2NX5D

Crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVQASGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA-B35
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 188
sequence length 188
chains with identical sequence I, N, T
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5D02
4Z7WF 4G6ML 3WLBB 2X4RB 4LRNH 4WW1A 3TLRA 3VI3E 1XGRB 2HN7A 4M6OL 5MENA 1BBDH 5F89A 1JYWA 4I3SH 4KJQD 3MNVA 4C83B 5SWSD 3LH2L 4U6TA 5B8CB 4FZ8H 1JPTH 5GRWA 5C6WH 1RUQH 5GZND 2V7NA 1S5HA 3TYFB 5ISZE 5I1KL 2G9HA 4XXDA 1BFSA 2PETA 3P4MB 4MLSA 1FLRH 3I6GB 4LRIA 5DURB 5EZJA 3T3MF 2H8PA 3O2WL 3VRJB 4P57B 5EC1A 3X3FH 1MFAH 1UH2A 5IW6A 1FG2B 1NEZB 3RL1B 1M4KA 5FGRA 2PR4L 3QXWA 2O61B 3S5LA 4YBLB 5MEPB 2YPKA 2MQ3A 1CYGA 3O6FC 1ZV5A 2MPAL 4CADA 2H32B 4PV8A 3GSVA 4QYOB 1UM6L 5C0JA 2W0FA 4Z77A 4NN7C 2I60H 3RTQA 2D0GA 5CEZH 2WK2A 1A3RL 4M48H 4PJ9D 3WS3B 4NWUH 4MXWL 2DWDA 3TBSA 2ZUQC 1EZVX 2WBJC 5IW1B 5HHVL 1PG7L 3UPRB 1HSBB 4N5EC 3KVQA 1QFUH 1EFXA 5HBBA 1CDCA 1XCQA 3QWOA 5H35B 3DIFA 3I3DA 2LFGA 4NNXA 4PJDA 3NFNB 3DETC 5CD5C 5EBWB 1ZVYA 2XN9D 1PY4A 3CZFA 5C70A 2FATH 4R0LA 1JFQL 3GBLA 1KB5L 5DRXA 5F9DC 4NNPL 3QQNA 3QUMA 1X5AA 2BXZA 3OHXB 3MTRA 1IFHH 1I8MA 4R2GB 3WNPA 4Q6IB 4EDWH 3EGSA 4TPRL 4YGVB 3PWPA 5D71L 1LE5A 2Z91A 4KK5D 5DK3A 4DW2L 2BERA 5IMOA 5HJ3A 4D94A 2KKQA 5I1AB 5I1EH 5I2IB 4EUPA 1FORL 3RUGF 3MPCA 5CBAB 5K9OB 4P59H 2HTKC 1JUFA 4KDWA 3ZT5A 2FECL 3VXQB 4ZFZA 4FQ1H 4PGDB 4Z7UF 3M07A 5D2LF 2Y23A 2QSVA 2F74B 3T65B 2P8MB 4WV1A 1YEDB 3CLEH 2APVA 3T8XB 4D9LL 4N0YL 5GS0L 1HZHL 2W1NA 1MRFL 4G6JL 5DUBA 1Y0LA 1T6VN 2IG2L 4OQTH 1F4YH 1MQKH 2PXYD 2ZUUA 4TYUA 4OCSH 1DQJA 2HKHL 2V6HA 1WFOA 1TQBC 1AC0A 1MIMH 3SY0B 4NDMB 4ODTH 2DOCA 4ODXA 3OPZH 5IT2L 3PHQA 3QEQD 1A0QL 3RVXC 3GHEL 2EH7L 4UQ3B 4EVNA 3WHXA 2R23A 1BFOB 1FNEB 1NMAL 2I5YH 1OF2A 1INEL 3VGAB 4YNYB 3ULVH 4I4WB 2NY1B 2ARJA 4XVTL 1U8OA 4XNUH 3VJ6A 2CIIB 3HTLX 3RVVC 1S9VA 2Y36H 1T1YA 1M05A 1M6OA 5EH1A 3STZA 4EI5D 4WJ5B 2HFFB 1J1XL 2JJSA 8FABB 2X5PA 3BEVB 4M5ZL 4YXHH 2AJYH 4ZTOH 1RAMA 1FFQA 2OL3B 1NMCB 4PREA 3JV0A 2EH8L 1T83A 2NX5E 4K3DH 4Y2DD 1S78C 4GRLB 1O5DT 4APQD 1Q94A 1OGTA 5ALBL 2F9BT 2VABB 3QIWB 2GAZA 5IMKA 3FRUB 4UUJA 3DLQR 4Y5XC 5CS7A 4F7TB 3TO2B 2YC1A 5CLWA 2MSPA 2DS4A 3T0EE 4OI9A 3AAZA 3C6SB 2WUCL 2VQ1B 4LARL 5FECA 1OY3B 5ITFB 1AGEA 1JTPA 4LVHC 1FNHA 4QWWD 3BGFC 3VGGA 3ZZ1A 3T4YA 4YIQB 4LRIC 4AT6B 5DA4A 2NW3B 4Z0BL 1BP3B 1C08B 4U1LA 3SKNB 5J6GB 4ONOA 4J6RH 3DO7B 2V5YA 3KR3H 2Z4QA 4HC1L 1QPXA 5E2TL 2EIZA 1Q38A 5HI3D 4QTIL 2I26N 5DMIH 3S5LG 4WVRA 35C8H 5C08B 3MNZB 5IB1B 2BOCA 1OOAA 1MQ8A 2BJML 2CUHA 3RTQC 4XGZA 5EPMA 3IGAB 4JY4A 5GRXG 3OKDA 3H2WA 2CRIA 1FYTE 1K5NB 1F4HA 5KW9L 1IZJA 2BVUA 1NGQH 2YOCA 3GSQA 4S10A 5E9DB 4LKXB 5I74C 2BK8A 1A9EB 1NGZA 3QIBA 1R3HA 4CBPA 3VFTA 5CP7B 1AD9B 5HI4D 5HD8D 4HT1L 4Y4FA 4R0LC 4KDTA 2HT3C 3FFDB 4G43B 2MJWA 4HLZG 3QDJD 3BP5B 4R4ND 3GSNH 2IBZX 4GKZA 1OAZH 1HIML 5T5NF 3SE4C 2V2WA 2Q8AL 4I48B 3ZYZA 5CSZB 1OTSD 3FTGA 2P5EE 2J6EL 2BOBB 5GSRB 5HHOD 1VSCA 3H3PH 2NY6B 3BVNA 1HHJA 2Q20A 5JHDE 3OKOA 1OSPL 2OM5A 1ZS8A 5F7NC 3MLVL 4EUPG 1U95B 2AJXH 1JNNL 1IARB 2VISB 1ZEAH 1UCBH 3PGDB 3V9FA 2WM0A 2Z8RA 5IVZB 2Q76B 3DUSA 4OZFB 1HEZA 3UZQA 3BFOA 2UY6A 3KPRE 2J4WH 2DKUA 2KQNA 3IF1B 5D5MA 3W0WA 1J1PH 4JVWA 3ZLQC 1U36A 1NC4D 4E42A 1FL5B 4K9EH 3WL9A 2C1PA 3Q5OA 3REWA 3QWQB 1CFNA 3O3BA 4PJGB 4YDKL 3VFMA 3QCUH 3IRPX 4NP4L 4I3RL 3CH8A 3EAKA 4TTGA 3BO8A 5HHNB 5E0QA 3DUUA 4HKJA 1XH3A 3ZKMC 1WVZA 3OWEA 4IMKA 3KPPA 4KK9D 1C1EH 1Q0YL 1HHGA 3Q1SL 3HFMH 4TSBH 4PB0L 5FHBH 5J1AA 2VDPH 4G6FB 3VD7A 1ETZA 5D1QD 4JFPB 3IYLW 1EJOH 3QUML 4UV4L 4UB0H 1BQSA 1DBAH 4Y16B 3QWRA 1CN4A 1T3FA 1W0YT 4FG6C 3TNMA 4HKBB 3O6KL 3HUJF 1R0AL 4JANA 1MF2H 1ZK9A 2HT4D 5BS0E 1FHGA 3LQAC 3VXPB 1NJ9B 4R9HA 3NZ8B 1AY1H 4OIIH 5C0BA 3VD5A 5EOCL 5CAYB 1OLLA 5IK3A 1D6VL 3NIFF 2BNRB 5DQDH 4FZEH 2R0KH 5SV3A 1LMKA 3V7AG 1LP9A 1U8IB 1I7TA 4LSRL 2I07B 5EU6E 4QXUL 4ODUB 2B4CC 5JTWA 3G5ZB 4WFED 2BFVL 1V7NH 3I75A 5H8DA 4YXKL 5I9QC 4ZUVB 2BDNL 4LGRB 3V4PL 2XKUA 5F1NA 1PVHA 1ORSA 1RK1A 1ND0A 2OTWB 3ARVA 3DXAD 5TFSH 3O3EA 1KCVH 1LEIB 4GUPB 3SGKA 3KYOB 4RMTA 4XTRC 3WEXA 2OTUB 3SCMA 3D3VA 4F7CA 3OAZK 4J3TA 3QAZB 1TCRA 5M94B 2A6JB 5FO7B 3VXSB 1S5IH 4LBEB 43C9A 3I3EA 4LFHG 4UT6H 4MXVF 3DGCR 5EO9B 4WHYG 2BSSA 3KJ6L 4JFOA 3H9SA 4JPVH 3QJHA 2JELL 3ULUE 5IFAL 5EDXA 3SDCB 5I17B 4AIOA 4ONGL 2BNUA 3DX6A 2F15A 4LEOA 3F62A 3THMH 1JTTA 1BQUA 4KHXH 2FD6H 1N0XH 2NY4B 3I02A 1G7QB 5HYJD 4OLEA 2OP4L 1R5VB 3LQAL 3OF6D 2EDJA 3RWCB 2VDQL 3OGOE 2KPNA 2ED9A 2FO1A 1XR9B 3MACH 2BSTB 1JN6A 2VDNL 4RSVA 1T03L 1AQDB 4K23L 2ADIA 2CLVB 1NANH 1UZ8B 2D9QB 4JM2D 3WDHA 2IALB 3QIBC 3C09C 5E1AA 1L4IA 2CIKA 4LHQB 4ZPVB 1CICA 4PGCA 1QR1A 2H26B 2B4CL 5J57B 3LN9A 2X6MA 2CKBB 4Y4FC 5SWSB 1D5ZA 1KTKE 3OQ3B 1DN0B 2F54A 4WEBH 2PCPA 3ESUF 4MXQC 1YN6B 1JWSB 4NUJB 5C2BL 5F6IC 2GTZB 4KTDL 5D70L 5IBLC 2XRAH 5LBSL 4LSQL 1LWRA 5KSAA 1G7PB 1IBGH 4H20L 2FLRT 4ZS7L 3MLSH 5IEKA 1BZ7B 3F6LA 4GBXA 4XPTH 3BSZH 3O4LE 5IB3B 5DI8B 2NY2D 4PJBB 1S9YB 4KAQH 3RVTC 1CGYA 2VC2H 4ZFFA 5A3ID 4YEFA 3VXRA 5HVFB 4DKFL 2I9TA 5CZVL 4FA8A 3CK0H 3FONA 2DB8A 4UZGA 1WIUA 2N7AA 3P9LB 1A7NL 1HILB 4PJ9B 2RIKA 3FOLB 4OV5B 4OLZL 1VEPA 4F7EB 1RZJC 4H88L 4NZUH 2DM7A 1VADB 3NFPA 5JUEL 1RUKL 4WHCA 4LPXA 1T04A 1T1WB 3GGWB 4WEUD 4XWOC 3QNXA 1JZ6A 3U36A 2XN9B 5C0AD 2F5BH 3IDUA 3NGBB 1IQDA 3CLFL 2Z92B 4IMKC 3PL6A 3ZT6A 3B9KD 1KIPA 1Z6JT 1AXTL 1MHEA 1P4LA 2FZ3A 4OZGB 4WFFE 3EJYD 5JMOC 1KPUA 2J2ZA 2MTPA 2IFFH 2Y5TB 3MV7A 1SJEB 1YC8A 3F7YB 1DUYA 4F9PA 4DUWA 4YQXH 3QBTB 3P77A 1DQDH 2GJJA 1EEYB 1EDQA 4G8GA 4HS6B 3HLAA 4W4OA 1XCTB 4H5SB 5GHWL 4AG4L 1I3GL 2KZWA 5FF6B 3IDXH 4C4KO 3HZKA 4PTUB 2I25N 3O2VH 1D5IL 1NMBL 4PGBA 5JOPE 1IGCL 4JR9L 4PFEA 3WUWB 1UXSA 4QRPB 2OQJB 1A6AA 4UNTA 3RIFK 5B4MD 3NAAL 4MJ5B 2FCBA 1UZ6F 1WITA 4D0BB 3QUXA 5T1DH 2D7MA 2GJ6D 5CZKA 1MCRA 2PXYB 4XZUA 4ZYKA 4MD0B 4H8WH 1FDLH 1EIBA 3LSOA 3QDHA 2DQHL 3R4DA 2QR0A 1XZ0A 4BZ1L 3SGKC 1NUGA 2UZIL 1INQB 3QEQB 1QOKA 5DJXA 5I30H 3SCMC 2YD3A 4KUCF 1KFAH 4OZ4A 1F2QA 4ZOBA 3DSFL 3I3BA 3NPSC 3VGFA 1F02I 3CFDA 4S0TD 1BFVH 3ULSB 4NFBA 5E5RB 3V0AC 5JIPA 2Z31D 4PRAA 5IBTH 2YD4A 3LN4A 4LRNL 4HK0B 5I19H 2L4OA 3U4AA 1G7HA 4KMLB 1BBDL 1BVLB 2W65B 4I3SL 1ZXQA 5FYKE 3ULUH 4EI5B 2EDYA 2P46B 4OT1H 3CSPA 4B0MM 5IR1B 5F44A 3GSNA 4O51A 4CGTA 4FZ8L 1JPTL 4WNQB 2X9XA 2ZUYA 1OW0A 4Y2DB 3F7PC 4JEGB 4KKCD 2V7HB 4LVNC 1JWMB 3OKMA 4APQB 3WJLC 4KRNA 2C3VA 5HHQB 1FLRL 3HNVH 1Q8MA 4FFYH 3BW9A 5I1GH 1CICC 1XF4A 1K8DB 3B2VH 2UWEB 3QDGD 5CWSA 1AIFA 1MFAL 3LD8C 4GSDH 1ZOXA 4MX7A 1FCGA 1ZKAA 4RAUA 2R9HD 1Q72H 2DYPD 1PX3A 1KPRB 1A4JA 2DM4A 1EERB 4QOKD 2NMSA 1K2DA 5KSAC 2JJVA 4Q9QL 4L8BA 5JDSB 1Q9WA 1C16A 2I60L 1RUPH 3R1GH 4M48L 4NWUL 1A5FH 3G5VA 4GBXC 4PGZA 2QTEA 1GH7A 3P4LA 1YECH 4X80H 1GCFA 1P6FA 2DQFB 4AEEA 2R2HB 3MYJB 4JFZL 1MSPA 3TH2T 1EEQA 5C2UB 1HK6A 2OSLA 3FZUD 5TDOB 3V79C 2VDML 2FATL 4JDVB 4X9BA 4P2QA 2XG5A 3SPVB 3ULVC 1UT9A 4JRYD 4ZFGH 4PJDF 5CIPH 4CUCA 5I8EA 3UJJH 1YNLH 4P4KC 1CFTA 2VB5A 3QHFH 1DQTA 5EU5A 5E56A 4WGWB 4OZHA 2WP3O 3QULA 2OI9C 2MMXA 1FRGL 4P59L 3SGDH 3PL6C 3QDJB 4FQ1L 4NKMB 4TTDD 3QXUA 3DVFA 5F93C 4ZS6D 1T7YA 4RZCA 2A83B 2E9WA 2NX5A 4P2OA 2J8HA 4F9PC 3T2QA 3ARPA 4L9LB 5HHOB 2BXYA 2Z9TA 4F7PB 3PABB 4W4OC 4OQTL 2NXYD 3W81A 2M2DA 3BGMA 1F4YL 1MQKL 2P1YA 3GSOA 2BVEA 4NRXB 4OCSL 4X6CA 5DJCA 1I9IH 3K7UA 5HDBF 1MIML 5F9OH 1E4XI 3U2SB 1TVBA 4ODTL 3T0EA 1M71B 3OPZL 1FNGA 4PY7A 4FABH 4PRDA 2WIIA 1FN4B 4JPIA 5M7QA 4YDJB 3QUXC 5BOPA 1NC4B 5A43C 2I5YL 4X9GA 2E5EA 3ULVL 2A73A 1XGTA 1CFVH 3FO2A 2N56A 4PV9B 2EXWC 4ODWB 5ESAA 2IADB 3TYGH 3JV6A 1A7OL 1Z9SA 4PR5A 2Y36L 5BXFB 4GT7A 1U3HC 2FRGP 1MCOH 4M7JH 4NUGH 4OIAA 1NDGA 5ECJE 4X4XB 4FQQB 4C55A 3ABZA 4YXHL 4PJAB 2A2QT 2AJYL 4MWFB 5ELIA 1LO5A 4XC1H 5D1QB 1EGJH 5KSUB 3JWDH 5C08E 4K3DL 1HYSC 5DTFA 1ACZA 1NDMB 3ME0A 1CL7I 1T66D 3FT4B 5IVXB 2H32H 1CS6A 3HZVB 2XWTA 5T1KA 4NQEA 4HQQL 1OTTD 1FO0A 3D39D 5E9DE 5DK0B 3VFUA 3DGGB 3K80A 1FZKB 1YYMH 5FYKH 3BH8B 5JIIA 1OW0C 5TDNA 5ENWA 3D85B 1NCCH 1FCCA 3QCVH 5C0CD 1JGDA 5ESQA 5INDB 2V2TA 2P5EA 3CX2A 4I18C 4KTYA 1PG7X 1PQZA 3SKOB 5JHDA 5EU3B 3DXAB 3KR3L 3DSNA 2X89A 5K9QI 2ESVA 5GS2D 1UJ3A 3SKJH 4JG0L 2XXMB 2QQLH 5T5FH 5DMIL 4YC2C 2X1QA 35C8L 5KJRL 2IMMA 3AMKA 1S9WA 5C9JB 4M03A 4K9EC 1B90A 1MCEA 4HIIA 2NY3C 3AUVA 3L7FA 1JL8A 2EC9U 4X4ME 3L3GA 2QV2A 2R0WH 2NW2B 1RIUH 1NGQL 5K9QG 5I8CA 5J7CC 2BRRH 2EC9T 4G7VH 3MLYL 3B3IA 4M8VA 2FSEA 3DX8A 1I7RA 3VW3H 5FA3A 4G8IB 1F6LL 5JXEA 3KXFD 2FH8A 4Z5RB 5HYJB 4DVRH 1XR8A 4XCYB 3HAEB 3BPOC 1G0DA 1FPTH 3GSNL 4CN4A 5ICZB 4WUUA 1H8OA 4AY0A 4JM2B 5JIHA 3C5SB 1IC7H 2FR4B 3EDDA 4X98A 4XI5C 1U8MB 2PTTA 4R3SB 4U1MB 4O2CA 4KRMB 1EPFA 4PJ7B 5DO2D 3MGAA 3L3KB 1F6AB 4OD3L 3MLZH 3BPCB 1EZVY 3DBXA 2AJXL 4EI6A 2GSIA 5IF0A 4F33B 5GGSA 1ZEAL 5I6XC 1UCBL 3H6JA 4LAJH 1BX2A 5ERWB 3BH9A 3IJHB 1PBYA 1CR9H 3MJ8B 5IB5B 4AEIH 4XT1C 4P2OC 2EE9A 2J4WL 4K3GA 3FN3A 1SEQL 5DRNB 1G9MH 1J1PL 4U0RC 3VXUD 5EU6A 5M95B 4K9EL 3N1MC 3BT2H 2BNRE 2IANA 3BEWB 5IHZA 1PZ5B 2NY2B 1XIWA 1P9MA 4MNQE 4P9MH 4PP1D 2BNQD 3B5HA 1UKQA 1FIEA 3T0EC 4L8SC 1ZLVK 3VFRA 4D2NA 5L8LB 1DP0A 3EOYG 1G9EA 3MRNA 1BM3L 15C8H 5DVNA 4Y5VB 1VFUA 4I77H 3HFML 4TSBL 5FHBL 2APBA 2B0SH 3RWIA 4FMFA 2BVQA 2DBLH 1EJOL 4UB0L 3NIGF 3L5JA 4FFVD 5DMGD 4AL8L 5ACZA 1GZQA 3EOTH 2LU3A 3VXSE 1NANI 4U1NA 1GGCH 4TUKH 2BY3A 1MF2L 4U33A 4XBEL 5E70A 5C0AB 1BZ9A 3B6SA 4PLJC 1OCWH 4YHNB 4LNVA 1QBLL 1JGVH 3B9KB 2WWKO 5TGBA 1AY1L 4E9LA 3HMXH 4OIIL 3LV3B 4OJFH 2WWMC 4ISVB 5DQDL 4FZEL 5LCVL 2R0KL 4U6YB 1MNUH 1S7UA 5BVPL 1HSAB 5IV2A 2L0DA 1G0XA 3AMLA 3JXAA 1V7NL 4J3XA 1A2YA 4U6XA 5FM8A 5TFSL 5EOQH 1KCVL 1W0VA 1A4KB 3IDIB 3V6ZB 3QPXH 1SBBA 5SWSE 4ERSH 3L3IA 2CO7B 3BUTA 3LKNB 2GUOB 1FVEA 4BFBD 1S5IL 3IXTB 2GJ6B 1OAXH 4UT6L 1Q9KB 5CMAB 1D5XA 3VXTA 4UU9A 5GZOC 1T0MB 4JPVL 4KROC 5F7MC 1ADQA 1UJ3C 1DFBH 5F8QC 1HHKA 2VIRB 1QRNA 4IRJD 3FMGL 2YD8A 5C09A 3THML 1UJTA 1G7IB 3MA9L 4KHXL 1OB1B 2FD6L 4PJBE 1N0XL 3QI9D 2F53E 3MA7A 4PJ8D 2FHCA 1ZA3A 3O3DA 5CIPA 5DJ2B 3NA9L 3P0VH 1IC1A 3MACL 3SDAD 2KDGA 2E9IA 4HGWA 2PW2A 3IU4H 2Z31B 4MCYB 5DEGA 4JPKL 2DMCA 4I0PD 3U48A 4NO3A 3EOAB 2XWBA 1MREH 1QSFD 3A6BH 4FQ2H 3TBYB 4W70A 1GYAA 3FQNA 2D7PA 4HIEB 2I9LB 4WTZA 4LPVA 1YZZA 3LKSA 2KBGA 2YUZA 2HH0H 4MA8H 3HI1B 5DJ6A 2Y9RT 3LVEA 3SO3B 1KT2A 4LEXH 4Q2ZB 1IBGL 3V5DB 1UB5A 4BQ9A 3HS0B 3MLSL 4XPTL 4UMGA 3BSZL 3NCCB 5HTSA 3QR2A 1CXKA 3DI3B 2B8OT 4KAQL 3MGTA 2VC2L 1B6UA 3BIKB 4LLDA 4EXKA 1CD1B 3REVA 1AXIB 1JGUH 3JTTA 2DYPB 3D69B 1F5WA 4OGYH 1I75A 4QOKB 3H9ZA 2D7NA 4PP2A 4YHPB 5L6YH 5I75B 1JPFB 1MJUH 1U8PA 3MRIB 3WKMH 4GW4A 5DYOB 2MHAA 3NOIA 2X7LA 3ARTA 2PO6A 4Z6AT 1YMHA 3S96B 2XWJA 3MRRA 5C0IA 1DVFA 3PJSA 1XIWC 2IBZY 5IJKA 2Q86A 4RAVB 1N64L 3ULVF 2VSDA 4CAGA 1WZKA 2F5BL 1DSFH 2P43B 2GKIA 4HMCA 4ZO8A 1JNLH 4KPHH 5JPNB 3F7VB 4AMKH 3Q3GA 4PG9B 1RMFH 2WBJD 4U3XA 1RULH 4N5ED 3QEQE 1I1AD 4M61B 4F3FB 1ZLUK 2IFFL 2AXGA 2BC4B 1LE9A 5CD5D 4L3AA 3VI4F 5INCA 5SWQB 4OIBA 1CGVA 1KV3A 1FFNB 1R6VA 4OD1H 4FXLA 1MI5A 1P4IH 3ULUC 1DQDL 3DYMA 2ERJB 3INUL 1YN7A 1A1MB 1ZMYA 3G6AA 3IDXL 1FQ9C 1F11B 3LQZA 1J88A 4YZFF 3O9WA 1KNOA 3CFKA 1U2CA 2APFA 1KJ3H 3FJTA 3PNWA 5FYKU 3MGOB 5I16B 1BFTA 4YBHA 1QFWI 5D1XA 3B8YA 2XG4A 1TITA 3VI3F 2QQKL 3NACL 1W0WA 5T1DL 5K9KA 3TN0D 2HTKD 3VFOB 1W8NA 2NXYB 4DEPC 3RUGB 4H8WL 4CW1B 5TH2A 2EIBA 4LF3A 4ZXBC 4XX1E 4Z7UB 1FDLL 1FV1A 5KS9E 1A1NA 3FO0H 2IFGA 3BYTA 5D2LB 2DAVA 1F58H 1KG0B 5DFTA 5I30L 1ES0B 5GGQH 1J8HE 2Q3ZA 1QUNA 1IGJB 1KFAL 4Y5YB 2EEAA 1G7MB 4RIRA 2C4XA 5IG7A 2GIYA 4DTGH 5LAXA 3MCG1 3K1DA 5C8JB 5FDWA 4CVXA 1BLNA 5IBTL 3WDIA 4CMMA 1S3KH 5I19L 3UO1H 3VWKA 1MPAH 3QUYD 3RIFF 1ZVSA 1DBBH 4ZTPL 3MBXL 4JN2B 3ULUL 1JRHI 1UVQB 5F6HJ 4ODBD 4OT1L 4D3CL 3TA3C 4KUCD 3ILPA 4PRPE 3BKCH 2EYRA 4RNRB 5DRZA 1T21B 1JI2A 1NBQA 1LGVA 3KG5A 2VN7A 4UDUA 2FX8H 4HJJH 3RVVD 3VDCA 3RY5A 3MC0A 3RWFB 4RFNC 5CEYA 3HNVL 1X4XA 4FFYL 5I1GL 1YEGH 3UJTH 3B9VA 1CDHA 1TTFA 5J3HC 3B2VL 3D39B 3FB8B 4GSDL 5HPOA 2YKLH 5GXBB 4M93B 1T4KA 1S78D 4HIXH 4GAJL 1Q72L 5ETUA 3WIIL 5J13C 5GGVH 3F6IA 1MCNA 4MA3A 4XCCH 1T1XA 1OD7A 1TIUA 5MEND 2HYMA 3GIVA 3QDJE 4WTZG 4KRPC 5C0CB 3L5WB 5GPRA 4IIQB 1EVUA 1M7DB 1E6JH 1RUPL 4EEEA 1PKQE 1S7WA 3R1GL 1A5FL 2CLRA 5DWUH 2J88H 1LEGB 1RZIA 3DECA 5FV2A 1YECL 1JPSH 4YO0A 3UZEA 1UKTA 4XAKD 3DVIA 1TVHA 5AAMA 3RVWD 4U49A 5D2NB 3ET9F 1BD2A 4V2CB 4L8DB 4OAWB 4HUXA 4LVOB 1R5WB 5DJYB 1WIPA 5JOFA 4NT6B 1VFAA 1A47A 1Y6NR 2ADGB 3U9UA 2YBRA 3TZVB 1A9BA 3QCTL 5JO5A 4ZFGL 3L3OA 2YRPA 4JFDA 2K9UA 5IJKC 1YNLL 3MJGX 3MROA 5D9SB 2YWYA 3QHFL 3NVQA 3HRPA 3U46B 1MUJA 5F9JA 4LOUC 3VWJA 3RTQD 3VFVB 3KXFB 1KUMA 2P42B 1FZJB 4M9OA 1HOCA 2E7MA 3TO4B 3WIHL 5EZLA 2OTPA 3BZ4B 2PUQT 4EZMA 1EFXD 1U8NB 1YNTB 4KKAC 1SBSH 4YXLH 3GMOA 5GS1B 4E0RA 3MRLB 1IGIH 3DVNA 5LXGH 5CD3A 3P2TA 4PJAE 4Z9KB 3OAYH 4YHMH 4NM8H 4HWZA 2Y6SC 3CCHB 2X4UB 4D0CA 3FB7B 4LHUA 1I9IL 3CSBA 3O9WC 1X9QA 2D7OA 5IVXE 5IOPA 3PWPD 1NCDH 2IPUG 4PTTA 3LKOB 5DRWB 5BV7H 4TNVF 4FABL 1ZWIB 5D1XC 3AU1A 3GIZH 3HCVB 3TBTB 2BVPB 3VXUB 4R7DB 4G9FD 5FKPA 5D7LB 4KZDH 2K7PA 1N5YH 1CFVL 3CVHB 4ZO9A 5HHPA 4Z7OE 2N1KA 2BNQB 4MJIB 3L1OH 4IJ3C 5GRVK 2ZNXA 2ZOLB 3OX8B 4WFEE 2ITCB 3VCLB 1MCOL 3LN5A 4M7JL 4NUGL 1HDMB 4ZFOA 3U30B 3B8SA 1RJZB 3GRWH 2XZAL 5D7JB 4EQ2A 3STLB 3W39A 4OKVA 4XC1L 1EGJL 4RFEB 3JWDL 2YPLA 1TZHA 5JA8B 4RRPA 3NCYS 3VD9A 2RAMA 1LNUA 3DV4B 3ZKMD 4HBCL 3VWKC 1BQLL 3VE0A 2VKWA 2X4NA 3WXWH 1WBXB 3MFFB 2JJWA 5JLZB 4BQ6A 3S3JA 1YYML 2VDKH 3NA4A 5FYKL 1EBPA 1LDPH 4FG6D 3S97C 1WAAE 5HYJE 4JVUA 3RWGA 5EIIA 1NCCL 5IB4B 4NCDA 3QCVL 5K59F 3I6LD 4QRTB 3O3AB 3HUJB 4IDJH 5B39B 1ZHBA 3UYOD 2BSED 3BZDA 4NWTL 3UTSA 3G6DL 1MLCA 4F7MB 3UTTA 4POZC 3TC9A 3PXHA 5D7SH 1CK0H 3JV5A 2QQLL 5T5FL 4CNIB 1Z9LA 2DQIL 1TJGH 1G9MC 4IHOA 2CDFA 5KN5B 4ALAH 4BELD 4GOSA 1XF3B 4Y19B 1ONQA 3LMJH 3R0NA 3SEPA 3FRPA 2EDHA 4WUKH 2OR9H 2JKXA 1S7TA 5GJTL 1UG9A 5AD0B 2AGJL 1SJVA 4GRLC 4V1DA 4IRJB 2HVJA 3DROA 1IILE 4G7VL 4MNQA 3Q48A 4LFHD 2IH3A 1E4WH 3MRMA 3VW3L 2RR3A 4GKNB 3QI9B 5FM5M 3FO1A 4IS6A 4PJ8B 5DD3H 1RIHH 5CJ8A 4FTVE 1R24B 4ZMAT 4GRWB 2A74B 3SDAB 2X70B 1J9CT 1ERNA 3TT1H 5CZXC 5MERB 3K1KC 4GJTB 1T80A 4I0PB 4ZAKA 3GUTB 4EOWH 1UB6A 1IC7L 1QSFB 3ZTJH 3GKWL 4ACPA 3HR5B 3MO1A 1HI6A 2X1XR 3QFDB 3V6BR 4YHKH 1L0QA 4J8RB 4HUNB 3U82B 3QNYA 5C0AE 1E28A 1EEZA 3IVKB 3QIBD 1BBJA 1CR9L 3C5JA 1AQKL 1FL3A 3O4OC 4AEIL 1KB5B 5DHVB 3L3HA 4C58B 1G9ML 4Y4FD 1QA9A 3CFEA 2HAZA 1U58A 3CDCA 4I3GA 3AGVA 3NABL 3BOVA 4MXQD 3V5HB 3KDMA 3GSRA 4LP5A 3DOSA 5IBLD 4JQVA 2ZUWA 4Q9CA 3BUYA 1SYSB 3MRGA 4LHUG 2JK5A 5L2KA 4TUJB 5E7FA 4XP5H 2D0HA 4YDVB 3RKDC 1HH9B 4I77L 1IL1A 5IWLA 4KHTH 3NFSH 2DI8A 4QT5B 2B0SL 3ARDA 4HZAA 1AP2A 2V9TA 5CKGA 2DBLL 1F6FB 3K74B 3VRLE 5TE4H 3KS0J 2NLJA 4QTHB 3G08B 5F96H 1KJ2A 1MCPH 1GGCL 4TUKL 4NN7B 5E5MB 3W0WD 1OCWL 2K3TA 4XRCB 4JG1H 1D6EB 1JGVL 5T1MA 4OM0H 2ZUQB 2WBJB 3HMXL 3CFJA 3GO1H 3Q6FA 3BQUA 3J8F7 4YAQA 1IE5A 3L6FA 4OJFL 1MELA 5SX5H 3ULUF 4LSTL 3VD4A 2PTUA 5IIEA 4XWOD 4PJXA 1MNUL 3GSUB 1OWWA 1K9TA 2QSCH 5A1AA 2NXZD 4X8XA 4YHIB 1INDH 3ARBA 3K3QA 3SHSA 1MFNA 3MMEB 2QBWA 5EOQL 2NNAB 3QWRD 4LLWB 3QPXL 1YDPA 4ERSL 4X5XB 3TWCH 2EDNA 3W9DB 5FM5O 3QXVA 3PIQB 4E5XA 3TN0B 1PG7W 1R3KB 4BSVB 1OAXL 4JAMB 4NO2A 1A6ZA 5C0BD 4XC3H 2FYYA 3HAEH 1IKNA 1J86A 1S7QB 3M17A 2YD7A 2EDBA 1DFBL 3JZ7A 1U91B 5GGTA 3DRTB 3QDGE 4YDIH 3UTOA 2XPGA 1HH6A 4KKLC 1T6WA 4NHUB 5FK9A 1JHLH 5D6CA 1JPST 5CGYD 3B43A 1IEAB 1JZ8A 3LZFH 4O02H 3OJDA 3RI5K 1JGLH 1LK2B 3CZJA 4CVZB 1TQBB 4XMKH 4QOKE 3B4NA 3UTPD 3BKYL 3IU4L 5HVWA 3FRPG 3S4SA 3SCMD 3D3VD 3P30H 1MREL 3L95A 3QUYB 5CEZD 1W2KT 1CU4H 4M7KL 3A6BL 2FDBP 4ZSOB 4FQ2L 5J9PA 1YY9C 2CK0H 4L1HA 2ATPB 4L3CB 1XGQB 1CVRA 4GQPH 1NGYA 2MQ0A 4MA8L 2HH0L 3DX7B 4LEXL 1I8IB 4M3KB 1B0GA 2Q7YA 3QAZC 4UIMA 4JRYE 5DQJA 5EC2A 1LEKB 4HV8B 2E9BA 3OL2A 4GMTL 4LLYA 2DQTH 4MDJA 3DX9B 3GMLB 3IS1X 3L3JB 1L7TH 4PRBB 2AV1B 4OZIE 1JGUL 4U1SB 2VOTA 4QNPE 4XPHH 4XP9H 4UV7H 5T3XD 4OGYL 4D0DB 3SBWC 5MENB 2HN7B 1SYVA 5F89B 3WFBL 5L6YL 1CICD 3V52H 1MJUL 3MNVB 4N0RA 4JRXA 5D1ZA 2X1PA 2JJTA 4AEHH 2HTLC 1IGTA 2F54D 2IBBA 4K71C 2PN5A 2D3VA 5EUOA 5D96C 4FQXA 1LO3H 4MAYA 1HQ4A 1KLFA 4DAGH 4LMQE 5I0DA 2V7NB 3GJEA 5GSVA 5DVLA 4NN6C 4LVHB 2G9HB 4JQVC 3BGFB 4XXDB 4HXBL 3TF7C 1EAJA 2EE6A 5KSAD 5KS9A 4TSCH 1HHHA 1DSFL 5EZJB 2CJUH 1NBVH 2H8PB 4GBXD 1BF8A 1J8HA 1I4FA 4AMKL 5IW6B 5IWLC 3PXJA 1RMFL 2XICA 1RULL 3ARDC 3S5LB 4HMEA 5CJOL 4BSJA 2YPKB 3VXRD 1H15A 1QO3A 4PV8B 3GSVB 4OD1L 3G6JE 5C0JB 1P4IL 2W0FB 4Z77B 1DLFL 3RTQB 3MJ6A 3ULVD 4RBPH 2MCPL 2DWDB 4H26A 1T0NA 3TBSB 3GFUA 1X5YA 3BQUC 1IZKA 1J0KA 1EFXB 4FS0A 5I74B 1XCQB 2VZTA 4RGND 1KJ3L 2JTDA 1X5ZA 1BHGA 1T7XA 2FIKA 3DIFB 3NIDE 4NNXB 4PJDB 1FC1A 2X05A 3ES6A 5HHXH 1LDSA 1F3DJ 4AJ0A 3CZFB 4R0LB 3TGXA 3BISA 3PL6D 4PJ9C 5DRXB 2DLGA 3ARBC 2LU7A 3QUMB 2IH1A 4LPTA 1CVSC 1WZ1H 4Q9RH 1FL6A 5C0DA 1I8MB 3EGSB 3MV7D 3PWPB 3FO0L 1LE5B 2Z91B 5JQ6H 1TMCB 3RNQA 3VMPA 1KEMH 5F9AC 4PUBH 1ZGLA 1F58L 3M1BA 3D39E 2LAGB 3K2UH 5GGQL 4AK1A 5IMOB 1AHWA 2VLKE 5HJ3B 4G8GD 2V5RA 3FCTA 4X7TA 1S9XA 4EUPB 2ITDA 2EZ0C 5DC0A 4U2YA 2J8OA 2DF3A 1LVEA 2G5BA 4G9FB 2EIDA 3HNTH 4DTGL 4P5KA 4ZFZB 5I8OH 3BD3A 2AXFA 1PKQA 1O0VA 4U2ZA 2C1OB 2R2BA 4KVNL 3D0VB 5LG1A 1Z0MA 1IKNC 2RBLA 2X9WA 4QO1A 3ZKQD 4WV1B 1S3KL 3G5XB 3KPNA 3UO1L 1KENH 4LSDA 1MPAL 4DKEL 3MOQA 5ISZD 5DUBB 3QUXD 1Y0LB 1DBBL 4WI8A 2IQ9H 2KZ1B 3HC0A 4PG2C 4UOW0 4I2XE 3A0OA 3BKCL 2EO9A 2Q6WA 4K94H 1I8KA 4LKCB 1IRAY 1QSZA 3B9EA 4ODXB 2FX8L 4HJJL 2H9GB 5A40E 3PHQB 2CO6B 5GRZA 3QEGH 1MCBA 4EVNB 4WFHD 3WHXB 2R23B 3S4SG 1TPXC 1YEGL 3UJTL 3WFCH 2YKLL 2O93L 1MCQA 2RJMA 1HYSD 2ARJB 1U8OB 4HIXL 3VA2C 4NJAH 1S7SA 4XPGH 3VJ6B 4J7RA 1U0QA 4FP8L 3S3PA 2P7TA 4XCCL 3KXFE 5F9WC 1T1YB 2EYTA 3BZEA 3L9RB 1M05B 1M6OB 2P48B 3IFOA 4OLYH 2XTJE 3STZB 1W8OA 1E6JL 1WWWX 5DWUL 4L5FH 2J88L 4A2MA 3VDBA 5E6IC 1BVKA 1JPSL 5E2JA 3K81A 1RY7B 4WY7H 2FJFA 5BV7C 2VLRB 1Q94B 2R69H 2Q7NA 3GB7A 4G8EA 3P9MA 2VQUA 2GAZB 4Z8FH 5IMKB 1NC2A 2Q87A 2E7CA 2YC1B 3GI9H 5EIQA 5HGHA 2GSGA 1IM3A 3AAZB 2V5TA 4FQXC 1K85A 4MAYC 5F7UA 2YXFA 3IKCA 5FECB 1AGEB 5DS8B 2AJSH 2GITA 4HKXA 3MV9A 1DQMH 3T4YB 4XMPH 2NY3D 3NCJH 2D4FA 3MFGB 4U1LB 3OR6A 2BNQE 1ZT7B 3P9WB 4XB8A 5TF1H 3ZHKA 2Z4QB 2XIDA 4ZOCA 3WBDA 1SBSL 1EVTC 4YXLL 2AEWA 2EIZB 3HB3C 1CG9A 5B22A 4Z18A 2BOCB 4YHML 2DDQH 4NM8L 3UTZA 4P2QD 5ID1A 4XGZB 5EPMB 2HVKB 3MRQA 1CTNA 4JY4B 3OKDB 2OR7A 4LGPB 3T77A 3GSQB 2O5XL 1E27A 1RZGA 1NQBA 5BV7L 1NGZB 3QIBB 1R3HB 3C09B 3VFTB 4Q7DA 3GIZL 4XI5D 4Y4FB 2C9AA 2JCCE 3I2CH 4LPCA 4NN5C 1N5YL 1DLHA 3OXRA 5HYSA 5F6IB 4P3CH 5D6DC 4R4BB 3L1OL 4GKZB 5GISH 2V2WB 1VERA 3HUJE 3KPOA 4KWUA 1JYXA 1FNFA 1Q0XH 3KPSE 2NX5D 4P2OD 3IU3A 4WI6A 3F5WB 3BVNB 1HHJB 3LPGA 1AHWC 3OKOB 3BDYH 2AI0H 3GRWL 1DEEA 1ZS8B 1H3PH 3L7EA 4NQCE 3T0ED 3M8OH 3K4DA 1HCVA 1A3QA 3DUSB 3BJ91 1HEZB 3MXVH 1OTSC 5D5MB 2HKFH 3W0WB 5DJAA 3U6RA 2VZOA 3WL9B 3V6FA 5JZ7D 2C1PB 2JB5H 3REWB 3WXWL 3O3BB 5CFHA 3C6LA 4JKPH 2VDKL 3VFMB 3LHPH 2ZCKH 1N8ZA 2R4RH 4HCRH 1LDPL 4FTVA 3BO8B 1T5WA 4PLJD 4HKJB 2NXZB 4GRWE 4PS4H 4IDJL 3GZKA 3VMOA 3ZTJG 2GK0A 1HHGB 3GKZA 5J1AB 1ETZB 5FUCC 2HMIC 3W2DH 5KBNC 1MJJA 1QSFE 1BOGA 1T3FB 1FYTD 5D7SL 3TNMB 2ED7A 3BPLC 4JANB 4KQ4H 1TJGL 2DQGH 1H3XA 2F8XC 4NQED 2GHWB 1NAMH 4HS8H 4KK9C 4LLMB 4WI5A 2Y1VA 1SQ2N 4Q6YA 1PFCA 5C0BB 1AJ7H 2OR9L 5IK3B 5IKCA 2YMXH 4RBPK 4PBWD 1NL0H 1LP9B 1I7TB 3IRZA 2A1WH 3O41A 1XGPA 1AFVL 2FJGA 3GBNH 3BGAA 4MD5A 2HT4C 5EU4A 1T1ZA 5T33H 4KQ3H 5EBMA 2P5ED 1CD8A 2P47B 4X4YA 3U0WH 2Y5EA 4RGMB 5FDYA 5JHDD 1ORSB 1RK1B 1CXHA 1ND0B 2FGZA 2X89D 1J87A 1EEUA 2ESVD 4KROD 1IAIH 3O3EB 3GM0A 5E4IA 3TT1L 3WEXB 3SCMB 3D3VB 3JTSA 3NCMA 5CGMA 4F7CB 4EOWL 3OKLB 4FQHA 3S3SA 2J1KA 1TCRB 2IWGA 5FM4A 2H2SD 1FZOA 2FNBA 43C9B 1WFTA 2M26A 5LJYH 5AWNL 4YHKL 2BSSB 3O11A 1GJIA 1CDIA 3HE6A 4HDIA 4JFOB 1QNZH 1AGDA 1ZT1A 3QJHB 5ICXA 3R0MA 4XXCA 3D5OF 5F7LB 3PGFH 4PY8J 5HDQL 3T4AA 3I02B 5JXED 5DSCA 4BKLA 2JB6A 1CFSA 2UVFA 1W72H 4LQFL 5BRZE 2W59A 1NCAH 3BN3B 3UP1A 2AK4A 4LVNB 4WUUD 5C0NC 2ADIB 5C0RH 3MLWH 4H1LA 2EDWA 2XQYG 5E1AB 2R15A 2CIKB 1CICB 4PGCB 1QR1B 1D5ZB 1UC6A 4PLKC 3LD8B 4X5LA 2F54B 2PCPB 1IQWL 3NFSL 2PYEA 2A9NH 3TV3H 4W6WB 3N06B 4D8PA 1I9JL 5EIVA 4WI7A 3N1GC 2J7LA 2IPTH 1CXFA 1MCPL 5KSAB 5HYSG 3MJ9H 1H3TA 1F4AA 4JFYB 1FGNH 3LOWA 3QDME 2OLDA 3QXAA 1QSEE 4YUEL 5EU6D 5IEKB 4GBXB 4JG1L 1WC7A 1YQVL 3IDYB 2IAND 3GO1L 4NHCH 4ZFFB 5I1CH 1XIWD 2J8UA 3UYPA 1TNMA 4Z7VA 1G7JB 4Z7NF 4WO4A 4J12A 3VXRB 1K3ZA 2I9TB 2X4RA 32C2A 3ZHDA 2QSCL 4LSUH 3FONB 1CDUA 4P5MA 4DCQA 4DKDC 4NCC2 1JE6A 4JKLA 1MFCL 1UM5H 2AJ3B 1B9ZA 1JWUA 1AD0A 1V7MH 3C6LC 3JUYA 3NFPB 4RGNB 3BRGC 4EKXA 2CKNA 1T04B 3D9AH 3TYFA 3QNXB 3ULUD 3TWCL 3U36B 1ULVA 2YN5A 3RNKA 1IQDB 1EXUA 5JW3H 1MFDH 2FJHB 5LWYH 4HUMB 2COQA 3PL6B 3LS5H 1B4RA 1KIPB 4XNYH 2A0LC 1MHEB 1P4LB 4GAYB 5JDJA 4JJHA 4G5ZH 4XC3L 1Q9LA 1OAKH 1CT8A 1KPUB 1NCBL 1JBJA 4GRWH 5EA0H 3MV7B 3LKRA 1MVUA 4NC0B 1DUYB 4OZIA 4HAGA 3P77B 4HEME 4N90E 4G8GB 3HLAB 1YMMA 2BVTA 3X14A 1JCKA 3HZKB 3UJIL 2ILLA 3LZFL 2ORBL 4O02L 4PGBB 1JGLL 1IGYA 3O3UN 1JV5A 4IM8A 4IOFC 4XMKL 4NQDE 5MENE 1BF2A 3RWJA 5IW1A 3RGVA 1UXSB 1A6AB 4EBQL 4HWBA 4NRZA 2X4QB 5H35A 3P30L 2GFBA 5ISZB 4XPBH 3QUXB 1N59A 1CU4L 2QL1A 3SDYH 1NGPH 5MI0C 4LVEA 5J8OA 3VG0H 2HFGH 3UC0H 4Y7MA 1KACB 4XZUB 1YEJL 4XAKE 1PSKH 5GIRA 4WHTA 1HWGB 2LVCA 2CK0L 3O8XA 3JVGC 4RQQA 3LSOB 2ZG3A 4ZOEA 2J5LC 2QR0B 1XZ0B 3EO1B 1QRND 1MHHA 3KS0H 3DYOA 4WU5B 4X83A 5C09D 1FVCA 4JREC 4ZG1A 1TENA 4XHJD 4F8TA 3RY4A 4BQCA 4OZ4B 3G6JA 3C8KA 3D18A 3G5YA 5GRYA 5I2IA 3CFDB 3QNZA 2DQTL 1EHNA 5CBAA 1L7TL 3P4NA 2DQEH 4PRAB 1YEIH 4XPHL 3CFCH 3LN4B 4XP9L 1NBZA 4XXCC 1I7UA 4UV7L 2YSSA 3VGEA 3CFIC 3T65A 1G7HB 1FZMB 3T8XA 4S2SA 5FIEA 1RUMH 1J0IA 4QCIA 5J3HD 4AEHL 3EYUH 4WWKA 1A3LH 3GSNB 4O51B 4PJDE 5SWZA 4JGJA 5BCAA 1J05A 1LO3L 4HJGA 3LEXA 4DAGL 5C71A 3CSYB 5AZ2L 3OKMB 1KXVC 4NDMA 1FFOA 1YEKH 2GK2A 2C3VB 4KRPD 3PG2A 5FUZH 1I85A 4LNRA 1KF9B 3WFEH 4S1DD 3BW9B 1OT2A 3O0RH 1EV2E 1QSVA 1FFRA 3EUUA 2HLAA 5CWSB 4PRIA 2IMNA 3PWPE 3R06A 1Y6MR 4MX7B 1MIEH 4HUVA 2H1PH 4YNYA 2YRZA 4RAUB 1A4JB 1T22A 1X4ZA 2E6QA 4M7ZC 4TVSa 5KS9F 4YC2B 1K2DB 5IMMA 4JPWH 1LK3L 4L8BB 4R4FH 1Q9WB 1C16B 4YE4L 2NY3B 1KTLA 3R8BB 3V0WH 1A7QH 2PO6D 3G5VB 4MMZC 2HFFA 4W6XB 4K94C 5IW3A 5HDBE 4C54A 4HCRA 3ETBF 4I2XA 3AY4A 2A6KA 4W81A 3EDJA 4WO4C 1WEJL 5FXCH 2APWA 5CBEA 2OSLB 1BJ8A 4LOUD 4Y4HA 5F7HA 3CH1A 4PJIE 5ESVA 3QG6B 5HDOA 5I75C 1QFHA 4P2QB 4O9HL 1EBAA 5IQ9A 1S7XB 2VXUH 3FRUA 2Y06H 1VFBA 3BPOB 4HJ0C 3G9AB 4N0CC 3BAEL 1CZ8H 1WZ1L 3L5IA 4KKAD 2FBJL 1NCWH 4YPGB 5I8EB 2ZG2A 3C6SA 2Q8BH 1KEML 3FFCA 3P0YL 4PUBL 3RJDA 5EU5B 1MI5D 2WBKA 4OZHB 3K2UL 1GGUA 3MBEA 2Y6SD 4R97C 3CXDH 2UUDH 4B5EA 1BVZA 3HNTL 2NW3A 5FYKD 4K2UH 5I8OL 3O9WD 5I6XB 1ZA6A 1MCCA 3I6LE 3SDXE 4LAQH 4RZCB 2NZIA 5D1XD 2NX5B 4P2OB 1KENL 4U0RB 3QISA 3V7AE 2IQ9L 3MNZA 2WQRA 3RDTA 4CN1A 3BGMB 3IFLH 3GSOB 4DN3H 4LCIL 4X6CB 4NJ9L 4K94L 2EIEA 2MKWA 4TTDC 4IRZH 3O2DL 1TVBB 3T0EB 3T3PF 3OBAA 2ADFH 1QKZH 5BQ7A 3RGVC 4DN4H 1UADC 2R2CA 1FNGB 3CUPA 4PY7B 4QGTA 4PRDB 2IF7A 4RFOH 3QEGL 1A9EA 4JPIB 5FO8A 2WANA 4ELMA 3U9PL 5F6HI 3WFCL 2XQBH 2VLMD 2A73B 1J1OH 3CPLA 3FFDA 1XGTB 3FO2B 3MUY1 5FGBA 1OQXA 1BOYA 1D9KA 1P7HL 1H5BA 5ESAB 3JV6B 4XPGL 4PR5B 3VWKD 5KVEH 5AAWA 4QRUA 3VH8A 5E8OB 3ROLA 3VG9C 3HZYB 1NDGB 1W72A 4MQ7A 5JW4M 3MLXH 4L5FL 3GK8H 5E2UH 1LO5B 3KLHC 3L5XH 2UZXB 4X6DA 2C4FU 1RFDH 1H3GA 2UYLA 4HFUL 1GGBH 4WY7L 2B2XH 1KLGA 1FYTB 5GGRY 2R69L 3WN5C 5KSBA 3ORJA 4MAUL 5DD1H 1F3DH 3LEYH 3MYZA 2C4FT 4PJAF 5JOEA 2XWTB 4Z8FL 4NQEB 3BYYA 3IF1A 1FO0B 4WWKC 1FL5A 2IBGA 4HIJA 3VFUB 4POZD 3B5GA 3KYKH 3TH4T 4EN3A 2JCCA 3MLTA 4P23A 5IVXF 4C56A 3GJFK 5TDNB 3GSXA 5ENWB 3MJ9A 2AJSL 1FYHB 2FEDC 3TPKA 2VKXA 3ARZA 3CDFA 1I85C 2LQRA 3KPSA 4XMPL 3HPJA 3NCJL 1OTTC 2V2TB 2P5EB 2FL5A 1PQZB 5JHDB 5TF1L 2W9DL 4YR6A 4AQOA 1MCJA 3S35X 2ESVB 4KROB 4Z7OF 4WTWA 1UJ3B 4YHLL 3P11L 3SE8H 1A64A 4NQCA 5IHUH 1I3UA 4M3JA 3MRDB 4Y16A 1BD2D 4FQCH 4LCCC 5E99H 1MWAH 3GJFA 4XMLH 2RHEA 4HIIB 4L1DA 1NGWA 3L7FB 2CGRH 3L3GB 5I1HL 3D6GA 2NY0D 5LQBH 4LLVA 5CZXD 3UPCA 4PGEA 4JFDD 5D5ME 5I8CB 4FQJH 4JY6A 3W0WE 2Z93A 5B3NA 4M5YH 1GZPA 3KPMA 4C57C 3B3IB 3ZE0E 3BRFA 2VL5A 4NQVA 4JZJA 2FSEB 3DX8B 1I7RB 3VWJD 4JVPA 4Y4HC 5FA3B 3RVUD 4K8RC 4ODUA 4ZO6A 2YA0A 1XR8B 4S11A 4M62H 3QHZH 5FO9A 5LGHH 3EJZC 1JPGA 2VUOA 3QUZA 3NIGE 2HWZH 4P3CL 4XVUC 5AG8A 4WUUB 1LEIA 4OFIA 3RZCA 4XP6H 1QEWA 4LIQE 4X98B 5DHXB 4UT7H 2PTTB 3MBEC 4O2CB 1AGBA 3BDYL 2AI0L 3TJEH 4Q0XH 4TVPH 4X99A 4U0QB 4LBEA 3SE3C 4OD2A 2XTJC 1H3PL 4LHUD 2VJXA 3DBXB 5IF0B 4EI6B 2GSIB 5GGSB 1DE4A 4JHBA 2VDRH 3BH9B 4POUB 2ZSWA 3SDCA 1L6XA 5I17A 3MXVL 1YEEH 4Y1AA 1NAKH 5EU6B 1RHHB 3RDTC 2JB5L 2IANB 4P2YA 1NLDH 1LP9E 5JW4Q 1XIWB 4JKPL 5J11C 5KOVC 5BVJA 2FBOJ 3TESA 2ZCKL 1NSNH 1MCSA 4X7FC 5ADOH 3T0AA 3VFRB 1ACYL 4KXZH 5B38A 3H3BC 4PS4L 4OF0A 3UTPE 3QRGH 2H26A 1N3NA 1EUUA 1JK8A 2CKBA 3RWIB 1A7PH 3H8NA 4HPOH 2BVQB 1DQLH 3W2DL 3D3VE 1MFBH 5CEZE 2YPLD 4OCNC 5ACZB 5FGBC 1D9KC 2OXGA 2DD8H 1GZQB 1H5BC 3D25A 2HFEA 4NKDB 4KQ4L 2VL4A 3FOMB 2DQGL 3U0TA 1BZ9B 3B6SB 4WHYH 3H9SE 1NAML 1Q9OA 2B20A 4JDTH 4HS8L 2E7BA 3VH8G 1TJHH 1V3LA 2D03L 1MRDH 2JIXA 5TGBB 1J5OH 5IM7A 1AJ7L 2F5AH 5DI8A 5IB2A 2YMXL 3T2NH 1NL0L 3N1QC 1QP1A 5BRZA 1E0OB 1S7UB 2A1WL 3FB5A 2QSTA 5I66A 1N6VA 3GBNL 1KCSH 1JNHA 5IV2B 5T33L 1CLCA 1GVIA 3QUKA 4KQ3L 4DEPB 2O5ZH 2P44B 3U0WL 2CD0A 1A2YB 4U6XB 3UTSD 1FGVH 3V4UL 5T3XE 3UTTD 1IAIL 4EN3C 2ZUVA 1G6RH 1MAKA 4F2MB 3HG1A 1Q1JH 3SN6N 2F54E 1FVEB 4KKLD 1T20A 3GSWB 3PWNB 1BJ1J 3T1FB 2EDRA 1EHXA 1JIBA 5IP4A 1IM9A 1AC6A 3RHWF 3QDMA 5DZLA 3VXTB 1QSEA 2J12B 4UU9B 1QNZL 3QO1A 4OI7A 1YJDH 2MCG1 4OZGA 1RI8A 4HGKC 2UUDK 3VRLF 1HHKB 4V1DD 1EO8H 1QRNB 4MNQD 1OGAE 5HHME 1SJEA 3MNWA 3PGFL 4DVBA 2HJFA 3EYFA 1OD9A 3N1PC 1KTDA 1CD0A 4GQ9H 4U6VH 3MA7B 4HS6A 5DD0H 5E8PA 5CIPB 3VXRE 1W72L 3I6KA 4J3VA 4HGWB 1NCAL 2PW2B 1FIGH 4UQ2A 5DEGB 4BFIA 3QJFA 3Q6GH 4L9DA 4EDXB 4IRJC 4ZAKD 4NO3B 2XWBB 4QRPA 5C0RL 2OQJA 1MLBA 3VA6A 4RFNB 4JZJC 1EAPA 2VE6A 2G5RA 4QHNA 1NCNA 1UWGH 5CJQL 3QI9C 2YD2A 3BKJH 4RGNE 5GS3A 5BO1H 2A9NL 2VR9A 3FQNB 4JJ5A 3EW3B 2FIRT 2PXYA 2KL6A 4O2EA 4FHBD 4OFDA 1RZJH 3QUZC 5A2LH 4HUUB 1U8KA 2DKMA 3LKSB 5EUKA 4YHOH 4I0PC 5DJ6B 2IPTL 3RZCC 2VZUA 4KRPB 1VPOH 3MJ9L 1P4BL 1UB5B 1FGNL 3GHBH 4LCWE 1T7WA 4XCFH 2HTLD 4GW5B 4TULH 3MGTB 4LIQH 4NHCL 5I1CL 4LLDB 3REVB 3ALWA 1LD9A 1OAUL 3RWHA 4G8GE 3ECBA 2AJZA 1U93B 4LQ1A 3W9EA 4NQDA 4QY8A 4XBPB 4LSSH 1QTYT 2VZ1A 5L2KD 3IFPA 3QFJE 3VFNA 4PP2B 1NEUA 4LSUL 3RWEA 1U8PB 2P4AB 2MHAB 4PGJA 2X7LB 43CAB 4DZ8A 4EI5A 1YMHB 4R8WH 2XWJB 2AAVA 5TE6H 3ARDD 5C0IB 1UM5L 4FQIH 3PJSB 3WSQH 3IDJA 1F45A 1V7ML 2Q86B 3SOBH 3S9DB 3S34H 3H7LA 3D9AL 3T0BA 2DBJA 2PW1A 5JW3L 4BH7A 5HHQA 5LWYL 3HNSH 1HQRA 3LS5L 3FHAA 3Q3GB 4XNYL 5B38G 5TQ2H 3BQUD 2F53D 4G5ZL 1OAKL 4OF8A 5EA0L 4DQOL 2AXGB 1LE9B 4WFHE 4BSWA 3S37L 2CDEA 1MRCH 5INCB 5DUMH 4J1UA 4MA1B 3H9HB 3IDGA 4Y4KA 1GC1L 5DHYA 3ARBD 3X13A 3G6AB 5EZIH 3OAUH 2E9JA 5FCUH 3LQZB 3O9WB 1KNOB 1VFOA 1CCZA 3CFKB 1I1AC 2D7TH 4OZIF 3PNWB 1DBMH 3VRIA 1HXMA 4QNPF 4OLVH 5C7XH 5D1XB 2FB4H 5KSVA 4ZNEE 3WE6A 4PYHA 4XPBL 2EZ0D 1IKFH 1W0WB 5TDOA 5ITBH 3VXNA 2HJLA 1ZANH 1NGPL 3TVMA 2C3WA 2HFGL 3VG0L 1IC5H 3UC0L 2AS5M 1PSKL 3SPVA 5TH2B 4LF3B 3OAZH 3MRFA 5EZOH 5L88H 4IJ3B 1FV1B 4JQXC 5EG6C 1A1NB 5ILTH 1UA6H 3IJSA 1MWAA 3MLPA 5T3XH 4U1JB 5DJZA 2WQ8A 2P8PA 5I1LA 1JHTA 2MKLC 3TN0C 3IAGC 4RIRB 5IG7B 3FT3B 5IROA 1QVOA 2XZCH 2ZP0T 4G7YH 1YEHH 5LAXB 5F7DA 3IFNH 3TCLA 3ZL4L 5FDWB 3RPKA 4CVXB 2R56L 1BLNB 5H2BA 1LO2H 2Y7QB 1YEIL 5AYUH 3CFCL 4HG4J 1GGYA 3VWKB 3G6JF 2D4DA 1ZVSB 3H0TA 4YGAB 4ORGA 5I8KH 3EYUL 4PJFE 2EDTA 2XT1B 3ILPB 4PJIA 2EYRB 3S88H 1YQ2A 5DRZB 4FXGA 3WO4C 5EOCJ 3NIDF 4P2QE 4PJCA 4AM0A 1YEKL 2NR6D 3QUYC 4UDTB 5ALCH 5FUZL 5E00A 5CEYB 4NYLA 3WFEL 3O0RL 3UEZA 2VLJE 5E6ID 1T4KB 4CVWA 5DJDA 3P4OA 4Q9BA 1MIEL 2EKSA 2H1PL 1AXSA 4M1CC 3GMPB 4OZHE 5ETUB 3G04A 5EN2A 5ACLA 3MUGA 4NQSA 4MA3B 3ARQA 1T1XB 4OB5H 3C08H 2IADA 4WHDA 1UXWA 3GIVB 3SDXA 4JPWL 4R4FL 3BPNC 5DD5H 5D1ZD 4JRXD 3V0WL 1S7WB 5C0GA 2YZ1A 1I8LA 1RV6X 2VZSA 4FQQA 3LS4H 4FQXD 2WZPD 12E8H 1RZIB 4MAYD 5T3ZE 7FABH 3T0VA 3BIBX 1TVHB 2Z35A 4ZD3H 1BD2B 4X6CE 5MEOA 4HUXB 5EFIA 4PRNA 5JOFB 1VFAB 1J8HD 2VXUL 3U9UB 2Y06L 1UFUA 1A9BB 5JO5B 5DZNA 2AKRB 2NY0B 1CZ8L 5DK0A 3L3OB 1MOEA 4JFDB 3HB3D 1VHPA 3RVWC 2Q8BL 3MROB 2SEBA 2G60H 5F9JB 3VWJB 3D85A 5E8DL 4NSKA 5INDA 2VDOH 4K2UL 3ARFA 5EZLB 4QF1A 3MJ7A 2ATKA 2NY5H 1E4XH 5EU3A 4PRPD 4HX1A 1FLTX 4X0KA 3GMOB 1QHOA 5L8JB 3GNMH 4LAQL 1RIVL 3DVNB 3O4OB 3D1MC 2DJUA 2ICCA 5AZEL 3MLRH 3C2SA 4JFEA 4OF6A 3IFLL 4DN3L 4D0CB 2PTVA 4LHUB 4XVJH 2AP2A 1G6RA 4IRZL 4DK6A 5IOPB 3U4BH 4ZUUA 4PJ5A 1J8KA 4PTTB 1P7QA 2ADFL 2NW2A 1QKZL 4NQEE 4DN4L 5K59E 2YWZA 5FV1L 2X44D 4O2FA 1XMWA 5K93A 3IKKA 4RFOL 4OUUA 2YEZA 1LHZA 2CR6A 1CFBA 4ZUSA 3WKNA 5FKPB 1KEGH 2XQBL 3TVMC 2R1WA 4KV5E 5I18L 3SKMB 4RA0C 4CDHA 1A14H 4QHUA 4NPYA 4AIZA 1CL7H 2CRZA 5KVEL 4NM4H 4NO5B 4JFXA 4ONFL 4ZFOB 1KN2H 4MZ2A 4DGIL 2ESVE 3BP6B 4R3SA 3MLXL 2ZUXA 4PJ7A 3GK8L 3W39B 3OJ2C 4OKVB 1NFDA 2QQNH 3L5XL 2FEEI 1CGSH 1RFDL 2F58H 2YPLB 1TZHB 1M7IA 1X6LA 1GGBL 2B2XL 4WWID 2XA3A 4WV1C 2OMNA 5ERWA 3LEYL 1XGUA 1E4JA 3VE0B 1BIIA 1OP3H 3X11A 1EX0A 1MCKA 2X4NB 1QLEH 4BJLA 1T2JA 4X6DF 1NCTA 4OCWH 5CUSH 2HMID 2IQAA 2HRLA 2QHRH 3JV4A 3AB0B 4G42A 1UGNA 1X7QA 2YR3A 1CFQB 5J6HA 3N0PB 3UAJC 3RWGB 5EIIB 1H8SA 3RIAK 3LEVL 4L8CB 4KI5E 3CD4A 1KCRH 5E1HB 4KKBC 1ZHBB 4WUUE 2D0FA 2JCCF 2WNGA 3UTSB 1IGFH 5J12C 1BMGA 1MLCB 3I50H 1OP9A 2ZUSA 3MZTA 3UBXA 3SE8L 5AYQA 5KVGL 5IHUL 3WIFA 4KDVA 3KNBA 4FQCL 4P46A 4KXZI 4IHOB 2MNUA 1NC2D 3MUZ1 5E99L 1MWAL 2VXQH 4XMLL 5ABDE 2JJSC 1TJIH 3S36L 1JMXA 2BX5A 3HE7A 5C0EA 4TNWK 4BQ8A 1X5FA 1ZAGA 5LQBL 1S7TB 1T83C 4FQJL 4V1DB 3F58L 2HVJB 3DROB 4MNQB 4OM1H 1A6VL 4F37F 1IGMH 1JF1A 4U6YA 3MV9D 3MRMB 2IANE 5T3ZH 1MCFA 1AI1H 1Z3GH 1VGKA 4IS6B 2KQMA 4M62L 4XBGA 3QHZL 1MJ7H 4DUVA 5LGHL 3I9GL 1VENA 2AQ3A 2D31A 1MCWM 2X4TB 4PD4J 4FFWD 4KJWC 5FYLH 1NFIB 3HC4H 3OKNA 5EORH 1DJSA 1UB6B 4IEFB 4XP6L 5I1IH 4H0IA 1WBYA 4UT7L 4Y8AA 3MO1B 4GRWF 1HI6B 3PE9A 3TJEL 4R26H 4Q0XL 1QLRA 3ZDXE 2V17L 4ETYA 3C8HA 4PJEA 2V5SA 2ICWB 3ARFC 3QNYB 5C0ND 3BMWA 1E28B 1EEZB 2VDRL 1GGIH 1G9NH 1YC7A 1BBJB 3IDNA 4ETQB 3C5JB 5DXWA 1FL3B 9CGTA 2V2XA 5JNYA 3FN9A 5CINH 25C8H 1QA9B 3C8DA 3CFEB 4PLKD 1U6AL 1CXEA 2DLTA 4FFZH 4K71B 5D93B 4U1HA 5D96B 4LSVH 4UOJA 1FE8H 1NLDL 3KDMB 1MJ8H 3GSRB 3IDMA 3B5TA 4NN6B 1NSNL 1MHPL 5ADOL 3MRGB 3NPZB 2JK5B 1Z5LA 5L2KB 2VAAB 5L0QC 3V2AR 4UOW1 4R90H 3LIZH 3KYNA 1SVCP 4KDTC 3BP7A 4DGVH 4XNQA 3QH3A 1FO0H 1RVFL 5I71C 3W82A 4M1GH 1A7PL 1YJDC 3ARDB 1AP2B 4HPOL 3TBYA 1DQLL 1X5KA 1MFBL 4P4RA 2WUBH 4HS3B 5DMKA 4MJ6A 2DD8L 2DIJA 3ZMRA 2NLJB 3E0GA 1HE7A 2DLFH 4O5LL 1KJ2B 4K7PX 4KGJA 5HDLA 2WMPA 5BW7A 1DEDA 4Z7WA 4JHWH 3QG7H 1OGAA 3HN3A 1OVZA 3V5DA 3WD5L 1UEMA 4N0UE 1TJHL 2N4IA 4QRRA 1MRDL 1QRNE 3CFJB 3Q6FB 4JHAH 3BQUB 3P0GB 2F53B 4YAQB 5C09E 3C6LD 2F5AL 3KLAA 5KVMC 2CMRH 5ADPH 1VFMA 3T2NL 4FTVD 3BIKA 4ODVL 5IIEB 3QXTA 4G6MH 4NCC1 3D69A 1ZE3C 3MXWH 2QKIA 4HWEH 1OTUC 3LRHA 4M6OH 1KCSL 4JE4B 4HUKB 4EIGB 4YHPA 3ARBB 4GH7B 5K9JL 1JPFA 2L7UA 3MRIA 2A0LD 3VGHA 3A6CL 2O5ZL 3LH2H 1FGVL 3AS0A 1JZ7A 5J0BA 2DRUA 4ELKA 1NUFA 2GT9B 1G6RL 4XNXH 1YDPB 3UBXI 1UYWL 3OMZA 2NXZC 2W0KA 4E5XB 4EIZC 2O5YH 3MRPB 5F1KC 3K0WA 4XNMB 5F1SA 4LCWA 4IOFD 5JPNA 4NO2B 1A6ZB 2FYYB 5DJ8A 1YJDL 3ARWA 3UTQA 3M17B 3FN0L 3OSKA 1EO8L 5E2VL 2EDEA 4RMWA 2M8XA 2MOVA 5CCKH 5J56B 4FOMA 3UBXG 2XPGB 5IESH 1NCUA 1HH6B 2G75B 3LKPA 5FK9B 2YS4A 5MHSE 5D6CB 1S7VA 4NO0A 1SY6A 4GQ9L 4EQ3A 4U6VL 3QFJA 4MD4A 1WF5A 1AGFA 3HE7C 3OJDB 1A1MA 4YFLI 1XF2A 2X4SA 3RA7H 3CU7A 3C9NB 1FIGL 1PG7H 3MCLH 3IAQA 3S4SB 1QFOA 3EBAA 3MGOA 3CDGA 2W91A 3LPFA 4N0FB 4PY8I 1UWGL 2IJ0C 1TPXB 3QO0A 1EO5A 5CGYC 5EU7C 4L4VA 1JFQH 2P8LA 5J9PB 3GMQA 3F8UB 4RGMC 5BO1L 1FH5H 2QQQA 3HE6D 6FABH 4NNPH 1JMZA 2CLZA 1RZJL 1NGYB 5IVNA 3C5ZA 4H25A 4Z7UA 4YHOL 3HPLB 5F9WB 1F4WH 1EUTA 4TPRH 4DW2H 3IT8D 1VPOL 4XB7A 1B0GB 2Q7YB 4UIMB 5DQJB 3GHBL 4U1KA 5EC2B 5TPWH 4XCFL 4U3CA 2RFXA 2AK1H 4MDJB 5E6IB 3PQYA 4HPYH 4LIQL 1R3IL 2HT2D 3KLDA 2B7DT 4AENA 5BV7B 1MI5E 2AK4D 1WK0A 1A8JH 5A2KH 1UKSA 1A21A 4LSSL 2APXA 3NN8A 5HGBA 1MRFH 5HXMA 5D1ZB 4JRXB 1KGCD 1X5LA 4ZNEA 1IGTB 4KK8C 2IG2H 5EUOB 2PYED 1ZLVH 1ZTXH 4R8WL 3BN9D 5TE6L 4CVUA 4FQXB 1RUQL 1N5AA 4MAYB 3GMMA 1OP3K 3WSQL 3GJEB 3LRSA 1T21A 1TFHA 3QEUA 2WSKA 5GSVB 3SOBL 3S34L 3K2MC 1PAMA 5KS9B 3PWLA 1HHHB 4OLWH 4XH2A 1J12A 1R5IA 2EH7H 3X3FL 1J8HB 3HNSL 3MCKA 4M4PA 1NMAH 3IS0X 3CMGA 4WO4D 4TSAH 1H15B 4S1RH 4XVTH 1QO3B 1QFWH 4GMSH 1MRCL 4KC3B 1ROWA 5DUML 1HYRC 2VLME 5JW4N 5CEZL 3FQUA 5KAQG 4HJ0D 1QG3A 4QHLA 1I9RH 3IDYC 4N0CD 5EZIL 3OAUL 1ZLSH 4H26B 1T0NB 4DGYH 2AJVH 4M5ZH 2NZ9D 2ICEA 3PDGA 1QFUL 4PJFA 2D7TL 2XNAA 3AREA 3I84A 1DBML 1MH5A 4PRPB 1ADQH 4HWUA 1ZLWH 5HYIA 4OLVL 5C7XL 1I3RA 2OBGA 2FB4L 5D2NA 5TJWK 1ED3A 1GOHA 1GSMA 1ZANL 2G2RA 1AO7A 1MY5A 4HFWA 3IXAA 4NN5B 5MP6H 1NGXA 1J11A 4GAFB 4NT6A 4ZQKB 4UTAH 5DT1H 4WU7A 1IFHL 3TZVA 1FL6B 5C0DB 1WTLA 2ID5A 5EZOL 4EDWL 4CL7A 2VLJA 3LKQA 4RGNC 3ARGA 3RNQB 3SJVA 4LARH 3WXVH 1ZGLB 1WLHA 2YRLA 5D9SA 4E41A 5T3XL 1AHWB 4X8JA 5I1EL 3FCTB 4X7TB 1RJYA 5DDHA 1JRHH 1YMMD 2ITDB 1H0DA 2FGWH 4U3HA 4QHMA 2G5BB 2XZCL 4M4RA 4P5KB 4RAHA 3ILQC 4G7YL 1YEHL 4MJ4A 1PKQB 4L3EE 3IFNL 2EECA 1ZGLP 4MHHI 2R2BB 3TO4A 2ZSVB 2YD9A 4R7NA 3TEUA 4PLNC 3RGVD 1LO2L 3CLEL 5AYUL 1YNTA 3KPNB 5E2TH 4PRHE 3DV6B 3WNNA 3WNMA 3HC0B 4O58H 4X5WA 5F97E 1X44A 4XVSH 2L7JA 2Q6WB 1PYWA 3O8XD 4RGOH 3ALXA 3CCHA 1G7LA 1I8KB 1BD2E 3RBGA 1QR4A 1O7SA 1NLBH 1DR9A 3LKOA 1HHIA 4GXUM 1CXLA 4K3JH 5ALCL 5JQHC 1I1FA 2V5MA 4PJIF 4OKDA 1FNLA 3Q0HA 3T08A 5F7KC 2R0ZH 1N6QH 1KBGH 4JFDE 3VXUA 3KLHD 5FCSH 2NY5C 5D7LA 5ACMA 3NCFB 1DUZB 4XNUL 3CVHA 1S7SB 3C5ZC 4MJIA 2P7TB 2D2OA 3BPLB 2DICA 4OB5L 3C08L 2R2EA 3BZEB 2EYTB 4PPTA 3IFOB 5C92A 2BZDA 2DI7A 2BVOB 4XCNA 3PP3H 2J6EH 5DD5L 4WWKD 1F4XH 4ZTOL 3VU2A 4G9DA 1C5BH 5SWZD 3LS4L 5D7JA 3H3KA 12E8L 2VH5H 4ZUTA 3MOBH 5DJ0B 7FABL 2FJFB 3EOBB 3SDXF 4F57H 2FEDD 3GB7B 4Y88A 4G8EB 1ZHLA 3P9MB 5H37H 4UNVA 5E8EA 1NC2B 3DV4A 3PV7A 3N50A 3HA0A 4PRID 1CE1H 2VLKD 5HGHB 2GSGB 1SMAA 2DIBA 4OQ1A 1WBXA 3S37X 1TTUA 4U4BA 3IKCB 5CHNB 4ZO7A 1CBVH 4YDKH 2GITB 2G60L 2P5WE 4AYFA 4QRSB 4HKXB 2P24A 1UM4H 2EDFA 4NNYA 3TIEA 3CFBA 5IB4A 3BXNA 4TRPH 1ZLUH 3OR6B 4ONHB 4J6RL 1E4KA 2VDOL 1Q0YH 5GRUH 1WUNT 4U7KA 1L0XA 2NY5L 1E4XL 2QADD 5GGUA 1RZ8A 3RAJH 4UV4H 3GNML 1RU9H 3MRHA 1CG9B 4HF5H 1CE6A 4Y4HD 2YD1A 1ZHKA 1R0AH 4K8RD 3UTZB 3TPUA 5ID1B 3MRQB 2YPLE 3EJZD 4Y19A 2AQ2A 1ITBB 4JO4H 4XVJL 3RY6A 3T77B 1X3DA 4XVUD 1E27B 3FO9A 5EOCH 1RZGB 4MQSB 5JR1H 3U4BL 4BFGA 3FFCD 2AXJA 2H45A 3MBED 2VUYA 1BGXH 1KEGL 4UT9H 2XTJD 4X6BA 4YX2H 1DLHB 5DVMA 1A02N 3OXRB 4IRSA 5HYSB 1OAZL 1A14L 2AV7A 3KPOB 1CL7L 3ARGC 3IU3B 3JWOH 4NM4L 4B7IA 2BMKA 4OCXH 3H3PL 3EYQC 1IMHC 1B4JH 2IPKA 1P5UA 3UTSE 3CNKA 1KN2L 1XFPA 3UTTE 3RDTD 4Z76A 3QIUA 4ORZC 1P7KA 3V0VA 3L7EB 3PV6A 2AABH 4LLAA 2QQNL 3KJ6H 6CGTA 2F19H 5CP3A 3X3GH 5HGAA 4ONGH 4BZYA 4AH2A 4NZDA 2XY1A 5DJAB 1Z0NA 3U6RB 3V6FB 1NFDF 4P5TA 5IMLA 4KUZH 1A7RH 1WZLA 4OCWL 4RWYH 1K8IA 4V1DE 2ZCHH 1SM3H 1CD9B 3C6LB 4F58H 1D9KD 3QCUL 1N8ZB 2OJEA 3RPIA 4YK4C 4FTVB 5D5MF 3TBVA 5IEHA 1HXYA 4JZOB 1WFNA 3P3YA 1FFPA 1T5WB 3ZE0F 1H3VA 3AM8A 1HCFX 1KCRL 2NY6D 2PNDA 1C1EL 5JZ7C 1OSZA 2VDPL 1C5DA 4NFDA 1IGFL 1RD6A 3OB8A 3I50L 1DBAL 1MJJB 3RQ3A 1BOGB 1MCDA 1G9NC 2NYYD 4YJZL 3EFFA 3O6FA 5FGCB 4QTHA 5LBSH 1UACH 5TQ0H 4MDIA 2VO5A 2PYFA 1C8PA 1KLUB 1I3VA 1TJIL 3SQOH 1D6EA 1K4DA 2DMKA 4GKOA 4NZTH 4EN3D 5IKCB 1MAJA 4C56D 4P23D 1AE6H 4ZPTA 4OM1L 3U0PA 3P73A 5DR5H 1IGML 3O41B 2FJGB 2B1AH 5T3ZL 1R3LA 3MREA 4MD5B 5EU4B 3KPSD 4YPJA 4UTBH 4NC1E 1T1ZB 5DC4B 5MI0B 1Z3GL 4KJYB 1ZLWK 1PGRB 5E6ZA 3VFWA 1D7FA 5EBMB 2DIAA 3EYVA 2A6IA 4X4YB 1A7NH 4S0SD 1LP9F 4DFIA 3MMEA 5L2KE 3AS3A 2J5LB 4NQCD 4H88H 4QXGH 4A6YH 3HC4L 5EORL 3JTSB 4JREB 1B0RB 2KH2B 4FQHB 5I1IL 3HKFA 4X5XA 4YFLF 1B0WA 1FZOB 1B3JA 4R26L 1A6PA 5FKAA 3STBA 3CLFH 5DEFA 1D5MA 3OKKA 2VITA 3O11B 4U1IA 3HE6B 4HDIB 1LILA 1AGDB 4Z7NE 4N0UA 4JCLA 3PWJA 2EC8A 1GL4B 3EO0B 1GGIL 1G9NL 3SGJA 4JLRA 4YHYC 3T4AB 4OGXH 5CINL 5F21B 5J06A 5ICYA 4MNHB 5DSCB 2H2SC 3PDOA 1O7VA 5GHWH 4BKLB 2LE9A 4GG6E 2YD6A 3KWWB 1FE8L 3MRJA 3QUZD 1MJ8L 4PJXE 1NMBH 3RY6C 4OFPA 3E6FA 3D2UA 4JR9H 2AK4B 1WGOA 3K4AA 4MB5A 3RZCD 4G8FA 4LSPH 1ODAA 2EICA 4WGVB 3E3QE 4R90L 3WS6A 4NFCA 4UILH 1S7RA 3LIZL 5JXEC 2LV4A 2QHLA 4WEBL 4DGVL 1LQSR 3WJJA 1FO0L 4KI5C 2PYEB 2H2PC 3ZTNH 1VESA 4HC1A 5JIKA 4MZ3A 4M7ZB 4IRSC 1CF8H 1KOAA 1D3CA 2XRAL 4CJ0A 3SDCD 2ICES 3MRCA 4OSUH 1CDGA 3OKEA 5IJVA 2VLLA 3QG7L 4Y1AD 3QXAB 4W68A 3QDGB 3MV11 1WC7B 1T7ZA 5IQ7H 3K8LA 3BWAA 3QIUC 4HV8A 2LTQB 1JVKA 4JHAL 1F8TH 3PP3K 2J8UB 4Z7VB 2CMRL 4WO4B 5KAQF 3JUZA 3E2HC 4U1SA 3DRQA 32C2B 2E6JA 3CK0L 3MXWL 4D0DA 3UYRH 4P5MB 4DCQB 4HWEL 3RX5A 1CXIA 4Q97A 2CDGA 5LGJA 1Z2KA 2WINB 4MS8D 4X6EA 4Y5XA 4P5TC 4P2RA 4ODHH 4MVBD 2XKNB 1KIQB 3RX7A 5C6PB 2HLFC 2FECI 1FNAA 4NZUL 3OR7A 1JWUB 1P9MC 1AD0B 5E94A 4U1GC 1WFUA 4XNXL 4JGUA 4MJ2A 2J6EA 4L29A 2CXGA 4WW2A 5E6YA 3MV01 3RNKB 1EXUB 5MEQA 3BZFA 3S36X 4R97B 3AM8C 2O5YL 3ZKNC 2YZ8A 2VERN 2JIXD 4G80A 4JRYB 1F42A 2PKDA 1Q9LB 2QEJA 4YWGH 1CT8B 4NRYA 3V6OA 3LKRB 2W0PA 1MVUB 5BRZD 4YQXL 4OZIB 1IAOA 5GS0C 1U8QA 5F3HA 5CCKL 5IESL 2ZOKA 1EMTH 1F3JA 1YMMB 3H7BA 4Q9QH 4HG4K 3X14B 3O2VL 4HH9B 1IAIM 1IGYB 1JV5B 1N4XH 1I1YB 3EFDH 3RA7L 3RWJB 4JZNA 3F7RA 3MV8A 4YLQT 4RMUA 3MCLL 3RGVB 4NRZB 4JRXE 3BMVA 4B50A 3HG1D 4JFZH 2GFBB 3DTXA 4JO3H 2IGFH 5EUOE 1N59B 1NBYB 4OCMC 5F7WC 2ED8A 2VDMH 1IM9D 5CEXA 3QDMD 2W92A 5GIRB 1FH5L 1QSED 2BSRA 4WHTB 3O8XB 6FABL 4JFFA 3O45A 3C60A 4RQQB 3KYMA 2FX9H 3MUJA 1MHHB 3SE4A 5J89A 1F4WL 1P53A 3VG9B 1FVCB 1H9VA 1MCLA 2P45B 4NBYB 3FB6A 4HD9A 4PJHE 5TPWL 4TUOA 4YEEA 3G6JB 3C8KB 3D18B 3G5YB 2AK1L 3QNZB 1YUHA 1WT5A 1FRGH 1BFVL 2GY7B 4G9FA 4HPYL 5D7IA 3P4NB 1MHCA 2FO4A 2C1OA 3DYPA 3D0VA 4GXVH 3WN5B 1NBZB 1JZ5A 1I7UB 3QPQD 2YSSB 4QRPD 3SGJC 1DQQA 1KJ2H 4P3DA 4S2SB 3G5XA 4UAOC 5LVEA 4XHJC 3CIQA 2E8YA 4QCIB 5C0FA 3MODH 1WISA 4MCZA 4WWKB 2LAAA 5L2JA 1ZTXL 4M1CD 5SWZB 1WWBX 1J05B 4HJGB 3LEXB 5HGGS 4LKCA 1FFOB 3KPLA 2XFXA 3HMWH 2H9GA 3U1SH 4LNRB 3BRDA 4OLWL 1VA9A 3WS6C 4RDQG 3CU1A 3HZMA 2HLAB 4PRIB 3MRKA 2VLKB 4N90D 3R06B 1WQVT 3WJJC 4AIXA 4HUVB 3QYCA 5JW5A 5IHBA 3QZWA 1T22B 4TSAL 4S1RL 1ITCA 1NUNB 4L3EA 1QFWL 4GMSL 4NQDD 3TNNA 4LCCB 1A7OH 5IMMB 5F7EH 4X7EC 3BHBA 3L9RA 4S1DC 3ISWA 1KTLB 4WENB 2ZPKH 1Y6KR 1I9RL 3FAWA 4PRHA 2X4OA 1ZLSL 4DGYL 2XZQH 2AJVL 4X80L 3T3PE 4X7CC 4I2XB 1DDHA 2QADB 2A6KB 1R3JA 1ADQL 2C7UA 5CBEB 2GCYA 5GGTH 2VLRA 4Y4HB 4JQIH 3PWUA 3CH1B 3WFZA 3TFKC 5ESVB 4X6FA 3SGEI 1K4CA 5IQ9B 2PO6C 1VFBB 4HQQH 4PJFF 5MP6L 3CVIH 4UTAL 5DT1L 1DVFC 2Y4SA 3IETB 3AFLA 1REIA 3UJJL 3QRFM 5E03A 3WXVL 3FFCB 4K7PY 5DS8A 1NAMB 4LU5H 4Y4KD 3EIFA 4WW2C 5FUCE 4DZBA 3MBEB 1ZT4A 1JRHL 1YPZE 4HK3N 2FGWL 3GMRA 1U8HA 4JN1H 2D9CA 3VFGH 4Y0GA 2XTJB 4CU6A 4WTXA 1ZT7A 2DQJH 1ZA6B 3QQ3A 2VXTH 4OZHF 2X1WL 3ARXA 2QJDA 3V6OC 4JG0H 3FKUS 3DVGA 4MA1C 3NMEA 5F7YC 5H37G 5KJRH 3T2PA 4MLIA 4O58L 4JKWA 3RDTB 3TVMD 2C3GA 4XVSL 2HVKA 2HRPH 4ESKA 5J11B 4RGOL 1HNGA 5F9OL 4A6YA 3WHE0 1X4YA 2AEPH 5BQ7B 1NLBL 3ALPA 3CUPB 1U8LA 5FO8B 2BHZA 4K3JL 2GI7A 3MLYH 4ELMB 4HEPG 4X6CF 4N8PA 2P5WA 2R0ZL 1N6QL 3MR9A 2X42A 5FB8B 1KBGL 3CPLB 4M8QA 2DJSA 2Y07H 3HRZA 2BY0A 4JFQB 1D9KB 3C60C 1H5BB 3MV9E 3TYGL 4TN9A 1WTGT 4PYGA 3DUHA 4R4BA 3EO9H 4XP4H 4QRUB 3OJVC 3VH8B 3ROLB 1NKRA 5H94A 5F72S 3F5WA 2ARWA 4D9QE 4PIRF 1W72B 4MQ7B 2AEIT 5CILH 1F4XL 1QZ1A 1WT5C 4WI2A 1C5BL 3KHOA 2YHGA 1PW3A 4OD3H 2VH5L 4X6DB 5HSFA 2YA1A 1DBJH 2UYLB 3MOBL 4DJMA 2BCKB 5C07A 1KLGB 3UAJD 1XT5A 4F57L 4WFGE 5KSBB 5FAAA 1T5XA 5JORA 4TVPD 4KKBD 4IOIA 3TBWA 1SEQH 2XI9A 1QLFA 1CE1L 4OLUH 4HIJB 4AEFA 4KK6D 1XF5B 5EBLB 4ZUWA 3GDBA 3WNOA 1IC4H 2HFTA 2JCCB 4EN3B 3MLTB 4P23B 4C56B 1CBVL 2VYRE 5I73C 3GSXB 3JWOC 4YBQD 3W5NA 2CR3A 1UM4L 4PD4K 3ARYA 3KPSB 3RL2A 3HPJB 1BM3H 4TRPL 4X9IA 5BMFH 4K7FA 2FL5B 1KPVA 2RGSA 1UQSA 4YR6B 4KV5F 5GRUL 3O6MH 5EBGA 3KAAA 3SKJL 4NC2B 4NQCB 3BE1H 3RAJL 1YY8A 1NH6A 4AL8H 5EOTA 1RJCA 1RU9L 2VTFA 3D48R 4HF5L 5DFVD 3QZWG 3LCYA 4XBEH 1JTOA 3GJFB 1NGWB 2RCSH 3VXME 4H0HB 1QBLH 3LY6A 3PWVB 2IAMA 4LLMA 2W60B 3MZGB 2R0WL 4JO4L 4LLVB 1RIUL 4J4PA 2R4SH 4KJWD 4PGEB 3MX0A 5JR1L 4JY6B 4OCRH 2BRRL 3E8UH 2Z93B 2B5IC 1GZPB 3KPMB 5LCVH 2VL5B 3FT2A 4LCYA 4NQVB 4JZJB 4RCAA 4FXKA 3ZDZF 4GLRI 3D85D 1MFEH 4HXAH 1H8NA 1WICA 4DVRL 1BGXL 5BVPH 1JZ4A 4OLXH 1N2RA 4UT9L 4MNGA 5FO9B 4NZJA