1U3HA

Crystal structure of mouse tcr 172.10 complexed with mhc class ii i-au molecule at 2.4 a
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
110
structure length
110
Chain Sequence
QVRQSPQSLTVWEGETAILNCSYENSAFDYFPWYQQFPGEGPALLISILSVSDKKEDGRFTIFFNKREKKLSLHIADSQPGDSATYFCAASANSGTYQRFGTGTKLQVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
publication title Structure of an autoimmune T cell receptor complexed with class II peptide-MHC: insights into MHC bias and antigen specificity
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 110
sequence length 110
chains with identical sequence E
ec nomenclature
pdb deposition date 2004-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1u3hA00
5I71B 1I8MB 3D5OF 3MJ8A 5CJXA 3V6ZA 3W0WE 2YA1A 2IADA 1AR2A 1QRNE 3FN0H 3IFNL 1L7TH 3WLWC 3ZE2F 1CFVH 2FBOJ 1F4HA 4WO4B 1T1XA 1X6NA 4XCYB 1P1ZB 3TO2A 4WTZA 2AV7A 5C0GA 3RWEA 2VUOA 3MOBL 3PABA 4JY4B 5IK3A 3VE0A 5I1DB 4LSPH 2UWEE 5E94A 4NHCL 3ZL4H 2P24A 3LDBC 4N90D 3VXSE 2HRPL 1ZHBA 4PBVC 3VXUE 5D6DC 1A6VL 3Q3GA 2EH7H 1GHFL 3MLWH 1QNZH 4JPIB 1IM9A 1ZHLB 3GSRB 1KPVB 4PRAA 2W9DL 4WEMB 3J7HA 2OMBA 4U1IA 5ISZE 3K8LA 2A6DB 2DI7A 1KTDA 1T21A 2EDNA 3GK8H 5DYOB 4KQ4H 5EU5A 3KS0J 1RZ7H 4YHZH 3MRCA 2AEIT 3SKJL 4U2YA 1D5BA 5ICXB 1NFDF 2COQA 3RKPA 5IJKC 1N5AA 1EEUA 5H94A 5SX4I 4NQED 5EN2B 3QBTB 5EUOA 3HLAB 3EYOB 1QPPA 4UUJA 3QIWD 4LSVH 3QAZC 2UY7A 3PV6A 4K94H 4UAOC 1WFTA 3QJFB 4OUUB 1TXKA 4Z0BH 5AZ2H 3WXWH 4AQ1B 3F58L 1XH3B 1F8TH 3QULA 5TDNB 1EHXA 1AC0A 3B83A 3KLHC 2E8ZA 4GBXD 1KCSL 5D2NE 4X80L 3IXTA 4AMKL 1BFSA 3NFNA 4EDWH 2GK0A 2D3VA 5IHZA 1CWVA 3O4LD 1NGQL 4MXVF 3DMMA 4OB5H 1HZHH 3VRIB 2EDRA 1MJUH 4B50A 5DQDH 5IGXH 3S37H 1FE8L 2QQKH 4I77L 4F2MB 2VXUL 4NN5B 4KJQD 2HFGH 2EYRA 4IRSC 2RBLA 1GCFA 2F58H 4XWOC 2FYYA 5IW3A 4M93B 4QHMA 5GZOC 4XMKL 4JFFE 5I6XC 2K3TA 1UVQB 1SY6A 1KIPA 3MRLB 3GEWB 4PJIF 3X14A 3SOBH 3MRQB 3MFFB 4AK1A 2AJYL 2DF3A 3SGDH 4PUBL 1IEHA 4L3EE 4BQBA 4PJ7F 3WFHB 4Q9BA 1P7KA 1CLZL 4PTTA 4HIEA 4I0PD 5BS0D 5DFWH 3H8NA 4FZ8H 3MLTB 2F53B 4FTVA 3TN0B 4HZLB 3H7BA 3W39B 4BFIB 4KRMB 2FNBA 3W82A 2ZG3A 1CF8L 2GUOA 1FL5A 1F4YH 1YNLH 3RAJL 1RIHL 1CXFA 5TGBA 4FQ2H 2IAMC 2ZOKA 2DQTH 4WV1A 1JZ6A 3IF1B 5EOCH 4EUPA 2Z31A 4JVUA 2HT3D 3SE8H 3NCFB 2ADGB 1MCWW 2RR3A 4HWZB 4KK8D 5CINH 2OX5A 2P8LB 3O3BA 1MJ8H 1FDLH 4M1CD 2VLRA 3LV3A 1LO0L 3V4UL 2VSDA 2R0ZH 1K85A 3WFEH 3UTTE 3NACL 3DX9A 2IALA 3PWUA 2W1NA 3KPRB 4QY8A 4P5TC 2XWBA 3GMNA 2CRYA 3OF6A 5KSAB 2R1WB 2OTWB 4PV9A 3OKNA 3GDBA 3ZTNH 1DCLA 3QUZA 1IAII 3CSBA 2BVYA 4TSBH 3LKQB 4M1GL 5T5FL 3GGWB 2DMBA 1IEAB 3QEQD 4NRZB 4GG6A 2A73B 4FFYL 3WD5L 4FQIH 4U3CA 1AXSB 3ZDZF 3PIQA 5E8OB 2EXWD 5F96H 4Y2OA 3IFNH 1K9TA 3MV9D 3MRPA 4PRPB 2OSLA 1Y6MR 3GSUB 4LGSB 2Z35B 3TZVD 3M17A 1JZ7A 1HI6B 4UNUA 5FYKL 3MOBH 2NY7L 5D72L 4Y2DB 4QYOB 5D1QD 3V6OA 3QRFM 4PGBA 2PO6C 5J13C 1A7PL 2BJML 1F58L 4KFZC 2YA2A 4UI2A 5IFAH 2E7CA 5J11B 2GTZA 4IS6B 3EHBD 1AY1L 1KCRL 2ZPKH 2E27L 4L4TA 1FZJA 3P73B 5DZLA 3M45A 1QLFB 4WI2A 2JCCF 1LK3L 2MPAL 4I18B 1KCUL 1A1NA 4P2RA 1YJDH 3RRQA 3GFUA 3TBVA 3DROA 3C6LA 4NKMB 4ZAKC 5T1KA 4GW1B 1R3KA 4AQOA 3JSSA 2CMRL 3LMJH 3SKJH 5MEND 1ZT4B 5JHDE 3TPUB 4LDEB 2EYSA 2AK4B 3QA3B 5D71L 3BKML 4LKXB 2DQIL 2IG2L 5HI3C 4E41B 2IWGA 1UZ8A 2YC1B 1NL0L 3P4LA 4BQ9A 1YEGH 1RUQL 3MLYH 3MUGB 4JREC 1H3VA 3DVGB 4MHHI 2CK2A 1SJHA 4ZFOL 3I75B 2W92A 1RUAH 3BYYA 4P57A 5T33L 1EHNA 2XZCH 4XXCC 5I18L 2GFBB 2CRMA 3MRRB 1I7TB 1XGPB 1Y18A 5F7NC 3H9SD 2VSCA 4PYHA 1YYMH 3CFJB 2FJHB 1XR9A 1MREH 4HCRH 4UIKL 3P9LB 4ZFGL 4XPGL 1HQRA 4Y4HB 1FAKT 5DJYB 3TO4B 1A47A 1NLBL 3D0LB 3OHXA 5F9JA 4Y1AE 3HNTH 3P0YL 1PKQB 4LHUA 2B1HH 4WUUD 5EU6A 4OCSH 2YUXA 5L9DL 3SO3C 1NGQH 1H3UA 4FXGB 3WLWD 3U1SH 1CL7H 5CD5C 4WI6A 5C3TA 1L0QA 4JZOB 1JGLL 3MNWA 5GIRB 1II4E 1PZ5B 4OCRL 4XBEL 2YZ8A 3SN6N 5KSBE 5A1AA 4NO3B 4O51B 1R3LA 3RWIB 1V7NH 1VB9A 5GS1A 1PY9A 1F6FB 2IQAA 2J2ZA 3SDAB 2VAJA 3QWRD 1OCWH 3WHXA 2B0SH 4Y4FA 5ADPL 5KVMC 1AHWB 2JK5B 1N0LA 1I3UA 4XCNA 1VGEH 5JW5B 4Y5YA 1S7TA 1T20A 3X11A 4OI9A 2D31A 4KI5F 1FC1A 3U4AA 2N56A 2Q7NA 4KHTL 3X13B 1R0AL 1WTGT 2WWMC 1AXIB 4KDTA 4M7ZB 5KJRH 4Z7UF 3PHSA 5I9QB 4ZOBA 5DQJA 3FQXB 2H9GB 1MWAL 4O4YH 4JFZH 4ODUA 4EIZC 3BKYL 2Y9RT 1C16A 4RX4A 4XPTH 3ULVL 4MQTB 5JOPD 2X10A 2J88H 1CE6A 2YXFA 4LIQE 3QHTC 5LGHH 2EDXA 2PXYD 2R23B 4JN2B 3WIIL 5DEGA 1LEIB 1QO3A 3WFDH 5HXMA 3OL2A 3QPQC 1KGCE 5IEKB 3KLHD 1ZA6B 2X09A 4AG4L 1FNSL 3V5DA 4D9RE 4PJXF 5DTFB 3H9HB 5B39G 2OR9L 4HUUA 3S7GA 3T3PE 2E6JA 2V2TA 3G6JA 1FO0L 2A1WH 3C2AL 3CMOH 3MACL 4GW5A 1H15A 4RQQA 4CVZB 2QR0A 2A9MH 4IRSD 3CFCL 3T4AA 4XWOD 2VL5B 5DUBA 4X4YB 4HUMB 5HHPB 1J10A 4NPYA 5ALCL 5DC9B 3IRZA 3CZJA 5ENWA 4JKLA 5FYKH 2NY7H 5D72H 4AENA 1T89A 2VLKA 3OAZH 5I8CA 5CFHA 4XMLL 1U93A 5D9SB 2YMXH 1OSZB 1UADC 1A6UL 3C5ZC 2Q1EA 2AQ3A 2E27H 5JPMB 3BI9X 4BH8A 2PKDA 2FO4B 2VZOA 2YSSA 1CICA 3VXRE 5EU4A 5JQHC 2MPAH 1KCUH 5E95B 2IAMD 2OCFD 1OGAE 4KMLB 3ZSSA 4E42A 3FZUC 3BGMB 1OGTA 4HJGB 2CMRH 5JDSB 1IAMA 3GMMB 1PSKH 4NFBA 5D71H 1CFNA 1MCLA 3VFWA 5HGDA 1NC4A 4G6KL 3ROOA 4HUKB 5IB4A 2DQIH 2IG2H 3MGAA 5FYJD 4EI6A 5F3HA 4OGYH 4K07A 5DMIL 5F7YC 2X4SB 5E00B 3ARGA 4OM1L 1C5BL 5E2UL 3MRKB 2CXGA 4LEOB 1MPAL 4WTWA 4P5TD 1JHLL 4PJ5A 5B39B 2EDKA 4QTHB 3PWPA 5I18H 3RZCB 2VLJA 3PQYD 4L3AA 4N0RA 3RHWF 1J0HA 4C56B 3T0WA 1N5YL 5IHUH 4ZFGH 2GIYA 4UIKH 3U36A 3FTGA 4K7PY 4QGTA 2XQYG 5A2KH 1NLBH 1NPUA 4J3XA 5IVZB 4LCIH 4XMPL 3FN9A 3L7EB 2XA8L 1JHKH 2F8OA 1NFDA 1FPTL 4OF0A 2R1YB 4FQXD 5GGQH 1KB9J 3PWLB 1JGLH 5FB8B 4FZEH 3NVQA 1YEHH 1NCUA 3DV4B 2V5YA 4XBEH 5EOTA 5JLZB 3KYMA 3AREC 2ERJB 4U1NB 4XHJC 2B8OT 4P3CH 1FNLA 3ROLB 2BY3A 1OAXL 3VXQA 3BGFC 4TSAH 2PO6D 5H35B 4PD4J 4PRBA 2I9TB 1YECL 5GQBA 3QCVH 4NCDA 1KB5L 4C58B 1ZA3B 4L9LB 4ZPTA 1MHCB 4W6WB 1HNFA 5DMYA 4YGVB 3QFDB 1OARL 3K0WA 3KNBB 3W0WB 4DOHE 2AABL 4QRUA 1C08A 3RNKA 1WVZA 4G6JH 3H7LA 4HCRA 5JW4Q 4QRPD 2ID5A 3EOBB 1MCFA 3N50A 4YIQB 3T2NH 4F9LC 1KPRA 4ZAKD 1Z3GL 4XXDA 4W6XB 3QIBB 2A83B 1OTSC 2OJZL 1DVFA 5H2BB 5GJTH 2B2XL 2APTA 4POZC 2UWEB 5IR1B 4EI5C 5HI3D 2EICA 1F3DJ 2ZG1A 4R3SB 1A1MA 2X4UA 3QO0A 4G9FB 5BXFB 3G5YA 1JNLH 3GBNL 1A4KB 4IHOA 4KRPB 4FXKB 4UOJA 1XIWB 4PGDB 3P4OB 1MUJB 3JWNC 3PXHA 4PJIA 5DJ6A 5E7FA 3JUZA 1T0NA 3WS6A 3V8OA 2D9QB 4RAHA 1A7RL 3KS0H 3LEXB 1EAPA 3BWAA 4PJ7A 1YEIL 3JWOL 1YMMB 4LNRA 2NY1B 5CBAA 3BGAA 1P9MA 1QLRB 5FO8B 5EUOE 3IGAA 3FT3A 1FNSH 1WC7B 1HSBB 1L9MA 3IJHA 4GS7B 1XF5B 3ZYJA 5SV4A 4UB0L 4L8SA 1G6RH 2O61A 1YEJL 4HEPG 1Q94B 4DGYL 5CD5D 2NPLX 4G8FA 2NNAB 5C0FB 2QSTA 4NN7B 1X5JA 3MJ9A 3X17A 2ADIB 5FGCB 4PJBB 3B5GA 3I6KB 1EVUA 2WAHA 3EYUH 4OZGF 4MXWL 2W60A 1T3FB 5F7EL 5JUEL 4P9HL 4H88L 1F3JB 1TQCC 2CPCA 1HQ4B 2IMNA 2Y25A 2R2EB 2E7LA 1S7WB 3OKLA 3MOAL 4R7DB 1D5XB 2BCKB 4NWUL 2E7HA 3T8XB 1FFRA 2Q87A 5C6PB 1A6UH 2OZ4L 4RAUA 4P3DB 1U6AH 5ACZB 4XB7A 4YFEA 3E6HB 2A77H 1YPZA 4LLQA 3JTSB 4EIGB 1U8LB 1P2CB 1JPST 3S35L 2WWMD 5J89A 5L2KA 4JN1L 5H37H 5C0AB 3P30L 3ULVC 2ZCLH 2BVOB 5CSZB 2CKBL 4NT6A 5F7HA 1ETZB 1KN2L 1WFNA 4FTVE 1U92B 3QEGH 4NQXA 4LLUB 3HZYA 2IF7A 3GI8L 3WHE1 2KUTA 3MA9H 4QHUA 2QQNL 4DKDC 1KULA 4XP1L 5DMIH 2LV4A 2EDYA 4U1HB 1BMGA 1KCLA 1A4JA 4Y89A 3O3AA 5E2UH 1Q9KA 4HIIB 5FUZL 4U7SA 3RNQA 1MY5A 1A3RL 4G43B 3MRDA 3QPQD 3MBEA 3B9KB 1J8KA 3BPNC 2JCCA 3DRQA 5F70A 3IJYA 2CRIA 3HE6A 5CEZE 2VLRE 4M7LT 1NGZB 1N5YH 4WWKB 5MEQA 4CVWA 2CJUL 1A1OB 4H8WL 4YAQB 3GO1L 1MFDH 5FM5O 1RJLB 5C0BA 3TA3B 4Z7OF 1ZWIB 1H3PL 1A6WH 4QXGL 2WW8A 2A6JB 1JYXA 3MV11 3UTTB 1UXSB 4F9PA 3E6FB 4FABL 3D6GA 4G42A 1ZANH 3OGOE 4ELMF 4FFZH 3TNNA 4GAJL 4OJFH 4GG6E 1A7NH 3VXSD 3B6SB 3BP5B 1DQLL 1LGVA 4LNVA 3MO1A 4CU7A 3GIZL 3IJSA 3BQUC 4B7LA 3PP3K 5J9PB 1YECH 3IT8D 5DD6B 1Q9OA 5C71A 1HILA 3L95B 3O45A 4UILL 1XAUA 2B20A 1JGUH 2Q76A 1XCTB 3EGSB 3C5ZD 4XPAH 4L29A 4UQ3B 4A2MA 3ARPA 2M8XA 1BJ1H 1GGYA 4GXUN 5SX4H 4NO2B 1KELL 3MBXH 1K2DB 1E4XL 12E8H 3MXVL 4NNYA 5DSCA 3V6OE 3W2DL 2XFXA 3ZKXB 3W9DB 2NMSA 1S5HB 5HBBA 5HYJB 3P40A 2DYPD 3VFUA 1KNOA 2WBKA 2Y1VA 3FB6B 1W2KT 4RZCB 1E6OL 3TT1L 5DK0B 1DUZB 3BMVA 3VXNA 4HPYL 4P2RE 4PIRF 2K7QA 2BHYA 5TQ2L 2NTFB 3GBNH 3FRPA 3GMRB 1VDGA 1JGVH 1WBYA 1H5BC 4KV5E 4L8CA 4TULL 5IFHL 1D6EB 1E4KA 3OJDB 4AYFA 4HULB 5KVFL 4LPUA 4YHPB 3V52L 5DHXB 4A6YL 1ORSB 2B5IC 1A7RH 4IDJL 4GAYB 3BIKA 1YEIH 3UO1H 2FR4A 5DJAA 4HKBB 3JVGC 3CSYB 2H3NB 2J12B 2X4TB 4HMEA 3HZKB 1KV3A 3V8CA 5JHDB 1ZHNB 3LEVL 1BP3B 2VN7A 1F3RB 4ORZC 4P23A 1YEJH 3C5SA 4EZMA 4Z7UA 4DGYH 3IDGB 5HYSG 4EJ1C 5FXCH 3MMEB 3QG6B 1QFOA 1YDPB 5D1ZC 1CR9H 2DI9A 2VXTH 1F00I 3OAYK 4ISVB 1EJOH 1OVZA 3DURB 4MJ5B 1SM3L 4MNQD 3WIHL 4DGVH 2QHRH 4JFFD 4QT5B 3ARED 4GRWF 4XHJD 4J4PA 4YHKL 4K71C 2PW2B 1TJIH 3LS4H 1I8KA 2P5WE 3HC0B 3MJ7B 2LABA 1I3VA 1MWAA 5D7IF 1LO2H 4MXWH 4JFDA 1N2RB 3KXFE 4GSDL 5EU6E 5F7EH 1HXYA 2OR8A 5SX5K 5FCUL 4RFNB 3O2DL 3GHEH 2VZTA 5I73C 1KYOK 4JM2C 4Y1AB 5IVOA 4K8RL 1Q8MA 2OZ4H 3HMXL 5EC2A 3TH2T 3JV6B 4N0YL 4BH7B 3RTQC 2ESVA 5F9OL 3QJHB 1U8HA 1PG7X 5L7XH 3P0VH 3NIGE 4PJCE 2CQVA 3FONB 1AIFB 5LBSL 5CJQL 1G6RA 4HWBH 1OTSD 3MRHB 3WUWA 3UTSA 1Q1JL 2ZSVB 1N3NB 4M43H 3ARFB 1JWUA 2DJSA 1LEGB 4POZD 3U0PA 1FO0A 1IAIH 4QHNA 3SBWC 4NGHH 1FLRH 3NZHL 5L2JB 5IM7A 3JWOC 4G6FB 4Y19E 1BBDH 3GI8H 2EDQA 1QA9A 1HHIA 5IB1A 2WZPD 3VD5A 3QRGH 5HYIA 3CCHA 1P4BL 4QHLA 4D8PA 1TETH 5E8DL 4HH8A 4X8JB 5GRVL 3QDGA 5HYSB 4LVHC 4Z95L 1DN0B 3D85A 1OW0A 4AEEA 1BECA 5DK2A 5AYQA 5TDOB 1FBIH 1A2YA 1XGQB 3GKZA 1P4IL 3ARBC 4NN6B 4EDXB 4H8WH 4HK0A 4P9HC 4O2EA 2JJTC 1KENL 1DQML 5TE7H 1H3PH 5DJZB 5FK9A 1FGVH 1MVFA 1IEBA 1RZFH 1EEYA 5C8JA 1OSPH 4FQQB 5C0JA 1ZV5A 4HDIB 4WEBL 3OV6A 5M94B 3RWDA 1DBBH 1DQLH 5GRWA 4ZFZA 4ZOCA 5E6IA 1YEDB 3VXOA 5CKAA 3CDYA 2W0LA 1JUFB 1ZLWH 5B3NA 1FL3A 4OZFA 2BXZA 1KJ3H 4TUOA 5GGSY 2DD8L 5EC1A 4JGMA 4P2YA 3OB0K 2ENSA 5AWNL 5ACLA 3RI5K 1P4LB 1I1FB 1BREA 2OTUB 3GIVA 2Q86A 4ZUWB 4NWTL 3F7RA 3FRUA 3MREB 4RFOL 3V0WL 3ZDYF 2VLKE 2APVA 1DL7L 3BPCA 2ZUQC 1I8LC 3D3VA 43CAB 1I3GL 5EBLB 4OCWL 1SYVB 3NH7L 3OR7A 5I75C 1LP9B 1FG2B 4JRYA 4HPYH 2FLBT 3QNYA 2Z91B 3FO1B 5C0CA 1KPUB 1T03L 5DXWA 3N0PB 2UVFA 2XZAH 3ZE2E 1J11A 5D93B 4GW4A 2DLFH 5KVFH 4A6YH 4MD4B 1J87A 3LKPA 1J1XH 2YKLL 4IDJH 5CMAA 4DKFL 4CMHC 1BBJA 2X4PB 3OPZH 4NQDB 5E8PA 4RGMB 1FYHB 4WTZG 4NQEB 5HYQA 3NA9L 4JRXA 3BAEH 2QSQA 4RWHA 1MCKA 4I1NB 3OKOB 5GPRA 1VADB 3O6FA 3BVNB 4PJ5E 3QHZL 1I7UB 2VQ1A 1NC2A 2CLZA 3PWPE 2FJGA 2AGJL 4XZUA 4L5FH 4GRWH 2BMKA 2VLJE 1WBZB 3BPLB 4GKNA 1I1YB 2IANA 4M61A 4Q6IC 1EO8L 3CFDB 5T1DL 4LPCA 2CDFB 3MV7D 3BQUD 3OWEA 4MZ2A 6FABH 3CFBA 5LQBH 1G9NL 5LGJA 1NFDE 3OKMA 3L5XL 2YN5A 1KSRA 5KW9H 3O2DH 4TUJA 4NHUB 3O8XA 4HUWB 2BY2A 4NNPH 1EK3A 2Q6WB 3C6SB 1YNKL 5F7KC 1G9MH 4EOWH 4K8RH 5CAYB 3MV8E 2HFFB 3HMXH 4XAKE 3SE4C 4JZNA 4N0YH 3UJJL 4M62L 4J3TA 1L0XA 5GGRB 2DQFB 1DEDA 3NZ8A 1GAFL 1Y0LA 4Z7VA 3C2SA 2AS5M 1XGTA 2QKIA 4IM8A 4D3CL 4XP5L 4X5WB 3MJ8B 3DVNA 5JPNA 2IADB 4KKNA 2BK8A 3EOTH 5DVLA 5GGSA 1SHMA 4I0PB 4MXVE 5C6TL 1W0VA 1BZQK 1RUML 1JNHA 5JORA 3RUGA 4UTBL 1Z0NA 4DOHB 3NCCB 4MVBC 2AV7B 5HGGS 3RWEB 4DKEH 5IK3B 3PABB 3VE0B 4F58H 5E94B 2I60L 3DUUA 3T2QA 5E1AA 1CK0H 3Q3GB 4QXWA 5ANMB 5E24E 1CBVL 3HR5A 2OZ4A 1BWWA 4Z95H 3EAKA 1F3DH 4H20H 4PRAB 1HCVA 3TBTB 1OD9A 4YLQT 4PJIE 5KG9B 4MB3A 4U1IB 2EECA 2V7NA 3QUYC 1DQQA 2ZUVA 1KTDB 1T21B 4JB9H 5CS7A 2G9HB 4PJ7E 4HWBA 4K3JH 3MUZ1 5D1ZD 1NEUA 1I7RA 3WNPA 2Q8AL 1DQMH 1JFQL 1QEWB 4PREB 4LFHD 3MRCB 2FRGP 1GGUA 3HI5H 1OQXA 5IIEA 2C3WA 1Z5LA 4M5ZL 1J5OH 5ILTL 5AYUL 4TSCH 4NDMA 3KG5A 3QEQB 4Y4KB 2CRZA 1HH9A 1NAKL 3WE6B 2YN3A 4FQLL 4Z7WF 2P7TA 4KPHL 4JM2D 1CDJA 3QI9A 4XVTL 5DHVH 3VXRD 1MHEA 3M07A 2XQBL 3RTQD 1YUHB 3V6OC 4NKOA 5EBGA 4RWYH 3QQ3A 3IDUA 5GRJL 1JRHI 4KRLB 4W4OA 4R90L 3ZE0F 5GGVY 5IWLC 4RFOH 2HVKB 3NFNB 2GK0B 4W81A 1DL7H 1ZGLM 3B2UC 2ICCA 3AB0C 3DMMB 2ICEA 4KY1L 4ELMA 1DFBH 1RULH 5A3IC 3NH7H 3W11C 3DOSA 4TTGA 1GJIA 3QFJD 5HY9A 3ZDZE 3KLDA 3NCYS 4OFKA 1CXLA 2FYYB 5L2KE 4LCWA 1ONQB 1HHKB 1JCKA 3IFPB 4C83A 1UWEH 1WZLA 3H42L 1IL1A 1KIPB 1HOCA 1NCWL 3EIFA 4L9DA 1OM3H 2VDLH 2Q3AA 2YD4A 3X14B 1T6VN 2BOBA 4DKFH 1JTTA 4ODSL 4NSKA 1SJEA 1CDUA 3EOAA 1N59B 3WKNA 3VFVA 3TM6A 4PTTB 1S9XA 3ARBD 1GPOL 5FYKE 4UV4L 2BDNL 4FTVB 5IEHA 3H7BB 4OGAC 5ID1A 1MLBA 2P1YA 5K9QG 3LN5A 9CGTA 2GUOB 1FL5B 1JNJA 1D6VL 5TGBB 5C92A 3F65A 5HHNB 4KRNA 1J88A 3B9DA 3D39D 5TPWH 3FCTA 4N5ED 2ZOKB 4WV1B 5ESVA 2EDWA 1S9YA 4APQA 2JCCE 3H0TB 3SKNA 1T04A 5F1OB 3MODH 4JAMA 4NZUL 4E0RA 4Y8DC 2GT9A 5D1XC 4CN6A 4Z7QF 2EDBA 5T1DH 1UM6L 4P2OA 3CXDH 3QUXA 5EA0L 4PJEA 1T4KB 4L1DA 5C0BE 3O3BB 5IBUG 3QIUC 5LCVL 3DYMA 1MRCH 2BVTA 4X6CB 4A6YA 3DX9B 3PWUB 3HZVB 3HZMA 4QY8B 4WW1A 3AMLA 2D0GA 2R8SL 3U30C 3MRIA 2FECI 3SE3A 3O81A 4M62H 3QUZB 1JIBA 5EOQH 3TIEB 4IBLT 1G7JA 1G0DA 2Z92A 2LQRA 5JTWA 4GG8B 4HS8H 1QSFD 5IUSA 5L6YH 2CDEA 2XWJA 2FD6L 2FB4L 3G6AA 5I66A 4GG6B 3L5HA 4R0LC 5C07A 2DQJL 1VACA 4IMKC 5F88A 1VFAB 2YD6A 4MJIA 4DFHA 1OTUC 2E9WA 3PIQB 4QF1B 5D7IA 1FYTD 3ZO0A 1I7ZA 3WIHA 4LASH 4KDTC 4ODVL 1RUMH 3MRPB 2LE9A 3U79A 3HPJA 4UTBH 3ULUL 3M17B 3LPWA 2YUZA 2W07A 5HI4C 3RIAK 4KC3B 4DW2H 2X4RB 5DWUH 1U8MB 3O2DA 4HH9A 4G3YL 4L4VD 2ZNXA 2ZG2A 1XEDA 4RA0C 3EDDA 2GTZB 1G7LB 5HDQH 1RZGA 3HMXA 2D03H 2E6QA 1CIUA 2MHAB 2CLVA 5IHBA 4L4TB 3QQ4A 5C0IA 3V4VH 1S7VB 1A1NB 3TBVB 1GZQA 4OLUL 3C6LB 2CUHA 4IJ3C 1NLDL 2A6KA 2EIEA 4FMKA 4PGZA 2J6EH 1UENA 2Q8AH 1AI1H 1R3KB 2R1XA 5IBUB 2VZ1A 5CIPH 5SWSE 2IFFL 1R24A 1BIIA 4KI5E 4CW1B 2EYSB 5F3BB 5DD0H 5ILTH 1ROWA 2VWEE 5AYUH 4Z7UE 3BFOA 5M7QA 1UZ8B 1KEML 5B8CA 1TMCB 4O9HL 4TQEL 4LRIC 4JKMA 3NCJL 2VXSH 2VUYA 4M6MH 1SJHB 4JPVH 5SWZD 3DUSB 4Y5XC 2UY6A 2XQBH 2V9QA 1GGCL 4JFDE 3MLSH 3FQTB 4ODWA 3MRNA 3BP6B 4OT1H 4UINL 3SKOA 1Y18B 2RHEA 4M1DH 3ARWA 1OF2A 3D1MC 1JGDA 1XR9B 4ZYKA 2YPKB 5I6XB 2PETA 1HQRB 3S9DB 3KJ6L 5F9JB 5HVFB 1NCTA 1H0DA 4N9GB 5EZLA 3L6FA 2BSED 4LPYA 2X41A 4WHYH 4Q2ZB 4WY7L 2ESVE 3UTQB 1I4FB 2XZQL 2HJFB 3INUH 2UYLA 3MCLL 3REVA 2Z31D 1QBLL 2VL4A 4LGRB 1CDCA 4OGXH 3S6CA 1EGJH 4MVBD 4YHMH 3FHQA 3NCBB 3U83A 3UTSE 4YBLB 3Q0HA 2IQAB 2IAMB 5DK3A 2VKXA 3WHXB 4E5XB 3LRSA 2Y36L 4OD3L 4IOIA 4UOW0 2Y23A 2VLRD 3E1F1 5IMOB 3FQRB 2AJZA 1CFSA 3QB7C 4Y4FB 5DHVA 3RP1A 4V2BA 5C9JA 3BYTA 4PRDA 4P2CG 5IB5B 1JVKA 1KG0A 4WDIB 3QUYD 2DRUA 5IVXF 1N6QL 1GPOH 4F7MA 2V2XB 1NCBL 1PQZB 2BDNH 4Y5YB 1S7TB 1SBSL 1T20B 4Z6AT 4QRQA 4KKCD 3VFGH 3RBSA 3BKCL 4UU9A 4S1RL 1U8IA 3C60A 3OGCA 1A5FL 3QDGE 5E8EB 5GSRA 2ADFL 1YJDC 4PG2C 3QR2A 3OJMB 4NZUH 1Z9MA 2VISB 5C3LD 4Y16C 1UM5L 1OY3B 4YUEH 4BSWB 3ARZA 5TDPA 4K3EL 1C16B 4KROC 3OG6B 3IKCB 4TOYL 1TQBC 5LCVH 3PGDB 1LO4L 1TPXC 2FX7L 2BNQD 1CE6B 4RGNC 3CDFA 2NXYB 4LVNB 1EMTH 5DEGB 4OFPA 5ITBH 3FFCB 2EEAA 3A6OA 3CK0L 1DEEB 4YR6A 3BP7A 4O5LL 43C9A 3L5WB 5J13B 3B2UD 5DZNA 5JNYB 1INEL 1FVEA 1TIUA 1UH3A 2R2BB 5CHNA 3U7YH 1KJMA 4XI5C 3VU2A 1RZKL 2ARJA 4MYWB 2V2TB 2AJXL 2NY2D 1S7XB 3W11D 3G6JB 4NZRH 5T1KD 4GQPH 3TBSA 4D0CA 1ZEAL 1K4DA 3UTPE 5I0DA 4ZOEA 1H15B 3TF7C 1GRWA 1O0VA 1FL6A 2QR0B 2AJUL 4Q9CA 2OS7A 4QRPB 1FAIL 5DUBB 4MA8L 5EZJA 3O6ML 3D3VE 3ULUH 2MTPA 1MIEL 2P8PA 3D9AH 4POYA 1FH5L 5I1AA 1ORQA 2G75A 4AENB 5BV7H 4JRYE 2JIXD 4NQUA 5T3ZL 1KEGL 1U93B 4M8QA 4XNQA 5C0CE 2Y7QA 1QKZL 2FCBA 2G5BB 3PDOB 4OGAD 1DSFL 4PJ8A 1P9MC 3KLAB 1CICB 5EU4B 3HC4H 3MR9B 1KIRA 1HHJA 1NLDH 2P5WD 4K9EL 5CP7A 4E42B 3KXFD 5EU6D 3TCLA 3CJJA 3K2UL 5CZXC 5D1XD 2IFFH 4JRXE 1WAAF 4DK3A 3GKWL 4HWEH 1CFNB 3VFWB 4AM0A 2PTUA 3O3EA 1NC4B 3ROOB 7FABL 4LMQI 5AZEL 1M7IA 4HS3B 5F3HB 3GMLB 2YD1A 5IF0A 2R0KL 1KEMH 4HJJL 3BN3B 4FRWA 5K9OB 4LSRH 1U8QB 2OI9C 4LLVB 2IANE 3M8OL 3TT3L 5C0ND 1ZLUH 4CDHA 3FB8A 5K93A 1I85A 3HG1B 3GNML 4I3GA 4M5YL 3KPPB 2VDRH 3PWPB 3MJGX 1HEZA 1CGWA 4RDQG 4UINH 5MEPB 1U3JA 4P3WA 2NW3A 3VFMB 1INQB 3M1BB 3U36B 3FTGB 4M7JL 2AJVH 4IRZL 4AH2A 4KUZL 1AGCB 2V17H 1AGEB 5F7WC 1KTLB 1OTUD 1QRKA 2VDOH 2J6EA 4HK3J 4LCCA 4Y19D 3ZMRA 4WY7H 3QCUH 1I1AB 2XZQH 5D70H 3HHRB 5MEOA 4WNQA 5EPMA 4G8GA 2GY5A 4LQ1A 4Z7VE 5EOTB 1C8PA 3KYMB 4Z7WA 2DQUL 1K6QH 1WZKA 5HI4D 1V3JA 1AJ7L 1N26A 1EPFA 2Y36H 4OZGE 3IAQA 1BQHA 1MRFL 1JBJA 1YY8A 3RVXC 2MFNA 5BMFH 3RUGE 4YX2L 1UJTA 3ALXA 4MCZA 3SDXA 5FAAA 3MRJA 3O9WC 2NW2A 4FQHB 3ZKQD 4GAFB 1IQDB 1NJ9A 4DFIA 2Z8VC 2DAVA 3E3QC 5E2VH 2J8HA 3RWJB 5F7LB 1JPFB 4X99A 1RPQA 4BZYA 5AG8A 1A5FH 1FNGB 2RCSL 2AERT 5TE4H 2KDGA 1DVFB 2ADFH 3PDGA 4BM7A 4PPTA 3VGDA 3GMQA 1CVRA 1T7WA 5DFVC 1YEKH 4XNXL 5DQ9B 5HI5C 3WJLA 1A1MB 2UZIL 4R9HA 4ZQKA 1RJYA 2XKNA 1EGJA 3G5YB 4FQ1L 1G0XA 5BW7A 1BWMA 1JP5A 1OP5K 5DJ6B 4ERSL 5J7CC 1T0NB 1JV5A 3QO1A 3SY0A 5KVDH 3BWAB 3S37X 4PJ7B 3MCKA 2VLKD 4LNRB 4HKXA 1BOGA 3RVTD 4OAWA 4ODBD 1SEQH 4XCEA 3X3GL 1JF1A 2XKUA 5I1GH 3VFOA 2BRRH 3S36X 1DQDL 3CSPA 3BW9B 2E9BA 2PTTA 3RY6C 3SDCA 1INEH 2MJWA 4UDTA 5DA4A 3O2WL 5DJ0B 3RJQB 5C86A 2OL3L 4G8FB 3STLA 4K23L 2BNRD 2N1KA 4IIQC 1JWSA 3VWJC 5KANI 2FSEB 4MA3B 5F6HI 4UTAL 1LO5A 4NO0D 3QDJA 5D96C 4GLRI 4JRWA 5DVNA 4MNGB 4XTRC 2GSGA 1LDSA 1MIEH 4ELME 1ZXQA 5MI0C 3ARGD 3HS0A 4LSUH 4PLOB 4JY5H 3VH8A 3RBGA 3VGBA 3K8KA 4EXPX 4JPKL 1F4XH 3SJVB 3IDMA 4PJ5D 1I8MA 3AMKA 3QXWA 3S88H 2DDQL 4LCWE 1UCTA 2FL5B 4YQXL 4GMTL 2VLJD 1YPZB 2XV6B 3NPSC 4LLQB 4U2ZA 1HKFA 4JFYB 2CR6A 4XCYA 4BUHA 1P1ZA 1OHQA 1PLGL 5L2KB 4YZFF 3D2UD 5I1DA 5FV1L 4D0BB 4NT6B 2Z8WC 4Y16D 3WFCL 3GKWH 3LH2L 5IESL 3ESVF 5I1JL 2AW2A 4PRIA 3NFSH 7FABH 2XNAA 1FNEB 4HFUL 5E5MB 5GGUA 3CXHJ 4KROD 1EUTA 4QHUB 1BZ7B 2OJEA 5DJXA 4NBYB 3GSRA 5FUCE 5DO2C 3MV8D 3VMOA 4YXHH 4XAKD 4DN4H 2YRZA 4OUOA 3RNQB 4P2QD 4RGND 2A6DA 3TT3H 1TJHL 4N0UA 3VRJA 4OLVH 4MNQB 4YDIH 1A14H 1N6VA 1SYSA 5IQ9A 3MRDB 3MBEB 1U8JA 3FRPG 5HGAB 5EFIA 2C1PB 1OWWA 1RZKC 3BWUC 4ODHH 3DRQB 3IJYB 3LB6C 3FOMA 3HE6B 4RAVB 5CJOL 4BUGA 4DVBB 4HGMA 5MEQB 3RFZC 4M7JH 5B21A 5I1IL 4IRZH 2YR3A 2R15A 2BVQB 1BFVH 4U6VL 4XI5D 1HINH 3LQAH 5EN2A 5C0BB 5KVGH 5T3XD 3EYOA 2C3XA 4QRRB 4XVSH 1QFUH 5GRYA 3QJFA 1XH3A 2A0LC 3TNNB 2MQ3A 4XP6L 3SHSA 2DQUH 2AXHA 5DLML 1WFUA 5C07E 1BX2A 4MJIE 1AJ7H 4GRWE 1YEEL 4LSSH 5D7IE 3F12A 3STZB 4EI5B 2I9LA 3IB4A 1Q9OB 1MRFH 3U0WL 2NY4B 2CIKA 4DUWA 2PN5A 3BDYL 2ZCHL 4K9EC 2WUBL 4U7KA 1QP1A 1KCVL 3VRIA 4KDVA 4DN3H 2P5EA 2NX5D 5JA9A 1TFHA 4NNYB 1T1ZB 3QPXH 4F2MA 3D69A 1JN6B 3LZFL 2JJSC 1SBBA 1WZMA 1WF5A 4XAWH 3SGKC 4KZEL 3U48A 5CZXD 1DP0A 2YS4A 3SQOL 2DKMA 4F15C 2C4XA 3EKCA 4G7YL 4H5SB 15C8L 4EN3A 5F6HJ 1NANH 1X5ZA 3MRLA 1JRHH 2DQEL 2DLIA 1TJGH 3VXNB 1YEFH 4YFLI 1ZLSL 2O93L 5AUMB 1SJVA 4XNUL 1MHPH 4WFEE 5K59F 1F5WA 4R97C 4L8CB 1UQSA 5JIIA 2QQQA 3MLTA 2F53A 4OCYH 4HZLA 3W39A 1RU9H 4IEFB 4BFIA 1MEXH 5D7SL 3MQIA 4OLWL 5TF0A 2AXGA 3NBNA 5E6IC 4MAYC 4LRNL 2FR4B 5DJAB 1BVLA 5IVXA 3D18B 4EBQL 3IF1A 1MH5A 1TQCB 1HHGA 3K4ZA 3X3GH 1EEZB 3KYOA 3S8WA 2ADGA 3VXPA 1JPTH 5DD3H 3P4MA 5IJVA 4JDTH 4PJBF 3C5SB 4OLZH 2X70B 5ITFB 4MAUL 4F7PB 3QEUB 4M9OA 4MMZC 2XN9D 3HNVL 4JPWH 4JLRB 1C12A 4OKVA 1I8KB 5HJ3A 5IQ7L 1MWAB 1EIBA 4FOMA 4UTAH 2R1WA 4Z8FL 3BUYB 3FO0H 4R4FL 1S7UA 3LD8C 2GSIB 4MWFB 3HE7A 4F57H 3RVXD 1FHGA 1IEAA 2B4CH 2B1AL 4JPKH 1AO7D 5C1MB 3I3DA 3O9WD 1AXSA 2ESVB 1DBKH 1UM4H 1U8HB 3WUZA 4FG6C 4UV7L 5FFLA 3NA4A 2JELH 4OZFG 5GGVL 2RFXA 1G6RB 1U3HC 1RVFL 1MCOL 3GSUA 3UTSB 4OI7A 4WFGD 5DUMH 1HI6A 3O6FC 3BPNB 3DSFL 4QYOA 4Y2DA 4JVWA 3ZDYE 1S3KL 5DFVD 1LO3L 4M3JA 3OX8A 3U0PB 1FO0B 5HI5D 1FNAA 5IESH 3S3SA 4F7EB 4TVPL 1QSVA 4HFUH 1BD2D 1QA9B 4OLYL 4XBPB 4B53A 1HHIB 4YXLH 5IB1B 4J3OC 1UG9A 1QLFA 1IKFL 2VC2H 3CCHB 4I18A 4QHLB 4D8PB 4XP4L 1CLYL 4UT6H 3WV0A 2J8OA 3QDGB 5T1LD 3VMPA 5DK2B 3QA3A 2AK4A 1A2YB 4LFHG 5C08A 4LKXA 3RGVA 4RGOL 1A0QH 1NMBH 1J0ZA 1I8IB 4HK0B 1WAAA 3VWJD 3CLEL 3U9UA 5FK9B 1EJ6A 1LNUB 3MUGA 3LHPL 1AXTH 1IEBB 4YHYC 3DVGA 2BSRA 1JPSL 1EEYB 2BVEA 4XC3H 1MI5A 5C0JB 1CTNA 1RD6A 1L6XA 4JM4H 2GFBA 4XP6H 4XTRD 4MA1C 1XGPA 4BKLB 1T0MB 4LVOC 4ZFZB 3BRGC 4JY6B 4FHBD 3CFJA 2FJHA 1MAJA 2OM5A 3P9LA 3TO4A 3RHWK 3D0LA 1FL3B 1AGBB 4OZFB 3P9MB 2R4RH 5DGQA 2PYEB 5EC1B 2WUBH 4Z0XB 1H5BB 2Z4QB 1PEWA 5JIHA 1PZ5A 3FRUB 5SWSD 5FGSA 5HPMA 4M7LL 4NO3A 4O51A 3PHQA 3RWIA 1A9BA 4P23D 4HX1B 3SDAA 3D3VB 3EFFB 4TPRL 2R2HB 4KMTL 1QLEL 1EZVX 3GB7B 1JYWA 1W0WB 15C8H 3QZWA 3E2HB 4EQ2A 3OR7B 3RPKA 2DQEH 2D4DA 2G60H 2OTPA 4X6FB 5GJSH 3QNYB 3AXLA 1ZLSH 5DO2D 4YWGL 5C0CB 2YD5A 2HKFH 2JK5A 4JFDD 5F71A 3GJFK 1RURL 2JB5L 5JW5A 5IKCA 1KB5B 4OLWH 1M7XA 3LKPB 3G04A 5CMAB 3CDCA 1ZOXA 3WO3B 3RDTC 1BBJB 2DM3A 2E9IA 4XNMB 2KL6A 3GI9L 5DJDA 5K9QI 1CD9B 1OAZH 1K3ZA 4R2GC 5HYQB 3R4DA 1JZ3A 3FQXA 4LSQH 5TF1H 3GBMH 5I73B 1H8SA 3LQZB 4GRLA 1B0GA 1U8OA 4M7KL 3KPOB 3THMH 2CLZB 5CILH 4WW2C 5E08L 2XTJB 1N8ZA 2FJGB 2Q20A 4CNIA 4XZUB 3PGFL 1VEOA 3QT2A 4PV8A 4H0HB 4GKNB 4WIQA 4MLSA 4UZGA 5T3ZD 2A0LD 4MD0B 5MERA 3F5WA 5FUOL 3T65A 5CWSA 1FGNH 3MRGA 1O7VA 1HWHB 1ZA6A 2X5PA 1QOKA 4I9WE 4R4FH 2LAAA 3SCMC 5DTFA 5FGBA 1PY4A 4G8GE 3KR3H 2HWZL 4DAGH 3C09C 4Z7WE 1NBVL 1BQLL 3QFJB 2ATKA 3FMGL 4JZNB 2ZUUA 4CVXA 4CVZA 3D85D 4UV7H 1MFBH 3GM8A 3HKFA 5KSUA 3NZ8B 5AG9A 1Y0LB 3QG7L 4Z7VB 4X4YA 5JXEA 4ZO7A 5HHPA 3SDYL 2UUDH 5A2IH 4PJAB 1T2JA 3ZE0E 3ARDC 1KIQA 4F3FA 1HYRC 3SDXE 3DVNB 7CGTA 5KS9B 3EYSL 1ERNA 5C0RL 5FUCC 4XNYL 3V4PH 5D9SA 2R9HD 1MCPH 1W0VB 1OSZA 2DJUA 1JNHB 5JORB 3RUGB 2QBWA 1G7PB 4QRTB 2C3GA 5JPMA 2VXQL 4BJLA 3VDCA 1JNNL 5E6ID 4MAYD 2BFVH 3MPCA 3TC9A 2DI8A 4IDLA 4LPTA 3BGMA 4JQVA 4ONHA 5EBMA 1FCGA 5JDSA 1N4XL 3GMMA 2V7NB 1DQQB 2D7NA 5F1NB 1E0OB 4KZDL 5TH2A 1CD0A 4Y5VA 2X4SA 1I7RB 3VG9B 3PGCB 3LHPH 2D7TL 3MRKA 1U42A 2OK0H 1D7FA 5FYLD 2HVJB 3CVHL 3VFPA 5IIEB 3N1QC 1Z5LB 2V6HA 3QNZA 4QTHA 3ZE1F 2OQJA 3G5XA 4JRYD 3WFBL 3P9WB 2VDQH 2X44D 4C56A 3NFPA 4Z7QE 1J0IA 5I1KL 4I5BB 3QI9B 5GZNC 4N8VB 3FQUA 1FYTB 4GXVL 5IVZA 1MHEB 4XPHH 4LAJH 4NKOB 4U6YA 2R1YA 5JR1H 4MJ6B 3PWLA 4I3SH 4HW6A 3SQBA 3DV4A 4MGXA 1U3HD 1KN4H 3T0EC 4U1NA 3IFLL 4M7LH 5EO1A 1LP9F 2VLMD 3O6FD 4CMHB 5EU7E 2DQHH 4HBCL 4L4VB 2GJZB 3L1OL 5JHLH 1UJ3A 3FQWB 5H35A 4KMTH 3K74B 3BT2H 3N1MC 1T83C 1ZA3A 2IAND 1KFAL 4JFHE 5E2WH 3U6RB 3K2MC 4YGVA 3D25B 3GRWL 3ESUF 3QFDA 5HY9B 2QQLL 1WK0A 3KNBA 4OZ4B 4FFWC 4YWGH 4YDKH 2LU7A 1ZLWK 4D94A 4N1CA 4XX1E 3FHAA 4Q9QH 1RURH 2K9UA 4YIQA 4C83B 3TVMC 4P9ML 1HOCB 5HTSA 2YRPA 1I9IH 3EZ8A 4PRIE 2ZUYA 4BSVB 2BOBB 1AE6H 1AQKL 3EOAB 4IOFD 1DQTA 1FC2D 3ULUE 5IR1A 4ZNEA 1EO5A 1NDGA 2AAVA 4OLXL 5GGTL 4N0UE 4NKDA 4R3SA 1MLBB 3LN5B 3U4EA 4G9FA 3HRZA 2NY0B 5SWZB 4FXKA 1XIWA 5ESVB 3PGFH 2Z8RA 1S9YB 4APQB 4BFGA 4Z76A 3VG0H 3LEXA 3ALWA 3TJHC 3ULSB 4M4PA 1YMMA 5D7JA 3L3DA 3O3UN 4P2OB 1V5JA 4F8TA 1RIVL 4PJEB 5FO8A 2RJMA 3RL2A 2XWTB 4TNWF 3ISWA 1WC7A 1HSBA 5IOPA 4F33B 4P59L 1MVUB 3EYFB 2HLAA 4QTIL 4A6YB 1EX0A 2HWZH 3HZMB 2F54D 2N4IA 1Q0XL 3MRIB 3FMGH 2NNAA 2PUQT 4U6HB 3ZT6A 3I6GB 5C0FA 3DX7A 5AD0B 1X5YA 4FP8H 2Z92B 4PJBA 3UROR 4YFLF 4JGUA 3QQ9C 2CDEB 5DD5L 2XWJB 5EULV 1IFHH 3H3BC 1T3FA 2AEWA 1F3JA 4P5KA 5DDHA 3DI2B 3UJTL 3G6DL 1QBML 4MJIB 2P5EE 2FEDC 5CEYA 1J12A 5D7IB 3EYSH 3T09A 2VH5H 1I7ZB 2BCKA 4OBRA 5C0RH 3QUYB 4G80B 4XNYH 3T8XA 1C5CH 3O4OB 2YOCA 3FO9B 4P3DA 4JFOA 32C2A 3S97C 1GSMA 5ACZA 3FB7B 4GKZA 3E6HA 2V9RA 2JE8A 2VXQH 4MDIB 3JWDL 2VABB 3BZFA 1I9RL 1U8LA 4WGWB 5EZIL 3RDTD 4NJ9L 2VZ3A 1RHHB 4FQCL 5DJ8B 2AEPL 4U3XA 5C0AA 4MQSB 5CSZA 4XVJL 1ZVHA 4R2GD 2YPLD 1N4XH 4GLRH 4QOKD 3QQ4B 2F53E 1U92A 4UT7H 3EDJA 5C0IB 1YQ2A 4I3RL 1GZQB 1KF9B 2SEBA 1VPOH 2AJSL 5IVXE 4TUKL 3OKKA 1NBZB 4U1HA 1RJZA 1ZGLB 1QFHA 1LK2B 2D7TH 3FO2B 1R24B 1QHPA 1T5WB 3N9GH 3BSZL 3CDGA 3SCMD 5DMGC 3R06B 1NGZA 4JO1L 4WWKA 1UXWB 3UDWC 1A1OA 4JZJC 5I1KH 1M1SA 2LTQB 4LBEB 5KBNC 5GISL 3UC0H 1T7YA 3TA3A 2J4WH 1ZWIA 3DO7A 3QDAA 4S1SL 3SKOB 1HK6A 1FVCB 2VNCA 2XIDA 5KZCD 3F7QA 3E6FA 1JYVA 4ZYKB 1CT8A 4BYHA 5GHWL 1H0DB 4HPOL 4V1DA 4J3SA 3B6SA 3ARDD 2DL2A 3BP5A 5EZLB 4OM0L 2JIXB 4XWGH 4J8RB 3WN5C 1AP2A 1IBGH 5DC0A 3UXFA 1BOYA 2AQ2A 5DD6A 2ZUWA 1IAKB 3L95A 4FNLH 5TQ0L 4M48H 4NP4L 4PRPE 3LIZL 3PWJA 4WI7A 1J1PL 3VGAB 5F44A 3A67L 1MNUH 4U31A 3KPTA 2X1QA 4RMTA 4PS4H 2WBJA 1NSNH 4IOIB 4F7CA 4O2CA 1FG9C 1RZJL 2HKHL 4BZ2L 5D1XB 4K3GA 5HVHB 2AJZB 5HYJA 5DHVB 4F8QA 4MB4A 4PRDB 4JKPH 1OP3H 5D7LA 1I85C 1KG0B 5IHLB 1BVKA 3OB8A 4PB9H 3QIUB 4RZCA 1NAML 1B0WA 2XG5A 4F7MB 1N64L 3ABZA 2L7JA 4ONFL 3VI3F 2CK0L 4UU9B 2NTFA 1FIEA 1DDHB 2DBLL 1U8IB 3GMRA 1BZ9B 3C60B 4OGZA 5LXGL 5A2FA 1D6EA 3U30B 5C07D 3T3MF 5BZDA 4YHPA 1F4WL 5HHOD 2AK4E 1FVDB 5C08E 4E41E 4J3VA 1D9KC 4X6CF 1J8HA 1MQKH 4DZ8B 5DA0B 2ADJA 4R0LB 1RIVH 2NY6B 3VFNA 5HHQA 2X4TA 5FEBA 3V0VB 1WAAE 3HZKA 1E28A 4U1GC 5GZND 5BRZD 4LCYA 1MI5E 1MJ7L 4N8PA 2G5RA 3IDGA 1P7QA 3MMEA 3QG6A 4GG6F 1E4WH 2UVEA 1Q0XH 4O02H 4YXKL 4MJ5A 1KC5L 3T0ED 1ADQL 2IPKA 4ALAL 1S7SA 43C9B 2FO1A 3HC0A 3IDIB 1OAKH 5CJ5A 2PR4L 5FDYA 4JFEA 1FVEB 5CHNB 1KJMB 4PGCB 3TNMA 2ARJB 3G6DH 1QSZA 1F2QA 4X4XA 4X4ZA 5DMJB 1UB6B 3MOQA 4FQJH 3KVQA 4FFWD 4K2UL 2AK1L 2FGWH 1D5ZA 3JV6A 2O5YL 5CKGA 2W91A 3QJHA 4CADB 3L3JB 5FM4A 3TVMD 5E9DA 5I1AB 1ORQB 5IB3A 1S8DB 1K8DA 4ZTOH 1X6LA 4PRHA 5DHYB 4YK4C 3MRHA 4PJGA 1IGML 4NJ9H 3VWKA 2AEPH 3ARFA 2Y7QB 1WSST 3OXRB 1WWAX 2ZUSA 5I8KL 1UWGH 4PJ8B 1G7QA 3UPCA 2BXYA 2VR4A 4OD1L 1P7HL 5HYFA 1MFCL 4NKIL 5B22A 4X7EC 4Y5XB 4C54A 1KIRB 1U2HA 4NC2B 4PLKC 3CC5A 4TUKH 1T2QH 1MCCA 2HFTA 4M8VA 4X7TB 3G5ZA 1IQWH 3OG4B 3TJHD 3K46A 4UT9H 3SDDA 3BSZH 4BELD 1D5IH 1ACYH 3O3EB 4WU5A 2MOVA 1MCNA 4U1JB 3TBYA 3WKML 2FEEL 1DN0A 2N7AA 3WS3A 5E5UB 1MCQA 5CBEA 1F6LL 5J6GB 4JO1H 3A6CL 1XGQA 2WP3T 2CUMA 4P0DA 4WFHE 2R4SL 1AKJB 3IDNA 2MQ0A 5GISH 5GRXG 3L3KA 4ZD3L 4P4KC 5C0EB 4S1SH 1Q0YL 5C09A 3SKMA 1DLFL 1DBJH 1MCSA 2IFGA 4JFQB 3QQ9D 5ABDE 5I71C 5GGRY 3DWTA 4PTUA 4HDIA 2HT3C 3KYKL 5F21B 3QQNA 1B90A 2JJVA 3IETB 4OM0H 4WO4C 1E4JA 2FEDD 4WRLA 1LDPL 1R3JA 5F1SA 3MLZH 1RMFH 3VXMB 1WUNT 1JUFA 4NZTL 1SY6H 1QUNA 5MEOB 3JWDC 4WNQB 4WENB 1BVZA 3Q2CA 3H9YA 1OB1B 4RMRA 4R96B 4Z7WB 3CU1A 3S96B 5FKAB 5JQ6L 3ARSA 3PWVB 1I1FA 2C1OB 5FYJL 3KYAA 2VTFA 4DQOH 1EA9C 2A38A 2VITB 5IROA 3D2UB 1TVBA 2HKHH 1F4AA 1YY8B 2VXVL 4LQFH 1ULVA 4JG0H 4HIXH 2H6PB 5EBLA 4MCZB 3SDXB 3K8MA 4KROB 3MRJB 2KKQA 5CCKL 1GIGL 3TYFB 1CXEA 1LP9A 4ODTL 1XR8A 1TPXB 2C7UA 5E6YA 3LCYA 4P2QB 1XT5A 3FQNA 3PP4L 4KTDL 4RGNB 3OKEA 2ORBH 3HNSH 4TN9A 1ND0A 4UMGA 1QD0A 3GMQB 1F4WH 1YQVH 2I5YH 5B38A 4MD4A 1UB5B 4KUCF 2GW5A 2BZDA 4YZFE 1NGXA 2X4PA 1WCQA 4ZQKB 1RJYB 2XKNB 4J6RL 1OQOA 1LMKA 2BOCA 5DMGD 2DQGH 2FATL 4GQ9L 3FL7A 5DRZA 4DCQA 4NQEA 1UACH 1NGPH 2H41A 2MCPL 2R29L 3DGGA 5F7MC 3S3PA 3TJEL 1JV5B 3QIWA 2QSVA 3OKOA 1VADA 1AGDA 1MJ7H 1BM3L 3MCKB 4AIZB 5CLWA 4HKXB 3MYJB 5J1TC 4JO4H 2BERA 1VSCA 4XCEB 2BHUA 1JF1B 1FFOB 1Q38A 4C56E 3A6BL 4U1LB 3G6JF 3KPSD 3QDMD 4ALAH 3CFDA 3LS5H 4GBXA 3V0AC 2PTTB 5C7XL 3SDCB 5JXAH 4ESKA 3NMEA 1UA6L 1CGSL 3R1GL 3CX5K 1CGTA 3O4LA 4R4NC 5TFSL 1JWSB 1ZK9A 4NHUA 1WBXA 5DVOA 3AVEA 4M93C 4NJAL 1MAMH 3C6SA 5LVEA 3QDJB 3WNKA 1ZE3C 3B2VL 1M4KA 3N85H 2GSGB 4Z9KB 5GGRA 1CIDA 1YYLH 1FJ1A 2DQFA 1B2WL 3HS0B 2EC8A 2W9EH 1B4JL 4P46C 2W65A 3TN0C 2C5DC 2BC4A 1QSEB 2H1PH 1EAJA 1HKLL 1EBPA 4CRPA 1WWCA 3Q6GH 4ZOAA 5I8KH 5F9AC 4KVCL 4I0PA 5BS0A 3QEHB 4H1LH 4XNZB 1I75A 1R3IH 3TYGL 1VEMA 4LGPB 1GGIL 3PUCA 2FBJH 2AEQL 1IGCH 2Y6SC 3PWNA 1YZZA 2ZKHH 4KK6C 1IT9H 3D0VA 3MXWH 1D9KD 4PRIB 4K55A 5EWIL 4AZ8A 3E8UL 2XNAB 4G9FE 2YD9A 1J9CT 5ANMA 2O5XH 4G8GD 4NFCA 5GGUB 2GJJA 2HN7A 4LLDB 2OJEB 5DJXB 2QJDA 3TBTA 5KG9A 3EO9L 3NIFF 4MSWA 1Z2KA 1T80A 5KSAC 2BSTA 3UTZA 4N0UB 4R8WL 3VRJB 4CVUA 2XN9B 5FHBH 2G9HA 4JHAL 1R5IB 5BV7B 2R4SH 5K59E 1JI2A 1YMME 2I07A 2VDNL 1SYSB 5IQ9B 2Q8BH 1QEWA 1Z9OA 1U8JB 4PREA 5EFIB 1AGFA 4UDUA 1Q0YH 3H3PH 2DQCH 3FOMB 4XPFL 5CZVH 4PJFB 5D6CA 2EDDA 3KYKH 1XGRA 4WFFD 1VCAA 3HUJF 1A7OL 1QYGH 3GSXA 3QEQA 4Y4KA 5C2BL 3WE6A 1T1YB 1AO7B 1E27A 5E99L 1X4XA 3T0XA 1K8IB 4HFWB 3WSQL 1IAOB 2UV3A 4IRJC 5FHAL 5FGCE 4PJBE 3IDXL 2X7LA 1A22B 3MV9A 5I76A 4OFYD 3T77B 1YUHA 1KYOJ 3C9NA 2A74B 2PXYC 3TBWB 5BO1L 3IDYB 5FYJH 4G6AC 1BX2B 1ZLUK 5J11C 4X83A 3TZVA 2EIBA 3GSWA 2HVKA 3F12B 2FIRT 1X5LA 2I9LB 2V7HA 2XYCA 1CDGA 5D1QA 1NFIA 2CIKB 3L7FA 2ED7A 4J7RA 4KGJA 5C0DA 1MFAL 1RFDH 3P11L 4HD9A 1KCKA 4QXUH 5EORH 2P5EB 1EEQA 1BD2B 3I9GL 1X3DA 3DXAD 3MLUH 1OAYH 3SE9L 2EZ0C 4PLKD 3D69B 3OJVC 4XP9L 1X4ZA 3PNWB 4Q9RH 4JQXC 5C0AE 3BE1L 3S36H 1ONQA 3OKYA 1HHKA 4JO3L 2ICWB 1R3HA 3IFPA 4NZJA 2GCYA 4RDQF 4EN3B 3MLPA 2W0FA 4JHWH 4GAGH 1ZT1B 3KPMA 1FIGL 1N59A 4XCCH 5CJBA 1FRGL 2FATH 4G7VL 3AS0A 5HVGB 3U9PH 4DJMA 1UQSB 4P48A 2W0KA 1HIMH 4PJ9B 4IIQB 2NY5L 4GO6B 3WCYA 2DICA 3TJEH 2FIKA 2UZXB 5D7KD 1WZ1L 3ZYZA 2AXGB 4P4KD 3LKRA 4YHOH 1IC4H 3RA7L 5HHNA 3LVEA 4Y4HC 1BVLB 3L3IB 5IVXB 3DBXB 3Q5YA 4U7MA 3GUTB 4LLMA 3UYRH 1MH5B 3O6LH 3H0TA 5TJWK 1JZ5A 4X7SL 1BGXH 1HHGB 2CGRL 4OF7A 3H9SA 5MI0B 3KYOB 4LHQB 5I2IA 5BVJA 3VXPB 4WO4D 3P4MB 5IJVB 1T4KA 3LSOA 4X4MA 2HMIC 5E03A 2WUCL 4X6CA 2OR7A 1C12B 4ZNCD 1DBAL 4OKVB 5DT1L 4EKXA 5B3JF 3HZVA 4NJAH 4R26L 5HJ3B 4HXAL 1RQ5A 4V1DE 5EU3A 1A3QA 1NDMA 4M02A 3TIEA 2QADB 1S7UB 4GG8A 1AHWC 5DZOA 4J3WA 3HI6L 1QBBA 3HE7B 1B6UA 2V5MA 1IM3B 3QNXB 1YPZF 5MHSE 5D6DA 1V7ML 1VFAA 4YE4L 3C08L 4QF1A 3F8UB 4FQXC 4HF5L 2DWEB 4LARL 3QH3A 2RFXB 5HYJE 1YN6A 3DI3B 1UC6A 1VKXA 1DE4B 1W72L 3WDHA 4U1SA 4G5ZL 5D7LE 5DEFA 4LMQE 1TTGA 2X4RA 5HYEA 4NHCH 1U8MA 3OX8B 2HH0L 5IJKA 2HRPH 5ESQA 5IV2B 1A6VH 3E8UH 1GHFH 1G7LA 2R56L 1U58A 3PDDA 5CJ8A 3U7WL 5CUSL 2MHAA 4OIAA 5I15L 2W9DH 1BJMA 5AAMA 1RAMA 2HAZA 3MTRA 3QZWG 1J05B 2IH1A 2OYPA 1S7VA 4JHAH 1J8HE 2VDNH 3ALPA 1BIHA 2N7BA 3V7MA 5F8QC 2O5ZL 4CW1A 1FSKB 2P44B 5F3BA 5C08B 4H1LA 3RGVB 1GGBL 4XVUC 5INDB 6CGTA 5F9WB 4R4ND 4NC0B 3U9UB 1E4XI 1KBGL 2X40A 3VGHA 2BSRB 1JZ2A 4Z7NF 1NEZG 1MI5B 4RBPK 3DUSA 3QDHA 3F58H 3FQTA 4IRSA 2F19L 3BP6A 1X9QA 3OBAA 5BO1H 2IPUG 3TGXA 2VOTA 2YPKA 3VJ6A 4DZBA 1KCSH 4R6UA 1QG3A 4X80H 4AMKH 4P46D 1HCFX 3U7AA 3TN0D 4N9GA 3BESR 4N8CL 4Q2ZA 5J1SC 1MFAH 3T1WA 3UTQA 5CEXA 3GMOA 1I4FA 2Y72A 4R97B 2HJFA 5I30L 4OIBA 5E9DE 3TP4A 1FE8H 4JQVC 3CH1A 4I77H 3BP4A 4YJZL 4WGVB 1OT1A 2VXUH 5T1MB 5HPMB 3N1GC 4YDVB 3PHQB 4PJGE 4KTEL 2RB8A 1DTUA 1A9BB 2XICA 2Y6SD 3ZDXF 1PX3A 2IAMA 1RJCA 2H8PA 5FA4A 2J5LC 2O26U 4KK6D 4E5XA 1SJXA 4XMKH 1AFVL 3QZWB 2NR6C 1I1RA 5IMOA 3FQRA 2A6IB 5BZWA 1Q72L 2D9CA 2IJ0C 3KPRD 2AJYH 2DL9A 2P8MB 1F90L 3AXLB 1MIML 4PUBH 5IB5A 4WDIA 5KSAD 4AIXA 5DJ2B 1CLZH 1HE7A 5EO0B 2V2XA 3RZCC 1PQZA 4KKBC 1TNNA 1TZHA 5IKCB 3RY5A 1CF8H 3RAJH 3KHOA 3G04B 5D2LB 4P5TA 1RIHH 5E8EA 1RK1A 4X6EB 2GJ6B 5DJDB 3EJJX 2DLTA 3PQYA 3WNNA 2VISA 2H45A 1NEZB 4BSWA 4GRLB 1B0GB 1U8OB 2ZZUT 1QQDB 25C8L 4PRPD 1N8ZB 3IKCA 4CNIB 5C09E 1LILA 2ERJC 4IRJD 3FT2B 4PV8B 1LO0H 3PGDA 3V4UH 2ATPA 3NACH 4JR9L 3ULVF 4CGTA 3B8YA 3HA0A 4OFVA 5MERB 3TEUA 4R26H 2DM7A 4HXAH 3F5WB 4G6AD 8FABA 3T65B 4L9LC 5CWSB 1F11A 3MRGB 3HR6A 2VDPL 3FFCA 3TCXA 1DEEA 1DANT 2DQDL 3ZE1E 3T2OA 3IU4L 3EYQD 1JWMA 4M1GH 5T5FH 2PO6A 4POUB 1XF2B 3L5WA 5GS0L 1NMAL 2FZ3A 3HPLA 5DJCA 5IMKA 5JNYA 2R2BA 4KGLA 2BY1A 4FFYH 3WD5H 5JW3L 1UYWL 4YE4H 1S7XA 2ATKB 3QIBC 4CVXB 2EZ0D 2C26A 4XPBL 3ZHKA 3MA7A 5KSUB 1QVOA 1S9WA 4QRPA 3K4DA 3AU1A 4E41D 1CZ8L 3T0DA 4N90E 2AKRB 4ONGL 1W72H 5E0QA 2OL3B 4Z78A 1BFTA 1KIQB 1X4YA 4JQIL 2IGFL 4F3FB 5DRNA 4NBZB 4C4KT 3R8BB 2NY5C 4KRPC 1LP9E 5FOBA 4CMMB 1A7PH 2BJMH 1F58H 2PF6A 4P49A 4G8EA 3KDMB 2R56H 5SV3A 1AY1H 1KCRH 2G5BA 2OXGA 1EHLL 1FNHA 3PDOA 3P0GB 2NY1C 3IU3A 5DVMA 3KLAA 1QFWL 1LK3H 4Y4HD 3TO4D 1E6JL 3AROA 3MR9A 4HHAB 2BHZA 4X9IA 4GS7C 4XXCA 4NQDE 4MA1B 5EUKA 2IH3A 4ONHB 4NCC2 5EBMB 4NQEE 4X7DC 1OTTC 5FM5M 3P77B 3OZ9L 3R0NA 5ICZA 1CDBA 2VQTA 3BKMH 5GSVA 4HS3A 3HN3A 3NAAL 4NN7C 1MCHA 3GMLA 5TH2B 4Y5VB 1NL0H 5K9OA 3B9VA 2HMID 1U8QA 4WCYL 4LLVA 3SGJC 1RUQH 1TENA 5JOFB 3OAUL 3SDAD 3FJTA 2F54B 2PYFB 1FFPA 2FX8L 3LEYL 4L8BA 3WXVL 3BH9A 3VFPB 3HG1A 2X4NB 4LAQL 1HDMA 1LD9B 3WNLA 4DTGL 3QNZB 1DN2A 2FDBP 3KPPA 5T33H 1MJJA 2OQJB 3F7YB 5D2NC 3G5XB 4LIQL 5MEPA 3DTXB 3O4LE 3VFMA 3NFPB 1INQA 3M1BA 1TZGL 4XPGH 1LE5A 4WI3A 1AGCA 3FQUB 3P0YH 1AGEA 1KTLA 2C3VA 4N8CH 4X6DA 2LVEA 5L9DH 4U6YB 3EUUA 3PP3H 5J56B 4JANA 1I1AA 3K1KC 5I30H 3HUJA 1I3RA 4OCRH 2X4OB 5EO1B 4XH2A 4WJ5A 3NPZB 3UEZA 2CH8A 2R69L 1UJ3B 3BDBA 1IGFL 4ZSOB 5DURB 2P42B 4LCUA 5INCB 2YPLB 3IVKB 5BS0E 2CUIA 5ADPH 5DR5L 4WFHD 5HGHA 1F90H 3WO4C 1INDL 4OCLC 5I1HL 3H6JA 4FQHA 3F6IA 2X9YA 1HXMA 1WFOA 5KSVA 1J18A 1IQDA 3B9KC 4PB0L 4JCMA 3RWJA 3ZTJG 3L3OB 1JPFA 1WTLA 4KHTH 5ANME 3VI4F 4GMSL 1FNGA 1R0AH 1CQKA 1QFPA 5ADOL 1L7IL 1NDGB 5BVPL 1XGYL 5DQ9A 4XVUD 4NKDB 1S7QA 1MWAH 1G1CA 4N0FB 3PL6C 4W70A 3U4EB 4XRCB 3HRZB 2EDHA 1JE6A 3BKYH 4NQSA 5JXED 3ULVH 2XQYK 5KOVC 4Z76B 4OLEA 2IBGA 4OZIF 4FS0A 3WIIH 5D7JB 3L3DB 5HHMB 3QEQE 4LLYB 3ZKMC 3KPQA 3RL2B 3QXUA 4NM4L 4AG4H 3ARDB 5IOPB 4HLZH 1MF2L 3UBXB 3KJ4C 1GC1L 1N7ML 2HLAB 1KJVB 2Q3ZA 2A9NL 3BW9A 1NMAH 4OCXL 2OR9H 5IT2L 3MV9E 5DJ0A 1RK0A 1T66C 4JHZA 4CDGC 2MKWA 4Z7VF 5SX5H 5JW3H 3ZKXC 5DEZA 3C5ZA 3RPIB 1EZVY 3DX7B 1J0YA 2FSEA 1NFKA 1FO0H 3C2AH 3MACH 4MA3A 4PJAF 5GS2D 3RVUC 4XPBH 1WEJL 3CFCH 2ICES 5KS9F 3CAFA 2VO5A 5K33A 2EIZB 4MNGA 4P5KB 4ONGH 5DDHB 5ALCH 2CSPA 3RUGF 2NR6D 3KYNA 3MJ9L 3LKSA 5CEYB 2R0WL 3AUVA 4H25B 4XMLH 3SJVA 3BZ4A 4ONOA 4TRPL 2FH8A 2J3SA 4JFOB 4G6ML 32C2B 4NIKB 1U36A 2ITDA 4GKZB 2GTWA 3RZCD 4KKBD 2FL5A 3IDJA 5BJTA 4BA8A 4NQCD 4C56D 2Q7YA 2WINA 3GSOA 3BZFB 4JFYA 4EVNA 1E6JH 4GKSA 3IS1X 2Z0BA 4D0BA 4XCFL 2CLRB 5HPOA 4G6KH 4MXQD 1M71A 2UUDK 1FNEA 5E5MA 2LFGA 3VGGA 5BRZB 2YBRA 2SEBB 1BZ7A 3HB3C 1NCCL 1TITA 3WIFB 3OKKB 1W72A 1RJZB 1XGUA 4OM1H 1XF4A 4WCYH 1C5BH 4ELKB 2ZUTA 4K3DL 3VI3E 1OLLA 1MPAH 1FZKA 4LSTL 1N0XL 4OZFH 1JHLH 4LAQH 5GS0C 2BRQA 1ZAGA 4MNQA 4DTGH 4JFFA 1MOEA 1U95A 5HGAA 3T3ME 2C1PA 3CDGB 2DS4A 1NBQA 4RAVA 4X4ME 3W0WD 4DVBA 1OAQL 4X6CE 4WEUD 1QRND 3C8KA 5C2UB 2BVQA 2QEJA 4YHLL 4XMPH 3B5TA 2XA8H 4YHNA 3L5JA 3DO7B 3QIBD 1FPTH 3NN8B 4QRRA 3CIQA 1F45A 1ZHKA 4HGKC 4F9LA 4NBXB 3TVMB 1CT8B 2Y5EA 3VXUD 4V1DB 4YEEA 4G9FD 1OAXH 5D8JL 3MC0A 2R69H 4O2FA 5KTEL 1AP2B 1D5MA 4KRPD 1H3WM 4EI5A 3STZA 1ITCA 2HJKA 1KB5H 4U1KA 3TV3L 5ISZD 4ZFOA 4TNVF 3NCEB 4ZMAT 3PWJB 4ORGB 1B6DA 1OARH 2AI0L 5I0ZA 1YMMD 5I1HH 2NY1D 1U3YA 2AABH 4NRYB 2ED9A 2WBJB 1QFWM 1L6ZA 2P49B 4S1DC 4KAQL 4F7CB 1T1ZA 4O2CB 1Z3GH 3NIDF 3U4BL 1JN6A 1R5WA 1IKNC 1ZSDB 4GMSH 2ZCKL 2OJZH 5ADOH 1OTTD 4NN6C 5D7LB 1DLHB 1BVKB 5IMMB 4H5SA 4RA3A 2B2XH 4L4TE 3WMSA 5JO5A 4HMCA 2EKSB 2R39A 5JOPE 4HT1L 1GGTA 5FCSH 4MD5A 5AUMA 1OT2A 2YPVL 3V2AR 1A7BA 1FCCA 4PJEF 1RSFA 5BZDB 2Y07L 4RIRA 2OMNA 5JOEA 4DGIL 3F7VB 1WIUA 2V5RA 2HT2C 3JWOH 3I84A 1J8HB 2VDML 3D18A 5JZ7C 2ADJB 3VFNB 3VMNA 5HHQB 2YEZB 2IPTL 1EEZA 1E28B 5D5MB 3ILQC 1MQ8A 1OAUL 4J1UB 4LCYB 5L0QB 2KZ1B 2A9NH 4UB0H 4D2NA 1PZUB 5CEZL 2X70A 5ITFA 3K3QA 4F7PA 1P7QB 3QEUA 5J12B 4KU1A 3CXHK 5K9JL 1RY7B 2Y06L 4ZUTB 5C0AD 3Q1SL 4JLRA 4MB5A 5HGBA 1CXKA 2IPKB 3O0RL 1WEJH 1S7SB 5E2TL 5KANG 2XT1B 3WL9A 4JFEB 5JUEH 4P9HH 3BUYA 4H88H 2AV1A 2F5AL 2MKLC 3TNMB 4L3ED 1UH4A 2GSIA 1KJ2L 4MWFA 4N68A 4X4XB 3U2SA 4F80A 3MOAH 2OP4L 2R0WH 1PVHA 4NWUH 2BSSA 5D93C 4IOSD 4UNTA 5HHXL 3LY6A 3EW3B 1D5ZB 1T0PB 3B9KD 3PV7A 1IARB 3RIFK 3JV4B 5E9DB 4JDZA 5IB3B 1S78C 3AM8C 3CU7A 5DFTA 1K8DB 1CU4L 4PRHB 4PGJA 4PJGB 3S35H 3VWKB 4JN1H 3P30H 1A3LL 3RWGB 5FYJE 1NCDL 2X1XR 2CKBH 2IBBA 1KXQE 2OLDA 1KN2H 5F89B 3PL6D 3JBG7 1G7QB 3RIAF 1CGXA 1MFEL 3UTTD 4JZJB 4F7EA 2GK2A 3EO1A 3RWCA 4AEIL 4XBPA 2F5BL 2QQNH 3CC5B 1TTFA 4XP1H 1BLNB 4DVRL 1CD8A 4ZXBC 1IC7L 3G5ZB 5FUZH 5F93C 1GC1C 3PQYE 4LSTH 5FA3A 3SDDB 1A3RH 4WU5B 2ICWI 3ZKMD 3FN0L 3TBYB 3QDMB 5T5NG 5IBLD 1CFVL 4XBGA 3WS3B 3I02A 1VESA 4NO5B 3MV7A 5CBEB 4BZ1L 5I8EB 2CJUH 5B38G 1T66D 3RX7A 3IDNB 4LSPL 1I8IA 2A2QT 3GO1H 3L3KB 3ZL4L 1LNUA 5F97E 5C09B 3FFCE 3SKMB 4MZ3A 4QXGH 4N5EC 3RVUD 2EH7L 3MLWL 3MYZA 3RGHA 4PTUB 1QNZL 5CJXC 4FABH 1LE9B 3BEVA 4GAJH 3HRPA 4LF3A 5ESAA 1IGYA 4BKLA 1T0MA 2APFA 3GIZH 4JY6A 1R3JB 2D7PA 3G6JE 1KOAA 3GK8L 1NCNA 4KQ4L 4NUJB 1CVSC 3CVHB 1AGBA 1RZ7L 3P9MA 4YHZL 4UILH 2PYEA 4QRPE 4Z0XA 5HDLA 2AI0H 1H5BA 1TVDA 2Z4QA 4X98B 1KELH 5LJYH 1E4XH 5DD1L 3MXVH 3W2DH 5JHDD 2M2DA 4LKCA 1TVBB 4OZHA 4BQ6A 4LSVL 4MJ2A 5SWQA 3VRLF 1M7DB 4QWWC 2P48B 4M6OL 1CXIA 4K94L 4HX1A 2LAGB 3JVGA 1WIPA 3UTOA 3EFFA 4Z0BL 2R2HA 4X9GA 3WXWL 3GB7A 5F9DC 3I3BA 1W0WA 3X12B 1F8TL 3AAZA 1E6OH 3TT1H 3UPAA 3X3FL 1XR8B 1JPGB 2C7UB 2VRAA 4PBWD 4X6FA 5DRWA 3HB3D 3DV6B 3FQNB 5TQ2H 3OKEB 4TULH 5IFHH 5D1ZA 1YY9C 1ND0B 1MELA 1PKOA 5GS0D 2Y07H 4Y4KC 3V52H 4OB5L 1KB5A 5B38B 4DGIH 1HZHL 3BXNB 5IGXL 4Y1AD 1NGXB 3S37L 1A6TA 2QQKL 2BOCB 4XNMA 5DRZB 4DCQB 5A16B 4LP4A 2ED8A 4ZPVA 3FAXA 1KLFA 2DB8A 2AVGA 3LEVH 2F58L 2VIRA 3DGGB 1OAUH 3QIWB 3LQZA 1TCMA 3HG1E 1HNGA 3KPOA 1AGDB 4IMLA 4X0KA 1OP3K 5F6IB 3NIFE 3RTQA 1P84J 1OOAA 2Y06H 3SOBL 3U0TA 2E7MA 3ARFD 4PBXA 3HTLX 1SM3H 3WIHH 3DMMC 4MD0A 1IMHC 4P99A 4YHKH 4U0RB 4GBXB 3TWCL 3WDJA 4YK4B 4FZ8L 4GSDH 1HN1A 3DO3A 3DRTA 2BVUA 4OZIA 1F4YL 3CFEA 3O4LB 1A64A 2F15A 1B88A 5FCUH 4TNWK 3HUJE 2DQTL 1WBXB 2ICWJ 2F74B 5EOCL 3SBWA 2APWA 1RZIB 5HHXH 3CFIC 5LAXA 1TZIA 3SE8L 3QFJA 4YDLC 5F9OH 3S5LG 4S1DD 1KT2A 1FJ1B 1L4IA 3CSGA 1GOFA 2DMKA 5CINL 3HAEH 1MJ8L 2X1OA 5LBSH 5CJQH 3ORJA 2W65B 2R0ZL 2WLZA 3BO8A 2BC4B 3WFEL 4PJAA 1Q1JH 2EDTA 3FFDB 5KS9A 3WEXB 4WV1C 5BS0B 3ARBA 3ZTNL 3NZHH 2Z31C 1U3ZA 4TSBL 4N5UA 2RAMA 1G7PA 1ZMYA 2JJTA 4QRTA 5EIVA 3EO0A 4ZS7L 4CBPA 3PWNB 3D39A 1KGCD 1YMHA 2HT2D 4FN0A 1P4BH 3D0VB 4FQIL 4HKZA 1WLHA 4Q74A 5JZ7D 4D9RD 5F96L 5E8DH 4OQ1A 1JMXA 2VQUA 5DMKA 2HN7B 3ILQD 4M3KB 5J06A 4BZ1H 1G1YA 4MSWB 1CFTB 3RZWA 4D9LL 2BSTB 1P4IH 3UTZB 1CFBA 4DEPB 1A6PA 3QUZC 5F1NA 2J8UB 3Q5OA 4KKCC 2I07B 2NYYC 1KENH 3PGCA 1AGFB 4UDUB 5IMLA 5IFAL 2CKBA 3BEWA 2HVJA 1KTRL 2CD0A 5J6HA 5D6CB 3ZKNC 2ZPKL 4WEBH 1XGRB 1QSFA 3OKDA 3EJYC 3CFKB 1G7HA 3GSXB 1I8LA 1YJDL 1E27B 3S5LB 4W6YB 2IBZX 4I5BA 1J0JA 4JEGB 4N8VA 1FYTA 2X7LB 3LMJL 4HGWB 3MV9B 4S2SB 5I76B 2DD8H 3C9NB 4AT6A 1OGAD 4MNGE 2ZSWB 5AWNH 1NANI 4NQDD 4MJ6A 3CVIL 2D7OA 5B3JE 1S78D 2DWDA 4NWTH 4A2LA 3TZVB 1P6AB 1ZS8A 4HSQA 5DD1H 3GSWB 3SDXF 3V0WH 5F7UA 2EYTB 1PYWA 2V7HB 1YEGL 3MLYL 4Z5RA 5D1QB 1NFIB 4PY8J 3SJVE 3L7FB 3S4SG 4M6OH 5C0DB 4L4VA 2GJZA 1I3GH 4NQTA 3FQWA 1TTUA 1RUAL 3C6LC 5F1KC 2XZCL 2NY2C 4OCWH 5EIQA 1YPZE 3LRHA 5IP4A 3U6RA 1EXUA 1G7IB 3X3FH 3B9EA 3D25A 3FOLA 1YYML 4HCRL 1MREL 4OZ4A 1T03H 4ZXBD 2JKXA 1UCBL 3HNTL 5T3XL 2B1HL 1R3HB 2YA0A 4AEFA 4OCSL 2GCYB 4NM8L 1ODAA 2W0FB 3JUYA 4Q6IA 5MENB 2YKLH 1CL7L 3U1SL 4BSVA 3RX5A 2AJ3A 3KPMB 1KACB 2X89D 3MFGB 1CGUA 4K7FA 4HMDA 1U8KA 1V05A 3MGTB 1A6AB 3NA9H 2EDOA 4HJ0C 1V7NL 2W38A 2FIKB 1JMZA 1MLCA 4MNQE 3QHZH 1EFXD 1OCWL 2EE9A 2B0SL 3LKRB 4GRMB 5SWZA 1R5VB 2AGJH 3SE4A 4LLMB 4ZFFA 3L5IA 4HUNB 1NAMB 3H9SB 3ULSA 2E5EA 1EO8H 5I2IB 5BVJB 4LHJB 3TWCH 1VGEL 3LSOB 2XWTA 4P46B 3BX7C 1G9NH 4QNPF 4WUUB 4QRRE 4F33A 1MVUA 3EYFA 3L5XH 3KWWB 1YA5A 4YBLC 5GS1C 3RKDD 5C0NC 1TVHB 4H1LG 4Q97A 5KJRL 1YNKH 3S4SB 4K94C 4H26B 4CAGA 5EU3B 1NDMB 4U6HA 5AD0A 1B9ZA 4Y4FC 3I6GA 3UJJH 4Z7NE 4O4YL 1IM9D 2OXHA 3QYCA 4JFZL 3LN4B 1DUYB 1GAFH 4XPTL 4QWWD 4K7PL 3LDBB 3UAJC 4D3CH 4XP5H 2J88L 4Y5YC 3VCLA 3MRMA 4Q58C 2NZIA 4G8IA 1A02N 5LGHL 4ETQB 3L3GB 3WFDL 2YWYA 3QUYA 4G80A 4HUVB 5C6TH 4NOBA 3QH3B 4JCLA 4KK5C 1YN6B 3FO9A 1VKXB 3FB7A 4WUKL 1YY9D 4B5EA 4ZS7H 4U1SB 4Y4KD 3QUKA 5DEFB 5ID0B 1KJ2A 4MDIA 1QZ1A 1WT5A 1BQUA 2I60H 2VABA 3ULUF 3R8QA 3ZDXE 3QWOA 1V3KA 1T7XA 3FT4A 5ESQB 1RHHA 2WK2A 2A1WL 5DJ8A 3CMOL 1CBVH 4RNRA 3RWFB 1BJ1J 1U58B 1UZ6F 2A9ML 3CPLB 2NXYC 4L8DA 4LVNC 1J7VR 2G2RA 3QAZB 3N1PC 4D9LH 3HAEA 2IH1B 4IRJB 4UAOB 2H26A 4PJFF 2BNQA 5E8NA 2VLLA 1NBZA 4BFBD 1CDIA 4OTXL 2PXYB 1JFQH 1ZGLA 1LK2A 3FO2A 3DMMD 2YMXL 1T5WA 5IWLA 3V6BR 4M5ZH 4PJDF 4H1LB 5ETUB 1EDQA 4QRSB 1NAKH 5DRXB 5HDOA 3R06A 1RIUL 4MA7L 4I4WA 4UBDC 4FQLH 4M6NL 4KPHH 1UXWA 1F13A 5LKNA 3RL1B 2HRLA 4S1QL 2M26A 4LBEA 2HJLA 4XVTH 4KTYA 3PJSA 1XZ0A 1PSKL 4IRSB 1T89C 5DVKA 1C7TA 5GRJH 4C57C 1FVCA 3CVIH 3ULVE 3RVTC 1NGYA 4R90H 4R4BB 2XZZA 4OGYL 3TH3T 3VJ6B 4DZBB 4QO1A 4FTVD 4V2CB 3BHBA 4KI1A 3UBXI 1CICC 2JIXA 5FO7B 4J8RA 1EHAA 3GJEA 5CEXB 3GMOB 4KY1H 1QHOA 3NABL 1IAKA 5I1LB 2HG5A 4GT7A 1LEKA 2GKIA 3CH1B 3BP4B 1DANU 4FQPA 4OF3A 3DSNA 5IHUL 1GZPB 4D0DA 3UCRA 5FA4B 1TCRB 2H8PB 3L9RA 1UCBH 2P5WA 5T3XH 4LCIL 3KXFA 3I50L 3H42H 4NM8H 3TPKA 1JTPA 5CEZD 1JHKL 1NCWH 3ARGC 5D1XA 1P5VA 1ES0A 5BZWB 5GGQL 4ODSH 3LAFA 3DYPA 1B3JA 4MDJA 4FZEL 1YEHL 3OF6D 3QIUA 3SKUD 3WBDA 1MCBA 3PHOA 4P3CL 3QUZD 2ZUXA 4HKJB 4UV4H 4L3CA 1TZHB 4TSAL 2NYYD 4Z77A 4LPVA 1D6VH 3W9EB 1DDHA 4P5TB 3QCVL 1BZ9A 4MLIA 1OP5H 4PJCA 1RK1B 4U1MA 4BQ8A 3MV7E 3ZKND 3CH8A 1FVDA 3PQYB 3EJYD 1I1AC 5E6ZA 1VFBA 1RUKL 4JFPA 4G6JL 1UM6H 4DZ8A 2Y5TB 4R0LA 5EA0H 3T2NL 3V0VA 1M6OB 4IMKA 5ACMA 4Y19A 4YPJA 2ATPB 4FQXB 2EE3A 3EZJB 2Y4SA 1FZOB 5GJTL 4NYLB 3W5NA 1IE5A 8FABB 2VE6B 2R8SH 3MLRL 3V6FA 1F11B 4F37K 1S5IL 1JNLL 4XGZA 4L4TD 1JWMB 1A21A 4ODXA 2PO6B 4KJYA 3IDIA 4HS6A 2FD6H 4K7PH 2FB4H 2FZ3B 3HPLB 5DJCB 5IMKB 4P2RD 2PYEE 4M6AA 1JYNA 3C6LD 4PGCA 2DQJH 2Z8SA 1MHHA 4PJHB 3ZLQC 1UB6A 1DVFC 3MA7B 1QVOB 4OZHE 1S9WB 3O41B 4ODVH 5JIKA 2EH8L 5D4QA 3C8HA 3AU1B 4ZAKB 4JKKA 4WUKH 4CADA 3L3JA 3PG2A 4Z78B 1G6RL 1X7QA 4JDVA 5FECB 5DRNB 5E4IA 1BJ8A 1S8DA 1OPGL 5FOBB 1MRDL 5DHYA 4G3YH 4OD2A 3MNVB 5DI8A 5C9KA 4G8EB 3WS6C 1VA9A 4LLAA 3OXRA 4HBQA 3EYUL 4HJ0D 4LRIA 4JREB 4RCAA 3IU3B 5GZOD 1ZT7A 4OLUH 3HI1B 4Y5XA 4LHUD 1UEYA 4OTXH 4X7TA 2J7LA