2ZOKB 1UG9A 4LCIH 4P4RB 1GHFL 5JHDA 1T2JA 1UZ6E 5DO2C 3HMWH 5J7CC 4X0KB 2W1NA 2GW5A 4P9HL 3CVIL 3RX5A 5JNYA 5BO1L 5F96H 1CDJA 4LKXA 2CIIA 1RQ5A 3SDXB 2VB5A 3P0YL 2D7OA 4O58L 4QOKD 4Z95L 1X5GA 2I5YL 2PYED 4XVUD 4M1GH 3HLAB 1PKQE 2AJSH 5A3ID 1JMXA 1VB9A 1ZA3A 1HH9A 1LEIB 2ID5A 1O7VA 4OFKA 3SKUD 3S5LA 1NCWL 2YN5A 4KAQL 3ARTA 5ITBH 2VZUA 5ETUB 1FNSH 3G5XB 4GMTH 2DIJA 2VQTA 1KNOB 1DFBH 2IFFH 4LSVH 3C8KB 1FRGH 1H3XA 1I8LC 4ZFZA 1O5DT 1ACYL 4JFYA 4PGBA 1IILE 1CYGA 1TXKA 1FV1B 1NL0L 4MAYA 2DMBA 1IGJB 1JCKA 4M5YL 1KXVC 1MJJB 2EXWC 2Q6WA 1ORQB 35C8H 5FFLA 3BZ4A 5IB4B 1KCSL 4GXVL 4MJIB 4C57C 5HY9B 3V6OA 2IQAB 5E2WH 3DOSA 3W9EB 4Z78A 4JM4L 1T1ZB 1IAII 4JG1L 4K7PH 4R0LC 5GRWA 1AQDA 4ELME 1FDLH 2Z31D 3WDHA 4HWUA 3FB6A 1K8DA 1KCUL 3MV7B 4WWKB 2FX9L 5IG7B 3ZHLA 3WO4C 3TWCL 4D0CB 3RWIA 3BWAB 3C60A 1QR1A 5IB1B 2R9HC 3SDCD 2XA8H 4TTDD 2BVUA 3ULVH 2YD7A 1XR9A 3AXLA 2FGZA 1FO0H 1F11A 1PZ5A 1U8MA 2JK5A 2X4UA 3GSOB 4UQ3A 1I1YB 1AGCA 2ERJB 4K8RD 3BQUA 1NBYA 3UYPA 4F58H 1A7QH 4UAOB 5EU4A 1WFUA 2X5PA 4XAKD 5KJRL 3E2HC 4CVWA 1DLHA 2PCPB 5EO9A 4NN7C 1MIML 4WW2F 5F7NC 4FABH 5MENE 1QLEL 4HKXB 1DQML 3ZSSA 1WIUA 4NNXB 2FLRT 4G8GD 3CPLA 5HYJB 3H9ZA 1QBAA 3FHQA 5L2KA 4JFPA 1CIDA 2XYCA 4MA7H 4GQ9L 1G9NC 4LQ1A 3RZCA 4EZMA 1I9IH 4JO3H 2LAAA 3OR6B 4GS7B 4KMTL 3RUGF 5GISH 3VXQA 1MJ8H 1PEWA 1ETZB 1ZLVK 4OGXH 4NRXA 2BVYA 3RDTD 5HXMA 2WK2A 1DR9A 2CH8A 1XGUB 3I3BA 3ULSA 3KHQA 5FYJU 2F58L 1JWUB 5FK9A 1G7PA 1NGWB 1S78D 2XZQL 1YEIH 3Q6GL 5B8CA 4NZUL 2HLFC 4RA3A 5DQDL 4Z5RB 2DLEA 5IVOA 3U7YH 1WAAA 2ZG3A 4JGJA 3CFDA 4KKAC 2GKIA 4Y5XB 3TA3D 3FRUB 3MRMB 1VA9A 2NLJB 1H3PL 3QHTC 5ID1B 1U9KA 2JJTC 3KYAA 3V0VB 1JHTA 4WDIB 1A3RL 1QVOB 4WHTB 4ZQKB 2YRPA 2JB5H 4PJGF 5DWUL 3QUMA 3UTQA 2J8UF 3H2WA 5KVEH 3AS0A 4PRIB 4WUUD 2QSVA 3BW9A 1QFWI 1BD2A 2GYSA 4U1JA 3SBWA 4TVSa 3LHPH 3QAZB 4Q74A 4PLJD 1OLLA 2NZIA 1X5JA 5K9QI 3WDJA 2Q7NA 1JPTH 3VWJA 2CIKA 4Z0XA 1LO4L 3WE6B 1DBJL 5F1NB 3CLFH 2IMMA 2RFXA 4PJCF 4NSKB 3S36L 1P7QB 4HS8H 4FA8A 1S9WB 4UQ2B 5HYSG 1TITA 4ZUVB 1BP3B 3O3BA 1BIIA 1YNLL 4KVCH 5IBUB 2G9HA 4OZFG 4S1SL 4DTGL 1CG9B 1T7ZA 3CXDL 5JOPE 5JOFA 1I1FB 5DQ9A 3I9GH 4OAWA 3P11L 4PRAB 3KLAB 4FFZH 1LD9B 1BQHB 2FIKA 4KI5C 5CSBA 1GIGL 2JIXD 12E8H 4L9DA 3GHBL 5K59E 3P4NA 1NFDB 3QH3B 3MOQA 1J1XH 2ZJSL 4HUNB 3ULVF 3EUUA 1SEBB 3NFSH 3U6RB 3RJDA 4ZUTB 5C0CA 1A6TA 5EZIH 4YHYC 3HI5L 3VJ6B 3RPIB 1EFQA 4H8WH 1U8KA 3GKWL 4MCZA 4NO5A 3MV9D 3O6LH 2H2SD 4G43A 1A7BA 4ZXBD 4KTDH 4Y89A 4O00A 3TT1H 3VXMD 4PJ5E 4MA8L 2NW2B 3S35H 4PTUA 3NFNA 3U1SH 4GKNA 3N06B 4K2UL 4KK5C 3L5WB 4ZS6C 4QRRD 4X9IA 2MCPL 1RVFL 1INDH 1S3KL 1J88A 2H32B 3LKSB 2A1WH 3VFGL 4C83B 2FECL 5C71A 3L3KB 4Y0GA 4P9MH 2NY1D 1FGVH 3ZYOA 4X4ZA 4KRPB 2D2OA 4JRXD 1JUFA 2RCSH 5CBEA 4Q9QL 4Y16A 2DKSA 3CDGB 3ROLA 5E6IC 2X6MA 3MRGA 4BZ2H 2OP4L 2P44B 1KEGH 2MHAB 4HHAA 4R9HA 4TSAL 4HXAH 1VACA 1GGIH 5KSBF 3I3DA 4L8DA 5C0BD 4WWID 4Y4FB 3EBAA 4BUHA 2DQHH 4KY1L 4OUUA 4X7TA 4NO0A 4ODUB 2ARJQ 5EOQL 5BV7B 4P3DB 4XMKH 3O6KL 4OLXL 5GRJH 2R29L 2QSQA 2BHZA 4RFEB 1FLRL 1CDYA 3J7HA 4PGEB 1F5WA 2AEPL 4QGTA 1T4KB 5ABDE 2HT4C 4YDVB 5T33H 4S2SA 1BIHA 1MRFL 3G6AB 5L0QC 1J7VR 3MCKB 9CGTA 3KJ6L 1B0GB 2BOBA 2CKBL 3SKNB 1A5FL 3JZ7A 4XPBL 4G8GB 1X4YA 3O6ML 1D5ZB 1TVHB 2X4PA 1LO3L 5DD3L 3SDXF 2APXA 3PQYA 3FOLA 4EI6B 3B9KB 4RFOH 3GSWA 1L6ZA 4HS6B 3VCLB 3HAEB 4I48A 3EO1A 4MLIA 1X5ZA 4NC1E 1WCBB 4GO6B 4DCQB 2AXGA 4S1DC 5E8OA 1KTDA 5IT2H 4MQXD 3NBNA 1IE5A 1DN0A 3RDTB 1R5IB 3D39E 3MJ9L 4I0PD 3ARED 4RAHA 1A21A 4DGIL 3ROOA 1J9CT 2LVCA 3CFEB 5L9DL 4JPVH 1AE6H 5FYJE 4WI3A 3MJ6A 5FYJL 4IRZL 4ESKA 1S7TB 3GSQB 5BJTB 2CPCA 4JO4L 1JPFB 2X41A 1A14H 3T1FA 4Y4HD 3S37H 3DECA 1A2YB 3T0VA 2AS5M 1TDQA 3K80A 5B38G 3O8XC 3QNZA 1YMMA 2YA1A 3SDDA 1L7IL 2DQFB 2NY2B 3PL6A 5IVXE 3L3HB 1SBSL 3OXRB 3ARPA 4GRMB 4YBLB 5CZVH 1MFEH 2VLKA 4FQIH 4EOWH 2ED9A 4Z7UB 4FXKB 4WUUB 5FO8A 2EDOA 1XCTA 4I18B 1FL5A 5DR5L 3UC0L 3D6GA 4XBPB 5KTEL 1HHKA 2FH6A 3ZTJH 1ZLVH 2O61B 3IDXL 1JK8A 4GAJH 4JFQB 2H8PB 5IEHA 4R7DA 1QLFB 4OZIA 3EYQD 4PJBA 1RULL 2HWZH 3GUTB 1M7IB 2HKHL 5H8DA 1CD1B 1NAKH 3O4LB 3KPSB 4HIXH 2WIIB 3KPPA 4KWUA 4FZEL 4JFFD 5I1GL 1U8HA 5FGBC 4EN3D 3SGKA 4TN9A 1F2XK 3DTXA 4JY4A 1S7VB 2ZPKL 4YEFA 3RI5K 2EC9U 3QXTA 3QXVA 2SEBB 4QTHB 2D31A 4IMKA 4KQ3L 1CR9H 2FIRT 3U30B 2XKSA 4UBDC 2X1WL 2VITA 3VRLF 4WFGD 2FO4B 3GMPB 3LQAH 4NQCE 2JIXB 1T21B 3LSOB 5DD1H 3N1MC 3TO4A 3FB5B 4MZ3A 4RNRB 5A2IH 3B2VL 5I8CB 4DN4H 2DQGH 4H26B 1OGAA 3W81A 3FO9B 2QSCH 1PG7H 2YEZB 3VGAB 2VLRE 1NKOA 3T3ME 3NZ8A 3HMXL 3UP1A 3V4VH 5TGBB 2DBLH 1TCRB 1HSBA 1E28B 1KB9J 3DROA 4JFDE 2ZSVA 4ZSOE 4Q6IC 1UT9A 3HE6A 5BV7H 4AH2B 3U83A 3FQNA 4QEGA 3ZKXB 5AYQA 5EOCJ 1I8IB 4OLVH 1JGLH 4QRRB 1CICD 1AFVH 4MAYD 5CJXA 4I2XA 3L3GA 1AXSB 4DGVL 1VFUA 4NDMA 3NIDF 2FNBA 1NMBL 2YBRA 1W0YT 2NY1B 4X8XA 3LV3B 5TF0A 4QHLA 1DVFC 5C09E 3N9GH 4OCYH 4JRXB 1FAIH 5HHPA 2AKRB 4ZOAA 4M8QA 1B90A 2O26U 1M05B 1VCAA 2R0ZL 2GITA 4V1DE 4YDIL 4K7PY 1MWAB 4JM2B 2FYYB 3MBEA 3ZZ1A 3BH8B 2DBJA 3EYUL 1RHFA 4QRTB 1BVKB 4PLKC 1BWMA 2YWZA 1IGCH 4KMLB 4KTEH 1MHEA 3M17A 4KROB 2ITDA 2Z91A 1DQLL 1DBAH 4YDKL 4LCUA 1I75A 1TZHA 1A1NA 3FN0L 2P8MB 1DP0A 3EYFB 4HJ0C 1FE8L 4DK6A 2EDQA 2IF7A 3DRTA 4JANA 1II4E 4UT6H 1VHPA 4HPYL 5F7UA 4M5ZL 5EZJA 3AFLA 4FZ8H 5JZ7C 1N26A 2AEIT 1T1WA 5DURB 1AGBB 2IAMA 1FIGL 5I1LA 4U6VH 2ZUWA 1TNNA 3SCMD 1WBXB 4NN6B 3E6HB 4O4YL 2UV3A 2HRPH 3W0WA 1LE9A 1C08B 1OAYH 5I0DA 1A6WH 2DJUA 5L2KD 1FG2B 5HGAA 2GAZA 1KCVL 1IMHC 1PGRB 4LASH 3VXSB 4HS3A 4WUKH 5B39B 1AY1L 3T2NH 5INDB 1FN4A 3OGCA 1AIFB 3BMVA 4XI5C 4PUBH 3MGTB 5EWIL 1U8OA 1D5BA 2BCKA 4HQQH 3OJ2C 2ARJB 2YUVA 3F5WA 3T0AA 1BEYH 3WS3A 5GS2D 4OZGE 3VFMA 2V2TB 1S5IH 1T83C 1J0ZA 1JNLL 2C3VB 32C2A 3VWKA 2N1KA 1ZVSA 4FS0A 3VRJB 1CLYL 1KELL 2R2EB 1JF1A 3QIBD 1OM3H 4IS6A 5JW5A 1ZT1A 2DQUH 1NGZA 4WO4B 2NX5A 5INCA 1VPOL 2EDWA 1A6ZB 4F37K 2VXVL 1QO3A 4XC3H 3P40A 4RGOH 2DWEA 5BOZG 3P0VL 5E6ZA 2YD2A 2B0SL 3SJVA 3GI9L 2HT3D 5DEGA 4S0TD 3ZE2E 2ITCB 1FNFA 2C3GA 3H7LA 1GPOH 4RBPH 5EFIA 5T1KA 4BH7B 3T77B 3W9DA 3MLVH 1YMHB 1FGNH 4ZUSA 1N6VA 3RNKB 2BC4A 4FFWD 1NANI 3MRIB 1CLOL 5L88L 1BD2D 5CEYB 4JDVA 5EN2B 3VI3E 4MXVF 4P3CL 1AXIB 4HX1B 3VWJD 2AK4E 1NBVL 3KJ4C 1NCDH 4ZTPH 5I8KH 2Q7YA 1MCDA 5TH2B 1FYHB 3AU1B 1A4JA 4R97B 3TFKD 3QUXD 5DEFA 3GI8L 4BYHA 5D96B 4Y1AB 1J0IA 4PJIA 3QDMD 5DK2B 5BVJB 3I6LD 5IM7B 4PRPB 4JQIH 2BVTA 1N7ML 3CUPA 3UYRH 3KLHD 4ZNEE 2OZ4H 2A77L 1KB5L 3FO2B 2BERA 4LRNL 5JHDB 3ARFA 1T6WA 4ODTH 5BVPL 4X7EC 4AL8H 3CMOH 3BPOC 1ZT4A 3QNYA 5I1HH 1JI2A 1Z2KA 4XCCL 5JNYB 1BZQK 2R0WL 2OXHA 1NLBL 2F54A 3Q1SH 4LKXB 1IC4L 3L5JA 1OWWA 2W0KA 1YQVH 2IGFL 3A6BL 2OMBA 3K3QA 1A6VL 1R3HA 3TC9A 3RY6C 1TPXB 1ZA3B 4U6YA 2KBGA 4M4RA 4AEFA 1WWBX 1INEL 2ZKHL 3S5LB 3UJIL 5JO5A 3VA6A 2GK0A 4TTGA 2CK0L 5GS3A 1MCPH 4OT1L 1BFTA 4TUJB 1X5HA 3ZKMC 1KTRL 1HXMA 3T08A 3VFOA 1CL7H 5B21A 3HN3A 3L7EA 5I1EH 2H2PC 3QWRD 3JWOC 4JFYB 4PGBB 3OAUH 4NM4H 5EORL 4MAYB 4PS4H 1RD6A 3AROA 4Y19A 2DLGA 4M43L 4M6NL 5ELIA 2NY3B 1E6JH 3GDBA 1FVDA 2Q6WB 2WSKA 3ESVF 3BZEA 4IIQA 3FQUA 3BZ4B 4N68A 4JKWA 2X9XA 4Z78B 4PJAF 3RY4A 1G7LA 1RU9L 2QHRL 5BMFL 1AQDB 3CLEL 1QKZL 3SDAA 3ULVC 3TPKA 4GKOA 2MJWA 2R1YA 1SYSA 3VD7A 4LLYA 4KV5F 1K8DB 1RZ7L 3UZQA 4L5FL 4D9QE 3DX9B 4X5LA 3RWIB 1TETL 3OWEA 3D0VB 4P5TD 2APTA 3C60B 4PJXE 1JWMA 3TJEH 1QR1B 5D2LE 4JPIA 1FYTE 2QADD 5CHNA 1RUQL 2UZIL 1XR9B 3AXLB 2LFGA 4H0IA 1YC8A 1F11B 1PZ5B 1U8MB 3SGEH 3DUSB 3HCVA 5F6HI 3C2SA 2JK5B 2X4UB 4UQ3B 1AGCB 5SWQA 1EHNA 2B2XL 4A6YA 4NM8H 1NBYB 1QBMH 5IBTH 5EA0H 2IBZY 1C1EL 5EU4B 3SE8H 5F21B 1F90H 5MERA 1DLHB 5EO9B 1HYRC 2P8LA 1KJ3L 4GG6E 5IBUG 3ZKND 2YR3A 3E6FA 5F1IA 1ACZA 5DMGC 1OAZL 3BDYH 2QL1A 1XCQA 5GGSY 3AM8A 1UH4A 5M95B 1RHHA 3MLTA 3DVGA 3CPLB 1BQHG 4MA1C 5L2KB 4JFPB 4LGSB 2CO6B 1U8QA 5BRZD 4TUOA 5D7JD 1IAIL 4MAUH 4D9RD 5LXGH 3OAYH 4OFVA 4UT9H 3FT4A 1MJUH 3VXQB 1ZV5A 5HDQL 3ZTJG 4Y5VA 4ZAKA 4ONFH 1CQKA 4OCRL 4QHMA 5EUOF 2EC8A 2VDLH 1L0XA 4NRXB 4OM0H 2LQRA 3ZHDA 3TVMA 1KN2H 3QFJE 4N9GB 4IOFD 4JG0H 5GS1C 5DRNA 3UTPD 4WFFD 1NJ9A 1KF9B 3GK8L 3IDYC 1F02I 2VDQL 1PAMA 3ULSB 4CKVX 4NKOA 4GAYA 1OTSC 5FK9B 1G7PB 5GSVA 3BGAA 3WJLA 3MUJA 4NIKB 5GHWH 1NC4A 2MQ0A 3CZFA 2WBJD 1JNNL 5H2BA 2O5ZH 3MLWL 3PWUA 4LCCA 2VC2H 2YXMA 2A6DA 3S4SA 2VOTA 1PSKH 5DK0A 2IPTL 3PL6D 4CVZA 2VERN 1XF3A 3TIDA 1JHTB 3MGAA 2EEBA 3GMLA 2VLKD 3QUMB 3UTQB 4BFGA 1BD2B 2G2RA 2R69L 3BE1H 4U1JB 4LFHG 1MNUL 1SEQL 1E0OB 3IDGA 1MF2H 4IMLB 3LEXA 1OF2B 3P2TA 3KPNA 3OX8A 5IHUH 5CAYB 4ZFGH 4KUCD 4M62H 3VWJB 4HCRL 1A02N 2CIKB 4YX2L 4Z0XB 2VMFA 5CWSB 1H8OA 1F3JB 4O51A 4TULH 3FFCE 5D7KD 4DN3H 1FQ9C 1LO2H 1HWHB 5ESQA 4XBEL 1MVUA 8FABA 3UDWC 3CFIC 2RFXB 3RWGA 5K9JL 4POYA 4LU5L 2A9MH 2PTVA 3MODL 3O3BB 1BIIB 1UWEL 5HBBA 4WEBL 2YSSA 3HB3D 2G9HB 4OFYD 2CGRL 1PG7W 5DI8A 1EHXA 1CLZH 5D2NA 4EJ1C 5JOFB 4S1QL 1I3UA 2B4CL 5DQ9B 5I15L 5DVNA 3C5JA 3QQ9D 4KKBC 1S7SA 2FIKB 2X40A 1OD7A 4WWKC 2WNGA 3ZT6A 3BAEH 2VDNL 5FYLE 1CDHA 5DC9B 5GGVH 4H8WC 5FYLL 3P4NB 3QPQD 4HKZA 2DM7A 3C6LA 2VDPL 1RUKL 1CQYA 4G9DA 2VXQH 5C9JA 1QFWL 1A6TB 1CFSA 3SGJC 3BXNA 3GMQA 1M1SA 2A6IA 4R4BA 2ERJC 4MCZB 4NO5B 3DYPA 3IAPA 4G43B 3WFEH 4XVSH 5D4QA 1QRKA 3FZUC 4UAOC 4JFZH 3SQOH 5J8OA 1ZK9A 2VR9A 1C5DA 4Z76B 2J6EL 4YFLI 4KDWA 3NFNB 2UY6A 4PTUB 2ATKA 5DD6A 4GKNB 5KVMC 3UMTA 4WHCA 4PB0H 5E7FA 1R0AH 5HDBE 5JR1H 4DGYH 1BPVA 3O3EA 4PD4J 4HWEH 4HSQA 3TF7C 1A22B 5EC1A 4M8VA 2XZCH 5IFAH 2ENSA 2F15A 4X5XB 5CBEB 4GS7C 2P8PA 4I5BA 4LVOB 4M93B 3ROLB 3MRGB 3WDIA 4CVUA 4AZ8A 2M26A 4HHAB 3QDGD 3VG0H 3ZDYF 3G6JB 2GY5A 1BFVL 4L8DB 1H3VA 2YD4A 1OWRM 2BVEA 4YWGL 4OUUB 4X7TB 3RFZC 3EGSA 4NO0B 5LWYL 5E2JA 1KXQE 3ZL4L 2XFXA 4LSTH 2NXZB 1V7NL 3WNOA 3GRWA 1DQQA 2VZ3A 1YJDL 3SO5A 1KEML 5IWLA 3BYTA 4Y5XC 1RIUL 2IAND 4J3UA 1KENH 3JVGC 4DKEL 4S2SB 3N85H 4YBHA 2CSPA 4OSUH 1HYSD 1MCOL 1GVIA 4MWFA 2VZSA 1BAFH 2BOBB 1FLTX 4LCWE 4JN2A 1P4IH 2DQCH 3DVFA 2JCCA 4KZEH 4OLYH 4M3JA 1X5FA 1EEZA 3PQYB 1YEEL 2WUBH 3FOLB 3QAZC 4ZO8A 3BP6A 2Y5TA 1RI8A 1WFTA 3EO1B 4I48B 3GIVA 4W4OA 3QUMH 4LLQA 3B6SA 2GJ6E 5SWSA 4XPGH 2AXGB 3TN0A 4HMDA 3V8OA 4OJFH 4YUEL 3PE9A 4UTBL 4Z9KB 3B43A 1KTDB 3PP4H 4XMLH 3ARBA 1DN0B 1V7MH 3L3OA 1LDSA 5LBSL 3WIFA 3ROOB 2VO5A 2DWDA 2Y07H 4MQSB 1LEKA 4BSWA 4UT7H 2DI7A 3ARDA 3OJDA 1FJ1A 4GMSL 4O9HL 2AJYH 4NOBA 1Z9MA 4PJFA 2J7LA 2HVKA 1WEJH 3QIUD 1S9VB 2F74A 2BY1A 2L7JA 3LH2L 1H0DA 3T1FB 4YHMH 4I3GA 4QNPF 4PG2A 4A2LA 3V52H 2V9QA 1E6OL 1YMMB 4HT1H 4RGNB 3SDDB 3WFCL 4ZOBA 4R90L 4PJ9D 3SE4A 3QCUH 4P2OA 3PL6B 1X5IA 3ULUE 3TZVA 3IFNL 5FHAH 3ULUL 2BJMH 1CFNA 1Z0NA 1P53A 2VLKB 4ZO9A 5E2VL 5EU6E 5C0AD 2HKFH 1XCTB 1P5UA 4GBXA 1IC7L 1PKQA 4K7FA 1FL5B 4U2ZA 1HHKB 2FD6H 3HFML 3QEGH 1JK8B 3QXWA 3QXAA 4R7DB 5CD5C 3TBVA 2YPKB 1LO5B 2CXKA 3QG6A 1QFPA 4LDOB 3JBG7 4QWWD 1AC6A 3O2DL 3KPPB 5SX5H 4F7MA 1X7QA 5T3ZD 3WXWL 1U8HB 3F12A 1OAXH 3DTXB 3DUUA 2FH8A 1Y18A 4JY4B 3VFSA 4G3YH 4QOKE 4QRQB 3VXPA 3LQAC 4M03A 2PYEE 1N5YH 1PJ9A 2Y4SA 2OR9L 3BO8A 2Z8WC 3CX5J 4KRPC 4XP1L 4JO2H 2D31B 1G0DA 3ARWA 4KHXL 5I66A 2ZNXA 2FJGA 4XWOD 2YZ8A 2CLRB 2HG5A 2VITB 1IGMH 3I75A 1N0XH 4Z0BH 4ELMA 2R8SL 2X89A 5CJOH 5C6WH 4Y4FC 3TO4B 3X11B 4QXTA 2AEQL 1C7TA 1OGAB 1KCRH 4XXCA 3ZE0E 2NY6B 5B39G 1HHIA 4DVBA 5E4EC 1P4BH 5BV7C 4IDJL 3NZ8B 4JR9H 3S8WA 3QJHA 4PRBA 3MJ7A 2CMRH 1HSBB 4R4ND 4OF7A 5CP7B 3DROB 2ZSVB 4AEHL 4AG4L 2M2DA 3HE6B 2BNQD 5EOCH 3KPMA 3FQNB 4MJ6A 4N8VG 2ZCHL 2R4RL 4GLRH 3MRHA 4QLRA 4OCXL 4GRLA 5DRWA 1JVKA 2X4OA 3ECBA 5F70A 4HUWA 4OCSL 3L3GB 4NDMB 2X9WA 5MENA 3NA4A 5JLZA 2YBRB 3MUY1 4YHPA 1UJ3A 3B9KC 2IBGA 4QHLB 4XXDA 5FHBH 2HN7A 1QQDA 2C7UA 5HHPB 2BOCA 2VQ1A 2EYTB 1IQDA 2A9NH 1KN4L 2GITB 4UINH 5D1XC 1OAUH 1IGFH 3MBEB 5CINH 1CU4L 4RZCA 4CDGC 4XAKE 4HJJH 4N5EC 3VI4F 1IM9A 3B9DA 1K6QH 1NLDH 1MHEB 1A0QL 3T04D 2ITDB 4LCUB 3K4ZA 4E0RA 1TZHB 5JPMB 1S78C 3CK0H 4IRSA 1A1NB 5I30L 1FORH 4EQ2A 4LVEA 2H3NB 3WXVL 3DRTB 1U8IA 4JANB 5DHVA 1H3WM 3BMWA 2UWEF 1WF5A 4KXZH 5EZJB 2A73A 4MYWB 3FQXB 1EVUA 4APQA 2NY2C 1FPTH 2IAMB 4QY8A 1IZJA 3NTCL 4NCC1 1U2CA 3RQ3A 1D6EA 4I77L 2EDEA 1P6FA 2X4SA 4YBLC 1A1MA 1QBLH 5TFSH 4LCYA 5EZLA 3UBXA 4I18C 1F3DJ 4XNQB 1T7WA 3W0WB 4ORZC 4PLJC 1LE9B 2APWA 1T66C 2WBKA 1DBKH 4LEXL 2GAZB 1TQCB 2JTDA 4NJ9L 4WNQA 1QUNA 4HS3B 4X6FA 1FN4B 3OGCB 3JWDH 5ICYA 2WMPA 5CEXA 1GGCH 3KXFD 2C5DC 4U31A 4P2QD 4MVBD 1XH3A 4J8RA 1U8OB 1D5BB 2BCKB 3KR3H 3Q6FA 3VD4A 1PD6A 3F5WB 3WS3B 2R0LH 1JGEA 1GC1H 3VFMB 1VEPA 5E0QA 32C2B 3VWKB 4JGMA 1ZVSB 4JCLA 4KZDH 4MX7B 1OARH 1VGEH 1S9KC 1RZFL 1JF1B 2YHGA 1OPGL 4IS6B 3L95A 3U30C 1ZT1B 5JW5B 1D3CA 4LSPH 5J11B 2AQ3A 4Z7UE 4WUUE 1NGZB 5GJTH 2NX5B 5INCB 5JQHC 3OPZL 1F4XL 4TUKL 5I1JL 1QO3B 2DWEB 3K46A 1EGJH 3SJVB 4XGZA 3D2UD 5T1KB 4KVNL 1V3MA 3WBDA 4S1RL 5TE6H 4HV8A 3W9DB 3OG4B 4FQJH 3VGAC 4ZUSB 1OSZA 3O2VH 3D5OF 2BC4B 4K9EL 1RFDH 3QHFH 1R3IH 5ID0B 3OB0K 3F6IA 4JE4B 4Z7NF 4X9GA 4WRLA 4JDVB 3DXAD 2ORBL 4AK1A 3NCJH 2GT9A 4JPKL 4UB0H 4DW2H 4U1LA 5H35A 1CXKA 1LGVA 3FT3A 4UV7L 2QQNH 3VH8A 4TPRL 4FFVC 1LO0L 1ZLSL 2QJDA 2HH0H 2KQNA 4WTWA 2DF3A 2Q7YB 4PJ5A 4K94C 1YEHL 2CK2A 1A4JB 1YYLL 1JNHA 3JUZA 1YPZE 5H37H 4PJIB 2QLVB 3VFVA 2NY1C 4C54A 1JZ8A 2RQ8A 3DVNA 3KNBA 1HZHL 2WLZA 1WT5A 3C2AL 5F72S 1L4IA 3O0RL 3CUPB 4TSCH 5C0RH 1B0RA 1XGYL 3MREA 4MD0B 1TQBB 4W68A 1GZPA 3ARFB 3OAZH 2XXMB 3MV9E 1J8HD 2VLMD 4JM2C 3U9PH 2GJJA 3FMGH 4XPHH 1ZT4B 5CBAA 3QNYB 4KPHL 3VXME 2EDYA 4Z8FH 3WFBH 4HIJA 2WWMD 4G7VH 4DUWA 2RJMA 1UXSB 4KROC 3NOIA 5AWNL 5CGYD 5GGVY 2O5YL 4QRRE 5DJAA 1R3HB 1X5YA 4HXBH 4MXQD 1IT9L 3NVQA 3DO7B 1I1AD 5JO5B 2GK0B 4PY8I 2E9IA 1KIPA 4JRXE 2I9LA 1HXMB 2Z0BA 4X98B 3VFOB 3ZKQD 2HTLC 1I7TA 3L7EB 4EDWH 2W60A 4XWGL 3P3YA 3ARVA 4K3DL 3BP5A 2GUOA 3MV11 5C0BE 2ZOLA 4NN6C 4Y19B 3M8OH 2R1WA 1XF2A 4LIQL 2XI9A 1CFVH 4FFYH 4FQPA 4XX1E 1TJIH 4NHCL 4LSUH 3PGDB 1FVDB 4HG4J 3L3JA 1MHPH 3CNKA 2HTKC 3HG1D 4IIQB 3FQUB 4P5MB 4WEUD 1UA6L 1EHLL 2NR6D 2XZAL 1G7LB 5I1IL 5C86A 3EDFA 3IFLH 1WTGT 3SDAB 4HKJA 2R1YB 5GSRA 2VQUA 4AIOA 4HF5H 3OKEA 4OB5L 1SJHA 1YEGH 3MJ9A 5FM8A 3MJGX 4U1KA 4PJBF 4OZIF 1RMFL 3D39A 3S3JA 1U58A 4JPIB 1AO7D 2FEEI 3C9NA 2E27H 4NOFA 5I74B 1R5WA 5HJ3B 7FABH 4WO4C 3TJHC 1S5HA 3H3PH 3HCVB 1MLCB 3V95A 3KAAA 3U7WL 1KLFA 5SWQB 2WBWB 4A6YB 3EYOA 3MLYL 1XF5A 3C5SB 3IDMA 4U1GB 4G8IA 3AVEA 1HINH 3DBXA 3D48R 2DJSA 5LJYH 3MRDA 4LPVA 5EU5A 3C8DA 2P8LB 3GKZA 4U2YA 1HQ4A 3GSNL 3LMJL 1AI1L 3I84A 3E6FB 5F1IB 5IVXA 5DTFA 3EKCA 4M6OL 1FHGA 2R2CA 1WBZA 4JFEE 1U91A 1XCQB 2IPUK 5JXEC 4HC1A 5L8LB 1RHHB 3MLTB 3DVGB 3KWWB 2DTML 2VNCA 3WN5A 4XTRC 2E6PA 5KVGL 3EYQC 4J3OC 4Q97A 3FT4B 4ZPVA 4F57H 1W8OA 1TJGL 4RMSA 2CQVA 4ZAKB 3N1FC 4QHMB 5F7KC 1ZTXH 4KRMB 2H1PH 4R97C 3TVMB 5DJXA 5KAQF 3EFFB 1PQZA 1YN6A 1FL6A 1NJ9B 4BFIA 3RX7A 3MMEA 1MAMH 3T0XA 3VXOA 3QQNA 4YE4L 3MLUH 4NKOB 4GAYB 3QUKA 2BSRA 5GSVB 2DB8A 2KZ1B 4YHOL 3CX5K 1QRNE 3RWEA 1PFCA 5F71A 1NC4B 4PJ8D 1HKLH 3CZFB 2I60H 4OF3A 2KQMA 5H2BB 2ICWA 4LCCB 3C6SA 4NQCA 3S4SB 1YNKH 4DZ8A 1EHAA 4HJGA 1VEMA 5DK0B 4X4ME 5DJYA 4CVZB 1KIRA 1XF3B 5AG9A 3TIDB 4JFFE 4NZTL 4JPWH 4R7NB 3I50H 1DLFH 1G0YR 1TPXC 1P6AB 1Q72L 1YEJH 4YAQA 1R5VA 3FAXA 4MB5A 1JHLH 1I3GL 2VLRA 3IDGB 2ZP0T 2DQJH 4RISL 4W4NA 3KPNB 2QQLL 3OX8B 1T0NA 3K7UA 4P48A 2UZXB 2E7HA 3BSZL 2J5LB 4JFDA 2Y36L 4NQTA 5JW4M 1HHHA 4WFGE 2W9LA 1NEUA 4ZSOA 25C8H 3KLSA 4O51B 4MAYC 3GJFA 3LS5L 4LGPB 5ESQB 4POUB 3V5HA 8FABB 4UMGA 2NY3C 4XVTL 4U1MA 4JHWL 3VA2C 4NKIL 4UDUA 4BQBA 3RWGB 1G9EA 4GSDL 4HZAA 5DJ6A 3V6OC 2YPVL 4ODVH 4OFPA 1PLGH 2YSSB 1AHWB 4OD3H 4URTB 5C09A 5DI8B 1Q38A 5D2NB 1VGKA 3B3IB 4PB9H 3O2WL 2V7NB 3C5JB 1E4JA 3ZKSD 1S7SB 4MCYA 4CJ1A 3EJJX 2C4FU 3CH8A 5E2TL 4ZD3H 1BGXL 4V1DA 5FYKD 2EEDA 4NO2A 3PG2A 4PJDF 3C60C 1D5IL 5IHBA 5J56B 3P73A 4NZRH 4RRPA 4HKZB 1LK3L 1XIWD 2XRAH 3C6LB 5T3XL 5ADOL 4G9DB 1NCBL 5C9JB 5ANME 1RUMH 1TVBA 2YN3A 1CFSB 4XCYA 1I1AB 3BXNB 3GMQB 3BJ91 2A6IB 4R4BB 5J12B