3G9VA

Crystal structure of a soluble decoy receptor il-22bp bound to interleukin-22
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
197
structure length
173
Chain Sequence
LKPQRVQFQSRNFHNILQWQPGRANSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIIEQKVYEGAHRAVECVVAEIYQPMLDRRSQRSEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Interleukin 22 receptor, alpha 2
publication title Crystal structure of a soluble decoy receptor IL-22BP bound to interleukin-22
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 173
sequence length 197
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g9vA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g9vA02
4MHHI 1FZOA 4YBLC 2R4RH 4ISVB 5C6PB 3TT3L 4AT6A 4PB9L 4WCYH 1L7IH 4GW4B 4XBPA 1AY1H 5HJ3A 4ZFGL 1HWHB 4OIAA 4FFWC 3AFLA 1UM5H 3EGSB 1DQMH 4APQB 1H0DA 1KGCE 4YGAB 2NXZB 5L88H 3FOLB 2E27L 5FYJU 5C70A 4LIQL 1CL7I 3IDIA 5C0JA 4XP4H 4YQXH 4F7MB 3EYUL 5EU6B 4QTIH 1PSKH 2B5IB 3MV9D 5EU4B 4Q9QH 2L4OA 2I60L 5C86A 1PDKA 2FBOJ 4HPYL 2K3TA 3FT3B 4DZ8A 3W0WA 4ZFFA 1NMCC 3IXAB 4W6XB 1XF1A 4I0CC 3VCLB 3V7AE 1YY8B 4QRPA 2CGRH 4ZO9A 3JWNC 3JVGA 1NGZB 4GRLC 2G5BA 3EBAA 2H32A 1O5DT 2IANA 5D6CB 1LO0H 2W0PA 4LOUC 1BIIA 3IAGC 1OCWH 4RWYH 3MJGX 4LCUA 1AE6H 5E2VL 2H1PH 5C09B 2D7TL 2X4TB 3RZCB 5KG9B 4DUWA 4PJAE 5F7EH 4LLWA 3IJSA 3KPNB 4UBDD 5LBSL 5C0CA 1JPFB 1RZ7H 4QXGH 4MQ7A 1MNUL 2IBZX 4OQTH 2PTUA 1WWBX 3D25B 3QIBC 1YEFL 2LU7A 3O11A 2O5YH 5SWSB 1N5YL 4UINL 3ZKMC 1K4DA 4HJJL 4M7ZB 5DMJB 2FO4B 2CH8A 1IM9A 2QQKL 5IFHL 5EIIA 5EZJA 2RGSA 1FVEA 5I1JL 5D7LA 2BNQD 4MNQD 5C08E 3V7MA 2ZSVB 2B1AL 4DCQA 5IFJA 2DQHH 4LRIC 4Z7UA 1L0XA 5K9OA 4HCRA 4YHNB 5H35B 5KJRL 5IFAL 4MX7B 3K0WA 3LS4H 4NKOA 1TVDA 4X4ME 1NJ9A 4OZIE 5SWZE 2J6EL 3G08A 3OAZH 3QWOA 5FUCC 4AH2B 2ICWA 4PJXA 4MA7H 1IC5H 3BIBX 4JFZL 4JFPB 3F5WA 4L8BB 3PL6B 4MAYD 2GTWB 4X9HA 1GZQA 5DUBB 2AVGA 3FO2A 4TTDC 1PG7W 3UTSD 5MEND 3KPLB 5D7KD 2NY6D 5J6GB 3X13B 1VFMA 2F74A 4GLRI 4IM8A 3CXDL 3WLBB 5FYKD 3PWVA 4FQ2L 4NWUL 3TNNA 1IAKB 3EUUA 3PQYB 3D39D 4G80A 3WN5A 1QHOA 4LEOA 4JZJC 3HLAB 1MCPL 1F13A 3LAFA 1ZGLM 4WO4A 1BQHB 2XN9D 3OKOB 3HR5B 4Y2DA 1WC7A 5D7IA 4PJDF 3ZE1E 4EI5D 4FQHA 4NJAL 4RRPG 4NQUA 1CQKA 2VLME 35C8L 4OGAD 2ARWA 3WS6C 1QSED 4M6OH 4HFWA 2EDEA 1WTGT 4PJ9C 3O81A 5F8RC 2NCMA 4FTVB 2XTJB 2PTTB 3KVQA 4JY4B 3BWAB 4P4RB 3WE6B 4Y5VB 3LV3B 5BV7B 1H8NA 4YBQD 1BD2D 3T65B 2P7TA 4NCC2 3CLEH 1VFBB 1TZHA 4F8TA 4JLRB 5C0RL 5KSBE 1TPXC 2OR8A 5JOPD 5GJSL 4BK5A 5DEFA 1INQA 1EBPA 3GEWB 3HUJF 2VIRA 4PUBH 2CXKA 3VD4A 2J8OA 3SDCD 4HULB 4GBXC 4Z78A 3GUTA 1EHLH 4P57B 1MCQA 2GJ6B 1A6AA 4JHAH 4QOKD 2YD3A 4ETYA 1ZSDA 2XTLA 3NFPB 4YPJA 3VW3H 4U6HB 4P23C 1WCBB 4M9PA 4OCMC 5CBEB 1FJ1B 3I2CH 5T1KD 1KG0A 4PGDB 1PD6A 4LKXA 4P4KA 4XPBL 2NX5B 4KDTC 5KSAC 4JN1H 5INDA 5I1EL 3BRFA 2DYPD 5BVJB 4AK1A 4PB0L 2DQEL 5D2NB 1S8DB 3R1GL 5TFSH 4NQEE 1EEQA 4XBGB 2IWGA 4UTBL 3Q0HA 2ADIA 3TIDB 4DGYH 3IFLL 2ADFL 2HLAB 2D03H 1CD0A 3TESA 4W4OC 5KZCB 1OLLA 2Q6WA 4G6KL 3WIHL 3NIGE 4UB0L 2AEQH 5J1TC 3CSBA 1KTDB 3V8OA 1T0MB 5KVEH 3RU8H 1I4FB 1ZLSL 1J0IA 1CQYA 4U6VL 3E3QE 3O4OC 2DQUL 4ZQKB 5ADPH 1KJMA 2AV1B 1AGCA 1JGUH 3LRHA 5DQ9B 5I30H 4J8RB 1GOHA 5I8KH 3LKSA 4Z8FH 5IR1B 2VZVA 1I7ZA 1G7QA 1MRFL 1C5DB 4YHZL 3IAQA 5GGTH 3EO9H 4FOMA 4Q97A 4FMKA 3P4LA 2H32H 2RCSL 3GJEA 1TJHH 1KT2A 2OCFD 4YDIH 5IGXL 3GRWH 2H9GA 1J12A 3QIWD 3K46A 1IGTB 4KTEL 3AMLA 5I16B 2JK5A 2APTA 1PQZB 5TE6L 3R06B 5JDSA 2IH3A 3L6FB 3WKML 1DBKL 1DBAL 4KK5C 4JDTL 4WNQB 4LBEB 2EH7H 4FABL 1U42A 4LU5H 5EC1A 3B3IA 2NY3C 1KEML 1HWGB 4ZO8A 1A1OB 2R29L 3UPRA 3UZVB 1EERB 1U91A 2R2BA 3GKWH 3MJ9L 5JA8B 3TZVA 5K9QI 2X4NA 3SY0B 1HXMB 2O5XH 1KCKA 3TV3L 3MJ8B 3VRIA 1RZFH 1REIA 1Z0MA 4MJ5A 3EDFA 5BS0B 1QRNA 4MVBD 2VR5A 2JIXB 3O8XD 3EYOB 5I71B 1OTSD 1K4CA 4K3EL 3VDCA 1AXIB 4I4WB 4Y19E 3DUSB 1UM4L 3LHPH 2GITA 4ZUWB 4N9OB 1SHMA 3H9ZA 3GO1H 2QBWA 1BF8A 5EUOB 1KCVL 2V2XA 1DUYB 2XZCL 1N26A 2HTLC 4DKFH 1FRGH 1G9NH 2IPKB 1AGDB 4PRIB 1C12B 5BXFA 1IAIM 3RJQB 2OMNA 4KTDL 1D6EB 2F19L 3VRJA 3U36B 1IAIH 5EPMB 1FG2A 2OZ4L 3EW3B 3GIZH 4UOJA 3AC0A 1TZGL 3PE9A 4P46C 3ARDA 3U1SH 4RGND 2DBLL 3MYJB 4F33B 2P45B 3VG0H 2IJ0C 3MBEB 2A74A 1A7QL 4DFHA 4U1MB 1JWUB 4HGMA 5I1LB 5ELIA 5FUCE 4IIQA 4JRXA 5F7YC 2X70B 3P73B 3ARWA 1N0LA 3GBML 3E8UH 2JCCF 4M3KB 3HNSH 4DW2H 1YJDH 2OK0H 4KQ3H 4KI5C 4BKLA 1MHEB 5JPNA 1FN4B 5EBWA 4NC0B 3QIUA 3Q5TA 4Q58C 4KRMB 2MQ0A 3TN0B 3BQUB 2QSCL 3QUMA 1ZA6B 3TA3A 4M48H 2HJKA 4KRPC 1T89C 4P2RD 3VFRA 1YNKL 2DM2A 4PBXA 5ERWB 5CZKA 3GSVB 1WUNT 2VITA 5D9SB 5DC4B 2J5LB 2VN4A 3TT1L 3B9EA 3S3JA 1BHGA 5I19H 4RGMB 4ZO7A 3EIFA 5GS0D 4KHTL 5FIEA 3BZEB 3MRBA 4ZSOA 1N59A 3ORJA 4XXDB 4RQQB 3WXWL 4JHWH 3ZDYF 1OAXL 1Z9OA 3RWIB 1EEYB 1FLTX 1GGUA 1DQDH 4LPTA 2AABH 4HWNA 4ELMB 5LGHL 3QH3B 3QI9C 4HEPG 2E9IA 1OTUC 3EOTH 43CAA 2F53A 1T2JA 3MRHA 3SHSA 1F00I 2JF1A 5FKPB 1GIGL 3HHRB 1F4XL 3C6LC 1J1PL 4OZFG 2H2SD 3U0PA 2X9YA 3BP6A 1AQKH 3VFNA 2HH0L 4V1DD 5ICXA 5IK3B 3SCMD 5ESVA 1NSNH 3K4ZA 4XPHH 5IEHA 1KB5L 3L3GA 3MO1A 2R8SL 1LP9F 3MNWA 4PJGE 4OFPA 4BUGA 4ACPA 5LKNA 4U0RB 4UNTA 2PKDA 2VDKL 1Q8MA 1RJLA 5HGAB 2PW1B 3BPCB 4HHAB 4EDXA 1RUQL 4M1CC 3NN8A 4FQIL 3BPOB 4U3CA 5ISZB 3MOAH 1T7YA 2MNUA 1Y6MR 3D0LA 1XCTA 2CDEA 3MRKA 3Q6FA 2OJZH 2AJUL 1MRCL 4U1HB 5DK2B 1XH3A 4H0IA 4HC1L 3QJHA 3SE4A 4IRZH 3MLVH 2I9TA 3BHBB 1ACZA 4KQ4L 4F9PA 2IMMA 4MWFA 1AQDB 4HJ0C 4RA0C 5ANME 3OQ3B 3EJZD 3QUXC 2R9HC 2N7BA 1B0GA 3ZE0F 4GAGL 1G9NC 1CXIA 1FE8L 3DARA 3GK8L 5LAXA 1QFUH 4PRNB 5DJ6B 2E6JA 2NY2B 1ITCA 4ZUUB 2VLRE 1FL6A 4FXKA 5HYJD 3S96A 3W81A 1MY7A 4WI3A 2O26U 4D3CH 3ULUH 3O0RL 1T1YA 1AJ7L 1UKSA 3MLUL 2NR6D 2R1XA 1IZKA 1A3RL 1CXHA 3BGFB 1J11A 2Z35B 3QYCA 4Z0BH 4M5YH 3L3OA 4GUPB 5HGGS 4B5EA 3P9LB 1IM3B 4X98B 1TVHA 4Y2DC 1FDLL 3VXSD 5BVPH 3S3SA 2FX8L 4XPGL 4N90E 5DJ8A 3HB3D 1AGBB 4LASL 5HYSG 1DBBL 4GT7A 1YJDC 4JKPH 4XRCB 2BSSB 5F1NA 4RRPA 5GS0L 2ATKA 5CIPB 2EDWA 4BSVA 3RKDC 1TMCB 3ROOA 4LNRA 3VXMD 2XACC 3MLZL 3PWPA 2BHZA 4LLMA 2HJLA 4KROC 4AM0A 4N8CL 1AD0B 3LY6A 4KY1H 4X8JB 2DD8H 2CUHA 2J6EA 3CC5B 1A21A 4HF5L 4QO1A 3QDGD 3LQAH 4TVPH 3UBXB 1FYTE 1XZ0A 4OCXH 4PJ7B 5H37H 4P9HH 2ZCKL 1EUTA 4YHKH 3EO1A 2J8HA 4JG1H 4NNPH 3KPQA 1G0YR 5E08H 2M8XA 5JW5A 5IBTL 2EDFA 2EZ0C 2V2WB 5HHOD 3G5YA 5DURB 2FNBA 3UZEA 5CD5C 1KENH 4LLDB 3UDWC 4E0RA 3K8LA 4MJ4A 5IHUL 4G8IB 3C5ZD 5A3IC 4G5ZL 3D85B 4M62L 3WHXA 2P8PA 1XGTA 2VLKB 3THMH 3GGWB 1DBML 1NGYB 3OJVC 3IT8D 3O3BB 4YH6A 3FB7A 5D2LE 2HT4D 4ZTOH 2EIZA 3NCMA 4NSKA 3I02B 1IBGL 4X80L 3T77B 1S7SA 4LHUB 2E8YA 2F15A 4IBLT 4ZS6D 4JQXA 2MTPA 3HZYB 3QFJB 3WS3B 4IRSC 4RFOL 3FMGL 1SEBB 4XCEA 5C7XL 4QHNA 1P84K 5BJTB 3MRGB 2AJSH 4JFFE 4OCWH 4DOHE 2A6DB 1FIGH 1OGAB 2IG2H 1PG7H 3N9GL 1WZLA 1JPGA 3AREA 1DFBL 1LDPL 4PJAF 2PTVA 4U1NA 4ONOA 1RUMH 3EZJB 3MRNA 1WQVT 2W65A 3RPKA 3VFOB 3GSQB 4Y4HB 1DQLH 1P9MA 5D71L 2HN7A 2ITDA 3BSZL 4L9DA 5I75C 1CR9L 4POZD 2I27N 5DD1H 2DIJA 2W92A 3IVKB 3B43A 2OI9C 1ZS8B 4D0CA 2DMCA 2JKXA 2DM4A 2VXTL 3CMOH 4OT1H 2EYTB 3V79C 1JMZA 5FYJD 3V4VL 4PJ8B 4AMKL 5I73B 4K23L 1ZVYA 3OG6B 5J1SC 1O0VA 1HHKA 2AW2A 4XCCL 5DJYA 1PX3A 4MNQA 3ULUC 1UB5B 2YS4A 5KW9L 3HTLX 3O4LE 4NRXB 1D9KD 5GSRA 4OZIF 1QPPA 4JEGB 1JNHA 2W9EL 4AL8L 1H15A 4JM2B 3PWJA 1MH5A 1RQ5A 5L2KB 3TT3H 2XKNB 4V2CB 4RMTA 4BK4A 1QVOA 2PW2A 5CGTA 5AZEL 3W0WE 4ZFGH 4I0KA 4JZNB 3RIFK 3ZKXC 1S9VA 2DI8A 4NYLA 4QRPE 4XTRC 3WIHA 4PRPE 1PJ9A 4NPYB 4LIQH 1D5ZA 4HG4J 3VWKD 2DDQL 2IANE 1B6UA 5JXAL 3FB8A 3H9HB 3EYUH 2DIAA 3BH8A 2BC4A 3UTSA 1S7RB 2D2OA 4I2XA 4PGEA 1T1ZA 5HBBA 4QRQB 4JFHE 4RZCB 2I60H 1B6DA 3MROA 3RWGA 1WZ1L 3R8QA 3ZE1F 4HPYH 4YNYB 3D39A 3HZKB 4YGVA 4W81A 5TE7H 3LKQA 5C0CE 3M8OL 3VXPA 4UT9H 1LE9A 2XN9A 3LQAC 3FONA 5D6DC 4OGXH 3S5LG 4EI5A 5AYUH 4P9HC 5GISL 2YA1A 1NDGB 2VUOA 3V4PL 1ODAA 4MA3A 1DQTA 4HAFA 5CZVH 1H5BA 4YO0B 3T0AA 3TO2A 1GRWA 5DS8B 1IQDA 4OAWB 1FIEA 1JF1A 4XX1G 2K1MA 4KK6D 5E2VH 1A5FL 2D7TH 3ZHKA 4LDEB 4HK0A 1LEKA 4U6YB 4L4VA 5KSBF 5BZDB 5LBSH 1FV1A 4Z7UE 1P7QB 1LD9A 3ARDC 3MJ9A 5I1CL 1RK0B 3TBSB 4F7EB 4G9FB 1YEFH 2MCPH 3DGCR 5EN2A 3NH7L 2F5AL 2BOCA 1N5YH 4UINH 1YDPA 2GJ6D 4HJJH 4YLQT 4EXPX 1UWXH 1VGEL 3OKMB 4IIQC 2QQKH 3GMNA 4PJXE 3K4AA 1FNSL 5IFHH 2YPLB 5I1JH 2NW3A 1OY3B 1J5OL 4WV1C 2B1AH 4QOKA 1KB9J 4OKVB 2O61A 1PY4A 2NX5D 3QIUC 4BQ6A 2HFFA 1N8ZA 4ONHA 5IMOA 2Z93B 5EULV 5FYJL 5HHNB 3P0VL 3NCBB 5KJRH 5IFAH 3TA3C 2OM5A 1FPTL 3MC0A 1KLGB 1ZOXA 3O3EB 2J6EH 1JYVA 3E2HB 4IRJB 1OM3L 2VLLB 2CPCA 2DYPA 5DD6A 1MCCA 5D7IE 4JFZH 2AV7B 2GCYB 4H25B 5KZCD 1LEGB 4X7DC 3F6IA 4PJEA 3NIGF 3QQ4B 1LO5A 2P49B 2OS7A 2EIEA 5C0BD 1MAML 1RPQA 3IXTA 1BJ8A 1LQSR 3QNZB 1A6TA 3CXDH 1I1YB 1I9EA 3BYYA 2GSIB 4FQ2H 2ADGB 4NWUH 4F7PB 3ARQA 5JOEA 5JIPA 3I84A 4Y1AD 1C08B 1MY5A 1JZ2A 1YEHL 3GSUA 1JI1A 2GK0B 2BNRD 4PGBA 4X5XA 1VGKB 3G6JA 3JV5A 3MLRL 4NJAH 1XGRB 2PYED 3GSNB 3MRRA 4JO4H 35C8H 1ZT1A 4XNZB 3NGBB 2IQ9L 1SY6L 5GSVA 4FXGB 4L3EB 2JB6A 3OMZA 4OZFA 5AZ2L 1WCQA 1V3MA 3B83A 4KXZI 1AH1A 4R4BA 3RDTD 1ZHNB 3ILQC 3I9GL 1WWCA 1AIFB 4NQSB 2QV2A 3PGCB 3BZ4B 1CFTB 1EVUA 2Z92B 3H3BC 3SKOA 3GMRA 4JDVA 3IB4A 4HJGB 5DI8B 2Y5TB 2OR7A 1OP5H 3C2SA 2R4SL 4MNHA 3DI3B 2LAGB 5GJSH 2PYFB 1J86A 3CDGB 1NDMB 1S7VB 1EBAA 3SE4C 5EU3B 1U92A 4P99A 4J3WA 3SPVA 4Z7VA 4G8FA 4X7CC 1DQJB 1EPFA 1FVCB 3VD5A 4F9PC 5H2BB 4UU9B 4MB5A 4O51B 2W0KA 2WBWB 2OSLB 4RAVA 5E0QA 5IUSA 2M1KA 2HJFA 3HE7D 5LG1A 4NM4L 3RUGA 1A6ZB 4RA3A 4MGXA 1P53A 1PKQA 3L9RB 2CK2A 5ACLA 5DRWA 1WIOA 4NRYB 1J8HD 5I15L 5I1EH 5CCKL 4OZ4B 4ETQB 4M03A 3MR9B 5JIKA 2DQEH 3ARBA 1FBIL 1UWGL 4OV5A 3DUHA 3BEVB 2BVOB 2NY0B 5HHMB 5IG7A 1A8JH 3GI8L 1KB5A 4UTBH 3FT2B 3EJYC 4EI6B 4ZFZB 3IFLH 1DLHA 1RIVL 2X89D 2XWTB 4WI5A 3BP7B 3GJFA 4NHUB 5HY9B 4G6KH 4LSRH 3OJDA 1QBAA 4K07A 3ARGB 5TDOA 5BZWA 5CS7A 1ZLSH 4HKJA 2AK4B 3V5KA 2FGZA 3ULUE 4HC1A 1ORQA 2DQUH 4Y0GA 4LSSL 4QRUB 5HYSA 5FYKH 5GPRA 3D2UB 1U41A 3X3FL 1JCKA 3EOAB 1R5IA 1RK1B 4G7VH 5GRJH 3L3JA 2ITCA 3AXLB 3MJ7A 4GG8B 4XPFL 5I1AB 2CD0A 1Q94A 2PCPB 3OG4B 1GOFA 3LKOB 3BWUC 3IETB 1MRFH 4YHZH 1KELL 4UT6L 2FGWH 4BH7A 5FOBA 2NTFB 1E6OL 2RCSH 3G5ZB 5IGXH 4JCMA 3TN0D 3PXJA 3HC0B 4KTEH 2NW2B 2ZP0T 5TE6H 1V3KA 2IFGA 4Z77B 1QRNE 2JE8A 3WKMH 1DBKH 1DBAH 4JDTH 1FFNB 2ZOKB 4FABH 1R5WA 4QHMB 3V5HB 4UAOC 4D94A 1LEIA 3F7VA 4P2RA 5F44A 4BYHA 3MJ9H 1S5HA 4XVUD 1GXEA 1QUNA 1JJUA 5FYLD 3ZT6A 3V6ZA 4YHIA 1A6WH 2X4RA 1CFSA 1HDMA 1PKOA 3QQ9D 1JPSL 5T5NF 4PJIA 1NMAL 4F7CB 3U9PL 3LKNA 5EBMA 5AUMB 1MREL 1UXWA 3WO4C 1UM6L 1UM4H 3OHXA 2DTMH 4ZAKB 3OR7A 1OD7A 4ZYKA 5ID1B 4X9BA 4MXVE 3KJ4C 1KCVH 1MAKA 5FCSH 2XZCH 1G1CA 4FQJL 4XVSL 3VXRB 3AY4C 4H0HB 4YX2L 5J7CC 1NKRA 3NIDE 5JR1H 4PPTA 4UBDC 4V1DA 3TCXA 1F97A 1R3HB 3WJJA 1A1MB 2CLZA 4PJGF 4QCIB 2Q7YA 5C0AB 3OF6D 4JRXE 4JO1L 4MMZC 1DUZA 3IFOA 3B2VL 5EO1B 1DLFL 2JELL 5EOCL 1CGSL 2AKRA 4IOSD 4KTDH 2D7MA 2F19H 2VN7A 3SKNA 4E41E 1F6AA 4XWOD 1J10A 2OZ4H 3LPFA 1TZGH 4XCFL 3KXFA 3KYNB 4YDLB 5HI4D 2FIRT 3AS1A 2R2EA 3U79A 3P9MB 3NIFE 5ICZA 4NT6B 3ELAT 3K3QA 2BY1A 1HIMH 4GS7C 4DVBB 4RX4D 3I75B 4HZLB 2Y1VA 1L6ZA 4HUXA 5DDHA 3C09C 1KXTB 5JQ6L 1SBSL 5DHXB 3JV6A 2NY2D 4OZFH 3CFDA 3G5XB 4CADA 2DQJL 3MLSL 4HXAL 4ZSOE 1XFPA 3RI5K 1OW0A 4PY8J 2FJFB 4OZGB 4WI2A 4MAYC 1TJIL 4ALAL 2HVKB 4BSWA 2A6IB 5HYJA 1YNKH 2F53E 3MZGB 2NY6C 5DMKA 3LDBB 1DEEA 5EZOL 2DWEA 2ZSWB 3FCTA 1S3KL 3V6FA 5ECJE 2F8XC 4PV9A 2YSSB 4M7KL 5IWLC 3SDDA 4KHTH 5ESAB 4GQ9H 3BD5A 3WXWH 5I18L 4EI5C 5IM7A 2A77L 3MV8D 4ZUSA 4OGAC 3QXAA 3V8CA 5EIVA 4FZEL 1UJ3C 5KS9A 4KMTH 2CDFA 4LIQE 1KN4H 1GOGA 3QUYD 5IB2B 1P7KA 1B0RA 4LVHC 3TBWB 5F1KC 3KYOB 1IQWL 1GIGH 1YYLL 4TYUA 3FO1B 5FB8B 2YRLA 2C3HA 4CAGA 4WUUB 2NTSP 4Z95L 2HH0H 4YBQC 4PG2A 1SEQL 4JFYA 2M2DA 5F6IC 1NCAH 2FX9L 4L4TD 3P4NB 2Z31C 1CDBA 4KZEL 1U8LB 3RNQB 3C8HA 1GAFL 3H9SD 5JA9A 1KB5H 5IHZB 3H8NA 2UUDK 4GW4A 4R7DB 3C2AL 2FATH 2R8SH 3LVEA 1I1AB 4APQA 5DURD 1EEZB 3OKDB 2VDKH 4RGOL 3SDCC 3FOLA 1RUQH 1CFVL 4P2QB 1JPTL 3ARXA 2X44D 4FQIH 3W9DB 2ZG1A 4F7MA 3U30C 1N6QL 5HHOA 5EU6A 5BCAA 5EU4A 3FQXB 1A1NB 3RA7L 2Q3ZA 5D2LF 2W0FB 4L3AA 4QRRB 2LFGA 2VL5B 5D96B 3FT3A 4OGYL 3NOIA 4KQ4H 4LHUD 4P3DB 3C5SB 2YUZA 3TBVB 3IXAA 1KIRB 3VCLA 4R4FL 1YY8A 3OSKA 1T3FB 3MV7D 3PABB 1NGZA 1FO0L 4GAGH 3GK8H 4CDGC 1XMWA 4FA8A 4QTHB 4O2FB 2WIMA 4LCCB 1XGQB 5DSCB 2QKIB 2ESVD 4L4JA 5DGQA 3O0RH 3GZKA 1AJ7H 2XY1A 5C09A 1UXSB 2X4TA 3ZL4L 3RZCA 4Y4HD 5KG9A 5CWSB 3PWPE 2ENSA 4L8CB 3KPNA 4LPXA 2P5WD 4KFZC 5LXGL 3RX5A 3D25A 3B9VA 3WIFB 5EFIB 2FLBT 2J8UE 4A6YB 4XPGH 4F8QA 1GZPB 2FO4A 2CIIB 1JZ5A 4PJ8D 4UNVA 1YEDA 5JW4Q 2VSCA 5GS0H 1KTRL 5GZOD 2ZSVA 3MLZH 3QXDB 1QYGL 5J13C 1CDHA 4N8CH 1QOKA 2VDRL 3QIWC 4YHNA 5B3NA 5H35A 1HH9A 4MX7A 1I8KB 4L9LB 5L2KD 5E5RB 1ED3B 3MV9E 4Y2OA 2B2XL 2ZCKH 4AH2A 1IAOA 3EYSL 3VWJB 3SGKA 1F6FB 4JY5L 3HS0B 4KHXL 1P4BL 2XPGB 4Q9CA 4L8BA 3PL6A 1NUFA 2GTWA 2J88L 5DUBA 1ZLWK 4O02L 3EYQD 4ZUTB 4JR9H 3BIKB 5IHUH 5J6GA 8CGTA 3X13A 1JNLL 3WLBA 4G5ZH 4Y5YC 4GH7B 2WSKA 5HD8D 1UQSB 3MOQA 1IAKA 2PETA 3PQYA 2YD5A 4MVBC 3O8XC 1OTSC 4TNWF 1BQHA 3OKOA 3HR5A 3CVHB 5IIEB 2X5PA 3T4YA 2A6KB 2D9CA 4KMLB 1G7PB 4G6AD 2Q86B 3TYFB 3DVNB 3H7BB 4XH2B 4BZ2L 3QNXB 2BCKB 1MCOL 3L5HA 5IVXB 3WUWG 2PTTA 4NUGL 2VNCA 3BWAA 3HAEG 4JN2B 4JY4A 4CVXB 1QKZL 1CBVL 3WE6A 3N9GH 2A9NL 3LV3A 4XC3L 3UBXG 1DFBH 3L5JA 3T65A 4MAUH 1RD6A 3O9WB 4Z7UF 3DMMB 3FHQA 1VFBA 4MNQE 1AFVL 4JLRA 4YHPB 2FJGB 4JFXB 5D71H 3KLSA 2X42A 4MCZB 2HMID 2V7HB 1CR9H 1Z2KA 3G6DH 1T80A 4RGNC 3C60B 4PJXF 3OTTA 4M6ML 5DRNB 4Y16D 4P57A 2GJ6A 1YECL 2FDBP 3DX6B 4XMKL 4YHYC 1ZLUK 4OFKA 3NFPA 3V0VB 4AMKH 5DQJB 3VGAB 4K23H 3QRFM 4U6HA 1QFWM 1WCBA 3SGJC 5JHDB 1FJ1A 3ARRA 2F54D 3F7QA 5JLZB 6CGTA 3QULB 4PGDA 5KW9H 4HWZB 4LHUG 2NX5A 4CUCA 3UTSE 5MENE 1K8DB 2CUMA 4YHLH 4I2XE 4IRJD 5D7KE 4DEPC 3F12B 4Y4KD 5JPMB 5BVJA 1PZUB 5FYKE 1JNJA 3CCHB 4HKBA 2X1WL 3BJ91 5D2NA 5D7IF 3VXNB 5E2UL 3D39E 3QUZD 4WHDA 5AZEH 5IEKB 3NABL 4XBGA 4LCWD 5F9OH 3K2MC 1Z0NA 4TVSa 2Y9RT 3TIDA 2XN9E 3HZVB 2HLAA 3B4NA 1A64A 1WAAA 4FQLL 2DDQH 5JXAH 1DVFB 1A0QL 1YPZB 2OR9L 5GS0C 1KTDA 1RU9L 4KKAD 1QSEE 2BSED 1T0MA 1CI5A 5BRZD 1I4FA 2R0LL 3WD5H 1XGUB 4GRWB 3T1WA 1EZVY 3ZKSD 2Q87A 3BOVA 1IT9L 1WZ1H 4JPKH 4ZQKA 3X14B 2AV1A 3M8OH 1BD2E 4HLZG 1WISA 5DQ9A 3WKNA 4E42B 5EH1A 4MA1C 4J8RA 1BJ1J 2VZUA 4HW6A 5IR1A 3DGGB 5FV1L 2H2SC 5GISH 1UCTA 1ZV5A 3V4PH 3B6SB 2C3XA 5JOPE 3REWB 4HUNB 3SCMC 4J12A 3IJYB 5C0GB 1DN0B 4MZ2A 2HYMA 1IGTA 1A5FH 5I16A 1PQZA 4NIKB 3R06A 2VH5L 1NBZB 4QOKE 4RCAA 1GGIH 3RGHA 3L6FA 4I77L 3ESUF 4WNQA 4LBEA 4RSVA 5T1MB 4GFTB 5I1CH 4EIZC 3BKJL 1A1OA 4OD1L 1V5JA 1A7OL 3NH7H 2F5AH 3K2UH 1RSFA 4HG4K 3SY0A 5ALBL 4M7LL 5TE4H 1HXMA 1PZ5B 1U8IB 1FNSH 2E7HA 2V5SA 4Y4FD 1J5OH 5BS0A 1BVLB 4PRAB 3EJZC 4PJEE 5HHQB 3BPLC 2JIXA 3EYOA 1OW0C 3LZFL 1U3ZA 2C4FT 3DRQB 3VI4E 4I4WA 5FYJH 3DUSA 2H6PA 4XNYH 4PJBB 1FPTH 1R24B 1NUGA 3KYMB 4WHTA 2NY0D 3D3VD 5IW1B 1JFQL 2HT3D 5EUOA 2IGFL 2VZTA 1OM3H 2QTEA 1NC4D 5DJ2A 2O93L 1DUYA 2NR6C 2FZ3B 3S7GA 1T6WA 2G9HA 4YR6A 1L0QA 1FNAA 4WVRA 2IPKA 3MZTA 2EH8L 3ARGD 1MAMH 1KGCD 1AGDA 4PRIA 4F7TA 1C12A 2EDRA 3QDMB 3TGXA 1D6EA 3HB3C 3U36A 5A2KH 3ULUF 5EPMA 1YEHH 2MQ3A 1MWAB 3D2UD 3SDYL 1C5CL 2ED7A 1U8NB 4I0PB 3KHQA 2C3VB 4JPWH 1OT2A 4ODVL 2X4PB 3TBTA 1CDJA 4NNXB 1LO2L 3MYJA 4ZD3L 4F33A 3MLRH 3WFCL 4NQXB 4U1SB 3MBEA 4ODXB 5A2LH 4U1MA 2OQJB 4PG2C 4PRHB 2IQ9H 4EOWL 1SY6H 4GG6B 3GSNL 2X70A 3P73A 2X09A 3TO4B 3GMMB 1EO7A 2W9DL 2IBZY 1MHEA 4UI2A 1FN4A 3HG1B 3I9GH 3U83A 4LLYB 3TN0A 3BQUA 3TVMB 1GGYA 1ZA6A 2E6PA 1MOEA 3QXTA 1WWAX 3BE1L 2R4SH 2DJUA 5ACZB 4FZ8H 1MFEL 5ERWA 2FJHB 3GSVA 5A16A 3C5ZC 4ZNEA 5D9SA 3G04B 1R3KB 1JF5A 3I3EA 4CMHC 2H8PB 5CGMA 1FCCA 4C56B 4OLVL 3VG9B 2HT4C 3QPQD 4RQQA 2CKBB 1B88A 3DJ9A 2F9BT 3RWIA 1EEYA 2IADB 4JRYB 4ZS6C 1NEZB 4HKXB 4DTGH 1I85A 1MHHB 2YA0A 4HUMB 4ELMA 4ZMAT 3QH3A 4ZAKD 2YPVL 5CSGA 4UV4L 5I15H 3T4AB 3V52L 3LEVL 5CCKH 4MXVF 1XF5B 5FKPA 1MJUL 5HDLA 2EXYD 5E2TL 4N9GB 3VXRD 2F8OA 1FBIH 1WZMA 1WWWX 2E7LA 3NIDF 3GI8H 2QQLL 5IK3A 5JXEA 5JW4R 4HS3B 4RGNE 1ZXQA 2WZPD 3LMJH 1NGQH 4KJQD 1IEHA 2Z8WC 1T04A 5ABDE 1YNLL 3RGVB 4XB7A 2IAMD 4POZC 1U8MB 2EDTA 4UUJB 2PW1A 3BPCA 4HHAA 5HGAA 5B39G 5AAWA 5ISZA 3ILPB 3NIFF 2X1OA 3N1QC 3N1FC 3QO0B 1X5XA 5CKGA 4LSSH 1MCFA 4O58L 5DK2A 3LIZL 2W07A 4U1HA 3X3FH 3DSFH 1YN7B 2LTQC 2JJSC 2QADB 1IC7L 3H3PL 4LF3B 4XPFH 2WBKA 3BHBA 4P2RE 4N5ED 1D9KC 4QEGA 1KELH 2HFGH 4UT6H 5D5ME 3SGKC 1E6OH 1KBGL 5DA0B 3B9KD 3GSRB 1I8LA 5DK3A 4WDIB 4HUVB 4PRNA 5DJ6A 4ZUUA 1V3LA 3PIQB 4M93B 5IB4B 4LSUL 3CFCL 3GFUA 3BD3A 3I6KB 3FN3A 4U49A 1ES0A 1NMBL 3V95A 3VWKC 3OR6B 5I1KL 2DBJA 2Z35A 4GUPA 5HGHA 1D5MB 3P9LA 1IM3A 4FHBD 4X98A 4DUXA 4H1LG 1K3ZA 5J3HD 2J4WL 4WFHD 3CNKA 3Q5OA 4V1DE 2CR6A 1NMAH 5GHWH 1RMFL 5BOPA 1AGBA 1NCBL 1MREH 1OB1B 4TRPL 4XRCA 2BSSA 2VDML 1UM6H 2Q8AL 3AM8A 1TETH 1A9BB 1QBBA 3L5IA 4ZO6A 1AD0A 4HH9B 4Q9BA 1JVKA 1MPAH 4KK6C 3KXFE 4X8JA 1FSKB 1RIHH 4XVSH 3CC5A 4YX2H 3DPBA 1HNGA 1BFSA 3UBXA 1EGJH 5L8KB 1ZE3C 4GO6B 4LMQE 4PJ7A 4FQPA 1U8HB 1AR1D 1IAII 4JO1H 4B0MM 4P5TB 1H3TA 1CICB 4M8VA 1IVLA 2DM3A 3DOSA 1X5JA 3B2VH 4IDLA 1DLFH 5EOCH 1H3PL 6FABL 1CGSH 4ODBD 2V2WA 2XFXB 3OXSB 4NQCD 4X0KA 1CGXA 4LLDA 4XCFH 4G8IA 1TQCC 3D85A 4YC2B 4MJ6B 2VLKA 2G75B 3GGWA 1NGYA 5HYJE 5C2UB 1WBZB 5LVEA 3O3BA 3LB6D 1DZBA 5JQ6H 3QXUA 3I02A 2GY5A 4MD0B 3SE3A 3T77A 1P4IL 4R2GD 5D2NC 1BLNB 4LHUA 5EWIL 1SBSH 3U6RB 3HZYA 4S1SL 1A7BA 3QFJA 4GAFB 3WS3A 1KC5H 3ZLQC 5BJTA 4HXAH 3MRGA 1IC4L 5ID0B 1DQQB 3RBGA 3JBG7 1CL7L 3VXSE 1LVEA 3C6SA 4PJ5B 1TJIH 1H8SA 2A6DA 4ALAH 1OGAA 2VZ3A 1YN6B 5KS9E 4JVPA 3HFMH 5T1DL 2IFFL 2CRIA 3JWOL 1CN4A 1KYOJ 4JGMA 5H8DA 5EOQH 3VFOA 3GSQA 1OQOA 2DICA 1N7MH 1TITA 4Y4HA 4X5WB 3VXME 2EIBA 4XGZB 1S3KH 4RISL 1U8PB 2P5WA 2J8UF 3FB5A 4GQPH 1IGFL 1EFXD 4XX1E 5T33L 1CXLA 3EFFB 3IVKA 3MRFB 1OT1A 5I18H 2A77H 1ZS8A 5FYLH 5IMKB 4ZPVB 3DBXB 4U6TA 1VACB 4AQ1B 2CLRB 5F3BB 2EYTA 2EEBA 1XCQB 4QXUL 4PJ8A 2AK1H 3KWWB 5TDPB 1IQWH 1YYLH 4Y19D 3RDTC 2VXUH 1I7TB 2VWEE 1UB5A 1NLBL 1Q0XL 2I24N 5INCB 4NRXA 4PREB 4Z95H 5EU6E 5HHOE 3DUUA 4XP1L 5SV3A 2FX9H 2HKHH 3RY5A 4JM2A 2D0GA 2ZUUA 3V5DB 4U6XB 5HXMA 5L2KA 1GAFH 2XKNA 1T0NA 1CDYA 1PEWA 3T3PE 3C2AH 4I3GA 3P4OA 3UTTB 5M7QA 1U9KA 4LSQL 4NPYA 1CFVH 1JPTH 2VO5A 4XNMB 3H9HA 4I9WD 4I48B 1BFVL 1S7RA 2KZ1B 3L3KB 1PW3A 4JFEB 3KYAA 3RA7H 3HE7C 3UCRA 2VDOL 4KKNA 4QRQA 5C09E 4RZCA 3EYFA 3DO7B 5IMLB 4UV7L 4LARL 1HQ4B 1MCHA 4OGYH 1GCFA 4YNYA 3HZKA 2FX7L 4OD2B 3L7EB 3C08L 4JG0L 1IKFL 1UB6B 2KBGA 4R4FH 8FABB 3WNKA 5TDNB 2CJUL 1FO0H 2RB8A 1NDGA 3K4DA 4KVNL 3P9WB 2B0SL 4NZUL 4YO0A 1IGML 5DS8A 2ZUWA 4OAWA 3HC4L 1E27B 2W91A 1HXYB 5E6IB 2I9LB 3O9WD 4YAQB 4QWWD 3QEGL 3VFUB 3ZL4H 4LLUB 4Z76B 3SJVB 3MRJB 4U6YA 3WJLA 5FYJE 3ZYIA 1NFIB 5LXGH 1CFNB 3ABZA 1MEXL 4OZHE 1RK0A 5GGRB 3TBSA 4F7EA 4G9FA 3C60D 3TNMA 3U0TB 1H3VA 2YUWA 3VXUB 3QHFL 1N6UA 2B4CL 5IMMB 3OKMA 2PXYB 4K94L 3EO0A 1GGBH 1Q38A 3S9DB 3E6HB 2YPLA 4F3FB 3MA9H 5F9WC 5JHDD 1OWRM 1NCNA 2EYRB 3VRLE 3UXFA 4OKVA 1U93B 5E6ZA 1XF4B 2BRRL 3T0EB 2CK0L 3IU4L 3KPTA 1S78D 3TN0C 2Z93A 1OAYL 5HHNA 1IGCL 5DMGC 5E99L 1KN2L 5FA4B 1QR1B 1EHNA 1DE4B 3HAEH 1KLGA 3O3EA 1A47A 3LQZB 4IRJA 2B2XH 2VLLA 3EYSH 3SDAD 3TH2T 1MI5B 5CJQL 2YWYA 4JY5H 2Y23A 1BVKB 2AV7A 2GCYA 2VKXA 4OLWH 4ONFL 1U8KB 1LEGA 4RGMC 1AO7B 2J88H 4XVUC 4LCWA 4OM0L 4O02H 3BP5B 3QQ4A 5CEXB 1EJOL 2AEWA 3RVXD 1Q72L 5CGYD 4GXVL 3MRDB 3IU3A 2VZSA 3RY4A 3F58L 3L3IB 3VH8G 5BQ7B 1I1YA 3QQ9C 2GSIA 2ADGA 1FNGB 1IKNC 4F7PA 3RKPA 2WIIB 3NZHL 4LPVA 1C08A 3T0DA 3MV01 3D69B 5DHVH 3WEXB 3BDYH 4AEFA 2GK0A 1SMAA 1VGKA 4FRWA 3CFKB 2NNAB 3UTQB 1XGYH 3LQMA 1XGRA 3GSNA 4U1LB 3AVEA 5H94B 2E7LC 3CVHL 3B9DA 3MRLB 4LSDA 1S9WB 4FXGA 1JRHL 4L3EA 4YHOL 5HDOA 1MCOH 3FFCB 1KSRA 4WI6A 4C59B 4NUGH 1ZHNA 4TUJB 2GJ6E 3CXHJ 1CBVH 1AIFA 4PGCB 2A9NH 5LJYH 4XC3H 3DVGB 4JJHA 1RFDL 3BZ4A 1CFTA 1GC1L 1IAMA 2NLJB 2Z92A 5EBLB 5E4EC 5IW3A 5ACMA 5EUKB 1LO3L 4HJGA 5F21B 1QFHA 4JJ5A 1AFVH 2Y5TA 4W6YB 5F7FA 4OSUH 2V5YA 2NX5E 4XWOC 1NDMA 1S7VA 3KPPB 5HI4C 3LN5B 5EU3A 2AI0L 4XPTL 3X3GL 3LEXB 4KDVA 2P43B 4WY7L 1DQJA 5D2NE 1FVCA 2VXQL 4RAUB 2QQNL 5H2BA 3STLB 4UU9A 4JQVA 4JDZB 3O6LL 1JPST 5JO5B 1M4KA 3RWFB 1YECH 4TPRL 4XMKH 3WFEL 4PJEF 5CUSL 2OSLA 4P9ML 4HLZH 1I8LC 4PJHB 1CLZL 1JHLL 4R7NB 3V6OC 3VI4F 1A6ZA 1WAAE 1YEKL 2NY2C 3L9RA 4OBSA 4JB9H 3PWLB 5F7KC 1OHQA 1UZ8B 3OAZK 1X5YA 4NRYA 3UYRH 3O6FB 4U2ZA 3HE6D 1W0VB 4OZ4A 4ETQA 3MR9A 2BVQB 5IQ7L 3G6JF 5E2UH 3KNBB 3BEVA 4Y1AE 1ZLWH 2BVOA 2P8MB 3UJTH 4PJAB 1BZ7B 3FT2A 4NN6B 4EI6A 4ZFZA 4X6FA 2ENYA 3AAZB 4Z0XB 1JMXA 2LVCA 2XWTA 1RVFL 2PYEE 3BP7A 3QDMD 4NHUA 5HY9A 4FQLH 3EKCA 1QFPA 5D1QD 1U8JB 1A0QH 2OR9H 5KVMC 1RZJL 2DKUA 1QPXA 3ARGA 5DA4A 2OYPA 2D7PA 4U7SA 4KU1A 2AK4A 4LSTL 4FP8L 5HYEA 3RWJB 1IT9H 4XMLL 2XKUA 5GS1C 2D7NA 4QRUA 1RHFA 1ZA3B 3D2UA 3QUYC 3EOAA 12E8H 1RK1A 2KUTA 1PYWA 4WWID 1X5IA 3QZWB 5I1AA 4GG8A 2PCPA 3AS3A 1U2HA 3LKOA 3IETA 5DQDL 3KPRD 3TWCL 3HG1D 4MLIA 1DBJH 5CD3B 3BN3B 2NTFA 3G5ZA 4N0YL 3GMQB 1BOYA 3HC0A 1K2DB 2CLVB 2ICEB 5L2JB 3RUGF 4Z77A 2VH5H 2FEEI 4I77H 3TBYB 1HNFA 2WMPA 2ZUQB 1FFNA 2ZOKA 4GKZB 2F58L 4QHMA 1VDGA 1ETZB 3BKJH 3V5HA 4GRMA 4OD1H 4WI8A 1WJ3A 4KJWD 1A7OH 4X6EB 3QDAA 4POUB 5IJKA 4LQ1A 5IVZB 4C56D 1J8HE 1Q9OB 1K3IA 4PJFB 5ALBH 5EUOE 5SX5H 1ZLUH 2E9JA 5DJAB 1F4AA 3K8MA 3S98A 4M1DH 2KPNA 5SWQB 2VSDA 4F7CA 5AUMA 1FFOB 3ZSTA 1CYGA 4RMUA 1S9YB 1HSAB 4LDLB 1FL5A 3IGAB 3LZFH 5D1XB 1QACA 1H3XA 4LLVB 1NBYB 1RZGB 1DCLA 3QHZH 3UYPA 4ZAKA 4HUKB 4XPAH 5ID1A 2VAJA 4OTXL 5DUML 4RMWA 1HZHH 1T4KB 4QGTA 3VXRA 4Y4HC 5D7JB 4HAGA 1KFAH 5I8CB 1JYWA 1R3HA 1KCUL 3RGVD 1A1MA 5IKCB 2Z8SA 4QCIA 2EH8H 3P0YL 1W0WB 5HHVL 1G9ML 4EVNB 4BSJA 5F72S 1NAKL 4WFFD 5JW3L 4I18B 4S0TD 1X7QB 1H3GA 1SBBA 2IAMA 4TSBH 2WLZA 3BGAA 4PJ8C 2R1YA 3S4SG 1VADB 5I73C 1C5CH 4NZJA 1XR9B 4MJIB 4ODVH 5E4IA 3P9MA 3BFOA 4ZD3H 4NT6A 3VJ6B 3UC0L 5I1IL 2R0KL 4EOWH 4DVBA 5F7NC 3I75A 4HZLA 1F58L 1KCRH 4EQ3A 4ZNEE 4PG9B 1TTGA 1WSST 1Z9MA 2ICES 2W9DH 4BFBD 1RHHB 2V9RA 3G5XA 3BPNC 1EV2E 5FYLE 4Q6IB 1ZK9A 4YDKL 2FJFA 4UDUB 4OZGA 5F88B 1ZWIB 4TNWK 2HRPH 2YHGA 2HVKA 3BE1H 3PGDB 5D7LD 2A6IA 4PLJC 3EYQC 4ELME 5FA3B 1QSZA 1MFEH 2WLYA 2L0DA 5CMAB 3T0XA 1G7JB 3MJ6A 1FORL 1WFOA 4HIHB 4OBRA 2CRYA 1JWSB 5HD8C 2ZSWA 4WRLA 4WTWA 4OLVH 3JUYA 1HHGB 1U3HD 5J11B 4IOIB 4QYOB 4YBLB 4OF3A 1UT9A 3TYGH 4YDJB 2Q76B 4HSQA 4WHCA 4G6AC 4KKBD 2YPVH 1T2QL 4UV4H 5IB2A 4CW1B 2D0HA 3G6AB 3V52H 4UILL 3TBWA 3KYOA 1MJUH 1D7FA 4YBHA 3FO1A 5E2TH 5FB8A 5C0FB 4QRSA 4WUUA 3DVIA 5DC9B 3WJLC 5DHYB 2IALB 1JN6B 2L7UA 4JKWA 2QQLH 3P4NA 1J05B 1U8LA 4WO4D 5IHZA 4R7DA 3TPUA 4XCYB 2HMIC 1YNLH 3U4BL 1EEZA 3OKDA 4XC1L 3DX7B 4NO0B 3V6OE 1M1SA 4Y16C 4P2QA 4GRLB 2CQVA 3W9DA 4HBCL 4H1LH 4ZFOB 5HHXL 4XNUH 4O58H 3FQXA 1KPUB 1A1NA 3EHBD 1BP3B 4OJFH 3R8BB 3LIZH 1R3LB 2W0FA 4QRRA 1E6JL 1IC7H 3WNNA 3QBTB 4P3DA 4BQ8A 3C5SA 3HZMB 1NEZG 3TBVA 3WBDA 1KIRA 5ITBL 4IRJC 4OF5A 1T3FA 1KBGH 1W72B 4Y4KC 3PABA 1J8KA 3CJJA 3WSQH 5IB5B 3QCTH 1F4HA 3QIBB 3QUZC 4PJ5D 4QTHA 4O2FA 2AJXH 2X9XA 1U6AL 4LCCA 3HUJE 2I07B 1XGQA 5DMIL 2A2QT 2QKIA 3Q1SL 4O2EA 1T7VA 5KS9F 1ZGLP 2CUIA 1CU4L 2VAAB 2C26A 2CR3A 3LKRB 3MV8E 1UXSA 2DLGA 2GW5A 3T08A 4YFEA 1NMBH 1S5IL 3HNVL 2GY7B 5CWSA 4KKAC 4L8CA 5GXBB 2APXA 4P4KD 4P0DA 5F96L 3LRGA 5DVMA 5FDYA 3WIFA 1MSPA 5EFIA 4WJ5B 4A6YA 3RWCB 4HCRL 2J4WH 3VU2A 4PJ7E 4KGJA 4J4PA 1RMFH 2CIIA 4L4TE 1J0HA 1NCBH 3LH2L 4TRPH 3Q5YA 3S34L 2GKIA 43C9B 2VDMH 3H9SE 1ADQA 2LQRA 4B50A 4MQXD 5ESQB 3QXDA 5MEOB 3QUKB 5IQ9B 2C4FU 1Z9LA 3PWUB 1I8KA 4L9LA 1A6UL 2HWZL 4DN3H 1F2XK 2VLKE 4OF8A 1ED3A 1KEGH 3T3PF 3UX9B 5JUEH 3VXQB 2CO6B 1G7MB 1HH6B 5E2WL 3BUYB 5DEZA 3HS0A 4JZJB 4NO2B 3GMLB 2XPGA 2ZPKL 2AEPL 4YXHL 1H3PH 1ZT4B 3F62A 1CWVA 3QFJE 1ZKAA 3MV7E 1K5NB 3SO3B 3BIKA 4LDOB 3AU1B 4PJ9B 4LPCA 4Y4FC 5IESL 1UQSA 1OGAE 3RPIA 1LDSA 4KUZL 1D5IL 4X6DB 2FCBA 1KLUB 1B90A 1OSPH 4AEIL 3CVHA 2QL1A 1F6LL 3PNWB 3KS0H 2A6KA 1P4IH 5EWIH 1B9ZA 4P5KB 1G7PA 4S1SH 2P5WE 4YFLI 2ORBL 2HT3C 4NP4L 5CJOH 2Q86A 3TYFA 3DVNA 3H7BA 4XH2A 3P77B 3TZVD 3QNXA 5CBAB 2BCKA 1IC4H 5IVXA 2EDQA 2W38A 3CX5J 1DDHB 1BREA 4JN2A 4CVXA 1ERNA 1MCEA 3ARUA 1QO3B 3ARGC 1U8OB 2IFFH 5B38B 3HC3L 3BKML 3O9WA 1BBDL 3JWOH 2DOCA 3DMMA 2EEAA 4OZHF 4UT7L 4P23B 3I85A 2FJGA 4JFXA 3VXUD 2ZUVA 2DLFL 4JQIL 1IGFH 4MCZA 5T33H 2V7HA 5D93C 5KSAB 4M7LT 5EZIL 5K9JL 4EN3B 3C60A 4X6BB 1YYML 5L2KE 5DRNA 1QLEH 3MUZ1 5E8DL 3SQOL 4O9HL 5FUOL 5C3LD 5ANMB 2XXMB 3DX6A 4QXUH 3V0VA 5DQJA 3GHEL 1CDCA 5JHDA 1QP1A 5JLZA 3QULA 1FFQA 1Q0XH 1VEPA 5FXCH 4HWZA 2VLRB 1S7TB 5TF1L 2A83B 5HDQL 4JZOB 3F12A 1RJZB 5JPMA 2R15A 4S11A 4HK3J 5IBUB 1AD9B 1KIPB 1MCRA 2BX5A 5HI3D 3VXNA 5TF0A 3V4UL 1AO7D 1T83A 3ULSB 3SDAA 3QPXL 3CD4A 4JRXD 3HZVA 1FC1A 1ZHLB 2Y06L 4LSQH 4OLZL 5EO0B 3S35L 3MCLH 4ONGL 1INEH 1F8TL 1KYOK 1DVFA 2C1OB 2VDNL 1YPZA 5F7MC 3D87B 4LPUA 2ATPB 3QPQC 1BFVH 5K33A 2YC1B 4NJ9L 4XZUB 1I1CA 1XGUA 3ISWA 5FO7B 3T2QA 5ILTL 4O5LL 1CTNA 5HSFA 1GSMA 1LILA 4ZAKC 2FX7H 3X14A 3C08H 4JG0H 3EDKA 2HVJB 1AKJB 3S35X 3KLHD 3DYOA 2XWJB 2EXYC 3PJSB 1JZ4A 2CJUH 3SO5A 5EO9B 5BO1L 3B6SA 1WICA 4KVNH 2B0SH 3TJEL 3REWA 1FYTB 1IGMH 1GGCL 1C1EL 4PYHA 1ROWA 3HC4H 3IJYA 5C0GA 2QQQA 1DN0A 4HH8A 2EYSB 3QEGH 4JVWA 1N4XL 4BQBA 1AXSB 4JVUA 4KJQC 2VMFA 2IAMC 3ARFC 1WTLA 3RL1B 3U4AA 5KBNC 5T1MA 5I9QC 5IVOA 2F54E 1KJVB 4ELKB 1P84J 3DXAB 3BP4B 4TSAL 2RQ8A 1HHIB 3QHFH 2B4CH 3RX7A 1JZ7A 4K94H 2VABB 1U8IA 2EDYA 3QCUL 5HTSA 3I6LD 4N5EC 2AJYL 1A4JB 4P48A 5T5FH 2ED8A 1BVLA 2XQYK 1WAAF 4LCWE 4PRAA 3PGFL 5F7DB 3WDHA 4ORGB 1L6XA 2BRRH 5HHQA 2VE6B 4IHOB 5MERA 3ULVD 3B9KC 2CK0H 3IU4H 3TEUA 4JO2L 1OAYH 4JFFB 5CILL 1IGCH 4CMMB 5E5MA 2BMKB 3JWOC 4PJBA 1KN2H 2FB4L 1R24A 2AXFB 3KYMA 3B8YA 3ZTNL 5E7FA 1YEGL 1CGUA 5IW1A 5DRZB 1EHAA 3L3HB 3WMSA 3SKUD 1UVQB 3HE6A 5BRZE 5CJQH 2FZ3A 4P46B 2FHFA 4ONFH 4OM0H 1BZ9B 1BJMA 1EJOH 4NFBA 4S10A 2CSPA 4LVOC 1Q72H 4Q9RH 4GXVH 2YKLH 5J3HC 5LQBL 5GGUB 3QDMA 4LMQI 1OL0A 4O4YL 4XNXL 3NZHH 3H42L 1ZLVH 2EECA 2VC2H 1OSZB 1MWAA 3W9EB 3S88L 1H0DB 1U8NA 4I0PA 2C3VA 2X4PA 2BVYA 1BAFL 5A2IH 4NNXA 3EDEA 5E8PB 4NQXA 4U1SA 2BHYA 4ODXA 3QRGL 1IGIL 4KRPB 2OQJA 4PRHA 3O4LB 4GG6A 3QUML 4U3XA 4YHOH 1JRHH 3IDYC 3NZ8B 4MXWH 3KGRA 3TO4A 3GMMA 3MUGB 4FQQB 4PIRF 1F3DJ 3HG1A 4RWHA 1AR1C 4LLYA 1RFDH 1GC1H 4PRPB 4YEFA 3T2PA 4ZODA 2VQ1B 2A1WL 1UH3A 5ACZA 1PEZA 4QHLB 3QI9B 1BIIB 2FJHA 1J7VR 2XQBL 2VUYA 4BFEA 5EUOF 1LMKA 4XPTH 3X3GH 3G04A 1R3KA 5JIHA 3ROLB 2H8PA 4WY7H 1S7QB 3C6LB 4F57L 3K7UA 2VXQH 2QQNH 2NY7L 1AHWB 4C56A 3O6LH 2YRPA 3WFEH 5B8CA 4TPRH 4DKDC 4P9MH 3RP1A 1CLZH 1JHLH 4R2GC 2IADA 4JRYA 1NEZA 4HKXA 1SM3L 5E1HB 1MHHA 1YEKH 4XP5L 2ZUTA 4BH8B 4ESKA 4C55A 3CSPA 1R0AL 3T4AA 1GH7A 4KC3B 5FECB 4BFGA 4FFZL 1XF5A 4OV6F 1UJTA 4C54A 3ULVL 4E5XB 3N1MC 4OM1H 5SV4A 3UJJL 2DIBA 4O2CB 4BQCA 4F9LA 2G60L 4S1DD 3V9FA 2XICA 4HS3A 2ZCHL 3DO3A 5ICYB 3CXHK 2UZIH 1KUMA 2B4CC 1RVFH 1NC2B 5HYQB 1JYXA 5D1ZB 5EU5B 3RGVA 1I9JH 1X5GA 2GI7A 1U8MA 3QUXB 3MACL 5GGSB 3PF2A 4UUJA 2FECI 2Y72A 4FQCL 4MJID 2K7PA 2B20A 2XQYG 4FP8H 4LSTH 3RWEB 4XB8A 3ILPA 3QO0A 4TUKL 2D9QB 4DVRH 3FO2B 3ARED 4NKIH 3SEPA 1YN7A 4XXCA 4FXLA 4FQXB 4LF3A 5E1AB 3QO1B 4L9LC 1C7SA 3T2OA 4NKDB 4AIZB 1MVUB 5DQDH 2NY5L 4N0UE 3A6BH 4RFNC 3TWCH 4U1GC 3ALWA 3GSRA 1N64L 2DQDH 5HVHC 4WDIA 4HUVA 1M7XA 1OP5K 1QTYT 3PIQA 4TQEL 1HSBB 4ELMF 2X4UB 3I6KA 5GRXG 3BKYL 3P4MB 3SQBA 3T8XA 3GSWB 4D9LL 1FYHB 4H8WL 2F58H 3OR6A 4U1KB 3DRTB 4UIMB 4FQ1L 5C8JB 1NGPL 1JHKL 4WW2B 1D5MA 2FEDD 2IPTL 1JZ6A 2P7TB 3VXRE 1ZTXL 4AENB 1TZHB 4NO5A 3MFGB 1U3HA 1QHPA 1INQB 1OB1A 3PUCA 5LGKA 4LGSB 1FG9C 1WZKA 1BQUA 4NKMB 3H0TA 3L5XL 1GC1C 3QZWG 5GRUL 2FR4B 3WNMA 5FKAB 2Y5EA 4HH9A 2KQMA 3O9WC 4QWWC 5DUMH 4XHQA 3D6GA 1NCWL 4U2YA 3DSNA 4CN6A 3QJFB 3RI5F 1WK0A 3HPJB 1KCUH 1U8HA 4N8VB 5E8OA 3FTGA 3P0YH 4P5TA 1TCRB 1CICA 1RULH 1G9MH 1FZKB 5KVDL 3FN9A 4R97C 2VDPL 5KVGL 4IJ3B 1HILB 3UJIL 5JW3H 2CIKA 1T03L 1KXQE 2XFXA 3OXSA 3CLFH 1INDL 4LL9A 7FABL 3ZDZE 4IRSB 3ALPA 1MFCL 2ADIB 4OZGE 5IW6A 4LHQB 3UC0H 2G75A 3MTRA 2GK2A 1WBZA 5I1IH 4L4VD 2R0KH 1S78C 1TTFA 5DFVD 5K59E 3K1DA 4MD0A 1BLNA 3U6RA 1MF2L 2FH8A 4TULL 4X99B 3NMEA 2MPAL 2UV3A 3SDAC 1HCFX 4K3DL 2R1WB 2ZNWA 5EOCJ 1YEEL 5I75B 5ID0A 4YDKH 1NBVL 1DQQA 4J3XA 1QEWB 4NZTL 5FGBA 4PJ5A 2OI9B 4WFHE 2QSQA 1H8OA 3KPSB 1NL0L 1QLRB 1I9RL 4OF0A 3RVXC 4TSCH 4G6JL 5CGYC 5JTWA 4J3SA 1FORH 2BNUB 5JW4N 4X5WA 3U46B 2JK5B 2FL5B 1YEIL 1U8PA 4CDHA 4BZ1L 1FVDB 3FT4B 1UA6H 3O2DA 4PJ7F 4Y88A 3EFFA 2ZOLB 4M4PA 5J9PB 2NXYD 3CDYA 3MRFA 1OOAA 1CLCA 2FBJH 4B41A 1C5BL 4J1UB 4XWGL 3AB0B 5IMKA 4ZPVA 3DBXA 1TXKA 1BJ1H 1VACA 4W4NA 2R2BB 1U91B 3NTCL 5M94B 1XCQA 4HK3N 1T2QH 3ZKXB 1KPVB 2YPKB 3KWWA 2WBJD 3KPOB 5GS3A 1I7TA 5D8JL 5ITFB 3VRIB 4MJ5B 3GSXB 2J3SA 5INCA 3RL2B 4PREA 2QSVA 4NQCE 2P8LA 4KK9D 1MRDL 4JGUA 1I1RA 3JTTA 5FM5O 5MEPB 3STBA 3VMPA 3A6CL 3V5DA 4U6XA 2ZG3A 1K4CB 3D0VB 1OAZH 5A2FA 1R3JA 2GITB 1X6LA 2UVEA 3GBLA 4S1QL 4PJCE 2XZZA 3UTTA 1HHHB 4P2OD 3U4BH 4WWKB 4XC1H 4TNVF 2W9LA 4AEHL 4PJ9D 3UPCA 3V0WH 3DTXB 5FM5M 4XNMA 5ENWB 4KPHH 4HBCH 4ODSH 4I48A 5HHXH 3QCVL 2WWMD 1NPUA 3L3KA 3VFVB 1LHZA 4JFEA 2V5TA 2V9TA 3RVWD 1E6JH 3DO7A 5IMLA 5DJZB 1HQ4A 4OD2A 3L7EA 1G6VK 1WIUA 5DMYA 1UB6A 5KSVB 5I1DB 3TIEB 8FABA 3HE6C 5TDNA 1BIHA 4YDVB 2E8ZA 3ARDB 4MDIB 1VHPA 1G7LB 1G9MC 1U6AH 1B0WA 4TUOB 5DMIH 1E27A 3Q1SH 3V0AC 1CD8A 4DGIH 1HXYA 5E6IA 4YAQA 3ZKQD 2XZQL 3ESVF 3VFUA 3RQ3A 3HNVH 4LLUA 5D1QC 4Z76A 3VD9A 3MRJA 5F9AC 1WT5A 2QHRH 4WV1B 4ZOEA 1EMTL 1J88A 4E41B 1D6VH 1NFIA 5F96H 4G3YH 1CFNA 1A3LL 3QIUB 5GGRA 4EN3D 4JM2F 2DF3A 3MRMB 3QEQB 3VXUA 3ARBD 4CGTA 4HCRH 3VFRB 5IMMA 2VDLL 2PXYA 3LH2H 3E6HA 2NZIA 4F3FA 2EYRA 3HI6L 2Y36H 1U93A 1XF4A 1FGVH 1CDGA 3T0EA 3DIFB 3IDGB 1QBML 4NN5B 4QGYA 5J06A 1MIEL 5FK9B 5HYFA 3QA3B 1CFQB 1A6UH 2HWZH 5FA4A 1YMHB 4I9WE 4C4KT 1DE4A 4QF1B 3EYVB 1XEDA 3LQZA 3ZMRA 3O2WL 1CLYL 2F53B 5E2WH 3GJFK 1MI5A 4PS4L 1N0XH 4WHYG 4I3RL 1BVKA 4ZNCD 2OBGA 3RTQB 3FN0L 5DVOA 3MODH 4KKCD 4KJWC 2AEPH 4YXHH 1U8KA 4JKLA 1AO7A 2FD6L 2Z91B 5EORL 2E7MA 5B8CC 4TOYL 3VG9C 5AYQA 4HFUL 4P59H 5IVXE 3MRDA 4R4ND 2AGJL 5I76B 1K8IB 1KCSH 5BQ7A 3VXTB 4WCYL 5IESH 1FNGA 2VZ1A 2JTDA 4KUZH 2WIIA 1A22B 4LSPH 2MJWA 3NAAH 4LVNC 1AKJD 3LEYH 5B3JE 3WEXA 1ULVA 2JB5L 1TLKA 3X17A 4AEIH 2R56L 4ZS7L 3FO9B 3UTQA 4DFIA 3CFKA 2NNAA 3ZT5A 4U1LA 5H94A 5IOPB 4HS8L 4AIXA 4F9LC 1NGXB 3MRLA 3QQNA 1MLCA 1PSKL 1AR2A 1S9WA 4NP4H 2CDEB 3Q6FB 3FFCA 1XH3B 3JTSB 2EC9T 1NANH 2RFXB 4TUJA 4WI9A 4BELD 3RGVC 3DHJA 4PGCA 3DVGA 2NLJA 3O3AB 3BKMH 1BBDH 3QB7C 3JVGC 5MI0C 5EUKA 5JHDE 4WEUD 4UT7H 2DL2A 1V7NL 4NRZB 4BZYA 2DLFH 4JQIH 4AJ0A 5CP3A 3KPPA 3FQTB 3LN5A 4XXCC 1XGPB 5EZIH 1T1YB 4QT5A 1RZIB 2H1PL 1A7NL 1YYMH 2EICA 5E8DH 3SQOH 4O9HH 4RAUA 3STLA 3AMKA 5FUOH 3VDBA 4JDZA 3RWFA 5JO5A 2CRZA 5C07D 3R4DA 4NM8L 5TPWH 4JY6B 4QXGL 3GHEH 4PJHA 4R7NA 4OQTL 4R0LA 5FCUH 2ZKHL 2O5YL 3MUHL 1YPZE 3PWLA 1UZ8A 5TF1H 5HDQH 3O6FA 4UMGA 1W0VA 3KXFD 4GRWE 4GJTB 3HMWH 2BVQA 2XV6B 3KNBA 2P8MA 3CX5K 3V4UH 1BZ7A 5J57B 2UVFA 2DQHL 2HJLB 3OAUL 3QPXH 2DQIH 5B38G 3AAZA 4Z0XA 2Y06H 4OFIA 4OLZH 4HIJB 3IDXL 2YEZB 1X5AA 3S35H 1LE5B 1NCDH 3LS4L 1F8TH 2J8UB 1U8JA 2VDNH 1G7IB 2AJVH 1U3HC 2AXJA 2C3GA 4NJ9H 1G9EA 1R3IH 4MA7L 5IT2L 1P7HL 1BX2A 5ILTH 4O5LH 3T3ME 4P3CL 2GUOB 4XCNB 4FFVD 5CAYB 3IYLW 4KKBC 3MLTB 4MB4A 1U8QB 1EAPB 2C1PB 1JTTA 1ZA3A 1FFPB 3G5YB 3MRPB 1P5VA 3DURB 4XMPL 3QZWA 4K2UH 5BO1H 4JM4L 3BJLA 2P8PB 3P30L 1XGTB 4X4MA 4G6FB 3TJEH 3MV9B 2MCG1 3VA2C 3WN5C 5CD3A 3SDDD 3KR3L 3SDXB 3VFGH 4HPOL 4WO4C 5ADOL 4CNIB 3D9AL 3GMQA 4LLQB 2CLVA 2ICEA 1QD0A 1N4XH 5L2JA 2AEIT 2OTWA 5IBUG 3HPLB 3QXVA 3TBYA 5F3HB 5HI5D 4PTTB 4GKZA 3RIAF 3WO4B 1ETZA 4UTAH 4YC2C 4X6EA 3FQNB 2VJXA 2KH2B 3OXRB 3OKYA 4TSAH 5IVZA 3EHBC 1Q9OA 2EDNA 4PJFA 5FYKU 1GPOL 5DJAA 5L9DL 3QCUH 4KXZH 1S7UA 3MRNB 5DTFB 3CLEL 2FHCA 2H3NB 5SWQA 3PGFH 2GAZB 1W8NA 1FFOA 1S9YA 4APQD 1HSAA 3IGAA 1CD9B 4PUBL 5D1XA 2NXZD 4JO2H 4HEME 4LLVA 3Q48A 5CILH 5FGBC 3UBXI 1NBYA 1RZGA 3PWNB 3QDME 3W11C 2FB4H 3ZTNH 3KYKL 1YEGH 5EU6D 4WFGD 1ORSA 3H2WA 1TNNA 3VW3L 1TQBC 1T4KA 1NGWB 5CJXA 2QJDA 3I2CL 1K6QL 5D7JA 1FNLA 2BNQB 4MNQB 1NC2D 5D1ZD 4WU5A 4PRHE 4P4KC 5KTEL 5IKCA 4GG6E 1F4YH 2VDQL 1W0WA 1EDQA 4HDIB 3NCJH 2P42B 3C09B 4EVNA 1M7IB 4TTGA 4D8PB 3KPRE 5I8EB 1X5ZA 4O4YH 5TFSL 4I18A 4XNXH 1X7QA 3HG1E 3H42H 3U7AA 4PY7B 5DC0A 3S37L 3TP4A 1VADA 1XR9A 4MJIA 4FQXD 5C09D 4MQXC 1J1OL 2D03L 3OAYK 3VJ6A 3RZCD 4MAYB 3GB7B 4OIBA 2AEQL 3OKLB 1V7ML 5IROA 3QUMH 3UTSB 5MENB 4QY8B 3RU8L 2NY6B 4PG9A 2DS4A 1YQVH 3S37X 1MCNA 4OI9A 3RWGB 1JTOA 1Q0YL 3RY6A 4JGJA 2P1YA 5SWSD 1QSFB 4C56E 3RWDB 4GXUN 4NOFA 1S9XB 4Q6IA 2BXZA 4JRWA 4KZDL 4UDUA 5F88A 4HT1L 1ZWIA 3CMGA 3OZ9L 4YE4L 4EI5B 3PGDA 3ZDXE 4M43L 4RMVA 3BDBA 4NZDA 4V2BA 2A1WH 2R0WL 5FA3A 2LVEA 1UJ3B 1QSEB 3HNTL 2XQBH 5CMAA 3UO1L 5DYOB 1G7JA 5KN5B 3IFNL 4HIHA 4LVHB 1JWSA 1A6PA 5CP3H 4KGLA 1AXTH 4F57H 1RURL 4IMLB 2BVTA 5F9JB 2NY7H 5B22A 2PR4H 1HHGA 4PV8B 2P5EB 5I17B 1BFOB 1BD2B 4IOIA 2R2CA 5F6IB 4QYOA 2Z31B 4J3VA 1TVBB 4HD9A 2I5YL 1AP2B 4PB9H 1SM3H 2EDOA 4YDJA 3L5WB 3MBXL 2Q76A 5EN2B 5A43C 3PL6D 4XP5H 5CEZD 3TZVC 1V8HA 3OL2A 4CW1A 3G6AA 2NQCA 4FFZH 1L4IA 3NCCB 2E27H 3SDCB 3ULVH 3OJ2C 3VFMA 3LRSB 2NW3B 4WFFE 5E00B 3L3DB 3UJJH 1WT5C 2DN7A 2IALA 3MNVB 2Y7QA 3PQYD 1JN6A 3U30B 3C8KB 1N8ZB 1J05A 2ZCHH 5IMOB 3TLRA 2MFNA 1URLA 5T1KB 5BW7A 3LHPL 4XCYA 5HPMB 5F1SA 1DP0A 1U3JA 5GRVL 2CKNA 5EC2B 4KRLB 3GBNL 4K7PL 4IRSD 3DX7A 4NO0A 3ZDZF 2DYPB 5DD6B 5DT1L 5I1GL 4QRTB 4FTVD 2AP2A 2XTJD 4OZGF 1ITBB 1FAKT 4TUKH 2R23B 1A6VL 3QG6B 1R3LA 2YBRA 1RAMA 1HCVA 5F7LB 4NN7B 5K59F 1SVZA 5D7LE 5CJ8A 1H3WM 4K7PX 5C6TL 2SEBB 4P5MA 3WIIL 4ODWB 5L8JB 3CK0L 5F1IB 1MNUH 1W72A 4L8SB 1N64H 3U1SL 2ADJB 1XIWB 3MSPA 5IB5A 5HI3C 2W0LA 2HG5B 5I66A 2VQTA 4YXLL 1GL4B 1YY9D 3MRRB 1J1XL 4TQEH 1FL3A 2I07A 5IF0B 4X7SL 1M7DB 2VAAA 3BKYH 4D9LH 3RWHB 4OZFB 3T0WA 3BEWB 5CSBA 1ZHBB 1F11B 1NLDL 3EAKA 5JMRA 3O6ML 3B5HA 2Y6SC 15C8L 4FQ1H 5E2JA 1NGPH 1JHKH 5J13B 2WQRA 1JP5A 5E03A 4LRIA 3F7RA 3ME0A 2IPTH 4F80A 4K71C 3QIWB 4JDVB 3CH1B 2QLVB 2WAHA 2D4FA 4WJ5A 3B5TA 3RWCA 3KLHC 2BOBB 2EE3A 1Q9KB 2DQGL 4WI4A 2L7JA 3MUY1 43C9A 1C16B 5DJCB 1ZHKB 3L5XH 2OL3B 4G8FB 5ESQA 5MEOA 3QUKA 3X12B 5IQ9A 5KSUB 5CEZL 1OAUL 1C8PA 5I1HL 3X11B 2WBJA 4LAJH 3PWUA 4EJ1C 1NCWH 2HJFB 1HK6A 5L0QB 1DQDL 2BDNL 4Y5YB 2AABL 4ZTPL 4R8WL 5IJVB 4ZOAA 3VXQA 1G7MA 1HH6A 3BUYA 3O8XB 3QHTC 4PJCF 4WWKD 1MCPH 4JZJA 2E3VA 4NO2A 3LKPB 3GMLA 1M71B 4JPVL 2AERT 2EDKA 1ZT4A 3PXHA 2VDPH 1IARB 3UJIH 1T03H 4P2OA 1PGRB 3WS6A 3J7HA 4XBEL 3LCYA 3PV7A 1KB5B 1K5NA 3VD3A 3AU1A 2BJML 1MFCH 4PJ9A 5DD3L 4R0LC 3O41B 2EDJA 4PJ5E 3HA0A 3OJDB 4X6DA 1T66D 3ULVC 2ARJB 1WFUA 1KLUA 2R0ZL 1JWMA 5BV7L 1LK2B 3CFEB 1GHFL 2P47B 2WUBL 5MP6L 1TIUA 1WGOA 5C0RH 2MSPA 3V5KB 1MF2H 1CS6A 1FLRL 4P5KA 4TULH 2MPAH 2X4SB 3P77A 5CBAA 5FDWB 1EO5A 1NBVH 4L3CB 4RGNB 1DDHA 4NZTH 1MJJB 5JORB 3RFZC 3LD8C 4ZUVB 1NL0H 4B7LA 3BGMB 5B4MD 1HQRB 3HI5L 1I9RH 5BS0D 2X9WA 5GZND 1QO3A 1U8OA 4YWGL 5B38A 2JIXD 1YMMB 4OCSL 2WINB 4P23A 1BQHG 2MQCA 1Y18B 2A6JB 3QEQD 1G0DA 4N0CD 2R2HB 4G9DB 4BZ1H 4XPBH 4NDMB 3KS0J 2J1KA 4DEPB 4EN3A 4PRDB 1CFBA 4PB0H 1C5BH 4XWGH 1KTLB 3R1GH 5ANMA 3NTCH 3HMXL 4OQTA 1T1XB 5D5MB 4LRNL 3BRDA 4NFDA 1Z5LB 2ADFH 1HE7A 4PRID 1SJEB 3WIHH 4LQFL 4UB0H 2VLRA 4OUUB 2A83A 2HT2D 3N50A 1OTTD 1MRDH 4JZOA 1YQ2A 2WWKO 1IEAB 2IBGA 3LKNB 5DEGB 3WL9B 4BJLA 5E5UB 2IH1B 1AD9A 1KIPA 4HKZB 4J3TA 3RTQD 5CJ5A 1VPOL 3VGHA 2WV3A 2Z8VC 4U6VH 3MBED 4S1QH 3CUPB 1NUDA 4HX1B 3C5JB 3QR2A 3ULSA 2X1QA 2VTFA 4Z5RB 4MA1B 1ZHLA 4AEHH 5E9DB 1JZ3A 5IVXF 5EO0A 2C1OA 4K7FB 4TVPL 4Q2ZB 2ATPA 3V2AR 3QCVH 3WYRA 4YHKL 2YC1A 3SCMB 3H6JA 2LABA 4XZUA 3UP1A 5B3JF 5FO7A 3BQUD 1JI2A 1K85A 4X7TB 2E9WA 5E08L 3O3DA 3GIVB 2HVJA 1F45A 1AKJA 3QWQB 4B53A 3SKNB 4XT1C 3ZHLA 1AGEB 4YK4C 2XWJA 3PJSA 5CJXC 5EO9A 4QNPE 1KEMH 2R29H 2XKSA 3VXUE 2R69L 2DI7A 2X05A 3THML 4M1GL 3TFKD 4S1DC 1FYTA 4IMKA 1BECA 1MHCB 3TV3H 2Y25A 1NQBA 2EYSA 1ZGLA 3GI9L 3REVB 4WHYH 3NVQA 1AXSA 1CCZA 2D31B 1QQDB 2YD6A 3FQRB 4JQXC 5DUPL 1EMTH 3MOBL 3WFDL 5I6XC 1Q1JL 1A3LH 3BPLB 4K3EH 4D0DB 4OCWL 2B7DT 3DVFA 1KJVA 4IOFD 4ELKA 3DXAA 1FIGL 3BP4A 4BSWB 2IG2L 1HHIA 4G43B 1PG7L 3AREC 1KULA 2VDLH 2VABA 5JXED 1XF2B 5LGJB 3IDJB 3D18B 4D9RE 1A4JA 3HI6H 1P9MC 1J0JA 3RY6C 1AO7E 2D0FA 5C07A 4U33A 5F7DA 5JNYB 2VE6A 1CGTA 1YPZF 4Z7WB 4IHOA 4EKXA 1QBMH 1MIEH 4JFFA 4CMMA 5IM7B 2BMKA 3VXSB 4GRWF 2KQNA 4WFED 4Z6AT 1ZANL 5ISZD 2AXFA 3BW9B 2Q7NA 5IBLD 3LS5L 3VMOA 5DRZA 4EIGB 3CH8A 3L3HA 1NAMB 2YD2A 3O2WH 1UVQA 1IILE 3S5LB 3C9NB 3FO0L 1DEDA 4P46A 2DBLH 1MFAL 3I6GB 3VXMB 2FD6H 1A7QH 5EORH 4TOYH 5J11C 1TJGL 4HFUH 3FFCE 2A0LD 1I3RB 2UWEB 2AGJH 2DQCL 3RHWK 5GGUA 3GBMH 1J18A 1HI6B 3QDGB 3T3MF 1OSZA 3W9EA 4AQOA 1CLOL 1VFAB 2JB5H 4ODUA 2R56H 4ZS7H 2QSCH 2EIDA 2AJ3B 3TCLB 5E8PA 1VENA 1BEYL 4HS8H 1HYRC 1T89A 3O4LA 1UEMA 5HHOB 4G6FD 1CD1A 3G5VB 4KJYB 3NZ8A 4R3SB 4D9QD 3C5ZB 3MUGA 3RZWA 4FQQA 5BW7C 3TT1H 4CMHB 4XVTL 4G8EB 5TE7L 1BQLL 1NFDA 4UT9L 1JHTB 3WCYA 4LAQL 4EDWL 4MDJB 4PRPA 4PJHE 4OGXL 5GGTA 5DK0B 1OAXH 3I6LE 5AYUL 4HMCA 2VQ1A 5LGHH 1H5BC 1V7NH 3TPKA 3GRWA 5CZVL 4PJBF 4QHLA 3QXWA 3QI9A 3MMEB 3ULVE 3PG2A 1G1YA 5TGBB 1SVCP 3K8KA 4WGWB 2DQTL 1A7NH 1F4XH 3FRUB 3ROLA 1J1PH 1S7QA 3C6LA 2Z4QB 3N0PB 1AHWA 4U05A 4NM8H 1MLBB 2IQAB 5DFVC 5DXWA 3U9UB 4F15B 4M9OA 4CU6A 1W8OA 4ISVA 1Q9WB 5GRZA 2MCPL 2ZKHH 1Y6NR 2FEEL 1QLFB 2ZJSL 4BH8A 3OBAA 3EGSA 4Q7DA 1QG3A 5KAQG 3GJFH 2YA2A 5FECA 3DYMA 1YEDB 4CN4A 4E5XA 3ES6B 3D85D 1ONQB 4O2CA 2VLKD 3W39B 5J1AB 1GYAA 1U0QA 4HUWB 2AJUH 1MRCH 3OAUH 5ICYA 4GG6F 4HC1H 2PUQT 4OZHB 1WBXB 2LTQB 3BISA 1MFNA 2P24B 3IDXH 3B2UD 1NC2A 1HH9B 4LEXL 1XF3B 5HYQA 1TCMA 5D1ZA 2FWOB 5EU5A 1D9KB 3QFJD 4LKCB 3F6LA 3QUXA 5GGSA 3QAZC 1IAOB 2NXYC 5IT2H 3NPSC 1FE8H 1IEBB 1MFBL 3EFDL 3RWEA 4P3CH 5D6CA 1Y6KR 2BSRB 1OGAD 3MRQB 1FZJB 1ND0B 3QWRA 2MHAB 2WBJC 4BFIB 1HEZB 4CBPA 4FQXA 4XMPH 5E1AA 3QO1A 3MLUH 2BFVL 4PTUB 4TNVK 4X5LA 1A3RH 4NKDA 4AIZA 3VWKB 4JM4H 1MVUA 3P30H 4KK9C 3T04D 3INUL 1QSFD 1JPFA 4PJFE 1CGWA 3KR3H 1RUAL 1I8IB 1TDQA 4HPOH 5ADOH 3D9AH 1VESA 1FDLH 1RZKL 1UEYA 3T4YB 4LP4A 4JO4L 2JJUA 5SWSA 2FX8H 3ZDXF 4P2OC 3AGVA 1HSBA 2X4UA 4LASH 3SO3C 3P4MA 1DBBH 3GSWA 4HGKC 2EKSB 3DI2B 2NPLX 1X5LA 5FGCB 3KPMB 1I1FB 4U1KA 3DRTA 2WP3T 4UIMA 2WWMC 5C8JA 4WW2A 3ZO0A 2P5ED 3RVWC 1GPOH 4U1JB 2V9QA 2XT1B 5L9DH 4JM2D 2Z31D 4AENA 2AS5M 4HBQA 4N1EA 3W5MA 4HF5H 1CE6B 1CG9B 4PY8I 2QR0B 2P44B 3BVNB 3C87A 4LLAA 2XG5A 4NKMA 4JFPA 4HLJA 2FR4A 5IBTH 5AEAA 3MUJA 5FKAA 3KYKH 3KPLA 3UDWA 4MJIE 1SQ2N 3KHOA 3IFPB 2CMRL 3MCG1 1F3JB 1K6QH 1TQCB 4WGVB 4M62H 3RVTD 3QJFA 1DBMH 1UACL 5KTEH 1CE1L 3HPJA 4N8VA 1T6VN 5D7SL 1XR8B 2VDQH 3HLAA 1TCRA 4EN3C 3U4EB 4OFYA 3EZ8A 1FZKA 3CFBB 1WBYB 3ARBC 1IBGH 5FF6B 2CDGB 3CFJB 4HKBB 4X80H 5JW4M 4GOSA 5I74C 1HILA 5FO8B 5SX4H 4OLYL 2HRLA 4Z7QE 4RFOH 3S37H 3FMGH 5C7XH 4IRSA 3CVIL 3FAWA 4DKEL 4YPGB 1JRHI 5C0IB 4GSDL 4FTVA 1J1OH 4H0GA 2MOVA 4LSRL 3L7FB 4P4RA 2OLDA 1V7MH 1HOCB 4Y5VA 2UZXB 1LDPH 5C0BB 3MREB 1P7QD 3QDJB 1YEJL 1XIWD 1MCIA 4G9FD 4FNLL 1Q0YH 3KLAB 2FIKB 4X99A 4Y1AB 2VISB 1X4ZA 5FYKL 3BSZH 2R1WA 3ARTA 1O7VA 5DR5L 1T5XB 2EC9U 4G7VL 5GRJL 4KZDH 2BNRB 1QEWA 4KKCC 1EO8L 3RVVD 4HT1H 3OZ9H 2YPLD 4YE4H 4F2MB 2PYEB 1P1ZB 3KPSA 1KOAA 4M43H 1QLRA 2VXTH 3RNKB 2R0WH 2FGWL 4HS6B 1NUNB 2NYYD 3HNTH 3V4VH 5SX5K 5C0DB 4R4NC 3UO1H 4NUJB 3IFNH 3UTPD 3PHQB 2BNUA 5CBEA 1KCLA 4XCCH 2H2PD 4ZPTB 3U46A 4ENED 3RDTB 2Z8RA 2FL5A 1RURH 1U2CA 5GGRY 1FVDA 2Y4SA 1ZMYA 3FT4A 3MCKB 4JHZA 5C2BL 1RIUL 1KXVC 1I7UB 2N1KA 2W9EH 4AL8H 3MXVL 4MCYB 2ZOLA 5J9PA 3HMXA 2I5YH 4J1UA 3P3YA 4CVZB 1S8DA 3MBXH 2MKLC 3AUVA 2ZUYA 4IMKC 4JREC 1EIBA 3MRIB 4Y7MA 3BH9B 1KPVA 2YPKA 3PP4L 2HP4A 2RR3A 3KPOA 4KVCL 1A6WL 5ITFA 4X6CB 1C7TA 2A9ML 5C0ND 3GSXA 4OI8A 2DJ4A 5E8NB 3RL2A 4WTZA 4YXKL 5MHSD 5MEPA 2JLLA 3HE7B 3D0VA 2H6PB 2DTML 4LCYB 4L4VE 3F7YB 4WHTB 1HHHA 1J8HB 4WWKA 2AQ2A 4L3ED 3GBNH 4K7PH 1DANT 4W6WB 1IE5A 5DJXB 5DJ2B 5DT1H 5D6DA 3DTXA 5I1GH 4ODTL 3OAYH 5ENWA 1E4WL 2G9HB 1C5DA 5T3XD 5JR1L 4YR6B 3VFWB 3WJJC 3VFVA 1A6VH 5KANG 7CGTA 4XP9L 5L7XL 4F7TB 1FNEB 5DJZA 5C6TH 1BPVA 4PGJA 2E7BA 1HHJB 5KSVA 3WIIH 4IDJL 5I1DA 3TIEA 2FRGP 4H5SB 3CK0H 4YDVA 2ERJC 1EK3A 4PGZA 5FM4A 4MDIA 3TBTB 2GHWB 1WEJL 4YXLH 2HFEB 4OCLC 2YR3A 1G7LA 2VRAA 2BZDA 1J1XH 3FZUD 4TUOA 4WENB 3W5NA 4X7SH 1VGEH 1HIML 4UQ3B 5FGSA 4OF6A 3MJ8A 4OIIL 1YMMD 4DWHA 3UTZB 5FOJA 4S2SB 4M6AA 5F9WB 1FZMB 1NLDH 2A73B 2WK2A 3O6MH 4WV1A 15C8H 3PV6B 4E41A 2DWDB 4J2XA 3DYPA 1CZ8L 2NY4B 3P0VH 3MRMA 4JFDB 5F93C 3QEQA 4FFVC 4AY0A 4ZUWA 3QEHB 3OX8B 5HHMD 5B21A 2QSTA 3IKKA 2DQGH 1R5VB 5A16B 3G6JE 2XRAL 3NFSL 2N7AA 3RIAK 1JZ8A 2V2TB 5EZLB 3SDDC 1CXFA 2OL3L 3DIFA 3IDGA 4GQ9L 1F3DH 2YWZA 1OAUH 5AG8A 5CEZH 5I1HH 5FK9A 1CTOA 4HIEB 3QA3A 1CFQA 4RBPH 2AK4D 1E4XL 2PNDA 1YMHA 2BDNH 4QRPD 4QF1A 3EYVA 4R8WH 4ZTPH 32C2B 4X6DE 4KMTL 5HI5C 2PF6A 1KN4L 3U48A 5L8LB 2D7QA 2C7UB 4N8PA 2WQ8A 3RTQA 1P6FA 5E9DD 4JPVH 1RI8A 4ODHL 4PRBB 2Z91A 5FFLA 1AHWC 1JWUA 3UMTA 4U1IB 5I1LA 4AYFA 4XBEH 1NCAL 1FQ9C 5F70A 1WIPA 2C9AA 1DSFL 2ICWJ 1KNOB 2EDDA 2BJMH 5I76A 1K8IA 5DD3H 2EXWD 5AZ2H 3VXTA 4Z7VE 2NY1B 1RY7B 3U0WL 5K9KB 2FATL 1QZ1A