3OZLA

Crystal structure of human transthyretin variant a25t in complex with flufenamic acid.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T in complex with flufenamic acid.
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3ozlA00
2G2PA 2QGDA 1Z7JA 3GS0A 4AC2A 3OZKA 1DVUA 4DEUA 1G1OA 1DVYA 2NOYA 3ESNA 3OZLA 4FI6A 4Y9FA 5AKSA 4QRFA 5EZPA 1ZCRA 4ABWA 3IPEA 5FW7A 2TRYA 4TL5A 3FC8A 5E23A 5E4AA 2B14A 4ANKA 1TT6A 3I9PA 1KGIA 3QVAA 3DIDA 4N87A 4PM1A 4TQPA 3A4EA 3NEEA 3CFMA 3IMRA 5EN3A 1Y1DA 4PMFA 3NEOA 4L1TA 2TRHA 3HJ0A 4YDNA 3I9AA 4TL4A 5A6IA 3IMSA 4Y9GA 4Y9EA 2G4EA 3CN2A 3CN3A 4TNFA 1GKEA 4N85A 4ABVA 3P3RA 4PVLA 4YDMA 2FBRA 1E5AA 5IHHA 5AL8A 1DVTA 2QGCA 3DK0A 4I87A 1U21A 3IMVA 4HISA 5L4FA 1ICTA 1QABA 4ABQA 4D7BA 1IIIA 4I85A 4TLKA 3KGTA 4ACTA 2G2NA 4IKKA 1ETA1 4TKWA 5CM1A 5CLZA 3GPSA 3CN1A 3DJZA 3BSZA 4FI8A 4HJSA 2H0JA 1F41A 4PWFA 2H0EA 3IPBA 5K1JA 1TFPA 3B56A 2F7IA 5AKTA 3U2JA 1TTAA 2IGLA 2H0FA 3NEXA 1ETB1 1SN5A 4TNEA 3FCBA 4WNJA 3NESA 5AYTA 3TFBA 4DESA 4N86A 4WO0A 1E3FA 5CLXA 5AKVA 5DWPA 3CN4A 4PWGA 3DK2A 4PVMA 3W3BA 3P3SA 2G3ZA 3CBRA 3ESPA 3TCTA 5FW6A 5AL0A 2ROYA 4TQHA 1DVSA 3IMUA 1IIKA 5TTRA 2H6UA 4PVNA 4TQIA 1DVXA 2QGEA 1QWHA 5FO2A 1BM7A 2H1XA 1TZ8A 3GRBA 1SOQA 5DEJA 1TYRA 3A4DA 3DGDA 2WQAA 3KGSA 4IKIA 1TLMA 2G3XA 1SOKA 1FHNA 2GABA 2ROXA 3IWVA 4PWIA 3DJSA 3A4FA 3IWUA 4TLTA 4IK7A 1DVQA 3GS4A 4IIZA 1FH2A 5HJGA 3GS7A 2B16A 1DVZA 5K1NA 3CFNA 1BMZA 4TNGA 2B77A 2G4GA 4MRBA 3NG5A 4DERA 1BZEA 1BZ8A 1SN2A 3CN0A 3GRGA 5L4MA 3CFQA 3CFTA 1IJNA 1THAA 3GLZA 4IKJA 4Y9BA 1RLBA 4I89A 4WNSA 5CR1A 3P3TA 1TTBA 3Q1EA 1TTRA 4PWEA 4FI7A 5FW8A 5JIMA 2QGBA 5CN3A 1KGJA 4TLUA 4PWHA 5CLYA 3M1OA 4QXVA 4TM9A 1TTCA 1X7SA 3D7PA 4IK6A 1F86A 2F8IA 2G9KA 3CXFA 1OO2A 5CNHA 4HIQA 4QYAA 2FLMA 4PWJA 2PABA 5L4JA 1E4HA 5JIDA 4KY2A 3BT0A 4DEWA 4IKLA 1ZD6A 3DJTA 4HJUA 2B9AA 1IE4A 3D2TA 3DJRA 5L4IA 4PMEA 4L1SA 2H4EA 3ESOA 3I9IA 4Y9CA 2GPZA 2QPFA 2B15A 4TLSA 2G5UA 1SN0A 1X7TA 2QELA 3IMTA 4ABUA 4AC4A 5JIQA 4PWKA 3U2IA 1GKOA 4MASA 4DETA 3KGUA 1BZDA 4Q14A 3P3UA 3IMWA 4TQ8A 1THCA 4HJTA 5E4OA 3SSGA 1TSHA 5BOJA 3DO4A 4MRCA
chains in the Genus database with same CATH superfamily
1AE6H 2JCCE 2F19L 4JGUA 3D3VA 4ODTH 4EKXA 3FB8B 4M4RB 3QYCA 1VCAA 3T2LA 2IAMC 2IH3A 4XC1L 2LR4A 5E8DL 2VDRB 3TS8A 4E68A 4A6YL 1OTTC 2YAOA 3ZZSA 2F5BH 2IVFC 3M46A 4YQXL 2Q3XA 4QRQA 5FF6A 3OM3B 1D9KA 2VDOL 3J2PA 1R19A 4P2QA 4JDVB 4B3VA 3DX6B 4LSPH 4B9ZA 2LQRA 2APSA 4PJIF 2R15A 3T65B 1X5XA 1A0QH 1WAPA 3L5WB 1JYVA 1A14H 3CVHA 2VSKB 4YHPB 2EJ1A 1GKEA 3ROOA 4JZJA 2EICA 3ZKND 4ABVA 2H2PC 4O2CB 4OZFG 1YEGL 2J43A 1FO0L 3NPZB 1WT5C 4FKKA 3SKJH 5A40E 3H55A 4POZD 3N40P 3GMPA 2F7RA 3BSZA 2UVFA 2AEPH 3PV7A 4FYQA 4BSVB 2WNWA 3QDJB 3QPXH 2VW7A 5IESH 4PJDE 1MNUH 1NL0H 4LNRB 2WYIA 5J57B 1JDCA 3UBHA 1OD9A 5EOQL 4YHNA 1YJDC 3W38A 3BD5A 3QJXA 4HT1L 4KZDL 1PU0A 1G1CA 4N5UA 1AZZC 1KY6A 5FPIA 2FWOB 3JUZA 2ZE0A 2C3VA 5TTRA 3RG1C 2A9CA 3SJVA 3M8OH 4HLJA 1HEZA 5EHFA 2PWHA 3G6JB 5D96B 1Z9OA 2G2RA 2RD0A 1Z5LB 2ZXBA 4CBPA 1BLIA 4JFVA 3SKMA 1OE2A 2HVKA 2DL2A 3D08A 1E5CA 4KI5C 3T77A 3UYPA 2TSAA 1DVQA 5KYXA 4N1HB 4P2RA 2R23A 4MD0A 3P4NA 2H3KA 3QR1A 5DD3L 5GS1B 2GTZB 4QCIA 1NCBL 3WUZA 3CSYB 1XGUB 5TF1L 3UJIH 4LLUB 4BFEA 5E2VH 3ZRFC 3IXAA 2DQHH 3RU8H 3RWEA 1RPQA 3SGDI 2QBWA 4FZ8H 2WXRA 3BFQG 3JV0A 1AQHA 3BP5B 3P9LA 2CLVB 3KLSA 3FQXB 2LAGB 2IPUK 4QRRB 4KITB 2G9HA 3S88L 4KMTL 4KZ0A 4XNYL 4GAGL 1C16A 1S5IH 4PGEB 5HYEA 2ICES 4R7NB 3GB7B 3QP3A 4XMZA 4BDVB 3HHSA 2PN5A 2X4UA 4TPRL 4X6DF 2V2TB 3QCUL 3QIBC 5L2JB 5LBSH 4AIXA 1O6SB 1AD9B 3DV4A 2PP7A 2FBOJ 2E7CA 4BFFA 1GS6X 1FZKB 3S4SA 3S35X 1V8HA 1KV3A 4FYRA 4OCXL 5D7HA 4ZO9A 3TN0D 2VLKD 3OAUL 2DQEL 5E4OA 4ZO6A 3QHZL 1KWKA 4G9DB 3EDFA 1DCEA 4GAYA 2AJUH 2YSSA 3LEXA 1T5WA 1JF6A 2W0FB 3Q6FB 2WIIA 3DYMA 4XPTH 4Q9QL 1J7VR 2F53A 3F7LA 1T83A 3MYJA 3MRQA 3T6ZA 4JG1L 2F58H 2IG2H 3PWLB 3QWNA 4OM0H 3TP4A 5CZVL 4MAZA 1LYQA 1LEKA 1XDTT 3C60D 2XG5B 5C07B 1MCEA 3H1ZA 1FGNL 4RMTA 4RWHA 1I7TA 2A4CA 3HNSH 5I17A 4JRLA 4M6OL 2YPLD 1V10A 1OEZW 3V5HA 4PS7A 1B9KA 1SY6L 3LEVH 4KOCA 1R5VA 3G08A 4FI8A 3SEPA 1ASOA 2WXMA 1HX0A 4HH8A 4HUMB 4PRPE 4RH4A 5JMOC 2OK0H 1PEZA 4ZMQA 4Y4FB 3UTZB 3VWJA 3MUZ1 1F4XH 4M43L 5H2BB 3BIAX 1UZ8A 1HK6A 2FQFA 1WIUA 1TZHB 2WBKA 5EDSA 4X50A 2OFQA 1T7WA 3C75A 4FQ1H 1E4XL 4WU7B 1LGVA 1T20A 3MRCA 5EIIB 4H2AA 4AWJC 5BVPH 2A7BA 2RFXA 5LCVL 3S8WA 2DQUL 1KN4H 4LIQE 2L4OA 1EXUA 1WUNT 4APXA 2H3XC 4L3CA 1FH2A 2XXGA 4N2KA 5MEQB 2RJMA 3TPKA 4JM2F 1EMTL 3GUTA 2VL4A 4QKTA 3ZIYA 5EN2B 5CD5C 1TDQA 4WSJA 1Q1JL 2IAMD 3QH3A 4M8UA 5ESVA 5ICXA 5JA9A 4PCYA 3MBXH 1YMMA 4AUJA 3O0LA 3DXAE 4NUQA 4Z7OE 1OTTD 2FGWH 3V0DA 1GGYA 4I1RA 4NRYA 2AXHA 3PWVA 3GMMB 4JR9L 3N1GC 4NYLB 5E2WL 2LU7A 1ASQA 1CLZH 1XIWC 1UZ6F 4X6FB 2I9LA 3U1QA 2JQZA 1MELA 3OR6B 1GW6A 3MV7B 5DTFA 4LLVB 1LE5B 4PJHA 3VRIA 3FFCB 2PYEB 4PJFB 2D73A 5SV3A 2H2PD 5DF0A 3OXRB 3ZRSA 4JFDD 3IFNL 4ALAL 5LNDA 3DSFH 4PRHA 3OTTA 4PJBA 4ZS7L 2XBDA 1OSZA 1ZHKA 1ZHBB 2ZSVB 4KJYA 1UXSA 3S3SA 1JZDC 3E6HB 5DJDA 4PJXA 1RY7B 4LP5A 4ANWA 1KCUL 5AEAA 1H3TA 4F33A 1RURL 2CGRL 5DMIH 3MA9H 3P4OB 1U8CA 5DUBA 5KSVB 1KYAA 4MA8H 4NKQB 4XRCB 4D9LL 1GGCH 1TQWA 3U9UA 4HV8B 3TCXA 5E8PB 1MG2C 3X12B 5FECA 1XH0A 3RQ3A 4KK8C 3O2DH 3QUKB 2BIMA 3V0HA 4UOW1 3O0RL 4X99A 4C4KT 5JXEC 1I75A 3GK8L 5DJXA 4WI5A 2V5MA 5D7LA 3ALWA 4P4RB 3F64A 3EOBA 3KPMA 3LPGA 4U6XA 1G6RL 4GXVH 3CPLA 3V10A 1D5BB 1KY7A 1I8IB 1QO3B 4IHBA 2FO4A 3IPBA 3PWPB 2G60L 4N0UE 1YYMH 2OMTB 4GRMA 3WFHA 2JSFA 4U6VL 5C0GA 2C26A 1IC5L 3FMGL 2XT1B 4MMXB 3P0GB 2NQCA 5F1IB 3A6BL 1H3XA 1NH6A 4Z78B 3U46A 4EI6A 3QIBD 4OGZA 4A6YA 3MA7A 2ICEC 2J20A 3FB7A 2ZOUA 5C08A 3FS9A 1MUJB 3OWRA 2JJSC 3NIDE 3RUGB 1S3RA 2C5DC 5KZCD 3FW6A 4NO2B 1TQVA 3RBGA 2WLIA 5F1OB 3ULAB 3APFA 2P80D 5K69A 4AIEA 4XP9H 1YQ2A 4ZMLA 1DO6A 3MCYA 3A0OA 5IQNA 3ASNB 3EG9B 4N6RA 1YYLL 3JWNH 4L2YA 5IUSA 1HDMB 3C08H 3U1PA 2X44D 3HE7A 5F1NA 1F4YL 2VM9A 1AY1H 2WWKT 1A4CA 3IM1A 2PR4L 1OWRM 1WS8A 3JWDL 3OBAA 5AUMA 3ABZA 3QR2A 4U3SB 4AYFB 3OHXB 1DCLA 3R7QA 1BOGB 4JDZB 5C09E 1LP9F 1I53A 1E28B 5C8JB 1IE5A 1QI4A 1ZVHA 4OFIA 4D0CB 4UUJA 3D33A 1S7XB 3GI9L 4FNLH 2W88A 5KANG 1W2KT 1ODAA 5HHNB 4L4TA 1OW0C 1QHQA 5FYJD 4E9VA 1S7UB 3LS4H 2KLRA 3BT0A 1YUHB 3WY3A 2IBZY 2EDMA 3CD4A 2WINB 3H9YA 4AGOA 1XGPB 1B88A 1OB0A 2GC4C 4QOKD 3RY4A 3UBXA 1FFQA 1YYCA 1URLA 1CLYH 2HX7A 1WZAA 4H1LH 4DCQA 3QAZC 4XB7A 3S5LG 4XAWL 4B9YA 1M9SA 2Q3AA 1EVTC 3BUQA 4S1DC 3W2DH 2Z64C 5DFVC 3OB8A 5T5FL 3APDA 3JZ7A 2AQ2A 2AQNA 3TO2B 3UTSA 3BD3A 3CSGA 1OGPA 3IU3B 2Y7MA 5IR1B 4YHKL 1E7UA 1BBJB 5HDQL 3X1FA 4NZTH 1OAYL 4Z7UA 4MCZA 1OD7A 3LRGA 2BW4A 5CHNB 1T2QL 1PD1A 5EBWB 2B1HH 4RX4D 4BM7A 4PG9A 3IFLH 2ZKMX 1ZPLA 1L6XA 1YEWA 3UGEA 2VDLH 5DJAA 2FIKA 3IMSA 2ZCZA 4UNTA 3EJUA 4JCLA 5IBLC 4NQEA 1JVKA 2OKMA 3VNZA 4C56A 3KPOA 3GIVB 1F2QA 3IDYC 5CD5D 1S4IA 2EIBA 4V1DD 4L18A 3EBIA 2VDRL 2J56A 2FX7H 3BE1H 3KH3A 1MRDL 2GUOA 1ACCA 2EDFA 3KPLB 3QO1A 5EFIA 1AQKL 4EIZC 5BZDB 5AKSA 5IFJB 4MMZB 1XIWD 4RIRA 4XMWA 3R7RA 1HOEA 4NP4L 2HXAA 4DKDC 5DVPA 1IC1A 3UIYA 1YC8A 4JKWA 3NFNB 4L8SC 2GTQA 3E3QE 4XXCA 4GSDH 2JMRA 4JY6A 3QDAA 1OP3K 3DX8A 4OV5A 1JTOA 2VLME 4ZOCA 2YO3A 5AOLA 3I02B 1SLVA 1GOHA 1A7OH 4S1RH 5LKNA 2WUCH 1A6TA 3D39D 4M7LT 4PJCA 2AV7A 1JHLH 1QOKA 5E51A 1T7ZA 2IXQB 5FYKL 3Q44A 1CDGA 3B9KC 4OZHB 1MNNA 2VUOA 1ETZA 4UIKL 3ARBC 4IK7A 5E1IA 4KROD 4ZMTA 2LFGA 2M26A 1AG0A 2WN2A 3VXMB 2Z31B 3FULA 1L7IH 3GIZH 4Y0GA 1NEUA 2I07B 5C0CB 1XHHA 4FQ2H 4ADJA 5E6IC 3V0VA 4HJ1A 4IKJA 3TH3T 4YJZL 4X7SL 3MRIB 3EADA 1HHGB 1EX0A 4WEUD 2VXTH 2NY2B 4KK8D 1NFAA 2N7BA 2XTJC 3CC5A 1WBYA 3FB6A 4WEBH 5H37H 5DUJA 1IKOP 4Q9RH 4NJ9H 2AJZB 2X09A 4PREB 5EH1A 4Y7OC 3D85D 3N50A 3F01A 5ADOH 2XQYK 4KX8A 1EUUA 3GZOA 2DJ4A 2ODIA 3DKHA 3I9IA 2ZOWA 2GFBB 3UC0L 1VKXB 2FZ3B 5LCVA 3FQRB 4AM0B 6FABL 2X2UA 4I3SL 1J1PH 2DB8A 3TEUA 1U33A 3CE1A 4OVVA 3VMOA 4XNBA 2VDKL 1KPVA 4WUUE 5T5NF 4NAJA 1UKQA 3BKMH 4LCCB 5JDJA 1T0MB 2H1LM 5LQBH 4TQEH 4HXBH 4ODWB 4P5KA 2EH7H 4KK9D 3MJ8A 3ARGB 3T8VA 2D4FA 3SYOA 3UTPD 2ADJB 5BO1H 1N8ZA 1NZRA 1WFTA 5CR8A 4ZMVA 4I5BA 4FFVC 5FGCE 5TDPA 2LU5A 5ADPH 1NC4A 2Y1VA 2FWLB 2VRAA 3I6LE 1G9NC 2W0LA 5IVZB 3BW9A 4ZYKB 3LRSA 1CDHA 1LO3L 1BAFH 2XUWA 1EAPA 3K0YA 1RP9A 2EIZA 2BSSB 1BQHB 5ESAB 2V7NA 4MHHI 1MFAL 1BYNA 2WW8A 4JZNB 3BGFB 3VRLE 1A6UH 5D2LA 5E6ZA 3V4UL 3B56A 1OK8A 4Y19E 2H0FA 4WI7A 3VXPA 5I26A 4ZFZB 3KPQB 1YJDH 4N0FA 5I71B 1RZKC 2YD9A 4PEEA 4TOYH 1OB1B 1JRHI 4RGOH 1HYSC 2MMXA 4QDGA 2W1NA 3BRGC 3F7RA 3MNDA 2H9GA 5JR1L 1OAJA 4BZ1L 5G2NA 4GLRH 1LE9A 1IX2A 3CLFL 3MUJA 4ODVH 1AZNA 3A4DA 3VFVA 3WMPA 5KUMA 4NWUL 5JW3L 4S1DD 4PWIA 5B1JC 2J6EL 4H1LG 5DFVD 4TSCL 5D2NC 2CJSA 2DQMA 3MTXA 1BZ7B 4KKPA 2BHUA 2V7HA 4CC1A 5I5JA 3BVXA 5IW3A 2K4AA 3LNDA 4GSRA 1RD6A 1JVLA 3C2AH 4FTVD 1G6RA 4HCIA 3GRGA 3ULVC 1MIMH 1QYGH 4JFXB 2HAZA 4B0MM 5E8EA 2YWZA 4P46C 1AQDA 3K6IA 15C8H 4EKJA 4GXUN 3PWJA 4H8PA 3KXFA 4PLOB 3T0EB 3HG1B 1MWAA 2RHEA 4ELDA 5L9DH 4ZJ9A 5A2LH 3ZO0A 1R75A 4Y2DA 5ID0A 1NIFA 3HBQA 3B8SA 3O11A 1IEAA 2B2XH 5SWZA 5D6CB 3RDTB 2WSDA 4XPHL 3K2UL 4PHXA 3ETSA 4JQVA 3ZTEA 4HD9A 4PPTA 5T5NG 5J89A 2QR0B 2ZXWB 1FH5L 4WZ9A 1FNEB 2YGQA 1OXYA 2RB8A 3L5XL 1J5CA 2ICWB 4BQ6A 4F9LC 1J1XL 1NBYB 2V8MA 1UD6A 5E2TH 2COQA 4P3WA 4X83A 2D7TH 4DEPB 4Y5YA 1I1YB 3D18B 3REWB 3TA3A 3L3KA 3LZLA 5JW4M 1KNOB 5CJQL 1XGRA 3QEGL 4P9HC 4O58L 4G7SB 2J1YA 2P5PA 3KR3H 4AKOA 4WIQA 1EO7A 3HAEB 3OKDA 1NQBA 5J56B 1MI5B 2XG4B 3L16A 4CDHA 2PXYC 2DDQL 5C0FB 3CX5J 1GIGH 1J9SA 2BJML 5AZ2H 2XN9D 4HKZA 3LKPB 1EEZB 4YDNA 3MO1B 1OKEA 1AIFB 5B3JF 3ARBD 5EOCJ 2VUYA 4QY8B 4FQIH 43CAA 3DMMA 5HYSB 5IFHH 3PGCA 2ZXDA 1I1CA 1U58A 1R3KA 1E5AA 1XR9A 2O5YL 4I18B 4LEEA 4P2CG 4U31A 1FPTL 1E8YA 3WO4C 2HTKC 1O5DT 3K80A 3I2CL 5GGSB 2PPAA 3QUZD 3FU7B 1BHGA 4M1CC 5HDBB 4A37A 1MLBA 4A66A 2WKGA 4AGMA 2EZ0C 1UD2A 2E74C 3FTXA 5DK0A 2CHXA 3SPGA 1N6QH 4MA3A 5C6TL 4HXAH 2XTJD 4QJ4B 5D7JB 5GJSL 3IAGC 3RWDB 4D0DB 1KYOK 4H0IA 3KVDD 5H37G 3ZE0E 4H2CA 3ECBA 3RJDA 1A4JA 5IGXH 5JLZB 4EDWL 3WAJA 4PVNA 1M1XB 3V7AG 2NR6A 2AJSL 5DR5H 5D7IB 3EUDA 3VFRA 2GABA 1Q94B 4NX0A 3VWKB 5KW9L 4HS3A 4FA7B 5F9WC 3LKNA 5ACMA 1FSKB 1PGRB 2V9TA 3JTBA 2BVEA 1AGDB 1A22B 3TJEH 1OGAB 2ZKHL 2V9QA 3D4GA 5TE7L 1IM3B 1BQRA 5FO9A 4PJ5D 4B9GA 2F5AL 3MV11 4KU1A 4XOCA 1IU1A 1K9TA 2QV2A 3WLWC 2FHBA 3MV8A 5DRNA 3G6DH 5EF1A 1KB3A 1X5MA 4LARL 4NIYE 1OAZL 3UP6A 4HUKB 2XCMC 4A2MA 5IFAL 4TLUA 1N70A 4JN1H 3FUJA 2WVVA 2CPUA 5CNHA 4ELME 4U1MA 2Y7SA 2YD2A 1I9RL 3CK0H 1A7PL 1NBZB 5I82A 2XZQL 5CKGA 3THMH 2F7PA 2ESVB 4O2CA 1R5IB 2KS0A 4MJ6B 4DVBA 4V2BA 1HCZA 3F7YB 4WFFE 2ETWA 5KSAA 5GRXG 1EFXB 1PKOA 4DK5A 1KWGA 1KTKE 1KYDA 2X28A 2ENQA 4H8WC 4KPHL 4M8QA 2ZAIA 4N2OA 4QXUH 4TQ8A 4F2MB 3BKCH 1WICA 4R7DA 2FSDA 5EUOF 1DJZA 3VSTA 3MUGB 2WQWA 3O81A 4R6UA 4YFLI 5HHVL 2KBGA 4Z7VE 4PIBA 3ABGA 2ZYIA 1MCCA 2EUWA 1DR9A 5IB1B 1WZMA 4ZAKA 4X6BA 1AZRA 4XVJL 1E4KA 2CH8A 2Y23A 3MROA 5C3IA 1Z9NA 5MENB 1KUMA 3SDYL 2GIYA 2XICA 2ZCKH 5I1IL 3MXVL 4MSWB 1AGEB 2EXSA 2EO9A 1IAII 2LTQC 3H2QA 1MCJA 3DIFB 7FABL 2DIBA 5CGYC 1PLGL 2EIMB 2Z35B 2A2QT 1FVDB 4FKEA 1F8TL 5E6RB 3IDIB 1RIVL 4DTGH 5FO7A 4NZUH 1U3HC 5IWLC 4P46D 5DJ6A 1I8AA 2G30A 3NRFA 1KN2L 4X7TA 2OW6A 4QRPA 4EZMA 3OSVA 2X0UA 1FN4B 4KGJA 1WTLA 2P3YA 4LSRL 5KN5B 4FGMA 2Q76B 4LLMA 4O51B 4PRBA 5EV7A 2BZ7A 3V8CA 1PQZB 1CFQB 3LV3A 1ACYL 3UTQA 3EOYG 4MVBD 3RNQB 3RVUD 3LKOA 2E6JA 4GG8A 2GTWA 1N8OE 3CVBA 4J3WA 3OAZK 1FFOB 5HY9B 2UZYB 4J3SA 4LPVA 5KVFL 3SE4A 2VKWA 3PGFH 1M71B 2X4QA 1KFAH 4DW2H 3KNBB 5CWSA 4XMPH 5BUAA 4RGNB 1G9MC 1BZ8A 2EYTB 3QJVB 2GSGA 2OTUB 4KQ3H 2O93L 4ZD3L 5C0BA 1TJHH 4EVNA 1E65A 2MTPA 3K1DA 4CMMB 1MCSA 5LNGA 1QRNB 2PXYD 4I0KA 3TL5A 1VAHA 1JAEA 1AYRA 1ECZA 5E1AA 4EI5B 1JZGA 3FRUB 3L1OL 4IS6A 1S9KC 3SGJA 2F54A 1VGKA 5GGSY 4UQIM 3N1MC 3GJFH 1A9EB 4JGMA 4P9ML 3MCLH 4HEMA 2XV0A 2BNQB 4ADGA 4BRVA 3CTTA 2OP4L 3QNXB 3ECWA 2HTKD 4XPGH 3R8BB 4BZ1A 4AQEA 2LVCA 4R4FH 5J4MA 2CLRB 3GI8H 4JRYA 1S9VB 3N44F 4M1CD 4YXKL 4PBXA 4B6ZA 4E5XA 2J6EA 3O3AB 4G7QB 2OQJA 1I9EA 3OLEA 2EZ0D 1FNSH 4GBXB 2AGJH 4NM4L 5ERWA 2ZOTA 4Y1AD 4IRSB 1KLUB 5D4HA 5CBAB 1YNTB 1NAKH 3EXLA 4MNHA 1O9VA 5TDNA 3AMLA 4AUYA 4CU6A 4YHYC 1FFTB 1QFUH 2HLAA 3V4VL 5FB8B 4H25A 1DUZB 1X9LA 2GBUA 1TKWB 2XQYA 3FO2A 3L1FA 3NTCH 4L3ED 3SE8L 2XXMB 4N2FA 1WS7A 2GYSA 2DQCL 3ISRA 3LH8A 3CN2A 3L3OC 5DHYA 1DBJH 2HLFD 3PAYA 1NTDA 3DRQA 4WJG3 4A7GA 2PO6C 3MLSL 4LHUB 1EHLL 2FT6A 3NCCB 5TE4H 2ADFL 3BWAA 2QPUA 2DIJA 2A73A 2YA1A 4Y16B 4I77H 4GO8A 1L9MA 1NGPL 2Q8BL 3SBWC 3K71B 4TXVB 1SXZA 1Y18B 4G71B 3S3BB 3RP1A 2CKBH 1SN5A 3LZFL 5IROD 3QIWC 2OMBA 2FATH 1JN6A 4MS6A 4OZGB 2BP0B 2PYEA 3H54A 2Z93B 3PS6A 3AREC 4HUCA 2YKKA 3KWVA 4KTDL 1G6VK 4IIQA 2BFGA 3GRBA 1K3IA 2XWCA 1TZGL 2DMBA 3CZSA 1RUPL 2FB4H 3BN3B 3L4TA 5FDWB 3W1ZA 3D30A 3CFEA 3PF2A 3PIQA 3IFPB 3ZT7A 3QFJB 3F5WB 5IJVB 1ZHLA 3N42F 4ODSH 5K33A 4OLXH 1KPUB 2EQDA 4NPKA 1KOAA 4J3OC 3IE4A 1XSJA 2WMPA 3T0XA 4ZTPH 3ARSA 3G7TA 3B9DA 4RFNC 2JTYA 4L4VA 2WNKA 3MUUA 4G9FB 1BZ9A 5DRZA 4F5CA 3ZKXC 3L8QA 3OJDA 2G5BA 3X12A 2BY0A 1MFCL 4P2AA 3MOBH 1YEFL 2FNWA 3AY2A 4DZ8B 3EDKA 3D9AL 5MEPB 4DH2A 1U93B 2DQJH 4OZFA 3MBEC 3SDCA 4NNXA 5IVXF 1RZJL 3TIDB 3VI4F 1T0NA 1ROWA 1BIHA 4FQHA 4YHIA 5SWQB 2ENSA 4P4RA 3WL9B 5CGYD 1HNFA 1M05A 1JWUA 1CL7L 1EAQA 2HFGH 3QEQB 2VDPH 5CZRA 3PAZA 1QACA 4JL2A 4C83A 1U3HD 2QL1A 5L8LB 2EYRB 3QDGA 2VZUA 3N3EA 5HJ3A 3SD5A 1W72H 1IC7L 2EEDA 4ODXA 4O5LL 2WXKA 1AJ7L 1D5XA 1TZAA 3MV9D 4G6ML 4LE8A 1CXFA 1J8HE 3QXWA 1BW8A 1PFOA 1EJFA 2YMOA 3RGVA 4AK2A 2AABH 2EDBA 1W6LA 4YSOA 1KTDB 4TUOB 4MAUH 1USZA 2P5WE 2BNRD 1G43A 3EDEA 3GMLA 2X7LB 4PI0A 2B14A 3FAWA 3LS5H 4WHCA 2IGTA 3DIDA 4DVRL 2Z4QB 4K3JH 4LCWB 4NBYB 5GQBA 2P26A 4K5LA 3E80A 4F7EB 3BEVB 4KKBC 1KIQB 5FIEA 3ARFB 3ULUE 1H9VA 3CFCL 4PGDB 1WG3A 1QPPA 1A8JH 2MTAA 1AS7A 2MHAB 2K0RA 1RFDH 3U6RA 5AD0B 4DKFH 2YMTA 2Y3NA 4JPSA 3AB0B 4TTDC 3LZPA 1M9WA 3WEMA 2R0LL 2VISB 2J1KA 2H32A 1CDJA 2JKSA 1RUMH 1TMQA 3ARDB 3DJZA 1IBZA 4YDIH 4JJ5A 2IQAA 3K2IA 3OD3A 4O02H 1F41A 4PB9H 1XO8A 4GFXA 2X4SB 5K39B 4GAAA 4MD4A 4K9EL 2R7EA 4PSRA 3HZVB 3PGDA 1MXDA 2ZTBA 4FYSA 1R33A 5ICYA 1MAJA 2R29A 3GSUB 3HZKB 4TQHA 4UU9A 5L0QC 5FA3B 3P4MB 3VFNA 3TYGL 5ICUA 4RBPH 2Y3AA 4TULH 3WHE0 3NZUA 3QQ9C 1KB9K 3FDWA 1A7QH 3GMQB 4XWOC 1U42A 2CM5A 5LAPA 3GO1L 3LIZL 5GZOC 4HFWB 5GGRB 3MRFB 3HPJA 4KZEL 4P2OD 4TNWF 4I9XA 1BBJA 3QR0A 4QXTB 1CMOA 3CFTA 2AI0L 3L4XA 2ORBH 1CZ8H 2ZOLA 3EGXA 1P7KB 1WA2X 4K94L 1MVUA 4XX1E 3TO4C 1TTRA 4L8DB 4AEFA 5EU5B 5IG7A 2LAAA 3F85A 3RLSA 5FK9B 2DMHA 1J86A 2GBVA 5C0IB 3WEXB 2Q9OA 1P4IH 1S3KL 2IPKB 4TSBH 3JV4A 3ZUNC 2DQGL 3E1F1 1J5IA 4NQDD 3WTYA 4MJ5A 4WFHD 2ITEA 2BNUA 2YC1A 3HMXL 2PO6D 4PBDA 4QXWA 1JWMA 5JHDA 5L4IA 3INUL 2GJ6E 5E4EC 1XWVA 1R3LB 4TLSA 1CT8A 3BEWA 3FT2B 5KYYA 4PWKA 4B7IA 4X4XA 2NNXA 4G3YH 2FEDC 4KXCA 1I4FB 5CFAA 2WBJD 1U8IA 2PCFB 4MX7A 4FADA 3X3GL 1ITBB 2BINA 3QAQA 3EF7A 3NZSA 1UGKA 3QIWD 2BSTB 1AXSB 3NFNA 4H20L 5B38A 5T1LB 2IMMA 2VXSH 3OKEA 3ARED 5HI4C 2F18A 1KGCD 3HI5H 1MJ8L 5TQ0H 5C70A 3D06A 3CQPA 3G5VB 2CDGB 3ZPDA 3ZU8A 4N6QA 4HU8A 3CMOL 4OZHA 4XZUA 1I7UA 1K5NB 3E1ZA 3QDMA 5D8JL 2G4EA 3OAWA 1AQ8A 4YDMA 4U6TA 4WWKC 2WV3A 4PJEB 4J3OD 2V8LA 4X6DA 2Z92B 1DQIA 2ZKYA 2X4TB 1BFSA 1U36A 3MZTA 1BX2A 4CC0A 1UASA 1QEWB 4LVNB 4ATTA 3PQYA 2WZPA 2Y7QA 3CV5A 2FD6L 3KPRD 3NEXA 3EHBC 2Y5TB 1LO0H 2CU9A 3MBED 2C3GA 1NCUA 5IHUH 4BK4A 2P8PA 2IADA 3J7HA 4B9PA 1V3KA 2YPVH 4PCKA 3EBAA 3V4VA 4XBEL 1GC1L 5CN1A 3LX9A 1QQDB 2ARJQ 1CXLA 1TYRA 1Y0LB 4XB8A 2Y1ZA 1QHOA 1WWWX 2FZ3A 5ESQB 2RCSL 3B7RL 3FYEB 2R9HD 2CO4A 2C7FA 4JO1L 1XR8A 2IPTL 2KLTA 3QNYB 4NKDA 4OVUA 3V4PH 3EOAA 5ISZD 3Q2LA 1SLWA 4DWHA 4E41D 4YO0A 1A4KB 1WJ3A 1JPSL 1LK3H 3NABL 4XC3L 3O6KL 4YDKL 2A6KA 1AFVH 2N7SA 3OKNB 4BFOA 3IJSB 4P8QA 1RZFH 1RXLA 2YWYA 2VDNB 4JX0A 3H3PH 4AIZA 1YEHL 1H3PL 1MN4A 5KSUA 1N10A 4KKBD 5IHZB 3DUSA 4M93B 2DLFL 4UT7L 3R0NA 2XYCA 4GKZB 2QV4A 5E5RB 2BMKA 3IBOA 3ARYA 4X7FC 1UCTA 4Y5VB 1A3LL 4Q6IA 3ZHFA 3LPWA 3PREA 3O45B 4OLZL 4YFDB 3QFGA 1FYTB 1TJMA 1XB8A 3G5ZA 5AVYB 2CO7A 1SMOA 4TTDD 4FXGC 3DJRA 3QORD 4XB3A 5FHBL 5HHOA 1XB3A 32C2A 2Z7ZA 2QT6A 3SQBA 1N3NB 3WKYA 5A2JH 1MCPH 2OZNA 1J18A 4N25A 1NDGB 1FQ9C 1KLFB 2DV6A 2RBLA 3L9RB 5DQ9B 2QKSA 5FCSH 5AW3B 4PV9A 2J5LC 4FG6D 1A4AA 1NAMB 1L9PA 2MQCA 1XGQA 1F0LA 3PWUA 5K59E 4YE0A 1OB1A 4JM2A 5LBSA 2NLJA 3JXAA 3P0VL 4JY4B 1G0DA 5AVQB 1JBJA 1C5BL 1KXHA 3GRWL 2XXCB 4GIAA 3ILEA 2AZAA 1SYVA 2FIRT 3TVMC 4AZUA 3G5YA 3V52L 1WGOA 1JDAA 2MNJB 1ZAGA 2AK4B 2XC8A 3BP7B 4U1IB 1GY2A 5KSBB 5GGRY 2D3NA 3JWOL 2FEEI 4IOSD 4QJ5B 1AI1L 1VFAB 5I1HL 4XWOD 4BQ8A 3EXJA 3TZVD 3W5MA 5GZOD 5BUGA 1YDPB 4HIXL 5I66A 3OKMB 3WTVA 4JKMA 4AYID 3FAXA 1M3IA 1O7VA 3WTTA 4UZSA 3BQUB 1MHCA 4YH6A 5C0AD 1ORQA 3SBRA 2V33A 3TO4D 2YUXA 5DLMH 1E6JH 3VA6A 4NO0D 1MXGA 4OF6A 5DSCB 1CXIA 2VO5A 3KW8A 5DJ2A 3EBGA 5E9DB 2YZ8A 4O4YH 3H9ZA 4NQCE 5EC1B 3S5LA 5CP7A 1S6NA 1U8QB 3KYOA 5D1ZB 5C6PB 4KV5F 3PNWB 1IGYB 2QR0A 4H44C 2IANB 4M1DH 5F9OH 1L6ZA 4H4NA 3QDJE 2HJLB 4F3FB 4BZ2H 2BVPA 2LHAA 2FEDD 3WS3B 2FJGA 2W8CA 4HP5A 4Z3GA 2R0WL 2Y06H 4UB0L 2AQSA 4PJ9C 4PW9A 3PP4L 1JZ8A 2CA4A 4PRNA 1DDHA 4LDOB 3CSTA 1NJ9B 2IFGA 1XGZA 3MGOB 2V6HA 4LVHB 3EGSB 2CHZA 1G7JA 1VIWA 2V4LA 2AEWA 4KQ4L 3I6SA 3F3HA 4IOFC 2OULB 3G6JE 4YSSA 1LILA 4TRPL 2QADB 2JJTC 3JV6B 2PW2B 4M5YH 1U8OB 2X0WA 2Q86A 4PJAB 5E6UB 1AGBB 4AVHA 1BYPA 1VESA 2WY3B 2W9EL 3LKPA 1M6OA 4W70A 3TXAA 1QFWM 3ZYOA 4BQ9A 1S7VA 3GLAA 3BI9X 1S7WB 2FNBA 1X5YA 1HKLL 4GW1A 4PY7B 1IARB 4LRNH 4MTMA 4WWKD 1V05A 3L5JA 1U8LB 5DJ8A 5E1GA 1P6WA 3WUWB 4F92B 2WQXA 4GG6B 4RMQA 3LZRA 1KBPA 3MJWA 1JK9B 5KEZA 4PY8J 1S7RA 4LLAA 2QPSA 2XDHA 4QRRE 3V6BR 3FQTA 1E3ZA 1D5ZB 2APTA 2YD1A 3EHBD 4ZQKB 5EU3B 1UB5B 7PCYA 3S3PA 4KTYA 3RFZA 4YHLL 3T3PB 3OKLA 1KENH 4JFHE 4GPVA 5EU7E 1NSNH 1V54B 4H40A 4K8RC 1UFUA 1SUJA 5DC0A 1PY9A 1UATA 5ITBH 2CUHA 2IWKA 3FRPG 3QQ4B 2JQAA 3O6FB 5KOVC 1YEKL 5DMJB 2AEQH 3B9KB 5F7FA 3AMKA 2TRHA 5F7DA 1NFIB 4E36A 4OZ4B 1ZXQA 4LDEB 5FOBB 2AQ1A 2Q8AH 3TH4T 1OSEA 4G59C 3FHAA 4G7YL 1CXKA 3LRMA 5IMLA 4ONGL 1INQA 3Q8BA 5LLIC 4KKLC 2YQ2A 5BV7H 2GEQA 3HBZA 4FX5A 5IB2A 3D07A 4NQVB 4GMTL 4BUGA 2L7EA 3MLZL 3DRTB 3NJMA 1IBDA 1QVOB 1UCBL 3BVNB 3FT3A 1KULA 3U0TA 1MJ7H 1YEEH 5DC9B 2CA3A 1CB4A 1K2DB 2IAAC 1VFUA 2VE6B 5KVDL 5C07E 3F6JA 1OAXL 3HI1B 1WAAA 3FO1B 4RQQA 1H19A 2K8MA 5GJTL 2D3VA 3CBRA 3GSNB 5B39G 1UWFA 4QRTA 3MRJA 3NJNA 1R5IA 1DP0A 2PCPB 5HJDA 5ABAA 2WLYA 4WCYL 4WI0B 2BOLA 1NFDB 4EIUA 1BSIA 1MFVA 5AZEL 1A6WH 3BKJL 1E9PA 2NX5B 4F2MA 2HJFA 5KS9F 3VTMA 2AXGB 3BHBA 2OMXB 2MCG1 5LGYA 1QR1A 3G04A 2JELH 4GB9A 3VXSB 1PYWB 3TFKC 1Q9KA 3PJSA 3WKNA 2H1PL 3IEAA 5DMKA 2W91A 2XOTA 5D7SH 1R3JB 4MQ7B 3PDGA 3CXDL 4YXLL 3X14A 1I8LC 3CDGB 3N85L 1DJYA 3BISA 1M7IB 2DAVA 3P69A 4P59L 5AW0B 3TVMD 2VM3A 3ZR5A 2NTFA 1TQSA 3HHRB 3BKYH 2EEXA 5DD6A 1H15B 3J07A 1CICB 3VYPA 3QUMA 1AGEA 5DS8A 3WIHH 2HT2C 3ZHNA 2X3BA 4OLYH 4Y2NA 1DBAL 3O3BA 1FVDA 2H4EA 4NIKB 2AZUA 2NNFA 2XKNB 4J23A 4NPJA 3V8OA 3BAYA 3MI6A 2BRRL 1FNGB 1CFTB 1PX4A 4OZIB 1F4HA 4PRPD 2AEOA 4HW6A 4JFOB 4MAYC 3RWIB 3ZJAA 2OCFD 4UT6H 5DYOA 4F7CB 1BEYL 1N5AA 2BVOB 3F83A 1TEFA 4PV8A 3NBNA 3VXQA 3JT2A 4GP4B 4X5XB 3MV7E 3ZDZF 5T1JA 4MHHG 2Q76A 2ZX9A 3FFCE 2NDGA 2PYEE 4XMUA 4PJFE 3IJYB 2YD0A 4MQSB 3PV6A 3AY4A 1CFQA 1JZ4A 2YEZA 2I60L 4FEMA 3VRJA 3DLQR 3RNQA 3FC8A 1AP2A 4H1LA 3SDAB 3HRZA 3AABA 5CMAA 5FEBA 3MRGA 3FO0H 1TJIL 3FQYA 2XA8H 5JW4N 1CLOL 2OMZA 4LCVA 3U7WL 2O6EA 1JVOA 5HYQB 4PJ9D 4I1NB 2AAVA 2CD0A 2WKOF 1KPRB 4GS7B 1TSRA 4Z0XB 3IGAB 1U8NA 2OYMA 1FZOB 1IAIH 4F5CE 3DXAD 4P23C 4QHMA 4PR5A 1VPOL 4IOFD 4JFWA 3CN1A 4CMMA 5F2FA 2FUQA 1OTSC 1QRNA 1H5BC 4Q0XL 5L7XL 1CYXA 4I13B 3COOA 1GY1A 4WV1C 5AKTA 2DYRB 5AYTA 3FQWB 3OPZL 4J3OF 3CLEL 5CLXA 3E3QC 3NCFB 3RWCA 3U2SA 4MXQC 4Z3FA 5IW6A 3QZMA 5GS3A 1HYRC 3BP6A 1T04A 3GRWA 3Q05A 1DVXA 2XN2A 3SDXA 4XCEA 3TN0A 4YUEL 2ZWNA 1JNLH 2VLKA 1BF8A 1ZT1B 1XD1A 2EVJA 3PWPE 4KUZH 2GIMA 4PP2B 1ZGLP 3O3AA 1J8RA 5IHWA 4KJQC 1Z32X 3NA9L 3C6LC 4LQ1A 4HIPA 1KC5H 1X5JA 1JOIA 2KI6A 4NEHB 5A3IC 2HUEA 4B0MB 1JPFB 5ILTL 3B3IA 4K8RD 1UA3A 1WZLA 4DSYA 5I1DA 2FX9H 4P5TC 3RUGE 2YSTA 3GLZA 2E75C 4Z0BH 5FB8A 1VEPA 5F8RC 2EINB 3QXUA 3MJ9H 4MCYB 3C60A 3FT0A 2JWYA 4IBLT 3LTVA 4ACPA 2GT9A 2X4PA 2HFEB 4AMXA 3STZA 1G84A 1NFKA 3KHQA 2HLEB 2YPLA 4DIXA 4KDTC 4HPOL 4YFLF 5A16B 3IJ7A 3EFDL 3E8UL 3GHEH 4AG4L 4KKLD 1JZFA 2B4CH 4DGVH 4G8EA 5HDWA 5SV4A 3GMRA 5IW1B 3LXUX 2VDNL 2YARA 1P2CB 3QEHB 2WUBH 3T4AC 5BOJA 5H37A 4HDIA 4QRBA 2CK2A 2Y7NA 4AC2A 5BMFL 1EO8H 1YN7A 2WO4A 4OUUB 1YEIL 2CRMA 4OFYD 3RGHA 1MHPL 1XF3B 3DGCR 3H0TB 3ZGIA 4Q2ZA 4IRJD 1W8OA 5EZOL 4ZTOL 5I1CL 2XPGA 4HUNB 4R8WL 2ZF8A 4XVTL 4NO3B 5ACLA 2H45A 1KT2B 3O9WD 2VZTA 2UWEF 3L3HA 1J11A 5CZKA 5EZJA 2F08A 5F9WB 1DQJA 4K2UL 2OYKA 3R1GL 1E5ZA 1MCWM 1KYOJ 3FSVA 3BJ91 5AYUL 1NAML 2IAMA 3CHSA 2NQDA 2O5ZH 4DP6X 1HTYA 1DVTA 3TFKD 2OA9A 1UM4L 4WW2C 1T2XA 1IAKA 1WZ1L 4J3OG 1N4XL 3O6LH 4ORGB 4B50A 1OZTG 1VGEL 3KWWB 1NUDA 3WLBA 4A67A 4A2DA 3WEAA 2NXZB 2XIBA 5IJKC 4DO5A 2X3CA 1OAQL 2YKLH 2UXGA 4QNPF 4X9YA 4MQTB 1EAOA 5LGKA 4JDEA 2AJYH 4GNKB 4ZUSB 1LD9A 2YBRB 4YSDA 5TH2B 5GGVH 4JFDA 4NT6B 1WT5A 4PTUB 3FTSA 4I2XA 4XNMA 1H9DA 4XOAA 5DYFA 5GRJL 4TQIA 3US9A 3L4UA 4WENB 1CF1A 4PJIB 5KVFE 1QG3A 1CE6A 3T0DA 2PR9A 5B1BB 1IC4L 2EYRA 2HH0H 4KK6C 4MAYD 1DQML 2UUDH 2ZWKA 3L08A 5DWUL 2ZSWA 1QBLH 4ZT1A 3QB7C 4XMTA 2B16A 4ZFFB 1JCKA 1QSEB 5FUOL 1IGCH 4TSAH 5IOKA 4TUOA 4X5PA 2AERT 4LCYB 4XNUL 3E9TA 2YRLA 3U7YL 3AITA 3W0WD 1RIHL 3PXHA 4G8GB 3CHRA 5I18L 3P3TA 4HSQA 2JCCF 2Z4QA 3H42H 4XN4A 4M5SA 1ZA3B 5J7CC 5D93C 3SGEI 3FUIA 1J9TA 4XMKL 2ZP9A 4AQ1C 5DHEA 5GS0C 1BYOA 3HN5A 1MRCH 3X13B 3VXME 2KMWA 5AD0A 4TNWK 1MHEA 4WTQA 4PJ8C 4MKMA 3P02A 3TEXA 5C0CE 2H6PA 4DKAA 1U3NA 3WGUB 1CGSH 5E7FA 4N2HA 3P2BA 3QQDB 1Q9OB 2RAMA 2R83A 4GIOA 2R0KH 2TAAA 1NGXB 2FYYA 2APWA 2BSED 2VLJA 1OTSD 4OQTA 4XXDB 3O6ML 3RX5A 5EO0A 2AF2A 3PABB 3NIFF 3EJSA 4QAMB 5FM8A 4L1BA 4OLWH 1HHKB 4HJIA 3H2PA 3QIBA 3CHQA 3MSPA 5DEFA 4MXQD 4ZTEA 5FWRA 1A6PA 5EORL 2VLMD 4JFPB 5I1GL 1ED3A 1WVZA 1TO4A 3A21A 2BSRB 5D5MB 2GAZA 4PJDF 1XF2B 3S5ZA 1ZT7A 3BUTA 2H41A 4ZFGH 4CADB 4L0YA 3MRDB 2Z1KA 4K7PL 3NSFA 4UZUA 3RZCB 4G7VL 3G5XB 1NCCH 4KI1A 3BAIA 4R7XA 2VYRE 1EDYA 5IJDC 1UH2A 3EH5B 3IVKA 4HUUB 4PB0L 1CG9A 3IGKA 3MBWB 2AXFB 5GGRA 1FBIL 4M7KL 3B2UC 1NGQL 1P5UB 4MKTA 3GSWA 4P5TD 5F96H 4UT9L 1UT1A 4IBWA 4Z8FH 2VR4A 1U8KB 4U0RC 5JNYB 3EYFA 1KJ2H 4UF7C 5GRVL 5AOMA 5AW8B 1UVQB 1DHKA 1TFPA 4XCYA 5EU5A 1TVHB 1XF1A 1DJSA 4H7VA 4ZUWB 1Q0XL 2O26U 3VFWB 4ZXBB 4JFFB 1M7DB 2X1WL 5T33L 2NTSP 1SBBA 1KTJA 4RBPK 1YN6B 4QOKA 1E67A 5BRZB 3AROA 3HI6L 2QKIB 2XKSA 1WRFA 4E9WA 2QGEA 1DQQB 2VQUA 5DEJA 3MRHA 4IKIA 1HC1A 2KC0A 3QCVL 4WUUD 1MF2L 1OL0A 4ZX6A 1F00I 1F1DA 3IKKA 2BSTA 3MRRA 3SHSA 2DRUA 3UO8B 2Y36H 4FCHA 1C12A 3GSOB 5T1LA 1EHKB 2R69A 3H9SB 4XAKE 2J8HA 5KVEH 4EQ3A 5CD3A 1SMDA 5JIPA 1DBMH 2CDFA 4QHUA 4RX4A 4AEIL 1UWGL 1UJ3B 1ZT4B 2L04A 2NNAA 2PYFB 4QO1A 4ZMZA 4MNQB 3VUAA 2P1YA 2IF7A 2NUTB 3EYOB 4JG0L 4PWHA 1X7SA 3KD4A 1IO4C 5ENWB 3RIFF 1S78D 1R34A 1FFRA 1ADQH 4NKOB 4TUKL 3LD8B 3D0LA 2VXUL 1C08A 4I0PC 4XE5B 4R2GB 4NDMB 4A68A 3KYNA 5CUSH 3L2LA 2PPFA 4H88L 3T0EE 4LKXB 1A66A 4M9OA 1D6EB 1XIWA 3HG1E 5I5RA 3JYBA 4LEBA 1M6UA 2ODHA 4AI7A 4KGLA 3MRLA 4I0CC 5E03A 4D8PA 2R4RL 4Z95H 2D03L 4FI6A 2KDYA 5F3BA 1L5GB 3D39A 4G5AA 5DUMH 1QPKA 4YS4A 3QI9B 3BPOB 2WOBA 3EJCA 1IFHH 4YSPA 1UUSA 4HF5H 3L2NA 3VVVA 4JHAH 1Z2KA 3UH8A 4JQXC 2D3JA 3D2UB 4KK6D 3S7GA 5EO9A 1NUFA 3QNYA 4ZUVA 5TPWL 4X4YA 5BOPA 1KTLB 3C5ZD 4GRLB 3DO7B 2WVUA 3EJJX 2E9BA 3IGLA 4KAQL 4JPQA 4NHCL 1MI5E 1IBGL 2IALB 4YX2H 2F61A 1JZ5A 3VI3B 5JUEH 2IO5A 5CLZA 1P7QD 2MPVA 1R0AH 3LRKA 4HJSA 4P04A 1JK8A 3M6DA 1HQ4A 1R47A 4X6EA 4IBVA 2Y4SA 3B8YA 4Y4KC 1G7HA 2VSMB 3QRLA 3ATEA 4G42B 5I1KL 2PW1B 4B97A 1E4XI 2YXMA 5GS0D 3D85A 1LNUA 1HZHH 4UV4H 5I6XC 1B4RA 4L05A 4MNGA 4PJ8D 4QHNA 3TEWA 4DUVA 2XZAH 3ESPA 4HIHB 5IEHB 4FHJA 4KXBA 4XWGL 4DAGH 4ERSL 2R59A 3ULVL 3K7UA 4RFOH 3P2TA 4QF1B 2ATKB 1PKQB 3DX9B 2B39A 2OV0A 3QC6X 2A1WL 4MA1B 3BZEA 4ZOEA 5DD0H 5HDBE 4RA3A 4G6KL 4FQQB 4AJYV 1TQUA 2X89D 3MREB 3UX9B 1SRDA 1Y7VA 3FONB 2JB6A 4PBWD 5DQ9A 2JKNA 2FAUA 1JV5B 5T1MB 4APQC 4MQXC 1NLDH 2IDUA 1N67A 3NACL 3SJVD 2ICEA 5IEKB 1XGYL 3FN9A 4A04A 1NEPA 2A4ZA 2JJSA 2OMYA 3FNKA 4IOIB 4JY4A 4GAJH 3PAVA 1KJ3H 4J2QA 2ZZUT 5EU6A 3SYPA 4F8OA 2VQ1A 4FA8A 5D7IE 5DK2A 3QNZA 3AM8C 4N1CA 4LT7A 1HNGA 1A1MB 3UJJH 1JXGA 3RWGB 1TTGA 4A55A 1OP5H 1OGAE 1RHHA 4JW3A 5F0MB 3RI5F 4M29A 4P9HL 1XL6A 4XPFH 3WKML 3MJ6A 3MCKB 5CP3A 1GTNA 1R4XA 4F2FA 4HWZA 2YEVB 4HBQA 1A8ZA 4JO4L 5CJ8A 4D2NA 3UC2A 3LIUA 4I88A 4ISVA 4XO5A 2XRAL 1D3CA 4KRPB 5BQ7B 4H26B 4Q14A 2NY4C 1OOAA 1QSFA 3FCTA 3GSQB 5HI3C 1KBGL 1YEDA 3GBEA 2KH2B 1OW0A 5L2KB 4L9LB 2VAAB 2HKFL 4H8HA 1EGJL 5JOEA 2ESVE 1KJVA 1SXAA 5JHLH 2VL5B 3CDYA 2CIIA 1LP9B 4CL7A 1J0YA 4R97B 2D31A 1JPST 5LWYH 3DX3A 3KYMA 2LU4A 4ZMOA 3BGAA 4OLEA 2WOYA 2VN7A 4L5FH 4QJ3B 2DYPD 4F2ME 5I8KH 2CUMA 3CLWA 4MWFA 1D7CA 5H35B 5KUKA 3WS3A 4F58L 3L9YA 2IEPA 3I9GH 3P0YL 1T22B 2Z34A 4NUGH 4CSPA 1QLEH 4N85A 4WO4C 5TQ2H 2Q2LA 1GCFA 3NIDF 1OCCB 3RX7A 4ADIA 1JV2A 3II1A 1U30A 4J3BA 2O5XL 3CXHK 4LLQA 1D6VH 1KB9J 4MGXA 4Z9KB 1Z3GL 1T6VN 1TMCB 2HG5B 4D94A 5LG1A 2XPYA 2AV1A 1NCWH 3D25A 5MENE 3V9EA 1AGBA 5F9AC 1HJBC 1I3RA 1QKZL 4MYWB 2Q7YB 3PXJA 1UOKA 1U6AL 3ZTNL 4N68A 3VD2A 3CDZB 3FSAA 2W9DL 1BQLL 4X4ZA 4PVMA 1J1OL 2X5PA 4H5SB 4U7MA 4W9HC 1AKJB 2B0SL 1MRFH 4OSUL 2KZ1B 1R3IH 1FL5A 1MCOL 4R0LB 4UQ2A 5E2UH 3N43F 5E4EB 5DD5L 5I8EB 3FO9B 3ROLA 1CXEA 5ABDE 1DSYA 1WDAA 1FRGL 4E9LA 1A7NL 2VR6A 4FQXC 1GZQA 4N0YL 4URTB 3F6IA 3EJZC 4UYPA 2AQPA 3GS4A 4L8SA 4CKVX 1KZYA 3SDDB 5IUCA 3Q7JA 2EDXA 1CE1L 2EO7A 2R2EB 4JFZL 4BH8B 1KXQE 2EDLA 1I9JL 4J4PC 3ZMRA 3QXDA 3MMEA 4HH9B 1I7RA 2K7PA 2X2HA 1FE8H 1MH5B 1ESOA 4UT9A 3VGEA 5E08H 3W9DB 2XN9A 1MJUL 5HHPA 1PG7X 4HIEA 5I6MA 2P5EB 4H8WL 3FYIB 2QSCL 5TE6H 3ARBA 3MLXH 4M6NH 2WD0A 1QTPA 4JQIH 1G0YR 1OCZB 5IJBC 4JG9A 2BY1A 1YPZF 2XXFA 4HIQA 4RGNE 4X9BA 3SKOB 4M61A 1JFQL 4JFYB 1TF4A 4HHAA 3ZVVA 1KEGL 3RWFA 1G7IB 1SEQH 4Q56A 4NFDA 4QTIH 5E6IA 4YHZL 4I48A 2AHIA 1KXVA 1KCSH 2F7QA 1QNZH 2VSCA 5J11B 3WFCH 1QRNE 4QEGA 3L9BA 1HSAA 4KRMB 5SX5K 4K5PA 1N59B 3IKCB 5CINL 1R3HA 4J8RA 2NY7L 1M2VA 2WXNA 5EPMA 3DO4A 1IM9B 2C34A 3C8HA 3FK3A 4KO7A 4JBSA 2QEJA 3G6AB 2DY2A 3NCMA 3VFPB 3MXWL 4FL4C 4XOEA 2C9RA 1KTCA 3H7LA 2BNQE 1YMHA 5IMKB 5I30L 1SOSA 4PRHD 4EZKA 1JTTA 1CGWA 4NZFA 1QX1A 2HX9A 4B27A 1HE7A 1WFMA 3LKSA 1EHAA 4E0RA 4F7TB 1NFDA 4K55A 5BJTA 3ULUC 4BFGA 1B3JA 2AJXL 3Q3GA 4WW1A 2ZUVA 1PZDA 1UOLA 1ZDQA 4WK2B 1RJYB 4APQD 4MQXD 3SGKC 3X11B 4PJ5A 5D72H 4NBZB 3VXSA 3B7SA 2FR4B 3EJYC 4LPUA 3WELA 1KG0B 2E8ZA 2QVKA 2VDLB 2BPBA 4N9OB 1ZGLA 3A6OA 3W9EB 4IEFA 4NAQA 1AE6L 1B4JL 3QJFB 3H6AA 3SYAA 4CN4A 5MHSD 1O7DE 3QJSB 4ODTL 1KIUB 25C8H 1S9XB 2J71A 1MLCA 1W0VB 4GAFB 3D34A 5DVMA 1UYWL 3KPSB 3LY6A 5D7LD 3BCFA 2F5BL 3SQOH 2R0ZH 1JP5A 1KIPB 1P4BH 5D1QB 5F7EH 5FA4A 1S8DA 1FA4A 4LK4A 1HIMH 2XX1A 5DQJA 2VLRA 3CDFA 3OKYA 2BVQA 1EO5A 2LU3A 3KDMB 2EEFA 2XWBB 3O3UN 4HAGA 2ZXQA 4KVPA 1F18A 4PS4L 1X5GA 4UM8A 5ECJE 5M95B 1F13A 5JIKA 1VADB 4O02A 4HUVA 2B1AH 5AB1A 4RNRA 1BA9A 4PGCB 2AQ3A 5HI3D 2R2BB 2CDEB 3SKJL 2QLYA 3IYLW 4OZGE 1ZLSH 5BZZA 4DKTA 3UMTA 3F65A 4M5ZH 3C5SA 1UB6B 1M2OA 3QPXL 2XZCH 3QUXB 2J7LA 1TETH 5B1JA 5D2NA 3NGBC 3CVHH 3QFJE 4RGMC 1WBZB 5K93A 5INCA 2KUTA 1OT2A 4J1UB 2YJLA 4ENED 5IIEB 4ALAC 3B5HA 4ZSOB 5BXFA 4X4MA 1BD2B 4JEGB 2C9QA 3WHXB 3NN8B 4P46A 4G9FE 3IT8D 4NLAA 2MQ0A 1I1AC 1CFNA 3QBTB 1J05A 5G5DA 4N2BA 4ZW3A 2WQ8A 3IU4H 2FQGA 4RWYH 2K78A 4N9GB 4Y7MA 1CVRA 1DEEA 1MW1A 4IQHA 4IU2B 2VABB 3RU8L 2R4SL 3KLAB 3VA2C 4HQQH 3FF8A 2OSWA 4NZRH 4F8LA 3GLEA 3WDHA 1DFBL 3QA3B 2MQ3A 4NJAL 4OCSH 2F0CA 3QEQE 4JRFA 1S5IL 1XAKA 3LZOA 2LVEA 4F9LA 1XAUA 3MFFA 1CLVA 5EN3A 2GSMB 4H8VA 3QZWG 5EA0H 3IETA 3UTSD 4K7FA 2EC8A 3DBXB 4YHMH 4M00A 2H8PB 3DI2B 43C9B 2ZUWA 3WTSA 3X1NA 2WXLA 2HT4D 1CD1A 5DDHA 2VNCA 4P3CL 5I0DA 3OKKA 4J4PD 3HUJF 1NGWB 5DZJA 5GZNC 1NIDA 4RMWA 2PXYA 5EOCH 1OE1A 2P4AB 1IKNC 4PRDB 4LCWE 2AJUL 5AAWC 1HCYA 1FIGH 1TR7A 2WXFA 5E00A 2M1KA 4FQJL 5GPRA 1Y1UA 4U1SB 2DWEA 3VXRB 4XPTL 1ETB1 3HC3H 5KVDE 3SE9L 4NQED 4LCIH 4C56D 4NUJB 3O41A 1IAIM 4MD5B 3UTTB 2F58L 2IG2L 3GKWH 1MIEH 4RZCB 5EMYA 5E24E 3K2MC 5K9QI 3GINA 1QFHA 3VD7A 5A1AA 4XH2A 3HNSL 4Y1AA 1XCTA 1CLCA 3CG8A 4BCXA 5ICZB 1FV1A 2IQ9L 3L3GB 1J8HD 3LEVL 4XI5C 5FUZH 4H0HB 1CS6A 2CIKB 3FRPA 3M88A 2X41A 1BZEA 2BDNL 2OK0L 2P5WD 2YPVA 5EZIH 4K3GA 3GLDA 3NK4A 3OX8B 3AU1B 5F6HI 4L3EA 1CR9L 3FZUC 1OF2B 4G5ZH 1UH3A 1JZ3A 3ULUD 1F6AA 1A6VH 1ZTMA 3QIUC 4CVXA 1TTCA 3B2PA 4KXDA 5ALBH 3WD5L 1QI5A 3MLRH 3MNWA 2CR0A 4BH7B 5DI8A 5J6SA 4C4BA 3OGCB 1H6TA 5CSGA 4BJLA 2R1YB 4Y5XC 4EN2A 4XN1A 1N0XH 1ZK5A 3PL6B 4NZ8A 2Q6WA 3BZ4A 3WTUA 4HJJH 3QXAB 3IJ9A 4ANUA 3KGUA 4R90L 1MPAL 4MLIA 1QMUA 4QXGL 1J8KA 2RGSA 5IBTH 3MBXL 5B39A 5KZCB 4D3CL 3BCDA 5E8OA 3O3DB 1H8SA 3JVGC 3T6XA 4BSWB 3S5YA 5E94A 3LPPA 3Q9QA 4G8IB 2Z6FA 4JB9H 3ZTJH 2LABA 3SO3C 3IJEA 4LCUB 5D7KE 3QJHB 4GT7A 1MEXL 2XIDA 2J4WH 4NNYA 3QRFM 1FAIL 3ILPB 3NYKA 3ZE0F 6TAAA 1IGMH 3ERXA 2MKLC 1JIBA 4NC1E 2W95A 1RSFA 1VFBA 4JO2H 3TNNA 2XTSA 1CGXA 1FCCA 3DOSA 2I25N 5MI0C 1RUQH 4G1EA 2AK1H 5C09B 5KYUA 4HWEH 3CH1A 4YBLB 2OTWB 5EUOB 4X5WA 5DMIL 1I8KB 3MA9L 2JV6A 1ZA3A 4JKPH 4MA8L 4LLWA 1V7ML 3EYQC 1GGCL 1P9MC 4MB5A 5DWPA 4PJEE 1LM8V 3U7AA 4FABH 1L4IA 3E6FA 1SQMA 1PW3A 4FF9A 3O2DL 3OV6A 1ZRUA 2GJ6D 1U3HA 2UUDK 3CHPA 5BRQA 3V6FA 5IWLA 6PCYA 1Q9OA 3H8NA 3BIBX 1I1AD 2CJUH 4YPGA 1NGXA 2IBBA 2DWDA 3O8XB 4ELMF 1GOGA 2AXWA 4YDJB 1D5IH 3MV9A 5F7YC 3BPNB 2E86A 3ECUA 4JJOA 3K4DA 4WJKB 1HHKA 2BNRA 1K72A 1U3YA 2DQ6A 1QWNA 3I3BA 3NZHL 1SBSH 1IQWH 1PZ5B 3KDPB 5D96C 1RZIA 3S96A 4AENA 3U48A 4B60A 1LO4L 2BH0A 5HHXH 5J1SC 4AEEA 2ADGB 4X0KB 4V1DB 1WPCA 1GS8A 3VSUA 1RU9H 2CXGA 4CADA 3H7BA 4PJGA 1XB6A 2CUAA 5GS1C 5DJZA 4KY1L 5JIIA 4XBPB 4Z7VF 2JK5A 4HBCH 4AITA 3SGEH 4P05A 3WJLC 2X42A 4CILA 1EEUA 4IBYA 4L29A 3VXUB 4P23B 4QWWC 4LSTL 3ZKMC 2UZIL 4DEWA 4F15B 1GAFH 2CMRH 3AAZB 2IJ0C 5IK3A 4FZEH 2VDQH 5GGTL 4A39A 3PLYA 5ES4B 5FWQA 1FFPB 3CZKA 4P5MB 2A77L 3C08L 3RB5A 3TNMA 1J5OH 4PD4K 3RIFK 2F19H 3SO5A 4UDTB 3WIFA 3WN5B 1AY1L 3ZLQC 4AYGA 2KERA 3FOLA 4AVKA 3TCLB 3T8XB 2G75A 5KS9A 5EU7C 5E8DH 5IP4A 3I85A 5SWZD 4JFFA 2WTRA 4A6YH 3CFBB 1FYTE 3GZQA 3R8QA 4YQXH 1JD7A 2R1WB 5CJBA 3PHOA 4UTBL 2VDOH 2IH1B 2Y24A 3EH3B 5IF0B 3S4SG 2OMVA 3SPVA 3DX2A 3BMVA 4WNQB 2PCXA 3C6LB 5J0BA 1A25A 4NENB 2JIXB 4N0RA 5IVNA 3TA3D 2OMUA 1YEGH 3FKUS 1S7SA 5KVGE 3R4DA 5JXAH 2ATPB 2ILLA 1CLYL 1ZV9A 2BK8A 2CM6A 4JFTA 4KWUA 5ITFB 5B4MC 1NBCA 1OPGL 1QLRB 2I85A 4KUCF 2O6DA 3T3MB 3ATDA 4BBWA 4BYHA 4Y1TA 3N44B 2ZUYA 3K8MA 1KJMB 3LDBB 2KYIA 4PJXF 4ZDHA 4UANA 3U0WL 1AIZA 2C9XA 2AK4E 5E1HB 3L3IA 1P1ZA 4WHDA 3WNKA 4HG4K 2FQDA 3HEIB 1ZT4A 1BP3B 3FZUD 2XVBA 4NOFA 5JHBA 3MYZA 4GW4A 5E7BA 5KSBE 1MFBH 4W9EC 3CWGA 4HT1H 1MZZA 1SEBA 3ZHLA 4KZDH 3FCSB 3L3OA 2JFCA 2I9TB 4NQDA 4Z3EA 2PO6A 2VLLA 1DN0B 3NFPB 1W16A 2OSXA 5CSZB 3IGUA 1UOWA 3LOWA 3L54A 5EEZA 4Q9CA 4WKXA 2SEBB 2AMGA 4F7KA 4LDLB 4WHTB 4FFYA 3SBWA 2UYLA 2OR9L 3QUGA 2IDCA 4Y4FC 3UPCA 3N1PC 2Y07H 4XPBL 3QPQC 1HU8A 5DD3H 3RVTD 4U1KB 5ANMA 5PAZA 4JFQA 3QIWA 5E9DE 2M8XA 3LQZB 2YMXL 3GSXB 5TF1H 1EFQA 3EO1B 3BE1L 3AG3B 3AREA 4R96A 2WKOA 3T4YA 5EDXA 2CSPA 2NR6D 1W0WA 5KG9A 2DQFA 5AALA 4E2OA 3A24A 2D7QA 2IANE 1QWUA 2X70A 3RB7A 3RL1A 1NOAA 3S88H 3F00A 4GAGH 2BHYA 4NXKA 4ZI8A 2JKWA 1MQKL 3QUYB 3ZTJG 1JF1B 4MXVF 3L45A 2JKTM 1PNDA 3BUBA 4TPRH 4S1RL 1ZVSB 1QNIA 3QCUH 1HZLA 2Z7WA 4HIIB 2WUCL 3ILQD 4BHUA 4WW2B 2OAAA 2AKRB 1FYHB 3EFFA 5B8CC 5HVHB 3BDYL 4LFHD 1HOCB 2I32A 4OCXH 4PLJD 2Z9TA 2CO3A 3OAUH 2B15A 2DQEH 3LHPL 3VI3A 3GJFB 3MR9A 1NC2B 3N42B 4PJAE 3GIZL 5FCUL 5INDA 4U6YB 3RIKA 3DVNA 1ZA6A 2HVJA 3MBEA 5C0EB 1TSHA 3TEYA 1QBMH 3RI5K 4U7SA 2OXGA 4FQ2L 3VFSA 1EZUA 5EEVA 1A6ZB 1KIRA 4Q9QH 3IF1A 2AFNA 3JT0A 4JG1H 2O61A 2OL3L 1ETJA 2VXTL 3OMAB 3PWNB 2C1PA 4GG6E 5H8DA 4LOFA 4PJ7A 5CZVH 4LSQL 4G1MB 4NRZA 3QDJD 3D0VB 4UOW0 5IVXB 3TESA 4UMGA 3BVUA 1RUAL 3VI4B 3RX8A 1FGNH 1MVFA 4XBGB 3FFDA 2GG1A 5EF0A 1YY9C 2P8MA 5CEXA 1B0GA 4M6OH 4TNFA 4XXWC 3T3PE 1EANA 4LP4A 1T3FB 3LNIA 5D70L 3Q2CA 2XV6B 2YIHA 4IDJH 1GYAA 1AKPA 1JWSA 3O4LB 1AD0A 2EVIA 4ZAKD 3QJUB 2A9AA 4KTEL 3B9EA 4IJ3C 1SJHA 4M43H 1EEYB 3OMZA 4HXBL 4Z7UF 3VTAA 2YOAA 4JVWA 3VW3L 1KCWA 4ODHL 4UMSA 2WCPA 1E4XH 2VMFA 2YHGA 3CPUA 3AUWB 3MCKA 5J1AA 1AHWB 3VD1A 4PCSA 1S7QB 3U25A 2H3NA 3DV6B 4Y4HB 3GGWA 5LCVH 5I28A 2DQUH 2EDEA 4RFEB 5AVRB 3DYOA 5GSRB 5LAXB 2X6CA 4QRRD 4KDWA 3BWZA 4XNQB 1BAFL 5JDSA 1EMTH 1FG9C 3BZFB 2WXHA 4MMXC 1CI5A 1Q1JH 4MZRA 4JFHD 1S2EA 3ALXA 3PG2A 5C0DA 4NP9A 1Y6KR 3NJKA 2OW7A 1A6UL 4F7PB 3I3EA 4JR9H 3D69B 4WFEE 2ZYHA 3O4OB 4DPRA 2BCKB 3MUY1 1NFDE 3WV0A 1OP5K 4JK0D 4IOSA 4HIJA 2A83A 2NX5E 5AW7B 4PQXA 3MOQA 3FT4B 3QUZB 3VGBA 4F7MA 1CL7I 5CGBA 1ZWIB 5GZOA 2WLLB 1JD9A 4ZZFA 5GIRA 1AACA 4ODVL 1WD8A 3IFNH 5B4MD 2C1OB 4ATWA 3BXNB 4HS6B 5C0BD 4ZS7H 5C0AA 1Y6MR 3OHXC 3TIEB 3VFMB 4U0RB 2J1XA 4ZODA 5DA4A 3TO4A 5BRPA 3OHMB 4NO0A 3WTWA 2R8SL 1KCUH 3P3UA 3QEUB 2EKSB 4U3HA 5B1CA 1MIML 5IOPA 5C07D 3BLPX 3NMEA 2EXWC 4MMYB 1PJ9A 2UY7B 3VNYA 15C8L 1E2VA 3K0WA 2XYBA 2ICWI 1W72B 1WUZA 4WI6A 1XF5A 5IB3B 2HCZX 3FFOA 4UIMB 1U8JA 2ZG1A 4G6FB 4BK8A 5L9DL 2VITB 4OZIE 4QLRA 3O0RH 3F62A 1I7ZA 4LSVL 5L6YL 1DBBL 2JCCA 3QPQD 3CZLA 2R27A 1T4KA 1RPKA 1SJXA 2GC7C 1YNLL 2FQEA 2N01B 1G6RH 1HS6A 1XBDA 1I8UA 1R17A 2HZHA 1T03H 3DTDA 1URZA 1WF5A 2HJKA 3IMVA 5GGTA 4HH9A 1IIIA 2EAEA 5E2TL 2O6CA 5ACZA 1AGFA 4FQCL 2D7TL 1MWAH 5FV1L 1RZGB 5I1JL 5K1JA 3SZ6A 3PDOA 2WN3A 4U6VH 1IC5H 3FMGH 2F7IA 1NCOA 4NM8L 1TEYA 3KR3L 4NNPL 4Q6KA 3A6BH 1WBXB 1ZPUA 3X3FL 5C9KA 5DCCA 4WWKA 1TTUA 1XQ4A 2Z8SA 35C8H 1MZYA 5EZLA 3TJHD 4Z5RA 3IDJA 4IMKC 5FO8B 3BUYB 1H6UA 5IZ7A 2VIRB 4UTBA 3VFTA 2WJ7A 3OJVC 1NGYA 4U6HB 2A6IB 4NWTL 1CFSA 2JKJA 4Z7NB 1X9UA 4RDBA 4PJDA 4JPIB 1OVZA 5DJCB 4MMZC 5J6HA 5JPMC 3LNFA 1PZ2A 2BWIA 1KBVA 1J0JA 2R2HA 2DMCA 3D87B 3MV7D 4OM1H 3B43A 1B0WA 4YN3A 4CVZA 2PR4H 1GTFA 1Z9PA 1X5KA 2WZ0A 3QJQB 2PYED 5E5UB 3LEYL 3JWDH 3VU2A 4S0TD 1E4JA 1JGUH 4HOWA 5FC9A 5D2LF 3VJ6B 2OJ1A 4PG2C 2A5UA 2ED7A 1FZJB 4FJ6A 4YPJA 2VDML 4CNIB 4KVNH 3POHA 2WWMC 3OF6D 3GI9H 1LK2A 4GMSL 1C8PA 5E5MB 3MGTB 2Z31C 4R4BA 3KWTA 1WFJA 4O9HH 4AJWA 4JREB 5C97A 2HTLC 3KPNB 1YY9D 2NSMA 5K1VA 5BNXD 5C2UB 4NGHH 5DR5L 1DANT 5FKPA 4Z7WB 4UQ9A 4ETQB 2NCEA 4CU8A 2GHWB 4P49A 4XAWH 4YEEA 3CUPB 4G43B 3AS0A 2XX0A 1CO1A 3ARPA 3TTSA 3W9EA 2FJHB 4G8FA 4E9QA 1ZS8B 2NY0B 2P7TA 2NY2C 1NCTA 3TJEL 1A7RL 2GBAA 3RNKB 2CJTA 4IU3B 4ESKA 3LXCA 5MERA 4LPCA 4YHKH 4GRWH 2F74A 3WNIA 5HDQH 3KPSA 1N5YL 1QD0A 1M53A 3VE0B 4QYOB 4FXGA 3GEFA 1CGVA 1PD6A 2R56H 1T2QH 2GK2A 3UCRA 5E4AA 5IY5B 4HJGA 3VACA 3BIKB 4JN1L 4JHZA 4ELKB 3LN4B 5DFAA 3HR5B 4QT5A 3DBSA 5TGBB 1NPJA 1FCGA 3S36X 3CK0L 3PWPD 2OX5B 4ODUB 3IMRA 2Y1AA 5BZXA 2EVFA 5I9QB 1JGLL 2DM7A 2DTSA 1FFNB 2ZWYA 4C57C 3RL2B 4P4KB 5E8NA 2CDEA 3RGVD 5LVEA 2DKUA 1JPEA 1RZQA 3P3RA 5G4MA 3U4BH 2F9BT 1YY8A 3ARGC 2BS71 1L9OA 4HISA 1JUFB 1MRDH 3QE5A 2FLRT 3UPRB 3TVMA 2NZ1A 1H3UA 1G7QA 5BS0B 4OAWA 3QG7H 4AGPA 5I76A 1KYUA 4S10A 3BYYA 3HS0A 4N5EC 4NP4H 2G3NA 4YMPA 3NCEB 2EECA 4JKKA 4YLBA 1UXLA 3RVVC 4HZLB 1SJEA 4WU5A 4CW1B 1AO7B 2X1QA 3ZYIA 3A6CL 2Y9RT 3N0AA 2J2ZA 2OL3A 2K6ZA 4H8QA 1S5HA 1HHJA 3N1QC 4L0PB 2P45B 5F72S 5FYKH 4PRPA 5CLWA 4YZWA 4WFGE 4DP0X 3BGFC 5D9SB 5IBUB 5TDOB 2OZ4L 1GSKA 2WYHA 2QZ5A 4KKCC 1XZ0B 4UDUA 5I71C 1Q72H 1V3LA 2OM5A 2OLDA 3A47A 4IU2A 2GCYB 2D9CA 4DTGL 2QMKA 4NZUL 3B2XA 3PUCA 1FG2A 1OWWA 2PPDA 2WGXA 2W38A 4J3XA 2BOBB 2E7DA 4X7SH 2WM0A 2A99A 4Q4EA 3V4PB 1RSYA 4PJIE 5BVJA 1ZHNB 1WFIA 4PJ9A 1RZJC 4QIRA 3REVA 3B3BA 1YC7A 2ZUUA 4S11A 3O2VH 1QSEE 1CWVA 2EDQA 2XFXB 3DXAA 4IKLA 5JPNB 4PRIB 2JJTA 2ZX7A 4G8GE 6FABH 1E4WL 3RWJA 3EIFA 4I3SH 3T0EC 3BAXA 2OYPA 1KFAL 4DW2L 2V5RA 2XU9A 1UXWB 1TVBB 1BFOB 2VDKH 2PWFA 2UX6A 4KQ3L 4U1SA 2MKWA 1EJOL 3CXHJ 1CGUA 3HC0A 3NIGF 4FERA 5G4NA 4WTXA 5KBDA 3RDTC 1SHWA 3GZKA 2R1XB 4N2IA 2NXYB 3GC3A 3MRMA 1DJXA 3ARZA 4HWBL 3K72A 1T6BX 3CAFA 1UWXK 3FTGA 4BFRA 3UZVA 3UDWC 3F84A 3OQRA 4WWOA 4LOVA 3RVXC 2P24A 4JUSA 4YWGL 2WHVA 4JCMA 4L1TA 3MCLL 1BJ1J 4NAMA 4FAAB 5A6IA 1LO3H 3V5DB 3K6OA 4DEPC 2Y1YA 1JS4A 1W8EA 4DQAA 3QHFL 3WKPA 5I1AB 2CALA 4YGVA 3HB3B 3OGOE 3BH9A 1WQVT 4YDVB 5JQ6L 4OT1L 3WJJC 3V5KB 1MFAH 1F6FB 1NDMA 5E70A 3L6FA 3FBKA 3OX8A 5D5ME 5EBLB 1WC7B 3V4UH 3AXHA 3WIIH 4KFMA 2QDVA 1NAKL 1T1ZA 4K9EC 5J9PA 3ABMB 5F3HA 3V79C 3HBPA 2A3TA 5I23A 2MPAH 4UILL 4LEOA 2Z31D 3CSBA 3HNTL 3NCYS 2HTLD 3NP3A 4I18C 5DD1L 2CNYA 5PCYA 3G6JF 2BSDA 3MPCA 4BZ1H 2XJLA 1WWBX 3CLFH 1DL7L 4DF9A 3C5JB 3OGCA 2W92A 1XGTA 2GSIB 3OXSA 4NWUH 1C5CL 2R1YA 2J6EH 4TSCH 3PQYD 3K6DA 1BVLB 2EEBA 4N0UA 5AW5B 3TASA 5IHLB 2FJFA 1DBJL 3FQUA 1UQSA 2ARJB 3QQ3A 4E9SA 3N2JA 2DM4A 5D7JC 4OGYH 5TE4L 4LF3A 3P54A 4JFFE 4R5XA 4N8VB 2V2XB 3U4EA 5MP6H 1BMZA 4MRBA 1GOFA 3CN0A 5BRZE 1Z9SA 3MLYL 5C9JB 1G5GA 1SVZA 5JW4Q 5ALCL 3F7VB 4K94C 1N0LA 4RAVB 5I16B 1S7TA 1PAZA 3VG0L 2HT3D 2ITCA 2PMZA 3E7JA 1A6AA 3MKKA 3VGHA 3VWKC 3R06B 3KCPA 5IMMA 5HGDA 2VMDA 2NSXA 1LDSA 1JZIA 2X87A 3ILPA 4FLRA 4JN2B 2NW3A 2Q2EB 3DPDA 3M1BA 4DUWA 4XPHH 2GHZA 2BSCA 2ENJA 3V6ZB 5C6WH 4LHQB 3H9SE 3ARGD 2DEYX 4TV3A 3DJTA 5I2IA 2A6DB 1I8MB 4WHYH 3L5XH 4XTRC 4LFHG 5C09A 4CC4C 5JYMA 3QZOA 3D1MC 5IQ9A 4AKPA 3T0BA 1J1XH 1LQBC 4MNQE 2OTWA 3W11C 4ZTPL 4QRSB 1SXNA 4JPVL 4K0OA 1A3ZA 2OYLA 3RVVD 3SOBH 3H2WA 4TVPH 4EPSA 2QGDA 4O58H 2VH5L 3GJEA 3P2DA 3B6SB 1XF4B 4EXKA 2E46A 3GMOA 3BP4B 1VLXA 3TX4A 5HGHA 3DX7A 3DROB 1Q1PA 4EDXA 3ASOB 1WHPA 2BJMH 5LXGL 2DQJL 3QRBA 3I6GB 1PX3A 5DRXA 4MAYA 2Q3ZA 2W80C 1B2WL 3QQXA 1FVCB 1G0XA 4LLDA 4HKJA 3WY1A 2A74B 2DW5A 3LKQA 2R2CA 3MJ7A 4KKCD 1WV7T 2O5YH 5EULV 3KLKA 2V37A 4X5RA 5F70A 1FPTH 1EA9C 3K2KA 3WS6C 3I2CH 2XQ0A 3HKFA 3IFOA 2ERJB 1U21A 2JCWA 4XAKD 4U7KA 4XP4L 5IMOA 5BOZG 3ULSB 1W72L 4R9HA 3UZQA 1UZ6E 3LN5B 5AW4B 3MOAL 1UEMA 3ZDZB 3KLHC 5C6TH 4OZFH 1PG7H 2V2WB 4PWFA 5CBEA 3SQOL 3VTTA 5GJSH 4JE0A 2CR3A 3LQAC 3TBSB 5BV7B 3FOMA 4DESA 1WA0X 2OXHA 4MZ3A 4HPYH 3FB5B 1FLRL 2NUPB 3CN4A 4EDWH 4RAUA 2P8LB 3ESVF 2AJSH 4P23A 2Z8RA 1MAKA 2HRHA 2G5RA 2JI2A 1U91A 4NQSA 4K7PX 1WCBA 3VXNA 1RFDL 2H1XA 1H5BA 4M3JA 2Y7LA 3T0ED 4ZFOB 4WV1A 3HG1D 4OY9A 2YAMA 1ZDSA 2E9WA 2ZKHH 4UDTA 3T1FA 1A7BA 1JXDA 3A23A 3APNA 1K4CB 4X42A 2IH8A 3NSDA 1DE4B 4Z7AA 2HFFA 3BAWA 3FSOA 3DC0A 4ZZKA 2F5AH 1RUML 1U8PA 3VFUA 3QC5X 2YXWA 1MKFA 3KWXA 1PKQE 1OAZH 4HPHA 1KCLA 3M86A 2A9NL 9PCYA 5IFAH 4WI2A 3Q48A 1J88A 4OI7A 2A9MH 5T1KA 3DVGA 2XVKA 4F7EA 3C6LA 1LLAA 2AJVL 4PJFF 4RSYA 4EBQL 1A7PH 4AL8H 2DBLL 3PE9A 2XZQH 4RGNC 1GYWA 4X8JB 3S37L 2VQTA 5C0JB 1JPGA 3HPLA 4EF3A 4P5TA 2RMNA 1T5XB 1FGVL 3D4CA 1MI5D 2OTPA 3OAYH 1M42A 3RZWA 2GPZA 3Q5TA 1MDAA 2OZ4A 3QO0A 2JXMA 4EI5C 3KHOA 4FKHA 5G55A 4JQIA 4TNVF 1ZMYA 4G70B 3T2OA 2ORBL 3LSOA 1CZ8L 2R29H 5DJYA 4KDTA 4JS7A 2DYSB 5LN4A 3KEDA 4RISH 1WWAX 3OLDA 1ES0B 4ZK8A 3ZZLA 1DUYA 4XVJH 5KYWA 2SEBA 2D7OA 4GUCA 4AUUA 3JWOC 3SDYH 3I6KB 2YK1L 1R24A 5I1IH 3T4AA 4GBXC 3C87A 4PS8A 3KPPA 4FE9A 4WUUA 4IRSC 3OWEA 1HSBB 5K9QG 5D7JD 3UZEC 5L2KE 2O30A 3P77A 2AJ3B 1ID5I 3SY0B 4B53A 1F8TH 4LLYA 5CEYB 2K1MA 1HHHB 3QXTA 1LP9E 3M7OA 1IGIH 3L95A 1O7DC 1VACB 3CIAA 4M48L 3QIUB 4LSRH 5E2JA 3UG3A 3VWKD 5EIIG 1W15A 1KGYE 4XPAL 3KLQA 3N0PB 3QORB 5BPPA 1NGZA 5HGBA 1YNKH 1OGAD 3L1EA 3SCMC 4WO0A 2PUQT 3IDNA 4LEXL 4WW2A 1IM3D 2AMUA 2P42B 4M7JL 2UWEB 1E30A 4AT6B 3DX4A 2C8NA 5DGRA 2Q0ZX 2X6UA 1HOCA 1O9ZA 4Y16C 3LNHA 5E99L 2GJPA 2O72A 1CK0L 3L7FA 5IJKA 4WHYG 3GT6A 1TZIB 4NPYB 4S2SB 2PWDA 4Y19A 2ITFA 4U1JA 3W11D 5F89B 1PDKB 1RVFH 1YCSA 5B1KA 4RSVA 1GJUA 4BFIB 3HZYA 1EK3A 1KELH 2Z4TA 3ZZ1A 2I5YL 4ZD3H 1CBVL 2YD6A 2ESVD 1KLGB 3EAKA 2ZNXA 4JCWA 4OIBA 2LGNA 5ID1B 5DVNA 1BLNB 3DUUB 1LO0L 1UT9A 1X9QA 4J3TA 4HFUH 3TZVB 5HPOA 3HVNA 3L1OH 4HK0B 1RL1A 1VZGA 1T1YB 2FH8A 4P9MH 3C5ZA 3ZYJA 5IV2B 2W65A 2F6AA 2XV3A 1U4FA 2OP4H 1JL8A 3HE6B 1MY7A 5MI0B 3WY4A 4AZ8B 4XNDA 4NCDA 1RJLA 3S35L 1ORSB 1LDPL 4WUKL 1XT5A 3U36B 4XNAA 1P7QA 3JTSA 1LO2L 3JWNE 4NO5A 4UQDA 4YXKH 1PZ3A 4OCYL 1Q9LB 4FQPA 4X9FA 2QPFA 5FHAL 3V4PL 1X7TA 1H0DB 2P5EE 4NM4H 3U2IA 4MASA 3ESUF 4OFVA 4D9QE 1BZDA 1HI6B 5LGHL 5MEND 4AQ1A 1XEDA 2NMSA 4F27A 1NLBL 4HKXA 4NQCB 1DQKA 4PJ8A 1JCVA 5J6GA 1HVXA 1IFGA 3V4VH 3B2MA 1IT9L 4W81A 2J1WA 3BPCB 4DN3L 2X89A 4O2FA 4NKMA 3CZGA 4LSDA 4WLCA 3TTYA 2W07A 2DQCH 5CSBA 2W59A 3KBHE 4E9XA 1JTPA 4U1GB 1EWHA 5JW5A 1CCZA 3NOIA 4OBRA 3TWCL 3AWGA 4HC1L 3DYPA 1X4ZA 1O75A 2ADFH 4MDIA 1PLAA 5EC2B 4UM9B 3EKCA 3U0PA 3KW7A 1X5IA 1J5DA 4HKBB 2BIHA 4LBEA 4HS8H 2N0KA 4ZUUB 3I75B 2BCKA 2J44A 3NIFB