3G9VA

Crystal structure of a soluble decoy receptor il-22bp bound to interleukin-22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
197
structure length
173
Chain Sequence
LKPQRVQFQSRNFHNILQWQPGRANSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIIEQKVYEGAHRAVECVVAEIYQPMLDRRSQRSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin 22 receptor, alpha 2
publication title Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 33
structure length 173
sequence length 197
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g9vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g9vA02
1NGPH 4LGSB 2ADIA 3PJSB 1V3LA 1J8HD 4Z95H 3HZMA 3NCYS 3EOAA 2BZDA 4NZUH 5FYKE 5GRJH 5JLZB 4ZOBA 4FG6C 3TO2A 2APFA 3PWUA 4JR9H 3P4OB 3KS0H 1IAKB 5I1AB 4F7CB 5F9JA 4X4MA 3GSOB 4XHQA 4YFLF 4L3EE 5GHWL 5IFAL 1FORH 4PJBA 3S4SB 4M1CD 1JGVL 1ZMYA 2VLME 5CZVL 1ZGLP 4MNQA 1FVCA 4ISVB 3DRQB 4LVOC 5DMYA 5D5MB 5CCKH 1YYMH 3KPRE 5KOMC 1M7IB 2NY4B 3GRWL 1FZJB 2DM2A 2NYYD 5EC1A 1D5ZB 5I66A 4LCWE 2G60L 4P3CH 5C0BA 5MEPA 4NQSA 3WIHA 2R0ZL 3ME0A 4OQTL 4U1NA 3NBNA 3OR6A 2DWDB 4I4WB 4L4TE 4XVJH 4Y4KD 5KW9H 4QF1A 1QSFD 3S36L 2C1OA 3BX7C 2DL9A 2MJWA 4KAQH 4N8CL 3EO9L 3RWIB 3B8YA 3O6FB 3X14B 5I1CH 3SGEH 1BBJB 1UCBH 2APWA 4NHCH 2VISA 3F12A 2CLRA 3MFFA 2OXHA 2OTUB 5EC2B 1LMKA 4OFVA 2IAMB 4KJPD 4EN3A 3VFGL 1UEMA 3OKOB 2E7HA 1Q9KA 2XQYG 5C7XH 4TNWK 5GGVH 1N4XH 3BEWA 2HJLB 1TJIH 3KPSD 5D7JA 3GSNH 1T4KB 3VXSE 2EDLA 3RNKA 1NSNH 3BYYA 2IANB 4X6EA 5T3ZE 4O58H 2H2PD 2PNDA 3GHEH 2X09A 1U8PB 4X83A 1KB5L 3T8XA 3NCBB 1SBSL 3FQUB 4JLRA 3GM0A 1ACYL 4PGBA 2OR8A 3ZKMD 3PHQB 3O3EA 4PLOB 4P2QE 1FSKB 2HLFC 4OZGF 5DMKA 5FHAL 3LMJL 2YS4A 4OFYD 2GW5A 4IEFB 1KENH 5DI8B 2WLZA 1ZS8A 2IBBA 3PGCB 4MAYA 5I17A 2NZ9C 1CLYL 2HKHL 4IRJA 4YFLI 2DQCL 3KPOA 1Z2KA 4XAKD 2F8OA 2GYSA 3CU7A 5GJTL 5CEZD 4E5XB 5C0RL 4U6TA 4HWZA 1NCTA 1IFHL 1UFUA 3QCUH 4MNHA 5DS8B 5I1GL 1IZKA 5A43C 1NEZB 4HQQL 1U8MA 3CIQA 1KIQA 1DUZB 1DSFH 5EUOF 2CDEA 3C2AL 1LE5A 1SVCP 2B1HL 4I18B 1AXTH 3SGDI 3LPWA 1MQKL 1S7WB 3VE0A 2EIEA 3NPZB 1KJVB 4XP6L 3Q6FA 4NDMA 5CJQH 1HHIB 3LIZL 5GRUH 3QXAB 4NUGH 1CF8L 4JREC 3CVHH 1MLBB 3ZTJH 4M43L 2VLRD 4YDLB 2AXFA 3CXDH 4LCCA 2NY4C 5GS0D 2L0DA 3BZEB 4YBLB 5MEND 5JXEA 3KPTA 4XCEA 4F2MB 1BIHA 1WCBA 2VTFA 1ZK9A 4TRPL 3MXWL 1DE4B 2QEJA 4K8RH 4QWWD 4N0YL 3ARFC 3LS4L 5HGDA 3P9MB 4U6VL 1MVFA 4IBLT 4M4RA 1KBGH 2YPKB 3LVEA 4UNUA 4NO3A 1FFNB 4XC3H 2WAHA 3BH9A 4NKIH 4WW1B 2XICA 4LSPL 3B2UC 4NC1E 3FO0L 3O6FC 1AI1L 1RULH 1J12A 5F1IB 2XTJE 1KJ3H 3BVNB 1YNKL 5DEGA 1JPTH 4Y4KB 3GI8H 4G8EB 4OT1L 4HEPG 5JQ6H 4JAMA 1IC5L 2FD6H 5HHOE 4M62L 5H94A 3O0RL 1G7MB 2IAMC 2PETA 5J11B 4HFWB 4YXHL 4Q6YA 1YEJH 5JDSA 4KVNH 4HIEB 5C07B 4JGJA 5HGAA 1VGKB 1TZGH 2VERN 3X3FL 3HE7A 2EDHA 3VFNA 3L3HB 4RA0C 4P2OD 4M6OL 4HAGA 4FP8L 1DL7H 5L2JB 3V6FA 3MLXH 4I3SH 2EIZB 1JRHH 1XZ0B 2XIDA 4PRDB 3M17A 2IEPA 3P77A 3WS6C 1DUYA 3QISA 3KPSB 2ADFL 3TCLB 2ARJA 1C5CH 4PRHB 2WMPA 4X8JB 2FBOJ 4K7PL 5DD6B 2QR0A 1DBMH 4YFDB 2ITDA 3TO4A 1DN0A 5HYQA 5KANI 1EZVX 4U4BA 4F9PC 4TVPH 5F7UA 2VN7A 2WWMD 2Q87A 1T21B 2P5WE 3BD5A 4RIRA 4HSQA 2B2XH 1BQHA 3PABB 1I8IA 5AWNL 3I9GL 2GQHA 1G7LB 2F53A 3MLVL 3T4YB 5IB5A 1T66C 2XXCB 2V5TA 1F02I 2UYLA 3K1KC 3UTQA 3KVQA 1CR9L 1RZJL 2X9WA 3KYNA 3L6FA 2ZG2A 4EUPB 3DUSB 3RIFK 4MXVF 1IJ9A 3MXVH 5D1XD 2I5YH 4Y4HD 4KKCC 3L7EA 5KVMC 4RAVA 5AZ2L 1P7QA 4WFGE 1AC0A 1U8LA 2VDNH 4MDIB 3EYOB 3SDDD 3MODL 3QBTB 3VJ6A 4LFHG 3RDTA 4I18C 3DIFA 4F3FA 4R2GD 4MB5A 4N1HB 5I16B 2XWBB 1IQDA 4MVBC 3O2WL 2DQTH 5SWSD 3M1BA 5DFWH 1Z9OA 1QP1A 1GRWA 5EBLA 4BK4A 4O2CA 2E9IA 1IM9A 5IFJA 3RPKA 5FM4A 4I2XA 5MERA 4P46C 1FL6B 5C0IB 4HF5H 2IC2A 3K2UL 3SDXE 2V5RA 4YO0A 4G42B 1PEWA 4UIKL 4YDLC 4HEME 4HUNB 4YWGH 5JZ7C 1H15B 1Q0YH 3EYVA 4ONOA 1UZ8B 5FYKD 3QIBD 5IBTL 4Q9QH 2EDRA 4OGYL 5ANME 4OFKA 5FAAA 5DRNA 3IXTA 4OF6A 2VLRB 1OAZH 4L3ED 1JV5A 2W59A 3HTLX 1Q8MA 1X7QB 1ULVA 1ORQB 1GGBL 5MENB 1EPFA 3HG1A 3HI1A 4CJ0A 4F7MB 3RVVC 5JW3L 2ICCA 3BWUC 1AXSB 4AENA 3KPRD 4CAGA 1B6DA 1HSBB 2OJEB 1NDGA 2OP4H 4YHKL 1OPGL 3UBXI 2Q7YB 5TDNB 1NCCH 2BSED 5J11C 1S9YA 1MF2H 3TFKC 4ZAKA 3CDCA 4LCWD 3A6BH 4LK4A 1Z3GL 3DX9A 3SKMA 2BVUA 3VDCA 5IVZA 3VH8A 1ED3A 1QEWA 2IMMA 4L4TD 1MEXH 4JN2A 4EXKA 4KGLA 5CGTA 1QRND 1X5ZA 1TITA 5I76B 4OF7A 5DUML 1DQQB 3QIUA 4H25A 5T33L 1XF5A 3ULVL 4HIXL 3KPNB 4GRMA 4P4RA 4PJXE 5SWQA 3T3ME 5EOCL 3KPLB 5FKPB 4KHTH 4OQ1A 5ICZA 3GMNB 4S2SA 1BQHG 2OYPA 1PX4A 5T1KD 4JHAH 4OLUH 2VDLH 5DUPL 3T3MF 3WV0A 3FOMB 3DSFL 1FPTH 3QB7C 3NZHH 4DZ8B 5FGCE 1AY1H 4D8PA 4L29B 3GJFH 4JDZB 4KRPD 2UV3A 4FXGA 4OF0A 5HPOA 4LL9A 4NQCE 3VXSD 4IRSA 4GRLA 1O7SA 4HUWB 3QXVA 1BGXH 1CGYA 2DQHH 2XPGB 1OGAA 3IFOB 4XI5C 1KIPA 4N1EA 5CSZA 5D7IF 1WBZB 1KV3A 4NN7C 5F88B 4YQXL 4YC2B 5ESVB 4LGRB 4Z7UE 1UXWA 3G08B 1WVZA 4Z77B 4WIQA 4M9PA 4P2QD 1ETZB 2CD0A 4JEGB 2DQEH 1IKNC 3BXNA 3HNVH 2J8UB 3DVIA 1CXHA 3MPCA 5HHPB 2C3HA 2VLKA 3WE6A 3CLEH 4N8VA 4RBPK 4Z7UF 1EGJA 5ID1B 1V5JA 2FX8H 1F42A 3T0EC 4FNLH 1ZVSA 2YUVA 3VXQB 3QIWB 4WUUA 2NW3B 3IF1A 1VFBB 3SDDB 3IAGC 2FX7H 4OBSA 4U1JB 5FKAA 3QAZB 3QQ9C 5ID0B 3T4AA 4XPFL 5SWSB 2CH8A 3MRPB 4NT6B 3HAEB 2FO1A 4YEFA 1JI1A 4G3YH 4LQFH 1ZHLB 4NKDA 4FS0A 1S7SA 5IKCB 4U1MA 2DL2A 3L95A 4RGOL 1MLCB 2YWYA 2R1WA 1D5IH 1ZLVK 5C0FB 4CVXA 1TJGL 2VR4A 1BFOA 2VMFA 1JE6A 4PFEA 3EO0B 3EFDH 3IFNH 3MGTB 2X89A 3EGSB 3LSOB 3CH1B 2VC2L 4PJAB 4G8IB 3AC0A 3HS0B 2RCSH 2AV1A 4OIIH 5E94B 1U36A 2AEQL 3HC4L 3QCTL 4WV1B 5FUZH 1NFDA 4QTHA 1HH9A 3UTZB 2W38A 4CMHB 5K9JH 1YY8B 4HZLA 3T2PA 3RIAF 1QBML 1UACL 3UX9B 4HJJL 3T04D 4KKAD 4NNXB 3RX8A 4ZD3L 3E8UL 4JVWA 4NBXB 2CXKA 3GMRB 4YZFF 5E8DL 1A3QA 1JWMB 4LCWB 3MMEB 5I1KL 4WFFE 2XTJD 4X6FB 1KFAH 1RY7B 2JB5L 1HK6A 4NPYB 3RWHA 3TVMC 3LN9A 1OD7A 4KUCF 1QRNB 1TIUA 5HHOD 1CIDA 3AGVA 2XG4A 2ADGA 4LSRH 5E8NB 5T3ZH 3MLRH 4HKJA 1LO5B 2P4AB 4DVBA 2XN9B 5IVXE 5TQ0L 2HFEA 2AABH 4LCUA 4ONHA 4BFIB 2IQAB 3MJ9A 3WHXA 2FCBA 5DR5L 2FWOB 1CD1B 1XGRA 4UBDC 5IVXF 4GKNB 3CVIH 4DWHA 4JZJB 3SGKC 2I07B 3DETD 5GGSB 4U6XA 4HC1L 4JQXC 4IJ3C 4W6YB 5F7DB 1JZ5A 1NCWH 2UZIL 3H9SD 1P4LA 1A7PL 3NZ8B 4ZUTB 4K3JH 2V7HB 3JWDC 4OZGB 5EULV 3BIKA 3ZYOA 2P5WD 2FECI 4TUKH 1CLZL 4R4FL 3DX7A 4HKZA 4H8WC 1MY5A 2GY7B 1D5MA 4L8CA 5CKAA 3PWUB 1JPST 3QIWC 3S97C 3OKKB 1IRAY 5J1AA 1N64L 1H0DB 3VW3L 2VL5B 3CZJA 5DJXA 2M1KA 4GAGL 4W4OA 1NCAH 2YK1H 5J8OA 2A1WH 2NX5E 3CMOH 1FVCB 3MV7A 4HJ0D 4KK9D 3I6LD 5D2NC 1IBGL 1DEEA 3CFJA 1JPSL 4WHYG 4WFGD 5L9DH 4H5SB 4G7YL 3VFOA 5EUOB 4ALAL 3BKML 1RZFH 2V5MA 1VHPA 4OCWL 1RZKH 5A16A 4A6YA 3H6JA 5D71H 5EIIA 1NBZA 1NFDF 3S35L 1BQUA 1K3IA 5IUSA 5EC1B 1T80A 3BMVA 2CJUH 4PUBL 2ENYA 4NWTH 4PRIE 5LQBH 3P0YL 4NQSB 3FCTA 4U1NB 43CAB 4NCC2 1A7RH 2GK2A 3WS3A 2R1XA 1DLHB 2XA8L 3V5KB 1A02N 1CDYA 4WV1C 2P49B 4N0CD 3SDYL 2AJZB 3PGFL 3GSUB 5B39A 3X3GH 4UV7L 4CMHC 5HHXL 5A2IH 1U3JA 2V17H 3VXMA 4OCRL 5EZLA 2X1XR 3OMZA 5EZIH 1GGIH 2CLRB 3JBG7 3L3KB 3HCVA 3GK8H 5C2BL 4C56E 1DDHA 3RKPA 4EN3B 5FYJH 2ATPA 1Q9KB 1KN2H 2D7MA 3NABL 1MCOH 4LPXA 1T1YA 4PLNC 5ITFA 5LGHH 3BEWB 4P5TD 1UM4L 2OL3H 2PN5A 4GAJH 1MCHA 1DVFA 5DMIH 3TH2T 3FFDB 4ZFZA 1RJYA 4LSQL 3RNKB 5E5MA 4LLWA 3OBAA 3RAJL 1H3TA 1BIIB 1QHPA 3ZE1E 2J7LA 35C8L 1QLFA 2XTJB 1NAMA 4LRIA 3S5LB 3WBDA 3KYKH 1R0AH 3PWPA 1KJ2H 2VXSH 3MYJB 3IXAA 2P45B 4V1DE 4U1GC 4J1UA 4PGBB 3UJIL 4MA8H 2AGJH 2XKNA 5AZEH 5HHOB 3LRHA 5F3HA 5DMKB 5J4MA 1OHQA 1OARH 1EERB 3ZE1F 1EBAA 3EUUA 3MV9A 3WHE0 5DD1H 5HPMB 1ZS8B 5KTEL 4JZJC 4MAYB 3E2HB 1O0VA 3UBXB 2VO5A 3RJDA 5IG7A 1C08A 4IRJB 3BKCH 4EVNA 2EDQA 2OMNA 1MOEA 3KPOB 3BDBA 3SKNA 2CDGB 4KJQD 1IARB 2CKBA 3RX7A 1T1XA 4M7LT 3T0XA 4CNIA 1HYSD 1KYOJ 2EIBA 4P2RE 2BK8A 2L7UA 4J3OC 4X6BA 1CDIA 1A6UH 1E4WH 1MJ8H 1FH5H 4MNHB 4OKVA 4K9EL 3C60D 1OAQL 3NIDE 1WFOA 1WUNT 2UY7A 1BQLH 1U8MB 4RAHA 3UTSE 5CP3A 3HC3H 1KIQB 3H9SB 1LE5B 1H3PL 4Z76A 4JDVA 4CBPA 4NO0A 4XNUH 2XWTA 3VWKD 3ZYZA 2NXZD 2C7UB 3NIDF 2EDXA 3UO1L 1KJMB 3VE0B 5BV7H 1CXLA 3KLDA 5IQ7L 2AJSH 3QULA 3OQ3B 4G8FA 2PYFA 5FO8B 3BWAB 1A4KA 1OCWL 3PXJA 1U2HA 5TE4L 2GHWB 5IEHA 1C5BH 2AXFB 5F9DC 2YUZA 4LCCB 1MELA 4TSBL 5A2LH 1EEUA 3DX8A 3LN5A 4PS4L 1WCBB 3WLWC 4JFHE 4X99A 1ZT1B 1RK0A 5CWSB 1WSST 4AMKL 2OTWA 5J3HC 2APBA 4AL8H 3G04A 4NO3B 3BH9B 4FQIL 3BPLB 3AY4A 4MJ5A 1BM3L 3LQAL 3D0LB 1QSEE 1CVSC 3IDJA 4MGXA 2OJZL 1LNUB 3T2NH 4POZD 2IF7A 4JAMB 1F45A 2WUCL 5HBBA 4JY6A 4Z78B 2L7JA 3O6LH 4EN3C 3D3VA 2CQVA 3C6LA 3VFWA 25C8H 4MXWL 5JDSB 4AG4H 2OMBA 5HGAB 5EN2B 4O5LL 5D72L 5ANMB 3VFNB 1JTOA 3K4DA 4YHLL 4IOFC 2BSTB 2O26U 4XBEH 4U6HA 5D7JC 1YUHB 4NCC1 4AYFA 3DV6A 2J5LB 4CU8A 1MFNA 5HD8C 3WDHA 1PQZA 5IMOA 5DRWA 3ZO0A 2JB6A 4HIIA 4KC3B 2AXHA 2EC9T 4PJ5A 3P77B 2XT1B 4P5TB 1MCBA 5DJYA 4BK5A 2VDOL 4FFYH 2R29L 1MY7A 2ARJB 3MLYL 4FFVD 2ITDB 4V2BA 2HP4A 1UKQA 1RURH 1KCRH 1VADB 3B8SA 4KUCD 4YHOH 1NFIB 4RIRB 4QXTB 1SQ2N 4MAYC 3E2HC 4HDIA 4M7LH 2HTKC 4IRJC 3KG5A 5HI4D 2F53B 4F37K 1AD9B 2PW1A 4U05A 1WEJH 3ZKNC 1MFDH 2UYLB 5HSFA 3T0EE 4MHHG 1JGLL 5GGTA 2K1MA 1QR4A 4RFEB 3KYNB 4W4NA 3CSYA 5H35B 3GMPB 4JY5L 3GKWH 1A64A 5EIVA 2IGFL 2UWEE 4ZNCD 4HMDA 1A4JB 5HVHC 3Q5OA 1P7QB 1CU4H 4ODSH 5BVPL 5F6IB 1U8LB 2I24N 1AD0A 1ZHBA 3NMEA 1FLRH 2R0LH 3VJ6B 3V6ZA 5J13B 4FFZL 5CLTA 2UWEF 3MBEA 5HDLA 4F3FB 5JHLH 5T1MB 1R24A 1J1OH 3CPLA 4P48A 4J3UA 3U4AA 2IBZY 5D7IB 5CEXA 5EBLB 4O2CB 5IFJB 1AIFB 3PDOA 5MERB 3PV6B 3VFRA 3OKLA 3VWKB 2B0SH 1R6VA 2NXZB 1M05B 3TJEL 4LCCC 5BS0A 3P11H 5TPWH 2EDDA 4Y5XA 5ITBL 4PJGF 3EYVB 4KTDH 4AQ1B 2Q8BH 3TBSB 3CZFB 1IGFL 1AKJD 1YEGL 2KZWA 4LSUH 4MJIE 2PTUA 4Z7UB 3V4VL 1XFPA 1ZEAL 4M8QA 3WFEH 4C83A 4X0KA 2H8PA 1G7IA 3VRLE 1QBAA 2X4NA 1NC4D 3O81A 1CIUA 4TTGA 3BPLC 4QO1A 1FL3A 3QSKB 2G75A 4WFHE 3HI1B 2NX5D 1IZJA 3TM6A 1F58H 4RBPH 3ZSTA 1S5IL 4HBQA 1KLUA 1Y0LB 2J1KA 4ZFOL 4DAGL 1U92A 3SDCA 3IJSA 3V2AR 2W07A 1AGBA 4LHUD 1S9YB 3T0WA 3OF6D 3T0BA 4OUOA 3VXRA 2P48B 3ARUA 4D0CA 4IOIA 2JK5B 3HE7C 2HG5A 2V5SA 3DX9B 3VH8B 1ED3B 7FABL 5FO7A 4JN2B 3QG7L 3T0DA 5LGKA 1DEDA 2J5LC 2VB5A 3G6JA 3RJQB 1XF5B 1HXYA 4ONGH 1FAIH 1A0QH 1LDPL 4GRMB 3GMMB 4P4RB 4L8SB 1ZVYA 2FEDD 2VXTH 2YN3A 4RGNE 4UQ3A 5SWQB 2F54A 3VD4A 3FQRA 4QCIA 4I0CC 4MCZA 4KAQL 4FABL 2IQ9L 3GZKA 4S2SB 3TO4C 4G7VH 4C56D 3VGAB 3MOBL 2W0FA 3L3JB 2R4SL 1BZ9A 3TA3A 1EAPB 4I0PD 4DCQA 3CX5K 1KOAA 3MRCA 1NCBL 1PG7X 1SYVB 4NJAH 3LV3A 1T5WA 5DO2D 4YPGA 5KAQF 4CN4A 1QFWH 2WLYA 4PTTA 4U2YA 4GRLB 3W2DH 2D3VA 3WUWA 3W0WA 5KVEL 2ZG3A 1AQDA 2VZ1A 5D7LA 3FN0L 3MUJA 4HH9B 1MFCH 3JWOL 5AUMA 5KSVA 1KIPB 3IRZA 3QNXA 4DGIH 5EZOH 3GSNL 4M7KL 2BSRB 2GFBA 4N5ED 2Y5EA 3BUTA 4V1DD 4P3DA 2V9QA 4ZG1A 1I85A 3TIDA 2XTLA 4YXKH 5ERWA 5D2NE 1NLDL 4O58L 3BXNB 1XIWA 1T0PB 3RDTC 5J13C 3WJLA 2VLKB 3OAUH 5IP4A 4JPWL 2AK4E 1J1XL 1CZ8L 3TNMA 3WN5B 1M4KA 4JDTL 1SY6A 5CBEA 1D5BB 4N8PA 3IF1B 5FGSA 1FRGL 3OPZH 4PB0H 2X44D 4ELMA 4NQTA 3OSKA 1YN7A 4HCRH 2VDQL 2H32A 2LU4A 3QJHA 4P2RD 1T1ZA 2Q3ZA 1B9ZA 1J86A 4K3EL 4PRPB 4GJTB 3L9RB 3O4LA 1BVKA 3MRGA 3UTSD 1S7SB 4U1MB 3L95B 2DJ4A 3PHOB 5TJWK 5DVNA 3QCUL 1FJ1B 4LP4A 1SMAA 1T3FA 2VLLB 4ONFL 3ILQD 4CVXB 3UPCA 1UB5B 1BFOB 2DTMH 2WINB 1YPZA 1E4KA 3S37X 3R0MA 2FB4L 1AKJB 3CFEA 3VG9B 3EKCA 1KCKA 3QT2A 3ROOA 2I25N 4FFWD 5GGUA 2EDFA 3G6JF 1F2XK 4LLDA 2AV1B 4X5XA 4RMTA 3BE1L 3LKOA 4JY4B 4P57B 4PG9A 1NFDB 4QTHB 4XB8A 1HH9B 3UYRL 1JBJA 4ZAKC 5CINH 4GQ9L 3RHWF 2Y36H 2MPAH 3DO7A 4JFHD 2P5EE 3MQIA 1KTDB 3F6IA 3F7VB 4C4KT 4NN6C 4KQ3L 3HC0A 1OTUD 3QIUC 4DGVL 4R4BA 1I1CA 3OJDA 3OHXA 2HKFL 1QSED 1NANH 4KKLD 43C9A 1NMCB 3V8CA 3ALPA 3RWHB 2VZSA 1UA6H 5IMMB 3GJEA 3A6OA 5C0CE 5JA9A 1A6TA 2ADGB 2LU3A 3KPMB 3VGAC 4WUKL 4G6ML 4YIQA 1A7OH 3A0OA 4C4KO 1DQMH 1QA9A 1T20B 2XZCL 4LCUB 4ONHB 4YFEA 5E2VH 1JHLL 5I1EL 3P0VH 2OBGA 3CFCL 4OLZH 3NIFF 5C86A 3BPOB 2R4RL 4DOHB 5FXCH 4IRSC 4GRLC 1RZ8A 2IALB 4MD5A 5T3XE 4EJ1C 2X10A 5E1AB 4JPVH 3PWLB 1QFUL 1QKZH 4G6JH 1GIGH 4LPCA 4ZSOA 4P2CG 1Q9OB 4U6XB 3O2DA 1OAXL 4HWBA 5BW7A 2HTLD 5F1KC 2DLHA 4ELMF 3HNTL 3LH2L 4I3SL 3MA9L 4PJ8D 3G9AB 5JOFA 1T04B 2PXYD 4MNGB 1FIGH 3CCHB 5DUBA 4JRYA 3BIKB 2R2HB 2Z93A 1JZ3A 3GM8A 5EA0L 1G7PB 1L9MA 5CEZL 4OB5H 3SGJA 1A1OA 3G5XB 4KY1L 2Y06H 1YMHB 2ZUSA 5C0BE 4YE4L 1FC2D 1PFCA 3RU8H 5L7XH 5DJXB 4Z7WF 1T5XA 4HGWA 1LO0H 4KK6D 1JFQH 2IADA 1L7IL 1MHEA 4WRLA 3PDGA 2A6IA 4HKXB 1R5IB 2BNRA 4WU7A 1JWUA 3IT8D 3FT2A 5DDHA 3VFOB 4M6NL 4M6MH 3D39E 3GRWA 5A16B 3ARPA 4A6YB 1BD2A 4P2RB 5EIIB 4Y89A 3EIFA 5B3JE 5HHQA 3SDAA 4JJ5A 4ODVL 4QEGA 1YMMA 1WWAX 3GHBL 1GYAA 5GS0L 3UTSB 3HB3C 2R2BA 4JFEE 4YNYB 5FF6A 4WDIB 4NM8L 4J3WA 3VDAA 3BT2L 3L5HA 1E4XI 1BEYH 2GITA 5EFIA 4CL7A 4XPGL 3FAWA 4JB9L 3FJTA 4NYLB 4UINH 4TQEL 4D2NA 2GSGA 4GW4B 5F1OB 1JHTA 4FQLH 1AGEA 4MJID 5JPMB 3G5ZB 5EZLB 4ZUWB 2JKXA 1BQSA 1EUTA 3KYMA 2DYPD 3I6GA 5GPRA 5HDOA 4LRNH 1DDHB 4JHWL 2RHEA 3GNMH 5KS9E 2ATPB 2IFFL 4HUVA 4JO4H 5D7SL 2H3NA 1A3RH 3MRIB 3WFDL 3T0VA 2VDML 3NACH 4WFHD 5IOPA 4KDTA 1XCQA 1P5UA 5ITFB 4Q0XL 4YBQD 1T7WA 1EHAA 1A6WH 5FB8A 5GGRA 1ZWIA 2DLFH 1A6AA 2E6PA 5KS9F 1RJYB 4L3CA 5E5MB 4LLWB 1UM5H 4QOKE 1IGJB 1YY9D 2HT2D 4LARH 2ZPKH 3PWPB 1HHGB 4JVUA 3IXAB 4HKBA 4MWFA 1FL5A 2NY3D 4J1UB 3STBA 1HXMA 1TVBA 2Z4QB 3QEHB 2XKNB 3EYUH 5F44A 4O4YH 4RFOL 5F3HB 4M7ZB 5C0DA 3Q3GA 4DZBA 5I1HH 3S88H 5ICYB 5AD0B 5F6HI 1DBBL 1MF2L 1ZVHA 3H7BB 1CFVH 1JNNL 2YKLH 5DK2A 1X4YA 2F5BL 1JYWA 3AS1A 2NY6B 4P0DA 3HZYA 3GSWA 3U9PH 3F5WA 3GSRB 1IEBA 4EQ3A 4X6DE 4RGND 3B43A 1MCJA 5IG7B 1MEXL 4G9FE 3SKNB 2CKBB 4U0RC 5HYSA 1T1XB 2LAAA 5F7HA 4LKXB 5IJKA 4YXLL 1YEFH 3HUJA 4ZDHA 4BH7B 1KEGL 2R56H 2P1YA 3OKEA 5CBAB 4XNXH 4PBWD 4RDQG 4PJ8B 3MLSH 5INCA 4UTBH 4Z76B 2EDEA 2PXYB 2KUTA 4XBPA 3QUYD 2A6JB 2C3VB 2Y07L 2VQTA 3ROLA 3I02A 3NCCB 4I48A 3R4DA 3UDWA 2X1OA 4W4OC 5KJRL 3RA7L 1F6FB 3WUZA 2CR3A 5B8CB 4LEOB 5IGXL 1HEZB 1NGYA 4ZXBD 3CLFL 2NY5C 3QULB 1DFBH 1RMFH 4G8FB 2PYFB 1CLOH 7CGTA 1A4KB 5E8OA 4O51B 4JRXE 1UH4A 5IFHH 2EXYC 2XZQL 3ARXA 1WFUA 4CVZA 1RIVL 2R69H 1JHKH 1E27A 2UWEB 2AK4D 3LN5B 5D96C 4ZNEE 5A1AA 1HHJA 3V5DB 1JPFB 3HNVL 3LB6D 1WK0A 2AJ3B 3UC0L 4Q9RL 3ZHLA 5I1IL 3ZTJG 2M26A 1RK0B 3CFKA 4K94C 5BO1H 4KKNA 5FYKL 3SQOH 2I26N 5EPMB 3F58H 4JVPA 2YRPA 3JSSA 5EU5A 4DGYH 4NHUA 4X7SL 1KXQE 4LQ1A 1Y6KR 2W65A 4PJGB 4OIBA 1A22B 4XCFH 1PW3A 4B7LA 4PBXA 2BC4A 4QGYA 1RIHL 4E42A 4NQXB 3V7MA 2A9NH 4NNPH 3I6KA 3C6LB 3VFWB 3B9DA 3TJHD 3QHZH 4WI9A 2ARJQ 5ECJE 3O8XA 2DKMA 5HHNA 1BF2A 2VXVH 3OJVC 2EYRB 3H9YA 3O3AB 4U6HB 3L1OL 1DVFC 1FE8H 4KZDL 4E0RA 3DV6B 1R3IH 3EFDL 1QR1A 3IFNL 2JB6B 3BKYH 1EIBA 5ACLA 2QSCH 4XCNB 1VKXA 3FQXA 4LRIC 1DBJH 5DJYB 3O3BB 4TSAL 4OLYH 3D9AL 3H9HA 3B9VA 3BZ4B 2G9HA 1F8TH 5I1JL 5AAWA 4Y5VA 5TDOA 2P5ED 4WWKA 1Q0XH 3PL6D 3JWDH 2NY6C 2ZUQB 5ACZA 4P2YA 4QXUH 2NY3B 4KRLB 4HDIB 5HYSG 3RVWC 3TYFB 1QLRA 1PYWA 5ESQB 2P7TB 1BOYA 4H8WH 1RUPL 1NPUA 4DKEH 5C0CD 1XGQA 3KLHD 4CDHA 5HYIA 1HI6A 2ORBL 5E6ID 2X4TA 1KFAL 1MNUL 1S7XA 1JF5A 4AIZB 4JG0H 2QKIB 4QRTA 2FJHA 2HVKA 1BX2A 1BVLA 2NY0B 2MQ3A 3IFLL 3RQ3A 3HAEH 4GLRI 4JQVA 3U4BH 1AD0B 3VXUE 5AYUL 4J7RA 3RUGA 3MREA 5DD5L 1I3GL 3V6ZB 1TCRB 2K7QA 1BAFH 5T3XD 2EC8A 5JW4Q 2VDPH 4QHUA 3MCKB 1DQTA 1OP3K 3VA2C 4XP1H 1R24B 3DMMD 3L3OA 3TYGH 5CEXB 5K9KB 1AXIB 3PDOB 5EZJA 5IF0B 2HLAA 3VFRB 2P24B 3HG1E 1HILB 3AS0A 3RIAK 2BNUA 1XGPA 4MDJA 3QWQB 1PSKH 5BS0B 3EYSL 1K85A 1T22B 4GKZA 4D9QE 4Y5XB 3P4MA 4PD4J 4ZXBB 4MQXD 5LXGH 4G6AC 1X5KA 3SCMA 5CSGA 4Q6IA 3W39B 1IQWL 2EZ0D 1P6AB 3PQYE 4K7PX 1FG2A 3HFMH 1I4FB 1JF6A 2H8PB 3FONA 2FJGA 2BX5A 5GIRA 4MSWA 1Y18B 3AY4C 5FYLD 2AK4B 3HPJA 4L4VE 4F8QA 2YBRA 4DTGH 5JNYB 3H9ZA 1CFBA 5JOEA 5E2UH 4KMTL 4FQ1L 1KLUB 5CS7A 5C08D 2FRGP 2YK1L 2EIDA 3SDCB 3D39D 3IJSB 4OZFH 5E99H 1U3YA 5T1DL 5DURD 1AGBB 1FLTX 3C6LC 1HIMH 5FYJU 4D0CB 4IOIB 2VAAA 5JR1H 4S1SL 1K4CB 5DTFA 1G7JA 5L2KE 4P23D 5D71L 1PKQA 3GFUA 4JFED 3QUKB 5FO7B 2CJUL 1S7UB 4AH2B 2HRLA 2E5EA 3G6JB 4Z7OE 1D5XB 1ZXQA 4X4XB 1B0RB 2VJXA 1HXYB 2W0LA 2ZJSH 3FN3A 3ZTNH 1EXUA 3ZDZF 4ODTH 4UQ3B 3QUXD 3FQRB 4QCIB 1OGAE 2GI7A 3QDAA 3LKRA 4BA8A 3ISWA 3RTQD 4L9LA 2W0FB 3GMOA 4I5BA 1BZ9B 3QDGA 2MKLC 1OAYL 2B4CH 3U0PA 1A21A 3E6FA 4DCQB 2A83B 1RHFA 3FQTA 1ZHKA 3LV3B 1T5WB 1IE5A 4YPGB 4CW1A 3CXHK 3EZJB 2A77H 3B2VH 3BPNB 1S3KL 3BP4A 4PTTB 3RUGF 2Z8VC 1FIEA 2I60L 3PP4H 3TPUB 3RGVD 4OTXL 3H42L 4WUUE 5D7LB 5LGHL 5KSVB 5AUMB 1MRFH 3QQ4A 4KDVA 2KL6A 1I1AD 3NA9H 3QNXB 5FUCC 4XGZB 4QOKD 2GFBB 5HVFB 4YBHA 1NKOA 1YJDL 2ICEA 4M48H 2NY0C 3U46B 4CN1A 3W11D 4N9GA 3TIDB 4Y19A 5CGYC 2ZCKL 1GGCL 5D70H 1G84A 5E6IB 3KYKL 3OZ9H 3ZZ1A 1IGTA 3MBEC 4PV8A 5KSAD 4UTAL 4MA8L 1JF1B 3QEQA 4CMMA 1CL7H 1N0LA 3DROA 3TNMB 1N6QL 3HRPA 4G9DB 3FT4A 4HPYH 5HI3C 1H8OA 5CBEB 4N9OB 3VFMB 2R1YB 1CDHA 4G9FD 4OLWL 4LFHD 3WIHH 4ELMB 1ZSDA 5ALCL 1YN7B 4XVTH 2E7BA 3BEVA 1S9VA 3O6ML 2H32B 3LCYA 4NKMA 5IQ9A 1VEMA 1MJUH 3VMOA 3DMMB 5CD5D 4Y5XC 5BRZE 4GMTH 4OV5A 5F7KC 4LOUC 2R0WH 2XQBH 1BVKB 4JZNA 1OP5K 2QADD 1P84K 2NTFA 5JXED 1A6UL 1E4WL 2VH5H 5HJ3A 1QQDA 2OR9L 3RWEB 1C1EH 2DB8A 1X5IA 3C09B 3WLBA 5L0QC 4Z7WB 1BWMA 4JFXA 4Z8FL 3SJVE 4OM1L 3CFEB 3STLA 4G6FB 5GSVB 4XNUL 1MWAB 1DTUA 2FLBT 3I50L 2NY2D 3ULVF 5GGUB 5D8JH 4KI5C 5EWIH 3SE9H 4JRXD 4LLDB 4OZHA 4WW2A 4X5XB 3SDCC 3LKOB 4X9HA 4WI2A 2RIKA 3O41A 1RUKH 3QDMA 3NCJL 4JKPH 1R3KA 2J6EL 4UV4H 1RU9L 1Y6MR 4O00A 4OLVH 4PR5B 5C08B 3D39B 3MZTA 1S7QA 4LKCB 1UZ6E 3G5YA 5KSBE 5DURB 2XRAH 4PLJD 4PJIA 3BJLA 2FHBA 3OJDB 4J3XA 2HJFA 4XPTH 43C9B 1EO5A 4JFEB 1W72L 3GJEB 5KSBF 3OXSA 1HWGB 2A6DA 1IGML 2GAZB 4TUOB 5B38G 1FCCA 4KKBD 2D0HA 3V0AC 3OR7A 3U0WH 2P8PB 4RAUB 1EJ6A 4JO2L 3VD3A 3TA3C 2FL5A 1TZIB 2EKSA 1FFOA 1HDMA 3VCLA 3P73B 5GGQL 3P4NB 1CTOA 4FQXD 1BOGB 4M4PA 2P8LA 3EDJA 2VE6A 5FECB 1HQ4A 3IAPA 4QRPA 4CN6A 3ULUC 3BYTA 4A2MA 4GG8B 1F4XH 2BHUA 3LEXB 5KS9B 3KJ6L 4K71B 3MV8E 4ZUSA 1U93B 3LHPL 4BQ6A 5C0GA 4HC1A 3DHJA 2Z31D 4XWOD 3WDIA 4BZYA 4XBEL 4JPIA 5ILTH 3REVA 4TNWF 4BUHA 2X2YA 3FRUA 4U3XA 5MEOA 5IESH 1D6VH 1I85C 5JOFB 3V0WH 1XIWC 2BVOB 4BKLB 1AR1C 4JRYB 1I1AB 3WJLC 3MRLA 3FQWA 4NJ9H 4QOKB 3TBVB 3OL2A 1B0WA 1NLBH 4Q97A 2EO9A 3N85L 1LVEA 2FR4A 4ZUUB 1DLFL 2DM4A 5KVFL 5EU3A 2Z9TA 3REWA 1RPQA 2AI0H 2V9RA 1SVZA 3BI9X 4MD4A 1T5XB 4HGWB 5JXAL 1X5YA 3DGCR 3HE6A 5BJTA 2OSLA 2IADB 3LQZA 3ARBA 5F9AC 3OWEA 1P4IH 2BNRB 5ADOL 4WU7B 1I9IH 1LD9A 3FT2B 2D31A 2J3SA 4NOBA 4OZHF 2DI9A 4WW2F 1W0YT 5E95B 4TN9A 4ODHL 3GKWL 1YEDA 3VXUD 1BD2B 3A6CH 2FGWH 3VXME 2GKIA 1V7NL 4P9HL 5HHQB 3QXDA 1N5YL 2PYEA 4FMFA 1E4KC 4ODSL 1YMMB 1BJMA 4PJ9D 2D03L 2FZ3B 4ZUVA 2R9HD 3H8NA 3D0VA 2PW2A 5IWLC 4MQSB 1NBYA 4IS6A 3I2CH 1MFEH 5EFIB 4JM2A 3RWDA 3FFCA 5MP6H 3QDHA 4QXGH 5E2TL 1LO4H 4BH8A 4D3CH 4OCYL 2JELH 2GSGB 3B5GA 1PG7W 3V0VB 2XY1A 3MRKA 3EYQD 4GG6E 3QUZA 3PQYD 4HFUH 3KYMB 1KIUA 1AP2A 3P11L 5I6XB 5TE6L 4B50A 2A6KA 3X12A 4D0BB 3MRNA 4HUVB 1KCSH 5F3BA 4FTVE 4L4VD 3GDBA 1U8KA 1INEL 1NMBH 1XCQB 3BKJH 4WJ5A 5CAYB 2AEIT 1RZ7L 4MX7B 1ZWIB 5D2LF 5BZDA 2GY5A 4YDVA 5FM5O 2GJ6E 5M7QA 2V2WB 4L3CB 3IFPA 4H1LA 4WTXA 2X70A 1ZTXL 1E6OL 2RAMA 4HUUA 5I18L 2YD8A 5KN5B 2D0GA 1JTTA 4Y8AA 1KB5B 4JRWA 3WKNA 2CRIA 3QWRD 4QRUA 3OJMB 1LGVA 3K1DA 1N5AA 1U2CA 4HWEH 4JFQB 1FL5B 3D18A 5ISZA 3T2OA 1P5VA 1MCPL 1TVBB 4DJMA 1DQDL 5L2KD 4LEXH 1KULA 3LN4A 4DZBB 2ED8A 4UDUA 2AKRB 4GAYA 4GKSA 2Y6SC 3S35X 5DK2B 2DQFA 1T0NB 3KPPA 4JZOB 1C7SA 3MGAA 3QO0B 1RIUH 3GSWB 4HD9A 3ZDYF 4N5UA 15C8H 1AGDA 2P8MA 4JANA 4NRXA 4XAWH 1SJVA 1I8KA 4Y4FD 3OV6A 1W2KT 5BW7C 1YA5A 3GSXB 4LPWA 2CMRH 1FAIL 5E8PA 5EU6A 1JK8A 2Q8AL 2R2CA 2Z31B 4PGEA 3BOVA 5HVGB 4RMQA 3OKEB 4U1SA 3T1WA 3AS3A 5IB4A 1NCUA 4PJDE 4G7VL 3SGJC 3WD5H 5C0NC 3D85A 5INCB 4JFFE 1JUFB 4WEBH 4YX2H 3SPVA 4WI7A 3WNPA 5DQJA 3KNBB 2HWZH 4I48B 4DQOH 4DN3L 3FT3A 3MA7A 2WP3T 2OCFD 2Z92A 4PJDF 2N56A 5T1LA 1OTTD 4X9FA 4RQQA 5EORH 4GS7B 4KQ4H 4WTZG 4DK3A 2AJYH 3C5ZA 1MFCL 1REIA 5E8OB 3QJFB 5KVDH 2LABA 3RX5A 5KBNC 3QPQC 2CK2A 3DBXA 3WXVH 3SDAC 2ZG1A 5I71C 1E27B 3QR2A 4EBQH 1FFPB 5HHVH 3D3VE 1KPRA 2WP3O 4E9LA 3TZVD 1JJUA 3CFKB 3BQUB 1A3LH 3VXUB 2FIKB 1I9RH 5GXBB 3FB5B 3Q5TA 1ZA6A 3VXPA 1JNHB 4XPHH 4BQ9A 1CS6A 2DWEA 3OAZH 4TVSa 3DXAE 5BRZD 4HX1A 2AJUL 1A6PA 1KTRL 1FHGA 2C26A 1VDGA 3W81A 1NKRA 4PJ5E 3EO1A 1RUQH 3MNWA 1CE1H 2CRMA 3BO8A 5I6XC 3LKPA 4XT1C 4K2UL 1R3JB 4TSCH 2CO6B 3BN3B 1IKFL 2CSPA 3I6KB 5I0DA 5ESAA 4JFDE 1DBAH 4N0UA 5HHNB 3RNQA 3SJVD 4KDTC 1MPAH 2LVEA 2YD9A 3BP7B 1TQCB 3LZFL 3PQYB 1K6QL 1EEYA 3VFUA 5DT1L 4E0RB 5K93A 2IPUG 3FZUC 1QR1B 1MREL 4HULB 3ZYIA 1E6JL 4IRZL 4MHHI 4ZS6C 1V8HA 3ARVA 4OCXH 1VKXB 3FQXB 4XMPH 3KLAA 3KXFE 3VFVB 3WFHA 3U0TB 1CE6B 3EJZD 3P30L 5IB3B 1WIOA 2G9HB 2O5ZL 4OLXH 4MLIA 3QDJE 4U1HA 5T5NG 1KTLA 1I7RA 2J2ZA 4Y5VB 3RVTC 5TDOB 3T09A 3WFZA 3BRFA 3QH3A 4WWKB 2ESVE 5JHDE 2VABA 32C2A 5DJ6B 1ZLSH 1JGDB 1I7UA 2FX9L 3UTOA 3CGTA 1OAUL 1KLGB 5L2KB 1QLRB 1PYWB 5E1HB 1EGJH 1VPOH 4PJFA 3UTTA 4C59B 1F4YH 1S5HA 1U8NA 2GSIB 3UEZA 2PF6A 3RKDD 1S9KC 5HY9A 2YN5A 1KC5L 1HI6B 2XA3A 5IJKC 2X4TB 4PV9A 1YEEH 5F7YC 3QA3A 1J1PL 2FJHB 1IT9L 4Y4FB 1U8IA 1BVLB 5LKNA 3RVXD 5F1NA 1D6EA 5A40E 1CQYA 1UWXK 3NH7L 5JLZA 3GUTA 3RUGB 4URTB 3MREB 5L8LB 3MRJB 3P4OA 1IAKA 4F7CA 3EFFB 4YDKL 3TN0B 4XVUD 3UDWC 3MV8D 3V95A 1QG3A 4ZS7H 4QHUB 2Q6WB 1I7ZB 4FQQB 3S4SA 3L3OB 1B88A 5GZOC 4EI5D 2QHRL 2X40A 3GIZL 4LPTA 3U7YH 3UAJD 2HLAB 4GS7C 4ISVA 4ZPVA 3RHWK 3GI9L 5TF1L 1MI5A 3DRQA 2BNUB 3MCLL 2XFXB 2XQYK 1XGPB 2X4RB 3O2VH 1KSRA 5FA4A 4W68A 1M7IA 4GKZB 3QCVL 2CK0L 3P4MB 3OGOE 4PP2B 3WXWH 4ZODA 3MRBA 1K4DB 1MCRA 1RZIA 4LDLB 1KELH 1FG2B 1PX3A 2AJXH 3D5OF 3BQUC 2DQGH 2HRPH 4WWID 5DRZA 1IAMA 4IDJH 2W9EL 1QSVA 5FDWB 3P0GB 4X5WB 1RFDL 4KU1A 1INDL 1EMTH 4OFPA 5C6TL 1IAII 3HPJB 1AE6H 4L8BB 4LLUA 3RWIA 5I2IA 3VI4E 1H8NA 1CFTB 4RWHA 5TFSH 1BBJA 4ZFOA 3SE8H 5DWUH 1WC7A 2F54E 2VIRA 2AJVL 4HW6A 3IETB 3LEVL 1FNFA 2YRZA 4UDTA 2OTUA 3WMSA 5DMGD 1Q1JH 1FVEB 4GXVH 3O8XC 2MMXA 3ARTA 4PJCA 1FC1A 1LO2H 3OKOA 5DTFB 3SE3A 1TQCC 4KXZH 3SE4A 3BP6A 4RX4A 3SKUD 3SO5A 1KTKE 3MJ9H 1A2YB 5I15H 1K8DB 4KK8D 3RVUD 3O11B 4D9RE 1T4KA 3JUYA 2X4PB 4HK3J 3IDMA 4XCYB 4HUXB 3ULUE 1EXUB 2IANA 2ID5A 4PJFF 5EBMA 4XH2A 3RL1A 4JG1H 3UJTL 3LKRB 4LLAA 2O5YL 1L7TL 4MJ2A 3FQUA 4J3VA 3ECBB 4Y5VC 3NCFB 4POUB 4WWKC 2GK0B 3PHQA 4L9LB 2FNBA 3GMOB 5GJSH 3QDGB 3U0PB 1ZANL 3E6FB 4FTVD 2D4DA 4F9PA 1ZHKB 1OM3H 2YR3A 1YECL 2HMID 1Q38A 5DI8A 3MUGB 2JCCE 3PGCA 8FABA 1CGXA 4GAFB 1RZJC 2YMXH 2GJ6D 4XHJC 5KSBB 5CZXD 2BERA 5EOQH 3KHOA 1WIUA 4LASH 4Y5YA 3GSNA 2Z35A 2XWJB 4E5XA 3U30C 3H0TB 4NZRH 5DHYA 2A2QT 1MH5A 4LPVA 2NQCA 4ZO8A 2B1AL 5DS8A 2JIXD 5F1SA 2NY5H 4Y19B 4LSTH 1X5AA 4JQVC 4TOYH 2MCPL 4QTIH 2UUDH 3R8QA 3VG0H 4M7JH 4OGAD 3TN0C 4PV8B 4KZEL 4A6YH 4UT9H 5FV2A 4CMMB 4PJ7E 1J8HA 5JIPA 5I1HL 1KB9K 3WNNA 2F15A 1S7WA 3FT4B 4WCYL 3MYZA 4OCSH 1KJVA 2EEDA 2ENSA 2HFGL 2YKLL 1M7XA 1B4JH 4HUMB 1HHIA 4M3JA 3FTGB 2D7PA 1T7XA 1KCVL 1QNZH 1Z6JT 3BEVB 3MV8B 4MA3A 4NKMB 5IQ9B 5DVLA 3K0WA 1OTSD 3JVGA 4JQIH 1MLBA 2CGRL 2FATH 4DUWA 4WFED 3SCMC 1R3LA 4JZNB 4Q6IC 4JFOA 1KIRB 4JFFD 4F2MA 2NTFB 5HJ3B 1QQDB 1DE4A 2ZUTA 2HFTA 3U6RB 1UWEH 1J05A 3P9MA 3WLBB 4H20H 4PJCF 4JFXB 3CH8A 4Z18A 1EZVY 3Q1SH 4WW1A 2YZ1A 3NIGF 2BVQB 1MRDH 1I7TA 2EXWD 4DW2L 3H2WA 2NY7H 3B3IB 4J6RL 5F1IA 1GGYA 4OZHB 4WW2B 4EOWL 4Y4KA 4UZGA 3FHAA 1J88A 1I8LA 1RMFL 2F5AL 1WTGT 4K23L 1FO0B 4XP4L 5LBSL 1NAMH 3ARWA 1LDSA 2WBKA 4HIEA 4MXQC 1S8DB 3IB4A 4PRAA 3G5YB 3L3HA 1FNSH 3UJJL 5EBGA 5KZCB 3ULVC 1N6UA 3WIFA 3OKYA 1KN4L 2X1QA 4PJIB 1VERA 2BXYA 4LMQE 4YR6A 5FIEA 1RUAH 1SM3H 4XNYL 5A2JH 3DXAD 2BRRH 2HJFB 1W0VB 2VN4A 1CXIA 2YUWA 1D9KD 4PRDA 4LAQH 4ZSOE 5HDQL 3HNSH 2F9BT 3OXSB 2A6DB 3V4UH 3KPSA 3BW9B 3OKNB 3TCLA 5D6DA 2YPLE 2CKBH 5J7CC 4L9LC 3N1GC 4PLKD 5DD6A 2FL5B 4HAFA 1FFOB 1HDMB 4JFDD 3KLSA 1T21A 1NH6A 2P8LB 5DD0H 4LLMB 4BZ1H 2VE6B 3PABA 1F90H 1HQ4B 3QI9D 5CP3H 4QRPB 3QHZL 1P7HL 5D2LB 3O9WD 3T4YA 5C6WH 3ZYJA 3L5WB 2VXVL 4OM0H 3L5JA 4OFYA 4S10A 5C0GB 1AH1A 2AK1L 1U95B 5HGHB 3ALXA 4JPIB 2ZKHL 2BDNH 1NEZG 3KXFD 1RUML 3REVB 4EUPA 2W9DH 2DJUA 3DUSA 5CJBA 3VXOB 1Z9MA 5IEKB 2HAZA 2DD8L 2GJ6B 3QDJD 1MCEA 3BKYL 3EJYD 2QSCL 5A3ID 3S3PA 2BHZA 5E08L 4M5YH 5JMRA 2ESVD 3H3KA 1DANT 5A2FA 5JHDD 2BMKB 3MRLB 4JO1L 4GFTB 3EYOA 5DQ9A 1VSCA 1TQBC 4DN4L 1UM6L 5I16A 5EU3B 4KHXH 1I1FA 3TT1L 3REWB 3FQNB 4MYWB 2NLJA 2WIIB 4AM0A 1TNMA 1UYWL 1YEKL 5ALBL 2FHCA 1SEQH 2WUBH 4ZTPH 2R8SH 3NCYP 5C0IA 3HE6B 4GUPA 2OSLB 1KPUB 5F7MC 3O3UN 2AVGA 3LQZB 5IVOA 3ARBB 5CILH 1LD9B 4PG2A 2X41A 5IJVB 1ES0A 2ZSWA 4PJHE 1CGSH 1M71B 3QXDB 4I3RH 2VLRA 4NRYB 5L88L 1V7MH 3MBXL 3SGEI 4XMKH 5T5FH 3QHFH 1X7QA 1H5BB 3RZWA 3U4BL 1ORQA 4PJDB 5CIPB 5MENA 3EHBD 4JFFB 2E7LA 3D0VB 2PW2B 4AEHH 4AIOA 5FCUL 1NBYB 4MAUH 4IS6B 4IMLA 1AXSA 1EJOH 2OQJB 4WW2C 2EEBA 3IAQA 3RWDB 5BZWB 2IPKA 3MLWH 4K7FA 2E27L 4BSWA 3E3QE 3QRGL 1JZ4A 1VACA 3CK0H 4HWNA 2R0KL 3MRKB 3QUZB 2DLTA 2YA1A 1AP2B 1HCVA 3CNKA 4JPKH 2EYSA 2A6KB 4NSKA 3K2MC 5LXGL 2ICWI 3QXTA 3BDYL 4M9OA 2Y23A 4HXBL 5F3BB 3HA0A 3MC0A 4P9ML 3T1FA 2Z0BA 4UB0L 2NR6D 4WJ5B 3KPNA 1XH3A 3MV01 5LWYL 5BZDB 4H1LB 4P2OA 3HKFA 5FKPA 1Q9WB 1TJHH 2X70B 3OB8A 5DQDH 5F9WC 5SV4A 3AUVA 4Z7VE 5GGTH 3QUMB 3GMNA 1EHXA 1MAML 3IVKA 3HUJE 1D9KB 3FOMA 4TVPE 1A6VL 4NZTH 5ISZB 5E03A 2VKXA 3NFNA 3TEUA 4HXAL 3MRMA 4Z7VF 3ZL4L 4GAYB 4GKSB 4JDZA 4JM4H 4L29A 1F4AA 2DQFB 1LO3L 2E9WA 4BZ2H 4D9RD 5F7FA 1A47A 4DVRH 4HUWA 4NRXB 2HVJB 3ZE0E 1I8KB 2DQDH 2XPGA 5DEFB 2ICWJ 1WBZA 4LIQL 3QI9B 4WI6A 5F88A 3O9WB 5E2JA 3ZTNL 2CRYA 3FN9A 5E8PB 1YDPB 1JK8B 4Z77A 1FGVL 3EJJX 4WHCA 2ZCLH 3ZE0F 3LEYL 4PGEB 4J3TA 4ENED 2J8UA 1N0XH 4U1SB 4N0FB 4OUUA 5IB4B 2B8OT 3LPFA 1MIEH 5D1XA 4Y4HA 2DLGA 4PRNA 1XGYL 5ID1A 2B4CL 4X80H 2W9LA 1I9EA 3FT3B 4WO4D 2NW3A 1VFBA 3SDDA 2ZCHH 3SOBH 3MA7B 2Z92B 3HE6C 1LP9A 5LG1A 4U1JA 4S1DD 4U7KA 3ARBC 3D1MC 5T3XL 4G80B 2P42B 1CT8A 3QFJE 5SWSA 3MRPA 1LK3H 3C5ZB 1U3ZA 1CVRA 1ZHLA 1T03H 1MFAL 1U91A 3DBXB 3T0AA 3RZCD 4RWYL 4YPJA 4Y1AE 4XPAL 2Q86A 1NL0L 1M6OB 5CKGA 3QIBA 4PGCB 3EO0A 1E28B 2MFNA 1XF1A 1AJ7L 4ZTOH 3N1PC 1ZA6B 1YEIL 3EGSA 5D93B 1GOFA 3VXPB 3WO4B 3LSOA 3CH1A 4EEEA 1QFWM 4G8IA 4JM2C 4L3EA 4UT7H 3C5SA 4OD1H 4M93B 3WHE1 4S11A 3AFLA 3IDGA 4KPHH 4EDWL 4HX1B 4NGHH 1J11A 4WV1A 5FYLL 3F62A 3UTZA 1C7TA 5IMLB 1J18A 3QUZC 3IDXH 2IG2H 4EI6B 4HT1H 2Y5TB 3KPRA 4GO6B 1A1NA 4GMTL 1KCUH 4ZOEA 3ARGD 4GRWB 5IW1B 4NNXA 5ESAB 1JRHI 3S37H 4N0UB 4OGXH 4HK0A 1TCMA 3RNQB 4R90H 2CKNA 2DBLL 5D7KE 1E4XH 3GMRA 4KTEL 5GZNC 1U6AL 2VH5L 2CUIA 1G9NL 5E4EB 3B9EA 4LCWA 2IBZX 1C1EL 4YHMH 3VFUB 4LVNB 4M5ZH 4Z0XB 3ULUH 2XZAH 4L4TA 4PJEE 1QRNA 4FZ8H 4R4ND 4BFEA 1G9ML 1GOHA 1BJ8A 3ZLQC 1F6AA 3TH3T 2HT3D 4YHYB 1LO5A 3BHBB 3ALWA 4NOFA 4JFZH 1KTLB 4TPRL 4PJEF 1NMAH 3QH3B 3VWJD 2DDQH 4YUEH 4Y16B 2IQAA 5DFVC 5ETUB 4UV4L 1NBVL 3V6OE 1L0XA 32C2B 3FAXA 1I7UB 5T1KA 2P44B 1IMHC 1I3UA 4P59H 2J88L 5F96L 2B39A 2QL1A 2PO6D 4PJFB 1HH6A 2H45A 5GGSA 4GMSH 4NQVB 4YGVB 1SY6H 3NAAH 5CFHA 5AG8A 5HY9B 2CIIB 1OQOA 2WBJD 2YPLD 3FOLA 4M02A 3VXSA 1LP9F 1GPOL 4PV9B 4K9EC 1YN6A 2H32H 4ZUTA 3MLZL 4GW5B 1NCNA 2VKWA 4OZGA 1U8IB 3UROR 3VGDA 2BFVL 3WKML 2VXUL 4M1DL 5F1NB 1D6EB 3DHMA 3FMGH 3VFTA 3EOTL 4D9LL 3GUTB 3MUY1 4FOMA 1CBVH 4P2QA 1NGQH 3V4PH 2DQJL 3OKKA 3TBTA 1EH9A 1H0DA 2VL5A 4QHLB 1F4WH 1FDLH 3HAEG 2O5XH 3AB0B 4LVHC 1Z9SA 4ZOCA 5SWZE 3ZT7A 4ZPVB 3C8KB 4NZDA 1OOAA 3C5ZC 4FQCL 1OY3B 1MI5B 4WO4B 1CYGA 4O9HH 4H5SA 5FA4B 5EUOA 1YNLH 5SX4H 2XV6B 4NRZB 5J0BA 1WWCA 5IESL 4XP9H 4ERSH 3MRBB 1RZIB 4M8VA 1D7FA 5F9OL 6FABL 1T2QL 5DYOB 2QQLH 3DVFA 5DRZB 4U3HA 5D93C 3DARA 1QO3A 1WF5A 1XT5A 5IB1A 4XVSL 3RZCB 1MFBH 2X4UB 43CAA 4XTRD 5IBLD 4LLUB 1DLHA 1MJ7H 5FUOH 5I2IB 1AQKL 3V5KA 1SJHB 2MSPA 2YD6A 5D6CB 4ZFOB 2AJZA 1VGEL 3GSUA 1WC7B 2VIRB 4OSUL 3ARED 4F58L 3M07A 4I77L 4HK3N 4UDTB 4BM7A 3L3KA 1AC6A 1D3CA 3EOBB 4K8RD 1YYLH 5FHBL 1X5LA 4LSSL 4PJCB 4RMSA 3D87B 2NXYD 1X4ZA 3U36A 1BZ7B 5E4EC 4QGTA 3CAFA 3BP6B 4FMKA 4OZFG 2DQIL 5E5UB 2VXQH 3ARGB 2YD7A 4W81A 3DGGA 5E5RB 3SY0B 5DD3H 4U6YA 3IDMB 3CMGA 3FFDA 2AS5M 1A1MB 3S3JA 3TIEA 3VMNA 3D6GA 3L3GA 1BIIA 5EBMB 4YHYC 4XH2B 3RL1B 3DUUB 1YC8A 3B9KB 4JN1L 4HMCA 3O2DH 1UWGH 4HWBH 3S5LA 3MACH 4JO3L 3MYJA 3GKZA 1NC2D 4F57H 4Z0BL 4Y16C 4LF3B 3PP3H 4HH8A 4QHKJ 5HHOA 2QSQA 4U0QB 4LSVL 4K07A 4HG4J 5D1ZD 5BXFA 4F15B 5HPMA 2KH2B 4NQEE 3MCG1 3VRIB 8FABB 5MI0B 4OD3L 3UBXA 1WT5A 3VWJB 4J3SA 4Q9CA 5GHWH 5IFAH 5IR1B 1PZUB 3WFBL 3OKMB 4Y5YB 2CDGA 3GSNB 1JGVH 2Z35B 2ICES 3K74B 2DIJA 1GOGA 5CZVH 1G0DA 4GSDL 1DBKH 1TPXB 5DHYB 5F7WC 1X9QA 1MH5B 4NQDE 4P5MB 4TVPD 1YQVL 1BFVL 4P4KD 2OZ4L 2YPLB 1Y6NR 3H9SA 1VEPA 3HI6L 3IGAA 3SN6N 1UVQA 1IAOA 3GRWH 1CD0A 4ODUB 4PREA 5KANG 4BELD 1J8HB 2G60H 5DXWA 2P5WA 1EHLL 1G9EA 2C7UA 1KJMA 1OAKL 2R0ZH 1GZPA 1WITA 2QLVB 3TCXA 2VUYA 3PIQA 5JUEL 2XY2A 3S36H 1TFHA 2VLJE 4AJ0A 1X44A 4N8CH 3E0GA 1YC7A 4MA3B 5FO8A 3EO9H 3OKDB 3BWAA 4JKMA 5F93C 3O45A 1AO7D 3MRFA 5TGBB 4KK5D 1Q9LA 4AEIL 4HIHB 1R3LB 2BNQE 4JFOB 3QDME 4WHTA 1H8SA 4U49A 5DC0A 1LEKB 3TP4A 2V5YA 3TLRA 5IROA 3S6CA 1VB9A 1ZT1A 5CWSA 3VFGH 5B4MC 1J05B 3C9NB 3ABZA 2YSSA 3E6HB 1I7TB 1HZHL 3D0LA 3VFPB 4UOW1 3DURB 3QFJD 1L0QA 2HT4C 2F58L 3H3PH 5IHUH 3GGWA 1GC1L 1LNUA 3NA4A 4RMUA 1NUDA 1QSFB 3PXHA 4ELKB 2J6EA 2CPCA 4Z78A 2AJYL 1SBSH 1CGVA 4Y1AD 1ACYH 5FYJE 3SE3C 5EN2A 3SE4C 2FO4B 4WGWB 5FHAH 1J0ZA 3LMJH 4PRAB 4QYOA 5CJ8A 5ANMA 2AEPL 2BSTA 4F7TA 3WIFB 4EDXA 4YR6B 1YUHA 4KROD 3PWJB 1CLYH 1W72A 1A3LL 3K4ZA 1FZMB 1I3RA 4PB9L 4ORGA 2HKHH 4Y7MA 3D25B 3B9KC 1U8JB 1QBLL 2DQCH 4P5TA 2YWZA 5GJTH 3TNNB 5C0RH 1F2QA 4HS3B 1FSKC 1U9KA 1X5FA 5CUSL 1IFHH 1QYGL 5I1GH 3UBXG 1RHHA 1RUQL 1VADA 4HQQH 1NFIA 1U3HD 4F15C 5JW5A 4QXTA 2Y7QB 1NCDL 3C2AH 2OK0L 5D1QD 3HMXA 3P9WB 2B1HH 3JWOC 1AD9A 5I30L 4K55A 5LAXB 4Y5YC 4RISL 5D1ZB 1MQKH 4RFEA 4X8XA 5IW6A 4FQ2L 4XP6H 1BZQK 2PR4L 1TPXC 3VXNB 5H35A 3GMPA 1B6UA 3LIZH 4M1GL 4F7EA 4PJXA 1TLKA 4DKFL 1A4JA 1CF8H 5I8OL 4M43H 1PKOA 4OCXL 3O6KL 4G8GE 5C09D 1MQ8A 4WY7L 5CJOL 3OJ2C 3Q48A 5DQ9B 4OLXL 2IFGA 1OSPL 2Z8RA 3RBSA 3C60A 1KGCD 2PYEE 3MXWH 3EDDA 5T1MA 1I1FB 1N2RB 2NLJB 4AM0B 5D7IA 3LS4H 1A7QL 4XNZB 4U6VH 3A67H 1AIFA 4S1QL 1I1RA 1CICD 4WNQA 3PV6A 5DHXB 4K3HA 3QEGL 4LSPH 1G7QB 4N90D 4GUPB 3FO0H 3JVGC 5DK0B 3VWKA 5C9KA 1AI1H 4M1CC 1M05A 12E8L 1I75A 4XRCA 1F4YL 1IEAA 3ZT5A 3FFCE 1QOKA 1YNKH 4OT1H 1HSAA 3TBSA 3CZFA 4YBLC 1IC5H 4Z7NE 2CLVA 4M62H 4Z7UA 3X11A 3SDXF 1ES0B 2ZSWB 3O0RH 2GIYA 4UU9A 4ORZC 2PUQT 1AO7B 4YXHH 5HYJE 3AMLA 1WZ1L 2NYYC 3OAYK 4HPOL 4GOSA 5GISL 3X3FH 2VR5A 3INUL 4P99A 2VLMD 3GBML 5SWZD 4IMLB 3UYPA 4M6OH 2JJSA 1JGEB 1C8PA 4Y4KC 1Y0LA 4QY8A 2IPKB 4K7FB 4BSWB 2VQ1A 1I8LC 1YEHL 5DRXA 3IKKA 1SEBB 3X17A 3BUYB 5JO5B 1VACB 4G5ZL 2ADFH 1ZA3A 2NY1D 4PP1D 3GBNL 4K7PH 2JK5A 4ZYKA 1S78D 2EYSB 3ARDD 4NSKB 1FP5A 5L6YL 3MNVA 1CD8A 4KJPC 4Y1AB 3T1FB 1UJ3B 4OZ4B 3LAFA 3QNZA 3U82B 3I9GH 4PGDB 1XH3B 2WWKT 3MLVH 4KI1A 3GMMA 2WIMA 4L8SA 5I73B 3ULSA 4H26B 4JFYA 4P2OB 3HZKB 1CR9H 1RZJH 3CFIC 5D6DC 5TQ2L 1HNFA 5T5NF 1EFXD 3IVKB 5AEAA 3L3JA 2V2XA 4PJXF 2H2PC 1EAPA 3EDEA 1DZBA 1KG0B 5AZ2H 3NFNB 4NFBA 1SYVA 1IGCH 2CO7B 3MRMB 3L3DA 4NIKB 3MODH 3ZKMC 2FGZA 1IC4L 2WWKO 3G6AB 4E41E 2EDTA 1CFNA 1NQBA 3O2WH 1YZZA 3BH8B 4HH9A 3ESVF 5T3ZD 2C1PA 1MCCA 5D1QB 3P9LB 2H2SD 1JIBA 1NGXB 2BSRA 3K2UH 5H2BB 3NTCL 1FYTE 5MHSE 4PJEB 4TTDD 1IGIH 4UIKH 4RSVA 4O2FA 5E9DE 4YH6A 1IC7L 4L4JA 2DJSA 3VI3E 1G1CA 4OCLC 3PNWB 4UUJB 4OUUB 5IBTH 4K3DL 5ACMA 1CQKA 4OGYH 5IVXA 5D1XB 4Y4HB 4NQED 4PRNB 4XCCH 5JPNB 5C70A 1KEMH 5C09B 3WN5A 4XNZC 4UMGA 2ITCB 4OZIE 3GJFB 1D5BA 2DI8A 4I0KA 1GGBH 1LP9B 2XKSA 4R2GB 4HV8B 3QFDB 1A7NL 4NQDD 2PTTB 5IT2L 1CT8B 1S7RB 4PG2C 4PRPA 4OZIF 2FH6A 3L9RA 1CICB 3C6SB 4AT6A 3Q6GL 4R3SB 1OPGH 4YHKH 4NZRL 1U91B 3PHOA 3LS5L 1FJ1A 5ADPL 4HS8L 4U3CA 2VLLA 5GS0C 1UB5A 2VZ3A 2Q86B 2WINA 3GMQA 3WEXB 1Z3GH 2K7PA 3QIBB 3OB0K 2E7LC 1AKJA 1B90A 3MLPA 4QWWC 4Y2DD 2VLJD 3PDDA 1JZ2A 4R96B 5DUMH 4L3EB 3C5SB 5T33H 1T1WA 1NC4A 3IDGB 4HIXH 1UXSB 3RI5F 4QRRE 5EOCH 2N4IA 2XNAA 4JY4A 4P57A 1U8HB 2NX5A 4LDEB 2BNQD 3VH8G 1M7DA 3QDMD 1XF4B 3AU1A 4XPBL 3MOAL 2DIBA 3KPRB 1A1NB 1FO0L 5EO9B 1WBYA 2GEEA 2ZOLB 1KTDA 3DSFH 4J4PD 2APVA 3F7VA 5DZLA 4KUZL 4HK0B 4LHUA 4F33A 4CVWA 2EH8L 3OF6A 3RFZC 5C0AE 3RWFA 5C9JA 5HTSA 4XC1L 4XP5H 2HH0L 4P2OC 5IMMA 1R5WB 4L4TB 4OKDA 4DFIA 1F6AB 3KPMA 1HHKB 1ITBB 1FNHA 4YQXH 3T77B 3RPIA 2HJKA 5FYJD 9CGTA 4KVCL 3THML 1JNLL 1T20A 2A0LD 4KJWD 4QKXB 4MS8D 5IV2B 2VAJA 5TDPB 1GSMA 3LPGA 4C56A 2IALA 5T1KB 4FQHB 2WWMC 4I0PA 2VR9A 5E1AA 4JHBA 3DO3A 1WIPA 3PWLA 5E56A 5B38B 1HH6B 5FFLA 4BQBA 1A6ZA 1Q9OA 2V2TA 4KRPB 4OFIA 4NN5B 1RUAL 4YC2C 3KDMB 2QQNL 2BRRL 2AERT 3FOLB 3VXSB 3WFCL 3TWCL 1URLA 4LBEB 3ORJA 1YN6B 5GGVY 1T04A 4N8VG 2VZOA 4MNGA 2BJMH 5D5ME 4FZEL 3CCHA 2F8VA 2C4FU 4LCIH 3ARQA 2R2HA 1G6RL 2AXGA 4LHQB 3UZQA 1G7PA 5D1XC 4Y4HC 5EU4B 3VFTB 1PD6A 4V1DA 4RGOH 3WIIL 2QTEA 4RMVA 1CD9B 4MJ6A 4P2QB 3G5XA 6CGTA 1YMHA 3TBTB 3SDDC 4F8TA 5CD3A 5CJXA 4GH7B 4NBYB 3WL9B 4XWGL 4R2GC 3QAZC 1FBIL 2EH7L 2HA1A 4PY8J 2VC2H 1EA9C 4OM0L 1TENA 4HKXA 1R5IA 2BOBB 1J0YA 4G8GD 4QHMA 3HC4H 3QCTH 1KXVC 5K9QG 2A9ML 4P2RA 2DQUL 2B5IB 1LQSR 1FV1B 5LCVL 3AROA 1XR8A 3MJ7A 1N8ZB 2AV7A 4I9WE 3MROB 3LKSB 3QIBC 1P7KA 1UACH 3BAEL 3UTSA 4HJJH 1P69B 3JTTB 2YPVL 4GXUN 1QO3B 3K8KA 4YNYA 5I74B 3N1FC 3S7GA 3E8UH 4WDIA 5IB1B 1OW0A 1DQLL 2E6JA 1BBDH 5I1KH 4APQD 2JB5H 3ZKXB 2IANE 2D7NA 4NYLA 4NNYB 4GW4A 1EDQA 4Y2DB 2VLJB 5JPMA 1V3MA 3G5ZA 4ZUWA 3CFBB 1ZGLM 5CEYA 1T89A 3SKJL 1H9VA 4CGTA 5HYJD 5DFTA 5J57B 4HLZG 4J23A 1B2WL 3HPLA 2ZWLT 3U36B 2VOTA 4H0HB 3MRIA 2BOCB 4X98B 5BMFL 2W1NA 5DR5H 1ND0B 5CHNB 2LV4A 2EECA 2JJVA 3QHFL 4ODBD 3BSZL 3DGGB 4U6YB 1A9EA 4OFDA 3TIEB 1FZOA 2IPTH 1MRCL 3DLQR 3MLUL 5HI5D 3BN9D 3L3GB 4HC1H 3D69A 1QSEA 3V5HA 4ESKA 1QFWI 5J6HB 1IGJA 3WNLA 3QUML 1HHGA 4IMKA 2UZIH 1R3HA 5DHVA 1A7PH 2Z4QA 3QEHA 1GVIA 2IJ0C 4R8WL 1IAIL 5ICYA 5AD0A 2DMBA 5GGRY 2RFXA 1P4BL 1CLZH 4R4FH 3H7BA 2H1PL 5BXFB 1PY4A 2YOCA 4L5FL 4JPKL 1HKLL 3FO2B 3F8UB 3GSRA 3T08A 1J5OL 2ZUUA 2Q3AA 3HR5B 5EUKB 4KRPC 1N64H 3HI5L 3RL2A 3VW3H 1F3JB 2W0PA 2OL3B 1DN2A 2Y72A 3NFSL 3N50A 4GBXD 4LKXA 4BH7A 1CGUA 1IBGH 2FBJL 1W0WB 1TJHL 3TBWB 1JPSH 2D7TL 5CBAA 2X4OB 4G7YH 3ARYA 4ALAH 3BKMH 1KJ2B 4YHPB 4OCWH 4PJ8A 3WNKA 1C16B 3DECA 3S35H 3IGAB 3MRHA 1UVQB 2PXYA 1IAOB 4NQCD 4JKLA 2AQ3A 2A6JA 2C3VA 5F89A 4PREB 4E41D 2DLIA 4FG6D 5KVGL 4PUBH 2P5WB 5GS2H 4FQJL 1MVUA 3P0YH 1GZPB 5B8CA 4Z5RB 3TBYB 4LEOA 3PIQB 1JTPA 1HEZA 3WSQL 1OWRM 1FYTD 5MHSD 2YZ8A 2XA8H 4O51A 1WAAE 4W6XB 3IS1X 3MRRB 3O45B 3SDYH 5E9DD 5F8RC 3MRFB 4LU5L 3PGFH 5EOTB 2B5IC 1Q9LB 1S7VB 2DIAA 2F19L 2G5RA 4UV7H 5HHXH 4P5KA 2UWEA 4OCRH 4NUJB 4WHTB 3V5DA 1JPFA 5C2BH 1WAAF 2YD1A 2AJ3A 3BFOA 1PG7L 5C07E 5F8QC 4UILL 5SX5K 4CKVX 3L5XL 1FGNH 5C3LD 5EPMA 2VDRL 3NABH 2YSSB 5B39G 4XMLL 3BZFA 3ZKXC 3P40A 1UM4H 1EVUA 1O7VA 3GGWB 5IIEB 4PJGA 4LSQH 3RBGA 3QZWA 3RAJH 4H1LH 3SDXB 3B83A 3KPSE 1AR2A 4KV5E 4NQXA 4PRHE 5K59E 1NANI 4NC2B 1T03L 2APXA 3UJIH 2ZUXA 1X6LA 1UH2A 4MA7L 4MJIA 1I9JH 2EYRA 3LDBB 4QYOB 4X6CE 2J4WL 1NEUA 4F7TB 3O3AA 4EDXB 4XXDB 1ADQL 4KKAC 5JW4M 4G6KL 5K59F 5KTEH 1TETL 3OXRA 1LE9B 1W72B 3CDYA 5I19L 1I3RB 4QRRD 4ORGB 1K5NB 4NC1C 2YXMA 4X6CF 4XCNA 2K3TA 2E8ZA 2XTJC 2AQ1A 3O3BA 2M8XA 3BZ4A 1T83A 1AFVL 1YQ2A 4NWUL 1EO8L 1QPPA 4K9EH 4R26L 3QG6B 1OAQH 1RHHB 2HFFA 4O02L 5IHZA 1QLEL 2VRAA 5JW5B 3C5JB 2HLFD 2D2OA 5C0AD 4S1RL 1WTLA 3RGHA 2VUOA 1H3PH 4PBVC 4WFFD 1WT5C 2EDWA 3TYFA 5ESQA 3S37L 2P7TA 4AEFA 3NGBB 4JFPB 2NZ9D 3LD8B 5GSRA 3UO1H 5IW6B 4YHML 1CG9A 1YJDC 1ZAGA 2RJMA 3TGXA 5FM5M 5IQ7H 2Q76B 3DETC 4AIZA 4F7EB 2ERJB 2QKIA 4PJXB 2XZAL 4Z7QE 4EQ2A 1WBXA 1MIML 3KR3L 1RI8A 4TSBH 4GBXB 1XGTB 2VSDA 1TCRA 3FL7A 4JFZL 4PS4H 4Z7QF 5AG9A 1OB1B 3C60B 3MCKA 2VLRE 3JV6B 5FGCB 3R06B 3C08H 4OJFL 1I3VA 5K9KA 1CTNA 4WNQB 5BVJB 5IF0A 4FQIH 2P24A 3QUYA 4NQCB 1HILA 4E41B 1BM3H 1OT1A 4H88L 2X1PA 1EO7A 4XRCB 1MHPL 4LVEA 4GMSL 1IEAB 2OJZH 1T22A 4NO5A 5TH2B 5CP7B 4HJ0C 3PWNB 4KK9C 1HSAB 4ZXBA 5I8KL 2CLVB 2NY4D 1RVFL 1FYTB 3X11B 4TULL 2WUCH 4UAOB 3W39A 2X6MA 5IROC 4UU9B 1NGPL 4ZO7A 1I4FA 4LVOB 1UADC 4MXWH 4Z95L 1PLGH 4NZUL 4BSVA 1Y18A 5GRJL 4O5LH 4GRWH 1V3JA 3ARFD 5D72H 2AK4A 1T2JA 1NGQL 4YHLH 4JR9L 5JNYA 1A9BA 2H9GB 1S9XA 3B2UD 4OZIB 3O6FD 1FORL 1AGCA 2G2RB 3IDYB 1F4WL 3VRLF 1VFAB 4QY8B 3HLAB 2VQ1B 5DRXB 4NM4H 4UOJA 2J8OA 2VDOH 4N0CC 1ZA3B 1YYML 5CCKL 4I9WD 2IAMD 4PRID 3N1QC 4ZYKB 1K4CA 3LDBC 1RQ5A 3GJFK 5KG9A 3MNVB 3QUKA 1ZKAA 4RX4D 2LQRA 1S7UA 4AH2A 4NKOA 1FVDA 4P3CL 1FAKT 1D5XA 3QWOB 4X4XA 1ZLVH 1B0RA 1SHMA 3QNZB 4O2EA 1KPVB 1Q72H 1WQVT 4XVJL 3ULSB 5KW9L 4P5TC 4JFYB 1JGLH 5I8EA 4NP4H 2ED7A 2DTSA 3EW3B 5I1CL 4JY5H 5ENWA 4I8DA 1UCBL 2IGFH 2V2XB 2GCYB 3MJ8A 3S3SA 4NHCL 3V7AG 4U1KA 2A83A 5BVPH 4U1IB 1RK1B 4FXKA 3L3DB 1VFMA 4B53A 1T0MB 1F3RB 3B4NA 1LEIB 3NGBC 4FFZH 5JIIA 3TPUA 3F6LA 3PL6A 3LD8C 1CFNB 5C7XL 4X7CC 1T66D 5GGVL 3U1SH 1N4XL 5C0AB 5C6PB 3L3IB 1TJIL 4XGZA 2C1PB 5KAQG 3ES6A 3NPSB 1NSNL 3U46A 3M45A 5F6IC 3TJEH 5C0CA 4KJQC 2IMNA 4O2FB 1HYSC 4KKCD 5ITBH 3GHEL 5E6IA 1JYVA 3BZDA 1IGFH 3V4VH 5IVXB 4JE4B 3C60C 5TE7H 1JF1A 3V6BR 1ZEAH 5GRZA 3RWCA 1XCTA 4G9DA 4HJGB 2Z91B 3VDBA 3VFMA 2R1YA 4MVBD 1KENL 1U42A 3VXTA 5DVKA 2GUOB 3VWKC 1J0KA 2NXZC 4LDOB 4PJAE 1I8MB 4P46D 4BFGA 5KSUA 3BP5A 3DMMA 1S5IH 1KUMA 1PVHA 5DJ0A 4M3KB 4DAGH 2VSCA 2Q1EA 4BYHA 2NNAB 1PY9A 4P9HC 4UAOC 4AT6B 1ZT7B 5JZ7D 1DBKL 3DV4B 3MO1A 4GW1A 4PJAF 2GTZA 1EK3A 2BHYA 4OIAA 3RWEA 1QVOB 3BIAX 2R39A 4JREB 4LLYB 3BJ91 3GMQB 4Z7WA 2H26B 1DSFL 1JYNA 3BD3A 4X4YB 7FABH 5IVNA 5GQBA 1WISA 5GSVA 1GZQB 3QG7H 4R7DB 1MWAA 2JJSC 3KWWA 5IWLA 1ORSB 3IDYC 1AXTL 1INQA 3RVVD 3KYOA 1T1WB 4LLVB 1NC4B 1JL8A 3AMKA 1LDPH 2DS4A 3ARFB 2XNAB 3IU3A 5CJQL 1QRNE 5GRUL 2NX5B 5FO9A 1XF2A 4FABH 1M7DB 4NUGL 1OF2B 2IQ9H 3AU1B 3CVHL 4RRPA 5M94B 4POZC 1BWWA 2XN9E 2D0FA 1WBYB 3CXDL 3TFKD 3MOBH 4PR5A 3R0NA 5C08A 1CFSA 5C07D 4F9LA 2R4SH 2VZVA 3D39A 1C12B 4LKCA 5ICXB 1NCBH 2X9XA 4LHUB 4F33B 3RWFB 5C9JB 4K8RL 3IDIB 4PRIB 4L8SC 2ATKA 4P49A 3ARRA 4P23A 1KBGL 4JFEA 5KVEH 4XC3L 4NKIL 1RZGB 3FN0H 3JWOH 2GAZA 4TUOA 4QXWA 1RULL 4LNRA 4PRHD 4M7KH 3H3PL 2P8PA 4RAUA 5IHUL 1KJ3L 3RPIB 1JPTL 1TZIA 2HJKB 3GI8L 3QUXA 3DOSA 5JQ6L 3P73A 2FD6L 1OQXA 3P4NA 4OZGE 4RMRA 4XNMA 1BOGA 1NLDH 5EO1B 3WUWG 1C5DA 4YEEA 3MGOB 3RTQA 5FECA 4FFVC 1YEJL 4C56B 4JPWH 4KVNL 4GG8A 3LEXA 4I0PB 3ZDXE 1J1XH 5KS9A 1TZGL 4KJYA 1CZ8H 1TZHB 1U93A 4X4ME 4JDTH 5DVMA 1A6ZB 4PJBE 1FRGH 3NPSC 2V2TB 5HI4C 4XI5D 1DL7L 3MLXL 4MNQE 2VDQH 3RGVA 3ZDXF 2X7LB 1JRHL 2WBWB 1EVTC 1SYSB 2BVOA 4K3EH 4BKLA 5K9OB 4XZUB 2MHAB 1FG9C 1I1AA 4PJBF 2AXGB 4QOKA 5EUOE 3TBVA 1C5CL 4WHDA 3BGMB 1DBML 2IH3B 4V1DB 4ZUUA 3WN5C 4L1HA 4MJ6B 4TVPL 4ONFH 4L8DB 2EYTA 5CD3B 3T0ED 2B2XL 2FB4H 5KSAA 4X6DA 3JXAA 3DVGA 1H3UA 3QQ9D 4XXCA 2IH1A 2DF3A 4G9FA 3BE1H 1ZGLA 4QHMB 4CADA 4ZO9A 1EFQA 4P46B 3UYRH 3TH4T 3MXVL 1ZHNA 2I5YL 4MQTB 2I9LA 1XR8B 4GQ9H 3MJ7B 4HS6A 2AV7B 4L9DA 3ESUF 2VDNL 1P7KB 3K80A 2FZ3A 4OQTA 5IB2A 3VG9C 1H3VA 1TMCB 4N0RA 1UKTA 4KQ3H 3CX5J 4WVRA 5B3JF 4DGVH 3DRTA 3QQ3B 3QRFM 2HKFH 1JMZA 2DQTL 1R5VB 4RRPG 5FDYA 1Z0MA 3A67L 3DJ9A 4NCDA 1KCLA 4IDLA 2XKUA 4HF5L 5B21A 3V0VA 3CD4A 4JRXA 5CEYB 1GH7A 4YWGL 4WUKH 4POYA 4G6MH 1Q0YL 4D0BA 2XZCH 4Q9QL 3HPLB 1JHLH 5I1EH 4ZNEA 3CFCH 3U4EA 2R4RH 1NMCC 1OAZL 2D9QB 4MX7A 3W9DA 2RGSA 3DTXA 1A9EB 2EDKA 3K8MA 2V2WA 4UT6H 1FZOB 1QFUH 5SX5H 2EE9A 2GT9B 3BRDA 3TVMD 1SJEA 5KN5A 1HOCB 3D69B 1OAXH 5FA3A 1KB5A 1QSEB 3V5HB 1MAKA 2FEDC 3IU4H 4EUPH 3HNTH 3LH2H 3MA9H 4Z9KB 1R3HB 5DHVB 4JFQA 2OP4L 3BPOC 1NCCL 2AKRA 2RFXB 5EA0H 5CEZH 1T0NA 3H9SE 4I0PC 5INDB 4JZOA 3A6BL 3QO0A 3S9DB 5DO2C 1RJLB 2RR3A 4FQXA 4KY1H 4UBDD 4X6CB 5C3TA 4YE4H 3I75B 3RL2B 3P4LA 3QXUA 4I13B 3S36X 3D48R 3GSXA 4MXVE 4RNRA 2KBGA 3KJ4B 1MCDA 1L7IH 4X6DF 1WFNA 1CL7I 2Z31A 3LKNA 2OZ4A 1BP3B 1F11A 4KHTL 4N5EC 2Y25A 4M6NH 3JTSB 4P3WA 1IAIM 3I6LE 4JHAL 3MRHB 1G0XA 1JUFA 2VDLL 3O3DB 3BIBX 4NN7B 4OLUL 1FPTL 4ODVH 5F89B 5CJXC 3KNBA 3NZHL 1IGCL 3Q2CA 1JZ8A 2X9YA 3QIWD 3GHBH 5L8JB 2AAVA 1AY1L 1MVUB 5GS0H 1K8IB 4NM8H 3BT2H 1WLHA 2DI7A 3F7RA 2EE6A 1LWRA 4JCLA 1BGXL 2DQHL 3T0EB 3QJFA 4XPGH 4JB9H 4N68A 4TQEH 3LKQB 1IM3A 1VFUA 4P5KB 2IPUK 1IGIL 1FFPA 2DQEL 3D2UD 5I8CA 3BGAA 4BUGA 4JHWH 3BQUA 1OW0C 3VXUA 3CLEL 2IFFH 2E9JA 2FIKA 2UZXB 5D7SH 4QT5A 3FB5A 2V7NA 4MJ4A 3ILQC 3WFDH 1JNHA 2VDMH 4M6AA 4XCCL 5HXMA 1OVZA 5EBWB 2DOCA 5BCAA 1KEML 1PZ5A 2FX8L 4QRQB 4Q0XH 4FNLL 1J8KA 3BZFB 4PJ9A 4YGAB 1QFOA 2FX7L 3QZWB 5GRVK 4FFWC 3PUCA 1J10A 2IBGA 1T89C 1BPVA 1R3JA 1G6VK 2AQ2A 2KKQA 4G3YL 4LQFL 4B7IA 2DICA 4F7PA 2QQKH 1CGTA 1EAJA 4PY7B 4RFOH 4MJIB 5J12B 3BP7A 1D5IL 1DBBH 3SO3B 3PQYA 1JNNH 2DYPB 2F5BH 4ZOAA 3B9AA 3U9UB 3OXRB 2F53E 1OTUC 3NN8B 4L4VA 2OS7A 3G5VA 4C57C 2W91A 2FSEB 4GT7A 4KKLC 1T6VN 3VFVA 4HZAA 3U0TA 4IMKC 1CE6A 5IB3A 3NFPA 2RCSL 4OIIL 4YXLH 2XN9D 1AHWA 4M7ZC 5FUZL 1I1YA 1KEGH 3TVMB 1N7MH 2CIKB 2HFFB 1BFTA 2QHLA 1LK2B 5IHZB 3ZSSA 5K9JL 5LGJB 4XBGA 1PDKA 5DJ6A 3QWRA 3IJHA 1JGDA 4MB4A 4YDIH 1RD6A 1KLGA 5L2KA 2Y07H 1OGTB 4ODXB 2CR6A 3M8OH 2GSIA 5D7IE 5KJRH 4KMQA 5GSRB 4MMXC 3RA7H 4BSJA 1YNTA 3KJ4C 1CG9B 4I2XE 2VZUA 5IGXH 4XP5L 3CLFH 3EAKA 2L4OA 3QXWA 1U0QA 4LCYA 4RGNB 4Y4FA 2A74B 1BLNA 1WBXB 2HTLC 4LSRL 2XZQH 5T3ZL 4PJ8C 3MLRL