3OZLA

Crystal structure of human transthyretin variant a25t in complex with flufenamic acid.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human transthyretin variant A25T in complex with flufenamic acid.
rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Transthyretin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3ozlA00
1TLMA 4HISA 3CFQA 4PMFA 5EZPA 1DVSA 2G3XA 3DJZA 4PWHA 5CLYA 4FI8A 4PWFA 3KGUA 5E23A 5TTRA 1QABA 4Y9GA 1BZEA 2B77A 2H4EA 3QVAA 4IKJA 5E4OA 3DJSA 5CN3A 1E3FA 2G4EA 3D2TA 5CNHA 2QGDA 4IKIA 4N86A 4D7BA 4PWKA 2QELA 3NEXA 4HIQA 1QWHA 3CN1A 3KGSA 3GRGA 4L1SA 4PVMA 1GKOA 3DK2A 3P3RA 5AL0A 3OZKA 1ICTA 4TL5A 1THAA 2G4GA 4PWGA 4TM9A 3U2JA 1ZD6A 2G2PA 2H6UA 1IJNA 4I89A 1DVZA 4TNEA 4IK7A 1DVXA 3TCTA 3GS7A 4YDNA 1SN2A 3CN0A 3DK0A 4YDMA 4PMEA 1TSHA 3ESOA 1DVQA 1TYRA 4HJSA 4AC2A 5DEJA 1X7TA 4WNSA 3Q1EA 1SN0A 1IE4A 1TFPA 4HJTA 4PVNA 3CFMA 4PWJA 5CR1A 4I87A 3P3TA 4TQ8A 3CN3A 3DJRA 4MASA 3DIDA 2B9AA 1ETA1 2ROXA 1FHNA 3IPBA 5BOJA 5AKSA 4L1TA 4TNFA 4ABVA 3DJTA 3CN2A 2G2NA 5L4JA 4TQPA 3SSGA 4TKWA 4N85A 1TTBA 4DETA 5AYTA 4PVLA 3CFTA 4ABWA 1ETB1 1THCA 5FW8A 1BZ8A 1KGJA 2B16A 3GRBA 3IMVA 3NG5A 3M1OA 3KGTA 2QGEA 3NESA 5EN3A 1RLBA 2H0EA 5IHHA 1DVYA 1BM7A 4Y9FA 2QGCA 2TRYA 2H0FA 5CLZA 1F86A 4QXVA 5HJGA 1TTRA 3CXFA 3IMTA 3IMUA 5AKVA 4QRFA 4ABQA 5K1JA 1BZDA 1GKEA 1X7SA 5A6IA 2ROYA 3I9PA 1E5AA 4KY2A 1G1OA 5AKTA 3BT0A 1Y1DA 1TTAA 2PABA 4I85A 4PWEA 2G5UA 2FLMA 3W3BA 4DEUA 1BMZA 1KGIA 5CLXA 3FC8A 2F8IA 5FW6A 1DVTA 4TLSA 4DESA 4FI6A 4IIZA 2FBRA 4TQHA 2GPZA 3I9IA 3ESNA 5FO2A 1ZCRA 4ABUA 3I9AA 2NOYA 4WO0A 1TZ8A 3IMRA 1DVUA 3B56A 4HJUA 2QPFA 1TT6A 4WNJA 5AL8A 4ACTA 3D7PA 3A4EA 3DGDA 1U21A 1SOKA 3A4FA 1FH2A 3OZLA 4AC4A 1F41A 2G9KA 2TRHA 3IWUA 3NEEA 3GPSA 4TL4A 5JIMA 4DEWA 5L4MA 5JIDA 4DERA 2G3ZA 5E4AA 4ANKA 5FW7A 1SOQA 3GS4A 2QGBA 3GS0A 4TNGA 5L4IA 3FCBA 4FI7A 3GLZA 3CN4A 4TLTA 4Y9CA 1TTCA 3NEOA 4N87A 3CFNA 4PWIA 5JIQA 3IWVA 4IKLA 3A4DA 3DO4A 3TFBA 3U2IA 3BSZA 1Z7JA 1E4HA 4TLKA 1IIIA 1SN5A 3ESPA 3IMSA 3P3SA 4MRBA 5L4FA 2H0JA 3IPEA 2H1XA 4Y9EA 5CM1A 4MRCA 3IMWA 2F7IA 4TQIA 2GABA 1IIKA 5K1NA 3CBRA 4TLUA 4PM1A 1OO2A 3HJ0A 2B15A 2IGLA 4IK6A 4Y9BA 4Q14A 4QYAA 2B14A 4IKKA 5DWPA 2WQAA 3P3UA
chains in the Genus database with same CATH superfamily
1I7UA 3WFDL 5I2IA 1NC4D 1DFBH 5CLYA 5GPRA 5A2IH 2MOGA 2VLME 4XMPL 2F58H 3TTYA 1SJEB 4C56D 2F5BH 2OMZA 3SDDC 2BVOA 1LWRA 2D7OA 2AEPL 2QELA 5I1AA 3L4TA 3IGAA 1YDPA 2AEOA 3DNKA 3QAQA 4YNYA 1JZGA 1I3GH 2KLSA 4MKTA 4EUPA 5HHMD 4EOWH 4QMEA 2V7NB 1IGCL 1PS3A 4FULA 2BNQB 2D73A 3HG0A 1F90L 1A22B 3NQKA 3PQYB 3RZWA 3QEHB 3R0MA 1AQHA 3L5XH 2K6WA 1OP3K 1A2YA 3VFTB 4NQVB 1JS4A 1AG0A 1INEL 4R0LA 2XWTA 5FUOH 2OXGA 2X0UA 2ITEA 4OCYH 3MX0B 1EA9C 3KDPB 4TUOA 4DETA 3ILQC 5JHLA 4U7MA 3GJFB 3KHQA 3HI5H 1VACB 2TSBA 1OP9A 3HE6D 4FNSA 4O02L 2D0GA 2WNXA 4OFIA 3OR6A 3V0GA 4ZNCD 1A02N 5FYKH 2OMBA 5TE6H 3PJSA 5H2BA 5BVJB 4PG2C 1M05A 5BRZE 1YSOA 2E59A 4FTVB 1INQB 2J12B 4OM0L 5AW1B 1YMMA 5A3ID 1IEHA 5IMKB 4L8CB 2AXGB 4X4XA 2ED8A 1V3JA 3F6IA 3H0TA 1JGEB 1T89A 2Z31B 3JT0A 4MSWB 3NGBC 2J4WL 1AZVA 1KPUB 2HRHA 4DO4A 5HD8C 2A1WL 4IIZA 4F24A 3ARRA 3GSQB 3FQ2A 3J27A 5D96B 2IPTH 4NM4L 1ZV5A 2NY7L 1QEXA 2PXYD 3SZ6A 4DK3A 3GRWA 1ZTMA 1WIUA 3NSFA 2Y22A 3SKMA 5D7SH 3DUSA 3HA0A 2BSRB 3QQDB 5FDWA 5ABZA 1TCMA 3OJ2C 3X3FL 5JHBA 1IGTB 1NTDA 2BP8B 5B1CA 3L3JB 4LLMB 3N91A 4MX7A 5D9SB 3V6FA 1NCOA 1XR8B 4AH2A 1AR1D 3EHBD 3P0VL 1NZRA 2O1AA 4YZWA 4J6RL 4NQEA 1JPFB 4BQ6A 4BKSC 2KLTA 4WUUA 5IMLB 5JO5B 1ZXKA 4IMKA 4PJIA 4S1RL 1QFUL 4QXUH 5SX5H 3WTXA 3VRLE 4AEEA 3QZWG 2UX7A 4P4RB 4D3CL 4OLWH 5AFAA 3QULA 1B88A 2EVHA 4QOKE 2ICCA 5IHUH 4DKFH 4HT1H 3H2QA 3JWNH 4U1HB 1GOHA 5HI5C 3V0FA 3HI1A 2DS4A 4OZGE 3CFKA 4AIOA 4F3FB 1KPRB 3II1A 5HHOB 4MXVF 3D39D 4P2OA 5CS7A 2ENQA 1AOZA 3AS3A 3TEZA 1EEYB 1GL4B 2I5YH 4ODVL 3OVUB 1THAA 1CFTB 4NBXB 4Z0BH 1RUML 2KMWA 1A1OA 1W0VA 3HG1E 4WKXA 3UTQB 1MQKL 5DZNA 2AV1A 3NPSC 4HLZH 3MC0A 1SHSA 3AITA 3GS7A 4FMKA 4Y1SA 4YHOL 4ALAC 1BZ7B 5AEAA 1ECYA 3NSJA 1R3LB 2NYKA 3JWOC 4FMFA 4QKTA 4NRYA 12E8L 2YK1H 3SQBA 2NY2C 4DPCX 4F91B 3DXAD 5L6YL 4B9JA 1L5GB 4N2AA 4TULL 4HUNB 1TU2B 3BP4A 5FUZL 1ETA1 2FD6L 4LLWA 1M71B 1DFXA 1KYDA 1NLBH 1FYTD 1Z6JT 4QRUB 3TS8A 1EXHA 4TNFA 3GXDA 3BVVA 1MOEA 1N0LA 3IF1B 1N6UA 3MCKA 4FFZA 4YZFF 1DQQA 1AQDA 3BPCB 2IAAC 3ARDC 4JY4A 3ABLB 1YEIL 1X5HA 4QOKA 3P9WB 5LXVA 1TJMA 1OF0A 2AF2A 4HCIA 2VXVH 1FL3B 1ZHBB 5C08D 5IWLC 5A7EA 1P4UA 4A66A 1OQXA 2AEPH 3HNVH 3PV7A 3JUZA 5A7BA 2C3WA 1CD1A 3AJ7A 3HMXA 3OKLB 3UJJH 1E5AA 1OTTC 4A7VA 4L9LA 1Y1DA 2JCWA 4Y89A 2HFFB 2BP0A 1BMZA 3L3GA 3P0GB 4RGNE 4XPAH 3SOBH 2OR8A 3E1F1 3MJ7A 4U1KA 4KGLA 15C8H 2VXQA 3KXFE 3RG1C 3HBPA 3MRNB 4AQ1C 3JYCA 2IH8A 1U2CA 3FO9A 2BRQA 3W0WD 4AEHL 2XZCH 4M3KB 5F9JA 1UZ8A 3O45A 2OZ4A 3K6FA 1AIFB 4LQFH 1I1AA 1ZEAH 1CBJA 2L4OA 2VL4A 4EIUA 2D7PA 5FUOL 2VLKB 4B7LA 3WN5B 3GS0A 2CKBH 3JV0A 1CYGA 4JRWA 1J5HA 2M83A 4YDIL 3BKJL 1RUKL 5LGJA 3SKOB 2V8LA 3L9YA 5ALCL 3DYMA 3DO4A 3RA7L 3ESVF 3H2WA 3QIBC 1AC0A 3ATFA 3E8VA 4NFDA 4DT2A 1A7QH 1I8KA 1IIKA 1UH3A 1ACCA 2PCPA 2JJSA 2XRAH 3CZEA 5CZRA 3V0VA 5F7EL 1HH6B 1DBKL 4XN2A 3BXNA 3MV8B 3NJXA 4UMGA 2AJZA 4PTUB 5HVGB 4QHLB 3GSRB 3MXWL 1CCZA 5FR3A 3MODL 3UP1A 1FFOA 3FU0A 1KLFB 1KGYE 3VXOB 1GJUA 4JFOA 4YC2C 4OFDA 3C09C 4MS8D 4RAVB 3WO3B 4X98B 3FZUC 2CXGA 1S78D 3KYMB 4JQIL 2VDMH 2H6UA 4CVZB 4PJ7B 1PLGH 1JN6A 2K45A 2OV0A 3HAEB 3SDDA 1L9TA 3WDIA 4X6EB 2DIEA 4NSKB 1H3WM 3BWSA 5CBAA 2VAJA 5DSCB 3GMNA 4WI9A 2VDRH 3D3VA 4XCCL 3IRPX 4QTIH 4XP6H 4OY9A 4JGJA 1QFPA 5IOKA 3S37L 4JRXA 1B6DA 1ULVA 3EH2A 3HCVB 3SY0A 4QEGA 5D7JA 2F5AL 2BZDA 1AXTH 4FP8L 1A6ZB 2RIKA 3O2DH 2ED6A 3DX7A 3GSRA 1Z3GH 3V5HA 1X6NA 1A5FH 2HKFL 3ABZA 2EIDA 5F7NC 3D52A 1AQMA 2FHCA 1QRND 2XY2A 5GSRB 5ICXB 5BOPA 5CEXB 3T0EC 5KVDH 5SWSA 2C9QA 3QULB 1CFNA 4ZRGA 5JOPE 1N12A 5E9DD 1FN4A 1H6EA 4MA8L 5JW3L 3QCTL 4Z5RB 1JD7A 3HAEH 4DKFL 3O9WD 3IGKA 4KTGA 4PJDF 4HKJB 2R1WB 5CZXC 3VXNA 5D1QB 3ROOB 4LVOC 4QO1B 5DURD 2YD6A 3L2MA 4B9CA 5INCA 2H9GB 2P80A 5D9SA 3ZUNC 2OTWB 4PCKA 5LN8A 1G6RL 2H6PB 2K78A 2UWEA 4Y2OA 1HQ4B 1BQHA 2YXMA 4JQVC 3AGWA 2HFGL 3WIHH 2AS5M 3EXJA 4R4ND 2BNUB 2EIZB 4ZUTB 4OF7A 5ISZE 4X4ZA 1RZIB 3LVEA 1J9RA 2BP5M 3VCLB 4GQ9H 5I6PA 2X42A 4AC4A 3SYAA 2AGJH 4YXLL 1YCSA 4X50A 1BYNA 5KYNA 2CBTA 1P84J 2F7RA 4K8RD 1EJOL 1BP3B 1PD6A 4PJBE 5CMAB 5MEOB 5DDHA 4XN9A 1T6VN 3MFGB 1ZWIA 4HC1H 4PJAA 2BSTB 2V9RA 5L2KB 3ZN6A 1FFTB 2FX7H 2OZNA 2C3XA 2PLTA 3EBIA 3SCMD 4ZS6C 4BFKA 2B2XL 3RTQB 3BCDA 2D03H 2QLVB 4M6OL 4J7RA 2PW2A 1E7VA 4HC1L 1HQ4A 4Y9EA 1EEQA 1BPVA 1AS6A 2CALA 4BFNA 1OE2A 2IDUA 2UY7B 3RNQA 4JFDD 2NT1A 3MCKB 4AEFA 2NNRA 1BVLB 3V5KA 1OSPH 2GTWA 1EAOA 2K9UA 1OGAA 1A6VL 4Z77A 4GSQA 3ROLA 1CDUA 4KUCF 5CJXC 1VF5C 4ENZA 4L4TD 4F8PA 4PJEF 2PPAA 3HMWH 4DUVA 5DJ6A 5HVWA 3TVMB 5MI0C 3VNZA 1C08A 5EEYA 5D2LA 4JFZL 3GNML 3MMEB 3NABH 4B9ZA 5BQ7B 4LIQH 1U8HA 3D85A 4LHUB 4AIEA 1CT8A 5T1MB 5E8OA 4JM4H 3NK3A 4BKLA 5I1IL 3ARXA 3ZQ9A 3MFFB 3VGBA 4I87A 4LF3B 4WWKA 1ES0B 4XNMA 3BP4B 3GK8L 1OSEA 2A77L 3BMWA 3TT1H 4FZEL 1J5OH 3QDHA 4PJEA 1CWVA 2FHBA 5ADOH 1KACB 2CNYA 4GW1A 4M3HA 4FQ2H 1RSYA 3BISA 2XX1A 1J1XH 1DSFH 2KQMA 2FL5B 2OMXA 3KLHC 2Y23A 5E8EB 3KYMA 3O6KL 1KYFA 5L8KB 1JYNA 3OXSB 2OJEB 3U1SL 1XH3A 5IB4B 2J2ZB 4B95C 3AACA 3TNMB 2EXYC 4MXQC 4L23A 4GMSL 2IDSA 1UM6L 1YQVH 1MY5A 1TTRA 4QHLA 1QBML 4V2BA 3GXNA 4HPOH 4L8SB 2JQZA 1S7XA 4NEHB 5I0XA 5LN4A 4H44C 4EI6A 1SEBA 1VPOL 2YBGA 1R5VA 1GHFH 2FO4B 3AG1B 3NJLA 4ELKB 1CI3M 1TQBC 1XGPA 3N06B 1R3IL 4KI5F 4NI6A 1RULL 5HTSA 3UDWA 1DVUA 2DM4A 2XPGB 2DEWX 2BSCA 4P2RB 4QHUA 5FGBA 5F1KC 3DGDA 4C4BA 3MUZ1 5J57B 5D7IA 4LLMA 3LH8A 1DQIA 3GPSA 3CXHK 3JWNE 5CIPB 3BYTA 4JN2A 3FTWA 4U0RC 4U1LA 1F6AA 2YQBA 2IPUG 4X6BA 2VR3A 4IOSA 1INQA 5SWZB 4NKDB 3QQXA 4O58L 3HLAA 3KZ8A 4HIEA 1A3RL 1HHHA 1CBVH 4Y4HD 3FOMB 4FQIL 3ESPA 3PJSB 2CMRH 3MHZA 3QDMD 1BD2B 1B4JH 4UNVA 3FUKA 4B9IA 4C4KO 1RZKL 2YQ2A 2XZAH 5GZOC 1TEFA 3HS8A 2ZX9A 4IRJC 2XFXA 1L9RA 2DQCH 1O9VA 1I9EA 1PFCA 4LSVH 1OB1A 4L8SC 4Z76B 3DSNB 3OKEA 5E6IB 3MLSL 5IVZA 3U4BL 2WV3A 1QABA 3DUUA 3O9WC 4MNGE 4UTBH 1DVFB 5F7UA 5HYSG 2ZUUA 2K4WA 1ID5I 1SY6H 3RWEA 2EE6A 4K94H 4F15B 1QSFE 2GJ6B 4FFYL 1P5VB 5GS2H 4U6XB 2XN0A 4J3OF 1L6XA 5DEFA 5T1LD 2XYCA 1FVEA 2EQDA 3CD4A 1ZD6A 3HMXL 3Q2LA 3UGEA 2K1MA 3BSHA 4JW3A 5EMYA 3WIIL 3UADA 3VRLF 2BOBB 4LSPL 1EO5A 5BXFA 4WFFE 5DEJA 3TT3L 4R0LB 4IEFA 1MJ8L 4LDOB 5J11C 3QNYA 4JY6A 5TGBA 3CN3A 3ZMEA 1TNMA 2FX7L 3F5WA 3QUKB 3BUQA 3ABGA 4N0YH 1NANH 5DEGB 2FX9H 1U8CB 2I9LB 4IRSD 2D03L 3MLTB 3PNRB 2L7EA 1RY7B 4FQPA 3RGBA 1XSOA 5GS0L 4AYID 4EVNB 5EOCH 2JF1A 1V3MA 4JHVA 4YHLL 4HSAC 2LV4A 4JFFE 3MLXL 2E47A 1LO3L 4JAMB 4J3SA 2GAZA 2NW3B 2H0FA 4KOCA 4G42A 4XOBA 4BZ1H 2FRGP 3RL1A 1KJVA 2VERN 5I8OL 3NTCL 2DKSA 2HJKB 4OZGA 4BFIB 4JK0D 5KVDE 3V9FA 1A7RL 1BQSA 1VCBC 2CJSA 3QO0A 1JMXA 4AEHH 2YGQA 2FR4B 1J0ZA 4W9FC 4UDTB 1HDMB 5J6SA 2ZX8A 1J10A 1S8DA 3SBWA 2NW3A 3WS3A 2J1WA 4HWBH 3NFNA 5JNYB 3A22A 4KXBA 3FMGL 3ZO0A 3OJVC 4PB9L 4R2GC 3B2UD 2NMSA 3K74B 2CU9A 4WNQA 1F97A 1XF1A 3UTTA 3DGGA 3LIZA 2BS9A 2UV3A 4NO0B 5ADOL 2PCXA 3MTRA 1VRSA 5EBWB 1JZ7A 3FTGA 4NM8L 1P4LA 4OZGF 2LTQB 3ZX1A 4G6KL 2H7WA 2NXZC 3E8UH 5AW8B 4JE0A 5DO2C 3CLEL 3OMZA 4P4KA 1NMAH 2BPBA 3MV9A 1NWOA 5I1DA 4JL1A 3EW3B 4RLDA 3MQIA 1QSFB 1I9RL 2GJ6E 4ZX5A 3DGGB 4JCLA 5FYJL 4CADB 1AY1H 4HDIA 3UTTD 1C5CL 1J0JA 1ZANL 4X4KA 5IFJA 2IAND 1HKLH 3STZB 1F3JA 1E5CA 1OM9A 4X6CB 4O2FB 1RURL 4FTVA 1T83C 4Y9GA 3S2AA 1OTSC 1S5IH 4WUKH 1DJIA 1X5AA 4P07A 5D1QC 3TM6A 3PP3H 4JBSA 3U25A 8PAZA 4M62L 2XETA 3DXAE 3N0AA 3EYOB 2EVGA 1JAEA 2YRBA 4Z7UB 5E2JA 4K7PL 4TTGA 1OCWH 1H3GA 1KG0B 5CCJA 2EEDA 3FHEA 3X1NA 5SWZE 2GK2A 3LKPA 3NIFB 4PJDA 3TCTA 2HB0A 1CD8A 3CDZA 5E0FA 4FHKA 5E95B 5C07B 4M1DH 4PUBL 3FTXA 3O41B 2YUWA 4P9ML 1ZLUH 5FYJE 2JFCA 3IDNB 1AGEB 1VZHA 5EHFA 5I6LA 2A0LC 3WLWD 3CZSA 4GIOA 1J86A 4WHDA 2NY0C 1DQJA 4Y1TA 1TEYA 5DHXB 3MLTA 3CUPB 4BD4A 1RUMH 3CSFA 3U6XA 3SPGA 2BK8A 2XOTA 3AT0A 2JK5A 4WK4B 2H32H 3QQ9D 4GLRI 5GGVL 4QI3A 1MAKA 3LPOA 1Q1PA 5KW9L 2JSFA 4PJ6A 3QWRA 4OCWH 4JKWA 4Y2OB 1PZ3A 1CICD 1K9TA 1P0SE 4KH9A 2HTLC 3KPMA 2VDPB 1U6AL 4KZCA 1DDHB 1N3NB 3D30A 4YC2B 1H5BB 1NFDB 2PYEB 3KLAB 4XP9H 2DQIL 3QHZL 3FU9A 1NAMB 1NAKH 5L88H 5LJYH 4F7PA 3UCRA 4KDVA 5DEFB 2YEVB 4N0UA 5K1JA 5DHVA 4MA3B 4OFKA 2FEEL 1F4WH 1PJWA 4BFJA 5C0CA 3RWEB 4M1CC 3SO3C 4MNHB 4AUUA 2RCSL 2WY3B 1XTMA 5DI8A 2LLLA 5GISH 4UQBA 1CDGA 4G7YL 2R9HD 3WHXA 1O75A 4TUJA 1HS6A 3UTSA 4Z3JA 4PY8I 1WBXB 3MLPA 4FFWC 5DUMH 2YPLD 5FUZH 4OAWB 3VXSA 2XFXB 4JRYE 1S46A 1A25A 3TYGL 4DGIL 1IU1A 1ZA3B 4PLKD 4ONOA 1H6UA 3HZKB 4HCGA 4XO4A 5E6YA 1UTDA 5C3TA 5CHNA 1KIQA 4HT1L 3TA3B 3IU3A 2UYLA 3LQZB 3NZHH 5FYKU 5DHMC 3VD0A 3IXTB 3CLWA 3H9ZA 5IJVA 5CSBA 4P3WA 3UTPE 1JV2A 4JFFD 2OAAA 3DTUB 5D7LA 3VWKD 2OK0H 1G0YR 3RURA 2I60H 1K5WA 3LRKA 4UDUA 1E27A 4Y8DC 3F62A 2QQNH 2RFXB 1L9MA 3CJJA 5D7IB 3VMOA 4F1ZA 4Q14A 4IJTA 2Q76B 3U1PA 1KTRL 4OFQA 4F2EA 2YUXA 2X4QB 1AZNA 4G8GE 5KSVB 2X41A 3G3LA 4HJGB 4XPFH 4NXSA 4KVPA 5FK9B 2AHIA 2X6MA 3GMPB 4NP4L 1WZ1L 2X7LB 2X89D 4JFFA 3CN1A 2FWLB 1RJZA 2AZAA 3PHAA 3AB0C 5AW9B 2ZXQA 1IJNA 1WTGT 4R8WL 1KXTA 3KEHA 1JGVH 2VM4A 3RWIA 1HE8A 2V9UA 5D1XC 1CIUA 4KO6A 2DMCA 2H2SC 4AGNA 5DQDL 3LAFA 4HKBA 3TEXA 3JTTB 2WN2A 4FQXC 2D3LA 2C9VA 3OXSA 1AIFA 4K5MA 3B2VL 3S35L 1RK7A 3WDHA 2WZ5A 3BZFA 5ALCH 2NNAB 4TNWK 3UBXI 1MFVA 3RX8A 3X11A 5IQNA 3PAUA 3WGVB 4LOFA 1WT5C 3QFJB 2BS71 3ARGA 4AQOA 2R1XA 5BRPA 1OAXH 2IFFH 2Z93A 1FFPA 5J9PA 4U1SA 2I32A 1KBGL 1ODAA 2APVA 3PHOB 1UH2A 4AGOA 4Y4FA 1NOAA 1ZANH 2QVKA 1ZOXA 5EU6B 1M7DB 3WL9B 4HGWA 2FO1A 1JTOA 4GS7C 2HLFD 3BJLA 4E42A 3VFNA 3UPRB 3EDFA 3MRKA 1GTFA 3OKNA 1UA3A 4Y4KC 4XNZC 2OMTA 1B0IA 2W0LA 1P7QD 2HH0H 5DYOA 1R5IB 3BH9B 1AAJA 2XWRA 3QIWD 4ZFFB 1NDMB 2LABA 3U79A 5F3FA 2E7MA 4FA7B 4P2YA 1DLHA 1M1XB 1FA4A 1T1YA 5LBGA 1NM4A 4YK4B 2R39A 2NY6D 2BO0A 3TJHD 3ZZ1A 3VXUE 1EHLL 3NJMA 1FL5B 4FLOA 2RJMA 3MRGA 2GTWB 5IHZA 3ULVD 1LEIB 2VDKL 1U36A 1KT2B 4HJUA 4JDEA 1NGXA 3O6FC 2R29H 1TZHA 2NCMA 3P4MB 4GBXB 3VDCA 4BRJA 2MNUA 1S9XA 5F9WC 1FH2A 1FJ1A 1R24B 1FNLA 4P2OC 5CFHA 1MRFL 1AZRA 4M93C 5D4JA 3W39A 2I7SA 1WWAX 5E4AA 3K4DA 4D2NA 4HKZA 3B9EA 3RJOA 3BOVA 5E9DA 3T77A 1BZ7A 4F20A 5G5DB 2W0FA 5GGVH 4I3SL 2ZOLB 3CCHB 2WXQA 3DX7B 2OMWA 2W60A 1U33A 4PRNB 4MA7H 4OI9A 5HHNB 1LVEA 1Y07A 1RZFH 2EXYD 3AG4B 4IDJH 1XCTB 1ZIBA 2VXTH 4KROD 3WS6C 3OB0K 4AYSA 4CBZA 4F9LC 2AMUA 1CL7I 3IPEA 5IGXL 3ULUH 4JHZA 1ZE3C 2AJUH 3DETC 4TQIA 3L08A 3U46A 4L0PB 2J4WH 3GJEB 4G9FA 4PJAE 4GQZA 5ENWB 4NUQA 4DW2L 3T8XB 1RVFL 4K9EL 1KXQE 4WW1A 4NKMA 2HT4C 3FB5B 4RDBA 3O6FB 1CDHA 5ILTL 4IKJA 1SF3A 3NCYS 3ZE2E 3A67H 5D7SL 5KS9B 1GGCL 3A4AA 3LEXA 3AM8C 4JFEE 2F0CA 5F7LB 1ZLUK 3RVVD 3T0EE 2O61B 4AKOA 5GQBA 1LM8V 3CBJB 4I0PD 4JO5A 5B1JA 2WKOF 1P7KB 5EIIB 1XR8A 3SYCA 3LNFA 3EO0B 4NPJA 3R06A 1IGYB 1GC1C 1BEXA 1FNSH 3WIAA 2MPVA 3S96A 2M26A 1EWHA 3RU8H 1U2HA 3NH7L 1BZQK 4DKTA 2Y7LA 5KJ7E 3TCLB 5E1AB 3NPZB 3T8XA 1KCLA 5KG9B 1IGFH 1GAFL 1GTNA 4K8RH 2BERA 5L7XH 3IKCA 3WN5A 4U4BA 4UV7H 4BGLA 5BZDB 3VM7A 5I8OH 1NCBH 5LDSA 5JYMA 1NKRA 1E6JL 2J1YA 3ZZSA 2R2EA 4RFEA 2IQAA 1FP5A 4F7TB 1PZUB 1U8JA 4ZS6D 1S7SB 1XGQA 2DQHH 2E8ZA 3D48R 3GSVB 1SUJA 1CE1H 3SDDB 3IJHB 4FQXB 2QL1A 4MNGA 4FFYA 4XNQB 1KN4L 4XC3L 3VI3B 1BQLL 5GJTH 1OLLA 3TZVB 1JFQH 2CHZA 1WICA 3L5IA 2DKMA 3WSQL 2PABA 4OM1L 4WO4A 5EBLA 3EFOB 4CN1A 4LSSH 2VISB 1NGWA 2CUMA 3CSGA 3JZYA 4N22A 2C4FT 2O5XH 1YYMH 4NI3A 3QJSB 2YXFA 3VFGL 4JY4B 5CXPA 5JIMA 1GOFA 2EUXA 2Y7MA 3BN9C 3WMSA 4GB9A 3V0JA 3VA2C 1S9WB 4APQB 1TTFA 1MCOL 3LTVA 1GGBH 1CR9L 1OTSD 4XGZA 1QLEH 1FZKA 1JL8A 2ZJSL 3MV9E 2N7AA 4GXUN 4GAGH 5KANG 1JPGA 2OMUA 5T3XE 2XXMB 3QEGL 4AYFA 1ECZA 3FCSB 1SBSL 4G3YL 2A5UA 3EOTH 3N1GC 5BV7H 1HCFX 2ZXEB 3RZCD 3TO2A 4Y4FB 4KO9A 4KKNA 4NZ8A 4ZX3A 3FQ4A 3RL2B 1QLEL 5E2WH 2R1XB 1QEWB 3BZ4B 2H26A 3OM3B 4EZLA 4U7SA 2VMEA 4IKKA 1IM9A 3VXRA 2ZG1A 1RZGA 2XN9D 4R97C 4P05A 4YHNB 1XXFC 2ZCZA 1MHEB 4ELMB 3T0XA 1XB8A 4GOSA 5E2WL 5CN3A 3ELQA 4HHAB 4NZUL 1YNKL 4WJKB 2MCPL 2EC9T 4M1DL 3PL6D 2G9HB 3QJXA 4YHIB 1UVQA 2CLRB 1XGRA 5CP3H 3W9EB 4AY0A 4TM9A 4G8IA 5LO7A 1SEQH 4MNQE 3B2PA 1SM3H 1EDQA 3O6KH 1J8SA 4KHXL 1EJ6A 1I9JH 2XQYA 3VB9A 4YSDA 1BD2D 1LMKA 3BZ5A 2P43B 2CH8A 4Z0XA 4A38A 4FNLL 3THML 1JPTL 1SY6L 2MWCA 2IQ9H 2A6JB 1A3RH 4L4JA 5DTFB 3V6FB 4MX7B 4BDVA 4FNPA 1WRFA 2EP6A 5AYTA 1T3FA 2WLLB 5J6GB 4OR1A 2PKDA 3LZFH 4Y16D 1TJGL 3BQUB 4LHUG 3TN0C 2WM0A 5LLIC 4NZFA 4ONGL 3EDJA 2AQ2A 4MD0B 1P1VA 3DRQA 3TA3A 4NBYB 2ZF8A 1X44A 4P57B 2ZSVA 3MRRA 4NP9A 4WRLA 1TJGH 2JTDA 2ZXBA 3SB3A 2GTQA 3ARSA 3RAJH 2UZYB 3ECUA 4IBSA 3BPLC 3BIAX 2XZZA 1YRKA 3CPLA 5DCCA 3RVVC 1SHWA 5EOCL 5HYJA 1N64L 3N42B 4MS8C 3CHRA 3HI1B 2BIQA 2V17L 4HV8A 4X9FA 5LXGH 4HS8L 1YN6B 4P5TB 5FO2A 3ARBB 1KGWA 5DD5L 2J73A 1T5WB 5C70A 1FH5H 2CD0A 5DHVB 3LZRA 3OKMB 4HPYL 4CILA 4DZ8B 3B83A 3B9DA 4OLXH 1MRDL 1T4KB 4W4OC 2IV9A 3A23A 2BSDA 1RXLA 1AD9B 3QUZB 3HIZA 4LB8A 4AH2B 4FGMA 2GBVA 3V6OC 4HPYH 4QHMA 5DHYB 5TF0A 4Z7NF 2VQ1B 1E4HA 4L0YA 2CHXA 4TTDC 3ULVF 1LLAA 1T2XA 4IRSC 1QFWH 2NXZB 3WE6A 4LVHB 4P2AA 2BS8A 3IMWA 4Q8BA 5EZOL 3SKMB 1B0GB 2QKIC 2R27A 1MJUL 2X38A 2GTZA 1IVTA 1XIWB 3NP3A 2VJ0A 3KDMB 4R2GB 1QFWL 1NJ9B 4YBQD 5B39B 4AW4A 1AGEA 1FGVL 3HI6H 3I02A 1KXVC 2FK9A 3BPOB 3SEPA 2AP2A 4L4TB 2IANB 2ADJB 3BEVB 4X5QA 1OARL 43C9B 3U2SA 3VD4A 4XZ4A 1TVBA 3Q6FA 5CEYB 3SGDH 1FVCB 2ATPA 3B7RL 1GMEA 4JFDB 3C12A 4QRPD 4F2FA 4N1CA 5I2IB 4N8PA 1MDTA 1RSFA 5IR1B 2BSEA 3F6JA 3F12A 3ILEA 2PXYA 2KH2B 1S5HB 3IDMB 1T0NA 1SQMA 3EYFA 3K72B 4LASH 4NT6A 2WYTA 3V4VB 1GS8A 1CGXA 2B5IC 1LO3H 1X7QB 4GAGL 1OVZA 4BK5C 1CURA 3AMLA 3ESUF 3IT8D 3TH2T 1UCTA 5B4MD 4EKJA 3EJJX 4KQ0A 1DCLA 5T33L 2WTRB 3V0DA 3VWKB 2Y7QB 3FRPB 3GC3A 1E50A 5JLZA 5IEHA 1K4DB 4KI1A 4AQEB 1I1FB 4DZBA 1KEML 4P9HC 1XO8A 2X1OA 4LPTA 2EO7A 4QWWD 3D5OF 4GW4A 3V0HA 1X5LA 4ODXB 1W0YT 3RI5K 1EDYA 4JDZA 4R96A 4PJFE 5CJQH 5T1DL 3APFA 4PSRA 3FT2A 5A16A 1D6EB 4KOBA 4L3AA 4QXVA 3KBFA 5F1NA 4HFWA 1GR7A 2PWGA 4NZUH 4XVTH 3VE0B 2WXRA 5DFVC 1G6RA 3QXTA 4KV5E 5I74B 4NBZB 2R29L 2ALWA 3TIEA 2QVIA 4XP1H 1J05B 3FYEB 2RQEA 4ZDHB 2O6DA 2VMCA 3RPKA 3OHXA 3UAFA 3RA7H 4H8WL 5HBBA 1E7UA 3I9AA 3RX7A 2XVGA 1JXDA 1OAYH 1U42A 1JXJA 3K8LA 3O9WB 4M29A 3A5VA 5L88L 4IBWA 2XJKA 1F41A 1RP8A 2GUOA 1DBKH 2AJVL 2IWFA 2GK0B 2VSCA 1IGML 1ZTXH 3CSYB 5LWYH 1E2WA 2BSBA 2WVSA 5F7AA 2Y07H 3NIGE 3WIHL 1SXZA 3FONB 3L4XA 3G5VA 4JY5H 4TVSa 1XL6A 4NJAL 1G7QA 5LHDA 1A4JB 2CAKA 1NGZB 3OKDA 5IF0A 3VFMB 4OGXH 4WTZG 3PWUB 2ADGA 2MQGA 3PABA 3AFLA 3UH8A 5CD3B 4A04A 3WELA 2B14A 5HHXH 1XCXA 3N85L 4H0HB 4GI9A 2ZUYA 5E8NA 4BZ1A 3KGRA 1E9QB 2R4SL 3FRPA 5F0MB 1ILUA 2MOVA 5C0GA 3FT3B 3D9AH 4JRXD 2UXGA 3B9KC 4GXFA 4UQ2B 5AB9A 2F74B 1JYWA 2J5LB 5JMRA 4OI7A 3SKNA 4FP8H 5K33A 1J9QA 1NFKA 2D31A 3RU8L 5ITBH 5LDUA 1Z3GL 5KVFE 4FOMA 1AYRA 2QT6A 1FO0L 3QDMB 1OAKL 4HLZG 4OGZA 3BAEL 2YPVH 5CJOH 3MA7B 3DBXA 3NJFA 4M5SA 4Z3EA 4PYHA 2QHRH 3N44B 1DVQA 2J20A 2ZYHA 2DI7A 1QSVA 3NZHL 3P3TA 1MQKH 1KSRA 1A3LL 5IVZB 1SRDA 2RB8A 4G11A 1MJ7L 3ZSSA 4Q4EA 6FABH 4RZCA 5DS8A 4X0KB 5ID1B 3W56A 5IT2L 1CD9B 4JFDE 2VLKD 4BQ8A 4R7XA 2EDWA 2ESVB 4K5OA 3QDAA 4XHQA 2VXSL 3KH3A 3ZK0A 2PETA 2V4LA 3FB8A 3HC4H 4JFQA 1YZZA 5FGCE 5HGAA 2L7JA 2VMFA 2IV8A 2CG9X 4I77L 4Z0BL 1SJHB 1T1XB 1JF1A 5CEZH 3J7HA 3O8XC 3F64A 5CIPA 4AYBA 1YA5A 2DQDH 3T0EA 4DFIA 3B2UC 1NCHA 1IARB 1UXMA 3QXVA 5EZLB 2R0WH 2GY5A 3VX1A 1OD9A 1FCCA 5EOTA 4Y0GA 1M7XA 2NX5A 3VFGH 3QA3A 3JVFC 3ZTEA 2UZIH 5DQDH 2MCAA 5I73B 3RWGB 2ICWI 1G9MH 3NFPA 3IFOA 2Y5TA 1SMDA 1T5WA 5AL8A 5ABAA 5F1SA 4W9IC 3WFEL 2J71A 2WWMD 3A6CL 1KV7A 5IM7A 4FCHA 3WMQA 3L3KA 2GK0A 2P24A 2GSIB 2QVMA 4ES8A 3AS1A 2IH3B 5IB1A 3A24A 1D7FA 3Q3GA 2DWYA 4OD2A 3FH8A 4N4YB 1DBBH 1S9KC 3N9GH 3M86A 1QP1A 4XWGL 3RTQC 2V5SA 2VN4A 4CUCA 4ZX6A 1KY6A 4KX7A 3DDFA 3WY3A 5BOZG 4A2FA 1O7VA 2OMXB 4OJYA 3GSNA 5SWSD 1FLRL 3UJJL 3UMNA 4I2XB 2FJFB 1A7PL 4KROC 5GSVB 1OO2A 2GSGA 3LNEA 4NN7C 3US1A 2R83A 1JRHH 1U8IA 4MMZB 3S97C 1JBJA 4X6CF 3UYPA 3MFFA 5HHOD 3ZDXE 1M9WA 5E5RB 5ESVA 4QYOB 4N8CH 1E9PB 2YKLL 5DUBB 1EEUA 4KZ0A 4R5XA 1C1EL 3NK4A 5D2LB 1EXGA 2D2OA 2XC8A 4A55A 4YDNA 2BIOA 1EANA 4YHML 3H9HA 3GKZA 3AADB 4R4FH 4UNUA 1OSZA 4QRBA 1QR1A 4MLSA 2GIYA 4MAYD 1W8NA 2XG4A 2FECI 2ID5A 4NIKB 2VXUL 5ICZA 1A7BA 1AR1B 1BVLA 3V5KB 1IBGH 5E4IA 1HKLL 3FQXB 2Z65C 4ELMA 5DS1A 4ORZC 1XF2B 3WKYA 2ADFL 1DEEA 1VFUA 1BFVH 3BFOA 4QRSA 3VJ6A 4YDLB 1IQDB 1RZGB 4G72B 2ZUWA 3QG6B 3TPKA 4GRMB 1QRKA 4PJEE 1AE6L 3EOAB 3DO3A 4CSZA 2FAUA 3F6LA 4UB0H 3PG2A 4L8BA 3UOAB 4FAAB 1S7UA 2BSSA 2YMXH 1H3PH 1D7BA 3MNZB 1JPGB 2OMUB 4F7EA 3BWAA 2YMOA 3FFDB 3GBNH 2X10A 3LB6C 3V9EA 4RMSA 2ICWJ 3CZFA 1M2VA 3UAEA 1QSED 2JELL 1YY8B 1RPUA 3T2NH 3C6LA 5GS0H 2ZWKA 4PWEA 1QFWI 3TEUA 3FC8A 1FH5L 3QFDA 4TVPL 2CBMA 4WCYL 2VDMB 3NCFB 4YBLB 5IBLC 4NHUA 4EKXA 1XGTB 4K5PA 3BWZA 1BZ9A 3LXAA 1UYWL 3EJZD 4ZXBA 5IHLB 4Q0XH 4WNJA 4IOFD 4XMWA 1A3LH 1AIZA 3WUWB 1LP9A 1X5GA 2DTML 2MQCA 1HN1A 3GTVA 1MJ7H 2VUOA 4OF6A 5JR1L 5JHDA 1E8XA 4M6MH 4QRPE 5CGBA 5C9JA 3HHSB 3D0LA 3HNTL 4GKZA 5DD6B 3TESA 1A9EA 3BT2L 4AIZB 3R0NA 1D5ZA 3IDGA 2EACA 2YARA 1QNIA 3LS5L 2P5WA 3OF6D 4M5ZL 4JM2C 2F53E 2ZWLT 2EDOA 3WIHA 3PP3K 1ESOA 4D0BA 2GFBA 1CFNB 4YBLC 4ENEC 2IQAB 3APDA 4RFEB 5AB1A 3U0PB 1NCAH 2GUYA 2LT9A 4K5LA 5FHBH 5BZDA 1AC6A 2VZSA 2L7UA 3CMOH 2QBWA 4FNTA 4G6KH 2OYMA 4JKLA 2EVIA 4WF7A 3MV8D 4KQ4L 1ZLWK 3BUTA 1NUNB 3ETBJ 4JHBA 4TV3A 4BH8A 4Z7IA 4WY7H 4E9YA 1O6TA 4LCYB 3DYOA 2CLVB 1WA0X 4YPGB 3MJ9H 4RFOH 4AVKA 4EN3C 2WZPD 3ZZLA 5I76B 5G55A 2YGPA 1IGYA 3TA4D 2E0PA 2UXTA 1G7MB 1QMUA 5MEQB 4KRPC 4FFVC 2VW7A 3KLLA 3WXVH 4XNDA 1PIGA 1PBYA 2JI3A 3KLQA 3UBXA 3MV8A 1W0WA 3D25B 3GMMA 5FCSH 3REWB 3DMMB 1IGCH 1OGTA 3SBRA 4G5AA 2WW8A 4IMKC 4QOKD 1RK1A 5CCKL 3FB5A 2DD8L 3H9SB 1W6WA 4OF8A 1ETB1 2XUWA 3EADA 4G9DB 4KAQH 5I75B 1CI5A 5HGBB 1T20B 1OPOA 4X4YA 4Z7VB 3C75A 3NA9H 4F37F 4U6YA 4JFEB 4K07A 4PP2A 4CJ1A 3L4VA 4BFEA 2FNWA 4M7LH 4POZC 2AC0A 3E2HC 2VO5A 4UUJA 2G3MA 5T3ZH 1BZDA 1GKEA 3WNKA 1YEHH 2ZIDA 3KYOA 3EDEA 4WFEE 4XCYA 5DJZA 4WI5A 3KWXA 1YEGH 1N5AB 2XLLA 4S11A 4YVUA 3G5WA 5I8CB 4S10A 5AKRA 4M7LL 5IKCA 3QARA 5C0IB 4BCXA 2CIKB 1DTUA 3IAQA 3KR3L 2X88A 3MNDA 2YAPA 5DRWB 2EEXA 4X0KA 4UIKH 1NBZA 1U92A 5T5NF 4AGMA 2QPEB 1PKQB 3DX6B 2YUVA 4W9LC 1GYVA 2PN5A 3EJCA 1J1XL 4G5ZL 5DURB 2ZP0T 2DJMA 3RYMA 1I8MB 4GUQA 3QBTB 35C8H 2OZ4H 3GTNA 5GRJH 1VZGA 2XTJB 2FLBT 3SE4A 3OX8B 4HK0A 3BH9A 3DOIA 2BXYA 2MNJB 3X13B 4QAMB 4JFXA 4QXGH 5DGQA 4LARH 5DC2A 1F58H 1SJXA 4WHTA 1QPPA 3LN4A 5IQOA 2HUHA 3D39B 4OLXL 3C5JA 4XOCA 4BEIA 1CBVL 4QXGL 3RVUC 1F42A 3TNNA 1KBBA 4APQD 3HFMH 1YPZE 1I9JL 3SDCD 1BM3H 4MXWH 2Q8AH 2QQKH 1AJ7H 1QACA 4PGEB 4PB0L 3MREB 3SQBB 3ZDZB 1OE3A 1ACYL 1Q0YH 4PBDA 3VI3F 3X11B 5LXGL 1YN7B 4HS8H 4Q97A 4FDWA 5I6XC 4N0CC 5JOFA 2WVVB 3E6HB 3QWNA 1MI5A 4ADGA 4CVUA 5H37H 1RMFL 5C9KA 1SFDA 2G2PA 2DIJA 2Z31C 1KTDB 2MPAH 4XBPA 3UGXA 3EYSH 3IU4L 5GRUL 4O58H 4XE5B 3FFCB 5I15H 1VFMA 2CMRL 5CZXD 2A83B 4RIRB 1TFPA 4PS4L 3MU3A 2GUOB 3RY6C 2X4TB 2GT9A 5KSAC 3I75A 4ZXBC 1Z9SA 4C56E 4G9DA 4K23H 2Y6SD 4XAWL 1WZKA 1EEZA 3QUYC 5KTEL 1D9KC 1H9VA 2WUCH 2QZQA 2FZ3B 3HUJB 4JHWL 1SXBA 5ETUB 3HRPA 3TASA 4ETQA 3E38A 1UUNA 2HFTA 4NCC1 1G9NC 1R47A 4QRAA 1XDTT 4HIIA 4LESA 5EWIH 3GRBA 3WV0A 5I19H 2RFXA 4KITB 4BK5A 5CZKA 3VFVA 4PRPB 2ZP9A 3GBEA 5PAZA 5KS9A 1YPZA 1MRCH 1HT6A 5F1NB 1PEWA 4LT7A 3L1OL 3H3PL 5L8JB 4QRFA 5FYKE 1AHWA 4IYKA 1OAXL 2IFFL 3DWTA 1MCBA 5DLML 2O72A 4X83A 3F58H 3P9MA 4XO9A 3WE1A 3FRPG 4GAYB 1FVDA 4X6DF 1JI2A 1OTUC 3TN0D 4BXSV 2WWKT 5CJQL 5M94B 3RUGA 1WAAE 3L13A 2F5BL 5AZUA 1T1WA 3FQTA 1U3ZA 4G1MB 5E7BA 3HMWL 2AV7B 2CRMA 3N5AA 3QEUA 2W91A 5DJ2B 3MOQA 1I1CA 4HKZB 1BOGB 2DV6A 3TGXA 5B3NA 3PXJA 3GS4A 3HC3L 2ARJQ 3HG2A 2C3VB 5BUPA 1XHHA 1JZ8A 2A6IB 3NRQA 1N6QL 2MKWA 1U3HD 5ADPL 2YPKA 2X89A 4U31A 5E99L 2UZXA 3GJFA 4QXWA 4MRBA 3RE0A 1IMHC 5GIRB 1HL8A 4GIPD 3FT3A 3LKSA 3JWNC 3PL6C 5FF6A 2WQWA 1HOCB 4DGUA 1CGVA 4J2QA 5E8NB 5DD1H 1UWEH 4Q89A 5KAQG 4PJ8B 3MUGA 4GRLD 2CDEB 1G6VK 1MHPH 3S35X 1BAGA 1A7QL 4M56A 3QZBA 4IBZA 4PJFB 4WGVB 1WE5A 1HCZA 3ZHLA 5B3JF 5AB0A 2Z92B 4NDMA 1UFUA 4ZMZA 5ICUA 3ARGD 4WWKD 3ILDA 1JGLL 4NRZB 4CU8A 3D09A 5LGHL 2EECA 1W72A 2PW1A 1SF5A 3UZQB 1KEMH 3FQYA 4PSPA 4U1SB 1E42A 1ASOA 2VN7A 3QIWB 5EEWA 2Q5BA 1KB3A 2FJFA 1U8PA 2F7OA 2YPKB 1JERA 1CDJA 4ZG1A 4R7DB 1I7UB 2ITFA 4YIQB 1WA2X 3G5ZB 3HZ3A 3JTTA 4L0ZA 3U4AA 2E7LA 4U2YA 1NSNL 3I85A 3QZMA 1QZ1A 4ABWA 1PAMA 1M6OB 3HPJB 3SE3A 1KXTB 2WBJD 3ZHNA 1WVZA 3STZA 4MYWB 2WSDA 3IDYB 2FHFA 3O6MH 4YVNA 3C8KB 3CIAA 5IW6A 4XBPB 1RU9H 1OPGL 1UZ6F 3QIBD 4WEUD 5E2UL 2ZYRA 3LRSA 1JV5A 2F61A 4XN1A 4H7VA 3V5DA 4OCWL 4DIXA 5JW3H 4JDZB 2WVUA 3SQOH 1EGJH 1URLA 2JKTM 2LR4A 2LAAA 3DSFH 3K2MC 2Q76A 3EXLA 3EZ8A 3FTGB 4FYSA 2ZOWA 5DZOA 4DP8X 3UBFA 2YOAA 2HPTA 4NB7A 3D3VD 5E1QA 1MCPL 2KHAA 5E4EC 1JP5A 1MIEL 2AK1H 4MA7L 3CH1A 4KTEH 2WTRA 4TS6A 3HNTH 4BDVB 2VMDA 3SDAA 1R46A 4ENED 3MV11 1TCRA 4ACTA 2WBJC 2G2RA 1Q1JL 2XT1B 3F8UB 3QEQB 3FT4A 4XBGA 5GSVA 5HDRA 1TMQA 1I1YA 2P5EB 3T2QA 1KB5B 1B90A 4UZUA 4Z0XB 1AS7A 1C9SA 1Z9PA 5HHME 5CBEA 3AY4A 5ETUA 3ZE1E 4ANVA 1LDPL 5IVXB 1X6LA 3QO0B 4WI0B 4TNVF 3V5DB 1GGYA 2CK2A 2Y2TA 4QTHB 5E7FA 4GQ9L 2ATPB 1SQ2N 3A4DA 1BFOA 1NAKL 1TZIA 1UKQA 4L3EE 2D9CA 1RK0B 1CMOA 1PCSA 4FABH 4R26L 4RNRB 3V0IA 2ADJA 5DI8B 3GSWA 2P80D 1KPVA 1P84K 3TJEL 5IBUB 4I3RL 1PY4A 3VFWB 4CW1A 2BRRH 2R69L 2ZX6A 2YFNA 4M7LT 2Y7SA 3MLRL 4DJMA 4B9FA 5D4IA 4G7YH 2NX5D 1JVKA 2P5EE 1RZJC 1DBBL 2BNQD 4JG1L 4YDVA 1TUPA 1EHAA 5AYUL 2NY4D 4BE6A 3VXME 4ZNEA 3TO2B 4E9RA 5C0GB 3U2JA 2YBRB 2COQA 1S9YA 1N18A 1ONQB 2IMNA 3MRCA 1OAJA 2JIXB 2OCJA 5FDYA 1SBBA 3K8KA 1GJIA 3KBHE 3FQWB 2LU4A 3AREA 4O51A 3OAYK 4OUUB 3X3GH 1IE4A 5KZCB 3OKMA 1DJYA 3V4UH 3N9GL 2ZTBA 4OIIH 3QO1A 3MUGB 5D1QE 2OLDA 1N26A 5KJRL 3NA4A 4B97A 5DS8B 4WW2A 2W0PA 4MNQB 3ARQA 3SSGA 1V3KA 3ALPA 1A7OH 3DURB 4PRHD 2OX5A 3TBTB 4XMKL 4K7PY 2CBPA 4P0DA 2HAZA 3ZT6A 2ZCKH 3FSZA 3MRIA 3T4AA 2VDQL 3K6SB 5KSBB 4JQVA 3BVWA 4R4FL 1KIRB 1USZA 2WQUA 2FNBA 4IOSD 3T65B 1IAMA 4CSSA 4PJXF 4NQCE 5DRWA 4WI0A 4ELME 5LCVH 3SYQA 1G7PB 1LO2L 3SPVA 1NPJA 2CLVA 2GCYA 3ASNB 3IMUA 3QIWC 4ZZKA 1WUZA 5SWZA 1E65A 3AZUA 1U8JB 1XF3B 2LVCA 3GSOA 4GEJA 1G1OA 3C9NB 3FTVA 4Q9BA 3T71A 4P59L 4U1LB 3G5XB 3G5YA 4A2EA 2VC2B 4FKEA 4OSUH 1LO4L 3T3PE 1LNUB 2HH0L 1F4YH 4LSTH 4OCRH 4TQHA 5F6HJ 3M1CA 4PJGF 1I7ZB 2KLRA 3MGOB 3KS0J 2VDRL 1AHWC 2B3RA 3MV9B 2XWDA 1BLNA 3UABA 1D5BA 1V3LA 1S7RB 3VAEA 3PWUA 4M9PA 4OD1H 5I66B 5SWZD 5HSFA 3TO4C 2OR9H 5BO1H 2XN2A 3UO1H 4L3CB 4L1HA 1CGUA 3IDGB 4G2AA 3UTTB 4N68A 3BZDA 4M7JH 1SMAA 3C8KA 3O11A 4HAGA 5C0BD 3W9EA 4ONFL 4LMQE 3EGDB 4BSJA 1ET7A 3P4LA 4WTXA 3UBXG 1MVUA 4M48H 43CAB 2J6EH 3HNSH 4OZIE 2J2ZA 4G71B 2WWMC 5KVEL 4KK6D 4U1MA 3VTAA 4XNXL 2OA9A 1U3HC 4JMNA 3TL5A 2VLLA 4JLRA 5E5MA 3TIDA 5SX5K 2Q8BH 3I2CL 3Q6FB 3FQNB 3BZ4A 4YFLI 4ZDHA 5CEYA 5F8QC 1EQWA 2JCCA 2Z7UA 4P48A 4XNXH 4KJYB 4UNTA 2VZUA 4XXCC 1D2OA 2AJVH 4PV8A 4N2CA 3X12B 4FXKB 2P48B 3KXFB 4UT7H 2QQLL 4U49A 1XSKA 5HI3D 5KN5B 3K0WA 5JMOC 1R34A 1VGKB 3BGAA 1MJUH 1MWAH 4G83A 4IBLT 1F5WA 2QJDA 3ULSA 1RUAH 5FHBL 4FFVD 2D7QA 4PIBA 5KS9F 1TYEB 1KBPA 1QR4A 1LDPH 2C9RA 2CO4A 2W88A 1MHHB 3FU7B 2NY7H 2CDEA 4C56A 1HSBB 3WIIH 3DIDA 5A2BA 4PGBB 1J5DA 4H2AA 1HOCA 4OLYH 4PRPE 4AX3A 1HHIA 1T2QH 2I07B 1JUFB 3KPQB 3P9LB 1JPEA 4N85A 3LN4B 3HHSA 2BOBA 4PG9B 4GSDH 4WHTB 4O00A 3MYJB 5K39A 3V4PA 1U3JA 3QUYB 3CNKA 1JD9A 4M5YH 3RBSA 5I18L 1JHTA 1T0NB 3EYFB 2JLLA 5KS9E 3QJZA 1CYWA 3PREA 5KSAB 4O02B 3P2TA 5IHHA 1PKOA 3P11L 1FO0H 1YEJL 4M5TA 3IDIA 2MCMA 3V6ZA 1JCVA 5ICYB 2DWDB 3B8SA 4V1DA 5IHUL 2IANA 5AOMA 4MD4B 1V27A 3RX5A 1A47A 4OQTA 1OTTD 3MGAA 3I02B 1FFPB 1UA7A 3OSKA 5F0LB 1GGIL 2ICWA 3D2UD 4NGHL 1OP3H 5I1LA 2EDNA 3MLWL 4UILH 4JKPL 5HHOE 3AG2B 4YGVB 3TCLA 2IADB 3FTZA 4M61A 3WEXB 2A3TA 4OU3A 1I8LA 1NMBH 4S1DC 4ZNEE 5LUMA 4HS3A 4ODBD 4LP5A 1MHCA 3RWDB 4JZNB 2H3KA 2PO6A 4KTDH 5IBTL 4XP1L 1EVTC 2W9EL 1MKFA 4PD4K 4BWWA 4YX2H 2EYRB 1KJ2A 2VDOL 3GGWA 3IMSA 1DL7L 4YQXL 4YK4C 4LCWB 5BS0A 3OAZK 3H9SA 4Z3GA 1P69B 4XP4H 3LQAH 4FHJA 1CLZL 1DUZB 1IAII 3GF8A 5DR5H 3GB7B 2XFGB 3NQIA 2WCSA 1Z5HA 1M56B 2CCVA 1DSFL 1NBQA 4YSAA 4JFSA 1BECA 3VH8A 1UACL 3MOAL 2B20A 3G04A 4N6RA 4EE2A 3GRGA 5AZEL 5C0CE 5EU6E 4WHYG 3RHWK 5A2KH 3T1WA 2VZOA 3FUNA 2V9QA 5HHNA 4EAEA 5DSCA 1HKFA 1U8LA 3AWEA 5E9DE 1JNNH 2VRQA 1FI8C 4HJJH 3RWHB 1B4TA 2W65B 4W9JC 4YPGA 5HGAB 3NRFA 1FAKT 3E2HB 4M62H 3JV6B 1NSNH 4FG6C 1BM3L 4FRWA 4MXWL 3GBLA 4PRDB 5EPMB 4W9ZA 4S2SA 5GGTA 2P49B 3ETBF 2VW4A 1MNUH 4MJIA 5TQ0L 2W80C 2YUZA 1H8LA 1NGXB 1YMHA 3Q3GB 3O6ML 2JIXD 1FFOB 2CDFA 3W1ZA 2X9XA 4R9HA 1ROWA 4KI5C 2AABH 5KYUA 3SDCA 3H9SE 1N67A 3MA7A 4HH8A 4KI5E 5ESAA 1EGJL 5KANI 5F21B 2DWEA 3BVDB 3IFOB 4N0UB 1QLFB 2EDQA 1FSKB 1MJJA 3IEAA 3MAWA 1KB9K 1N4XL 2DIBA 2VE6B 3B2MA 4JM2A 5IVXE 3UTOA 3S8FB 2ORBH 4WTQA 3V8CA 4FL4B 3AREB 3PQYE 4NKQB 1AFVL 1MCFA 3SKOA 3QEQE 5F70A 3P9LA 1Q9LA 4G6FB 2DRUA 3KCPB 5GGRY 1NL0H 4WFED 5CKGA 3LCYA 5EWIL 2F54B 3H7LA 4W68A 4Z7OF 4XBMA 2HT2D 5AUMA 1R6VA 4O2EB 4MA1C 4FXTA 1CQYA 1ZIAA 3K7UA 2EC9U 4PLKC 3VQ1C 2YGOA 1A4JA 4PCTA 2CDGB 3MROB 3QNXB 2CJUL 3FSVA 5HDQL 3T8MA 2EKSA 4OJFL 3TONA 4JQXC 1GIGH 3H6JA 3VSUA 2QGBA 3C5XA 3QEQD 4J3VA 5CILL 4RVBA 1UB6A 3CN4A 1E0OB 3OB8A 4MJJA 1RZIA 4MGXA 2SEBB 3REVB 1ZHLB 3SCMB 1BLIA 1FZJB 1G1KA 1X4XA 1W8EA 2F53B 3DOSA 4WLCA 5BV7C 3F7YB 2O5ZL 4N0YL 1CXHA 5B7EA 4KUZH 4RETB 2F19H 3ORJA 2IAMD 3GQFA 3N1FC 4O2FA 4ZUUB 4U4IA 1HJCA 4K71C 3S8GB 4W9CC 2G2RB 3QEQA 5L0QC 1PMYA 1E40A 1I4FB 4RBPH 5KOMC 3K6NA 3SJVE 3ZKSD 4YHYB 5LAXA 2AQ3A 2CGRH 4CC4C 2DYRB 4H8PA 1F11B 2Z9TA 3VXSD 4L3CA 1LL1A 3O6FA 5EFIA 1B0WA 4XNQA 3FDWA 3BKYL 3IETB 4PTTB 1EO8H 4LQFL 4Z18A 4PJXA 3H54A 2H41A 3EYVB 4WKZB 3QORB 4HJSA 4XO5A 3RVUD 1W0VB 4PVNA 3NSDA 2YA1A 1I7ZA 3MRHA 4RBPK 5MEND 2XYBA 2GI0A 3MBXH 4KXAA 1WEJL 4X9IA 3DRTB 1A6TB 3U6RB 4PRHB 5F7FA 1ORQB 4J3XA 3PDOA 1TTBA 1XF3A 3JWOL 1KTBA 1FGVH 3HI6L 4X6FA 5E9DB 5FIEA 1O7SA 2VN6A 5F7EH 3P40A 5D7KE 1G7PA 2FR4A 2CLZB 1L9NA 5KZCD 4JFDA 5EZIH 4G6AC 4DPRA 2ARWA 4H40A 3ALXA 4MQXC 5FFGA 1WFIA 2E9BA 2IH3A 43C9A 4I1PA 5SV4A 5JHDB 1K2DB 3O3DA 2ZUSA 1OSPL 2WD0A 5IM7B 4A7GF 1YJDL 1AGBB 3EH1A 4IGBA 4TVUA 5GGSA 2APFA 4MB3A 1IEAB 3ULUF 4QIRA 4XNYL 1MCWW 2YAHA 1AKPA 1NA8A 1NBYA 1XF4A 1JZIA 3PGCB 4NHUB 4NNXA 4UQ3B 3SBWC 4HJ1A 1MLBA 3DKHA 3ETTA 4HD5A 1G7LA 1DLFH 3FQWA 4O51B 3TBBA 1XD0A 1TG8A 4G70B 3EGXA 4XBEL 2OQJB 2NX5E 5ACZB 1JNLH 3MBEB 3HZYB 1K4DA 4B9PA 4H20H 2BSSB 4C59B 4W6XB 1MNNA 4EO5A 4ZD3H 3MA9H 3SZKC 5IMKA 4A7GA 4L8CA 2YPLA 3BSZL 3BVTA 5D2LF 3ULUC 4PY7A 1O6SA 4RX4A 4EJ1C 1IQDA 3BIKA 2HJLB 1OPGH 5DF0A 3EBHA 2DWXA 3OG6B 4MAYC 3OR6B 4YSTA 2E7HA 5IR1A 3CVDA 1BXVA 1FRGH 5K69A 1WCQA 4Y2LA 3RTLA 1YEDB 4WQOA 4KXCA 3U2SB 1ZPUA 1OP4A 5I1CH 3R4RA 1QUNB 3GZOA 5EB9A 1RI8A 4PRPD 1BFOB 3A0OA 4G5ZH 4Y4KD 1FRGL 4D7BA 4PJAF 1IM3B 5I73C 4QTHA 1HYSD 3WMPA 1TZOA 3GMOA 3FB6B 4Q9CA 4OV6F 2XV6B 4JO2H 3RFRA 3RNKB 3SGEH 1HL5A 5KVGE 1WGOA 1CE6A 1N0LB 3IF1A 1OGPA 3MRKB 1QPKA 4QCIA 5EO1B 3ESOA 1AD0A 2JTYA 1LYQA 4OCNC 4JJOA 4YNYB 2IPTL 4NM4H 5D1ZC 5DD0L 3F7QA 4PRPA 1FFNB 2WXKA 3QQ3A 3ZBMA 3HUJF 1AD9A 3QUZA 1N8ZA 2MFNA 2OMZB 1X4ZA 4W6YB 3QFJA 1VCAA 1PDKA 4FKKA 2MNWA 2FO4A 1HCYA 1JMZA 5JTWA 3UTQA 2MHAA 5GS0D 4TVPH 4WCYH 5HYQB 2R0LL 3KMDA 4J3TA 4OAWA 3WN6A 1SYVA 3MRDA 4JO3L 4KH2A 4KO5A 5EDXA 1KENL 2DQEH 2QGCA 3CHXA 1F86A 1LK2A 3ARTA 2DTMH 3K2IA 1LEKB 4AMXA 4U1HA 4KJQD 3AGVA 2R9HC 4DVRL 2JCCE 3WFHB 1CQKA 4N1EA 2XWJB 2X7LA 1IM9D 1KBWA 1IV8A 3ZDZF 1COBA 3S37X 3CZKA 2FL5A 4R7DA 3ZO9A 2DM3A 1A8JH 2X4OB 3NA9L 3U9WA 4IRZA 1PLAA 2KUTA 3KPOB 3O81A 4XHJC 1TZ8A 4LE8A 4H25A 1C5BH 1QI5A 4TQEH 4KRMB 3QQ3B 1S7QB 3ULAB 3QDJD 5JZ7D 2A77H 5LBSH 3QT2A 3RGVC 4DEPB 2F8VA 3LJ3A 1I7RA 4E41B 1YEIH 1RP9A 1QHPA 2X6CA 5E8OB 2CO7B 1YYML 3N44F 4PLJC 1OCCB 3SO5A 4CMHC 3DUSB 2VXVL 2WKLA 3L3IA 4PJXE 5B3SB 5GJSH 1XQ4A 3M07A 4GJTB 3TFBA 2DW5A 3HVDA 5AYUH 3C5SA 1P5VA 3AQDA 5IQ7L 2X4UB 2YSSB 3T04D 5K9JH 1R3HA 4HUXB 3H7BA 4RMQA 4TLUA 5IEHB 2Z8WC 4M00A 3WJLA 1MFUA 3DPBA 4ABQA 1DSWA 1OM3L 4WGKA 5E6IA 4TUJB 3DSNA 5EZPA 3S3CB 2G9HA 4MYPA 1G7JB 3GFUA 3MDJA 1GC1L 1KCKA 4Y5XA 4V1DE 1JDCA 3X17A 1A7PH 2VLJA 5CU5A 4QRQA 2IBBA 4JFED 4LSTL 5L9DL 3KYNA 1B2WH 1NLDH 2YHGA 4ZODA 2C3VA 4AI7A 5C0IA 3QYNA 1WFJA 3LKOB 5K59E 1IM3D 2Z8SA 2K4AA 3ATEA 3BKJH 3QEUB 1T6BX 1MRFH 2MOQA 2X44D 1HAWA 2Z31D 3F83A 3IPFA 2OMVB 3HBGA 1W2KT 4N8CL 4GRWB 1TYRA 4LNVA 1ZXQA 3TBYA 1U93B 1IC1A 3TWCH 2I85A 3QDJE 4HXBL 1XEUA 3MBEA 4WVRA 1PX3A 5A6MA 3R8BB 4KK5D 1TKWA 2YOCA 4WI2A 3CDGB 4Z7UF 2XZCL 3NZSA 4E2OA 1QUPA 4HUWB 2XPGA 3IPBA 3DECA 1CVRA 1ITCA 2PR9A 4OCMC 2A73A 3QWOA 4GMTL 5L4JA 2BNUA 5DMJB 4AEIL 4ALAL 3QXDA 3GI9L 1QO3A 4G80B 2V7NA 2CKBL 1NCTA 2WLYA 4S1SH 2QKIA 4ZPTB 5E08L 5KVEH 3CVHH 5F9OH 4QPEA 3K2KA 4GRLC 5BS0E 2F54D 3FH5A 4WO4C 3NG5A 4O5LH 5MI0B 2FECL 3VFVB 2Q8BL 4LKXB 4GRWH 4ADJA 3MUJA 4G6FD 2IGTA 1U58B 1PY0A 2R56H 2WQXA 3O2VH 2BVQA 5DZPA 2HVBA 4Z7UA 3GBML 5EOCJ 4Q56A 5I1KH 3RIFF 4LPYA 4D9RD 2ITCB 3BEWB 4IS6A 5C0AD 4FA8A 4W4NA 2XWBB 3TP4A 3W3BA 5LQBL 4JRLA 1F1AA 3AU0A 4BFIA 3CFEB 2HN7A 3LEVH 3PDOB 2ZXWB 3RIAF 3TIEB 1XGZA 1A5FL 2OK0L 4NKIL 1U3NA 4DN4H 3FAWA 3WYRA 3ZYZA 5J1AA 4HDIB 3OZLA 2PYFA 1IJ9A 3KVDD 3LRHA 1MCIA 5F6IB 5EF3A 2WQRA 4PRIA 1IO4C 1KCRH 4TOYH 4GG6B 4YDJA 1AHKA 4LVHC 5B7FA 1NCBL 1USQA 1SMOA 3S4SA 4YBHA 2ATKB 4OLVH 2YPVL 4B5ZA 4NUGH 3MREA 3AY2A 5EBWA 4KY1L 4X98A 4X8CA 4IRJD 2FQFA 4AVJA 5E8DL 2QPDB 4JMXA 4GP5B 1QYGH 1L6ZA 4I13B 3UGUA 1C7TA 3LIZL 4NQEE 1NGPH 3ZVVA 5I1HL 1C5DA 2EDJA 1BVKB 4PMFA 1DVSA 3RZCA 1WJ3A 2BNRE 1UWGH 3D0VA 3DVFA 4KU1A 4LVOB 4U1GC 4A68A 4QJ4B 2D0FA 1N59B 2IWKA 4P5TC 1GGIH 2VDOH 3SY6A 3BQVA 3L9EA 2Q6WB 1XGUA 2PNDA 2H32B 4P2CG 4G8IB 4UT6H 2EDHA 4I89A 4L8DA 5CR8A 4Z76A 3POCA 3JBG7 5KYYB 4JAMA 2A9NL 3U7WL 2GC4C 4XI5D 4ANXA 3CZLA 3HLKA 1IAOA 2BZCA 2OULB 2DAVA 3DJRA 2BY2A 3VXQA 4N9GB 5IW1A 2CO6A 5B39G 2BRRL 1RUPL 3CFCL 3F84A 2WUBL 2F53D 1IFHH 1YEWA 1OOAA 2FO8A 2V2XB 3QRGH 4Z7VE 1T2JA 3CMOL 5E9AA 3IGUA 3VVVA 4ZT1A 3MYZA 1KJMA 4UANA 2E5EA 1O9ZA 4QF1A 1S9XB 4B9GA 3I9GL 2XQBL 3C87A 4JO1L 1A1NA 1LK3L 1WWBX 4AYFB 1PF3A 1ZVNA 1R3KB 1DJXA 1JZFA 4QO1A 1T4KA 2DICA 3BP7A 2FIKB 2XA3A 4HMEA 5C8JB 5L0QB 2P46B 5KBPA 3FYIB 5L9DH 1T7ZA 3BUBA 2XQ0A 2C7FA 1KCSL 2NDFA 2ED7A 1MCCA 4OTXL 3I9PA 5IWLA 2ZX5A 1OAQL 1P9MC 1WISA 2JB5H 3JV4A 5DJ0A 5I71C 4YE4L 2HP4A 5SWSB 5GGSY 1FDLH 4R7LA 1UENA 2OJZH 4HV8B 4MJID 4K9JA 3OKEB 2E75C 2ZWYA 3QE5A 3D7PA 1JWUB 5TE7L 4B0MM 2HJFB 2BHUA 5HYJD 5G2NA 3N3EA 1ZT7B 4HMDA 2R2CA 5J9PB 3FW6A 3QDGE 4P57A 3FOMA 1WAAA 4DP7X 2UYLB 5KW9H 2HZHA 2AKRA 5FYKD 1FQ9C 5DJ8B 1S7VB 3B43A 3VXSE 4AG4H 3K2UL 3KD4A 4MA1B 4M9OA 1U6AH 1IAIM 2OSWA 1WBXA 2YD8A 1EZLA 1TNNA 2R56L 3TC9A 4ZFZB 3LMJH 2LFEA 3N40F 4S1DD 2GSIA 5C71A 5F93C 1R33A 3L3KB 2MKLC 3MRPB 5ESQA 3ZRSA 1PLCA 2Q7NA 25C8L 1OE1A 1MXGA 2D7MA 3AREC 2COVD 3EO1B 3P2BA 5E4OA 1UM6H 4GSRA 5GISL 3WHE1 2FYYB 3IAGC 3WJMB 2C8NA 4GNKB 4IM8A 1E8YA 3VQMA 5EEUA 3HG5A 2FX8L 3ROLB 3VXUA 5GRJL 1UEYA 2VOTA 1E67A 3KYKH 1BQ5A 4LFHD 1QD0A 4TNEA 1JJUA 4HA1A 3DK0A 3MLRH 4YDMA 1E27B 3Q1SL 3VI3E 3K4AA 3WNLA 5C0FB 1CB4A 4FQIH 3I50H 3WIFB 5FDWB 1DDTA 2DQMA 5BW7C 4DFHA 1NDGA 1V8HA 1X9UA 2IADA 3EGSA 2WC7A 3MOBH 3LQZA 3C6LB 4PJEB 3D3VE 2G5BA 4M6NH 1F3DJ 4KK6C 2IAMA 1NL0L 4ZW5A 5BNXD 4LBAA 2MTPA 1ASQA 2DQGL 5EORH 2ZNXA 5E00B 2HLEB 2YEZA 3AAZA 1LD9A 4LOUC 4BKLB 1WK0A 3WCYA 4GUPA 4OZHF 3IJSB 1MFNA 3V4UL 1HI6A 4IDLA 4WU5B 4IMLA 2B4CL 4FN0A 3T77B 2E8YA 5K9KB 2P8PA 4GRLA 5ERWA 5HDQH 2NY5L 1NKGA 5HI3C 3ZKMC 1I9IL 3LPWA 5AVXB 3MYJA 3V4PB 1KT2A 4JDEB 1T7XA 4XC1H 5JHDD 1OB0A 3CQPA 2H9GA 2CM5A 4HSQA 2VDQH 5EIIG 1OT2A 3B9KD 4EDWL 4N2FA 4NC1C 5IFJB 3TV3H 1DDHA 1JUFA 3ZDYE 3VQ2C 3QZNA 3HN3A 4UM8A 1M1XA 3Q5YA 3T6XA 5A2FA 2Y5QA 4H8UA 5ECJE 5IOPB 1OZUA 4N8VB 1ET8A 2Y3NA 2FIRT 3F58L 4LSPH 3QEHA 1Q72H 1R5IA 4MB4A 5DFVD 2IDTA 2OSYA 5CEXA 4LEEA 1SDAB 5DQ9B 4Y16C 4WU5A 4YDJB 2Q3XA 1XH0A 2BCKB 2XVBA 1K5NA 5IF0B 1AO7A 3NIDB 5IFAL 4R90L 1U8QB 4I2XE 1HNYA 3NSCA 2J6EA 5F88B 3G5VB 1F3RB 4LASL 4ZMYA 3R4DA 3P3SA 4K8RL 1CZ8H 4KO7A 4H1LH 3GMNB 5J4MA 2AQTA 1U91A 1AGDB 3ATDA 1KWKA 1UD6A 4JQIA 3EUDA 2KYIA 4NNPL 4QRTB 2H3NA 3RI5F 2VLLB 4FTVE 2YJQA 4JLRB 4QR7A 1F00I 2EIEA 2J55A 4FX5A 5JYLA 4OLEA 5C2UB 4QRRD 1NCUA 4PU2A 1WBZB 4OZ4A 3DI3B 3KXFD 2E9IA 3CSPA 4K2UH 4LLAA 4BH7A 4JHUA 1E4KA 5FXCH 2ADYA 1P7KA 5EIIA 2UZPA 3GK8H 1N6QH 3VWJD 4MJ6A 3HB3D 1K8DB 4XAKD 3K6OA 3EYQD 4PJFF 3VGHA 4ZZFA 4F7CA 4FLHA 3DHMA 3ME0A 2R4RL 1NGYB 2BNRB 3CWGA 5I66A 3QXDB 1TJHH 3T0DA 4EI5D 3KBEA 4XXWA 3K2UH 3M1BB 2BNQE 2P5ED 4RMBA 2WXJA 3B37A 3U7YL 2EE3A 2MRYA 3VYOA 1LNUA 4X5RA 1GZPB 4NM8H 4NUPA 1JTTA 2P8MA 4YO0B 5FO8A 1UD3A 3HKFA 4P23C 4PHZA 1ZRUA 5HHXL 3GZQA 4UT9L 4FERA 5JNYA 3D3VB 1YEEL 4C57C 1SBSH 4ZTEA 5FYLE 3O45B 3WHE0 4D0CA 2K6YA 3BRFA 3FT0A 5BRQA 4P99A 1JYXA 3H3BC 3VDBA 2ADFH 4KK8D 3V7AE 3IU3B 1P53A 1IL1B 3W81A 2K0RA 2XHNA 2A99A 1LJMA 3BCFA 4DGYH 1SLWA 3T65A 1KEGH 1TJIL 5ID1A 3HVNA 2Z8VC 5E2UH 1VACA 3OWRA 4CMMA 2NXZD 2VZ3A 4E0RA 2B8OT 5EV7A 2JKSA 3WTYA 2ZCHL 5CN2A 1YNKH 3J8F7 2V5YA 4MNQA 4WI3A 1IGIL 4HETA 1DLHB 1L3WA 3ZL2A 5FFLA 4QT5B 4XNUH 1QI4A 1BD2A 3DA0A 5J06A 4OZFG 1U8OA 2NW2B 4GQRA 2BIHA 2WBKA 3MOBL 3OKKB 1TEGA 4TMPA 2C3HA 4KHXH 3CGTA 5HPMB 4O2CA 4HEPA 4LSUH 2VABA 5D7IE 3C08H 3WE6B 2MPAL 2VYRE 4AKPA 3OPUA 2DQGH 1A4KA 4EUPB 2GITA 3WTUA 1EFXB 1RKRA 2DOCA 4LLWB 3CVIL 3S3JA 1YDPB 12E8H 1LTXA 3BLPX 3MGTB 4P8QA 1NEZG 1PW3A 1W91A 2NYZA 3LQAC 3EG9B 1UM4H 5C7XH 5JXEA 3VD1A 1HHJA 1QTYT 4W93A 4ELKA 1HXKA 5HPMA 5D2NA 3U30B 4ZW3A 3QDGB 4LCVA 1NGZA 2ZXCA 4QTFA 2YD2A 1U8MA 5FCUL 3QP3A 1ZSDA 4AL8H 4JRYB 3FONA 3PP4L 4QRQB 3O4OC 4CC0A 4LNRB 3ARBA 1J8HB 5DZVA 5BQDA 3RFZA 3II2A 3BI9X 1EV2E 2ZPKL 3CSYA 4OT1L 1WFUA 3CFDA 3FCTA 2FGZA 3O3UN 4M43H 3DX2A 2UXVA 1KG0A 2XPZA 1F1GA 1NCDL 5EG6C 5LNEA 3ULVC 3NSYA 4Z8FL 1TQVA 5DC4B 2X4UA 5E8EA 4UQEA 4XVUC 3MRRB 4P9HL 5FK9A 4A7SA 5IREA 4ZUVA 4IW4C 1IEBB 1A6PA 2H47C 4MBRA 4GW1B 4Z7QF 3ZKND 5EU3B 3H9YA 1XF5B 2X4QA 3V55A 5D6CB 1BVKA 4JO1H 1ORSA 3BQUA 2D7TL 4FZ8L 2YZ8A 1I7RB 1T3FB 2P8MB 1WGVA 4QRUA 1PG7L 2X3BA 1Q94A 4C4KT 4HVBA 5AAPA 6CGTA 2BSRA 2EXWC 2XBTA 1EAPB 3VG9B 1U8HB 3ZDXB 2DQTL 3D05A 1PU0A 4HJIA 3RNKA 5F89A 2N1KA 1FFRA 4HQQH 2EH7H 1KDJA 4J23A 3BKYH 1NUGA 4NQCD 2EEFA 1NGYA 2BNRA 1RV6X 1ZT4B 4HU2A 2MCPH 5I5JA 4XVSL 3IB4A 1CFTA 4FE9A 2YKLH 1AS8A 5JIKA 3SDXF 4LAQL 3UP6A 2Z31A 4MJ6B 2AXFA 5AVYB 1TTAA 2MIZA 4HJ0D 2DLHA 3BD4A 1LEKA 2YAFA 4YHIA 1MAML 4BH7B 4YSEA 2P7TB 3HE7B 4M8RA 2NSXA 5FYKL 2GQHA 1YEHL 5BVJA 1JZHA 2IDCA 4OW6A 5MHSE 4L4TE 2C7UA 2XV2A 3OD3A 3GM8A 2N1TE 4WW2C 2HJLA 1ZGLP 1JHKH 4LIQE 3ZSTA 2OMNA 5CD5C 1NIDA 5K5YA 5TPWH 4BQCA 2GEEA 4WUUB 5DR5L 2DF3A 4S1SL 1NEUA 3AG3B 2D8KA 5AQ0A 4EF3A 2WJ5A 2XWTB 4ODWB 1KYOK 4LMQI 2WBJB 4D8PB 2LFGA 3LEVL 2VR8A 4LNRA 2CRYA 3WLBB 3FSOA 3EBAA 4L4VE 2YD7A 2X1QA 3EIFA 3KM2A 3JVGA 4YOKA 5E4EB 1FAIL 4Z95H 3MRBA 3ZXAC 1D5IL 5HD8D 3D85B 1S9WA 3S5ZA 4NNXB 2NZ9D 4LKCA 1SUHA 3IE9A 4PJ5D 5I1KL 4AL8C 2DMHA 5CGYD 4M4RA 4MDRA 3DJZA 3O3BB 3VFSB 5AG9A 5JDJA 1WAEA 4MHHI 2NY3C 4LP8A 4JQIH 4BFBD 1VKXA 5KBDA 4M7ZB 3QQ4A 4R4NC 2KDGA 2GITB 3QCTH 3T6QC 5E03A 1K8IA 4E9LA 4UAOC 2C9XA 5CKAA 2UZXB 3OSVA 4HK3J 2BWIA 5JW4Q 3UO1L 5IG7A 5FM5O 4ALAH 4GAJH 2ESVE 1JPSL 4ZO8A 1FL6B 2F18A 2O5YL 4GP8B 4L3FA 1UQSA 2F19L 3CN0A 4H8WH 4QT5A 2X9YA 2A6DA 4IDJL 5ITFB 2DTSA 4JFPB 4UT7L 1OAYL 2GVYA 4N2OA 2OTUA 4FQHB 1FWXA 4FKHA 2OSLA 4K8RC 2WZPA 4PRBB 1F3JB 1T66D 3EDDA 1ZWIB 5FA3B 2R7EB 2CGYA 4DP2X 1G9NH 4CADA 2VDNB 2L8AA 2UZYA 5D1XA 1GZPA 2CSPA 4NQVA 4IOIB 4DTGH 3BC9A 1T0MA 3MR9A 4LRNL 2R15A 2DM2A 5CBAB 3EGXB 1JNHB 3IBOA 3FXIC 2WTOA 4M6ML 5F7KC 1ZV9A 3JQOB 1W15A 4Q7DA 1GY1A 2CHNA 3L2LA 4KQ4H 4JPSA 4JG0H 1G7IA 1VJSA 4R0LC 4HYTB 2DH3A 3LSOB 4RAVA 5D5ME 1I1AD 2ED9A 2KZBA 2WIMA 5AKVA 4OD3H 5C0FA 4XMTA 3UJIL 5ID0B 2LGNA 1CIDA 5F7MC 2ERJB 1JNJA 2F9BT 2LVEA 4Y88A 2FEDD 4F33A 2DMBA 3PL6B 3B1UA 3NH7H 4A37A 1WZMA 3IAPA 4TN9A 2A6JA 2MQ3A 2ZUVA 3VXUB 1IC4L 4G6JL 2XV0A 1L7TL 2VMJA 4F15C 4OD3L 3UBGA 1XD1A 2R0ZL 3QJHA 5DXWA 3LKNB 2KERA 1BVNT 1RL1A 1SEBB 3Q6GH 5CCHE 1OTUD 2CLZA 4KV5F 1FN4B 3Q44A 4PIRF 3TH4T 3OAYH 2V7HB 3WFHA 1BIIB 2JWYA 3TH3T 5DLLA 4B50A 1ZDSA 3S88H 3MRPA 5ESQB 5ICXA 2JJVA 1T7VA 3PWJA 3U6RA 1A6TA 2ZUXA 3CFNA 4ISVA 1OWWA 4KKAC 1YEJH 3K6IA 2WKOA 1NCCH 4DVRH 1P4BL 2BOCA 3CC5A 3KPLB 4JKMA 1UZ8B 1VENA 3Q8AA 4U7KA 4H1LG 4ODSL 3O0RL 1QQDB 4HCFA 4N28A 1MQ8A 4QKXB 2PMZA 5T1JA 3JWDC 1HHJB 4NQXA 2X4SB 2XA8H 4NQDA 4MHHG 4OTXH 3QG7H 3F5WB 3TNNB 1FJ1B 1R24A 4ZFGL 5IY5B 3QNYB 4JY6B 4KWUA 4AV5A 1JF5A 3TJHC 1E3FA 2JQMA 4JFOB 3T0ED 1MFEL 4OIBA 4PPTA 3ZTNL 1NQBA 1TQBB 4LZKA 1DQVA 4FEIA 5EC1A 3GLEA 3GKWL 1OP5K 3SYOA 1D9KA 4PWGA 4FXLA 1BJMA 1MJJB 3J07A 2NR6D 2XQYG 3JV4B 3E6FA 3OHXC 3TVMA 2F15A 3TEWA 1QOKA 5A43C 3SDCB 4FQLL 4Y2DA 1DN0B 3BP7B 5C8JA 2AXJA 1IKOP 1UH4A 1UB5A 1HI6B 1YC8A 4FG4A 3PPEA 1CLOH 1UT9A 5BVPL 4HWZA 4OSUL 2W9LA 3U4KA 2WWNA 2WXFA 3K6DA 1D7DA 4F2MA 5E00A 3CHQA 2PTVA 5CJ5A 4IGBD 3VI3A 4D9RE 4OCSL 3AT9A 1QFHA 4GT7A 4ELDA 3T6VA 1WT5A 3BIKB 3HC2A 2CDGA 2CK0L 3QNXA 5HJDA 1HNFA 1TLKA 3MZTA 2VKXA 4TF4A 4NKDA 3V0WH 3SKJH 1XH2A 5D6DC 5I6XB 4JPIA 2R4SH 1C7SA 4GUPB 2Q87A 2IALB 5AUMB 1QSEB 1BM7A 2B9BA 3QI9D 5CLZA 5L2KA 4LOUD 4ZMQA 3VXUD 4OCXH 5FYJU 1PX8A 4FLQA 2QFRA 4M48L 1KF9B 1M6UA 3RVXC 3OKLA 1RULH 2CE6A 2X87A 3TWCL 2QPUA 2HFEA 2MH4A 3DDGA 4KKPA 4ECNA 5KG9A 4FNLH 3THMH 3MA9L 1C16A 3QR2A 3MI6A 5TK4A 2NSMA 2R0LH 2AEQH 4G7SB 3BSZH 5BZWA 3O6FD 4P4RA 3TLRA 4OF5A 3DX3A 5IBLD 1KENH 4EI6B 1GOGA 4WFGD 4F7CB 3W9DA 4WWNA 4BSVB 3BPCA 4AV0A 3VFRB 2OTWA 3KW8A 5EIVA 4P2QD 3COOA 7CGTA 4RAHA 1IVLA 1SOQA 4GYBA 1T66C 4MAYB 4AYMC 4OCLC 3GXTA 1LQBC 2DLEA 3R7QA 1IC5H 4J27A 2NY2D 5T3XH 4UT6A 5K9OB 1DQDH 2DMGA 1KLGA 4K3HA 3BVNA 4D9LH 4YGVA 1AGFB 5L2JA 1C16B 1KFAL 4MD5A 4GI8A 4YHPA 5LQBH 1ED3B 1NLBL 1U91B 2EDMA 3GLDA 5L2KE 3LZFL 1AO7E 1ZT7A 5LAPA 3MBEC 3BP6B 2OL3B 3DRTA 2FJUB 4AE1A 5DMIH 3K5SA 4NC2B 3ARDD 3P30H 4WWKB 5IFAH 1WLHA 5H8DA 4JDTH 5ICYA 2OSLB 1S7VA 4IKIA 1RJYB 1SLXA 5J1SC 2X3CA 2BCKA 5IQ7H 2W0FB 1W9XA 2DB8A 2DBLH 1KIPA 2VLRB 4ZXBD 4DGVH 1JHTB 3Q8FA 3QYCA 4P3CL 4F7MB 1KCUL 3TO4A 3WFDH 5IOPA 3Q2NA 3L3HB 5TFSH 2LU3A 1NAMA 3QPXH 4AMKL 5BRZD 1UD5A 1L7IH 3OAUH 1YY9C 1PG7H 1FBIH 3GMQB 2B4CH 1UXLA 5CP7A 4KMLB 4KRPB 3FHQA 1EHNA 5GRYA 5E24E 3QJTB 2QMJA 1Q8MA 4LCWE 4PJHE 2AVFA 3FULA 3BKML 4PAZA 2RTTA 2WLKA 4ZPTA 3LD8C 4PB9H 2WXLA 2IG2H 3SCMA 4FNUA 4FNRA 1AKJD 2NTSP 3UMTA 4F1SA 3SDXE 3QFJE 1QVOA 1SXCA 4YLBA 3RGVD 3NESA 3KGTA 4LLDB 5SWQB 2PPEA 4HPHA 4HCRA 2V37A 8CGTA 1TKWB 2D9QB 4GH7B 1SGKA 1S7UB 3QISA 4KJPD 4RGOH 3F7LA 3GIZL 5J56B 3DETD 2EABA 3IGAB 5MEOA 2Q86A 2WBJA 1MVYA 3D2UA 4LDEB </