3OZLA

Crystal structure of human transthyretin variant a25t in complex with flufenamic acid.
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human transthyretin variant A25T in complex with flufenamic acid.
rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Transthyretin
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3ozlA00
5CN3A 3B56A 4FI8A 2G9KA 2G4EA 3CFNA 3I9PA 3FCBA 3CBRA 5CR1A 4ABWA 4PMEA 3DJSA 3CN0A 3GS7A 5A6IA 4L1TA 2B16A 4PWJA 4MRBA 5IHHA 4PWIA 3QVAA 4Y9CA 5CLYA 5L4MA 3BT0A 1Z7JA 4DEUA 3IMWA 4QXVA 4TQIA 3OZKA 2G5UA 5E23A 3HJ0A 5FW6A 4D7BA 3ESPA 3GRGA 3NG5A 5AKVA 4ABUA 1F41A 1SN5A 4DETA 1FHNA 1QABA 1TTRA 2TRHA 4PWGA 4PWHA 5L4FA 3IMUA 3A4FA 2GABA 5DWPA 4L1SA 2G2NA 3ESOA 4AC4A 4DERA 4KY2A 2G4GA 4PWKA 5JIQA 4HJSA 1ZD6A 4HJTA 2FLMA 2QGCA 1TLMA 1SOKA 4Y9GA 3DJRA 4YDMA 3U2JA 1OO2A 1DVZA 1GKEA 1KGJA 1TTAA 3GPSA 1RLBA 3CFTA 1TFPA 1THCA 3DK0A 2B14A 4TL4A 1DVUA 2QGBA 5L4JA 5JIDA 1E3FA 4HISA 4Y9BA 4DEWA 5K1NA 3P3SA 4IKLA 5AL8A 2G3ZA 4AC2A 2WQAA 2H1XA 4TL5A 4PM1A 3CN3A 3SSGA 4MASA 5DEJA 2G2PA 4IK6A 4IIZA 4TLTA 3D7PA 4N86A 2F7IA 3CN2A 4TLUA 4DESA 3IPBA 4Y9EA 3A4DA 1ZCRA 1ETA1 3A4EA 4PWFA 4TNFA 3DGDA 3CXFA 1ETB1 2H6UA 3ESNA 2IGLA 3I9IA 3IPEA 1SN0A 3U2IA 3P3UA 5JIMA 5L4IA 1DVXA 3P3TA 5FO2A 4QRFA 2QELA 4IKJA 4PVLA 5CLZA 5CLXA 1SN2A 4TQ8A 4WNSA 2B77A 4IKIA 4QYAA 2H0JA 1FH2A 3DJZA 3NEEA 3KGTA 3TFBA 5CM1A 4Q14A 2H0FA 3GLZA 3FC8A 1Y1DA 1X7SA 4I87A 5E4OA 4FI7A 5HJGA 4ANKA 4TQPA 1TYRA 3IMVA 3IWVA 3CN1A 4N85A 5EN3A 4HJUA 4Y9FA 1TZ8A 3KGUA 5AL0A 2FBRA 4TQHA 5K1JA 1TTBA 3NEOA 1G1OA 1THAA 4ABQA 5EZPA 2TRYA 3D2TA 1BZDA 3M1OA 3NESA 3IMTA 3Q1EA 3DIDA 5FW8A 1DVTA 1IJNA 4TNGA 5AKTA 1IE4A 3IMRA 3KGSA 5E4AA 1TTCA 3CN4A 4I89A 4TKWA 4MRCA 1BZ8A 3IMSA 3NEXA 4WNJA 2QPFA 2B15A 2ROXA 2QGEA 5CNHA 1IIKA 3DJTA 4TLSA 3IWUA 1SOQA 4TLKA 4IK7A 4TNEA 2H4EA 3OZLA 1GKOA 1E4HA 4IKKA 4PWEA 2H0EA 1DVSA 3GRBA 3DO4A 1KGIA 5TTRA 4ABVA 2NOYA 3CFMA 1TT6A 4N87A 3GS4A 4PVMA 5AYTA 5BOJA 1DVQA 1IIIA 4ACTA 5FW7A 1E5AA 3TCTA 2GPZA 1X7TA 1QWHA 2F8IA 2G3XA 2PABA 3GS0A 3DK2A 1BMZA 1TSHA 2QGDA 3CFQA 3I9AA 1DVYA 4HIQA 1BZEA 4WO0A 1F86A 2ROYA 4I85A 4PMFA 1ICTA 1BM7A 2B9AA 4PVNA 4TM9A 3P3RA 4YDNA 5AKSA 1U21A 3BSZA 3W3BA 4FI6A
chains in the Genus database with same CATH superfamily
3BKMH 1WUZA 1WZMA 1ID2A 3RWHA 1MCQA 5JIKA 1NFDE 1F4HA 1P7BA 4MXWL 3CBRA 4PB9H 1XD1A 3U4AA 4DEUA 4ZW6A 2YJLA 5D7JA 2R1XB 4QTIH 5IOPB 1KPUA 3DHUA 1Z2KA 5AVQB 5I8KL 4HKBB 4DKEH 5K59E 1D7BA 3FONB 4ZFOB 3ECBB 3QHTC 1P2CA 4CRPA 1Z9PA 1K6QH 2YOAA 1OQXA 1IZJA 3GLEA 5MENB 3SEPA 1OP5H 3CFDA 2V7NB 1J0ZA 3G5WA 5J1AA 4RSVA 4GXUN 3K6SA 4BZ1A 2FH6A 4PRPB 4KKLD 1ED3A 2GSIB 2F15A 4GW1B 4OF3A 1JMZA 1DSYA 4JVUA 3ATAA 1A6PA 5JQ6H 3PP3K 3FPYA 3AB0C 1M1SA 2X2JA 4Q8BA 3TL5A 4NT6B 4HG4J 1MDAA 4JFEE 4XBEL 1FNFA 5DUML 2KHAA 2E6JA 4PREA 3ZIYA 1AXTH 1WAPA 1IEHA 4L1LA 2HJKB 2G2PA 2ZE0A 4X7DC 4R4NC 3UGUA 2ODIA 4KQ4H 5IY5B 1XH1A 3CUPB 4MB5A 3OAYH 4QRAA 4JY4A 3QWOA 1UD3A 3BUYA 2FQFA 2X2IA 4NP4L 2LFEA 4EDXB 3PRZA 1WWCA 4G6KL 4QOKA 3SZKC 1T7WA 3Q2LA 1LNUB 1A0QH 1IAOA 4NKIL 4ZMTA 4LL1A 3BVWA 3V6OE 1B2YA 4GUOA 1JGUL 4AL8C 2NY3D 5IHUH 3QUYB 3HN8A 2VN7A 2AITA 5AYUL 4APQA 1URLA 1HSBA 2UZYB 4D7PA 3KYKH 3RUGE 2WYHA 4A2FA 2V4LA 5EN3A 2V7HA 1FLRL 4P23A 5DJ2B 4YDLB 1HEHC 5D5MF 1UENA 2B4CC 4AEFA 1MW1A 4HD5A 4A6YB 4JY5L 1HWWA 5IK3A 4LOVA 1OT2A 2Q76B 4M5ZH 5DZAA 3LXCA 1SF5A 3EO1B 1U2CA 5DWUL 1WFJA 2ZF9A 5MEQA 1FZOA 3LZRA 3SDCC 3VD4A 1CDCA 4GXUM 5EU4B 3SDDC 4XZUA 2BP8B 3MRIA 1K4CB 5I5JA 3HB3B 2WUCL 5DD5H 5I19L 1DN0B 5AYTA 2ZG1A 5D4JA 4OUUB 3A6BH 2E7MA 4QHNB 1AZVA 5CGYD 3DX8B 4NZFA 3QUML 4P4RB 4X80L 1LD9A 4WZ9A 1IZKA 4R7NA 3SYAA 2VDRL 3V7AG 3GRWL 4ZYKA 2R39A 2R15A 1WITA 4UZUA 4BFRA 5MI0B 1EHNA 1YECH 2EDFA 5G55A 3AROA 4HF5H 5HGBB 3SGEH 3UP1A 4DP1X 1IKFL 5JIHA 3UDWA 1QFOA 1ONQA 3S37X 3APDA 4KJYA 2Z31B 2R0LL 1N0LB 4FFYL 3ZOAA 3NIGB 4AJ0A 1AGBB 3K4AA 2GHWB 2W07B 3O2DL 1TTRA 2DKUA 5F7AA 3T0DA 4FCAA 5DRNA 5JDJA 4JO8A 3ZTNH 4DFIA 3WTVA 3VW3L 3MJ9A 4ZUVB 1DFXA 1T1WA 2QDVA 4BQ8A 5C0AD 4O4YL 3KD4A 2BCKA 5D70L 3LKPB 2DQHH 5DTFB 1GMIA 2J1XA 5BS0A 1WV7T 3GMQA 4GKZA 2R8SL 4OLYL 1UWXH 3HI1A 3TJEH 4FTVB 3TIEA 2WTPA 2Z4TA 1BIIA 4NQVA 5HDRA 4AVJA 1B3JA 3NA4A 3CFKA 3RNKA 3OXRA 1I3RB 2P5WE 3MRFA 3BP5A 2DQDL 1OD9A 1KWGA 4AITA 2IAMB 5F7UA 3AG2B 4KY1H 5F70A 1A2YA 1IC5L 2AK1H 3U46A 4UOZA 4XI5C 1F2QA 4APQB 4H0LC 2NTFA 3OKOA 4NUGL 4QMEA 2C1OA 3SYPA 3UTSA 4OFDA 5GRJL 2DQCH 2BK8A 3BFWA 4B9PA 3UPAA 1IC4H 1E4XL 1R1CA 2JKRM 1RZ8B 3CZSA 3GUFA 3CWGA 3TFBA 4GT0A 3SGKA 1F4YL 3QHFL 4YE4H 3UGXA 4NM8H 1QFHA 3M17B 5C07A 3QB7C 2WGNB 3HI5L 2X4OB 3DX9A 2H3NB 1KXTB 4JFHD 4KQ0A 1FHGA 1GGUA 5DMGC 1T2QL 3GMLA 4PJIA 4B7IA 3BDBA 4PB9L 2NMSA 2Q1EA 3O3AB 3O8XD 3HE7B 5L6YL 2WZ6A 1WBZA 4CC4C 4WTWA 2VXQL 1INQA 2X2HA 3HUJA 2EC9T 4OCSL 4OLXL 4HKBA 1NFKA 3OR6A 2AV1B 2BSCA 1JN6B 5J9PB 4K9EH 4W9JC 5B38G 1XF1A 1J5CA 4NSKA 5IQ7H 1QPXA 3BDYL 1G9MH 3WJLA 3N0AA 1Y07A 3MLXH 5ISZB 3DX7B 5DJ6A 4BV1A 2HZHA 4DP8X 1L7IH 3V6OC 5KSAB 1DQQA 3LNDA 4FZ8L 4IEFA 2V17H 3UERA 1DBBH 2YAHA 3NYKA 4M3HA 5I17A 1VFBA 3FO2A 4XMXA 3P4OB 3QQNA 4K8RH 5E9AA 3S0PA 4AYDC 4PJ7B 4OM1L 4X8JA 3GQFA 5HHNB 1KT2A 1OB1B 4PRPE 3QIBA 3T77B 3CFBA 1E4KA 3JWDH 4MJ5B 2BOBA 4OCLC 2NSQA 3ULVL 3NRPA 2WXLA 2E3VA 3HC4L 5FUOL 3WJJC 2UXFA 1JGVH 1JZEA 3UG4A 5HHPA 4JPSA 2HG5B 5E8DL 3UAJD 3MV8A 3WD5H 2V8MA 4GW5B 4ONGH 3UYOD 3RY5A 2ZOOA 3UZEC 1ZEAH 5FO7B 3L7FA 4ZFZB 5IESH 2XACC 1ETZA 1KTLA 1R47A 4XB8A 3NAAL 4G5ZH 2DQTH 4FQXC 5EO0A 3E9UA 2YFNA 3N1QC 1MFAH 1R3LA 4NC0B 4OVVA 3WN5A 4HEPG 2G3NA 2ZXQA 3R1GH 3ARDA 1YO4A 4S1RL 5K59F 2X4SA 3JZ7A 3N1PC 3WTWA 3U4EB 4M48H 4M7JH 4AQ1B 5K1NA 3PREA 4PV9B 4RZCA 3HI6L 3ULAB 1ZXKA 1A64A 4PJGA 5JLZA 3MHZA 3OJ2C 4DQAA 2XVGA 2M8XA 2NZ1A 4FTDA 3U46B 1TENA 2EVJA 4J27A 1V8HA 3JVGC 4X4KA 3MXWL 4D9QD 4D0BB 3BAEL 3HG1B 1FL3A 4QI3A 2UZIH 2HPTA 2BP8A 5CEZD 2KS0A 2H6UA 3BVUA 3TJPA 4S2SB 4PI0A 2H6PA 4QTFA 2WLLA 1OGAE 4B9JA 1S7TB 4X6BB 3AXLA 3MV7B 4IYKA 4XC3H 2XY1A 3ME0B 1E4WL 3MGAA 4LCUA 4WO4C 3LN4B 3QDHA 4N2LA 4LLWB 4QYOB 3IDNA 4OZFH 3SO3B 2LGNA 1UM6H 2JKTM 3OKLB 3T3MF 4ES9A 1FGNH 3U82B 1YCSA 3BUPA 4L9LA 1SY6A 1SEQH 5FW8A 5MEND 2PYEB 4G43B 2N56A 4NSKB 1N0LA 5TQ2L 2XTJB 5FYKD 3UTOA 1AGBA 4M9OA 5FYKU 1M42A 1FBIH 3E2HB 4O51A 1OM3L 3DMMC 2ZUYA 5D5ME 2WXGA 2YWZA 4A7GA 1HZLA 5TJWK 2IAMC 4K94C 2AGJH 5LO7A 4OCWH 1NFDB 1AR1D 4HPOH 5FFGA 4JPIB 1NBCA 2DJMA 2Q8AH 2P1YA 4N3TA 4XCYA 4HG4K 4XO5A 5D1XE 3VX0A 2HH0H 3QPQC 1TSHA 2XG4B 3QBTB 2YEQA 1S6NA 1A9BA 1F3DH 3QIBB 5FYLL 4LEOA 4WEUD 5DURD 3TZVA 2X6BA 1QBMH 3P9WB 1CVRA 3IS0X 5BRQA 2WB1A 4LPCA 5EN2B 3NVQA 4IQHA 5MHSD 1KBBA 4ZFZA 3TFKC 3GXFA 1QWUA 1GW0A 2FLBT 2HXAA 3BUQA 2I9LB 1ZA3B 4Q9RH 1C1EL 3RJOA 4BINA 4XCCH 1JGDA 4NQXB 3OF6A 5ABAA 2GB2A 4L29B 3CHXA 2LAGB 1SMDA 3W0WE 1G7QA 1NFIB 1DEDA 1WFTA 1E7UA 3PDOA 1X9RA 2R27A 1F00I 4TPRL 1BQUA 5C6TH 5KVGH 1AGCA 1EMTL 5GRYA 1A6TB 3WE6A 4Q58C 4ZUUA 1HT6A 2Z0BA 1JFQL 1PU0A 3TBYA 4M8QB 1RPKA 3GSRB 2BPBA 5IFHH 4U1GC 2VXTL 4G8EA 2WXPA 5FYLH 1BECA 2VDLH 3HG5A 2HUHA 1X5XA 1WBZB 1XCWA 2DQGH 2FTAA 3LRHA 3NJNA 3X3FL 3A4DA 1A02N 2NUPB 3FU5A 1MJ7H 3OR6B 1RY7B 3P2TA 3M86A 1S7TA 3CH1B 3L1GA 3NUKA 3DC0A 1OM3H 4X83A 5KSVA 1H9DA 4YSPA 1DVXA 3EDEA 1CT8A 1T2XA 1MQKH 2X38A 3SB3A 4JFVA 1TTFA 1YYLH 4B95C 5IEHA 4KAQL 2J4WH 3WNPA 4ES8A 1SM3H 4ZO6A 2OX5A 3OJDB 4MKTA 3VXRD 3DIVA 1M6UA 3V0FA 3V6BR 3FU7A 4LSRH 5GZOA 4MCZB 1HX0A 1WWWX 4WW2F 2PMZA 2XZZA 2VUOA 3H2WA 4ZXBB 2BXZA 4UINH 4ZFQA 1KJVB 3IGAB 3SE8H 1JNNL 4OD2A 4G59C 4F7MB 4YDVA 4D0DA 1U41A 3RJDA 3MXWH 1MVUB 1WAAA 3ILQC 3IJHA 1BZ8A 1B2WH 2UYLB 3HCVA 4ORZC 1JWUA 5E2JA 2H4EA 1MWAL 2VDLL 1L7TL 3L6FB 2X5PA 4N2CA 4UBDC 3KLSA 4F7CA 2ZX7A 4XCEB 1EXGA 1PZ2A 5KBDA 3WMSA 3AVEA 1CGTA 2FT8A 2ICEB 4KKCC 3ULSB 1SJEB 2X9XA 3QUXB 1X4YA 5IHZB 5I0DA 2YKLH 2YAQA 3QCTH 4DUXA 3SPIA 4PJDF 4YDNA 4PBXA 1S5HA 2OTUA 4MWFB 3B3IB 4APQD 3WAKA 3PU7A 2WPGA 4PBVC 1D6EA 2C9AA 4PV9A 5DF0A 4AT6A 3JV4A 4OKVB 2CBTA 2BVYA 3HR5B 4FQHB 4UT6H 2Y07H 2Y5TB 3PDGA 5EEUA 2IVFC 1VLXA 5KJRH 5LNGA 3EIFA 3ZMNA 4F8NA 2OYPA 4HXBH 5IQ9B 3WY2A 5DJYB 4F8LA 4E42B 3FSAA 3NG5A 1BD2A 4YVUA 1MY7A 3V4UL 1BVLA 2VDML 2VJXA 4NN5B 2VLRE 3CFIC 3WO4C 5ITFB 2AJ3B 3QORA 4Y2LA 1JXKA 1E9PB 2G2NA 5A3ID 3N2JA 1I7ZA 3AB0B 1I8AA 1OSPL 1P4LA 3ZVVA 2Z4QB 3CFJA 1CR9H 4MKMA 4BA0A 3VDCA 4XZUB 3ZKND 4XC1H 5ICYA 2JQMA 4CVZA 4V33A 2HRPL 4LARL 4M1DL 1KB5L 2YPKA 4JZJB 4RQQA 1GYCA 5IB2B 2B14A 4LCCA 1XWVA 3E3QC 3SGJA 3V5KA 3HE7C 2R69H 1I4FA 1LK3L 1OE3A 1XZ0A 5F3HA 8FABB 2DJSA 1YDPB 1YEFH 1BZOA 1QLEH 2B3RA 2JXMA 1SY6H 4I4WA 3NSDA 4R7NB 1I1AA 1U8PB 2X88A 4S0SD 2WW8A 3LRLA 3U9WA 1TEFA 5IM7A 3FCSB 3PCYA 3RZCB 1T0MB 1X5JA 2X6AA 4DVRH 2WQUA 4HBCL 4MJ6A 3LD8C 2X4RA 3ILPB 5IW6B 1J9RA 2DL9A 1RSYA 3ARBA 1WPCA 4ZFFB 2VR4A 4YK4B 4KK6D 2C9UA 4PJHF 4Y19A 1JF5A 4KK5C 4V2CB 4OB5L 1CFMA 3MLTB 1YQ2A 4FFVC 2P45B 1BVNP 2Q6WA 2J44A 3RZCC 1JHKH 1BJ8A 1P7QD 4IBUA 2QQKH 2ADJA 3MX0B 5F7FA 2W92A 2MEJB 4M1CD 2PYFB 4AQAA 4IU2B 2VLKE 2CALA 2FHFA 4UILL 1A1NA 7PCYA 4BUQA 2KZWA 1CXHA 3PPSA 4A2LA 5IR1B 2Y3NA 2CA4A 2PP7A 5BS0B 1MCPL 5E4EB 5D7LA 5EN2A 3BZ4B 4ONGL 5BS0E 2YQ3A 5GGTH 4FGMA 1BBJB 3BWAA 3II3A 1N0XH 3MQIA 4K15A 3T3ME 3W0WD 1MCKA 3QORC 4IJTA 4PB0H 5D71L 2AEIT 3BP6A 4BD4A 3AM8A 4OD3L 3W38A 1JGLH 2OP4L 4M48L 1WTLA 4YEEA 3V7AE 2CK0L 4RVBA 1TOXA 1XB6A 3UJIH 1PL3A 3ISWA 1X9QA 5FKAA 1K2DB 2CDFA 2NY4B 3CK0L 4J3UA 4EKJA 3TWCH 3UJTL 1ACZA 2Z31D 3Q44A 1H3GA 1YY9D 3CHSA 3IXTA 3KPLA 4XX1E 2WSPA 4E42A 2LTQC 4NZ8A 3FCBA 2EECA 1KMGA 5DC2A 3VI4F 4WFHE 4N6RA 1EQWA 4KK9C 4HUVA 1XAUA 5EOCH 4BQ6A 2G5UA 1D7FA 4H44C 3CH1A 1MJ7L 5DD6B 2F54D 4OFKA 3DSNA 1D5IL 1AS8A 5E1HB 4WSGA 3QUMA 1PTZA 5DK3A 1S3KH 2OBGA 2LTQB 5DLML 2DS4A 4NUGH 3TNNA 1BFVL 2MQ0A 4K4KA 4WWOA 3OKMB 4AIZB 4ODWA 1S7QB 4BGLA 5JQIB 5JHAA 3NPSB 1T7VA 2YXWA 5AW5B 5I5MA 3B7SA 1L0YA 4X6CF 2BX5A 1YEIH 4WHDA 3MLPA 1I31A 1OAYL 4U1LA 2CKBB 2XTSA 3ISYA 2GKIA 3QUKB 3UROR 1QSFD 1TPXB 2JQAA 2EZ0D 1JNLH 2TSAA 3S3DB 1TFPA 4G83A 1MHPH 3DK0A 4K2UH 4MXQD 4HWNA 4JRFA 3MRPA 1GYWA 3R8QA 5ERWA 3RRQA 1Z32X 1DBBL 3IJYB 1KELH 2NR6A 3WN5C 5KSAD 3VGAB 4L8SA 1HXKA 4OVUA 4N90D 5F88A 1XF5B 1NCGA 4P99A 1CTNA 3S3BB 4DW2L 4XN5A 3EH5B 4IRZH 3GXUB 3B9KA 3FUJA 2W0LA 4POUB 3VX1A 1C7SA 3ZDZF 4CN1A 3GDCA 4Z3GA 1MHHB 2VYRE 2EKJA 2ZG2A 3LSOB 2EYSB 2FYYA 4UUJA 3KYOA 1E67A 5IQMA 1L9TA 3N9GH 4DKDC 1LEIB 4GAAA 1L9NA 1FCGA 1ADQL 4YXKL 2A0LD 1JPTL 3QZBA 1F3DJ 1UZ8B 2CJTA 1EHXA 2OZ4H 3VD2A 4ZQTA 2H1LM 3VWJA 4JHWL 3FQUB 3I50H 2FR4A 4OTXL 5KYWA 3CHRA 2WO3B 3O45A 4X9BA 2AQPA 3HS0B 2IANB 3CH8A 4MS8D 3WNLA 4B60A 4E0RA 1IJNA 1NOAA 5CZRA 1IE4A 4PRHB 4CBPA 2G5BB 4LKCB 1U93B 3M88A 2CHWA 1NEPA 3T2QA 3WOVA 3X14B 2V33A 5HY9A 2GJJA 3UBXI 1NGPL 1MIEL 5DJAB 3MYZA 3CSBA 1JZ6A 1WP6A 4MAYD 5TH2A 3CFMA 1CTMA 4RLDA 3BFOA 4JJ5A 1U92A 3ZR5A 4F2MB 3A6OA 3T3PE 1BQLH 2VQ1B 5B39A 1JJUA 3SPHA 5L88H 4XBEH 2DYPD 3EFDH 4APXB 2B8OT 3BT2H 1TYJA 2WLLB 1N70A 3V5KB 3MV11 3TNMA 3FT0A 1UXWA 2BVQA 3BI9X 4KZCA 2ITDB 2OYMA 1ZV5A 2YA1A 4MQXD 2DLIA 3AS3A 4PFEA 5CILH 5C0GA 4YPJA 4GO9A 3BZEA 1GY2A 2VKWA 3RDJA 3PFUA 4KX7A 1NM4A 5TQ0H 2L0DA 3OR7B 3CFEB 1TCRB 2F8VA 2XVBA 3C9NB 4PJDE 3DPBA 4PWHA 3VMPA 1RZKC 2I85A 4KC3B 4YBQC 4BZYA 2ZCLH 3TF7C 4HBCH 2P46B 4HHAA 2E9IA 2GABA 2X40A 4Q9CA 3LNIA 1JGIA 3LQAL 4R3SA 3MRMA 2G4GA 2PETA 3CGTA 3GK8L 4O9HH 1E4JA 5TGBB 1FG9C 3GMOA 2NXZB 4WFFE 3VXPB 1JNJA 1JFHA 3CDCA 4ZXBC 4PJAE 3SY6A 1V05A 2UZPA 1KLUA 4UAOB 4MHHI 5C0CE 1JF6A 4AQZA 2Y1YA 4FA7B 3OX8A 4DJMA 3V4LA 2YN3A 3BZ4A 3QUXD 4EO5A 1U8JA 1MI5A 1CD9B 1OWWA 1TIUA 4R0LA 4X4YB 5IOPA 3OAUL 1UTDA 3RB7A 2OMXB 4LQFL 4WO4B 3U1SH 4RETB 1JZ5A 4N4YB 5GS1A 5CCGE 1R5VB 4ZFOA 2JLPA 3WO3B 1EHKB 2BNRB 4AYFB 3K7UA 4Y5VA 1DYZA 1OSPH 2BVUA 3KBFA 2VN3A 5GGVH 3OAZK 4H26A 4D2NA 2VE6B 4HIJB 4P2RD 1LP9F 3KCWA 5L88L 1TYRA 3AWGA 4X5WB 3IVKA 1JNLL 2EAEA 2ZXCA 2F5AH 2I9LA 3K2KA 4H0IA 4Y4FB 5F7YC 3RU8H 2O4EA 4G11A 1GZPB 1YNKH 2WZPA 1RH8A 4OZHF 1NSNH 3SKNB 4Z6AT 3LZQA 3LRGA 5JYMA 1G7QB 1DVTA 3VO0A 3L3OC 1QNZH 5EIIA 3AZUA 2D7QA 1GPOL 3T2NL 4FLRA 5EBWA 2CLVA 5CLTA 3GGWB 1WIOA 4WWKB 1A5FH 3FQRA 4WEEA 4WI4A 2EDYA 1S7QA 3FUDA 2UXTA 4N2IA 1T1ZB 4NQTA 4LRIA 1E8YA 4UOW0 12E8L 4ETQB 3LEYL 4AKQA 2HKFL 5JOFB 5KANG 1PY4A 2QQKL 1U2YA 4QRRD 5LQBH 3TO4D 3NCBB 2FJHB 2Z9TA 3SDXB 3SQOH 2P7TA 4NQCE 3BRGC 1S7XB 4PD4K 1WFOA 1QKZH 4W93A 4YSSA 1ZANL 2NW2A 2Y7NA 3ARYA 3FSVA 4NO0B 3FU3A 5T1JA 4L3CA 2D9QB 5CEZL 5MEQB 4Z5RA 3JWOC 2EH7H 1DJSA 4EXKA 3EOAB 5CEXB 3DOSA 1CG9B 3MRIB 1JPFB 1NCAL 4Z7WA 2CRMA 5IV2A 2AXGA 1EFXD 3U0PB 1OAJA 5EO1B 5D6CA 2X0VA 3O6LL 5DRZA 1QFWM 4ZMVA 5I2IA 3SE4C 1UFGA 5EF3A 3T1WA 2CO3A 3VI4E 1BXUA 3G5ZA 1R9FA 4PG9A 3GSOA 1OAKH 5D1QB 3EOYG 5CBAB 2JIXB 4P05A 1HILA 1KYDA 4PJXF 1IGFL 4HLZH 1O75A 5KYWB 1JHLL 3F2LA 4NJ9H 4X4YA 2WQAA 3VM5A 1B90A 1DBJL 2R69A 3QUXA 5IHZA 4X6EB 4Y16A 5KOMC 5EDSA 1B0IA 1R0AH 1IM3D 4F15B 2X10A 4KJYB 3GKWH 4JRYB 5HDWA 2CM6A 1XGQB 3GIZH 3H1ZA 5E9DD 1EZUA 4ZQKB 4HFWA 3LNFA 5CSBA 5HP5A 3STLA 3BH8A 4ODVH 6TAAA 43C9A 1LO5A 1P7KB 1KCWA 3CK0H 4XVJL 3V0WL 1JVLA 4JG1H 5F9WB 4NQEE 4I9XA 5DS8B 2N7SA 3BKJL 1LHZA 4DAGH 3K2UL 4XN8A 4ZD3L 3HEIB 4TSAH 1BD2E 2A83A 3JV6B 4KKCD 2A9NH 4ELKA 4AUUA 1TJIL 4G1MB 1AQMA 1XR9B 2BP0B 2ILLA 5D1ZA 4QF1B 4B9KC 32C2B 1QBML 3V4UH 4KBPA 3ULVF 1EJ8A 1PEZA 2Y9RT 3ASOB 4FMVA 4U6HA 3B8YA 3E8UL 4G3YL 3II1A 5CEYA 1KJ2B 4TKWA 3VFTA 3BP5B 2J8UB 2B2XH 1CLOH 2XU9A 2BY2A 3RWEA 1QASA 3AC0A 3HZYB 2OULB 4UNTA 4K8RC 4ORGB 3KVDD 4KX8A 4AK1A 1ZY9A 2XRAL 3EYOA 2K7PA 4GIPD 5CF3A 2B1AH 2BSSB 3CLFH 2VJ8A 3FU6A 4HCGA 4JFFB 3T09A 4DN4L 2DYPA 2YN5A 2NX5A 4GRLD 3WLBA 5HYJE 5C3TA 1HE8A 2Q8BH 3ZKXB 1ID5I 5D1XD 5I1EH 2Y69B 5HDQH 3IAQA 1N5YH 3EDFA 1MFCH 2XWZA 1A65A 3F7PC 3VXQA 3WEXA 3TEYA 5KVGL 1ICTA 3RVUD 2X4PA 4Y5YC 1RP8A 3F7YB 1V7MH 2RAMA 4E9LA 3ARBB 3SKOA 5JUEH 1OAQH 3C09B 5D7KD 1NPUA 3EGDB 3CTTA 4WTQA 3RVVD 4DF9A 2PCPB 1AZBA 3IU4L 4PGDB 1HYSD 4HWZB 4Y19E 3HB3C 1GGTA 1U8JB 2MCPL 3CVIH 4JPKH 4L37A 4OM0H 3HUJB 1T1XA 2LLLA 1FSKB 1Q1JL 2NQDA 4IMKA 1T3FA 5E5MB 2AEPL 2IDQA 4I18A 3QR2A 5GGSB 3GHEL 5C86A 4KROD 2IGTA 1BGXL 3BH4A 4LSVH 2J20A 2R29L 3P9MA 1MLCB 5FLUA 5T1LD 5ID0B 5DHMC 4F37F 3QS2A 3OLGA 5BZZA 3HHSB 3MNWA 3BWAB 1RL1A 4JRWA 4AQ8C 1ACYL 5ENWA 3P4OA 3MCYA 1CGSH 4OQTH 2F7PA 4XVOA 5GGUB 3MLRH 3CU1A 4LEXH 4Q74A 2PR4L 2FWUA 3C6LC 1CI5A 4CAGA 4B9CA 3QZOA 5FX3A 1M53A 3VXTB 5IUCA 3IGFA 4OCWL 4FFWC 5HXMA 3I9GL 2AMUA 3IU4H 3P3UA 1OGPA 4P3DB 4ZODA 5C08A 4AH2A 1B6DA 1QSFA 3EDKA 2IXQB 4NKDA 4QXGL 4IBTA 5GGQL 1Z0NA 4Z3TA 2QADC 4OQTA 1A6AB 5IIEA 3RX7A 4P57A 3VA2C 4JDEA 1UM5L 3GC3A 2ATPA 1MCFA 1S9VA 3LPWA 2L8AA 3JWDC 3FFDA 2MJWA 3NSXA 1CL7L 2J88H 1KJ2A 3QEQA 4WUKL 1AZCA 2EIJB 3LVEA 4I0PA 2CBOA 3FK3A 1V27A 1HK6A 2VC2B 5AZUA 4YR6A 2FLRT 1OALA 1DCLA 5J89A 1UKQA 3TA3B 4UT9H 3QRLA 2X70B 4S0HA 5HVGB 5FYJU 2X9ZA 4DH2A 1LWJA 5CNHA 4DP6X 2NY0C 1WFIA 4PRPD 4BE5A 5FYJL 3FO1B 4CL7A 4WW2C 4F1ZA 3X2QB 4IIQC 1QYGL 4OZHE 2PLTA 4DP4X 4U4BA 4OLWL 5F97E 2FSEA 4JL1A 1TEYA 1D7CA 3NSCA 5F88B 4JFWA 3S37L 1ZJBA 2X44D 3V6ZB 5I8EB 4XC1L 2VWEE 1XGUA 3BKJH 1MCLA 4DAGL 4XP1L 4FQJH 5CJXA 1DVYA 3GUTA 4PJXB 4HWZA 3RURA 5ADPL 4U1NB 1S9XA 2NYYC 1GC1H 5J6GA 5E6IB 4XNYL 1KPUB 5ITBL 3WKNA 1OTUD 5D7LD 3ZGIA 4YNYA 1SLVA 5L8KB 1ZHBA 3CHOA 4UT7L 5SWZE 1DANU 4DT2A 4PV8B 5I24A 5ID1A 3DX6B 3IK2A 1SEQL 1A5FL 3ZZSA 4LAQH 3P9LA 4JFZL 3ZIMA 2DWDA 3T9WA 4ZO8A 1AZNA 1NBYB 3BP4A 2DWTA 2Y5QA 3F64A 5KBPA 2BVOB 2PW2A 3L48A 2VQTA 3BVDB 4OCSH 5C09A 2PTVA 4Y19D 1QATA 1RZFL 4PJ8D 5KSBA 4NRYB 1F6AB 4N1CA 5TPWL 4KK5D 3LQMA 5EUOB 5D7KE 5F96L 2Q0ZX 2XFGB 4RBPK 4YSQA 2RQ8A 3CHQA 4NAMA 2YAEA 2EH8L 1OCCB 4A55A 3CHPA 2C1PA 1QSVA 5I6NA 1VACB 4L0PB 2MSPA 3D7PA 3WS6A 1U8NB 3MA9L 5I18L 2IXQA 5IBTL 1ES0B 3RFZA 4Y1AD 3FSZA 3HE6D 1Y6MR 2VLKB 4EN3A 2QVFB 2IGLA 1FF5A 1PD6A 4M5TA 2Z65C 5SWQA 4CU7A 4YLBA 4DGVH 2WGXA 4HUXA 3KYNA 2ERJB 2BHFA 4Z7VF 1U3HA 5A2KH 4FYRA 5IT2H 1BGXH 2DF3A 4XPBH 3MBWA 5CBEA 3V9EA 1O0VA 1X7SA 2F74A 3KWVA 5I1KL 5IEKB 2IAND 1T5XB 1ZVSA 2GY7B 2X1OA 3HZMB 5IK3B 1NKRA 3U25A 3IMBA 3V4VB 3LXAA 1JYWA 1OPOA 3L9RA 1YLBB 1WISA 1RP9A 2JKIS 1BD2D 2HFFA 3U0TA 5JOPE 1P4IL 5B1AB 2Y7MA 3ARQA 1K4CA 2YPVH 2YAOA 1R0AL 5F44A 3SYCA 2NY4C 5T5FA 1ANUA 4KTEL 3VI3E 3F12A 4I89A 1IGCL 1DN0A 1QZNA 3ET9F 3JBG7 5EU3B 3GZOA 3VW3H 4HSAC 3DJTA 5D1QD 1IC5H 2ZD0A 5HGDA 3L9YA 5ICXA 1CIUA 5C0CA 3U4KA 1MPAH 3W5NA 1G5GA 2XV6B 5GRJH 1XF4A 1TJGL 4QLRA 4C4BA 4FEMA 4OCRH 2XPGA 3FJTA 2V9UA 1HEZA 1INDL 4N2HA 1QUNB 3TVMC 3LKNA 2PWHA 4BBWA 4XCFL 3D85B 4KRPC 1G1CA 1N5AA 3VXMB 1FFOA 4IRJC 5B7MA 1ZHBB 4NYLA 5I1JH 4MCZA 4KUCF 3RX5A 3QCUL 1BW8A 3B2UC 3GSNH 2XNAB 1FLRH 3I9PA 5LBSH 4LLVA 3BAEH 4OZIF 4KRPB 3BYTA 2EICA 4B3VA 1UVQA 2DQFB 4TUJB 3CC5A 3IJSB 4JM2B 3T5WA 3N43F 3HZVA 4GP8B 1M1XB 5HVHB 3QIBC 2P47B 1BVKA 4BSVA 3WV0A 2QR0B 5D93B 3ZKSD 5EUKA 4HAKA 5I1HL 4L8CA 1JV2B 3MRQB 2J1ZA 1SMOA 1MSPA 5CU5A 3UXFA 3GIVA 3B7TA 4XMWA 4WWKA 5KBMA 5J3HD 5GRZA 4JFTA 1HHKB 3NPZB 4P5TB 2Q7NA 3MLSL 3SE4A 1E5YA 2WSKA 3NA9H 3QIWB 1HWGB 2ZYRA 3T2NH 2AQRA 2FX7L 3R7QA 4JHAH 4J28A 3SSGA 4B96A 1ZS8B 5I76B 3QIUA 3ULVH 1SUHA 2QV4A 2CPCA 2VH5L 3P2DA 4UIKH 4BFFA 5C3LD 3QR0A 1CU4L 3QCUH 3A6BL 1RZ8A 4JL2A 5GS0H 1WT5A 5I1GL 5GSVB 3MN8A 5D55A 4PVLA 4N0FB 4RAHA 4R5XA 3K3QA 1FFTB 1GW6A 4TOYL 2F08A 2XWTA 4HMDA 2EJ1A 1OTSC 4U3SA 5B22A 3QUZD 4N0CD 3DOSB 3ZHKA 1Q9KB 3S5YA 1MHPL 4K2UL 5TK4A 1RUKL 3H56A 5E6IA 1D5RA 5D70H 1A7OL 1W2KT 1DQKA 3AREC 1F1AA 3NH7H 4A39A 3FN0L 1XGYH 3ARPA 1JN6A 3L5WA 1ZK9A 4HLJA 1XF4B 2A9MH 2YPLE 4FNQA 2ZF8A 4WUUB 4X8GA 2FJGA 4XMZA 2PN5A 1B4RA 3NZ8A 5T5FL 1PAZA 3KAAA 3D5OF 4JHAL 2Z93B 3I6GB 3MLWL 1BP3B 1AQDA 2VM9A 4LOFA 4N8VA 4K5MA 5F2FA 1T0MA 1DLFL 3C60C 1VEPA 4ABVA 3L1OL 1CO1A 4P48A 1BZ7A 4YIQB 4AEIH 1NUNB 3WXVH 1RZJC 3QXAB 2F58L 3CVHL 3H9SE 2CPUA 2P80A 2YD6A 2YEZA 3NIFF 1KLGA 1KJ3H 4K9JA 1E4XH 2B9AA 2X4QA 4LHQB 5D7SH 3V0VA 2OJZH 2X87A 5AYUH 1P7KA 2Z8WC 5JQ6L 5FGCB 4ZMOA 1KN2H 3EJZD 1GH7A 3MUGA 5DA4A 2FQDA 2BVTA 3RVXC 4S1QH 5E4EC 1TKWB 1GJWA 4AMXA 3BHBA 3HC0A 5KN5A 1ZIBA 3C60A 3JTTB 4J6IA 4QXVA 2F9BT 3DKHA 1GHFH 5CUSL 1YUKB 2ZUTA 3PJLA 4DPCX 3ORJA 3QK0A 1T4WA 2QADB 5JTWA 3BISA 1FFNA 3M1BA 1AD0A 4HJ0C 1U58A 1JP5A 2VITA 4NLHA 1IQDA 4R2GD 3OL2A 1KPRB 4WDIA 4EI5C 3N42B 1ZPUA 4Z7QF 1DJYA 3ZE0E 1D5BB 3AS0A 3GNMH 4ALAL 1BQLL 2E7BA 5GGVL 2YO3A 2BINA 3AGVA 3QIWA 1S7RB 2OKMA 4WW1B 3KYKL 4I0PC 2AEOA 3LS5H 2EABA 25C8H 4AUJA 1MCCA 4JN2B 3RE0A 2HVBA 1KBVA 3HG1A 1E3FA 1N26A 4M4PA 3RAJH 3H4HA 2IH9A 3S2CA 3ZT5A 2WVVB 2YC1A 5G5DA 4EDWH 3OPUA 5GGTL 3WELA 3CBJB 3B1UA 3AG1B 3NFNB 2PNDA 4E41B 1PZSA 3F12B 3OKNB 1ZCRA 1ZIAA 5TF1H 2NDFA 3EOTL 1DJIA 2XIDA 3LEVH 3QAZB 4HF5L 4B0MM 3QDJA 3ABKB 1JVOA 3MRDA 4J3XA 2VLJA 3EGDA 3P3TA 3QI9C 5FO2A 5AW2B 4W9DC 3AADB 2FQEA 3GT6A 1JI1A 3HE6B 1IBYA 1QHPA 1FN4B 2D7MA 2R83A 5T1DL 4RCAA 2VXUH 4YX2H 3QAZC 3L3OA 3NP4A 3TN0B 1T3FB 3MV9D 4IGBD 4DKFL 3ARZA 1PAMA 2E7LA 4WUUA 3BXNA 3ZE2E 5SWZB 4J12A 1T66D 4HETA 5A2AA 3IN2A 3WKPA 3ALXA 3MJ7A 2E9JA 4J2QA 3TBSA 5BV7B 4NAJA 1ORQA 1NCJA 1DR9A 4JLRA 4PCSA 1UZGA 3Q6FA 3IBEA 3NOIA 4TLKA 1KEGH 4MVBC 2W65A 1J1PL 1K5NB 2MHAB 1MFVA 3GJFA 1SVCP 1UH4A 4O58H 3DUSA 3QEHB 3R4DA 2XN1A 1RJZA 2AVGA 1X7TA 4GQRA 4KRMB 1KIUB 4XAKE 5FCSH 4EZKA 5KSBF 4LLMB 2DQHL 3CLEH 2IF7A 4EDXA 5BV7L 4AGNA 1EXUA 4K7FA 2RGSA 4AXWA 1MHEB 3IKCB 3QJTB 4WTZG 4C8XA 4NKDB 5CN2A 1QSFE 1KN4L 3D12B 1AKPA 1EGJA 4NQDB 1ZS8A 4UQDA 4MRBA 3DTXB 4L05A 3OXSB 3DHMA 4I3RH 4AYMC 3EYSL 5KUMA 1PG7X 4WJ5B 1OP9A 2Z7UA 4PHXA 3SBWC 5DJAA 5EA0L 3ZHLA 3CVBA 1GZQA 3SGKC 1ZV9A 5CGTA 4LLQB 4RFOH 2WZ5A 3LRMA 4U4IA 3GSWA 4X4ME 2VDPB 2WXOA 2Y7SA 1FC2D 4L1SA 2BNUB 3ZZQA 2WTRA 3KBHE 1IAIH 5HYJD 3GTVA 4PWKA 4IU3B 4G9FB 3K46A 2HT3C 5BQDA 3I74A 3V79C 1OGAB 1T7XA 1KLFA 5E94A 5C0JB 1RLBA 5KVDE 1VA9A 1IVLA 4GP4B 4PRID 4HUWA 1YNTF 2AXFA 3DXAA 2RALA 2DIJA 2NUPA 2K78A 3GF8A 3UJJL 4UDUA 3L4UA 3VCLA 2WXQA 2V3FA 5KJRL 4EPSA 1URIA 4UF7C 5D7EA 3EYVB 1EEYB 4EVNA 4W9LC 5I8OL 4PHZA 3BWUF 3LMJH 1PGRB 3TURA 2HJFB 1GGYA 1KV7A 1MY5A 4MXWH 4PN6A 1U8CA 1J1OL 3IT8D 3ROOB 5TE4L 4U7SA 5LWYH 3BVXA 3OKDA 2B0SH 1RURH 2NY0D 1YNLL 3KPNB 4YHIA 1A6VH 3BPLC 2YA2A 1P9MC 4BCYA 3RWIA 2E9BA 4JFZH 5EIVA 4FXKC 3BEVA 5SWZA 3GPEA 3NJGA 3UIYA 1N5YL 1FE8H 2DWDB 2Y06L 1N64H 4TQHA 4IEFB 5IJKA 1MCEA 4MJHA 1SMAA 1U3HC 5AQ0A 4P2AA 4F3FA 4ZUVA 2VMEA 2GTZB 3L3DB 3AABA 4HQQH 3VB8A 3MRNB 5JNYB 3BHBB 3HC0B 5KN5B 2IDTA 4U6YB 4Z7VB 1HS6A 1QRND 3A67H 3CDZA 2TAAA 4N2AA 4ZNEE 2VDPH 1MEXH 1MJJB 4AV4A 1J8KA 1B88A 3DO4A 1TZIB 1EXUB 4K7FB 3CVCA 1D3CA 3CZLA 1T6VN 4Q4IA 5AYQA 4BGDA 3NJFA 3SDDB 4DGVL 2G9HB 2VDOB 5BRZB 2A1WL 1A2YB 3HR5A 2EDMA 1R17A 2K70A 4ZD3H 1P1ZB 4H1LG 2DTMH 4TM9A 4P2RB 1WO2A 3DTXA 4WHYH 1Q9WB 3VD5A 1EJ6A 1QR1B 1I8IA 2DQUH 2J25A 5AVVB 3QDGE 3GIZL 2E56A 4WAFA 1E30A 2C3HA 3E8UH 2AXJA 5GZOC 4MB3A 3GINA 1IKNA 1IC1A 3L3GA 4FZEH 1NGXA 5DK0A 2EEAA 5AUMB 4PLKC 1F56A 4KI5E 4PGCB 1BBDH 5GS0C 3V55A 4QRQB 4I1RA 3CXDL 1EZLA 2R56H 3O41B 4BFNA 3K2UH 4H8HA 5IROA 1R3HA 5HI3D 2QADD 1FVDA 5E5LA 1MW2A 5MEOA 5DJZA 1T89C 3QQ4A 3FQWB 4ZUWA 1IGML 2O72A 2WLMA 5IOKA 1I1AB 4G3YH 4KTEH 5IVXA 4AQEA 1JZ7A 2X4TA 3CFCL 4PJBF 2B2XL 4Z9KB 5HVFB 3QZLA 4JO1H 1MAMH 2OMBA 4FERA 1FV1B 4LSSL 5AOZA 3S34L 8PAZA 2OMTB 3HHRB 3PV6A 5DMIH 5TQ2H 2QMJA 2VM3A 3SN6N 1MOEA 3D1MC 3L4XA 3Q8AA 4K7PX 3CQPA 2NY4D 2EYTB 1ITBB 2D73A 5KWYC 5LHDA 5C0DB 2Z3FA 3VGGA 2XNAA 2B20A 2PTUA 1LGVA 4Z23A 4OLWH 4K73A 5CLWA 1KCUL 2DLEA 1J10A 3ZTDC 2ZUVA 3B5TA 3N40P 4M61B 3SKMB 2HG0A 3MLZL 2R7EB 1TZGH 3OMIB 5DEZA 1T0PB 1XF2A 1P84J 1N8OE 4YFEA 2NYYD 4UV7L 1XEDA 4HGWB 4JKPH 3RP1A 5KVFL 3QPKA 1XB8A 4GIAA 2B4CH 2MWCA 2PYED 1U3YA 1IGFH 5GSRB 3BW9A 4CVXA 4OGXL 4ZMNA 1JWMB 4JFEB 4YSDA 4ADJA 3U7YH 4I5BB 2BVPB 4U49A 1FJ1A 3JTSA 5DHVB 3ZO9A 2GW5A 4TTDD 3TEUA 3EH1A 5J11B 3IDMA 4ZS6D 2E9GA 3GSXA 3K80A 4FE9A 4WNQA 5FKPB 3RA7H 4ECNA 4FKKA 5GGQH 5BOJA 1GGCL 3K1KC 4GAYB 2AK1L 4P59H 1NBVH 3Q0HA 4UB0L 4Q7DA 3A24A 2ZQKA 3FAWA 1KBWA 6PCYA 3K6DA 4D0CB 1F58L 4MFHA 3L4CA 1E0OB 4OIIL 4V1DE 1TCMA 5DJCA 2YZ8A 4NCDA 2A74C 3QUMB 1VKXA 1NGQH 3N85H 5A2IH 1IGTB 3GMMB 1F13A 4XP5H 5CSZA 1KSRA 3EHBB 3PL6D 5D2LA 5C1MB 1Z7JA 4UINL 2W60A 5FW6A 3NCFB 1YPZE 2CUHA 2R23A 4RGMC 3O8XB 2PR9A 1P6AB 3BQUA 1SVZA 3OMNB 2ZP9A 5I82A 4BQ9A 3VFWB 4YX2L 3FAXA 4LL4A 1JSYA 3TCXA 4Y4HD 4PGZA 5FA3B 2GK0B 3BO8B 2BNQD 5EC1B 4X8CA 2AQQA 4AQEB 4FZ8H 2EE2A 5BRPA 3K5RA 1KGJA 1QRKA 2WQXA 3DETD 4X5XB 1XH2A 2AJYL 3P0YH 3P3SA 4F3FB 1XF5A 1AG0A 4KXZH 3L3DA 1UGNA 4PY7A 1SXCA 3BMWA 3SDCD 5D72L 5E24E 4AENA 3T6QC 2X2UA 3H9SA 2DI7A 3KPQA 2WCSA 3HRZB 4XP9H 4ZDHB 3TPUB 5DT1H 4YHYB 3Q6GH 5AKRA 2E7CA 5IWLA 1QTYT 2NY6C 4DK5A 2XXFA 3LKPA 3A47A 5BUGA 3MDJA 1I8UA 4L3FA 5C8JA 4F7CB 4Y8DC 4U1GB 1HSAB 2QPDB 2DLFL 4HGWA 4E0RB 1UKSA 1XL4A 2FIRT 4LVHC 3V6FA 2G5BA 5SX5H 1UOVA 4KUCD 4Z0BL 3TJHD 1BJMA 3Q06A 1IILE 3SQOL 4Z3JA 4I0KA 4W70A 3KL3A 2WXKA 1RIVL 5F89B 1C5CL 3JVFC 5IMMA 3K0YA 3VXME 3KPSA 3EZJB 4LVHB 1KEMH 3H3PL 4UM8A 1OGAD 1UGKA 3QXDA 4P04A 2IPUG 1MCOH 2Y5EA 4NZTH 1M2OA 5GGRA 4HUUA 1TLKA 4Y5XB 5SV4A 5H35A 4K3GA 5ACZB 3ERXA 3HIZA 3K6FA 4CVUA 3T4AB 2MRYA 2GUYA 5MEOB 4A7SA 1I7ZB 2QLYA 4GRWB 1XGPB 2LHAA 4XTRD 1NQBA 1YMHA 2F54E 1JRHI 3MREB 4I77L 5D7IB 4ZUTA 1SBSL 1JDAA 4XPGH 4WFHD 3LZFH 3RWGB 1OL0A 3PP4L 2APTA 5IB2A 1K9TA 1RZGB 3DPBB 3T4AC 4ZMLA 3F6JA 3QXWA 2IQAB 3WL9B 1SDDB 1I8KB 1T4KB 3KPOB 3KW7A 3WNKA 3PNRB 1VGKA 2BNQE 4PRNB 2J55A 1DQIA 1PZ5A 3Q8EA 3IFPB 2CKBH 2FIKB 1XIWD 4H8UA 3APCA 2F1AA 4ZK8A 4GMTL 3WXWL 4XNUL 5ISZA 3DECA 4JFDA 5I75B 5MEPA 4R4FH 4HJGB 1R3KA 1CLOL 1MVUA 1XSOA 1XIWA 1UXSB 4XB7A 3TBSB 2IJ0C 5FXCH 3KEHA 2X4RB 1U8LA 3D05A 2J73A 1KZYA 4GH7B 2CWRA 2YK1H 3Q6FB 1A7BA 4MDJB 4AZ8A 5C0FB 3PAVA 4GQQA 2LAAA 2ZJSL 1PW3A 4R0LB 5CWSB 2ZYIA 5F0MB 1FPTL 1CE6B 1A8JH 1T1YB 2KLSA 1AE6L 4KHTL 4JCMA 2EDJA 5SV3A 3TBVB 5GS1B 1U8KA 2ZNWA 5IMLA 1P5VA 3K4DA 3IJ8A 1I8MB 3O6FB 3GO1H 3OGOE 4UTBL 3V9FA 1U8QB 2FEDD 1ZHLB 2D3LA 5ANME 2GT9A 4R0LC 3HLAB 3DVFA 5DR5L 4FQHA 1ETZB 3EYQC 1MFUA 5FV1L 1XVSA 5TE7L 2DD8H 4JZJC 4JKLA 1IEBB 1YEEH 3BSGA 5F9OH 1QQDB 4U6VH 4PS7A 1KGUA 2AJXL 2C4FT 1Y1DA 3LN9A 2OK0L 1AXSA 1EZVX 2ZOKB 3FB6B 4MXVF 1EEUA 4U33A 3D39E 1KXVA 3RY6C 4LE8A 4X0KA 4UQ3A 3AWFA 4N6QA 4PJ9B 5JW3H 2C1PB 2WTOA 4JUTA 4S10A 4PJGF 4MJIB 4KO6A 4DKEL 1WK0A 5CSZB 4AKPA 1J1XH 1ZXQA 3NCJL 2EE0A 2DWEB 3AUVA 4IHOB 1HCVA 1ND0B 5J1SC 2CHXA 1KNOB 1UJ3C 4ZMYA 2G60L 1NCNA 4PRIB 2BY1A 5EOTB 1DVFB 1N3NA 5D1ZI 3WG7B 2GBAA 2JIXD 2IDFA 3LKQA 1WD8A 2GAZA 2CGZA 3NFSL 1NGYA 2ZAGA 1XL6A 3MREA 5D7IA 3S5LB 2O6FA 5BQ7B 3AWEA 4EI5D 1BAGA 2YAFA 1EEYA 4B0MB 2GTWA 1YPZB 2F8IA 4OB5H 1OAYH 2ZWKA 3H9SD 3W37A 2E59A 2O5YL 4FQXB 5I6XB 3RZCA 5IEKA 4TQEL 3FB7A 1U8CB 3V52H 5EEZA 2UY6A 3CSFA 4PJHE 2IQAA 2HVKA 4AMKH 3O3UN 4L3CB 1QLEB 4LSUH 3SBWA 4E5XG 3IEAA 1KXHA 1PZ5B 3IGLA 5CZXD 2E9WA 1KACB 1FYTB 2H26B 3JUZA 4W4OA 1L6XA 4XX5A 5KZCD 4KJWD 3GD1C 3IETA 4JHWH 3H8NA 1NMBL 5F1NB 2YPLD 2BOLA 2ADIA 4YHNA 4XN1A 5IT2L 4RMQA 4PWGA 3SOTA 5FB8A 3DGCR 3KE0A 3OZ9H 1TXKA 2OSLA 1IAKB 1EANA 1OAXL 5DZPA 4ZS7H 4Q9QL 2YR3A 3VSQA 4GI9A 4DVBB 3ECVA 2XN9A 1A9BB 4UMSA 4IOFC 5E2TH 4MYWB 1AZRA 1ZVYA 1MHHA 4BM7A 1SOXA 4RMTA 4GKOA 5FYKL 1P69B 1THCA 3ARGB 2OSWA 1JXFA 5L0QC 2EEXA 4NYLB 4LIQH 2Z35B 1CZ8H 3CN3A 2IQ9H 3RB5A 1FO0H 3FCUB 3HPJB 4N2NA 5IMKB 3A4EA 2ZUQB 4P2RA 3VXRE 1WTGT 2DIAA 4UT6L 1MNUL 4DCQA 5I0ZA 2VL5B 3BKCH 3L3JA 2XSKA 4WWKC 3GI9L 4JDZB 3H54A 1QWNA 1HKLL 2QTVA 2BWQA 1MJUL 2LU7A 4UQ3B 3BAXA 4M43H 3IMVA 5HDBB 3WUWB 1F6LL 3TNNB 4AIZA 2Z8SA 4FP8H 1JE6A 2QSVA 1Q8MA 4J7RA 1AGFA 3FU9A 3GSNA 4JO4L 1FC1A 5LBSA 1CQYA 2OMWA 4M3JA 2Z34A 1WE5A 4PU2A 4XCNA 4GEIA 5ESAB 4W4OC 3SY0A 1NEZA 1HH9A 4AUYA 4WI8A 1QFWH 5FO9B 1M57B 4L18A 5AAPA 3CV5A 3T6VA 5CKGA 3MJGX 5DHEA 1E6JL 2ZSWA 5DVPA 5PAZA 2N59A 1WS8A 4LNRB 1ZKAA 2ESVB 4OIBA 3GXNA 2Q5BA 3KLKA 4N2FA 2F7RA 4MJIE 1ZTXH 1AHKA 3K2MC 4KXBA 3V7MA 4ZX3A 3EUUA 3QFJA 4GXVH 1X9LA 3QG7H 1G7IB 3ZDZE 4TRPH 4A2MA 4N9GA 2HJLB 3SODB 3HFFA 5EHFA 1T03L 4L3ED 5HI3C 1MN4A 3C6SB 4RAVB 4F7PB 4PGDA 1Q9KA 2APXA 2BHUA 2VDLB 1BFOB 4GKSB 3ULVD 5IF0B 3TT1H 3IYLW 4P8QA 5E8NB 3GBNL 4HAFA 2DI8A 3BJLA 4K23H 2HT4C 3KBEA 4GSUA 3SJVB 5CR1A 4NHUB 4HULB 1DEEA 3IJ9A 1J1XL 2ZCHH 4S1SH 4AKOA 1UA6L 4Y0GA 3POCA 4JY5H 3SE8L 1CB4A 3ESPA 3QH3A 3LRKA 4QRRE 3SHSA 4ZMXA 1RUAH 4JRXA 5IQNA 3REWA 1BXAA 4HUMB 4IBLT 4M5SA 1I9JL 4MQ7A 3FXIC 1BQKA 4MAYA 5GSRA 2XZCL 5HHVH 3CZEA 3DPDA 1ZS2A 4AQOA 1T7ZA 1Q72L 3C75A 1FJ1B 2V0AA 4PJEE 4UV7H 5DUBB 3HUJE 3EYFB 4RFNB 1J0YA 4BCZA 3SQBA 2CO7A 4ZW7A 3V0VB 4X5WA 1HI6A 4R97C 3Q2CA 5E1AB 4Z7AA 2J6WA 3MUGB 4DGWC 2H2SC 4HX1A 1MCOL 4HKXA 5BPPA 1LE5A 5CFAA 3HRPA 5FAAA 1KTDA 1DJXA 2DDQH 2WLIB 1Q90A 4NHCL 3TWYA 4AL8L 2CKBL 3K8LA 2AS5M 2QSTA 4P3CH 2VDPL 4UT6A 5DJCB 2CLVB 4U0QB 3FOMA 4NB7A 5L9DL 2V9QA 1CD0A 4A7TA 4XO9A 1VKXB 5DD5L 4A38A 5KVDL 5ICYB 1LK2B 3GJEB 3VGFA 2GTWB 5CM1A 4M6OL 1M05A 3C9NA 2I07B 3RL1A 1F4AA 2OMWB 5CJOH 5FGCE 2L3BA 2HVKB 4HLZG 4JCLA 1NEZB 1CGVA 2CDGB 4FCHA 2NR6D 4GP5B 2TRYA 5I1JL 2XVKA 3TIDB 4FNLL 2F68X 5IREA 1ZSHA 2I69A 5CZKA 3VXPA 5ADOL 3BX7C 1NJ9A 2ZPKL 1ACCA 3BUBA 1AFVH 3T6WA 3U7WL 2EXTA 5E2WL 5F1NA 1G87A 1FZKB 3O6FC 1CXIA 4S1DC 3ZL4H 3ZQXA 5DMYA 5J6HB 3MNMA 1O7SA 5CKAA 1IIKA 2AJUH 3ILPA 3IWUA 1DBJH 5AZ2H 5C9JA 3L95B 2CIIB 3FYIB 1UOWA 5CJXC 4ZFFA 1JAEA 4PY7B 1KTJA 4ZTEA 5A40E 1IL1B 1RURL 1FYHB 1JPFA 3ABLB 4NWUL 4PJGE 4XCCL 1SJHA 4H8WL 4RWYL 3PS6A 1I9IL 4CMHB 4JJOA 3SPGA 2YA0A 4ZG1A 5J6GB 4UT9A 1P4UA 4DVRL 5C2BH 5I2IB 1QPKA 3HR6A 2OMXA 2DV6A 4WO4A 1DJWA 3UJJH 2BSDA 3L3OB 3DO7A 2TSBA 4NHUA 5LVEA 2Z7YA 1O7DC 4MD4A 3L4WA 2YQBA 5HDBE 1KB5B 4NCC1 3Q5TA 5A6IA 4YH6A 2XV3A 4PTUA 5IVXF 4J39A 3BFQG 2FAUA 4GRWH 3SCMD 2KBGA 3AACA 2PPDA 3QO0A 2YAPA 2XN0A 1FFQA 2NY3C 2WQ8A 4PRHD 5JW5A 2ZOLB 4PPTA 3QEUA 4GUCA 3QEGH 3WCYA 4LEBA 3PWPD 3L3KB 4ODVL 3L08A 2O6PA 3MUJA 4JGNA 1FI8C 4F7EB 1DL7L 3X12A 2K6ZA 2PXYD 1KGCD 3B9DA 4EOWL 2FGWH 2BC4A 3JXAA 3SPVA 3RY4A 1CLVA 1NCDH 1VACA 2F8XC 3DBSA 4XVTH 1SQMA 2OTPA 3IKCA 4OUOA 1AGFB 3GSNB 1WBXA 3Q13A 3UTQB 4EN3B 4LRNH 2XLLA 5I30H 3NT0A 4IOIA 3N50A 4UOJA 4TLTA 2ZICA 1ZGLB 4N86A 4OGZA 4TS6A 4U1HB 2R2BB 1R24B 4UYPA 4YS4A 3G08B 5TDPB 3OKMA 1B4TA 2AABL 3V8CA 2BOCB 3VRLE 3ZKMD 3GMRA 4KVNH 4K8RD 2P7TB 4LU5L 2PPCA 2DW5A 4FAAB 1JK8B 1MRDH 2HRHA 4ORGA 1SN2A 1J8SA 1E5UI 5AW4B 1ESOA 5AWNL 3U0TB 1B9KA 3WFEH 4E9YA 4XNYH 4XMTA 2JK5A 5AVUB 2KC0A 3DBXA 1KLFB 1CFVH 4FLOA 4TNWF 4XMLL 4K3JL 2WMPA 5KAQF 1GL4B 2R69L 1OD7A 4XNXH 2YEVB 5DJ8A 1YRKA 1QLFA 3F5WB 2FT6A 3I6LD 1X5ZA 1R19A 2G2RA 1OP5K 4KK9D 5I66B 4CMMB 2NNRA 4NBZB 2E74C 2OR9H 2H9GB 3RKDC 4UOQA 3V4VH 1G7LA 3S4SG 5EV7A 2AKRA 4JAMA 2R29A 3Q01A 3BAIA 5I30L 5L2KB 1UT9A 3H6JA 2EDLA 2OS7A 5CWSA 4N3UA 3LSOA 4UUJB 4G42B 3X3GH 3B2DC 3EHBC 3FFCB 2FD6H 1ERNA 3D85A 3NACH 5FW7A 1WG3A 4KQ3H 4BUGA 1IMHC 1P2CB 2XXCB 2VLME 2BLFA 3NAAH 4ACPA 3J7HA 1HHIB 1D2PA 2FGWL 4MD5A 3CFQA 3JWOH 2LVCA 4HFWB 3GZPA 2C3VA 1BWWA 5B7EA 4HFUH 1LO5B 4NI6A 1BPLB 4QGYA 2BDNL 4MX7A 2CUIA 4GW1A 1S2EA 5JHDD 5I75C 2FB4L 3WUWG 4ZMQA 3RU8L 1VSCA 2WNWA 4R7XA 4P9ML 5KSUA 2B4CL 1D5XA 3ZL4L 5SWSB 1YNKL 3B9VA 3IMWA 4YDIL 1YNLH 1Z9SB 2UWEE 4W9FC 2QHRH 4TULL 3KPRE 1FLTX 4HEMA 4Y16C 4A2GA 2CIKA 1EVUA 1JK9B 4QF1A 4DTGL 2A6JA 2J1YA 3QXUA 4G9DA 5DHVH 3CDGA 5I15L 3SPVB 2GG1A 4GNKB 4MJID 1KDJA 3D87B 3T08A 2D7NA 5CEYB 2IDSA 4OJCA 2XFXA 1HWHB 1C5DB 3MCLL 4YDMA 2PWEA 3RWEB 1HINH 1UXMA 3HMWL 1FAIH 3EYQD 1HH6B 1CGXA 1XBDA 1ZSDA 4U0RC 4CADB 4XNXL 1QR1A 1RK0B 3PWJB 4PH8A 5EF1A 5E9DE 4HIIA 1KC5H 3IDIA 5ABZA 1Y6NR 5C97A 2P80D 5HYSG 2BM3A 5LXGL 3OAWA 1QO3A 5D2NE 1AGEB 4CNIB 2R2CA 1OLLA 2MNWA 4PJHA 4N1EA 5GISL 1JPEA 2ZWZA 5IVZB 4C59B 4X6FB 3KS0H 1UZ6E 1RUMH 4WWNA 4NQCD 2W94A 1QA9B 3IJEA 3LS4H 2VDRH 2D0GA 1FNGB 4RWYH 2WMPB 4D8PB 1V5JA 2AJZA 3S8GB 1L0QA 3DURA 5HYSA 2W59A 1M3IA 4BFJA 4HIHB 2WAHA 4WQOA 1EDQA 3V6ZA 3I6KB 2PPAA 1HOCB 2YBRA 4AMWA 4Z77B 4NJ9L 3VU2A 4F9LC 1NCBL 1E8ZA 4TUOB 2CJ3A 1FVCA 3MGOA 4D9LH 4RMSA 2N1KA 3ARXA 1IQWH 4G5AA 3ZZ1A 2YMXH 1VPOH 4AGMA 4YFLF 3L1FA 4YNYB 1OP3H 5BXFB 4CVWA 4KU1A 5ESVA 1EX0A 2FX9L 2E7LC 2DLHA 2VAAB 4U6XA 2EVHA 5HD8C 4XNUH 2OQJB 1U3ZA 1OM9A 4F7EA 1L9OA 4UIKL 1OE1A 1MFEH 3QARA 3HC3L 3O4LA 2IFFL 4EN2A 5LNDA 2ORBL 2HYMA 3BGAA 2FSDA 4UTAL 5FUCE 4O2CB 3L3JB 3H7BB 4P3DA 1KJ2L 3N44F 1LVEA 3RDTB 5K9OA 1JERA 2A9NL 4QY8A 5KSUB 2Z8RA 4OFIA 4QOKE 3MV01 4J3OG 5ICZB 1G7MB 1MKFA 4N28A 1KWKA 3B56A 2ICEC 4R4ND 4KKRA 2K9FB 3QUXC 4X7TA 4HK0A 1PSKH 4OCYH 3DJSA 4PY8J 4F5CA 1G94A 1XFPA 4JFQA 4LNVA 4OI8A 5LBGA 3RUGA 4O2EA 5HTSA 1WZLA 2VZ1A 5GS3A 1WFNA 4QO1A 1M3JA 2O30A 2P5PA 3V0WH 4HZAA 1XCTB 3QWNA 3NIFB 4KI5D 1D9KB 1QFWL 2Q87A 3R8BB 3SCMB 2VLKA 5AVYB 3T2PA 4IRZL 3A4FA 3GSXB 4QPEA 1HH9B 4ODSH 2IMMA 2NTFB 3OKOB 4LSTL 2ICWJ 3L3HB 4W9GC 3UBFA 4DOHB 1HH6A 1ZSDB 5ICUA 3QNXA 5D7LE 3PHOB 3DYOA 3KYNB 3PWJA 3NH7L 3E6FA 5FIEA 3FO1A 4E9QA 3MBEB 5ECJE 4WFFD 4L0ZA 3LAFA 1UB5B 2ZSVA 4C4KO 5EU5B 3MJ9H 3WUZA 4OZGB 3H9HA 1YJDL 4X98B 5LN8A 2J12B 1INDH 1DSFH 2A74B 3DETC 1CDBA 4JFUA 3QFJE 3AUWB 4ZSOA 3KWWB 3ATBA 3ZXAC 1KFAH 5J12C 2JV6A 4JEGB 2C9QA 2D03L 4Z76A 3LNEA 4MQXC 4CW1A 2NY3B 1VAHA 1PCXA 3V0DA 4UNVA 1EA9C 2G60H 5KEZA 3BPNC 2V5MA 3FUFA 1RD6A 4N2OA 4YFLI 4MNQA 1EAPB 3MBXH 4HSQA 5ICXB 4K7PL 3N41F 3D8MA 3HBZA 3JYBA 5D1QA 3BP7B 3NDZE 2YBRB 3LZFL 2GVYA 2DQ6A 4MD5B 1MCJA 4JJHA 3GBMH 2C4FU 4TQPA 2VZUA 1KN2L 3NMEA 1A7PH 2BRQA 5F1OB 4GSQA 2Y2WA 3QDME 4JRXE 4QEGA 4UM9A 3VFNB 2FJFB 5LN4A 3H42L 1BX2B 4HS6A 3RWFB 2CBPA 3ARDD 4DEPC 4ETYA 1XR8A 1H6TA 4H13C 1MLBA 4NWTL 4ELMB 3HRZC 4WJG3 1UD2A 2VDKL 4L1DA 1G6RB 5HHVL 43C9B 4KMQA 4M6MH 1WZAA 3MNVB 5BZXA 5BJTB 4WU5A 2ZOWA 4GQZA 3RDTA 3CC5B 4OLUL 1K6QL 3GYRA 1AY1H 1FAKT 2Y2TA 4EN3D 1E5AA 3ABMB 4KMTL 1G0DA 4JHBA 4HHGA 2N4IA 4L9LC 1R33A 4ELKB 1O5DT 4LVNB 1N2RA 4EN3C 1DBMH 1O9ZA 5F9WC 4M7LL 5BZDB 3UEQA 5T1DH 1RK0A 1PJWA 5I1IL 4N8CH 1CPUA 3KG5A 3GB7A 1TJHH 3D18B 2Q3XA 3ZY7A 1ZLSL 5T33H 4AE1A 4PWIA 5FYLD 4EF3A 1KTBA 1VPOL 4PRDA 3UTTB 5A6LA 2YUVA 1HSBB 2KPNA 2UZYA 4HWEH 3E2HC 3L3HA 1AHWB 4LQFH 3VI3F 4FXGC 5I28A 4RFNC 4UQBA 4B3EA 3PHOA 4ZPTB 3NIGF 2YD2A 3ESOA 3U7YL 2HMID 1OAUL 3GZKA 4Q0XL 2JJTC 1FZKA 5HGAB 3TU6A 4KZEL 1NCCH 1KIPA 2J43A 3ESUF 2C9XA 3ZE1E 5JR1H 3DXAB 5FHAL 3O9WB 2VXQA 3LXUX 3PHAA 2BZDA 2QSQA 1IGIH 2WWKT 5DZOA 4J3SA 2Z64C 4UOW1 4R84A 3U1PA 3EYUH 3S8WA 1YAIA 1CCZA 4XP1H 3OHXB 4PIRF 1Q9OB 2O61B 2K8MA 1IBZA 3PJSA 5DURB 2EDOA 4JMNA 4WY7L 4UU9A 1IVTA 3ARBC 3HOGA 3C09C 4H1LA 4PYGA 3UG5A 5D4IA 5E8PA 4XWGH 4H0HB 1HCZA 2JCCF 1F6FB 4QTHA 4CN6A 2R4SL 4WGKA 2Z93A 4LLVB 3AU1B 3K6SB 4RH4A 4HJGA 3VWKB 1W72B 4PRPA 3K6OA 4PJCA 2QKIC 3BAJA 4W9HC 3MRJB 1KYOJ 1SZNA 5HJDA 4X7CC 1JRHL 4XAWL 4WCYL 2FECI 2YPVA 3MRNA 4HH8A 1SYSA 1XR8B 4HXAH 5DDHB 5DVNA 1CD1B 2VR9A 1ZLWH 4HPYL 2V2WB 5GRWA 2Y07L 3ABGA 1B0GA 2W8CA 1RLWA 1BEYL 4HT1H 4JREB 4F7KA 1AI1L 2MCMA 3T0BA 4EIZC 5BS0D 3K4ZA 1FDLL 1U3JA 3NEXA 4Z8FH 4EI0A 1GHFL 1CDYA 2V3EA 4C47A 3QDMB 3GHBH 5INCB 4KVPA 1KXVC 5CHNA 4GYBA 3L5XH 3RVTD 4IOIB 1N2RB 3TVMA 5C08D 1JGUH 4PJ5E 5FV2A 2ATPB 1EMTH 1EFQA 1W15A 3I9GH 1X5HA 4JQIH 5DJ2A 1JGDB 1TVHB 2ZOKA 2V2TB 3VNZA 1NAKH 4OKDA 5AW6B 4H88H 1T5WB 1JYVA 1EO8H 4X98A 4F15C 3JSSA 2X05A 4AM0A 3WFCH 3NTCL 2PO6A 1P7HL 5AW7B 5J1TC 1Q9LA 3RNQB 3FMGH 5FS5A 1EV2E 5JPNB 2WVVA 2R2EB 1X7QA 1ZT4A 2YC1B 3BT0A 3FTVA 2WNGA 5G5DB 3ULVC 5T5FH 1JL8A 3BIKB 1ZRUA 1QMUA 5MERB 4OUUA 1EAPA 2ZAHA 5CGYC 3PAUA 3A0OA 3MRDB 4K3JH 4FFWD 4NQUA 5T3XD 4XE0A 3QPXL 4RMVA 3GBDA 1I7RB 4GG6A 2FWSA 3KXFD 3AT9A 3EDJA 2D7OA 3NIFE 2AI0H 2WWOA 5CS7A 1IRAY 4GSXA 2YMXL 3QYCA 1AC0A 1HCYA 3O3DA 1IGJA 2DQEH 3B2VH 4P2OB 3LIZH 3MFFB 5DZJA 3WHE1 1E7VA 4BFGA 5EZJA 4G71B 5ID1B 4IMLB 4RNRA 2VDMB 1YY8B 3EFOB 5D1XA 1ZVHA 2BDNH 1RZQA 3U30B 4UMGA 2WINB 3U2IA 4E9TA 3MRJA 4LP8A 5BVPH 4KPHL 1VFBB 1WFMA 4NIKB 1T1WB 2QELA 2WBJB 3RIFK 4NRYA 4KXAA 4QOKD 4QWWC 1GOFA 1LQBC 4FXGB 4X50A 5E4OA 2RIKA 3RPKA 3ZE0F 1TSRA 4L4TA 2BFVL 2ICEA 3ULSA 2VN4A 4OU3A 3KPRA 2P5EB 5E1IA 1NLDH 1ACYH 1KBGH 1KPRA 2AFNA 3ARGA 1RMFH 1F42A 2FWOA 4WDIB 5I1HH 1VFAB 3T8XA 4BH8B 5K93A 3QRGH 2FDBP 2UWEB 4MNHB 3DIDA 4P9MH 2WY3B 4F37K 5IB1A 3VI4A 3SCMC 1I1YB 3Q9QA 2ZCKH 4FFZL 3S7GA 4L4VA 4NQSA 4M6NL 3WN5B 4ONFL 3CNKA 3VFVA 2A6IA 4NO3A 3ARDB 3WAJA 1CF8L 4XO3A 1RV6X 2V2TA 1GZHA 2DQJL 2VB5A 2P8PA 2XYBA 4ZFGL 1H6FA 3O9WA 2EIMB 5D7JD 4N2BA 4Z7UB 1IM3A 4TVUA 2AXWA 5D2NA 1INEH 3EO9L 4WVRA 2YLKA 2JWYA 1X4XA 4UNIA 2EE9A 5E4IA 5JZ7D 4GEJA 4CSPA 5E6SB 2OZNA 5J12B 3EBGA 2XQBL 5DS2A 4RGNE 5E08L 4XPTH 5AZEL 5IJVB 1PMYA 4L8DB 3VFUB 1YJDC 4DKAA 3ZE2F 1BEYH 3QG6A 2LLNA 1HDMB 2CJUL 3ZW3A 5CJ5A 2QPEB 5FOBA 5T5NF 2C3WA 1H3PH 4DSYA 2JCCA 4HCFA 5TD4A 3BGMB 4EVNB 3MJ6A 3U4BH 4AVIA 4LLWA 3OVUB 3ZDYE 1CYWA 3BH9A 4YE0A 1MUJB 5TE6H 1NBZB 3VMNA 4ESKA 4ERSH 3T6ZA 3MJ7B 5D6DC 2YD3A 3IDGB 2Z1PA 1WAAE 4LGRB 4DZBA 5C0IA 5CZVL 2R2HA 4AW7A 3GSUB 4IDLA 4MS6A 1GGCH 4JGMA 3S36H 2HB0A 3V4PA 4GBXD 3HRZA 4RSYA 4X7SL 4XTRC 4POYA 3TF4A 2E6PA 1ZPLA 3B5GA 4RIRB 5HHOA 2BSEA 5DCCA 2GSIA 4AEHL 1W0VA 4PLOB 3FQYA 1F58H 2WWKO 5HPMB 1JCVA 3DV6A 3P30L 1A3LL 3HZVB 3IPEA 3LZLA 3B9EA 4UB0H 4ZO9A 1H8LA 9CGTA 3CUPA 3V0JA 2I26N 2DQJH 2P5EA 1ZEAL 1QBAA 4EOWH 2M2DA 3U4BL 1GIGH 3ZPDA 3BLPX 3CZJA 4F2FA 1DQVA 1QFUL 2JMRA 3RBSA 4FFTA 1M7IB 5K9JL 3KNBA 3VFMA 2EUVA 3LRSA 4QRPB 1F1DA 1KZQA 2ZNXA 2YUWA 3OKKA 3VDBA 3P77B 3A23A 4MHHG 4AOFA 4GAJL 1T22B 4XXDA 1ZA3A 3S4SB 1CTOA 4G8AC 1PZCA 1UA7A 3OQ3B 1SXAA 2DJUA 2FATH 3QQDB 2GI7A 2IMNA 4P23B 4OJDH 4FMFA 5E4AA 1IT9H 2FBJH 4KKNA 1CZ8L 5MENE 1MJ8L 5MERA 3FDWA 4LLDB 4X6BA 4ZUTB 1A4AA 4Y1AE 4PSPA 5JZ7C 5DMGD 4IKNA 3D2UA 1LK2A 4LCWE 1E4XI 4H8VA 4M7KL 1H19A 2YQ2A 1M7XA 1AG6A 4AIXA 4I1PA 1VZGA 1G9MC 2O6EA 1CGSL 1YAZA 1RZ7H 4X5LA 5GRUH 2EXSA 3VD7A 1I8KA 1T4KA 2PWDA 3KPOA 5L2JB 3EHBD 1W6WA 3PL6B 4QRTA 2HWZH 2E27L 2H41A 4YSCA 2WXRA 5EZLA 3MV9B 3VG0H 2VDNL 2DQEL 2R9HD 3EJJX 2J56A 3F7LA 3NZ8B 4BHUI 5A2CA 4NZUL 1LDSA 5DD3H 3CXHJ 3U6RA 1QR4A 1NBZA 4IBWA 4U0RB 1A4JB 1F11A 3H42H 4PS4L 3CJJA 2FJFA 1BX2A 4POZC 4MDJA 4AZ8B 4OY9A 2XXGA 5IW3A 4U6YA 4Z7VA 2E46A 2A1WH 3O2VH 5MP6H 2A9CA 3BLBA 3CSYA 3UTZA 3PIQB 2GITB 3MLYH 1KGCE 3TBVA 1OARL 2WXMA 5F1IB 2HX8A 1RUKH 2BJMH 1PIGA 4XNDA 1TKWA 1ZLEA 3NFPB 5HDQL 1F90L 3MYJA 4DHLA 2D3NA 3TEXA 1UOLA 3ELQA 2EINB 2CO1A 3MV9E 4RMRA 5IFJB 4JQXA 4ZAKA 5AVXB 3VFGL 5IKCB 4CVXB 1U8MA 5H94B 1I8IB 2YS4A 2A6IB 4NQXA 2GBVA 2YD8A 4KO7A 1HXMA 3HG2A 1UACL 1M7IA 2NQ3A 4WK0B 4A68A 1L9PA 4X0KB 4Z7NB 4WV1C 3CSGA 4XODA 2JTYA 2DLTA 1QBLH 1S9YA 1LE9A 4JJ5B 3LQAC 4A2DA 2A4CA 3D0VA 3JWNH 4P4KA 5ECGA 3QQDA 2ZCZA 4NZJA 1A6UL 4C54A 3SGDI 2L7QA 3BWSA 4P2QB 4AY0A 5T1KB 2UZXB 5HYQA 3VWJD 3UTQA 4IIQB 3NN8A 3QORB 1FWXA 1BOGA 4YQXL 5KW9H 4ZW5A 2IBGA 1S4IA 4RFOL 2RTTA 5DQJB 4Q56A 4KKAC 1YNTB 3CU7A 1RQ5A 5FYJD 3VWJC 1CURA 1NAMH 2NY5H 2J8UE 3VMOA 4KPHH 3OR7A 5IEHB 3UEZA 1J8HD 1MUJA 1FN4A 2CCLA 4GUPB 4Y5YA 1TT6A 5BVJA 1BFTA 4Y4HC 5L2JA 4XNMB 2OMTA 3PV6B 3IDGA 4WI6A 3LOWA 4NN5C 2CLRA 1QD0A 1JWSB 1XMWA 2QMKA 5A2LH 25C8L 4J3OD 5C92A 1DJZA 3AQXA 3F7VB 1J0HA 4BKSC 1PQZB 3PHSA 4DN3H 4P5KB 5AAMC 3P4MB 1DQQB 5CJOL 3SE6A 1O7VA 1GCYA 2IAMD 3G9AB 3HCVB 2EIEA 3V0AC 3FO2B 2Z92B 1YEJL 4V11A 4R2GB 3OLDA 2DOCA 1DJHA 3BAWA 5I5RA 4B9GA 1XF2B 1WC7A 2Q6WB 1CD1A 3HG4A 3JWNE 3FKUS 3OJVC 3F00A 2CU9A 5LGHL 5IBLC 3FFCA 3TV3H 2UUDK 4G7SB 4L1HA 4F92B 2C7UB 1FO0A 4Y5VB 1C08B 5KYNA 1FNAA 1FVEA 2YQGA 4CBZA 4TNVF 3VFMB 4NRZA 4NEHB 3TBTA 2GJ6B 3DI2B 3M8OL 1AI1H 1LO2L 2IC2A 4EZMA 4OR1A 1PG7W 3OPZL 4Y4HA 1FIGH 3QO1A 1WAAF 4Q52A 3UADA 2BSED 2CRZA 1HXMB 2HTKC 2I25N 2FYVA 5PCYA 2NCMA 3WIFA 3MRRA 4JDTH 1SHWA 2JFCA 3DTDA 3WFHB 3RWCA 5ITFA 4Y8AA 1CFBA 4BXVA 3ESNA 3LH2L 5KAQG 1E9PA 1L6ZA 2Y23A 3QG7L 3IDYB 4NCC2 4XXCA 2HTKD 2IOOA 4LLDA 5FO8A 4UM8B 3GGWA 3EXJA 3QDGD 3ZE2B 4PB0L 3N43B 5D71H 3FQ4A 3U9UB 4OLUH 4UQ9A 3KGTA 2DBJA 4KRLB 4KFMA 4L3EE 3RVTC 3US1A 3GBNH 4KITB 1OAKL 3G04B 1QI4A 2ZX5A 2COQA 3FUKA 4LKXB 1NCWH 2EYRA 2YGVA 2AQSA 3OSKA 2OZ4A 2WCPA 1HYRC 3HZKA 1K3IA 2VXSH 1A7RH 2XV0A 4OZFB 1AZZC 2Z7ZA 5DYOA 1FZJA 4L2YA 3NIDB 4NP9A 4PJAA 3WL9A 1QSED 5C0BE 4NKOA 1J5OH 1AC6A 1GKOA 2IBZX 1U33A 4FQXD 4JCWA 4KZ0A 2PYEA 4NQDE 1OHQA 5CJ8A 5DVLA 3T04D 3C6SA 2WKGA 4RAVA 5IP4A 3WIHA 4AENB 1BFOA 4GKSA 3RIKA 2VDQH 1KIRA 1TQCB 2QT6A 4OJAA 3ILQD 4E5XB 3PIQA 3O6KL 3N6YA 4KTDL 2XQYA 4C56A 5F9OL 4Z95L 2ITFA 4MAUH 4P5MA 2VSDA 2Z8VC 1G7PB 3CLWA 1DQJA 4GAFB 4YO0A 1HKFA 3O9WC 3TH2T 2FNBA 4NJAH 1U4EA 2HJKA 3B9KB 4FP8L 4KHTH 5I8CB 1NC2D 2GYSA 5G4MA 5SX4I 2Q2EB 3L4TA 4NUMA 1AZUA 1A9EA 4OZGE 2IEPA 1J18A 4LSPH 3LH2H 3L5IA 1UZ8A 1C08A 2WKOA 4ZOBA 3KPRD 2OXHA 3O2DA 2Y24A 3S35X 1CDIA 2ZWLT 3EYFA 5B3SB 1AIFA 5HGGS 1RU9L 1A7QL 4OFVA 4W68A 3QZNA 4JKKA 4X6DB 2WKLA 3W9DA 3HA0A 4J8RB 4UILH 5JHDE 2QQNH 1RJLB 5D1XC 2EIZA 2W0KA 5DRWB 2X6CA 1CL7I 4EIBA 3LEXA 4YUEH 5D6DA 4QRSB 5JW4Q 1NLBH 1FH5L 2AVFA 2PWFA 3DVIA 4H2CA 3WJLC 2CCWA 4N6RB 3NCEB 2O1AA 3R19A 4PM1A 2A73A 4LBEB 3DARA 4U6TA 5DEJA 1IM3B 5AUMA 2CHNA 1YMHB 2HKHL 4RWHA 4MZ3A 5EUOF 5B39B 2A3TA 3O41A 5AB9A 1J9CT 2XWDA 2NY5L 3VH8B 1SN0A 2P28B 3K2IA 1IFHL 4L48A 3RI5K 4R90L 1RZGA 1KYUA 2X6MA 1KJ3L 2WP3O 2NY2D 2MTAA 3EYOB 3K72A 5HJGA 4IHBA 4MNGB 3TBCA 3CN1A 5ELIA 4XAKD 3W5MA 1IKFH 3OB0H 1MG2C 3DOIA 5EU5A 2X1PA 2CZNA 2BIHA 1KBKA 4KXCA 1M2VA 3RAJL 3D6GA 4DNLA 1HL4A 4JHZA 5AEAA 1RK1B 2UV3A 7CGTA 4F8PA 5CD3B 3OJDA 4O00A 4QXUL 3RJQB 4JR9L 1O6SB 2EDWA 4PS8A 4JDTL 1FYTA 2CE6A 2DM7A 1PX4A 2WIMA 1KTKE 4LMQI 1FG2B 3AY4A 1O6TA 4I48A 4PWEA 1MNNA 1SPDA 2DD8L 2JVUA 2CMRH 3HPLB 1UUNA 4Q9BA 4WLCA 4A66A 2GIMA 3S88L 3RTQD 1IAKA 3SD5A 3UP6A 2OI9B 4LESA 3LHPL 1DSFL 3RVWC 1G9HA 1QLRB 2XHNA 3VXUB 1T04B 5SWSD 5I6OA 3FCTB 4MXVE 5E8EA 3QNFA 2OM5A 1KOAA 2D8KA 2GEQA 1OHZA 1U93A 1SEBA 1ZTMA 4YSRA 4HOXA 1JWMA 1OWRM 1SBBA 1SGKA 2JKSA 5DT1L 2BNRA 3VXSE 5KOVC 3X14A 1QI5A 5IHHA 4GSRA 5DHVA 1UACH 2Z35A 2FEEL 4DQOL 2ITEA 4FNLH 1OCWH 4PGJA 3PWPE 4PLNC 3BPCA 4PJ9A 4NP4H 3IE9A 3FT1A 4E2OA 5JXEC 5IMKA 5J13B 1U92B 1RUML 1CI3M 2BC4B 1A0QL 3NSJA 4P06A 1A6UH 1NCUA 3UYPA 2YXFA 3CSTA 3UX9B 1NCOA 4PRIA 5E6UB 3UYRH 1NIFA 2PKDA 4LKXA 2AAVA 1I9RH 2SEBA 1TJIH 3MR9A 3B6SA 1W16A 3C12A 3GMNB 2EXWC 4EKXA 3IRCA 3C6LA 4WI7A 3UJIL 3EH3B 4UQCA 1MIMH 4XH2A 2JELL 4MASA 4I0PB 4XPGL 1I3GH 1JNHA 2QTEA 4PRAB 5D2LF 3RIAK 3SO3C 1ETA1 4OCNC 2EE3A 1CFNA 1NCIA 3CQFA 4N2KA 3VXSD 5LJYH 3FTWA 1GS6X 2ZSWB 4QKXB 1PLGH 3VE0A 1CYGA 3MACL 5TDNB 5F7HA 3DX7A 5DJ6B 2EEFA 4GI6A 4ZRGA 3ARFD 5DC4B 3D39B 3FT4B 4U1IB 4E5XA 1QLFB 3F5WA 3DUHA 4OGQC 2BMKB 1MFCL 3UZEA 1R3IL 1RVFH 5IB3A 3QW9A 1MELA 2BS71 1EAOA 2F18A 3NA9L 2KLRA 1R3JA 4Z7WB 3BPNB 3WY3A 3W1ZA 1A22B 1IO4C 4XPTL 4I48B 1S3KL 3IBOA 2AMGA 3N41B 3MODH 4QXWA 5IBTH 4BSWB 5DD3L 1X5YA 2VL4A 4FZEL 3HMXA 5B8CC 4ZX4A 5DFWH 1GOHA 3IDYC 5JXEA 4NENB 1CDUA 2J5WA 4RDQG 4ZUSB 5C8JB 2XVLA 3PPEA 1GGIH 3AU1A 3VWKC 1T04A 2OCJA 3W9DB 5EEYA 1WCQA 1JZ2A 2C9RA 4KVNL </