3OZLA

Crystal structure of human transthyretin variant a25t in complex with flufenamic acid.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T in complex with flufenamic acid.
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3ozlA00
3CXFA 3DJZA 3NESA 3ESOA 3NEOA 1DVYA 1QWHA 4TLTA 3D7PA 4QRFA 3A4FA 4PMFA 1SOQA 2H1XA 3IMWA 1Z7JA 3I9AA 5E4OA 1TLMA 4IKLA 4L1TA 5FO2A 4PWIA 4Y9CA 4N87A 5CN3A 5DWPA 3BSZA 4Y9FA 2QGEA 4PWJA 1THCA 3DK0A 1GKOA 1GKEA 3SSGA 5L4FA 1IIKA 1TTRA 4IKJA 3I9IA 2QGDA 4Y9BA 3CN4A 3CFTA 5CLXA 4PM1A 4Y9GA 5BOJA 1TTBA 2TRYA 3IMUA 4PMEA 2G3XA 1E5AA 4TLSA 4HISA 4WNJA 5CNHA 4TKWA 4AC2A 4ABUA 2QPFA 1TTAA 4I85A 4HJUA 3GS7A 5AKVA 5TTRA 2PABA 4TL5A 1DVXA 1TTCA 5EZPA 1KGIA 1DVQA 2G5UA 3W3BA 2B77A 4L1SA 2ROYA 1OO2A 3P3SA 1SN5A 4ACTA 4N85A 1TT6A 4ABVA 5L4IA 1TSHA 1BMZA 4ABQA 5CR1A 4FI7A 1IE4A 1IIIA 1SOKA 2B15A 2B16A 1SN0A 1X7TA 2B9AA 3IMSA 4HIQA 3FCBA 4KY2A 2G2NA 3CFNA 4TLKA 5FW6A 4Q14A 1BZEA 3U2IA 5AKTA 4DESA 5A6IA 3CN0A 3IMTA 4HJSA 5CM1A 3B56A 4TQPA 3GRGA 3DJSA 2H0FA 1FHNA 2H0EA 1FH2A 1DVTA 3CFQA 3NEEA 3IMRA 3A4EA 4MRBA 1BM7A 4I89A 2G4EA 5K1JA 3GS0A 3NG5A 4IK6A 2H6UA 5JIDA 5JIQA 2F8IA 1DVUA 3FC8A 3GRBA 3GLZA 1E4HA 5E23A 4DEWA 1E3FA 4DERA 1DVZA 1F86A 1TZ8A 3DJTA 3CBRA 4N86A 4PWHA 3TCTA 3DO4A 4AC4A 1ETA1 1ZCRA 5JIMA 5K1NA 3KGTA 5AL0A 1BZ8A 4MRCA 2TRHA 4PVLA 4WNSA 1F41A 3OZLA 4YDMA 5AKSA 5L4JA 1IJNA 3A4DA 3Q1EA 3I9PA 4IIZA 1RLBA 3NEXA 3QVAA 1QABA 1ETB1 4PWFA 4IKIA 5DEJA 4I87A 4HJTA 4IK7A 4PWGA 5FW7A 3ESPA 3BT0A 3CN1A 3IMVA 5HJGA 2QGBA 5IHHA 1ICTA 3DK2A 2G9KA 1BZDA 3DGDA 4TQHA 5CLZA 2B14A 1TFPA 2NOYA 4MASA 5CLYA 3IPBA 3P3UA 2GPZA 3DJRA 2IGLA 1U21A 4Y9EA 3GPSA 5AYTA 4TLUA 4YDNA 3U2JA 4IKKA 4PVNA 2QELA 1G1OA 2QGCA 3CN2A 3KGUA 1KGJA 5L4MA 3DIDA 3D2TA 3P3RA 4TL4A 3OZKA 4FI6A 4TM9A 1DVSA 4FI8A 4PWEA 2GABA 4WO0A 3GS4A 4PWKA 4TNFA 4TQ8A 5EN3A 1Y1DA 2G4GA 3IPEA 2G3ZA 2FLMA 2F7IA 2FBRA 3ESNA 3CFMA 1THAA 1SN2A 3IWVA 4DETA 4DEUA 2WQAA 3IWUA 4TNGA 2H0JA 2ROXA 5E4AA 4TNEA 3TFBA 2G2PA 2H4EA 4ABWA 4TQIA 5FW8A 1ZD6A 3KGSA 4QXVA 4QYAA 3HJ0A 4D7BA 4PVMA 1TYRA 1X7SA 3CN3A 3M1OA 5AL8A 4ANKA 3P3TA
chains in the Genus database with same CATH superfamily
1XB6A 2VLRA 2EYTB 3KPSB 3LIZH 1IGYA 3SOTA 5IB4A 5AW6B 4OZFB 2YPLE 2WINA 1FUNA 5HPMB 4I77H 2VB5A 7TAAA 1N26A 2R9HD 3KW7A 1C5BH 5F1SA 4NDMB 1BEYL 2APTA 4TPRL 4ZFOB 3ZE2F 4U1NB 1PKQE 4LVHC 2XJLA 2B1HH 3RY4A 5CIPB 4KKQA 5F1NB 3S8FB 1NFDA 3GMRB 1H3XA 4QWWC 2CGZA 3S3JA 1QQDA 1DQJA 2XWDA 2BFGA 5JHLH 1CXHA 4U3XA 4BFRA 3V7MA 1WJ3A 4XOEA 5FHAL 4I85A 1RUPH 3KEDA 4O51A 2EE9A 1AQDA 3RDTA 1ACYH 4P5TC 4I8DA 1NPNA 1FCCA 1V8HA 2P24B 4KZEH 3ARTA 3O3DB 4MJ6B 4BZ2H 4F7CA 1YY9C 3EHBD 3JWDH 4QRRD 4H20L 1CFSA 4P59L 4RGMC 5DC2A 3ZGIA 2XN2A 1YAIA 5HYFA 4DZBB 4OCYL 3I3BA 3OB8A 1DANT 2UZYA 2RCSL 3GMLA 1T03H 5FV1L 2P49B 1EGJL 1BX2A 4KTEL 1AANA 1Q0YH 3CZKA 2BY2A 2DBJA 1NC2B 5AVWB 1HX0A 5DZ9A 3RPIB 5F6HJ 1PSKH 1JPGA 4FQPA 5I6XC 2JLLA 3S34L 4XWGL 4D0BA 2K6YA 2G4EA 4WTZA 1U58B 2IAMA 4JFTA 2N7AA 3GUTA 3QUHA 4MMXA 4HC1L 2D7QA 5DS2A 2OMZA 1BBDL 4JEGB 3Q0HA 4U1MB 3QIUA 4DQAA 3I6KA 1A14H 1Z0MA 1A6PA 3EGXB 1FLRL 4IIZA 2Y7QB 4XMKH 5D7IB 3OBAA 4M8VA 1JF5A 5F97E 4KKZA 2GFBA 4H8QA 2IG2L 5FW7A 1FIGH 4H88L 4NCC1 3IMVA 5A2BA 4RMRA 1DL7L 4NC1C 4OZ4A 3L8QA 4W9IC 2AV1B 5EC2B 4NQEB 1GAFL 1IC5L 1HSAA 2Y5EA 1IM9B 3OMIB 2CKBH 3WNIA 5BS0E 4LLVA 2CO6B 5ALCL 4YDNA 4HKBB 5HJBA 3NCBB 3BIKB 5IJCC 1M6OA 2AXGB 4XWOD 3AWEA 3ZQWA 2BWQA 4X6EA 3MLTA 2X4NA 4PGBA 5ITBH 2DQGH 1G6RA 3MNZB 4NAJA 1JTPA 1TXKA 4WJG3 3TXAA 2OX5B 1RZFH 4ODWA 6FABH 1AG0A 2AQRA 5E2JA 4JRFA 4BCZA 1GYWA 3CZJA 2PKDA 3J2PA 1DN2A 1I53A 1NDMA 3APDA 2IFGA 1TO5A 2YPKA 3AABA 4HWEL 4D7BA 1IBFA 3L3JA 4P57B 2YXWA 3LKRB 1ZPUA 2X4OA 4LU5L 2OL3L 4KXAA 1EXUB 3HC3L 1MCEA 5DA4A 5TF1H 3K2UH 5DO2D 5KAQF 3QDHA 1X5ZA 1W16A 2YFNA 1Q9KA 1FJ1A 2KQNA 3ZTNH 1Z1WA 4OF5A 3UIZA 3V6ZB 3C6LA 4NOFA 1D9KC 4A7TA 3PDGA 3UCQA 1ZY9A 5CILL 4JB9H 3TONA 5E08L 2NYYD 4GAYB 2WLZA 3ZHFA 4W4OC 3O45B 1BWMA 3D85A 5D1QE 3WJMB 3FSVA 3QHFH 3PE9A 5CN2A 5PAZA 3CMGA 1M7DB 4BUGA 3Q9PA 1CTMA 5KOVC 3K81A 3HBGA 3BFWA 4BZ1A 5I0WA 5T1KD 4AL8C 3MBED 3QZBA 3ZO0A 5GGSA 5I17A 3RJQB 1C7SA 3FYEB 3CX5J 5G55A 3MCKB 2Z8VC 1LO3L 1ZK5A 4L5FE 3QC5X 1MFCH 3F5WB 3JWOH 2DM4A 1MUJB 2EIJB 3G6JB 1FV1A 3BSGA 4PJFB 1M71B 5DT1H 1IGTB 1ZHLB 1HJCA 2BVQB 5F1IA 1BQKA 5HI3C 2XBDA 4PJAF 3CVIH 5GSRA 4XC1L 2ZWLT 2W9DH 4A2LA 4B50A 3SEPA 2B3RA 4R90L 4XN1A 2WMPB 5E1AA 2XN9E 4POUB 1EDYA 2E74C 3SJVD 3VX0A 3Q1EA 1A7PH 1MVYA 3FQRA 3WIFB 1FNAA 2DQCH 3HBPA 5TE6H 4PJEE 2X9ZA 3OL2A 3R18A 1FFTB 1MEXH 2F5BL 4YNYA 3BGAA 3L95A 1FPTH 4NP4H 2EIZA 1CFMA 2YOCA 1L5GA 3PUCA 1QSEE 4LRIC 3WEMA 1EEYA 1T0MA 1E5ZA 5L2KA 2IGLA 5I1EH 1BZQK 5DQ9B 3O2DH 5SV4A 3LSOB 2QKSA 3QIWD 3CHXA 2AEOA 4NQVB 2AV7B 2UUDH 3NFPA 2EILB 3VI3B 4BQ6A 1HSBA 2DLGA 1J12A 1QUPA 4QHMB 5IMMB 2VR4A 3ARFA 2CMRL 1CI3M 3HRZB 3NZ8A 3VG0L 5B8CB 3DOIA 4AXWA 2Z34A 1YECL 4LLUB 2E5EA 1C5CL 4Z0XA 4HZLB 2AHIA 2VLKE 5DSCA 4RMBA 4M3JA 3VRIB 3OJ2C 3UL4A 1YN7B 3KLDA 5E6SB 5T1LB 5IB1A 5GGRB 2GJRA 3IPFA 3FS9A 3MRIA 3MV8B 4XNZC 4Y19E 3OJVC 4DOHB 4GW1B 4JRYD 1T0OA 2A6JA 3UAJD 2ZKHH 4Q9QH 5J13B 1UKSA 1O6TA 2BVOA 2VXVH 1U8OA 2H32H 4LLMA 2Z35B 4PRAA 3U2SB 4F92B 1HH9B 3R06B 2ZAIA 2W9EL 2DLEA 3TPUA 4K94H 1YYMH 3ECWA 3EGDB 3F84A 2OW6A 1CT8B 3ABKB 3QO1A 2WLLA 3KS0H 4BXVA 4XN8A 5FYLH 4JDVB 2CDEB 2JKJA 2OMTA 1FHGA 2O4EA 1NANI 1U41A 4LLDA 4WVRA 4XN9A 5MI0C 3L54A 1D5ZA 12E8L 1ADQL 2F6AA 3VYNA 2YEVB 2EIBA 2NX5B 3X3FL 2D2OA 4WI9A 4WI2A 3HPJA 4I2XA 5ESAB 1T22A 2E7HA 1LP9A 5E2TL 5F9AC 2QHRL 1Q38A 2X2JA 2FVNA 2WUBH 2HX7A 3BKYH 1BDYA 1RD6A 2KH2B 3HFML 4FFYA 5C2BL 2CLZA 4H8PA 4NHCL 3ARWA 1L0PA 3FHQA 3I9GH 4YHNB 3KYNB 3AQDA 2IFFH 5B8CC 4HIIA 4MCYA 3SYOA 1JZDC 3LXUX 4Y1TA 4GAGH 1OAQL 1JZ8A 4RIRA 4L18A 2CUMA 1EAOA 3QCVL 3SKOB 4MBOA 4KAQH 3SCMC 3FF8A 1HL9A 4HPOH 1QWUA 1Q1JL 2OJZH 2DDQH 4U4IA 1ZDQA 1YHPA 3OHXC 4GUPB 2FD6H 2NT0A 3CBRA 3MUJA 2EO1A 2FSEB 2NNAA 4FQLH 1SJXA 4GKOA 5FOJA 4IRZA 2QQNL 2CZNA 1RZGA 5J13C 5IQOA 2FJGA 2DJSA 3UGEA 5CJBA 5A7BA 4FFTA 5KS9F 3HZYB 2UY7B 4FFYL 4GOSA 1T0PB 1ZSDA 3PWNB 4NO0A 3BE1L 3RA7H 4AENB 4YHIA 4OIBA 3EYOA 5KSAB 1QFWL 3QUXB 5CJOH 1PYWA 3T4YB 4MQ7A 3NCMA 1IAOA 1Z9MA 2OJEB 3HAEG 4H5SA 4RGND 4DIXA 5I30H 2IQAB 4HD5A 3ZW3A 5I19H 1B90A 1TZIB 4PRNB 4KKNA 3N9GH 3KBPA 1H3GA 3T1FA 2EQDA 1IKOP 3DIVA 2EDQA 5FLUA 1AIFB 5CU9A 3SQBA 3WMSA 4FQ2H 4NO5B 4D0CB 5FGBC 1X6NA 3RL1A 5IZ7A 4G8FB 3CFBA 1DBKH 4YPJA 1BQHA 4ZX3A 4RDQF 4EVNB 1GS6X 1YJDH 1O5PA 4UTBL 1BQLL 2W91A 3AUVA 4FZ8L 1BVKA 2A83B 3BRDA 5FYJU 5HVHB 3DRQA 1KWKA 2WXPA 3CXFA 4WWKC 3ARGA 1M1XB 2Z1PA 3MCYA 3NIGB 3WKML 1PG7X 3MVSA 3N0PB 4NENB 5E8EA 5MERA 4K4KA 4E9SA 5CUSH 2YD1A 1EEQA 4IIQA 4JR9H 4LSPH 2E6JA 4FZEL 4Y1AB 2WP3T 3FFCB 2Z92B 4XBEL 2KC0A 4UT6A 4JREC 5I1HH 2VLJD 4XPBH 5JOPD 5H8DA 1WIPA 4F8LA 2OYLA 4KV5E 3ULVH 4XBGA 2X28A 3QNZA 3VGAB 3CD4A 1VFOA 1P6FA 2Q3AA 2G5BB 1WBZA 4MB3A 4AC2A 4HJJL 4TUOA 4UOJA 3FRUA 3PDDA 4LQFH 4LOUD 3MUZ1 1KLGA 2AJUH 1AXSB 1IMHC 1IB5A 1SHXA 2OMYB 1H6EA 4D7PA 1KFGA 3FCUB 4MYWB 1R3JA 3IGLA 3Q7JA 1QACA 3IETA 4DUXA 3TN0A 4ELMF 4AQ1B 5D71L 2QDWA 4XNMB 4HQQH 3OKEB 3S98A 1A7OH 1CF8H 1AHKA 1X5HA 4P2CG 1ACCA 4TTDC 4XMPL 3L17A 4X5PA 4E9WA 2G5RA 3ZKXC 4UU9B 4AL8H 2Q87A 3SBRA 1U8PB 2GSIB 3ZDYF 5D7JC 3AMLA 3FBKA 3C5SA 3KD4A 4IS6B 2VW4A 4NZFA 1W80A 3MR9A 1R3IH 2MOQA 4ZAKC 5AVQB 4OI8A 3FFDB 2MPAH 3J7HA 3IGKA 3SQOL 2AVGA 5FM4A 1OSZB 3GSNB 5FUOL 1A0QL 1E3XA 3KYMA 3DI3B 4HGKC 1NL0L 1AOHA 3QE5A 3U6RB 2LU5A 2XG4A 3QJUB 4F3FB 4U6YB 1S7WB 1ZT1A 4JFEA 3WNPA 1Y1UA 5C09A 1GHFL 3EUUA 2FBJL 1BZDA 1CDHA 4X80H 4FXGB 1ZLVH 1TJXA 1B4JL 2CRMA 4FQJH 1RIUH 1VHPA 4Z0BL 3DBSA 1JFQH 2XWTB 1AZRA 4JHZA 1VKXB 4Y4FB 2O26U 3GJEA 2XI9A 4EKXA 4FFZH 4O5LL 3QXAA 5KTEL 1PU0A 1ULVA 1XZ0A 4Z7QE 4NKDB 4HU2A 5DJZB 3MLRH 1GZHC 4MZ3A 5DLLA 1NAMH 4DETA 3NPZB 3TJPA 2DB8A 1YEGL 3FQUA 3WY2A 4UINH 3PL6C 4Y89A 5I0XA 1K5NA 4IDJL 4PJFF 2VQUA 2YPLD 3QYCA 5EZJA 1OCWL 4PJCE 3L5HA 1S6NA 1NIDA 4FFVC 2W65A 3U9WA 5KYYB 1F56A 4LSTL 3VX1A 2R0KH 1HDMA 1NGXA 5EWIH 2V17H 4BFNA 2YMOA 4PWJA 3HI1A 3LEXA 3Q2LA 1NAKL 4IRJA 3V0JA 4M6NH 4HUCA 1U9KA 4KZ0A 3V5KA 1IAII 5LJYH 3B8SA 1PFCA 4D9LL 4DSYA 2EDKA 15C8H 4LPXA 3CLEH 1MVFA 1M42A 5BUAA 5CHNA 4DTGL 1JK9B 4Y2DC 2DQEL 1E8ZA 2XWEA 3EYQC 3GXIA 2QHLA 5EZPA 3UC0L 2E7MA 3J07A 3IDGA 4RRPA 1AH1A 3OLIA 3KYAA 4OJYA 3K6OA 1JZIA 4N1CA 3DC0A 5JOFA 1DJXA 4GBXC 5CEZL 3LS5L 3D69B 3GI8H 2AQ1A 3VI3F 2YLKA 4Q14A 2CCLA 4EAEA 5ANMB 2D3LA 1GS8A 2IXQB 2X0UA 1H5BC 1Q8MA 3QJSB 4JRLA 4NQDA 3RJOA 4Z3EA 3EFDH 3L6FA 3FO9A 4JM2A 2WLNA 4YL4A 3PHQA 2AK4E 3B9KB 3SDDB 4NJAL 3VW3H 4CDGC 1IGMH 3IDNA 1DE4A 2MQGA 4GG6E 4PJGA 4XOBA 2GTZA 4N22A 5FXCH 3DVFA 2ED8A 5E99H 3TCTA 4F2EA 1UADC 1U8HA 4N8VA 3LXCA 1LEGB 2NY1B 4KGJA 1R3LA 3O41B 4ECNA 3LTVA 3DO7A 2ZAGA 3K72A 25C8H 1HYSD 5D7SH 5BS0D 1E5CA 3CDYA 3H42L 1J9TA 2SEBB 2KQMA 2FK9A 4IRSA 2GIXA 3DX3A 5ADOL 1SY6L 4LHUD 3KJ4B 2XN0A 5JMOC 4ERSL 3QDGB 5F7WC 4ZMTA 1QPXA 3Q2WA 1BZ7B 4YSEA 4PWEA 4OCSH 5E2VH 2BIQA 4M7KH 3PGCA 1MNUL 5EN3A 5FYKH 2G4GA 3D0LB 2FX9H 3V0EA 3B9AA 3ENEA 3T65A 1O6VA 2FIRT 4PRDB 1JDAA 3IDMB 3SGEI 1AR1C 1CBJA 2VH5H 3FSAA 5DHVB 4WK4B 2PYEE 2WXKA 2VUKA 4Q4IA 3FU9A 3N1QC 3LV3B 3CC5B 2XA8H 2ZKXA 3WUWB 3E3QC 3WKYA 5EZIH 2VXTH 2BS9A 1AQKL 2IDQA 2R0LH 4Z7WE 3TIEA 2X4TA 1E4XH 3NCWA 5JUEL 3BPCA 3FZUD 4R6UA 1SEQH 3ILPA 1JF1A 1EJ8A 1X9LA 3GB7A 3N41B 5J57B 4BM7A 1QW8A 1W8NA 1YMMA 2DBLH 4QTIL 4YC2C 4QEGA 3MKKA 4WNQB 5D1QD 2LGNA 5DUBB 3VRLF 4B96A 1XCTA 2AF2A 1MN4A 1LO2H 4NJ9H 3MUY1 3C8KA 4GKNA 1TNMA 4HLZG 3COOA 2ETWA 3NT0A 3RGVA 4FTVE 1ZRUA 3B34A 3SODB 5KBLA 3LQZA 3LNEA 3OG4B 4G72B 4Y16B 5DD0H 3RWHA 1IGJB 2WZPD 4ZOCA 2NDFA 3CFEA 3CLFH 4Z7NB 4N85A 3QPKA 5E0QA 4AUJA 5CR1A 4K71C 3TS8A 4OCRH 3VUAA 4ZTPH 2RH0A 2EO7A 4LSRH 3OM3B 2VDQH 3NH7L 4X9HA 1DQTA 3V4PH 4Z78B 1JNHA 5EU4A 4MMZB 2NQCA 3MACH 5GS3A 4PJXA 1NCOA 1ND0A 2ICWB 5E00B 5GJTL 5H37A 3R8BB 1MNNA 5IHZB 1P84J 2Y06H 3SDAA 2EE0A 1X5KA 3LPOA 3H9SE 3TBWA 2XN9D 4MJJA 4XZUB 2H9GA 2V5SA 4IGBB 1KN4H 3O8XB 3VFTB 3O4LB 2ZG2A 5DFWH 2O5NA 4BDVA 3DBXA 1CG9B 1U2CA 2YMXH 4BK8A 1O7VA 2YAFA 5TDNB 2NNFA 1CGWA 4EUPA 4PJHE 4EZKA 5I73C 2ZCKH 1DQLL 3T3PB 4EDWH 5DJYA 3LNDA 4X7TA 2YK1L 4HALA 1ZTMA 2XKUA 4AQOA 5ICYA 1SM3H 4V33A 3N1GC 1NCIA 1F8TL 5AOKA 3NFNA 1RULL 2NZ9D 3BAKA 4HZAA 9CGTA 2DQFB 3P0VL 4L8CA 4XPTL 1S7TB 4B7LA 4K9EL 2AGJH 3QUYD 4FYQA 1MFAL 2PCPB 3D50A 2ZTBA 2XZAL 4ZFGL 2X9WA 3GRWL 3PNRB 4GRLB 4LHUG 2PCFB 2Y2TA 5IUCA 4L37A 2RQEA 2ZX9A 1KB3A 2HTLD 3QWQB 5CLTA 2KL6A 4MZ2A 4LVNB 2VLKD 2NY5H 4TYUA 3MGOA 5MEPA 1CR9H 3KPMB 3X14B 3RZCB 5E6ZA 1HNYA 2Y72A 4PPTA 4Y19D 3C6EA 2FEJA 4QXVA 1B4TA 1XV8A 4JG1H 1S9VA 4G7YL 4IM8A 3RX7A 2VLRB 3GI9H 2UXFA 3S36H 1WITA 1IGYB 5DJ6B 4ODVH 2ORBL 5IB4B 1QFUL 2WINB 4KPHH 1SDAB 3MXVL 2B4CL 3VI4E 2ITFA 3GKWH 4L1TA 4UM9B 3RTQC 2Z31A 3O8XC 2FUQA 4M62L 2C1PA 5J5EA 1G5AA 1GR7A 1IZJA 1P53A 1ROWA 3MCLH 1ZEAL 4J8RA 4L2YA 3OKKA 1NFDB 2QQLL 5BVPH 3FMGH 4JZJA 1ZVNA 3SYPA 1QQDB 1DQJB 2COQA 3AB0C 3PS6A 4PBXA 1UM4L 1HYRC 3VSTA 4O51B 2ENPA 1AQDB 3N44F 3RDTB 3A22A 3KG5A 1LILA 1S3KH 5HDBB 2XWRA 4F7CB 1LO4H 1WK0A 4ACTA 5MHSE 1I1AA 2E27H 3V5HA 1CFSB 1AXTL 2WP3O 2YJLA 1J8HE 1A1OA 4CVUA 1Z3GL 3ZQXA 4H1LA 4JKMA 3GMLB 4LO9A 8CGTA 4LVNC 5KVGH 5IUSA 5DD1L 2RMNA 2N59A 4OSUL 2FYYA 2E7LC 4D0BB 4YSPA 3FRPG 4K3EH 4CJ0A 4W9LC 4YX2L 5ETUA 4CSSA 1F45A 3GUTB 1X4ZA 4MMXB 5HHMB 3H6JA 1JIBA 1N8OE 4B97A 2OMZB 1HAWA 4FKKA 4K3GA 3CU1A 1I7ZA 3N91A 3QIUB 3I6KB 4BYHA 1G7JA 4DKFL 4NC1E 1OXYA 3FTYA 1NBCA 2GFBB 4DFIA 4HJTA 4HOXA 2L7UA 2VERN 3RGHA 4XHJC 3SO3C 4P3CL 1YEHH 3BT0A 1KY6A 3QXVA 1J11A 4OZ4B 3KPRA 3L5IA 1HSAB 1DO6A 4N2DA 1SXZA 4ETYA 4U33A 4LLVB 5IQNA 4UZUA 1WZ1H 1CLVA 2CWRA 2ZSVA 1IBGL 3RWJA 3RDTC 1NGZA 1CU4H 4BRVA 1M6OB 2E6QA 3P2TA 1ANUA 4QLWA 4X6EB 3MLTB 2CIKA 2DZEA 2X4NB 4FFWD 2YMTA 4PGBB 3TBYA 1G6RB 1WC7A 2WPGA 4B53A 2VZ3A 3O6ML 5IBUB 3WBDA 4ODWB 1LNUA 4Z76A 5E1HB 3MV11 4GP5B 4N2NA 4TNVK 5FCUH 2C26A 3G6DL 4UNUA 5DRWA 4G83A 4UTAA 1NDMB 3SPJA 4W9GC 5DEGA 2YPKB 3RVXC 2DQDL 1QUNB 3L3JB 4GXVL 4WGWB 2Z1KA 2X4OB 4BFBD 4MMYA 5FDYA 4N0RA 3WIIL 5F7LB 1SEBA 5IK3B 1KJ3H 4KUCD 2IAMC 2R56H 3W56A 4XP6L 1FJ1B 3BSZH 2KI6A 4FL4B 5D7IE 3QJXA 5I1GL 3C6LB 4F7KA 1DEDA 2HLFC 2ZNXA 4YLCA 1N5YH 4ZMNA 1OM3L 5CJXA 4GO8A 1MJUH 3OKLA 3P0YH 1WQVT 4WI4A 5CFAA 1IBYA 3SPGA 3TO4A 3E8VA 2IJ0C 5GS2H 4PUBL 2VDKB 1YPZE 2A9MH 2XQYK 3D85B 1G94A 3ILEA 5DGQA 4P23A 4TOYH 4OGXH 1KBWA 4N90E 4UTAL 4OZIF 4IBYA 2R8SL 1XFPA 4Y4HA 5GGSB 5I17B 2BSSA 3PG2A 5I6LA 5MEQB 4WSKA 1B9KA 4CMHB 2OSYA 2Y36H 2EIDA 2IPKB 4E9LA 4ZXBC 1OP5H 1QA9A 5IHLB 3PXHA 2RA1A 2V2XB 4JFSA 1Q72H 1FV1B 1SNRA 1VFAB 3P30H 3KLQA 4QRQA 1BM3L 5TE4L 1UATA 2XC8A 3R0NA 4NWUL 3VCLA 4JJHA 3L4WA 4ZUUB 1OWWA 5F1IB 1AHMA 1FQ9C 2CLVA 4QIRA 4UV7H 4WRLA 5F1KC 1IM3A 4LL1A 2E76C 3C2AL 4OFKA 5GSRB 3WKQA 5D93B 5IMLA 2J6EH 3MLPA 2DY2A 4DO4A 5E1AB 1AVAA 2QV2A 2LLLA 5E2UL 3QR0A 2CPUA 1RLWA 3FQRB 3DJ9A 5JDSB 3W81A 3US0A 3CVHH 3NEXA 4PH8A 4R4FH 4PWFA 5DEJA 1UCBL 4YNYB 1NIEA 3L95B 5F7YC 3D8MA 4CN6A 3QZWG 1L5GB 3BO8A 3RB7A 5KVDH 1EEYB 1T0MB 2JKXA 3ROOA 4CA4A 1IE5A 2D7OA 2NOYA 4HF5H 2Q8AH 5L2KB 2WXRA 4UQ2A 2Z8RA 3FQ2A 3VA6A 4RNRA 1D6VL 2O6DA 1E4JA 3TH4T 3NFPB 2B0SH 2F1EA 3CN2A 1CLYH 4GRWB 4NZ8A 1KEGL 1HSBB 4R3SA 3V0DA 3MI6A 1KEML 3O6FA 3MO1A 2Z7WA 3ARFB 2VDRH 2AXHA 3G9AB 3NZ8B 3IKKA 3VM5A 2PP9A 5FFLA 2IOMA 4JUSA 3MJ9H 1JYNA 3W38A 3L4VA 4Z0XB 2FJFA 5IEKA 5IHUL 4OBRA 4HWBH 3U82B 4XVUC 1UXWA 2VDPH 1ZS8A 3G3LA 4PG2A 1MAKA 5GQBA 5IB1B 3M1OA 1OT4A 1YUHA 3MRIB 4I1PA 3QIBA 4PFEA 5ALBL 3C5ZA 2A6JB 2VZVA 1XGYH 4PRAB 2BVOB 3SD2A 1X7QB 1U8OB 4DW2H 4LLMB 3VSUA 4JDTL 4JVWA 5T3ZD 3TPUB 4LLYA 2FEEI 1DBBH 1PQZA 1GZPA 4RBPH 1MIEH 4C4UA 4OJFL 1I8KA 4I9WE 1ZWIA 3QO1B 3N3EA 4PGDB 1MKFA 3AY2A 4K5NA 3G5VA 1QATA 3RX5A 3UP1A 4Z3JA 5IY5B 1TR7A 2OMTB 1BFTA 1M7XA 4HPHA 4TN9A 1AKJD 1D5ZB 5G4NA 3B9EA 4LEEA 3MAWA 1IFHL 4DP2X 1UB5B 3HPJB 3UTSA 4I2XB 1T22B 3HZMA 1LP9B 4JFDA 2CLZB 3QQNA 4DPBX 4HBQA 3BUTA 5I5JA 3ARFC 2JJUA 1UKQA 4NLAA 2OS7A 3NZUA 4HIIB 4MCYB 2ATPA 4X0NA 2AK4D 4Z1PA 3GXUB 4PCSA 4OLXL 1KBGL 3KVDD 4GSQA 1FHNA 1PTZA 4DOHE 1C8QA 1PD6A 3H2WA 5AENA 4HW6A 4AW7A 3CVBA 4C4BA 4RZKA 3PWPA 1BEYH 4PWKA 1KBPA 4TPRH 4X0KA 4KXDA 3MZTA 2NNAB 4L23A 5FYKE 3TASA 1UACH 1RZGB 4LNRA 1XF2A 1PG7L 1TQBC 2FJGB 1KELL 4RRPM 1WUNT 1F41A 5FHAH 6CGTA 3NCFB 5D6DA 1ZSDB 4NO0B 4ATWA 4HUMB 1OAKL 4H20H 4YHIB 4P59H 2FEDD 3EYOB 1YNTF 2NX5E 2BPBA 2CNYA 3HB3D 4G80A 4GQ9L 4BELD 1PYWB 2H5UA 4MQ7B 2QLYA 3BI9X 2E8YA 1IAOB 4NM8H 4OCYH 4OF0A 4H5SB 1U8NA 4FMKA 2VIRA 3MOAL 2LW3A 1QSFA 1EFXA 1EGJH 5IB3A 5HDBF 3UO1L 2NY0B 1RK1A 3T1FB 5JA9A 2GJ6D 4CKVX 5GS1A 3RHWF 1IC0A 3SQBB 4ELKA 2KPWA 3D33A 3S34H 4XWGH 2LU7A 3RL1B 1F4XL 3CFBB 3RY6C 4GAFB 3M46A 1BQHB 1WTGT 1NC4A 1NMAL 3APNA 4W9JC 4HC1H 1OSEA 1BVKB 2YSSA 3ARDA 4ZOEA 3S35H 1BBDH 5EIVA 2O5YL 5IMOA 4MB1A 1FLRH 2H7WA 1F90H 1CD1B 4ALAL 3OR7A 1PZ3A 5E8EB 5MERB 5KW9L 2IG2H 4KO6A 2K6ZA 4IIQB 4H88H 3K46A 2QMJA 2QVKA 3C60C 4P9ML 3ZHKA 3EUDA 4FTVD 4P5MB 3QXDA 4XBGB 3QNZB 4ZFZA 1NFIA 4U1GC 2ZX5A 4EIGB 4ZS6C 1WBZB 2DV6A 4TUOB 3FRUB 4ADGA 4BCYA 2P28B 5FK9A 2Y1ZA 2VZOA 1KLGB 3QORD 1EO8L 3V6FA 2DYPA 3L9EA 4FQ1L 4WW2A 3RNKA 4GKSA 1R3JB 5F7NC 1KTBA 3ZE0E 3AZUA 4ONOA 4QAMB 2FB4H 2WQRA 4JRXA 3IETB 1BQUA 1MFMA 1UKTA 2DMCA 3CH8A 3RVTC 4HWEH 1CBVL 3UTQA 3UFIA 5LGJA 2GI0A 2J5WA 4KDWA 1NKRA 4LU5H 5AZ2L 1CWVA 5EU7C 3HC3H 2QTVA 1B4RA 2CHNA 3QXWA 1GGTA 2AJSL 4CN4A 1KLFA 4M48H 2ZF9A 1OSPL 2JKWA 3L16A 4RQQA 4AZUA 3C5SB 2ENJA 3MR9B 3ES6A 4Y1AE 3ARGC 3QAZB 1GMIA 3FB7A 4DERA 1EWHA 4YJZL 4KKBD 1PZUB 3KYMB 4Y7OC 5EOQL 2DH2A 2XG4B 3I85A 4DKTA 1KYFA 1JHTA 4JFEB 1ZT1B 1FSKC 5IJDC 3FU5A 5C09B 1CGUA 2WVVB 4BK5C 2YQ3A 1B0RB 1U42A 2ZD0A 2WO2B 2EDHA 4YZFE 5J6SA 1LO3H 2PTUA 3VWJA 3MDJA 4NQCE 3X1EA 4PJIF 4G1MA 3IJEA 2QBWA 3EBAA 2VN6A 5E5MA 3GJEB 4KH2A 3FH7A 1XZ0B 2FGWL 5JLZA 1KYOK 2J8OA 5F7DA 3EW3B 3STBA 3W1ZA 2X3AA 4NKQB 1HC1A 3LHPL 3LS4L 3ZDZF 1I3UA 1BIHA 2K6WA 3TN0C 2V4LA 4AIXA 4TF4A 3EADA 3FQUB 2X9XA 4XC1H 2NY3C 1K5NB 1TZOA 5CR8A 6PAZA 2EDFA 4R90H 2Q2EB 1U95A 3RTLA 1BIIA 2P5WE 2VT0A 3QEUA 3DJZA 4ANXA 4QWWD 1BXVA 1TZGL 3ULUE 3OQ3B 2X4SA 1DCLA 1HDMB 1YQVH 3KCWA 1VA9A 1NGXB 2F5BH 1RUQH 2P3YA 5BPPA 4EN2A 3LEXB 4LHJB 3D06A 3FQXA 5T8IA 5KVGE 4IRJB 2DW5A 4X7FC 2MCMA 1S4IA 2NW2B 3O9WD 1YY9D 2ZOKA 1WE5A 3V5KB 3O81A 4O4YH 4W70A 1X9RA 4Y8AA 3D4GA 1G84A 3QJVB 1P1ZA 3K7UA 4MZRA 4XCCL 5CHNB 5ENWA 5MHSD 1T5WA 2QPEB 4L9DA 3FSZA 3FTZA 2C3XA 1EBAA 3DX6B 1J8HD 2CMRH 3T8MA 3VSVA 3VG0H 5F3BA 2GB2A 3IDGB 5C0AA 4AKQA 1C5CH 2NY4B 4R4NC 4M4RA 5HYSG 4JFYA 4JY5L 4KDTA 3U4EA 4WK0B 5BZDA 4RFEA 1Y0LA 2ZKMX 1VSCA 4AIOA 1EANA 4G1EA 4YH6A 5BV7H 4RX4D 4U49A 3P3YA 3CN0A 5C86A 4NQUA 2EDEA 1HZLA 3L6FB 4JM2B 3PHQB 1L7IL 4L3EA 4P9HH 1XDTT 1H0DA 2IH3B 2ZCLH 3IDNB 1DE4B 2W9EH 2XXGA 1MCDA 3B2VH 3IRCA 3GXTA 4PJGB 3RIKA 2GTZB 3ZXAC 5DQDH 4E68A 3MNWA 4NI6A 1U8HB 3QI9B 4N8VB 3TA3A 3U7YL 3VXRA 1A4BA 2FWUA 3H9HA 3IEAA 3KS0J 2X0VA 1GSMA 4B7IA 3NJGA 2YRPA 1SLUA 5LBSA 3DO7B 12E8H 1ADQH 1BAFL 1T89A 3K72B 4IDLA 3EJCA 1JS4A 3IKCA 4R7XA 3QQXA 5IV2A 3X3FH 3BT2L 3CN1A 3F6JA 1SVBA 4YS4A 3WAJA 4IRSB 4KK6C 5E2TH 3M1BA 2DI7A 3HFMH 5C2BH 4UBDC 5BW7A 1RQ5A 4NHCH 3WXVL 2GCYA 4G43A 4LAQL 4KI1A 2EC8A 4J3SA 1FAIL 3UAEA 1ETJA 2G3MA 3PGCB 1OAQH 2CDGA 2NY4C 5ANME 1ZANL 5JR1H 2FQGA 2VISA 4LESA 3QCVH 1F3RB 1D5XA 1MY5A 4HULB 5T5FA 3CE1A 1Q1JH 3E3QE 2V3FA 3QDMA 4X5RA 1BW8A 1A22B 5DC0A 3BAIA 1X5JA 4Q8BA 1D9KD 4MDJA 4GSXA 2FSDA 4QJ3B 3R8QA 4KMTH 4BIKA 3CBJB 3UMNA 4UT9H 1ZGLA 2X09A 3JWNC 1CGTA 1XMWA 2VSMB 2HPOA 1NA8A 5CZRA 1IQDA 3ECVA 1J0YA 4M1GH 1H9VA 4M1DL 2X4TB 2XV0A 4PLKC 3BPCB 4Z95L 2FQEA 1JF1B 3I9AA 2ERJC 3ILPB 1C7TA 4WU7B 1D7CA 4ZPVA 3GB7B 3BE1H 1IM9D 4M3HA 5FHBH 1YMMB 3AU0A 3KLKA 5K59E 1MI5A 4MB4A 3VRJA 4FXKA 1H9DA 4J8QA 1CFNA 1XCTB 2NW3A 4CMMA 4GKNB 4N90D 5DEZA 4M5SA 2KZWA 1RUKL 5T5FL 3RGVB 1S7XA 2YXMA 3QDGE 5AW0B 1JCKA 1A65A 1L0XA 1P6WA 5I1IL 3QZNA 3LQZB 1CFQA 3NJXA 4B27A 5A40E 1OE2A 2EUXA 5LBVA 3RWHB 4HJUA 5TTRA 3CFEB 1OTTD 1J1PL 1CCZA 1TT6A 4L48A 3B3BA 1OE1A 5HI3D 4UTBH 1BQLH 4FZ8H 1G1CA 4X7CC 1N59A 3LZQA 5BZWA 3NSJA 3H4FA 4X4ZA 1CPUA 2XJKA 1JNHB 1LMKA 5EU4B 3M17A 1QEWB 2ZUXA 4P4KC 5KVDE 4PJXB 3VXMA 1ND0B 3KWTA 5AG8A 2NTSP 3CU7A 2PF6A 3FPXA 3HS9A 3Q2NA 2YUWA 3VGFA 3SDAB 4DGYH 3U7AA 4FZEH 4IOSD 4XPAL 1U8CA 5EORH 3TBWB 3OR6A 3RWDA 1G9NL 4H26A 2AZUA 4XBEH 3Q01A 4P2RA 2H9GB 5DK0A 3W0WE 5E23A 1U33A 3BHBA 1WA1X 4YR6B 2ZF8A 4BDVB 4QXGH 2H3NA 2HYMA 3EH3B 3RY5A 3K91A 1KYAA 3FHEA 3MRDA 5DJYB 1R33A 4X7TB 3UJJL 2Z8WC 5B39A 1EV2E 5ICYB 4EEEA 5T1KA 3MBEA 4Y7MA 3NFNB 3G5YA 4BKLA 3NJIA 4EXKA 1JPTH 4ZUTA 5CLYA 3PAVA 5AW4B 4Z7NE 4MAYB 4PJDE 3T6VA 2Z4TA 4OLVH 1Z32X 4YAQA 4NT6A 5GGUA 5D71H 5ILTH 4R26H 1MIMH 1QBLL 2F8OA 4NUMA 4L37B 1RP9A 3QUML 4XMPH 3TLRA 2DQUH 4MXVF 1AR2A 1JWUA 1MJJA 3S4SG 5MEPB 2Y4SA 5J6GA 5C6TL 2CDFA 4JCMA 3E9TA 1NDGA 3DVIA 4UIMA 3OSKA 3B7YA 4K9EC 2VC2H 1X5FA 1J88A 3OHMB 2D0HA 1S9VB 2X89D 3SQOH 4EN3B 1A0QH 1A3LL 1XAKA 2V8MA 3D0AA 2WLJA 1NL0H 3HMXA 3GF8A 2R2EA 1VERA 4KO7A 4I9WD 1UWYA 3T3PE 1KJMA 1GHFH 2C1PB 2F7QA 3N1FC 4U05A 2FBJH 4R96A 1KCBA 4RVBA 3ZDWA 1A47A 2EDJA 3HAEA 3FN0L 4DN3L 3AADB 1B4JH 3L13A 1X5YA 3OKKB 5KYWA 4Z0BH 4JZJB 1RMFH 2DICA 2R39A 4ZMZA 5A6MA 2JJTC 3ZMEA 4H40A 5GRJL 2CO1A 3VXPA 5KTEH 4O5LH 5F7AA 4TKWA 4ABUA 1G9MH 3DV4B 3VWKA 3U9UA 1FBIL 1ZV2A 3D39E 5DFAA 1I1AB 3A6BH 1D7DA 1ROCA 5E1IA 3V5HB 4YXHL 3ZL4L 4QRPB 1AGCA 3HHRB 3EBHA 1YEGH 3ZRSA 1DQIA 2A1WL 4A38A 1XCQB 1CS6A 1KUMA 5B3SB 4H1LB 5I23A 3HMXL 1AZVA 4IDJH 1EMTL 1HJBC 4ZFFA 3ZZ1A 1OCWH 4ONGH 1PNDA 1JXFA 4KRNA 1HEJC 2VLRE 3H0TA 1I1RA 4JRYA 5IKCA 1A7BA 1B4LA 3KPQA 1YZZA 5ETUB 4ORZC 4UQ3B 3VGGA 5FYKD 4EN3C 3D4ZA 2H6UA 2YA0A 3L45A 1V5JA 2EIMB 1I7ZB 4HT1L 5I1AA 4WEMB 4R0LC 1A6UL 4YDVA 4D9LH 5BVJA 1G7JB 4QRUA 4LVOB 2Z31C 3ZE1F 3VXOA 1T7ZA 2DL2A 1BXXA 3TGXA 3X3GL 4DTGH 2P42B 1W0YT 4X6CB 3DX7A 2DQEH 2NX5D 3CZFA 3GTTA 3GHEH 4IKIA 3V5DA 5IWLA 3UC0H 2BP8B 4ZT1A 3PPEA 3NCJL 4JO1H 3OC8A 3KPRB 2N56A 2NY2C 3VFGL 1WV7T 4LOFA 2BIHA 4UYQA 2Y6SC 1A9BA 2FJHA 2ZSVB 2I24N 2ZUYA 4P4RA 1NGZB 1MFUA 1F1AA 4Q56A 3R7QA 2W1NA 3T2NL 5LCVA 1EJ6A 5GGTL 3TBVA 3JYBA 5DMYA 2CIKB 4Y2LA 2WBJA 4ZO8A 4QO1A 3RUGA 2E59A 1WC7B 5TK2A 3TBYB 4WWKD 1Y1DA 4Z76B 2EDYA 1LNUB 3OAYH 2Y23A 3UPCA 5T3XL 2HX8A 4NJAH 1P9MA 4QLRA 5DRWB 5E4AA 5DEGB 1HILA 4J3WA 4AVKA 1AGFA 5HHME 2M83A 4MMYB 5DTFA 1JXJA 2DQTL 1SEBB 4PY8J 1SQ2N 1IGCL 5D1ZI 1U3NA 1HHJA 1DQML 3N2JA 2DH3A 2ICEC 2EABA 4WEUD 1XH3B 5KSAD 2KKQA 3KLAA 1F58L 2EUWA 1BZ9A 4BFKA 2OJ1A 1I8LC 3TO4B 3IS1X 3WFDH 1LK2A 4OJCA 4Y88A 3ZJAA 3JWNH 1RJLA 1ZLUH 2H3KA 4A1RA 4P23B 1OLZA 5I0DA 1MNUH 3M07A 5L9DL 1NBVL 2D3JA 4OZFH 2EVFA 4JFVA 3STZB 4L1SA 1I8MA 2E8ZA 3VH8G 1QA9B 1O6SA 3QDJE 2PN5A 4HIQA 3SHSA 4ZAKD 2CKNA 4QRQB 3UADA 2WC7A 3WJLA 2F54E 3WFCL 3AGVA 3BKCL 4H0LC 3TWCL 1AQKH 3JV4A 1T3FA 4ZW8A 3FAXA 4AVHA 1PD0A 4Y1AD 4FAAB 4H4NA 2ODIA 2CLVB 1BQ5A 1U8IA 4UUJA 3SBWA 3K2KA 2R29A 5IMLB 3SGJC 4QTIH 1H8LA 3I84A 1BFVL 1TZ8A 2FX7L 3ECBA 3LKNA 1VGEL 2D31A 2FIKA 2DWXA 3ZZQA 2DF3A 2H26A 4X83A 3THMH 2PWDA 3MRHA 2KYIA 3VA2C 5D4QA 5T5NF 4LAJH 2YQGA 4W9DC 2YWYA 3QWRD 5KVFL 2YPVA 2GEQA 4YHYC 3TO4C 4HCRA 3BO8B 4NQCD 2EEBA 3ROOB 3V2AR 3BVTA 5DD5L 4UQ2B 2ED7A 5DUPL 3VFOA 2Q86A 4RNRB 5CGYD 3TBBA 3L1OL 3NH7H 2X5PA 1OGTB 3SYAA 1HCFX 2BW5A 4Y4HC 4JE4B 4UM8B 3U0TA 4R3SB 3O0RL 2DPKA 3O6FB 1M4KA 3OGCA 1KXVC 2R29L 5GJTH 3MO1B 1R46A 1RK7A 1AZBA 3A47A 4FFVD 2FJFB 5IEKB 1EEZB 5I6OA 4BWWA 2Y1YA 1UXWB 5E5LA 5KVEH 3DIFA 1QTPA 1YSOA 5DD3H 3ULUD 1M3JA 1YUHB 5L88L 1V7ML 5EPMA 3QIBB 4V1DA 4XTRC 3C5ZB 2ZOLA 3FO2A 1WA2X 5LLIC 1DQLH 4NO2A 3BUIA 2NR6C 2YK1H 5CXPA 4R8WL 4Y2DD 4KFMA 1F8TH 4LLYB 1PQZB 1GZPB 5T1MA 3IGAA 4GT0A 4BH7B 1I8KB 3ZT5A 4XPTH 1XR9A 1ZWIB 4K9EH 4Z3FA 1DZBA 3G5VB 4KTDL 4FADA 1MFAH 3IMBA 2XZAH 4ZSOA 4ZFGH 3GRWH 1SDYA 1QR4A 3Q43A 4GBXD 5A2FA 3TVMC 5GS0H 4NO3A 5EUOF 3BPNC 1N7ML 1DHKA 5I5MA 3K6SA 2IBGA 3TYFA 4Z7OF 3SE8H 2BO0A 2AC0A 5IVXF 5GGRY 3U4KA 1CXIA 4ISVA 3UTSB 1OP4A 2CE6A 3NPSB 4HX1A 1AS8A 4QCIB 4LSSL 1UHVA 2J7LA 1OQOA 1JXGA 1K3ZA 5LUMA 3SOBL 3CFJA 4TRPL 4B9ZA 2ATPB 2ORBH 4M56A 1QFUH 1EZSA 1FFRA 1XH2A 4EDXA 1JNLL 3MXVH 2LHAA 2B4CH 3VXNA 2WXNA 5F0LB 3G5ZA 1PKQA 4ZUVA 3WFHA 3PWPB 4WHDA 1WWAX 2W38A 4P2OC 2VE6A 4CL7A 4ETQA 2WIIB 3OAUL 3ZE2E 3C5ZC 4UAHA 4TSCH 4K5PA 1K6QH 3GMNA 4LNRB 1XF2B 1PJ9A 1AQMA 4GW4A 2QSQA 2UXTA 3W9EA 2Q6WB 1UM4H 3T3MB 3OZLA 1J8SA 2BY0A 2WYIA 3EF7A 4GXFA 3M8OL 1LD9A 3JVGC 1YAZA 1AXTH 2PWFA 2W94A 4G80B 1XGTA 2W0FA 1W8OA 2GC4C 1AR1D 5F7HA 1U8NB 2VIRB 5L2JA 4F33B 2J4WL 1QSFB 1CD0A 1EFXB 3IJ7A 3QQ3B 2B1OA 4MA8L 5IB3B 1AD9A 4KI5F 1NOFA 2VDOB 2AEWA 2FBOJ 1QI5A 4OSUH 5HDQL 5IT2L 2D9QB 2GG1A 2YRLA 4NZUH 4ELKB 3B9KD 3SDDD 1WFMA 1DANU 2MCAA 4YX2H 1NC4B 3DNKA 1QZNA 2J5LB 4WCYL 1SXCA 5A1AA 3DTDA 2YSSB 3ARDB 4XVTL 1VCAA 5LN4A 2N0MA 1P5UA 5IMOB 3EXJA 1GTNA 4B9CA 4HUUA 1Z9SA 2JXMB 2MTAA 4DKFH 2JI2A 3OR7B 5HD8C 1RZJH 3EBGA 4GQRA 4LLWA 3AW5A 3VFMA 1NFKA 4P3CH 4G42A 5BS0A 2WBXA 1DBAL 1CGXA 3WTVA 2VMJA 1ZTXL 2DKSA 1PZCA 3FQWA 3HG0A 2I7SA 4LMQI 3B7SA 2Q9OA 4F27A 5HJ3A 3QDGD 1GOHA 3NAAL 3QXDB 4JZNA 4LHUA 4M6MH 5KYUA 1IBGH 4NRZA 1NFIB 5D6DC 4Y5YB 5FGCE 1T5XA 5I18L 1U8MA 4X6CF 5EEWA 3FN9A 5EZOL 1SJHA 5FK9B 1J0KA 4TLSA 3K3QA 1NWPA 4PGCA 2E7CA 5A7EA 4NQSA 2DYPB 1CFVL 4LB8A 3V6FB 2BS8A 2HH0L 2ZQKA 5ADPL 4WW2B 1DVQA 4NHUA 3RNKB 4GKSB 4I0PA 4PY8I 1ZGLM 1ZIAA 2OZNA 1N0XH 3UDWA 5EU7E 3G6DH 4ZBJA 2CO7A 2VN7A 2VXQL 3HG1E 4JRXB 3V95A 2WNGA 3NSXA 5GS1C 1UGKA 3UTQB 2DQDH 4GXVH 5C08E 3QEQE 3MRLB 2YEZA 4JKPL 3WFBL 3CVDA 4K8RL 1QBML 1KLFB 4LEBA 4XP6H 3WTUA 2DKMA 4D3CH 4L4JA 3W0WD 2DIBA 4EO5A 1MCOH 4RQQB 4OIIL 5HGHA 5I1GH 4GAJL 2JKTM 3ES6B 1OM3H 4BWTA 1ID5I 2YAPA 1LMIA 3KGRA 3FB7B 4IKNA 3IT8D 1L9SA 5D1QA 3KCPA 1ACXA 3VG9C 3WNLA 4WGKA 1QRKA 4PUBH 2FRGP 1L9RA 5DZLA 2LVCA 5PCYA 4OIFA 3MLYH 3IE9A 4Y16D 1NEZG 2LFEA 3Q44A 4E5XG 1JHTB 3W5MA 4I87A 4CC0A 3BPLB 3QFJA 2R8SH 1SDDA 2X1PA 4H8WL 2WZPA 3ZVVA 1JNJA 2PO6C 5I75B 2VUYA 4OJDH 1KXTA 3RI5K 2QMKA 3VWJB 2NY6C 3KM2A 5K9QG 2EKSB 4MKMA 2A5UA 3MLUL 2RR3A 4G1MB 3IJEB 2FEEL 5E5MB 2ZWYA 5TE4H 1BM3H 3SE6A 4TSBH 1JD9A 4PS3A 4NWUH 4WW2C 5HYIA 3AG2B 3FRPA 3RIAK 5JLZB 4BE6A 5F7DB 3NIFB 4PV8A 4DP7X 1GOGA 2NNCA 2NPLX 2MSPA 1XCXA 3CDGA 3D18A 1JHKL 1J9CT 2WNWA 2GBAA 4HS6A 3C2AH 2FATL 2GAZA 3RTQD 3O8XD 3NJFA 4PJAE 5C0EA 2H8PA 2WOBA 1JGDB 1U95B 2VM9A 3U79A 4WK2B 4PJEA 3T0XA 3QEUB 4OT1L 1E27A 3RBSA 1AD0A 1DVYA 5FUZL 5BO1L 3O3AA 4Z7VF 2X4SB 1ET5A 1QSEA 4KOCA 1OVZA 1AAJA 3VXUE 3NMEA 2WUCL 1A4JA 2J43A 4M03A 4JFEE 3FQXB 1QSVA 1RU9H 8FABA 5T33L 2KZKA 2ZOKB 3BP5B 1EHKB 3WO4C 2BSRA 2Z8SA 1IEHA 3L4UA 5B22A 3LB6C 1P1ZB 3GSRA 3IRZA 3D39D 2CHDA 1KB9K 5ENWB 1A6ZA 5C7XL 1T5WB 1KEGH 4N2BA 1KEMH 1FWXA 1QLRA 3LHAA 4XCFL 4JJ5A 1TTAA 5EO9A 3VWJC 1XGZA 4S10A 3HE7B 3HS0C 3IB4A 2GBVA 2XWCA 4A39A 4M4RB 1T20A 2W59A 4C8XA 5TFSH 5EUKA 1UENA 3U4EB 3IRPX 3QAQA 4RFEB 4OAWB 1FORL 4NZDA 1Y0LB 5EDSA 3K6IA 1ET8A 2VLRD 2ZP9A 4RA3A 4G82A 4PJ9C 3SGDI 4KNTA 5F9WC 1FVCA 2F1BA 2V5TA 2XWJA 4J4PC 4OVVA 5ALBH 3OKYA 3IJYA 3MX0A 5CEZE 2LQRA 4J28A 1H0DB 3DJSA 2H0EA 4JDTH 1MLCA 1FGVL 2UVFA 3ZMNA 3IDUA 4XHJD 4CNIA 1YN6A 3TZVC 1F4WL 3MNWB 1BSIA 5FYKU 3TA3B 2LAAA 3VXRB 1U4FA 2Z4QA 4HAGA 1AJ7L 2VDLB 4WLCA 3H9HB 3PY9A 4OKVB 3L48A 3RDTD 3I6LE 3UYPA 4Q89A 3IKCB 2Y7MA 3FSOA 3SE3A 5IV2B 2IF7A 3WOVA 1U8KA 3EHBB 1FL5A 5CJ8A 5GJSL 2M26A 5JXAL 2WCPA 2GITA 3M1BB 4DGIH 3TH3T 1RHHA 4AVJA 4G43B 1Q9WA 1Y07A 1OCCB 3RVXD 4OLXH 3EG9A 2VISB 1KBGH 4NS0A 3GSNH 3FO0H 3WIHL 1GIGL 1D5XB 4NQDE 4UQAA 2IAMD 5ISZE 4J1UA 3FOLA 2P9RA 1FZJA 1H8SA 3JWNE 5HHMD 4Q58C 4A66A 5DZVA 3IWUA 1NM9A 1NMCB 2HLFD 3L1FA 1BMGA 2CO4A 4MDJB 1ZA3A 5C3LD 3SZKC 1AHWA 2BNQA 4RETB 2H2SC 3FUKA 1ZGLB 1PG7H 3CHSA 1KELH 1IQDB 1I9JL 3QGVA 3T6WA 1BA9A 43CAA 4DPRA 1XF4A 4UT7L 1GL4B 2Q76A 3CGTA 1IJ9A 1JGUH 3QZWA 4JY6A 4MD5A 1SF5A 1QG3A 4ZPVB 3T04D 3X2QB 4CU7A 2UXGA 4LCWE 3TA3C 2X4UB 3PYCA 3K6NA 4GNKB 3VRJB 3HG4A 4FXKB 3IAQA 4AZ8A 1CFNB 2NW3B 3PHAA 5I76A 4CMMB 5F9JA 3B5HA 3IYLW 3MOAH 1S7XB 1CDGA 1BVLA 3UO1H 1MCQA 3ZR6A 2G3XA 2H47C 1CFQB 4A04A 2EDXA 3FH5A 1OAUL 1BQRA 1PL3A 1TKWA 5I24A 1OTSC 5BW7C 3QDJD 4TL5A 1DVXA 3VVWA 3WEBA 3ZTEA 2H41A 3IK2A 3BYYA 4HUKB 1GC1L 1K8IA 4JMXA 2F54D 1WGOA 1N59B 5BZWB 3WXWL 1FLTX 5INDA 3TURA 1T0NA 2O5YH 5B1AB 4PHZA 3IGFA 3M17B 1M9SA 5LWYL 4ALAH 3VXMB 2APXA 3GUFA 2QR0A 5KW9H 2VL5B 3V8CA 2OSWA 4XMTA 3W2DL 3C6LD 3KYKH 1XGQA 4NQXA 1NMCC 2MKWA 1U8CB 3D4YA 4FJYA 4YBQC 3WV0A 4P2YA 2I5YL 2X1WL 3OR6B 3RWDB 4H26B 3BUYB 1JN6A 4KWUA 5DK0B 3TV8A 4DEPB 3QJQB 4IBVA 4LF3A 5ESVB 3T2LA 4DEWA 1OKEA 1YMME 3D85D 2ILLA 1WEJH 4JPKL 4JQXA 4PJBA 5I1DA 2PMZA 2EE6A 1XSKA 3MRDB 5B39B 3PNWA 4O9HL 4JRWA 5GRWA 2XZQL 1EO8H 3QQ4A 4FXKC 1G5GA 5T1KB 3MBEB 4L9LC 2LOEA 3G5YB 4FQ1H 3VQ2C 4BKLB 1UJ3A 5EFIA 1G9NC 4ZUTB 5HHXL 4I3SL 5E9AA 2X4QA 3DGGB 5K9QI 1H8NA 1EA9C 3BCDA 4HIPA 4F15C 2QVIA 4ZNCD 1CBVH 4YAQB 4MLSA 3HA0A 4NT6B 5GGUB 1WH0A 4XVUD 4IKKA 5AZ2H 1VEMA 3UIYA 3RPBA 1UWXK 3FDWA 5EIIG 4ELME 4CC4A 2HP4A 3Q06A 2CJ3A 2AJSH 1J5OL 3P54A 4LFHD 4PJXE 1JWUB 2OW7A 1MJJB 4KX7A 4F1SA 3UZEA 2WLMA 1PZBA 1ODUA 1OSPH 5J6GB 2L8AA 3AXHA 2CDFB 4KKLC 1M6UA 3I02B 4ZNEE 1NDGB 3ZDYE 4AITA 1FP5A 3TFBA 3DVGA 5B38B 2IGFL 2C8NA 1N5AA 3FT9A 3HUJF 3ZL1A 2Z0BA 5D1XA 5CEXA 1U3HA 3WN5A 1UFGA 3BEWA 4W9FC 1WIOA 1YNKL 3MJGX 3T5WA 2BIPA 2YQBA 2VITB 3CX2A 2WO3B 3R1GL 3LIZA 5LKNA 2J8UA 2EDOA 1KJMB 1XQ4A 2DM3A 4GXUN 1VLXA 4R96B 3JBG7 2HAZA 3O4OC 3NIDF 3E0GA 3HAEB 1QKZL 2NQDA 5KYWB 4D9RE 1RAMA 4DKAA 4NN7B 3QIWB 4Z7UF 4L8SA 1PPIA 4HGMA 3VXPB 4U0RC 2XSKA 4A7GF 5MEOA 1I85A 3QRBA 2FGWH 3ARFD 3LRMA 4X99A 2O72A 4HU8A 3U9UB 5JHLA 3IAPA 1F6AA 1Q9LA 3LHPH 1U2YA 3LS4H 5E6IA 1AGCB 1W6WA 2HB0A 2G5UA 4RZCA 4K7PY 2C7FA 5SWSE 2BHFA 3VDAA 1YEWA 3L2NA 4JM4L 4PJCA 1MZZA 4BZ2A 4LLAA 2BDNH 4KK5D 4ZFFB 2IDTA 2XBZA 2N1KA 1KPVB 4FERA 4TLKA 1KGXA 4TV3A 1FE8L 3HKZA 4JKWA 3WI9A 1F5WA 3H0TB 2A2QT 4I77L 4JRYB 5IKCB 1JNNL 3SPCA 3KPQB 5FM8A 1VGKA 3GQFA 4KUZL 5DFVC 2H2PC 1TDQA 2FT7A 3KNBA 3UTZA 4CVZB 1GA2A 1V3KA 3GMPA 3BZFA 5I1AB 4KNUA 4YDVB 1I82A 3VXOB 4XCCH 2EXWC 5FO9A 4M5YL 3CZFB 4BQBA 1KTLA 1XF5B 3V5DB 1QLFA 4GI6A 3JWDL 4YDKL 4KO5A 2NZ1A 2ZOTA 3FNKA 2XKNA 1A9BB 3EYVB 4JY5H 2ADJA 2FJHB 3G04A 4D8PA 4JS7A 4P4RB 1T03L 1U21A 1Q0YL 2IANE 1MW1A 4OZHA 3VWKC 4DKEL 3AQYA 3FT4A 3TBVB 5DMGC 2CKBA 1KJ2L 1PSKL 2WBJB 2WXQA 2AK4A 2J6WA 2JCCF 4O00A 4U3HA 5D2LF 3RUGB 5IVNA 2GABA 1TF4A 5BMFL 3DOHA 1L7IH 3F8UB 4LOEA 4LPYA 4LXFA 2ZNWA 3GEWB 4GG6A 2FBRA 3P4OA 4FYSA 4IJTA 3SE4A 2CJTA 4PRHE 1OL0A 1HILB 1JV2A 4JKLA 4MSWB 5SWQA 1AGFB 1LE9A 4ONHA 3U7YH 3LH2H 3LXAA 3N43B 5AB2A 2PWEA 2DYSB 1K8DA 3WFEL 5DF0A 1FIGL 3S88H 1IL1B 1HHJB 4PJ8C 4W9ZA 2FHBA 4ZD3L 4BGLA 4N3UA 5B1JA 4J39A 3BT2H 1NQBA 3UX9B 3ZDXB 1BZ9B 2CKBL 1S9YA 5J0BA 3KPRE 4S2SA 3MNVA 1R17A 1LK2B 4RGNB 4N2MA 4EE2A 2D7PA 4XCEA 4LAQH 1W91A 4R5TA 3RVTD 4XHQA 4UQDA 1FAIH 3NP4A 3ULVF 3A6CH 2DQGL 1A4AA 1ZANH 2EXTA 2DQMA 4HSAC 3N1MC 2X6MA 3HG1D 2IOIA 2PYEA 1KENL 1T04B 3MA9H 5IW6A 2F68X 5C08D 2FO8A 3QEQD 1I8MB 5DWUH 4AKOA 1O6SB 3MQIA 2WBJC 4R97C 1EXGA 1IE4A 3ZUCA 4JM0A 4H8VA 3ARGD 1EVUA 4Z7WA 5C71A 2CUAA 3VMOA 4HK0A 3OB0H 1QFOA 1PZAA 1T3FB 2BVTA 4HJSA 1G7MA 4Z95H 1DJGA 4KNQA 5DJXA 1U8IB 4JO2H 4UUJB 1YO4A 3M86A 4JW3A 1D5RA 1XIWA 1I8UA 1O9VA 5JIDA 4S1DC 5GGSY 3LKNB 3ECBB 4FTVA 4QF1A 4N2HA 1N6VA 2D31B 2FIKB 2WTOA 3VRLE 3DX0A 2PWHA 1DUYA 1RUKH 4S11A 2H26B 2I9TA 3LNHA 3MRHB 4RAUA 5I1IH 3P02A 1E5UI 4UB0H 3VGHA 1QWNA 3QORA 4F7PA 5HYSA 4QHUB 3MXWL 5EBLA 3ATEA 4MNGE 4OLUL 2P52A 3L08A 5B4MC 3MOQA 1NUNB 5A2JH 1MFCL 1WBYB 3VFOB 2XQBL 4TUUA 5FKPA 4TQHA 2J44A 2Q86B 3TN0D 4JY4A 3S3CB 4NWTL 1PZ5A 2BWDA 4MBRA 2NY3D 3R4RA 3U0TB 1L3WA 2OTUB 1RERA 2C3HA 3OGCB 3O2DA 5FWQA 4CSPA 3BSHA 4YHKH 3H9SA 3DX8A 3TEXA 3N06B 5C70A 2B7DT 4FABH 1TJIL 4XPAH 4MXQC 3PP3H 3QHZL 1G9NH 3FTWA 5HVFB 1E5YA 2WB7A 3DIFB 4F24A 2R2HA 3ISRA 2EEXA 4TVPL 4CJ1A 4LPVA 1DBML 3V9EA 5EBGA 4QYAA 5EPMB 4V1DB 4G9FE 1JWMA 2A77H 3VXUD 3SBWC 5C9JA 3FO2B 3FO1A 4JFED 4NO2B 3D7PA 1MEXL 1QASA 1FPTL 4NP4L 4AK1A 1MQKL 2C3WA 2XDHA 5IROC 2J55A 5GZOC 2C9UA 4Y9CA 1FA4A 1UWFA 5T1MB 3P40A 1QHOA 1X5IA 1I7UA 2QGEA 2AEIT 3G6AA 3GSWA 4FCAA 3T0EA 5T1JA 3LRHA 2H32A 3VNYA 4R4ND 2DIAA 2ZOUA 5I8CA 1YRKA 4ZSOB 3ATDA 4AV5A 4EZMA 1A6WL 4NO3B 1INEH 3K6SB 2XV6B 1IAIH 1F3JB 3QUMH 4HWZA 3TYFB 3FQNB 4ISVB 5CP3H 2PW1A 3T0DA 2PR4L 4HX1B 4JGNA 1I1FA 5C6TH 2HA1A 1J5DA 3H9ZA 1E65A 2XNAA 1JP5A 2EH7H 4HH9A 4JKKA 4OFDA 2EVJA 2XWBA 3CFJB 4RMWA 1A3LH 5CEZD 3VI4A 1BZEA 4DESA 4EDXB 5DZPA 2YD2A 4Q9QL 4IJ3C 1TYJA 1DQDH 3VXNB 4U7KA 5KAQG 2VXVL 3G5ZB 4PTTA 3WNNA 4FJ6A 4UWQB 3RFZA 1PKQB 1M56B 1K72A 2Y6TE 4ZUVB 4LGRB 3TT1L 3WFHB 5CJ5A 3PGFH 3GKZA 4P5TA 2VE6B 4ETQB 3FN0H 4DN3H 2YN3A 5K9OB 4G59C 4FLOA 1JSYA 2M8XA 3FC8A 5BCAA 3I6LD 4FG6C 3HC0A 4KK6D 1QVOA 1B6UA 3GMNB 1QR1A 5FYLL 2X4PA 4GS7B 3W9EB 4QI3A 4UBDD 2CRYA 2VDMB 5GRJH 5EU6E 1YEFH 4DVRH 3BLKA 4AJ0A 1IJNA 1GZQA 1ETB1 4J27A 1FBIH 1LD9B 2NY4D 1J8HA 5KANG 3ZL4H 5I2IB 3L4CA 2C4FT 1NBZB 1XGTB 3REWB 3BKYL 2W0FB 2A1WH 4HA1A 4JFDE 5AALA 2ATKA 1J1OL 1KN2L 5L2JB 2CNZA 4NQDD 1P7HL 1CLZH 2QKIC 4RX4A 3BVUA 5ISZD 4JM2D 4FI6A 1KACB 32C2A 4J3XA 4OKDA 2FH6A 4NRYA 2GW5A 2GY7B 4U3SA 3E8UH 3SDXE 3U48A 4X50A 2NUPA 2OJZL 5SX5H 4PLKD 3LZRA 4A7UA 1BF2A 3US1A 4XN4A 4XBPA 4LEOA 1T21A 2HJFA 2AW2A 3PWPE 4FQLL 4HS3A 4Q0XL 5CCGE 4ENEC 1P5UB 1KULA 3BRFA 2JLPA 2XYBA 1Z9SB 3CQQA 4HUUB 4TQIA 4P05A 4RMTA 4GIOA 3X3GH 4LCWD 5CD3A 2Z93A 4LLWB 2DD8L 3HR5A 4JL2A 4DUWA 3T3ME 3VFMB 5JA8B 4WF7A 3P73A 1HWWA 2YKLL 4G42B 5BS0B 4OM1L 2OI9C 4IRSD 5C0JA 5DHXB 3VFGH 3FQWB 4GS7C 4QT5A 5HJ3B 5KYUB 4IBLT 4JZNB 1TJGL 4LHUB 5D4JA 3T9WA 5I30L 3QR2A 4PGEB 4NRZB 1SPDA 5HHNA 1T5XB 2EUVA 3WY1A 4DN4L 1U8MB 5GHWL 4WKZA 5GGTH 1SJHB 3GK8L 3VD7A 2APBA 4MQXC 3S4SA 4PGCB 2HXAA 4QXUL 4NZTL 3IN2A 4NQSB 1A25A 3U36A 1L3NA 3WD5H 4OBSA 4U1JA 4NHUB 5T3XH 2K7PA 4I0PB 1INQB 1F42A 3B7UX 1YJDL 3AROA 2CO7B 1RY7B 2VW7A 3H6AA 1QEXA 2F8VA 4TULH 1KF9B 4DKDC 1D9KA 1AY1L 2YEZB 3UBXI 5E94B 3B7RL 2DQTH 2V7NA 2WKGA 4ODBD 1R5WB 4W4OA 2VJ0A 4LSPL 4NN5B 1JZ5A 5HGHB 3EF4A 1DQMH 1JVOA 1P5UC 1YMMD 4XPBL 2WTPA 1F58H 4YSOA 2WAHA 3RZWA 4PCYA 1L9PA 1YPZA 3ULVL 3JTTA 2G60L 5D1QB 3KCPB 5DUML 4PRIE 3WY3A 3OMNB 1Q0EA 4N86A 3IFNL 4PWHA 2XY2A 1W2KT 2WXHA 1WFIA 3S37X 1T5KA 4K8RC 1WVZA 1XGPA 2AJUL 1TYEB 3QFJB 1NBVH 1SDDB 3MODL 3Q2VA 3QZOA 3A3YB 4OZIE 4JDEA 1GPOL 4Q9BA 1RZIA 1KXTB 4A7VA 1WISA 1TQCB 2K45A 1UB6A 3B5GA 4YBHA 1GH7A 3MC0A 1A8JH 5F88A 3S35X 1OAYH 2HFFA 2YLHA 4FX5A 4PB0L 1I31A 2D7TL 2W0LA 4G2AA 2L04A 1A7OL 1IBDA 3AXLA 3WFCH 4W9CC 4I0PC 3TWCH 4XNQB 4CU6A 3SDAD 2B39A 2QLVB 3FT1A 5DCCA 3ARBC 4PV8B 1MHEA 3TNMA 3CWGA 5I6PA 4F9PC 1PLCA 4FFZA 3UG5A 3W37A 3CDGB 3JWNG 3D18B 4H8WC 4IOSA 3U1SL 4HS6B 2R4SL 5L0QC 2BMKA 2GAZB 3U30B 4P2QA 4EI6A 3BX7C 2BFVL 1JRHI 4XXDA 5C0EB 2H8PB 4HKZA 2RGSA 1NAMA 4LRIA 1AIZA 1BFVH 2FX7H 2JH2A 5KSVA 4NN5C 4PJEB 3JVFC 4OZFG 4BINA 4OQTL 3BVWA 1E27B 3QUZA 4LSQL 4DK5A 1AD0B 5IF0A 3O3AB 1QSEB 4LHQB 2AXWA 5EV7A 1P4UA 4D9RD 1N70A 2NXZC 4X80L 3FT2B 1EHAA 3E6FA 8FABB 5DD5H 1R0AL 5LB1A 2CSPA 2KLSA 3ZZSA 2BSRB 2GTWA 3L1OH 3QUYB 1IIKA 3M88A 4ZX4A 3MJWA 4XVOA 2HWZL 4BKTC 1A6ZB 4MHHI 2FNBA 3OLGA 3O0RH 5HHVL 1QLRB 3KR3L 4NUPA 1KTJA 2BOCA 3EDKA 4JZOA 4XP9H 5EO9B 4NKIL 3TH2T 1GXEA 5SWSD 1PLBA 3UZVA 5JYMA 2RAMA 5CCKL 1T20B 3NIFE 1UA7A 4S1SH 5EUKB 1SYVA 2OCCB 5SWZA 1MWAL 5AW5B 4RDQG 4EN3D 2ALWA 4Y19B 4YXLL 2QZ5A 3EO0A 4UNIA 5JMRA 4OZGF 3A21A 1FVCB 1G1KA 5L88H 1YEJL 1V7MH 2F0CA 2XWJB 4OCWL 2OZ4L 3IJYB 3FU7A 2R0KL 3MX0B 1UXMA 3U30C 2Z31D 5I8OH 2V17L 4WJ5A 1JXDA 1MLCB 2B9BA 3NABL 4R8WH 5BQ7A 4CNIB 4I0CC 2C9AA 1YN6B 3QEGH 5J3HC 5GZNC 4N8UA 1D6EA 4OI7A 2NY2D 4N2EA 4PU2A 4KTDH 1XHHA 1BXUA 2P45B 2Y6SD 2Z4QB 3W11C 3WSQL 3M7FB 3PWUB 2XACC 4R7NA 2IADA 2B8OT 2ZUQB 1N7MH 1GOFA 3UYPB 4ZMXA 4FTDA 1A6AB 1E7UA 1XO8A 3PGDA 2WHVA 4AUUA 1U8KB 4ES9A 1FL5B 4XOCA 3VH8A 2IAND 2QV4A 1T1YA 2GITB 2QGBA 5C0AE 3CIAA 1RHHB 3SCMA 1LWJA 1MFBL 4LSSH 1WCQA 1TCRA 1HL5A 3S6CA 5EC1A 3GI8L 3OHXA 4TRPH 4HFWA 4A68A 3EG9B 3EFDL 4AYID 2WKOF 4PRHD 4TNFA 2XVGA 3BZ5A 1D2OA 4NUJB 4J1UB 3FOLB 4BFIA 1FZJB 4K5OA 4L3EE 1ZVSA 2ZONA 3GT6A 2AXJA 1AGDB 4ZTOL 2XIIA 3OAUH 1ZA3B 2VRQA 1AHWB 4HXAL 5AVRB 3WMPA 2QQKH 4ATTA 1ZAGA 4U1LA 5GRYA 4YDLC 1V27A 1XF4B 1L0YA 1AO7E 3VXRE 3P3TA 4E41E 2Q76B 4AGLA 4MD5B 4JY6B 1DSYA 3M8OH 1SOQA 3KPRD 3OWEA 3KL0A 1HOCA 4CILA 4E9XA 2HCZX 4AQAA 2APFA 2X44D 5FGBA 5C0RL 5I76B 3K8KA 5F9JB 2AKRB 5IG7A 2J4WH 2R69L 2X6BA 1OB0A 2XN1A 2AERT 2OR9L 3CLWA 3QXTA 4KGLA 1OK0A 1TSRA 4XX1G 5E2VL 1AE6L 5GRZA 4WNJA 5HHOE 5ID0A 1GGCL 3DMMC 1BFOA 1TKWB 4LPTA 1F11A 3T1WA 1HXKA 1KCWA 4IBSA 1ZK9A 1ZOXA 1A6VH 2BVUA 1SLVA 4UQEA 1TUPA 4HEMA 3FB8A 4WCYH 5MENA 3OWRA 1K8IB 2WWNA 1OF0A 4KI5C 3BH8A 4XVTH 4DVBA 2V7HA 3QDME 1AZUA 1I9RH 4FQIH 5INDB 2XA8L 1BBJA 2X7LA 3HPLA 3NJVA 5C0GA 3VDCA 1P7QA 4U31A 2R0LL 2QR0B 2WXIA 4UDUA 4EIZC 3ZLQC 1RHFA 3RWIB 1SEQL 3V4PA 1DQKA 4NQXB 5C9KA 3H7BA 4BGDA 1AHWC 1I9EA 1DBAH 4O02L 1S7QA 1JN6B 3BPOB 1ZTXH 3IMRA 4JQVC 2UV3A 3TO4D 5AWNH 1GC1C 5AKRA 1J5HA 4LF3B 2OXGA 4FQHB 1LO2L 3NAAH 4NJ9L 1MI5E 5KJ4A 4JFXA 1GYUA 1QI3A 2IALA 5AVTB 3KXFA 1YEKL 5I18H 1LO0L 4P23D 5I1DB 2R23A 4OLZL 4LP4A 4PVLA 1WA0X 1FFNA 4Y4HD 5ICXB 3QQ4B 1GY1A 4BCXA 1CFVH 3I74A 3LDBB 3DXAE 5AUMA 5GPRA 5ADPH 1UJ3B 5EFIB 3L9RB 5C7ZA 4Z9KB 3LZOA 5HJGA 1T7XA 2X1OA 4ZTPL 4LSRL 2VXQH 4YPGA 2VDQL 5KUKA 3F62A 5D7JA 1KYUA 3FUIA 1M57B 2NT1A 4B3EA 1LYQA 3OKNA 4ZAKA 4TUJA 2CHXA 3BESR 2APSA 1SLWA 4JKPH 2I25N 1QBMH 2A4ZA 3Q3GA 4N2CA 3VXME 4QXWA 4XTRD 4A2FA 1IM3D 4DGUA 4GMSH 1ZLSL 2AJ3A 1B2WL 4M7ZB 2IV9A 4Y1SA 4OIIH 5DRXA 1WWCA 3WYRA 2NR6D 2A74C 4P5KA 5I0ZA 3WLWC 3ZYIA 4KTYA 3DVGB 4G9FD 1N5AB 1PG7W 4P2RE 1G4MA 2YMXL 5D1XB 5CEXB 1U3HB 3WN5B 3BEWB 4JHBA 1A1NA 4U7SA 1NDTA 1X5MA 2J1WA 4HS8H 3BPOC 1SQMA 4N2IA 1A9EA 5EU3A 1H6TA 3RKPA 3TVMD 3QWRA 2V6HA 4H8WH 4YSTA 4AEHL 5E4OA 4JFPB 5A2CA 3ARUA 4PD4J 1KG0A 1ZT4A 5LGKA 3MFFA 4KH9A 4CGUB 1HHHA 1JV5A 3D3VE 3GXPA 4Z7QB 5FR3A 4C4KT 4L8SB 2EINB 4MJIE 3BZ4A 4QJ5B 3PL6A 4PJIE 1MHCA 3MRFA 1FL3B 5MEOB 4X99B 3NJHA 4WV1C 2NY5L 4YK4C 1F6AB 1Q9LB 5E6IB 2CH8A 4RZCB 3IJHA 1JHKH 1GTFA 3ZDZE 1TFHA 2FATH 4LDOB 1PEWA 1WFNA 4PW9A 2P5WA 4PJCB 5KSBF 4I88A 4CC4C 4FRWA 4P2OD 2C7UA 3PU7A 4ODVL 5IBTL 3OKMA 3UZEC 3ZGHA 3C5ZD 3P69A 2YKKA 3AS2A 4YSUA 4DP0X 5FUZH 5BO1H 5AZEH 3GKWL 3ZSTA 2Q3XA 1ADWA 4NUQA 4GO9A 4NC2B 1VGKB 4BRJA 4DGVL 2WUCH 5KJRL 3BH9A 3KNBB 3UTZB 4Y2DA 5D1XC 1Y6MR 3MCLL 5T33H 1HZKA 1JK8A 3WL9A 1MCPH 3GMPB 3BZFB 2XLLA 1J8RA 5EU6D 2AEQH 3RWEA 2CAKA 4LCIL 3EBIA 5I1LA 2CIIA 1XGRA 1ZCRA 3HS8A 1J0ZA 4UAOB 5C7XH 5FO9B 3ARSA 2PCXA 4HSQA 4XCFH 1KTLB 4Z3HA 1QLFB 1LO4L 2ZG1A 3FB6B 2YGVA 1V54B 4JFDD 1H5BA 4FE9A 5AEAA 2K3TA 4L8SC 5AW2B 3HR6A 2XKNB 4U6HA 4XAWL 2ADJB 3G04B 1S5IH 1RZKH 4D8PB 1FORH 1I85C 4PW3A 2GPZA 3KHOA 2AK1H 1KFAL 4EZLA 1MW2A 3TJHC 3GBML 2VQTA 2B5IB 2AK4B 3GXFA 4Y5VA 4UIKH 2PTTA 1CDYA 3CZEA 4K3EL 4WO0A 1JGIA 5HD8D 4GG6B 3PWPD 3JWDC 1FGVH 1OGSA 5E7FA 3BDBA 2WJ7A 4YDIL 3CPUA 1O9ZA 1JV2B 2GVYA 4WU5A 5SWQB 1F4WH 2ROXA 3ML9A 3T09A 4ONHB 2WVSA 2C9VA 3KDPB 4DUVA 4YZWA 1GCYA 5KUMA 1P2CB 1DP0A 4HVBA 1AJ7H 1NEZA 4E5XA 1HXMA 5TK4A 5T3XE 1K8DB 5EEXA 3NESA 4UF7C 3QA3A 1YEHL 2RQ8A 2O93L 4IKLA 4DAGL 5GJSH 5D7LE 1S9YB 1DUZA 4X6DA 3BSZA 1AQHA 1WZ1L 4HMDA 4S2SB 3U0WH 3MNVB 2LABA 4XVSL 3SDXA 5BXFA 3MLXL 1XGUA 4W9HC 4FHBD 2CUIA 2R59A 3CC1A 1EDHA 1CVSC 1LGVA 2XTJC 1W15A 2CXGA 2ZWKA 2PYEB 3RUGE 3WIHH 4F7TB 4J3OD 1RUMH 1NC4D 4FYRA 5IW6B 1T7WA 4JFFE 5F7KC 4ZI8A 4RH4A 4URKA 3GBDA 3W39A 2FNWA 4P49A 2WXFA 5DA0B 4Z7WB 3LQAL 4G6JH 1I9JH 3R0MA 4AV0A 4HK0B 1OPOA 3FFOA 4XI5C 1M05A 3SE4C 4UT7H 4XPGL 2EC9U 1G7MB 2E6PA 3EO1A 3WE1A 1C1EL 5DJXB 3FCTA 4GG8A 4PRID 2B2XL 3P0YL 1XIWB 4HIHA 4XO9A 4QF1B 4FTVB 1TJHH 2IWGA 1DUYB 5LXGL 2YAHA 2I9TB 4OUUA 5B1JC 4RAUB 3SD5A 4XRCA 4PJ7F 3A67L 3WEAA 3MJ6A 4M43L 5HP5A 3A4DA 1OAUH 5J12C 3QORB 5HYSB 2BSEA 3A0OA 5EBLB 4ZMOA 1H3VA 5FKPB 1TQSA 4OLWL 1ODAA 4JY4B 3RYMA 2JIXD 2Y1AA 3WXWH 3P30L 3BISA 5KVFE 3HLAA 3O2VH 3MLSH 1S9KC 3P4MB 3QEHA 1ZPLA 5LWYH 1G7IA 2VMEA 5DJ8A 1HE7A 1OZTG 3H9SB 2XBTA 3DX8B 1WFJA 5GGVY 1BG1A 1G7LA 3W2DH 1G1YA 2GY5A 2Z64C 4XODA 4YDJB 3W0WA 3WELA 2J6EL 1L6XA 1NCAL 1FNFA 1KXQA 5AAMC 5LVEA 2XVBA 3JWOC 2R2HB 3GMMA 3MJ9A 5F8RC 3I2CL 4PJHB 1AP2A 1R24B 2XQYA 4M1CC 4PLJC 4Q97A 2VAAA 4JPKH 3GSUA 4KUCF 4W6YB 3IBOA 1JWMB 4Q6IB 4HWBA 4X5XA 3CVHL 1EJOL 1KC5H 3FO1B 4HH8A 5D72L 3IDIA 3LB6D 4O9HH 4KV5F 1XIWC 3NEOA 4PVBA 3QPXL 5K9KA 2XZQH 5FO7B 2HKFL 4J3TA 1CDCA 1CYGA 1Z7JA 4PJDA 3BJLA 1IX2A 3SDCC 3VWJD 3G6AB 1I7UB 3GSWB 3SQRA 5HHXH 4FNLH 3LN4A 4I3SH 3QZLA 2H32B 1KDJA 2OMVB 3HJEA 1N3NA 4N0UE 2IH1A 1BJ1J 1CLYL 1E28A 1NCDH 5F7BA 1E6OL 5AVYB 1CDUA 3SGKC 3EKCA 4OGYL 1JOIA 4HWZB 2GKIA 1JZFA 4PJ9D 4OGZA 2VDRL 1J5OH 1EK3A 2GEEA 4WFHE 1PCXA 4QHNB 3B2XA 3TEWA 4J4PD 2PW1B 3JUYA 1I1FB 5M95B 2XNAB 4HWBL 3ZHLA 4HH9B 2VDPL 3RTQA 1BYNA 3ISWA 1J18A 1F18A 1N2RA 2XWBB 1BVOA 3L3HA 3TZVD 3VI4B 2X2IA 4LVHB 2BIMA 3N55A 1YNKH 5L8KB 1AZNA 4V1DE 4FLSA 3R19A 3QUGA 4PTTB 2Y0SA 1NOLA 3RFZB 1SZNA 3QNYA 2D8KA 4P5TB 3ILQC 4DPAX 1U91A 1QKZH 4QXTB 1UH4A 1SHWA 3NGBC 2HT2C 3PREA 3HC0B 4RGMB 3K4DA 1QVOB 3UZQA 1DVZA 2X4PB 3SO5A 3VFVA 3D39A 1XF3A 3MMEA 1GZQB 3NRPA 4BHUI 1ZLWH 1BLNA 2WYTA 5C0AD 2HTKC 3T0EC 3EJZC 4RFNC 3CSYA 1J8HB 4PQXA 1U92A 2E7LA 5LBGA 4UMSA 2P80D 5I6XB 4QKTA 2IOOA 4ZZFA 2NMSA 3HMWL 4F8NA 2ATKB 3GMQA 4PJ5E 1DSFL 4MJ5B 3L5WA 1E9QA 1FE8H 1NOAA 2H2SD 4L3ED 1B3JA 32C2B 1JNNH 5TDOA 1HINH 3MRQA 1EGJA 4NRYB 1RIHL 3GS4A 5G4OA 2NSMA 4U3SB 1SJEA 2WXLA 2NUPB 4LCCC 2C9SA 4KUZH 3KW8A 2V2TA 4XBPB 4NN6B 4LEOB 1T21B 2HJFB 4L4TA 2P48B 4NNPL 4HDIA 4HS3B 3TA3D 1U30A 2BVYA 1UACL 1AO7D 3VXRD 1HWHB 4E41D 2RJMA 4M7JL 5C1MB 4B5EA 3VFPA 2B20A 3RFZC 4HC1A 3D51A 1T6WA 3AUWB 4JFOA 5ANHA 5CD3B 2Z93B 4AM0Q 3HR5B 4M5YH 3ZE1E 1RH8A 3DX2A 4YDKH 2EXSA 4NGHL 5FO2A 2XX0A 4PWIA 4U1SA 2JB5H 3UYOD 4AGMA 1OTSD 4QT5B 3KLSA 4NM8L 4U1IA 2ICWJ 5TH2A 3E38A 5A2AA 5I8KL 1QW9A 4F5CE 4YSSA 1ZIBA 3A24A 3WUZA 5HHNB 3S37L 3AT9A 2ARJQ 5EIIA 1VFBA 5HHOD 5JW4Q 1R3HA 2WWKT 4DKEH 4WKZB 3PDOA 2C34A 4DHLA 1KJ2H 3DV6A 4Q6YA 3OSVA 5LNEA 5JPNA 4ZDHA 3S4SB 3L3GA 4N1EA 4TNWF 2F08A 3U36B 5BMFH 3FU6A 3P11L 2CHZA 3QDMD 5BQDA 4M8QA 2O61A 3NCXA 2I69A 2YBGA 3VSQA 3S35L 4YBQD 3TO2B 5HGBA 3BZEA 1D9KB 1VESA 3BWAA 3P4NA 2BS71 5KBDA 1L6ZA 1F90L 3FCBA 2V5RA 2X70B 1N18A 4C4KO 2V7NB 3BWUC 4KRPB 4WI8A 2WV3A 2D0GA 3U2IA 3RWCA 3WFEH 4NN6C 2HRLA 2O6CA 1BJ8A 3IMTA 2OL3A 4ZD3H 4J6RL 5F7UA 1BG9A 1MI5D 5F71A 2Y07H 3FHAA 1YJDC 2FYVA 3NEEA 1YPZB 4HIXH 3FTGA 4X2UA 1Z5LB 3JTTB 4PCTA 1SOXA 2C9XA 4BQ8A 3GRBA 3BOVA 4UV4L