1BV8A

Receptor domain from alpha-2-macroglobulin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
138
structure length
138
Chain Sequence
EEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSRSASNMAIVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVSNQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ALPHA-2-MACROGLOBULIN
publication title NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 1998-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 1bv8A00
3T4AC 5JPNC 3CU7A 5FOBB 3L3OC 2ICEC 4LNVA 2WIIB 1AYOA 4FXGC 3HS0C 2XWJB 2PN5A 4FXKC 3HRZC 2XWBB 2A73B 2B39A 3OHXC 2WINB 3G6JB 1EDYA 2QKIC 2A74C 1BV8A 3KLSA 5FO7B 5FO9B 4D94A 5JPMC 2I07B 5FO8B 3FRPB
chains in the Genus database with same CATH superfamily
3J7HA 4XB7A 3VFUA 2EDJA 2NYYC 4PRHB 1A6PA 2Z93A 1KDIA 3TZVB 3FUIA 3BO8B 3IMRA 3D0LB 4WSGA 4LSPH 4BDVA 1SEQH 2FHBA 4M5ZL 5MEOB 5IUSA 1FRGH 2ETWA 3MTXA 4F1SA 5J13B 5LGHH 4WO4D 1KYOJ 1Q0YL 3TBSB 1BWWA 3H4HA 4LASH 4ZNEA 3RY4A 3VXUA 3DX7B 4CC1A 4HJEA 1U42A 2K70A 1KACB 4LQ1A 2GW5A 2XNAB 4G7SB 3A6CH 3BWAB 4S0SD 4IOIA 2P8LB 3BCDA 1NZRA 5ERWA 4X6CE 3CBKB 1MOEA 2OLDA 5EUOB 1YPZF 3LKRB 1CYXA 2ENQA 3TA4D 3UPAA 4TL4A 3KGUA 4FQHA 1DZBA 1PFOA 3TWCL 1TO5A 3QUYB 4U1JB 2HFGL 3QQNA 3PPEA 1N3NB 4HC1A 4DCQB 1S9WA 4IW4C 5EU4A 2WQRA 4KZCA 3MROB 3P73A 3QJHA 2CM5A 3MMEB 1TT6A 1C12A 3HR6A 4J3BA 4Z3TA 2ZCKL 3DBXA 1EWHA 2XV0A 5EU6A 5TQ2L 4F5CA 4R0LA 4UYPA 3PJLA 4CJ0A 4M43L 1EGJH 1T1ZA 4EN2A 4UT7L 2JLLA 4ATTA 2ATKB 3BAWA 2MCAA 3KPTA 2D7TH 2WBKA 1JXFA 2OMZA 3VGDA 4Z7OF 2F53E 4YGVA 3T3MF 2F1AA 3OM3B 1K4DA 3K2UH 4W93A 4ANUA 5ESVA 1G43A 2CIIA 1UKSA 2O5NA 3UGXA 1FHGA 3ZT6A 2AKRB 4UOJA 4KPHL 2G4EA 5CKAA 3HHRB 5EIIG 5FYKE 1KJ2H 3RWJA 1B88A 2WW8A 5G4OA 3RWGA 3L4TA 3BN9D 3MRQB 4IRSD 2F7PA 1EHXA 3HG2A 2HLAB 4L18A 1V3KA 1WTGT 2XICA 3BCFA 4OM1H 4MQXD 3BZ5A 4PR5B 4PJ6A 4WI3A 2X53A 3QUML 4BKTC 3KLHD 1P7BA 3HG3A 5FYLH 1DEDA 4CMMA 3IFPB 1A64A 2IAMA 2Y36L 2QTVA 4HJGB 2CLZA 3H7LA 4BWUA 4FZ8H 3W0WD 1SXNA 5A2JH 4O58L 3U0TA 1RXLA 4F7EB 1QTYT 1X7SA 3SE4C 2WZPD 5HGDB 3QPKA 4WK4B 3UMNA 1IC1A 5E2TH 1HZHL 1JZ6A 3QG6A 5JA8B 4QRRD 5B38G 5DQDH 4OUUB 1BZ9A 3SPGA 1XZ0B 4E0RB 1A9BA 3QA3A 2XG4A 1XSJA 1M3IA 2HH0H 4LLWA 4NNYA 1MCKA 1MCHA 4UINH 2H2PC 4QNPF 1ZTMA 3A4FA 4HIEB 3RB5A 2YMOA 5D5MF 2XY1A 4FXGB 5CO1A 1NEUA 5F7YC 2NLJB 4XOEA 4HZ1A 3TO2A 4OLXL 1E67A 3U9PL 3WAKA 4BK8A 4G5ZL 1IGCL 1MFBL 4PGDA 4HKJB 5HJGA 2C26A 3ARGA 2XJLA 4YSRA 1OW0A 5C70A 3DVNA 1COBA 2B4CC 1G0YR 3QJOA 3ES6B 2IDTA 4TTDC 1N4XL 2VCOA 3U4EA 2FYYA 4GKSB 2NY3D 3PFUA 1PYWB 1MCQA 1HL4A 3OAUH 4X6FB 2J3SA 3EFFA 2E4TA 4KROC 2NRDA 4N2NA 4H20H 1TJHL 1JK9B 4JZJC 3MRBA 1RK1B 4XNUH 5LWYL 4YFEA 4NN7B 3QBTB 1YNLL 3UBXI 2IGLA 4KY1H 4FQCL 3P30L 4GFXA 4QHPA 4TNWK 2OJZH 2A9BA 4ANKA 2V17H 3O4OC 5C6WH 3LKOB 5FFOA 4MXQC 2EYTB 4DGVH 3LRSA 1AIFB 1F97A 1GOHA 3CD4A 4FJZA 1WIOA 4R4FL 4RGNC 4HAFA 1X4XA 5BNXD 2IV9A 2YD6A 3DPBA 4BSWB 3O45A 5IW6A 3LPFA 1E9QB 5TE6H 5FYJH 1M71B 4WNQB 1NFIB 1IC5H 2LOEA 3FAXA 2PO6A 3MBXH 5IJKC 1XIWC 3ABKB 3KXFD 4Y5VA 1ZA6A 2IMNA 2X4SB 5JNYB 5J0BA 4GYBA 5IJCC 3BPOC 4IRJD 4GMSL 1N6UA 3WKQA 1X7QB 3E8UL 5CINL 1SY6L 3HZKA 1DVFA 2ZWKA 1EEYB 3AMKA 4MX7B 5D1XD 4QHUB 1AZZC 2L7UA 2IVFC 2R0KL 4IU3B 4O2EB 4OIIH 5AZ2L 3BQVA 2QADC 4I4WA 1AXSA 3AG4B 4FNLL 5HJ3B 3GXNA 5T3ZE 4MYPA 1PLBA 3EYQC 2UY7A 5EO0A 5CD5C 3P3YA 4P9ML 1G7PA 2PTTB 4PLJD 2C3WA 3GSNL 2C4FU 3C9NB 3OAZK 4H26B 4MRCA 2FIRT 4MSWB 2IWKA 4O2CB 5DEZA 3ZL4H 1X9QA 1I53A 3UABA 2R29L 1FFOB 4N87A 2WC7A 1CICD 1QABA 4K7FA 5MERB 5C9KA 1ZGLP 3CFTA 2JCCB 3L3JA 2WKGA 3KYNA 3S2AA 3FU3A 2ZAGA 4MA3B 5HHOD 5C7XH 3DSFL 4L9DA 1OO2A 1KTCA 1PAZA 4NO5A 3ZZLA 4ENED 2B5IB 4M5TA 4KU1A 2ITCB 3WO4C 4CVXB 4RZCB 2AI0L 3E38A 3OX8B 3KLLA 4PW4A 1MCOL 3EFDL 2VDQL 4AX3A 3U4BL 4F92B 3SDCD 1UHVA 3UTSA 4ELMB 4I13B 3DMMB 2C9PA 2OCFD 4FRWA 4JFVA 4LOFA 3KCPB 3QO0B 4OLYL 3Q2CA 4QEGA 4X0NA 5GRWA 2WB7A 3WL9B 3N85H 3X12A 3RUGB 2VJ8A 3AY4A 2BO0A 1GJUA 3VI4F 2VSCA 2GG1A 3CSPA 1HAWA 4GAGL 2VDNL 1FC1A 4TUKL 1PZ5B 3DK2A 4JO8A 1FUNA 3WHXA 5CZXD 4Q6YA 4FA6A 1CFBA 1VAHA 5EMYA 1IZJA 2YGQA 4JR9H 4OAWA 2MCMA 4AT6B 4X9GA 4PUBL 3H9SE 1PVHA 4NENB 5GSVB 3SKMA 5FHAH 5HI3D 5TK2A 4NQCD 1K4CA 2BSDA 1AGFB 2X4TA 2CBTA 3B9DA 3AZUA 4U1SA 3DROA 3HS0C 4XE5B 1DBAL 4MTMA 5IB1B 2YS4A 2HLFD 3OR6B 5EO1B 4DERA 4APQB 4GUPB 3HC4H 3KPRE 3PF2A 3FCSB 1RH8A 1HU8A 3IU3B 4MZRA 1K5WA 5A7EA 3CZGA 4N1EA 4D2NA 4PGJA 1TEFA 2IADA 2C5DC 2ZG1A 4NM4H 1CXLA 1I8IB 2Q1EA 3NJFA 1TEYA 4CVWA 4GLRI 1KNOB 3H6AA 5D70L 4BFJA 1XD0A 1O7DE 4YNYB 3ZHDA 4A2GA 3FFCA 3HE7C 2IGTA 1KUMA 3CAFA 2VAJA 3W11D 4XN1A 3WLBA 1MHEB 2DTML 4ADGA 1L7IH 1OK0A 1Z0MA 1NCAH 2VDLB 2Y4SA 1Q9WB 1D9KD 4MS8C 2O6FA 2FX9H 4FQPA 5CBAB 4BQ9A 3U2IA 1NA8A 3LS4H 3U1SL 3FUMA 3MRPA 5C0GA 1NCDL 4LO9A 4I0PC 5EWIH 1FVEA 1N5YH 4OZHA 5SX4I 4Y5YA 3H42H 5F7EL 1NMBL 1U8NA 4LCIL 4P2OB 4RWHA 1HH6B 3K2MC 1OPGL 1DJWA 1C8QA 2C9UA 4R7DA 3UIYA 3UG5A 2H3KA 4HKBA 2YO3A 2CDGB 4M5YH 2YPVA 1AIZA 1DN2A 3P0VH 1YEFL 3F7YB 1CT8A 2VLJD 2EVGA 4JFPB 4JFDD 3BLPX 1F5WA 3FTGB 5I74B 2IGFH 3RAJL 4L4VD 3SDXF 4HK3J 2H3XC 3GXMA 4MNGE 2ATPB 3JSSA 2F53B 4P5SA 3L9RB 1AYRA 3QR1A 3D50A 2BINA 1PZBA 1PZAA 2AJYL 2LR4A 5E6IC 5H8DA 3NCFB 4X4KA 2J1ZA 3NOIA 1IGJA 1LL1A 1ZMYA 3NEOA 3O6FA 5CJXA 5IFHL 1E5AA 4Y1TA 2PXYC 1Z5YD 3FTWA 4GAAA 3QHFH 5ANHA 4Y5XC 2R0LL 3WY1A 3RVXD 4AL8H 4X6BB 4K3DL 2MHAA 2C3GA 2BSCA 2WPGA 1T03L 4AW7A 5LNEA 1YMMD 1JPTL 4DAGH 2C7FA 4ZUWA 1IGMH 3AXIA 4NFCA 4K3JL 3QZWG 1XGUB 5CHNA 1R3HA 2Y25A 5D2NA 3N1FC 5E08H 5DS1A 4X5PA 5BQDA 1A2YB 2GIMA 5GXBB 5KYUB 1EDQA 2DQUH 2BOBB 1ACZA 4I3SL 3D34A 4HS6A 5I1LA 1ND0A 1H0DA 3QIBA 4WI4A 5HDOA 4F80A 3A4AA 4H13C 4XN5A 1QSEE 4PJ8B 4KK5C 3FSVA 3BIKB 1RERA 3T08A 4NZRH 1SJHA 2CDFA 2HJKA 5T5FA 3A6BL 3ARDB 3KLSA 3W37A 4XRCB 1PZSA 3P4NB 2AV1B 1AJ7L 4DT2A 4N8VB 1GIGL 4OJFL 2COVD 3IGAA 3L9BA 3Q06A 2GYSA 2Z0UA 2EJ1A 3GM0A 3IDYC 5AOLA 5DJ2A 3ECBB 5FDWB 4EVNB 3LQMA 4NKDA 4XVOA 1ZCRA 5C07A 3P9LB 1KIUA 3QPXH 4BA8A 5KVDE 4U1NA 4DVRL 1A3RL 1DSWA 3NIFE 1VKXA 3MVSA 3NSYA 5E5MA 2BIOA 5B7EA 4D9LH 2J6EH 4FCAA 2W38A 3MCYA 5D1ZA 3D18B 3FF7A 5EOCL 2IO5A 3GMMA 4DP0X 4TNVF 4NOFA 1PJWA 3W39B 2JJTA 1K3ZA 3ZKSD 2YRZA 3HI1B 3TNMB 4DW2L 1AZNA 5EU6D 4GLRH 1AQMA 1UG9A 5KAQG 1S7VA 4MD4A 4X50A 1WAEA 2BNUB 1BFOB 2DL9A 3BH8B 3FB8A 3V0GA 3ARZA 2DPKA 1WD9A 4XP5L 1ID5I 3DUSB 4TQHA 5B8CC 2EP6A 3NQIA 5MENB 5J3HC 4AQAB 2JXMA 4AQOA 1BOGB 3K5RA 3PPSA 3RKPA 2WUBL 3D5OF 3LRMA 3S4SG 4NUJB 1QSFE 2ZG2A 3CH1A 4BH7B 5KANG 2QSCL 1OQXA 1QBAA 2XQYA 4WSKA 3IMTA 2BZCA 1FA4A 1T7YA 3OAYK 1BM3H 1VRSA 3PGDA 5SX4H 2ORBL 3KPMB 1RZJC 1S7UA 1FJ1A 1G5GA 4LCCB 1Q9OA 3EHBD 3K8KA 3O6ML 3MYJB 4OCRH 2DQFB 4PRIB 3TH3T 3GJFH 4WDIA 5EOTA 2BLFA 3IPEA 3PGCA 5HD8D 5C0AD 1UATA 4HLZG 3MNWB 4F9LA 5KTEH 2VR3A 3AXLA 5CBEB 3JVFC 1DJHA 3EUDA 3IAQA 2VDOB 1F8TL 4IKNA 3HB3D 5FV2A 1R5IB 5I73B 1F6LL 1RZ8B 2IDQA 4UILL 4WCYL 3X11A 1MJ8H 4HUNB 2E7BA 1P2CB 2K8QA 4O4YH 4OGZA 3U7YH 4XP4H 3T6ZA 1A7BA 3OZLA 1NAMA 1TO4A 1XAUA 5FYKU 4CC4C 4J1UA 1VGKA 4P5KA 1J10A 1FZJB 1X6LA 2CHDA 2CUMA 1HWWA 4AH2A 4D0DB 3KBEA 4FQXB 2CJUL 4PJAE 3C60A 3N5AA 5F7UA 1MFNA 3RI5K 1U92B 4L3EE 5GISH 1NOAA 2EXYD 4PJCF 3BP5B 2A4CA 4FKKA 3ARGD 4QT5A 1OTUD 5CSBA 2VDKH 1B9ZA 3QGVA 1P4IL 3CQFA 3L4CA 5T1DH 5C0EA 5J6GA 3VAEA 1MHCB 4G80A 4LEOB 1KF9B 2CLRA 2LAGB 3HZMA 3P69A 1B0GB 4ZQKA 3ZMNA 1D2OA 1PKQA 3O3EB 3BD5A 2VLRD 1Z9OA 5CIPA 3WEXA 2JB5L 1RJZB 2GSIA 2X4NB 4QYAA 2B39A 1DQQB 1P4BH 2BRRH 1PEWA 4MA1B 4NPYA 4DGWC 4PCKA 1NTDA 4JQXC 3EOBB 5GIRA 1H8SA 4U3SA 4G9FD 1QUNA 2WP3T 3E8VA 4HMCA 3DSNA 3OPZL 1JNNH 2ENSA 4NYLB 1HZKA 1IAIL 2F7OA 1E4XI 5CEYB 1ZHNA 1EAOA 3EO9L 3SCMC 5JXEA 3MX0B 1DCEA 1QA9B 2HXAA 4FQIL 4HMEA 4MVBD 4HULB 3B2DC 4NFDA 2EDMA 3K6FA 3OZ9L 3RPKA 3EXLA 3QDJA 1J18A 1T5WA 3EYUH 5EBWA 4JANB 4NHUA 4MAUL 1BHGA 3OXRB 1PG7H 2NSMA 2C3XA 2VNCA 3VXQB 1C5DB 1JPGB 1JXGA 1ZANL 2QKIA 4NT6B 3ARFC 4NOBA 4PYHA 1NDMA 2Z35A 4POZD 1GAFL 3SYAA 4BXVA 4IDLA 4OJEH 5EEYA 3WFHB 4FQLH 1DVFD 3U9UB 3CXDL 4M8QA 4J3VA 5H4ZA 4HS3B 1T6VN 2ZKWA 1FF5A 1BLIA 3EDJA 3H85A 2FJFB 3OKNB 3U4KA 2PR4L 3UCQA 4Y2LA 5AW0B 2A1WH 1I8MA 3N55A 5KJRH 2H8PB 1T66D 3LNEA 1XB8A 4UOW0 2OMBA 3BGAA 1ZGLA 1DZ0A 1NINA 2NPLX 3B9VA 4EOWL 5IVXE 1I1FB 2P5PA 5FGBA 3L7EB 3VE0A 3LV3B 2W60A 3BN3B 4WKZB 5IROC 5IR1B 2MIZA 4L4TB 1L9TA 3QORA 3S3CB 1H6UA 3CFEA 4PQXA 3TO4B 3VWKD 4Y8AA 5CGYD 1ET8A 4FFZL 4WWKA 4ODSH 5BUAA 5DJYB 3IETB 2A38A 4TQPA 4JPIA 1NCBL 1ORQB 2DQHL 4NO0B 3HS8A 3KS0J 4MNGB 5EIQA 5MEQA 2NX5D 4P2QD 1JL8A 2EKSA 3NJGA 4QWWD 5C6TL 2Y3AA 5CCKH 1RZJL 2FJGA 5E0FA 4L37B 3PWUA 1J1OL 4G8FA 1R3LB 1VA9A 3FB5A 4UTCA 4ZS7L 4N0YL 4OZIA 4EEEA 2FVNA 5ICYA 3DX6A 4DGYH 1GMEA 2IALB 1TEGA 15C8H 2EE3A 4LSUH 4PS4H 1NIEA 4RGOL 2D03H 5TQ0L 5HHQA 1LE9B 4HX1A 3BGMB 3FUKA 1JSYA 3SGJA 1NC4B 1FBIH 1LO5B 4YQXH 5IHUH 2FLBT 3DJSA 2CGYA 2YUZA 3EYFA 2VKWA 4WU7B 3ECQA 4FQQA 1X6NA 3FU7A 4R7VA 4XO9A 5D7JB 1ZIAA 3ALWA 2E8YA 4NQDD 3IF1A 4RMTA 3MV9E 2DBLL 3SE6A 4Z3JA 1FG2B 4U1LA 1S9VB 2IPKB 4ZX4A 4YSSA 3RILA 1NMCB 3H54A 5DHMC 4FYSA 2UZIH 3IU4H 3B1TA 4RRPG 1JGEA 1ZSDB 2QR0A 2PW2A 3NIDF 3RGVC 3EGSB 1F4AA 2OL3B 2W91A 1V54B 4DPAX 2I9TA 3DKHA 5CUSH 3G6AB 1ZVNA 3SYCA 5I1EL 1OCZB 4ETYA 4Z7UE 3FF8A 1HHIA 3BIAX 3JT2A 4F3FB 4B9FA 2DIJA 4M48L 3FFCD 3EJUA 1T1XB 4DKEH 4ZO9A 3GZKA 1S5IH 4DEUA 4Z95L 1OCWH 3QI9C 4NQUA 3VD5A 5DZJA 3HPJB 2LGNA 2N1KA 1RZIA 4X4ME 4GXVH 1YYLH 2CRYA 3VRIA 3IMBA 1DHKA 2CNYA 3VXSA 2BVQB 2WO4A 2DWDB 3N2JA 4ZXBA 1OTSC 1E4XH 1UJTA 1U3HC 2WLNA 4AQEB 4PG2A 5C0RL 1ILSA 4OCYH 2LLGA 3CZJA 3VXMA 3EOAB 3BFQG 2NTSP 3H7BB 3DO7A 5KSVA 1SJXA 3ZY7A 5K9KB 2ZSWA 5D2LE 1F6AB 1U36A 4XNXH 4YHNB 4XHQA 1SBBA 3MOBL 4DSYA 3FTSA 4PLNC 5F44A 1G7HA 3LPOA 4RVBA 4P59H 4G6JL 3O3UN 4AYBA 1S7QA 2X38A 4GSXA 3TZVC 1Y1DA 2PYFB 1F0LA 3D3VD 2H7WA 4H2AA 3K4AA 3MLWL 4BFEA 3GKWH 1NUDA 1NCNA 1FGVL 1T0MB 5J13C 5EEZA 4KGLA 3S37H 1QSFB 2ZCLH 1JZ4A 5FR3A 4W81A 5CLZA 4F8QA 3O6FD 3IT8D 3ARUA 1OM9A 4L29A 4AUJA 4P4KD 5B1JA 4JHAH 2V33A 4AMKH 5C09D 2NZ9C 2V3EA 2EO9A 3IGFA 3I85A 3L4VA 4BHUA 4V1DD 4IM8A 4YE4L 5TDNB 5I18H 1M3JA 4X7TA 5GRJL 4JPKH 4DUVA 2ALAA 3MXWL 3GPEA 1MIEL 5DDHA 3HHSB 4ZAKD 4NO2B 3K6DA 1BZQK 4LHUA 3S36X 4EBQL 4BV1A 1OT4A 1AZBA 2LQRA 3GJEB 3VWJA 2YKLL 3ZZQA 2XDHA 3QUYC 3O2WH 5C71A 5KYXA 1BF5A 2VITA 2APWA 5BZDA 2XPGB 1EFXB 2P8PB 3PWPA 5AYQA 1OAQL 4DH2A 1LTXA 4U1MB 2BCKB 2BY2A 4KJWD 4MA7H 5EPMB 5FKPA 1G1KA 3MRJB 4P2RE 5TPWL 5DQJA 5F3HA 1X5IA 3DUUB 1JZ5A 1OHQA 4LSVH 2V2TB 1NUNB 1H3XA 3LEYH 3NCYP 2EUWA 2GJ6E 2GBTA 4PJAB 5JW4Q 3WIHL 4YDLB 2BNQA 4LCWA 4XB8A 1ITBB 3US0A 5DVPA 4EI0A 2I26N 1SHWA 4L3EB 4M4RA 5FA3B 2XN9A 1AZUA 1T4KA 2UV3A 1FN4B 4NGHL 1KTBA 3JT0A 1D5IH 2EDRA 2FEDC 1HOCA 5C07D 1LEIA 4XPHH 1D6VL 1OALA 3T8VA 3UO1H 1FVDB 3VG0L 1AC6A 4P5MA 5I76B 1AO7A 5LAPA 2YEZA 1FLRL 4AEEA 1I9EA 3QFDB 2FQFA 3GSOA 1NBQA 2BZDA 4KJYA 4RDQG 4M6OH 1A65A 4QXUL 3QUKA 4RBPK 2WYHA 4JY6B 3M1CA 3BD3A 3CNKA 1R3JA 1CN4A 4A63A 3MV8D 4JFED 5AKVA 3FZUC 2FJSA 4IIQA 1XR9A 3B7TA 3S0PA 5L88L 4Y2DD 4NWTL 4FZEL 4QHLB 4ZFGL 4YPGA 4G6ML 3WBDA 2Y72A 4JM2A 4PGZA 3NZHL 1D5ZB 1UZ8B 4PRBA 1NPNA 2C7UB 4NNXB 2VAAA 5DJXB 4H1LG 3MGOA 4P23A 5IB3B 1MI5A 4N2GA 1GYWA 1N26A 4K2UH 4R90H 3L4ZA 4XC1H 2GBVA 2Z1KA 4FXGC 4U1KB 4AVKA 1CLYH 4K3HA 3SPHA 4EKJA 1QTSA 3NIGE 1LO4L 3QW9A 3CLFH 1ASOA 1F58L 4GT0A 3NFNB 4GY4A 5CSZB 3S8GB 4FG6C 1WZ1H 4XVTL 3RKDD 1HNGA 2F74A 2OXGA 1ZGLM 4I2XE 4U1IB 3GZOA 3H3BC 3GHBL 3A6OA 5GRZA 3BT2L 4PCYA 5IJVA 3VNYA 1NKRA 3BSHA 4V11A 3V5HA 4MGXA 4UM8B 1S7SA 4E2OA 3RGHA 3CVHH 4IKLA 3RA7L 4LPUA 2AJZA 1AS6A 1M05B 1YECH 3RVUC 3WNKA 1PSKL 4FTVA 4XBEH 2CO1A 3I2CH 4PP1C 3EH5B 1CDGA 4I18B 3FT4A 4JFHD 1R5WA 2ZOLB 5EZIH 2VWEC 2P1YA 3NFPB 4HAGA 3M86A 3V5KA 3EBIA 5C0BA 1CK0H 4GRWH 4AYSA 4RWYL 5KVFL 1L0XA 4AUYA 4JCMA 2C34A 2G9KA 1BXVA 5CD3A 4FQJH 4U3CA 2FNWA 3LVEA 1FFNB 1KGJA 1M6UA 5I8CA 3SDYL 1BQ5A 2CPCA 1YHPA 4MMYB 3UJIH 2CD0A 4XT1C 5HVGB 3VXTA 2VRQA 4LSTH 5FEBA 8FABA 1LJMA 1NCCL 2H1PL 4UV7H 1CFVH 2HUEA 1OE1A 2IQ9L 3HBQA 3IDGB 4OZ4B 4TRPL 1Q0XH 5DWPA 4XBMA 5KSUA 4JLRB 3GSQA 3RVTD 5DK0B 1S3KH 1T89C 1Y6MR 1GVIA 3IXTA 3UTPD 2DQGL 3MRCA 4QRSB 3VDCA 1NSNH 1OHZA 5JQ6L 2UXTA 3JWNG 1BIIA 3F7QA 4XMWA 2NNCA 5EZOH 4BUQA 4N2IA 4LCUB 1EPFA 5GRVK 2GCYB 5HI5C 3LAFA 4TV3A 5JXED 1UENA 3GHPA 3A47A 5CMAB 2ZUWA 1I8UA 1R5VA 5J6SA 2UXGA 2HJFB 4CSSA 1KEGH 3ZE2F 2YK1H 2D4DA 3RJOA 4N8VG 3RFZB 3KHOA 3OHXA 4QXGH 2AAVA 1IX2A 2XN1A 2B5IC 3CFDA 4BK5A 4CSZA 5DMIH 2EYSB 1OV8A 1YEEH 4LVHB 5DI8A 5SV4A 4EJ1C 5JR1L 2R69H 4XHJC 4LIQH 4ENZA 1NFDE 5DUPL 3C5ZB 3TM6A 3QQ4A 3DMMC 2XYBA 2GVYA 4HWBA 1IGIH 3L5IA 2EIZB 2RMNA 4PJEA 3T0BA 5E95B 3ZK0A 1Z9SB 3JZYA 1RJLA 5DA0B 2EACA 5BV7B 3IRPX 1SJEB 1UQSA 2R1YB 4JG5A 2YGNA 1KIRB 3Q5OA 5EZLB 2Z4TA 1BBDL 4MD0B 1QLEH 4OLEA 2LE9A 3MV7E 2V5SA 1QUPA 1GCYA 4GQ9L 5FHBL 3DTXB 4PYGA 1TVBA 1NGYB 1YN6B 1MJ7L 2Q8AL 4ZX6A 3GLEA 4C47A 3LEXB 3QUXD 2ZCHH 2HX7A 5ECJE 2LLNA 4ZX5A 4KKCD 4S1RH 4CDHA 4NO3B 3ZHFA 4APQC 3O8XA 3SKNA 4CU7A 3VCLA 3O9WD 1MIML 3Q3GA 2K78A 2A6JB 5F8QC 3RX8A 1N18A 2JJVA 2AITA 5IJDC 4N2EA 4MAYA 4PB9H 5E2VL 3OJDB 1GL4B 2V2XA 1XSOA 4X80L 4N6RB 4OCMC 3V7MA 4ZUSA 3L08A 1I9JL 2JELL 3CFBB 3PHOA 5F6HJ 5FOBA 3VG9B 3ZE2B 4F7MB 3FO9A 4G1MA 3U0WH 3MYZA 1JHLL 3ZE0F 3MA9L 3IK2A 3IFLL 2WWOA 2RFXB 4BKSC 2R2HA 3K74B 1FSKB 2DF3A 3T2OA 4EUPH 4A37A 5FK9A 2V37A 5K9JL 5ISZD 2E86A 2H5UA 4FXTA 4B9ZA 3RHWK 4WSJA 4JN2A 4PCTA 3NDYE 1AANA 5AUMB 1MRFH 2DWYA 2G4GA 3BAYA 3E2HB 1OF0A 3QS2A 4KKPA 4P2OC 4XMLL 1WFOA 1P5UB 2R2EB 4X99B 2EEFA 1DO6A 5C08B 2G3NA 1J88A 3BQUD 4LBEA 3EJCA 3E9UA 5KSBF 4LE8A 4PY8I 1OP4A 4OJYA 2DDQH 4EN3A 3E7JA 1N7ML 4WEUD 5DA4A 5I1JH 2XLLA 3FUDA 1JDAA 2AJ3B 2X4RA 5I74C 4Y7OC 3S3BB 1CU4H 4ODUA 2GJ6B 4NRZA 1VADA 2WYIA 1G7QA 3ESMA 1U95A 4Z7VA 3Q6GH 4P9HH 3WFDL 3ZZ1A 1WC7B 2B9BA 2AK1L 3BVDB 4MB4A 3N0AA 1T04A 2VW6A 4I5BA 5DK3A 1PFCA 3L3DA 4TVPE 4AGQA 1FDLL 5JPNB 2OX5B 3NJHA 1JV5B 3T4AA 1JYWA 3CXFA 1QFWL 4OT1L 3FC8A 5TK4A 1VEMA 3CFJA 2WGXA 2GSGB 4YLBA 3ESPA 3TIEB 1GZHC 1OP5H 2AGJH 3O81A 4ONFH 1JZJA 3FRPG 2EC8A 4LF3B 5BVJA 1G6RH 3QEHB 1CDBA 1KCLA 3IB4A 3NACL 4H0LC 4GRMB 4YFLI 4LOVA 4D3CL 2Z31A 5KOVC 3PU7A 3C08L 5IREA 2UVEA 2DOCA 3LXUX 3ZE0B 3DX2A 4DO6A 2WJ7A 1CGUA 4PJBF 2V7HB 2IPTL 3V0VB 1E7UA 3BIBX 4KQ3H 5E2WH 1MAKA 3Q05A 1UB5A 2XZCL 3OKEB 3GDBA 4PJ8C 3MJWA 2YC1A 3ATFA 4EIBA 4XVUC 3ARDC 3PXJA 1QAWA 3CDGB 2DLTA 2B4CH 1ZT1B 2P24B 2VZ1A 2YXFA 1NCJA 1OIOA 3VM5A 1KB5A 2KS0A 2CKNA 2X2IA 4NP4H 4PIBA 4Q9RH 2IANE 2WGNB 4UQCA 4YHKH 3AB0B 3INUH 2OCJA 5FGCE 5I19H 2CO7B 3NSJA 3TV3H 4AQ8A 4U05A 3I02B 4FP8L 1AQHA 3FONB 4H8VA 1DBJL 2NT0A 3RX9A 5EOQL 2AQNA 1C16B 5E6YA 2WINB 1ZOXA 2NY7L 3G6JB 1JFQL 1CLCA 3D39E 5ITFB 1FH5H 4MD5A 4WK2B 2MPAH 1SVZA 1FZOA 4AIZB 3PG2A 4R3SA 3NRFA 2HN7A 4UB0H 1UVQA 2LT9A 3OWRA 3RHWF 3BDYH 1MCLA 1PD0A 2VXVL 4Q0XL 2OR7A 3RRQA 4DETA 1W72H 3PV6B 4WUKL 5T5NF 1L6ZA 3KPNA 5E99L 4HJ1A 3DXAD 3HC0A 3PUUA 2VZ3A 3B7SA 4UOZA 3HZYA 5C0DB 4GXFA 1C7SA 5CFAA 2P5WD 3NBNA 2YPLA 1CTNA 3C2SA 2DYSB 2E27L 4PJFE 4NRYA 3PNWB 3GPSA 3OVUB 1A5FL 2R1WB 1UM4H 5DMGD 4PJBB 1KYDA 3T4YA 3TBWB 1YNKL 1SPDA 2CIKB 4LKCB 2PR9A 3V9CA 1BVKA 3WJMB 3RTQB 4J8RB 3MLTB 4FKHA 3V6FA 5INCA 1IE4A 4D9RD 1KLFA 3QRLA 5HHPA 2NNAA 4L3FA 1I1YA 4MS6A 1S7XA 4KTYA 4LCCC 3VRLE 1IILE 1TU2B 1SBSL 2OMXB 3B7RL 4DGUA 4QHKI 1J8HA 4LSQH 1MCNA 3SCMD 5IG7A 1IC4H 3ARBB 3TF7C 4M9OA 3IAGC 1TNMA 2G75B 2GK0A 4WFFD 3GMQB 3GI8H 1HTYA 5KS9E 2XFGB 2VDRB 4L5FH 4YHZH 2VB5A 5KBMA 5I73C 4XAWL 1M1XA 3HI6H 4HK3N 2QEJA 4IBTA 2I27N 2PCFB 4KX7A 1YZZA 2N3JA 5EBMA 3SOBL 5I75B 1CZ8H 3MR9B 1C5CH 1IAKB 2GIXA 5FYLE 1JAEA 3AUVA 3BI9X 3ESNA 3TNNB 1KIQA 2HG5B 4I48A 3KWUA 2OMUB 3K81A 5FYKL 1XF5A 3UPRA 5C0IB 3T6WA 2IF7A 1XF4A 4FQXC 1RMFH 4MBRA 4NZJA 4XO4A 2NY1B 3O0RL 4ACPA 1BF8A 4PJDF 4HUWB 4F8PA 3CK0H 2NZIA 3EJQA 5B22A 5F1OB 4OGAC 5PCYA 4N5EC 5DSCA 3UADA 5HYFA 3MGAA 1QR1A 4ZUUA 4L4JA 3GUFA 4CRPA 5D7KE 2PETA 1X5KA 3IVKA 3WFCH 5JUEL 3HG1A 3S8WA 4ZW3A 2Z8RA 4J7RA 4XNAA 3I3BA 4EDXA 5L4FA 5EU5A 3R4RA 3KR3H 4Y1AE 2DI8A 2H26B 3FBKA 4MA1C 5E5LA 4PRDA 4JN1H 3I6SA 3LH8A 3V0FA 5KBNC 2VXQH 5E1AA 3CFKB 2GFBA 5DJ0A 3AFLA 4M7LL 1ES0B 2BVPB 1CQYA 2HTKD 1KIPB 2B3IA 3PAZA 1MDAA 2R4SH 2DBJA 3EFOA 5SV3A 5IM7B 3SE3A 5HYJE 1JGVH 2V9TA 4J3OD 1U6AL 2AFNA 3NTCH 4M6NL 5AG8A 3V0IA 4CU8A 5HGAB 3QH3A 4M1DH 1MAJA 1X3DA 3ZBMA 1DUYB 4JKPH 4N8CL 2EYRA 5B1BB 5JOPE 3C6LA 1RU9H 3GYRA 2WQXA 4N0CC 4A2LA 3CXHK 2VYRE 1O7DC 5J4MA 1VGEH 3DRQA 1XF2B 1D5XB 3JWOL 4YL9A 1WFUA 2O5XH 2FJHB 4R2GB 2JKJA 4GSUA 3QHZL 3ILPB 2Q10A 1UWYA 4FJ6A 1N70A 5FYJE 3MKKA 2WK2A 5IEHA 2W0KA 3GNMH 5EHFA 1WQVT 5T33H 3VI4A 3IS1X 1E27A 3TA3B 3TL5A 1BVLA 2BNRE 4NKOA 3IFOA 3NA9H 2K9UA 3HMWH 5E8DL 2MCG1 1Z9LA 2B14A 4X7SL 1JYNA 4LLMA 4KHTL 3CXHJ 1KPUA 2VW7A 2DLHA 1QR4A 3GSUB 2EUZA 4F24A 2NZ1A 4NQXA 5F89A 1TCMA 3M8OL 2D9CA 4MDJB 4KNTA 3LKPB 1GC1C 2IWEA 3L4YA 4G8GA 4RH4A 4YZFE 3TO4C 2C9RA 4Z77A 3OHMB 2EH7H 2YLHA 1P4LB 4ODBD 3VFSB 4DOHB 4BQ6A 1BFTA 1KTJA 4FFTA 3TU6A 4IBLT 3OD3A 2GAZA 4QRPD 2ITFA 3WFEH 4QJ4B 1UGNA 5C0FB 3C5JA 5E1HB 2NY2B 3UG3A 5D8JL 1IM9B 2NTFB 2GEQA 4JO4L 5F3BB 5AOJA 3ARPA 5IJBC 3KPQB 4ZTPH 4KH9A 4N2HA 1S6NA 3DX1A 1NGZB 3ABGA 5T3ZL 3IPBA 2WB1A 3EF7A 1TZIB 4PRAB 5BRZA 1E9PB 1KV7A 3FHAA 3GK8H 2DY2A 4IBYA 2FO8A 2GPZA 2YA0A 4G3YL 3V9FA 2VDOL 4PU2A 3PCYA 5FWQA 5D1QA 4EI5B 4OFDA 4W9DC 1S9YA 3N1GC 4F58H 1JWMA 1MXGA 3QEQD 4J4PA 4FNUA 4XNQB 1W9XA 2V2WA 1OGAA 3HAEA 1ANUA 1BX2B 5F7KC 3UAJC 3W9EB 3GMPB 4JRYE 3AT9A 1RZPA 3BSZL 4C83B 2ZKHL 5MHSE 4K7PH 3WMPA 4GG8B 5GGRY 4GBXA 4HU2A 5D7JC 5T1LD 2GHWB 2WM0A 4XPBL 3HRZA 4HCRL 1ZPUA 4M61B 4NXKA 1EUTA 4LCYB 3I9GH 2AXGA 1NMCC 5EEWA 1NEZG 3TONA 1F1DA 1YEHL 4RNRA 4ZFZB 4YGAB 3T0EA 4MAYD 5J1AB 1K85A 3WY2A 4M62H 1INQA 4UM9A 3QRGH 3SDXA 1U8JA 5FUZL 1IFHL 1AY1H 1F56A 4JQVC 3I6GB 2OFQA 3KH4A 5I5IA 3IKCA 5F7LB 5FGCB 5JHDB 2H0PA 4NJ9L 5LXGL 3HI5L 1A7OH 3RIFK 4ZK8A 2ZSVA 1Q90A 2DI7A 4FFVC 3KBHE 1D7FA 4M1CD 2DQDL 2TSAA 2XVKA 1V7MH 3PWLB 3AWFA 2ALWA 3DNKA 4X98B 5CN1A 3UROR 3QUHA 3D25A 3GIZL 1CFTB 3D39B 4L8DA 3OC5A 1MQ8A 5DQ9B 2YSSB 3QUMA 5IMLA 5KSAB 1A25A 1XGRB 3WNMA 2X40A 1Y6KR 4R84A 5HYQB 3I50L 4QJ5B 1GR7A 1LMKA 3ASNB 1KY7A 4KMTL 3VM7A 1LK3H 2BIHA 5E94A 1U8LA 3CDCA 4PBXA 5KZCB 5GS0D 2GTZB 2R1XA 1IBGH 2HVKB 4WUUE 4JQIL 1MLBA 3U79A 4XBPB 4JHBA 3MJ9H 5BS0E 5L2JA 4AE1A 1E2VA 1F90H 4HV8A 3RDTA 5D6CB 3C6EA 4Q52A 2CO6B 2KPWA 4J27A 2ADFH 2EADA 1F4WL 5BJTB 5F9JA 4FF9A 3NH7L 4ONGH 2AXFA 4KVNL 4M03A 3TX4A 3K4ZA 5KANI 3KW8A 5FB8B 1RPUA 3SPVB 2I60H 1X9RA 5TE4L 4WTXA 3KLAA 12E8H 4JFWA 3KVQA 3UTTD 2XFXA 1QFUH 4X9BA 1CGWA 1GC1L 1QNZL 3BKCH 5IMMA 1KJ2B 4MZIA 2KZWA 1MVUA 1A3LL 2PYED 5F70A 3FSAA 1KBKA 4YBQC 5KS9B 2WOYA 4PD4K 1RIVH 2L7JA 4RFOL 4UDTA 3PWJA 5AVTB 4AYMC 4K15A 2Y1VA 1AHKA 4UQ2A 3THMH 1INDH 2CKBH 3QNXB 1JPFA 5PAZA 4WW2F 1A8ZA 2ZPKH 4Z7WE 4E9LA 4QF1A 4YSPA 2QMJA 1WA1X 1HWGB 4H5SA 4Q6IB 1TSRA 2KL6A 4GOSA 4S2SA 4N25A 4DZBA 2P44B 3WKMH 3F3HA 1UXLA 3MCKB 4HHWA 5B3JE 1YLBB 4ZOAA 4K8RC 3TOPA 3O41A 4YDLC 3Q5TA 5K9QG 3N1PC 1XVSA 1Q8MA 3T65A 1RZQA 3QWRD 2YMTA 2OMYA 1NC2B 4PD4J 2V9RA 1F2XK 1U93A 1BFVH 1VFUA 1DBKH 1H15A 5DLML 1DQDH 4BFRA 3OJMB 5IV2B 5JOFA 5HHNA 1QW8A 3E80A 1F11B 3FCUB 3ABMB 5IQ7H 5TFSH 5E9AA 5IVZB 4A6YH 1QRNA 1GGYA 5J6HB 3AG2B 4WI0A 3FYEB 4X6DE 3RIFF 1SY6A 4Z3IA 3RVUD 4NQEA 4O5LH 5DZAA 3FULA 1E42A 3L7FA 3LN4B 3W9DA 3MRIB 4Y1AB 4XCNB 5IK3A 2Y69B 3DX9B 3I75B 3PGFH 5DD6B 4P49A 4JPVH 5D9SA 1NCWH 3E1ZA 2WY3B 1MG2C 5BZWB 4J8QA 2QSTA 4ES9A 3GSNA 4JKLA 4OFYA 1Q1PA 1HZLA 3NN8B 5HYJB 2IFGA 2VN5A 3MCLH 3N1MC 4LT7A 1HEJC 2R29A 1SN0A 5CF3A 3AREB 1XGTA 3TN0A 1NPJA 1O6SA 3OKDB 5I2IA 1BZEA 4XCFL 3D30A 4XO3A 5C0CB 2XX1A 3VW3L 1T1YA 1U58A 4PTUA 2YPLD 5CJOL 3CFNA 3FS9A 4E5XB 2UZYA 4YO0B 2ZKYA 5DJ8A 1HYSD 3LXAA 2NNFA 5KVDL 1Z66A 1JV2B 4H8PA 3PWVA 3P9WB 4HXBH 3D4ZA 1Z5LA 4JRXD 4QRRE 5K39A 5T1MA 1DFBL 1WCQA 1AXTL 3AWEA 4Y16B 2SEBB 4ZOEA 2BY3A 3PQYD 4IOFC 4N2LA 4NBZB 4N28A 2VL4A 3NQKA 4PWFA 3GS0A 3LKQB 4ODHH 2OR9L 3EDKA 4PFEA 4LLDB 3KM2A 1UZ6F 1NBYA 3C09B 1P7QA 2BNRB 4J2XA 1CFQB 2P80A 3DRTA 3C8KB 3MA7B 2FBJL 3WD5H 3SE4A 4PJ5B 4G11A 1FYTA 4ETQB 5AW1B 3QZPA 4B3VA 3ATEA 4JPWH 4MKTA 4JX0A 1WZLA 3AUWB 4RQQB 1LE5A 3NCCB 1XGYH 3MJ7A 2E7CA 3D85D 4OLVH 3TBVA 3APFA 3LY6A 1R24A 4UANA 3N42B 2J88H 4J3OH 4BFIB 5C2BL 2QSQA 4I18C 2OJEB 5L6YL 2J12B 3WTWA 1I9IH 4ILDA 1D7BA 5KYWB 2ICWA 2NY0B 3IDJB 3TVMB 4KFZC 4L0YA 3CN3A 4BZ1L 2Y5EA 4ZDHA 3BP7B 4PV9B 2Y5TB 3QJTB 4H0GA 1Y0LB 2VZUA 5I8OH 5DURD 3RWIA 1K8IA 2A6IA 1F4YH 1XGQA 2HVBA 2Q86A 2HUHA 2YD3A 3EOTL 4NKMA 4P5TB 2X87A 2GUOB 3KYOB 1ML0A 3MFFA 5E8PA 4HLZH 3K2KA 2ZQKA 3CJJA 2FATH 1XBDA 3JV5A 4JZJA 2BFGA 2H2SD 4GSQA 1TG8A 2I5YL 4MJIA 2J6WA 1VJSA 3B8SA 3IJYA 2O5YH 2DYRB 1D5RA 3S3PA 2FZ3A 3K6NA 5HGBA 4PB0H 1NLDL 3MXVH 5D1XE 2YZ8A 5E1IA 4ZD3L 4Y0GA 5FF6A 3FN3A 1KCUL 4Y4HB 3MUZ1 3B2XA 1YUKB 2FAUA 1PU0A 4TLKA 4LP5A 4KV5F 1AR2A 2Q8BH 4PV1C 3ZGHA 5BQ7B 2AZAA 4OLWH 1E5ZA 2ZX5A 4GNKB 2DLFL 1XIWA 3PDGA 3RFZC 2A9NH 4HBCH 1N5AA 3UYPB 4RX4A 4WZ9A 1SXBA 3X13A 1MHHA 5F7DA 4ZFOL 4Q2ZA 1HILB 4LVHC 3STZA 4Q97A 1YEJL 5FW8A 2VR7A 5HHOE 3GJFK 1EZVY 1NCOA 1SYVA 2E76C 1ADWA 3C5ZC 3CUPA 4XMZA 2OQJB 5CR8A 4NC2B 3NPSB 5D4HA 2ZD0A 5IB4A 3VFWA 2ZUYA 3STLA 3BZDA 3ZDYF 5C0NC 3BKYH 4K5MA 4OR1A 4DP8X 3W57A 2K4WA 4G6AC 3T0DA 5DR5L 5BV7C 5GZOD 3QO1B 2E6QA 2D0HA 1UC6A 1VZGA 4QY8B 2FTAA 3QJFA 4ORGA 3ZL1A 5JZ7C 3DOHA 4JDVB 4UQDA 2J8UA 3LSOA 3QXDB 3HPLB 2CBMA 2FL5A 2JJUA 4XOBA 3TBBA 3WEOA 3UBXB 4OLUL 4G8GD 1T2XA 3T6VA 4MAZA 5INDB 4JFFA 4DPRA 3H3PL 1AE6L 5E6RB 3CH8A 3KYMB 1ONQB 1YUHA 1FO0H 2ICES 2R4RH 3NJXA 2BOCB 3LPPA 2L3BA 4KC3B 3WKPA 2DD8L 4N0UE 5GGUA 5BS0B 4PJ7F 2VXTL 5FYJU 2IQAB 1T1WB 2MFNA 4JPSA 2OYKA 3MLXL 5JQHC 5I1CL 2FH6A 2Q7YB 1QQDB 3IJSA 3VI3A 2C1PB 2EAEA 2Z3FA 3IDIB 5AVYB 2VQTA 3K71B 4KK6C 5TF0A 3VFMA 3UH8A 3WXVH 3VG9C 3IDMB 4WO4B 4PG9B 3T09A 3BEWB 1JK8B 2FIKB 5D1QD 1Z3GH 3CPLB 2KYIA 3I84A 1KPRA 3FMGH 2LU4A 3MRRA 2WLZA 2ITEA 1MEXL 2DIEA 4XMXA 4HIIB 1OGAD 4ODVL 3HMXH 5EC1A 4A7GA 3TCLA 1FSKC 2CXKA 3HS0A 2J2ZA 5DFVD 2NW2A 5B3NA 4IHOA 4MXWH 1OSPL 4MJHA 1K6QL 1WT5C 1TZAA 2DL2A 1P6FA 1UYWL 1RIHH 4KK9D 3ZDYB 4WENB 5CNHA 4LARL 1MFCH 3E2HC 3EO1B 4KFMA 1OGSA 1P5UC 4YDMA 1U3JA 3ULUF 1DLHA 1BYPA 3I6KA 3G5XB 5GJSL 5HHME 3S36L 5GS0H 4UTAL 2LFEA 4U3HA 3WJLC 5DRZA 3IJ9A 4HWZB 4LMQE 2ZF9A 2IBBA 3RL2B 4K3EH 2VH5L 1V7NL 2YA1A 3JV0A 4UM9D 1JCKA 4WU5A 5T5NG 4IOSA 5IFJA 1HXMA 2KZBA 4Z6AT 5IQNA 3CFMA 3ZZSA 5C9JB 5HSFA 4LVNB 2VLJE 2F8XC 3KGSA 1NLBL 4LEXL 1WS7A 4L4VE 5SWZE 4Q8BA 1UXWA 3FHQA 1CXFA 1MZZA 2Z8SA 4LQFL 2YLKA 5JPNC 2NCMA 4JDTL 4I0PA 5KWYC 1ZAGA 4X6DB 4XVSL 2BFVH 1LILA 2ESVE 1LP9E 2R9HD 4AG4L 3KPOA 1F4HA 4QTIH 2ZNWA 4XTRD 3OF6A 4AGOA 1RZ7L 3GMLB 4NP9A 4JO1L 3KPSA 4OJCA 4IRSB 2OP4L 3VXPB 4F8LA 1E65A 1CD0A 1JGUL 4NZDA 5TDPA 4EIZC 2EDTA 4ESKA 2R2CA 3BD4A 5DHEA 3RWCB 5IB5B 5H2BA 3C8DA 2BX5A 1PG7X 1ZLEA 1GY1A 2E7MA 2X7LB 3GMNA 4PEEA 2NOYA 3OQRA 4MJ5A 4YAQB 5DYOB 1FORH 3W0WB 3QPQD 1I9RL 3N44B 4ZQTA 2OK0L 3CN0A 3IDNB 2AJVH 1P9MC 2I25N 4ACTA 3P77A 2P8MA 2J25A 3OR7A 3NIFF 3HUJE 3PP3K 4Y5XA 5CJ5A 1X5GA 4QRRB 1AGDA 2KZKA 2SODB 5MEPB 4XPGH 2JKTM 2J71A 4LVOB 4GH7B 2RCSH 1DQKA 3HS9A 3AB0C 1L7TL 4HU8A 2ZOTA 4ZMNA 5IFAH 3VH8A 3CVBA 5F96L 1JGDB 1R6VA 2VLKD 1OTTC 3F6LA 2EE2A 3OKKA 4HFUL 2A9MH 3APDA 1U8CA 1JBJA 2W9EL 2FWLB 1DP0A 2RBLA 3C2AH 4ECNA 1BVOA 1HHJA 1H3TA 1LK2A 1QLRB 1T0OA 3U36A 4XCYA 2WLLA 1ORSB 3UXFA 4IS6B 3L16A 1MSPA 3PUCA 4JFOB 1E9OB 2G30A 3WGVB 4XP6H 2W65B 3LS5H 4HIXH 5DWUL 1G4RA 3JWDH 1F4XH 4MDRA 2JB6A 3DOSB 3ULVF 3GJFB 3QXTA 1TJGH 2WUCH 4MJ6B 1ZEAH 3V7AE 5CEXA 1L9MA 5IMOB 3GBLA 2DQJH 2NY3B 2WYZA 1FIGH 1WITA 4L9LB 1SOKA 4CN1A 2E74C 1P84J 4IEFA 1CVSC 2I24N 3DGCR 4TPRH 4XGZA 1UA6L 2YBRA 1F18A 2YBGA 4HK0A 3SZKC 2QPEB 2WWNA 5ESQA 4MB3A 1AD9A 3MJ8B 1MJJB 2XKNA 1XF3B 4PI2A 2EXWC 5IP4A 1J0ZA 1PY4A 4GMTH 1MELA 1KJMB 3RTQC 2A74B 3BAEH 3EJYC 4YUEH 5F7BA 3H0TB 3D4GA 3PDDA 4GFTB 7FABH 5AD0B 4PJXA 3KXFB 2AERT 4KKQA 4POUB 4E41E 3CVDA 1I3RB 4IRJB 2FR4B 4FXLA 1J5HA 5CFHA 2D31B 4ZMXA 1L0YA 3ARBC 4PTTA 1UD2A 2VDKB 3D48R 5L2KE 5D4JA 4CL7A 2WXNA 5D1XB 2AABL 1KC5H 4OFYD 5E6SB 2H45A 5AZUA 3PWNB 3F04A 4JL2A 5C0AE 2FX7L 2Z7WA 3KPPA 4HHAA 1NDTA 4HPOL 4OM0H 3IRZA 5B8CA 2Q76B 2MCPL 3TN0D 1OAKH 5I75C 5FO9A 1Y07A 4PP2B 3K72B 4NNPH 1LVEA 5F7HA 4FFZA 4JEGB 4UT6H 4XPTH 4HF5H 4H44C 4YLCA 1OK8A 1VFBB 3WI9A 1ZK9A 3E6HB 4ZUVA 3D69B 3WIFB 2AMUA 2AEPH 2YWYA 3GUTA 3SPCA 1CICB 5FM5M 1A6VL 4WHTB 3GI9H 4PV8A 5D7HA 2IBZX 3KPLA 4ZSOE 2AMGA 1EHLL 5HVFB 2NY1C 5HHOB 2XPZA 1IEBA 2ZXBA 5B39A 4XNMB 1A1MB 1LHZA 2C4FT 2UZPA 2ZUXA 4KAQL 5CJQH 5A2KH 3AGVA 4LSSL 2CA3A 3MNZB 4YJZL 2IXQA 4N3UA 1DQJB 1TTGA 5TE7H 4C56A 3X1FA 4XMKH 3SDCB 4ZUTB 3QJRB 1S7WB 2W9DH 5IBLC 5GPRA 1FYTD 3NEEA 3OTTA 1F13A 1N8ZA 2WIIB 3UZVA 3EKCA 4G6FD 1HHGA 1BQHA 2XXCB 5G4NA 9PCYA 2MTAA 3NK3A 4N9GB 5CLTA 4JDEA 4QI3A 1KXQE 4HJTA 1MQKL 5EORH 4A66A 2VT0A 5HYSB 2VLRE 4XVJL 2R23B 2JIXA 1D6EA 2QQKL 1J5IA 2H6PA 3GRBA 4XPAL 4NQCB 4HH8A 3SJVE 2CBOA 3AQXA 4G9FE 4H1LH 4GQRA 1NL0H 2YGVA 3RL1B 1WIUA 4N0UB 3P11H 4P2CG 5ICZA 1PL3A 3BUQA 2VDLH 3G5VA 4BEIA 5ESAA 3LPWA 5LBSH 4B6ZA 3FT3B 4QRAA 1BJ8A 2A6DA 4PJHF 4XCEA 4AJYV 2OZNA 1LD9A 2O93L 4GRWE 3D12B 5IVXF 4R2GC 5DMKB 1FZMB 2ADJA 4EMZA 4RSYA 3UZEA 1HKLL 1OSEA 1JS4A 2VLMD 4BCXA 5ID0B 1JZ2A 3JV4A 3QDGD 3L6FB 2EIJB 4HJ0D 3TA3C 1GCFA 5J57B 5I1DA 4NLHA 5ACZA 1I82A 2ZXEB 4UT9L 43C9A 1BMWA 1UA3A 1OLLA 4TULH 1X5ZA 1D9KB 1AG6A 1Y6NR 5IHZB 1NIBA 3Q2WA 2UWEA 3GBNL 2PCPA 2VN7A 1MCJA 1XT5A 2A9DA 3HNTL 5IHHA 1WH0A 1UXMA 2VERA 3SE9H 3UPCA 4UF7C 5J9PB 5K1VA 1HH9A 3GSXB 1ICTA 2F19L 2KLTA 3CSTA 4IMLA 4L8SB 3BVVA 4MYWB 1ITCA 1T5KA 1YEKL 4NCC1 5DHYB 5FO8A 3B3IB 4M5ZH 4A7VA 3ARFA 4G42B 3N41B 5AOMA 5F3FA 1Y7VA 5DUBB 2VLJB 5DJDB 1Q0YH 2NY2C 4JFDB 3S7GA 3VXRA 4L4VB 4HWEH 4KKRA 1AP2B 5K93A 1QW9A 3GM8A 4WJ5A 1P1VA 2NX5E 4NZUL 4P2QE 2JI2A 3OKMB 4WY7H 5BS0D 2OKMA 4AC4A 1HHHA 2DH2A 1MDTA 3QNYA 3CFCL 3ARSA 3JV6A 4WV1A 4EI5C 1TJMA 1I8AA 2VDRL 3HAEH 4N3TA 3OXSA 4R26L 43CAA 1USQA 4LIQE 3UEQA 2QVKA 1E28A 5IROA 3R8BB 3JWNH 2BSRB 3HJEA 3VRJA 4J6IA 4RMBA 1YY8B 4IBZA 4Y19A 3UTOA 4J23A 2OMNA 5HI4D 1VZHA 3ZL2A 2OM5A 1E40A 4Z7UF 2CO2A 1QYGL 3T0VA 1IARB 4JFFD 1YMMB 2EIKB 4LAQL 2YMXL 2OZ4H 2X2HA 5TQ2H 3EH2A 2EE0A 3VFTA 3SEPA 1CL7L 1M2VA 2NY5L 2VDMH 4MCYA 3CHSA 5I17B 3OAZH 5EEVA 2R8SL 5A16A 4E9QA 2OR8A 4UT7H 1REIA 1OP3H 2H3NA 5KSBA 3S97C 4NQDE 1B0IA 2H32B 3C5SA 3UDWC 1OAZL 1INEL 2G5UA 3NSDA 3VFUB 2A6KA 5DJ6A 3WIHA 5L7XL 5IQ9A 3ARRA 3JTSB 2HFEB 2AQQA 4BDVB 1DVXA 4UQ3B 3CVIH 4WFHD 2C3VA 1QEWA 3VFGH 2X4UA 2XWBB 2VJXA 2N0MA 5DVLA 1CFNA 1T5XA 3ZE1E 4A39A 1M1SA 4PJGE 3WFBH 5AVZB 2PCXA 1ETZB 1DN0A 2HB0A 1PZ3A 1VESA 3DPDA 3MRMA 4YDJB 4I87A 5D2LF 1ZLWK 3ZKMD 1NBZA 3MO1B 4F2MA 3TBYB 5A2BA 2RTTA 1IAIM 3A24A 4IOIB 4WWOA 1NWPA 5ERWB 1MF2H 3RGVA 1OCRB 2G60L 3BSGA 3N9GL 4Z8FH 5KSAC 2BHUA 3P4MA 2K7QA 3FCBA 3ZTJG 4AV5A 5DO8A 4AENA 5IF0B 1HZHH 1S9WB 1KENH 1JRHL 3M1BA 5EU4B 1H5BB 3P73B 2OYMA 2WAQA 3QJHB 4JE0A 4LRIA 3L3HA 3B6SA 3CZLA 4OSUL 4QRUA 5BO1L 4FADA 3DBXB 3MNDA 5EU6B 3PREA 1KJ3L 1U8QA 4R0LB 4WHDA 5KVGH 4EO5A 5K59F 2EZ0D 2CDEB 4DKFH 4LHQB 4LSDA 1WBZA 2EDQA 3QUZA 5DCCA 1XDTT 4XMPL 2F2HA 2EILB 1MVFA 3TPUB 2IG2L 1U3HA 3D3VE 3MRNA 4FULA 1HL5A 5H94A 1LDPH 4LNRA 1ZLSL 4ABQA 1I1CA 1X4YA 1LO3L 5ETUA 1EUUA 2BVOA 3BW9B 1NGQH 1N4XH 3RWJB 2O5ZH 1MAML 3OF6D 3P9MB 5EN2A 2YHGA 4HIJA 5C09E 3KPSD 3WS6C 1GSKA 4JAMA 5EO9A 3EHBB 3DETC 4V1DE 5C0AB 4TYUA 3TT3H 2BVTA 1AYOA 3LHPL 3TZVA 2J8OA 3RZCD 3BO8A 3D0LA 5MEOA 4Q9QH 5DTFA 4CN6A 4TSBH 2CLZB 3EOYG 3HB3B 1XXFC 3RNQA 3N91A 4UBDC 2D2CC 3K4DA 4U2YA 4W4NA 3FU0A 2G2RA 4Q6IC 4R4FH 2HA1A 4TVPL 4AEHH 3TBSA 3GEFA 2JSFA 4R96A 1ADQH 1CGSL 4G6KL 4ZSOB 3DX7A 3QG6B 3FO0L 5BOJA 2F7QA 3VDAA 1FL5A 3KEHA 2EUXA 4O9HH 2XNAA 4HEPA 3I3EA 3BWAA 1A9BB 2K1MA 2P8LA 2UX6A 4U6VL 3BUPA 5EFIB 2IPUK 2FEEL 4GMSH 4CU6A 4RAUB 3UBFA 3WCYA 5CINH 1JF1B 3R0MA 4KUZH 1BQUA 5EUOA 3LKRA 3SE8H 1P5VB 4DUXA 1VEPA 3N43F 3TO2B 3X1BA 4U1JA 3FN0L 3LXBA 3CG8A 4M1GL 2N7AA 3V4LA 3ZYJA 3ARGB 3MROA 3SGKC 5BW7C 3TEZA 2D2OA 4Y4FD 1R3IL 4DPCX 3S5LA 1E5UI 4OZFG 4PWEA 5GRUL 1ACYH 1L9QA 2VLRB 1QKZL 2J21A 4CAGA 2EECA 4KI5F 3RP1A 3U4EB 2W59A 3H3KA 2ATKA 2EIBA 4B3EA 1V5JA 3BAKA 5CM1A 4L1HA 2PPFA 3BZFA 3AREC 1KWGA 4G9FB 3CVHB 1OZTG 3MRBB 4EZMA 3R8QA 3UJTH 4RGNE 3QXWA 4DZ8B 4AW4A 2A4EA 3MV8E 3K8LA 1SEQL 2AKRA 1FRGL 4I88A 1KCBA 2F9BT 5LGHL 3EFDH 3LRSB 4UWQB 1B2YA 1FFPB 5GZNC 3BWUF 4OLYH 4GRWB 1NAKL 4Y16C 1UB6B 1PX8A 1OP5K 1AD0A 5GGTH 4E9WA 1J11A 4HIPA 4BZYA 4PR5A 1A4BA 4PVNA 4X9FA 4Y5VB 1OCCB 4HJSA 2VDNH 3LZFH 5ENWB 1F3JB 3IFPA 3C09C 5DMJB 5IQLA 4HJGA 2PPCA 1OOWA 4XN2A 5J1SC 1ACCA 3HZKB 4PUBH 1DVFB 3IMVA 2WXKA 1SXCA 7PCYA 4YXLH 5HGDA 4UIMB 1U8PB 4BUGA 3QFGA 1M56B 1MG3C 1NGWB 3ZGIA 3K0YA 1ZWIB 3N43B 3T2NH 4EI6A 3VDBA 2ZE0A 1PF3A 4B41A 5D7IE 1AC0A 1G7PB 2CPUA 3MUJA 4OUUA 3QNZA 1EJ6A 3V52H 5A2CA 4E0RA 4YXHH 2VZOA 4WTWA 2FSDA 4FKEA 1EGJL 3B9AA 5CZVH 2VABB 4HIEA 1KG0A 2YARA 4K7FB 1ZDQA 4L5FE 2BW4A 4X6EB 4KKBC 4KRPD 5E2UH 3VWKB 3KYNB 2NY0C 3TVMC 4HGKC 1NCHA 1CB4A 3LRLA 2VL5A 4TUJB 4NO5B 2ZX9A 2OYPA 1NKGA 2FECL 2NX5B 4P2QB 3ES6A 1KJ2L 3Q8BA 1OM3H 4C56D 5JW3H 4P5TC 3FUJA 1RAMA 3P3TA 2R0ZL 2Y5QA 3KLQA 2YXMA 3NZ8A 4G7YH 5E70A 4KK8C 3L1FA 5M94B 1KBVA 4K23H 3WFZA 1DQLH 3OAYH 3X12B 5HY9B 4X0KA 4OM1L 4X4XB 1RK1A 5JOEA 5HHVH 1QLFA 4FQ1H 4HXAH 1RHFA 2ILLA 4V2BA 1VDGA 3B2PA 1O9VA 4N9OB 5F7EH 2OL3H 4LCIH 5FYLL 2LU3A 4JNXA 3WHXB 4RDBA 2DKMA 3LKOA 2FHFA 1XH3B 2EYTA 2WXRA 2AK4A 4Y4HC 2BERA 1I85C 3KBPA 4HS8L 3MLYH 4WGWB 4GKLA 1I1AD 5E2TL 3UTPE 2X4TB 1CD1B 1E9QA 3FUHA 4NQDB 3VU1A 2XQYK 3GRGA 4JFXA 4U1SB 1H6TA 5ABAA 1NFIA 1QWUA 5HDBB 5DQDL 2MMXA 4WTQA 1WO2A 2X4SA 4Z0BH 1TZ8A 1R9FA 1SOSA 3MV11 4UINL 1ZTXE 3PHQB 4HUUB 5CKGA 5DK2B 2UZXA 2J8HA 1EEYA 1FFQA 4MX7A 5I8KL 5LCVL 2YD4A 3FCGA 3WJJC 4IU3A 5GGRB 4OVUA 3NPSC 3ZE1B 1M57B 5HJ3A 2B9AA 3PL6A 4JY4B 3RB7A 2FGWL 3FFCB 4K3DH 3M45A 3FO1B 2WVVA 3WNPA 3OG4B 5A3IC 3C9NA 3V95A 1WEJH 2FGZA 4H26A 4MSWA 3V6OC 4O2CA 4QRQA 4XODA 4Z7QE 4N5UA 1A14H 2VC2H 1N10A 3SQOL 1FFOA 3OAUL 1UXSA 2ZJSH 4P2YA 5MERA 3RVWD 2DH3A 4XCCH 4H20L 3MRPB 2JCCA 3LRGA 3H9YA 2QQQA 3E1F1 5C0GB 4XNUL 1FVEB 4OZHB 4EUPB 4I3SH 2OJ1A 4KY1L 4C58B 5JW4N 3TS8A 2OJZL 4PY8J 2V17L 2ITCA 4R7DB 1ZVYA 3P3UA 2RGSA 2DJMA 3OX8A 2ODIA 1SDAB 3B43A 4DGVL 2XACC 1I8LC 5JORB 3L3OA 4E9XA 3TPKA 4OBRA 1MCIA 3A6BH 1CT8B 3DMMA 2CR6A 3QO0A 5B4MD 3TCTA 2CK0H 5IW1B 4KZEH 5TE6L 2XX0A 4OJFH 5FYJL 3VXRD 3WL9A 2E7LA 3RUGA 2ROYA 3B37A 1NCGA 1IC5L 4RIRB 4M5SA 4PJIE 1JWSB 1TKWA 1ZHBA 2LAAA 3BVNB 3D3VB 4EE2A 2ZX8A 5DD1H 1TZHA 4WO4C 5JYMA 1EH9A 1PLAA 1IGJB 3DYOA 5E1GA 3O6FB 3TJHD 4XX1G 5HPOA 1OSYA 4HUVB 4P4KB 2ROXA 2NXYD 4TN9A 1MCPL 4L0ZA 2W94A 5C09B 1AGFA 1YYMH 5CP7A 2QBWA 3IWUA 3OJVC 5IB1A 1P0SE 3NABH 1EMTH 2Q9OA 3OR6A 3T3PB 5DO2D 3ZQ9A 3KS0H 1NOFA 4V1DB 5EO1A 4AL8C 4APQA 4GUPA 4MJ4A 3FCSA 4OFVA 4J3SA 4S0HA 3IU3A 4K8RH 3HLAA 4BYHA 5E00A 3BUIA 4ZAKB 3FT1A 4XNYH 3MN8A 5JMRA 4X4ZA 3IJHB 2HPOA 2ITDA 1I8IA 6PAZA 3FOMA 5H37A 3WKNA 4P46D 2VOTA 4Y9FA 5ISZE 1II4E 1KNOA 1SJVA 1G6RB 2GT9A 1M2OA 4XP5H 3CFUA 1BWMA 2DM3A 5C7XL 4XMUA 4ODWA 4HS6B 2QLYA 1AMYA 4AEFA 5JHLL 3MRLA 1PLGH 4NAMA 1MHEA 1NFAA 5E7BA 4ANWA 1WA2X 4NIYE 1QFOA 4LVNC 5IBTL 4XO8A 1L5GA 2CDFB 4HD5A 1FWXA 4YWGH 1FP5A 4FYQA 5K9QI 2DQIH 4X6CA 1VEOA 1W16A 1BD2D 2WLYA 2FWSA 2DQMA 3LZPA 3N85L 4CNIB 3IGAB 4P5RA 2B1AH 2FT8A 2L0DA 3ZRCC 3B9KD 5E0QA 4P2OA 5DJ2B 3ULSB 1HH6A 3RJDA 5A43C 5FGSA 1BM7A 2OMWA 4JR9L 3UGEA 5C07B 1XH2A 2CDGA 4U1NB 5CCGE 3BN9C 1JZ8A 3FQTB 4IRSC 4FNSA 5E5MB 4ICWA 2R0WL 4R4ND 4IK6A 4KDVA 4JFPA 4UZSA 3VB8A 2D7MA 3FTGA 1THCA 4HQQH 5E4OA 3BH9B 3CZUB 2PKDA 1MKFA 3GMMB 4MQXC 3ERXA 3KLHC 1BJ1J 2F53A 3MRGA 3L9RA 3WHE1 4O02H 3HC4L 3BPCB 2EXWD 1H3WM 2NY6D 3MV8B 4JG1L 4JFEB 3S3JA 3QE5A 4NM4L 4ZYKB 4B95C 2CSPA 4Y2DB 1WUNT 5FA4A 4AYFB 2VRKA 3AQZA 2VR8A 2X4PB 4GUCA 1HL9A 2V7NB 3QUZD 2OI9B 3AMLA 4X6BA 4LVOC 5DHXB 1EZVX 3V0AC 2A4ZA 4TVSa 1L7IL 1T0NB 2F7IA 1NCAL 4FD0A 2AS5M 3ORJA 1WGOA 1G9MH 4I1RA 3IBEA 2FX9L 3QR2A 3WIIL 1BCIA 3MJGX 3Q9PA 2UXVA 3GFUA 3LS4L 4QHKJ 1S7UB 1BGXH 1OB1A 4LGPB 1A2YA 1FJ1B 5EWIL 5KYUA 2BOBA 1N5YL 1IO4C 3L95B 4WDIB 5AENA 1SJMA 5T1KD 2EDWA 3AXLB 3PHSA 2X4QB 4FYTA 4PJ8A 4PJFF 2VMDA 3BIKA 1NGPL 4M5YL 5L8JB 2NY3C 3P0VL 3BUDA 3P0YH 3ARDA 4L9LC 4ICXA 4XRCA 5DHVH 2AV1A 3TBCA 2MJWA 3KWXA 3OZ9H 3VFPB 2IGFL 4M7KL 3BLKA 3HOGA 3X11B 3ZMEA 3SYPA 5DZVA 2JFCA 3BZ4B 1TZGH 4DKDC 3VRLF 4ZMAT 4MBOA 1PD6A 1NAMB 3ECBA 4EVNA 5FDWA 4HEME 3BEVB 1VGKB 3VX1A 1HXKA 5F97E 3DXAE 1XCTA 3TASA 1GGCL 4TTGA 4BWTA 4HALA 3VVWA 1LMIA 2NSQA 3COOA 3MBWA 2A74C 4TMPA 4WHYH 2JKIS 5KEZA 1T20A 2P5WE 3RPBA 1SEBA 2BVEA 4K7PX 5I1AB 3D18A 3T2LA 4AL8L 4IRZH 3SDAA 3BISA 1IKNC 1YMHB 2PR4H 3W39A 4Z23A 1JF6A 2C9SA 4ZX3A 5K33A 4IRJC 1JWUB 3HI1A 4D9RE 4CADA 1LXMA 2HX8A 4L05A 1NQBA 4DAGL 1IGML 3FQ1A 2FLRT 1PKQB 2PTVA 5I16B 3WEXB 5JA9A 1YG9A 1NDGA 4CGTA 4OGXH 5D1XC 1BFOA 4M8VA 3BH8A 1MCWW 3MV01 5BVPH 5E08L 5K1NA 4KZDH 4NPYB 1I7ZB 3DUSA 4UV4L 2DQUL 8PAZA 3ZMRA 3FQNB 3LMJH 5GIRB 2NXZD 3DSNB 1YNTB 1DVYA 1NCBH 4PLJC 2QHRH 4WFFE 4AQAA 1N6QH 5ILTH 4KVCL 4GG6E 2MQGA 3WGUB 4NZRL 4OZIF 2JLPA 4PREB 3ZQXA 1CICC 5B38B 3V4VH 3ET9F 3KPMA 3W5MA 2UXFA 5D7SL 2W0FB 1QFWM 2EO1A 4PRIA 1YY9D 2DQFA 1W8EA 4ZPTB 5IKCB 5IVNA 4ENEC 1LQSR 4FHKA 1XHHA 2EDFA 5DFWH 3MNWA 3V5DA 1F86A 5CBEA 2E8ZA 2QKIB 1KCRH 3QPXL 2Z35B 2EUVA 3SDCC 2KQMA 4DO4A 1OE3A 3CU1A 2QQLH 3CZFB 1R5IA 3O6LH 3UL4A 3KWWB 4D9LL 3L45A 2J6EL 4M8QB 3BLBA 3U6XS 2FEJA 1QP1A 3QISA 3BSZA 2KUTA 4P07A 2J1YA 1CQKA 4L2YA 4PGCB 4AM0Q 4F7KA 4MXVE 3OB8A 2W0PA 4OD3L 2F54D 5CZXC 4Z5RA 2K6WA 3QRBA 4MQ7B 2BDNH 2N1TE 1ZGLB 2Q3AA 1DANU 4D0DA 5CZRA 3LH2H 5HI3C 3L17A 2W60B 2YJQA 2YSTA 3KAAA 2GQHA 4H0IA 4NN5B 4B9JA 5EDSA 5LUMA 3F2LA 1BEYH 3UP6A 3L3GA 1U92A 1KZQA 2APFA 3CFEB 1USZA 4JHWH 3AAZA 3QUXB 4OZGE 2HLFC 2N01B 1HJBC 2JQMA 3QQ3A 3BP5A 4JPIB 4MZ2A 4JKNA 3CN1A 3O9WB 5MEQB 1MHCA 2D7QA 4LEOA 4PJIB 2EQDA 5G55A 5FECA 2QPDB 3JYCA 3QC6X 3I9AA 2PWFA 1RJZA 1XCQB 1LGVA 1OAUH 1WS8A 3H9SA 3GS4A 3OJ2C 2WV3A 3PE9A 5D7LD 5EUKB 3NFSL 1SHMA 3ZDXE 1MFVA 4JGMA 5ICYB 2QZQA 4B96A 2Y2TA 2QFRA 3DX6B 4LOUC 3EOBA 4OCRL 4TNGA 4ZZFA 2YQ2A 1QO3A 4IBVA 4YXKH 3W11C 3S8FB 3K2IA 5C0RH 2F5AH 3QC5X 4NYLA 3DGGA 1E4WH 4OKDA 5CEYA 4WGKA 3ZXAC 1N59A 3KPRA 1D9KC 1QA9A 2XQ0A 2OBGA 4ES8A 3Q13A 2DYPD 2AK4D 2CA4A 1MJ8L 4FEMA 4X2UA 1QNIA 1YJDL 4JANA 4O4YL 4H8QA 1BA9A 3OXRA 3U7YL 4XP4L 4J6RH 3BDXA 3G6DH 4L8SC 1C5DA 4FYRA 4NFBA 3JVGC 1JPGA 3BQUB 1R1CA 4NT6A 5AVRB 4E9VA 3WNLA 5CGTA 1MN4A 1JGEB 3WEBA 5JPMB 2E4FA 5D4IA 3KG5A 4GW5A 4JQIA 1SYSB 3WFHA 2QGBA 2C9AA 4RMSA 3U9UA 5JDSB 4HS3A 2BZ7A 3M07A 3B5HA 3EZJB 1B90A 3LZNA 4QRPE 4WFGD 1CVRA 3D08A 5GISL 2FJFA 2FQGA 3PL6D 2E6JA 4BFBD 4KOBA 4FL4B 5A2AA 2VDKL 1FL3B 2NMSA 5SWSE 5TF1H 4CSTA 5GGSA 4DHLA 1YQVH 4MNHA 4PRPD 1QFHA 1EJFA 4GSDH 2BSTA 1I1FA 4NQSB 3MXWH 1RZIB 3FCTB 2A0LC 3GXDA 3L7EA 3LV3A 4GRLA 5LLIC 4LLVB 4NDMA 4EBQH 5IR1A 4JHVA 2BRRL 5I6OA 5IBUG 2GUYA 5ADOH 2P47B 3RVXC 1JDCA 2QDWA 3RYMA 5ADPH 1ZVSA 3IETA 1JNNL 1P7KA 3KYKH 3QEQE 3H1ZA 3ILEA 3MPCA 3VJ6B 3WE6A 4MNGA 4H8WC 1XEDA 3SDDD 2F68X 4MB5A 1RULH 2ZZUT 1VFMA 1JVOA 4FXKA 4PRHE 2X44D 4R7XA 4L37A 5KSVB 3FQXA 1U3NA 2DICA 5EU7E 2DEXX 4PWKA 4I9WD 3EYUL 1B3JA 4YC2B 3W81A 3DX3A 1IKFH 5JXAH 1PG7L 2IALA 3K6SB 1RZFL 1X9LA 1B2WL 2A77H 5FWRA 5FXCH 3BAIA 3UTQB 3ZPDA 5EBGA 4NGHH 3BGMA 2MQCA 3QFJD 1NC4A 1LO5A 2EDXA 4HIHA 5F9OL 4FQLL 5IOKA 2UYLA 5CWSB 3LNFA 3VXNB 1EXUB 1D6VH 2B20A 4L29B 3KVDD 3MQIA 4WU7A 2R7EB 4DP7X 2K6ZA 3QNFA 2GITB 2FX8L 1AACA 2HT3D 1PZ2A 3BVUA 4IGBD 2A1WL 4XC3L 4D94A 3VQ1C 5KJRL 5LAXB 1FG2A 2LV4A 1S9VA 2IPKA 4A7TA 2X09A 4Y4KD 4WWPA 2YAPA 1EEZB 3LD8B 2FWOB 4RISH 1FG9C 4PY7A 1QSEA 4JDZB 4B27A 4W4OC 3EGSA 2WVUA 1J9RA 1VPOH 2OMTB 4D8PB 4JM2F 4JMXA 1X5YA 2XY2A 3G6AA 4HJJH 1HFUA 3Q6FB 4NWTH 3IN0A 4AC2A 4ZFGH 4I3GA 5KYXB 4ODSL 4TSCH 3FK3A 3OGCA 1JHTA 3NZHH 4F3FA 1H5BC 5IB2B 1WBXA 3OAWA 2CQVA 5ACLA 5FKPB 2CKBB 4GEIA 2AEQH 4MDIB 5E9DD 4R0LC 2W5PA 2XVBA 2DLGA 3HPJA 5LDUA 3BAXA 3B5GA 4OI7A 1MWAH 3V2AR 5I1IL 3DXAB 1NGXB 2KZ1B 5JHMA 2BVQA 1W0WB 2DWDA 1WTLA 4DGYL 2P5WB 1M53A 15C8L 4LSUL 3QWOB 4PS4L 1GKOA 4M4RB 5BCAA 3EOAA 2D03L 1AZRA 2Q7NA 4P3WA 2VQ1B 1AI1H 1FBIL 4Z7WF 4YQXL 2C8NA 5IHLB 5IHUL 3H7BA 3LJ3A 5K9KA 4Z7NF 4BCZA 1F6AA 3O11B 2G9HA 2X41A 3O4LD 4FFWD 5ALBH 1TLMA 1AGEB 3EHBC 4YDZA 5I1GH 3E9TA 1JFHA 1TFHA 3ZTDC 5HD8C 3VD4A 3UTTE 1IM3D 3U2SB 4DKTA 3BWSA 2Z7YA 4KJYB 4AYID 1CTMA 3IU4L 2QGEA 2PYEE 4K07A 1YPZE 3HB3C 1T0MA 3OLEA 5AG9A 4WI5A 5KVFH 1QSFA 3KDMB 4ATWA 1OZUA 5FKAA 5CUSL 3RG1C 5BXFA 2B08A 3MACH 1L9RA 2B15A 2VXSH 5FYKD 2HP4A 4XI5D 4YPGB 4A2DA 1AKJA 3NCWA 1DJXA 3KJ4B 4BZ1A 4DKEL 2VAAB 1A4CA 3SDYH 4Z78A 1S5IL 3KHQA 5TDNA 5LGYA 1M9SA 1OCWL 1R75A 4JFYB 4QHNB 4YDIH 3UJJL 5AW9B 4MHHG 3ZQWA 4XXDB 5E4EB 4PJ9A 4GXVL 1J1XL 1NCCH 1EFQA 1YYLL 4KJQD 3MBED 1MRDH 2WXPA 3GJEA 5EU3A 5GHWH 2IQ9H 1M6OA 3NMEA 4U7KA 2EXYC 4AKPA 3FTXA 3ARGC 2BHFA 1OTUC 2XPGA 2P8PA 1G7JB 3GBEA 4KKLD 4OCYL 2IPUG 1OW0C 5CILH 1SMOA 4YN3A 5I8EB 1QFWI 4U1MA 1PZCA 4QAMB 3MRJA 4X5WB 1M9WA 4LU5H 3G08B 4R7NB 3DUUA 3V5HB 2V2TA 1S7SB 4ONHB 2O61B 4PJAA 1HXYB 3F65A 2VWEE 4LK4A 1WG3A 3ALXA 1SUJA 5EA0L 3WUZA 2ZOWA 4P59L 3IDXH 2A2QT 4L3EA 4OZGB 5FA3A 1RSYA 3FT4B 1R5WB 1IBBA 1SUHA 4OY9A 3VSQA 3GKWL 3QVAA 1VACB 2CRZA 1BYNA 3V5KB 3P40A 4MVBC 3S37L 4PJEF 2ZCLL 3F01A 4HJUA 1KCVH 4ZFOA 2DW5A 2YD0A 2QV2A 1UJ3A 1HK6A 1A02N 1FVDA 2ISDA 3DX8B 3S4SB 4AMKL 3ZR5A 2HWZH 3SDAD 3ZDXB 1MHPH 1KCSH 4JKWA 4DO5A 4ZFFB 2BIPA 1UH3A 4JJ5B 4Y5VC 3DWTA 1T7XA 2XBTA 5FUCC 4JRXE 4QNPE 4HWNA 4HCIA 4JPKL 2QHLA 4JY6A 4POZC 5D5ME 3VXTB 1SN2A 2CHWA 1KZYA 1DVFC 2AJXH 3PQYE 3VGBA 3ARTA 3PAVA 1KTDB 5HDQH 4QHLA 1H3VA 2K3TA 3UIZA 4R8WL 1D5ZA 3MRCB 1UZ8A 3ILDA 1T66C 4NAQA 4BJLA 4I77H 2C7UA 2A5UA 1WWWX 2K6YA 3Q2VA 4GW1B 3D07A 4KBPA 32C2B 1H9DA 3BUBA 3H2PA 1UACH 3NSXA 4PWJA 2AQ3A 4LSVL 4BKLB 5DZPA 3LEYL 4U1KA 4JZNB 1U30A 3EYSH 5CN3A 3W1ZA 3U82B 2X1PA 3D87B 3VWKC 5JIQA 5CGYC 4IJTA 3DO3A 1UT2A 4ZT1A 1LNUB 1TQWA 5C3TA 4QRPB 1WFTA 4B9KC 4ELME 1SFHA 1C08B 5T3ZD 2WBWB 3FH5A 4QWWC 1D5IL 2X28A 2YAQA 3GO1H 4XPHL 4UM8A 3M17B 1PZDA 5AW4B 1EAPA 2M26A 3FOLA 4XX5A 3UO1L 5IVXA 5KBLA 4RLDA 3NCMA 1RJLB 3VXOB 3S35X 3WN5B 2WVTA 4I18A 1AR1D 2K7PA 4FA8A 4M6OL 4FA7B 2XV2A 1XEUA 3QEQB 4QXWA 1OKEA 3BJLA 1JMZA 3ETTA 4H4NA 2WNGA 1K5NA 1PLCA 3PY9A 1N7MH 2CMRH 4AQ1B 1TVBB 4Z7VF 5T1LB 4QKTA 3ECUA 4UTAA 3V8CA 8CGTA 1XSIA 1FFNA 4GP4B 5E8OA 3FSWA 3QQ9D 1N2RA 1LEKA 2NW3B 3SKNB 3WFDH 4MMYA 2LW3A 3DJTA 3VCLB 1ZSHA 1CJYA 1FO0B 3D2UA 2ZONA 3Q3GB 4GAJH 4S10A 4UQIM 4R90L 1GYAA 2UY6A 3EGDB 4XC1L 2HT4D 1CLYL 1RURH 1UOWA 2ATAA 2XQYG 4MAYB 3CLFL 4HCGA 1UWEL 3HG4A 3IDGA 4NHCH 2ID5A 1SMDA 1IAMA 1QFWH 4JLRA 1AZVA 1WZ1L 4B7LA 1OAYH 5FW7A 1G9EA 4LGSB 3US1A 3A67H 4NZ8A 2Q5BA 2E5EA 4Y89A 1VCAA 2DQCH 3FO9B 4LCUA 3BVWA 2XG5B 4XBGB 3MV9A 5E7FA 4CILA 3NESA 2K0RA 3KPRD 3N6YA 5CMAA 1CE6B 1TQCB 3J8F7 1HS6A 2MWCA 3CFIC 4IIZA 3AT8A 2HJFA 3C08H 1YECL 5TH2A 3RFZA 4J3XA 2IMMA 2YD2A 2ZUTA 2EE6A 4Z7UA 2WXHA 4JN2B 3SZ6A 4DIXA 2MKWA 3BC9A 1RV6X 3F84A 4FLHA 1UCTA 4QR7A 4WI9A 1YEIH 5EZIL 5I0VA 2EYSA 3AT0A 3D9AH 3UTZB 3D0VB 4LBEB 1CK0L 3ECWA 2Y6TE 2WHVA 5IQMA 2BXZA 3QXAB 2B2XH 2X4RB 2EIZA 1JNLL 4FQJL 4X4MA 1Q9KB 1VFAB 3FQYA 1HEHC 5FGRA 2J4WH 3EBHA 4ODUB 5BZZA 1VADB 4U0RB 1U4FA 4W6YB 2ARJA 3V6BR 5C0JA 1KIRA 5EZLA 2ZWLT 3I3DA 3BFWA 1THAA 2LU5A 3BPLB 4MD0A 1GPOL 5BPPA 1WRFA 4P9HC 4LSTL 3L3DB 3SBQA 3O6FC 4UV7L 4G72B 5CJXC 4GRLD 2XCMC 4OIFA 4B53A 4P4KC 4W9HC 3DTXA 2YQGA 2EDKA 4HCFA 4MCNA 4L1SA 1Q0XL 3VFRB 4PCSA 2NY7H 2TRHA 5D2LA 2Y23A 3Q8AA 1JFQH 1S3KL 4WRLA 1NSNL 3CDFA 1FE8L 2R2BB 5AQ0A 1QBLH 1J5OH 1MRCL 3Q7JA 2A73A 3EH4B 2PMZA 4HIQA 3UTTB 4D0BA 1OD7A 2GB2A 3HJ0A 5DRNA 1CI5A 1TIUA 3IWVA 4ZAKC 3JWNE 1GGTA 2A6JA 2PYEB 1YPZB 4GQZA 4KKNA 2VSKB 1OY3B 4LFHG 5F1IA 4BZ2H 3ULUD 5E99H 1KEGL 3OJDA 2YK1L 4N6RA 2TAAA 4BFGA 2ZUQB 3MRDB 4QXGL 4WI2A 1LP9F 2MOVA 4KJWC 2E27H 3CFBA 5ICXB 1Q72H 1YEEL 4WQOA 5CLWA 2VMJA 2R69L 1DBMH 4LIQL 4ONOA 1RPKA 5AB1A 4TNEA 1UWXH 4QOKD 3DHUA 1IGIL 4P99A 3LN5B 4W9CC 5L4IA 1KB5B 5AWNL 3GMRB 3KM1A 4Z7OB 2WZ0A 3T3MB 2FUTA 3DJRA 1I3GH 2X1QA 1TJXA 2HSIA 2WOBA 2NYKA 3MODH 4PHXA 2CLVB 1P5UA 3L3IA 4N8PA 1QLEL 4Q9BA 1B3IA 4P2RA 4NSKB 5IEKA 1GJIA 4JK0D 5TDOB 1QSED 3SBRA 2GTQA 3CSGA 5AW8B 1T2QH 3GD1C 4WLCA 2AJ3A 2CU9A 1GY2A 5L8LB 3HUJF 1U8IB 2E46A 2GJ6A 3MDJA 4KKAD 3U46A 1T83C 4B5ZA 5BZXA 3APMA 1FZOB 4FFYH 4S1RL 5AVSB 4R3SB 3B34A 5EZJB 3ISYA 1KPVB 4G59C 1SQMA 2RALA 1GS8A 4XH2B 5FYKH 5I6NA 1KN4L 5MENE 1UM6L 1MWOA 1GYVA 3B7UX 3QCVH 4Y2DC 2VISA 5DS2A 1JV5A 4GSRA 1W2KT 3HC0B 1HQRB 2OI9C 2BRQA 3HZYB 1B0RB 3OWEA 1YQ2A 2CK2A 4Y9EA 2YPLB 1R33A 2GSGA 2W80C 4NRYB 3TIEA 3PP4H 5A7BA 4KXAA 5DVKA 3U0WL 5KVGE 5JUEH 4XAKE 4JRXB 3FFOA 2ZTBA 3AU1A 4LF3A 4PRIE 1SOQA 5DZ9A 3V6FB 5D5MB 4BQ8A 3QEHA 1JD9A 5HHPB 2P5ED 3V6ZB 3PQYB 4UTBH 5DEJA 1EZLA 1E7VA 1I1YB 2VLKE 3KVPA 4N2AA 3RKDC 4EIGB