2NX5D

Crystal structure of els4 tcr bound to hla-b*3501 presenting ebv peptide eplpqgqltay at 1.7a
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
188
structure length
188
Chain Sequence
b'QNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVQASGGSYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA-B35
molecule tags Immune system
source organism Homo sapiens
publication title A T cell receptor flattens a bulged antigenic peptide presented by a major histocompatibility complex class I molecule
pubmed doi rcsb
total genus 31
structure length 188
sequence length 188
chains with identical sequence I, N, T
ec nomenclature
pdb deposition date 2006-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2nx5D02
1XR9A 4JFEB 2PW1A 1HWHB 5D1XD 4ENEC 4HUUB 2UUDK 1YMMA 3D25B 4IDLA 1IC1A 2FO4B 2NZIA 4E42B 2OJZH 4ZUWA 1QPXA 5E08L 5BOPA 2FJFB 4FQHA 5KSVB 5IGXH 3T2NL 1LD9B 1FG2B 4R90H 5BXFA 1JPFA 4IOFC 4LVHB 4OB5H 1FYHB 3IT8D 3O3DB 4JQXC 2APTA 2O61A 5E6ZA 1FNAA 2PR4H 3O6FA 1I8KB 4QGTA 1NUFA 2EXWC 3F7QA 1W72A 3TT3H 4F7CA 4PG2A 4W70A 2RCSL 5EZJB 5GS1B 1MCLA 3DWTA 3E6HB 1QBBA 4U7KA 5DQJA 5HHVL 1AGEA 2FEEL 3IJYB 4WW2B 3MRQB 3SKUD 4FZEH 3P40A 4UBDD 1IM9A 2ADIB 3NIFE 4NYLB 2D31B 2HT3C 3UO1L 2DTML 5SWSE 4XMPL 43C9B 5FO9B 4RSVA 4TSBH 2X4NB 3AXLB 3VE0A 1MWAB 3WDHA 4XVJL 1EEZB 1RJZA 2DQEL 1CWVA 4AL8H 5JW4N 3NGBB 3VFNA 3DX8B 3O0RH 5C8JB 2Y07H 4DOHB 4N90E 2YPKA 1S3KL 1QNZH 3TVMB 5JQ6L 3HNSH 1D6EA 1R3HB 1P84J 4Z7UF 4NJAL 3WBDA 3DX8A 1UG9A 4NQCE 3NH7H 4U1KB 3L5XH 4JKWA 5GGSY 1MCRA 4LRIA 5I15L 2DDQH 3GSWB 5D72L 1AIFA 4L29A 4Y4FB 2ZCHL 5FOJA 4WGWB 5GGRA 1GZQA 3GUTA 5J9PA 5JXEA 2Y6SD 1YUHB 1X7QB 4K8RD 1ITCA 4B0MM 1FYTA 2FNBA 2F8OA 2AV7A 1J87A 2A6DA 3HE6B 3B6SA 4KQ4L 1MCPH 2AJVL 3MV9E 1OAYH 4JFDD 2ZPKL 5LWYH 5IM7A 4PLKD 4L4TA 3RI5F 2J4WH 2BVUA 3HZYB 3HPLA 4Q7DA 2Q8AL 4XP5H 1Q1JH 3PWPB 4OLUL 2MKLC 2XYCA 5I19H 3BMVA 5D2LF 1LDSA 3RWDB 2FIKB 2GEEA 2IEPA 2DQFB 2GSGB 2NY4B 2E27L 1I85C 5CD3B 2DS4A 4UIKL 4LKXB 1YYLL 4MNQE 3SDXA 2X2YA 3WNLA 4Y8AA 2DQTL 1XGPA 4NOFA 4AM0A 2VLRD 1L7IH 2DD8H 4GRLB 2ZCHH 4UB0H 1KB5A 3ARUA 3LN9A 4MNGA 2X4PA 3M8OH 3U9PL 1OGAD 4KKCC 3SE3C 3U7WH 2DKSA 1SJVA 2FJGB 1URLA 3KDMA 2NZ9C 1PLGL 1ZTXH 3FFCD 1KB5B 2HJLA 3NPSC 1G0XA 1T89A 3ARDA 1YJDL 2H9GA 5ICYB 4QF1B 1IFHL 3KLSA 3MROA 5DJCA 5CEXA 4XPFL 1DLHB 1FCCA 2D4DA 4IJ3C 1JTTA 3S35X 3EOTL 1CDJA 3ZKQD 2GSIB 3PQYD 3H9SA 1CI5A 3QJHA 4NM8H 3ZYJA 2OBGA 4PGBB 4YQXL 5FGRA 4XT1C 1KJVB 3ILQD 2CRIA 2HFGH 3ZE0F 3LKQB 1IM3A 3GHEH 1KIQA 3MYJA 4MB4A 4QT5A 2P8MA 4LCYA 2VE6B 3BWAA 4NP4H 5CEZH 3BW9A 4HAFA 5JIKA 3UBXG 2XQBH 4KUCD 3RPIA 1T80A 2VAAB 4TN9A 4TTDD 1AR2A 1T7VA 5ELIA 5TE6L 2FL5B 4XNXH 3QIBC 3IDXL 1RURH 1RY7B 1TJHL 2D0GA 3RWEA 2V2XA 1XR8A 4DAGL 1BVKA 3BAEL 4IHOB 3DROA 3BEVA 3VI3F 5HBBA 2K7PA 2C3WA 3QZWG 3CVHA 3RVXD 5C0AB 3TNNA 5CFHA 4HCRH 1NKRA 4KHXH 6FABH 1KACB 4MX7B 2NX5A 1HEZB 3QXVA 3EDFA 5EIVA 2AEWA 2BNRE 4YDLB 1LO2H 2H6PB 4R7DB 2Q6WA 5CZVL 5DHVA 4P2CG 4LLMA 3MOAH 4Q6IB 2BY0A 4F7MA 3QWOA 3L3HB 2EDNA 5L8LB 3QEUB 5CGYC 1CZ8L 5GRWA 3CZFA 4G8FA 4X6EA 2FO4A 4E42A 1KCRL 2F53E 2VDNH 1F4XH 5GJSH 5GS2H 4EI6A 1TITA 3NACH 4J7RA 3VI3E 2BNRB 1KN4L 4XC1H 2Y9RT 5JXAL 2Q87A 2F5BH 4E5XA 2R0WL 2G9HA 4QTHA 1UJ3A 3MCKB 5C0AE 2OSLB 5D2NE 3NCFB 5HYJB 5DYOB 5DJXA 1BBJB 5T5FH 2IFGA 3N85L 1EGJL 2G75A 1IMHC 3U0PB 2Z8SA 2A9NH 3B9AA 1R5VB 3QEHA 4P2RA 5ID1B 2VXTH 4ETQB 3RKPA 1JK8B 2PO6C 3TH3T 4OGYL 2C4FT 2E7HA 4ACPA 4N9GA 4M02A 4UMGA 3N1GC 1OAUH 1WWBX 3QIUD 2H1PL 4BJLA 3ARGD 4LSQL 5J12B 4PJEB 1NFDA 4LIQL 3ZL4L 5ETUA 3AGVA 4XCEB 4FABH 5DQDH 4WWKB 3SQOH 4QCIA 4YHKL 5D70L 3BD5A 3SE4C 3VXSA 1E6JL 1QBLH 4LCUA 1EZVX 3O11A 5KSBF 5IB2A 4Z9KB 5HTSA 5MEOB 5EIQA 3EDJA 3QO1A 4IRZH 3ARDC 2X7LA 5DC4B 4X7CC 4R4BA 2CK0H 4MSWA 1U8PA 3DXAE 3QG7L 4O2EB 3DRTA 4HWEL 4KHTH 5C09B 1LEKB 1ETZB 3WSQH 4KZEH 2SEBB 1BBDL 1MLCA 4CN4A 1LO3H 2EIBA 4M48L 4X4ME 3CSBA 4DGVH 4DJMA 5HHPA 1MCQA 3SKOA 4HUWA 4FQXA 4K3DL 4MAUL 1RUQL 3MA7A 1PKQB 2ITCA 3WN5B 1A7BA 1T0NB 3FB8A 4ZOEA 5FUZH 1T83C 5JMOC 4LQ1A 2VYRE 3OG4B 1NEZA 3CFCH 4JFED 1ZVSB 1ROWA 4WWKD 1GHFL 4PRNB 1HQRA 2AXGA 3TA3B 4H20H 2UVEA 3HG1B 5F1NA 1X5LA 3J8F7 1V05A 3CVHB 1C8PA 4XH2B 1S9VA 1VA9A 4YDKL 1ES0A 4B41A 1RZ7H 3O6FC 1HI6B 1N2RB 5EU3A 2D7QA 3F12B 4S0TD 3VXQB 4PP1D 3KPPB 1KBGL 4RQQA 3F7VB 4DQOL 3GMLB 1AY1H 2FIRT 1EEUA 3OKNB 3RHWK 1M6OA 5B8CC 1J05A 4HKBB 5CUSL 2EYRB 4JHWH 2WBWB 2EH8H 2HA1A 4BZ1H 4HD9A 1AD9B 5KG9B 2BNUB 4LU5H 2VITA 3V7AE 1F45A 4JY5L 1H3UA 3U4EA 1OPGH 5F3HB 1VACA 1MRFH 3MUZ1 3QR2A 1ULVA 1FL5B 4M1DH 4DK6A 1B0GB 3RWFB 2CIKA 4WU5B 5LBSL 4XXDB 2DQEH 1UQSB 3IU4L 4XPHL 1F3JB 4JO3H 3PJSB 1U8IB 2O5ZL 3VWJC 1G9MC 3V4VL 1Z5LA 2MKWA 5JOFA 5J56B 1S9XA 4L4VB 1U2HA 5CJOL 1NBYB 1RUPH 4WENB 3ALWA 2DLTA 2RB8A 1I3GL 2R1WA 4GW1B 4D0DB 4PGBA 4JQIH 4R8WH 5HHPB 2XG4A 3O2DL 1DBAL 5C0RH 1UZ6E 2QADC 3WNNA 2QTEA 2JCCB 1SY6L 2JJVA 5ERWA 2ESVB 4NJ9L 4RA3A 3I3BA 3BE1L 4RZCA 1CDCA 32C2A 1JHTA 4HPYL 1S5HB 1KPRB 5F96H 3LN5B 1EHXA 5H37G 2QEJA 5DJ0B 1KB9J 3MBED 3W39A 1F42A 4JVUA 4G6JH 4F9LC 3RWJA 5C3LD 5DRNB 1A7OL 1S7SB 3DVNB 3KGRA 3ROOB 4NRXB 4CJ0A 5KSBA 5LBSH 4OZGA 1H8SA 2XOTA 4JJHA 5KOMC 4CVWA 2VIRA 3S3SA 1HIMH 1SEBB 3O0RL 3PNWA 4H8WH 4N5EC 4JFDA 5I6XC 2AEPL 2CRYA 1T04B 5DJ2A 1F4WL 4BFGA 1ZE3C 4LPYA 1HXMA 3BJLA 1U3HD 2KQNA 2DYPA 3QFDB 5F1IA 1ZLUK 3LRSA 3PDOB 4LSUH 4JRXE 5BRZE 5HDBE 1TQBC 3MRFB 3WHE0 4ZOAA 1N6QH 2CIKB 1JZ6A 3G04B 4LMQI 5E9DB 1V7NH 3BE1H 3TBWB 4GLRH 3GEWB 4ZTPH 1G7QB 5C0CB 2QQKL 5KAQF 3BP4B 3REVA 3IDMA 1MSPA 3I75A 3C09C 2EE9A 2CDEA 2Q3AA 3EIFA 4FQLL 1P1ZB 2PETA 4PRPE 3V6OA 1Z3GL 4GKNA 3DV6B 3DLQR 3RUGA 2AK1L 1BP3B 4XAWL 4PR5A 5DD3H 1FFNA 4QYOA 3GBNL 1ND0B 1VCAA 1EHNA 1RMFH 3GSWA 1M4KA 2EDHA 2J4WL 4OZIB 3IAQA 1MEXL 3WFBH 1R5IA 1QTYT 3VH8B 3DI2B 1F4AA 1QSFA 4TOYL 1G7JA 3S98A 3X17A 5IBUG 4OD2B 2C1PB 5F89B 1BM3L 3FMGH 1LE5A 4NP4L 5GRJH 4PJAB 3EDKA 4PRNA 5LJYH 2DQGH 3ROLA 2VDKH 3EO1B 3TGXA 4L3EE 3SCMC 3VXSD 2CUHA 5E2VH 3LIZH 1DDHA 3E6HA 4XX1E 1MWAA 4OLWL 3LAFA 5D6DC 2R29L 4G6FD 3L3IA 3EO1A 3SKOB 3DMMC 4JZJC 4U6YA 3CXDH 5BS0B 5EDXA 5C3TA 4NYLA 4XVTH 1I75A 5C6TH 1B0WA 2BVEA 3SKMB 3OJ2C 2V17H 5C09A 3ZDYF 3P9LB 3SKJL 3VXME 1YJDH 3TZVB 4JZOB 4PY7B 5CHNA 1IFHH 2PNDA 2FDBP 1EXUA 1T6VN 7FABH 4QHKJ 2R4RL 3I6GB 4AYFA 2BSRA 5HY9B 4QOKB 5IHUL 4Y1AA 3MRDA 3GGWA 3MJ7B 3T3PF 2YRZA 1C08A 4P59L 4L8DB 3DUSB 3TBWA 4DW2L 4OI9A 1CG9A 3FO2A 1K8DA 1XCTA 2WWMC 4X98A 5EU4A 4HZLA 5I1CL 4WHTA 2MCPH 2DWDA 4XNYL 3WS3B 4X80L 1FFPB 4GXVH 1SM3L 1T1ZB 2GJ6D 3BPLB 4PJ7B 5IQ7H 3PGCB 5DURD 3SGKA 3V9FA 4JPKH 2C7UA 1EO7A 1IBGL 4Z7OF 5FECB 1KJ2H 3GJFH 1G6RB 1Q9LA 4GMSH 5JUEH 2WQ8A 2R0KH 1NC2B 3CGTA 1CDUA 4GS7C 5EO9A 1ONQA 3TH2T 1XGYH 3HE7C 4QHLB 1T04A 2Y06H 4QXUL 4AZ8A 3PIQB 1JHKL 2CJUH 2X44D 3DXAA 1SEBA 3PNWB 3ULSA 5EU6E 2IWGA 1RUAL 1A1NA 4QWWC 3W5NA 5F7MC 4KK5D 5TFSL 2W9EL 3L95B 5FA4A 4OQ1A 5BW7C 4ZXBA 5E03A 4NCDA 1K4CB 4UNVA 4PJ8D 2EDXA 1WBXB 2EEDA 4TUJB 3RFZC 4XCFH 1F6LL 3CC5B 4I4WB 4KPHL 4AH2A 3BUTA 4ONOA 4WEUD 35C8L 4PJBE 2H2PC 1FCGA 1T7ZA 4QXUH 2Q3ZA 2VH5L 5ITBL 2NX5B 1H15B 3TFKC 5HGHA 3WEXB 3LD8B 3IRPX 3BYYA 4P2QE 4NRYB 2ZKHL 3LKSB 4R0LC 3MRNA 4FNLH 2XIDA 1MIMH 2A73B 1MCWW 5GJTH 2APVA 3JV6B 3NCBB 5J89A 1TZGL 1KEMH 2DQJL 3MJ8A 3VJ6A 1XGQA 3EYSH 1UWXH 4OUUA 1FSKC 4K07A 1WIPA 1BEYH 3KPRB 3KPTA 5DXWA 4IRJC 5IMOB 1K85A 3O4OC 5TE7L 2X4QB 1T4KA 3BMWA 2DKMA 1ZT1A 2DIJA 4LIQH 4NN6C 4ODBD 1EERB 2XA3A 1OSZB 1FIGH 1RUML 3SQOL 2H1PH 1TVDA 3KAAA 4G6FB 4V1DB 5EOQL 3OZ9L 1M7IA 4QHMB 4NQDA 1TMCB 5DD5H 2D7NA 3O2DA 1B3JA 1TQCC 4LFHG 3RIAK 1RI8A 2EDQA 4Y1AE 2WK2A 1AP2A 3UTSE 1SYSB 3G08B 3ESVF 1UKSA 1XGRA 3F65A 4DQOH 2AK4B 2EYSA 3D3VD 5INDB 1ZLVH 4R4FL 5FHBL 5I1DA 4KY1L 5DGQA 1ZVHA 4XPBH 3TA3C 2ZG2A 1UJ3C 1ZGLB 1P2CB 2HLFD 5J57B 1ERNA 3U7AA 1CGTA 4V2CB 1BOGB 4UV4H 1AE6H 3QG6A 4NN7C 3RX5A 3NN8B 3IDYC 1A2YA 4M5YH 2GITB 4I48B 4OCSL 4EIZC 1VFBA 3CCHB 3M1BB 4G9FB 1CGWA 4LCUB 4PJBF 4S11A 3U2SA 4YEFA 4YC2C 3P77A 5E94A 2I25N 3OR7A 4PRHE 4KJQD 5DD6A 1BWWA 3HUJE 2XFXB 4DEPB 1OB1A 1DQLH 2BJML 4X7TB 3I2CL 4MAUH 2YA2A 1BQLH 4YDVA 4M7LL 4KC3B 3JBG7 4NKMB 5T1MA 1BZ7B 3FTGB 3INUL 2QJDA 1YEFL 4JCLA 2DWDB 1OSPL 1AO7E 1CT8A 1WZKA 5EU6D 3OF6D 1DBKH 3QHTC 4TUKH 3MMEB 3MRHB 3NIGE 3N06B 5TQ2H 3X14B 1CFTA 4KXZI 2DI7A 2CKBA 4F8TA 2OR8A 3TBYB 2GK2A 4X99A 3RVTC 1WCBB 3ARFC 3ECBA 1MFCH 5HYJA 3P4OB 1CFTB 4GQPH 1H3GA 4ODTH 3MJ9H 4NQEA 4W6XB 5EZOL 1JNHB 1XZ0A 3EZ8A 5MP6H 1FNGB 1KTLA 3KJ6H 2EH7L 15C8L 4FG6D 2YN3A 4X0KB 3MRHA 3PXHA 3I3EA 2IPUK 2HVJB 1W2KT 1RK1A 1IGCH 5IVXA 2VXSL 1DVFC 4U1MA 1D5IL 2QADB 2BSED 4LSVL 3JXAA 3HAEH 2O5ZH 2HTKD 1ZLUH 4NQCA 3MBEC 4KI1A 5ADPL 2ZSVA 3QNXA 1P2CA 3OJMB 2IH3A 4UT7L 4LRIC 4Y1AD 4M61A 2DLGA 5BVJB 3KPLA 4QRPD 1QSFE 4OD2A 4S1SL 3NN8A 1TXKA 2XZAL 3GGWB 3U6RA 1DBAH 2UV3A 5C0RL 4XCCH 4M8VA 3B4NA 1FZJA 1EAPA 3V0WH 1LEGA 1VB9A 2CD0A 2G9HB 3U30B 3MA9L 3F62A 3LB6D 1K5NB 5F93C 1K3IA 5CJBA 5C0CE 2NCMA 3HNVL 5E5UB 1CU4L 2DQCL 1S5IH 3T77B 4PJFB 3RVVC 4C83B 1BGXH 3MFGB 3RKDC 4ALAL 4RMVA 4YPGB 4MXWH 4H1LH 4U3CA 4WJ5B 2D7TH 3SDCC 1P4LB 1WZLA 4WI7A 3CDCA 4QTIL 4EI5C 1FZKA 1DBML 1JP5A 4TUOA 2XPGB 3JWDL 4MA3A 3OAYH 3VXRA 3PF2A 1MJUH 5HDBF 3TYGL 1UM5L 2VZOA 4HK0B 1T7YA 3R06B 4WFGD 5CKAA 1Q9WB 1CU4H 3MV7E 3T2NH 1O0VA 1UEYA 1HINL 5CUSH 4FQQA 1WLHA 2WLYA 4XPTH 4HSQA 4YHIA 1LGVA 3EYVB 3PL6D 1MCHA 4Z7VF 1K3ZA 5DTFB 3HB3C 3G6DH 4Y16D 1KFAL 4PJ8A 2HAZA 5FK9A 3QJFA 4IMLB 3WKML 5IVXF 4D8PA 3LHPL 1ADQL 2QQQA 1IM3B 1E4WL 3GSQB 3LQZB 5GGTL 5LAXA 2E6PA 3P4NB 4NQXB 3AC0A 3BUYA 3IDNB 2Y36L 5C6PB 5C6TL 2A77H 4KXZH 4LLVA 2MPAH 4IOSD 2FCBA 3MR9B 3PXJA 4BH8B 3IU3A 2DTMH 1FL3A 1EHAA 1HINH 4LAQH 1RZKC 1HH9B 2P5EB 4FQJH 1RHHB 3IDUA 3P30L 4FQ1H 5BCAA 3BQUA 3C08H 3VXPB 3W5MA 4JO2L 5BZWA 3M17A 2YRLA 2G5BB 1ADQA 4DAGH 4ZFGL 1CFBA 4PJHA 3FT2B 3I50L 2XKNB 5I74C 2DQIL 2Z92B 1YQ2A 4L3CB 2X89D 1GGIH 3S36X 3GNML 5DJ2B 2X4PB 2X1XR 3ARQA 2VLKD 4PRDA 5L6YL 3GI8H 2NW3B 1BFVL 2BP3A 3QEGL 4XZUA 2NXYC 5TPWH 4LHUB 2ARJQ 1YY9D 4Y16B 2ID5A 1KCKA 2QHRL 1TCRB 1JFQL 1FYTB 3WFDH 3TZVD 3O45A 1JE6A 1A3QA 1G9EA 3M17B 4ERSL 4DN4L 5CEZD 1J0HA 5D6DA 3HI6H 4ODWA 3AU1A 5IOPA 4AM0B 2PKDA 4MXVE 4F15C 4HQQH 1LO0H 2NQCA 4KV5E 2ESVE 1B0RA 1RIVL 3DUUB 4FQXD 1D9KA 1NGPH 4ONHB 4P57A 3MRDB 5IHBA 4FQQB 2GJ6A 4XP9L 2XICA 1UKTA 3OKKB 4DZ8B 4U2ZA 3RJDA 4OV6F 3WYRA 3VXMB 3NCEB 1JNHA 2Q8AH 4OD1H 2OX5A 4Y19D 1KSRA 5J1AA 4NM8L 5B22A 2FEDD 1LILA 4YO0A 2YK1L 3V95A 3RL2A 1FORL 3MACL 5JPNA 5T1KD 3RY4A 3PE9A 2QSCH 4YXLH 3ZKSD 1S9XB 2BNRD 4KTEL 4Z7UA 5E4EB 1T1ZA 1YEJH 4Q6IC 5CSGA 3VXOB 3PJSA 4HXBH 1M1SA 2BOCB 4OCNC 4G8GB 2W38A 5FYKL 4DKEH 2BRRH 5T1LB 1NUNB 3B9EA 1G7MB 4X4ZA 4N0UE 4UINH 1DANT 1H5BB 3M8OL 1U91A 2F54B 2I5YH 5E4IA 2MFNA 1LK2B 5CIPB 4PGDB 4LSSL 3W9EA 1U8LB 4Z77A 5HVWA 4HX1A 4PTUA 5FV1L 1SJXA 2QSQA 2IAMC 3LQAH 5F7EH 3HUJB 1NGPL 4PFEA 1JI1A 3DURB 4PPTA 1TVBA 4D2NA 5C0NC 4XP1H 2XY2A 5LQBL 1KIUA 3LKRB 4PRPD 5FYLE 3NIGF 4EDWL 3MRGA 3HN3A 4M7ZB 5D7IB 3I75B 1I1FB 2B0SL 2B8OT 4LSSH 2E7LA 1CZ8H 3IXTB 3L3JB 3OGCB 2HTLC 3F7YB 4P5MA 3STLA 3T0ED 3VA6A 2ZUSA 4MCYA 1AGEB 3IJYA 4JFHD 2G60H 5HDLA 5I18L 3H3PH 4YHNA 4EN3D 1XCQA 3QNZB 2VNCA 4LHQB 1CICD 4JKMA 4ZOCA 3LZFH 4PJFE 4QRPA 4R4FH 5FHBH 1LQSR 1SQ2N 4Y5XA 1D6VH 4XNMA 2H41A 1B4RA 4O2CB 3HNTL 3BD3A 3U1SH 4F57L 1YNLL 4ISVB 3J7HA 3AVEA 3W9DA 3VXRE 3RDTB 3LRSB 3PDOA 3C6SB 5D2LB 3UYOD 1UB5B 1BWMA 1YZZA 2N7BA 5D7JB 2XRAL 1TVHB 3T1WA 7CGTA 4XNUL 4Q9RL 4G3YL 1CLOL 1BFOB 3WO4B 2JELL 3RWHB 2ED9A 1B2WH 3GB7B 4K8RL 4LIQE 1RUMH 3CH1A 4NCC1 1ACYH 2J5LC 1GGCH 2X4RA 2E7BA 4FABL 5CKGA 3REWA 5E99L 2NYYC 3K3QA 4PJXF 4ODVH 2HT4C 4GJTB 1QR1A 2B0SH 1FC2D 2WLZA 1DUZB 5B4MC 4GRWF 4P46D 4ELMA 4L9DA 3DV4A 3FOLA 4Z76B 2WBJD 3QUZB 3B2VL 1K4CA 2FEEI 3RHWF 4PJHB 1A14H 1KLUB 5J1SC 3OB0H 1DQJB 1AI1L 1U58A 1ZHNA 2QR0A 5IW6B 4YFDB 3D69A 5DI8A 2UVFA 5JW3L 3RPKA 4R3SA 5DVOA 2ADJA 4LBEA 3U0WL 3BGFB 5I1EL 5TF1H 2D4FA 4OAWB 1BBDH 1WC7B 3KJ6L 5D1ZB 3O3AA 5CCKL 3QB7C 2EKJA 3IB4A 4GW1A 4D0DA 4HWEH 2VLKE 1PZ5B 2M2DA 5D7JC 3H0TA 1EV2E 4MWFB 4EN3C 4DGIL 3I2CH 2OZ4L 4TSAH 3HZKA 4UIMB 3TYFB 4UBDC 1F4YH 3CNKA 4HPYH 3RUGE 4ZUUA 1F6AB 3MLZL 3MRRA 3V6FB 1E6OL 4YXHL 1MVFA 3WIHH 2IANE 4PLJD 4J3TA 4QRPB 2VSDA 2VDOH 1DBKL 3GMRA 4NQSA 4QLRA 2BNQA 4TSBL 4NFDA 5L2KE 2VE6A 1IL1A 1NCWH 2UY7A 5MEPB 1P7HL 3VFOA 1B6DA 2XWJA 4JG1H 2MWCA 4PJ5E 5GISL 3EO9L 3M45A 1B88A 4MA1C 2X40A 4LDEB 1DVFA 2HWZL 1MRCL 5ICZA 3BIAX 3GKZA 2ENYA 5CBAA 5I2IB 1CDHA 5D7IA 4OZFG 3D0LB 3JV0A 5E08H 3VFGH 5GRVK 1BAFH 1E4XH 4YR6A 4JN2A 5BO1H 3MBEB 4O02H 2XZQL 3E8UL 1JPGA 3LKRA 3L9RB 3MJ8B 4X7SH 4AH2B 5EO1A 5C0GB 4A6YH 4DUXA 2OP4L 2DB8A 2VXQH 4S1DC 4Z76A 5BW7A 1ZKAA 4TPRL 4JM2A 5T33H 1NMCB 1LO5A 2EDYA 5E00A 2W0PA 3WNKA 4BA8A 5LCVH 4RGNE 4JKPH 5IEKA 4PYHA 4WI3A 1MAML 4P4KB 1VFUA 5J6GA 5I1GL 4R4NC 1N59A 1NKOA 1T89C 1T0NA 3O4OB 1IC4H 3VDBA 3OXRA 1VPOH 4X6FB 1VKXA 1DEDA 5T1LA 5JLZB 1WBXA 4OCRL 3ZDXF 4S1SH 5FF6A 3LN4A 1K2DB 2C1PA 4NQCB 5IBUB 4OFVA 4OLXL 5J11B 1J86A 3MCLH 1RK0A 3HG1D 5E9DD 5J0BA 1WTLA 3BX7C 4NKDB 5D1XA 4MLIA 5FKAB 1YMMD 4M93C 5TH2B 3TIEB 4TOYH 2XZCH 3DHMA 2BC4A 5EIIA 3BIKB 4Z7VA 3TBVA 3E2HB 1BGXL 1OGAE 4OLEA 3P0GB 5BMFL 2P45B 3QDMB 5GS3A 3O6FD 1IEHA 5IJVB 2R8SL 5SWSB 2DM7A 5D7KE 4LCCC 1G7QA 2P5ED 3ARVA 3GJFB 5KZCD 5IROA 5SV3A 3LQMA 5DR5H 4JHBA 1UA6L 5ADOL 1MCCA 2YA0A 3V4VH 1WSST 4Z5RB 1J0JA 5SX4H 4Q74A 2PCPB 2VC2L 5DFWH 8FABA 4ODTL 1XIWA 1HHGB 1A6PA 3EJJX 3L5HA 2A83A 1H3PL 1EVUA 3TC9A 5H35B 1AC0A 3B9KB 5F9WC 2G75B 3VH8G 1DTUA 5D7LD 5ECJE 4L4VD 1R6VA 1JHLL 2X89A 4PJGB 4DW2H 1N6QL 2EDWA 1KOAA 2P5WA 4FMFA 4U6VH 4P2QA 4KROD 1EHLH 3QEUA 4JQVA 5GGQL 1J0ZA 5AZEL 1S7XA 1I7ZA 4EEEA 4MJ5B 3BZFB 1V8HA 4E0RB 2VDMH 4LOUC 4ETQA 3X3FH 5HHOA 1QHPA 4NKDA 4ZFGH 1JGLL 4UNTA 3ZDZE 1NCCH 3GSOB 2DRUA 3HC3H 1A2YB 2NXZC 1FYTD 4GBXC 2Q6WB 8CGTA 1RMFL 2ZG1A 5DRWA 1MCWM 5SWZE 2H26B 2AEQL 2FHCA 1YEGL 2H3NB 3VFOB 3OXSA 1U8HB 4HCRL 2ZOKA 5C0AA 2ED7A 4WY7L 4TRPH 4J6RH 3CX5J 2E9JA 3DNKA 4XPAH 2ICWB 3MV9A 2DQHL 4TQEH 5IEKB 5J6GB 5E2VL 2NNAB 5T1KA 5GRJL 3D3VA 4UILH 1SYSA 4RISL 4G7YL 4HDIA 4FFVC 4K9EL 4JFOB 3EOYG 2YD3A 4MWFA 2HG5B 5CJ8A 3MYJB 3ULUC 2H45A 2QQKH 3BXNB 4F7TA 1J8KA 3ZKXC 3G5ZB 3NACL 3QUKA 3G5VB 2NY0D 4PJAE 5IV2B 2YXFA 4MX7A 5F9OH 2DLFL 3GMPB 1BF2A 1CLCA 4LHJB 2FD6H 1OGAA 1J9CT 4XBEL 4PRHA 1LHZA 2GFBA 4BUHA 1EX0A 4MXQC 1NBZA 1TJHH 2IAND 5DJ8B 3FFCA 1BVKB 3GSVA 1EFQA 2V2XB 3G9AB 2A9NL 3HE7B 5KAQG 1CDBA 3VRIA 1ZANL 2D9QB 2PXYD 5IIEB 1DSFH 1ADQH 4ZAKD 4CRPA 5D6CA 1IGIH 2CH8A 1ES0B 4P0DA 1G7HA 4N0FB 3W82A 4J8RB 4YPJA 2P8LA 3QCUL 3BWUC 3R8QA 1YN6A 3ZDZF 4YC2B 4EUPG 2GHWB 3GSNH 4MJ4A 1C5BL 3QUXB 5EBWB 4XBEH 3RX8A 4J3UA 1ONQB 4RGNB 3IDIB 1X4ZA 3T4AA 1WT5C 3BISA 2J2ZA 3RVWD 2EIZA 2LU4A 4WV1A 1Q72L 4JREC 3V6ZB 1P7QA 4G80A 2V17L 1A1NB 3K8KA 5T1DH 1DSFL 1T1YB 1ZXQA 2X9YA 1XEDA 4Q9RH 1HKFA 5DO2C 1MCOL 2ZZUT 1FZOB 2HN7A 5IJKA 5IJKC 3EBAA 2AK4E 5IHUH 3PP3K 1NC2A 3BO8B 4JZNA 1N3NB 4K3EL 4M5ZL 1KV3A 3RDTC 2Z31D 3O6LL 1TZIA 4WFHE 3PQYB 4G8EB 2E8ZA 1DFBL 3HUJF 3H3PL 4DKFL 2WBJB 3QUZD 5FYJH 1YDPA 4HDIB 4M43H 2P43B 3IFLH 4YBLC 3S5LA 3NA9H 3GMMA 1IQDA 2VLRE 4A6YA 4U49A 4P2OB 3V5DB 1JK8A 4F37F 4KH2A 5F6HI 4L8DA 5GRZA 1N2RA 1W8NA 1PEZA 2BY3A 5GS2D 4R26L 3MLTA 3L5WB 3WV0A 1H3WM 3BSZL 4OGXH 2YPKB 4HS8L 1JHKH 2YD6A 4YHNB 3KJ4C 3VE0B 2WZPD 2DWEA 1DUYA 3F8UB 3UTSD 5J8OA 3FB5B 4H25A 4JY5H 2W9EH 12E8L 5E6IA 3RAJH 3X12A 1UVQB 4X6DE 3A6CH 4LSTH 4IM8A 4UQ3B 1GZQB 3LMJH 4LARH 4H8WC 3MV8D 1INDH 2LVCA 2V6HA 3C2SA 3LV3B 2CDGA 5C6WH 3NIDF 5C0BE 3C8HA 3IGAA 5E6IB 5CSZB 3ARGB 1CVRA 3CVHH 5SWQA 5C0IA 3T1FB 1IQWL 1SYVA 4UDTB 1QLFB 1OAUL 2HLAA 4RFNB 4YH6A 3TJHC 1VADA 4HUWB 5I30H 1FH5H 2IADA 3ZE1F 5MENE 5SWZA 4M00A 4OF5A 2W9LA 4GRMB 3GSOA 5ILTL 3TBYA 3A6CL 4X9FA 3T8XB 1IKFL 5JORB 2FBOJ 5TDOB 4JO1H 4P2QD 1HHJB 1V3KA 1GAFH 1IC5L 4YWGH 2BDNH 1S5IL 5HHXH 3P2TA 2Q86A 3CAFA 3ZKND 1I7ZB 3SDCD 2VDOL 4CMHC 3MRQA 5IP4A 3WIFA 1AKJD 1JWSA 1N5YL 3SJVD 1YEFH 3BH9B 3EUUA 1OB1B 3RP1A 4QRQA 1HSBB 4LARL 1AXTL 1CK0H 5GGVY 4ELKA 3I9GH 4LRNH 4FQIH 4L9LA 1HXYA 4KI5C 2J8HA 5DHYA 3VFPB 4MA7L 4P3WA 5IESH 3P0VL 4JO1L 1WTGT 1IEAA 3G6JE 4K3DH 4X5WB 4XP6L 5IMLA 4ZFOA 5J06A 3QNYA 5F9JA 2FATH 3VW3L 5CEXB 2Z31B 1GCFA 5I6XB 2F54E 4WTZG 3CFEA 2YHGA 5AZ2H 5EO9B 3G6DL 3NCJL 2HJKA 5F7KC 3OJDB 1FPTH 2EDTA 4EBQH 2GCYB 3VGAB 2FGWL 4NNPH 3VFVA 4N8PA 2OQJB 1VGKA 5IFHL 3VFMB 3FT4A 5K9QG 4PY8J 2GAZA 1F4WH 3B5TA 3LRHA 4PRHD 4PREB 3RZCC 5I1EH 1NGZB 3SGJC 3T0EE 1UM6L 3CDGA 4EZMA 4OQTA 5CAYB 1KB5L 2AJ3A 3ARRA 4WHYH 3WN5C 4X98B 4AENB 2WUCH 2B1AL 2FYYB 5DD1L 2XXCB 5I76B 4PBXA 2VDRH 4MA3B 4HGKC 3BRGC 4I8DA 1DVFB 3BRFA 1XIWD 3X12B 4W68A 4ODUB 3WHXA 4KK8D 2OZ4H 3IDGA 1U8OB 1S3KH 3QUXA 5T3XE 5F7YC 4OQTH 3KYOA 3OXRB 4ZPTA 4GG6E 4G42B 1DR9A 1FP5A 3GMRB 4NQSB 1SBSL 3MLTB 3TO2A 3T77A 1NL0L 4WDIA 3RWEB 1X5JA 5FK9B 1SJEB 4WI9A 1T3FB 1KEGL 2PTUA 4JQIL 2IPTL 4I0PC 3DO7A 1T5WB 3GBNH 2WM0A 4AEHH 2WIIA 4YDLC 3B5HA 4DVBA 5CZKA 1ZGLM 4NNYB 5E56A 4HC1H 3MBEA 3S5LB 3JUZA 3UTQA 2NY4D 3RZCB 1NC2D 1S7RB 4PD4J 3AUVA 4JFPA 4CU8A 2ZSVB 5JTWA 1G84A 1A3LH 1OD9A 1UXWA 1SVZA 2DI8A 1HK6A 3QHFL 4NBYB 1SMOA 4OFIA 4YGVA 3CFIC 2VAJA 3QI9C 1UCBL 4G7YH 3CD4A 1P4BL 1QVOA 1AH1A 3QUZA 1MFAL 3GM8A 2NY2C 3MBXL 3QPQC 3DBXA 2YD2A 4K23H 2SEBA 4M7KL 2MPAL 2LU3A 4XTRC 5D96C 5L0QC 3SDXB 2OYPA 3CSPA 2R2BA 4ZSOB 3BHBA 2AXFB 3CFKA 1NL0H 3N1MC 3T09A 3LH2H 1JNLL 1MCNA 2BCKB 2VLKB 4BH7B 3BP4A 2H3NA 3LPWA 5E7BA 4PG9A 1GIGH 3MRIA 1BFOA 3T65A 1JZ3A 2GUOA 2OL3L 3U9UB 5DMJB 3QCVH 4H8WL 1MFBL 1PLGH 4HIIB 5GIRB 1G6VK 1K6QH 1OP5H 1UM4L 5F7NC 4NWTH 1NAMA 2PO6A 4HZAA 1IGJB 4YGAB 4JZOA 3DX6B 3N9GH 2VRAA 1NEZG 5DK0A 4HH9A 3BZFA 2OI9C 2BMKB 3HR5B 3G9VA 4M7JL 1DQJA 5KANG 1U3HB 2F53D 1AGDA 3DX6A 3WO4C 5MEQB 5EU4B 3GJFA 2XT1B 1TQCB 3EZJB 2C26A 4ELKB 1P69B 5T3XH 2MQCA 4XI5D 2ICEA 4PJGA 3RRQA 1T2XA 5GSRB 2XN9D 3GMQA 4G6ML 4PRHB 2DI9A 5JIPA 4P3CH 4GUPA 2F15A 3MXVH 1V3LA 5HY9A 5TQ0H 2YKLH 3T0BA 1ZT7B 1BVZA 2DQGL 2F19H 3L7FB 2WINB 2YBRB 4GW4A 3L5XL 5TDNA 1I3UA 3BGAA 1XGRB 3FN0H 5JORA 3C6SA 4FRWA 3U0PA 5DT1L 3HAEG 4MQXD 5JXEC 1FJ1B 3KLAB 4Q9QL 5L2KA 1N8ZA 2BVPB 3FQWA 2CXGA 2Y6SC 3ILPB 4K8RC 1U8NA 5ESVA 4M7ZC 4BSWB 3HZMA 2YRPA 4JEGB 5D7SL 5L8KB 1FFOA 2I5YL 1OT1A 1A6AA 2DQDL 5L2KB 5E94B 4FA8A 2BFVH 3IF1A 2OJEB 3DBXB 5DD5L 2E7MA 2YPLD 1CFSB 2OR7A 3JVGC 2MHAB 4UV7H 5I66B 3FN0L 3T0AA 1MIML 1B0GA 5FB8A 2D31A 1MWAH 5B39G 1RIVH 1A4KB 3SCMB 1EUTA 5DK2B 3GI9L 2ATKB 3LQAC 3ILQC 1T3FA 3LKSA 1BEYL 1J1XL 3NFSL 2AK4A 4FZ8L 4WW2F 1H15A 2HKFH 2L0DA 3RPIB 4DOHE 4EDWH 5LQBH 3OSKA 1A7NH 2P5WB 1H9VA 1QHOA 3OAYK 5F21B 2R4SH 3LS4H 3NTCH 4JFEA 3VD3A 1NFKA 1B4JH 4DUWA 5IMKA 5EOQH 2B39A 1T66D 1KCUL 4N5UA 3U48A 4NRXA 1T5WA 1U0QA 2IAMA 4FQHB 2NY1D 1CR9L 1J11A 3AS1A 1X5FA 3L95A 3SDYL 2DN7A 4QNPF 2X4QA 3V6FA 3QXTA 4IMKC 2QQNH 1U93B 4X8JB 3K2MC 2BFVL 4P48A 1IRAY 3IFNL 3QFDA 4HBCH 3MLYL 2V2WA 4ZXBD 4AEIL 3D0LA 2R1XA 4RFOH 1KYOJ 4UOW1 3NAAL 2W0LA 4Q9CA 2ADFL 5C08B 1KJVA 2KZWA 3S37H 3OGOE 4ZDHB 3OR6A 1QEWB 4KTDH 4L8SC 1DP0A 3WO3B 4G3YH 4JZNB 3S3PA 4TSCL 4UOJA 3GRWL 4NT6A 3UPAA 3IAGC 2NY3B 2DF3A 4S10A 4HJJH 5BO1L 5GHWH 3ME0A 3U79A 5IVNA 4KY1H 4QRTB 4CJ1A 1F2XK 1E28A 2J6EH 1YN6B 1NQBA 3T0EC 3V4UH 2DTSA 1ZWIA 2R4SL 1KLUA 4BSVA 1UQSA 3G6AA 3NPSB 4QHNA 4LKXA 1E0OB 5D6CB 3WFEH 3AFLA 3EOBB 3O6ML 5I8OH 1CFNA 1WWAX 2HTKC 3H0TB 1FVCA 1YEDB 3OKLA 1N64L 1AD0A 3LEVL 4RMTA 3MCG1 3MRMA 3Q2CA 5H2BA 1KXTB 5I0DA 4F7EB 4M6NH 1IQWH 3M07A 4RAVA 1MREL 4Z0XB 4M7LH 4Q9BA 3PV7A 3SJVA 3U0WH 3LEYL 2VLME 4OLVL 4TTDC 5D7LE 5IGXL 2VQ1B 4NQDD 1HCFX 5FA3B 5IWLC 5FHAL 2NW2B 1MJ7L 3NPZB 5JDJA 3SDAC 1MFNA 3WXVH 1ACZA 2ATKA 4YAQA 4HJ0D 2YPLE 5DGRA 1KG0A 2DQJH 3RDTA 1J1OH 3HKFA 1WZMA 4KK8C 3PDDA 3DV4B 1X5AA 4KI5E 4M1GH 4M1DL 4NZRL 1IVLA 3MLUL 1P84K 3EYFA 1CFSA 1GGUA 5CMAB 1HSBA 1CGVA 4NCC2 1QA9A 3AB0B 3BKYH 1KN2H 5I8KH 1PZUB 1OF2A 3C5ZD 2ZCLL 1G0DA 5IV2A 3ROLB 3C6LA 2OR9H 4Y4HB 4YPGA 1K8DB 5JR1H 1VADB 1Y0LB 2D7TL 3CFDA 5CGYD 3GSQA 4POUB 4J4PC 1MJ7H 4JFDE 3MV9D 3TN0D 4DN3L 1LE9B 2VXSH 4UDUA 3QSKB 5K33A 2EIDA 4D9LL 4X6DA 4FXGB 2CDFA 5KS9A 3EYVA 4NDMB 5CZXC 5FOBA 1JWUB 3D3VB 4FP8H 1UB6B 4JPWH 3QCTL 1DE4A 4HF5H 5JQHC 2OMNA 3VXUD 2XZQH 3B9DA 1CF8H 1QNZL 1W0VB 1EBAA 3CFBB 4P9HL 5GSVA 4YHYC 1SYVB 4OCYL 1A4KA 4O02L 3CSGA 4PJ7E 1A6AB 5FYKU 2O5YH 3LB6C 3H9ZA 1LO4H 2XA8L 3D2UD 1PZ5A 4N90D 1XGTB 3NCJH 1INDL 1EH9A 5AUMB 1OAQL 4KVCL 5FIEA 5GGSA 5FCSH 4PJHF 3ARZA 1GGBH 1AGCA 3PWUB 4JKPL 1UENA 2ZCLH 5IVOA 2HTLD 4NQEE 3KXFA 1JNJA 3TN0B 5GZOC 1CYGA 4TUKL 1J10A 3MXWL 2PO6B 2FLBT 3VRLF 4FXLA 1F11A 3F58H 5TDPA 5ILTH 5I9QC 1AQKL 2O61B 3EO0A 2XWBA 4XGZA 3QIWA 4YZFF 2RGSA 4N9OB 5IFAH 4TNWK 3FONB 1P7QD 5IHLB 1IZKA 1CLZH 2EDKA 4N0YH 3HMWH 4WGVB 4F7PB 5HHVH 4APQB 1FO0A 1BVLA 1L7IL 3P4LA 1I7UB 4WI6A 3SE9H 1ZLWK 32C2B 3SQBA 3ARDB 3P9WB 2ICWI 2NYYD 3HC0B 1PQZB 1HDMB 3MOQA 4G6JL 4JCMA 4WUUB 4KJWD 1OAQH 5LCVL 2JK5B 1JZ4A 1P9MA 9CGTA 5LGJB 5KSAA 4NQTA 2BNQE 4PD4K 2AABL 3DGGB 3GSXA 3GSNB 4FXKB 3HR6A 1HEZA 4P4KD 2F74B 1YPZE 3O2VL 4QWWD 3KPQB 3H9YA 3MCKA 3QHFH 4JREB 5BV7C 3IFOB 3THMH 5BVPL 3BQUC 1I7RA 3TCLB 1R0AH 4XCCL 3AROA 1IAOB 2YK1H 4PRPB 4OTXL 5FAAA 4ZPVA 3MJGX 4OLWH 2MSPA 3SDDD 3DO7B 4PJBB 4ZSOA 4K9EC 4EDXB 4CADA 4F80A 1FL6B 3KYAA 4JFZL 2JTDA 3QDAA 5T3XD 4JO3L 3ZSSA 5KTEH 3EW3B 4MNHA 4PJCF 5IEHB 4ORGA 1CGSH 1BQHG 4LHUA 3SGEI 2FR4B 5IB3B 1XH3B 4G42A 2CXKA 4FFVD 3HS0A 1KC5H 5JOEA 3LQZA 2XFXA 3WDIA 4IS6B 3QIUC 3E6FB 3SO3B 2WW8A 1FSKB 2IH1B 4YGVB 3MNWA 4PB9L 1I1AB 1Z0NA 1XGQB 3IXAB 4XVTL 3QT2A 3C60D 4WY7H 4LKCA 1IL1B 4NKIH 5FO7A 1IM9D 5L9DL 1I1AA 2CIIB 4X4YB 1AQDB 4LDLB 1YEIH 5I1CH 3TA3A 2G5RA 1FRGL 5I2IA 5KSUA 2HJLB 3QIBA 3VFMA 1JZ2A 4MDIB 5JPNB 1I1YB 4ZQKB 1DQMH 1ZSDA 5DJYA 2OTUA 4CW1B 5FGBA 2E7CA 1FN4A 2JJTC 4HUXB 4YNYA 2VITB 1KLGB 3GRWA 1VDGA 4JAMA 5C0BD 5D71H 3QUXC 1JF1A 1FO0H 1IILE 2AQ1A 2EXYC 3HI1B 1XF5B 3FHAA 4GG8A 4GAJH 4OUUB 3Q5YA 4G80B 5T5NG 1U8HA 5DHVH 2NY4C 3HRZA 4IRSA 2PTTB 3N0PB 2UWEB 1HI6A 2XQYG 5E8NA 3LS4L 3NTCL 3L1OH 5EN2A 3RTQB 3I50H 4GKSA 3QISA 1G6RA 1Q9LB 2FJGA 4GAYB 2DJSA 4OAWA 1DLFL 2Y7QA 1NEZB 2L7JA 3QCUH 1OY3B 3Q6GL 1XH3A 4G8GE 2W92A 4LLDB 3MRJA 5HGDB 2JB6B 3CH8A 1NFIA 4I0CC 1HOCB 2BMKA 3HE7D 3UROR 5HYEA 2VABB 1X7QA 4NO3A 4WHDA 5DZNA 1Q72H 5IW1B 4OFYD 4U1NB 1TVHA 4OZIE 2OTPA 1QBAA 3CUPA 3D85B 1T20B 3BI9X 4YXLL 4KRPB 5JZ7C 4GMSL 2R2CA 4OZFA 1CXFA 3EYSL 5CD5D 5J1TC 1J8HB 3MRIB 3WFZA 4GG6B 2EC9T 2F54D 3V52L 4NGHL 4HXAH 2OXGA 4TVPL 3SGJA 5EOTB 5MERA 1FH5L 2ZUXA 3LY6A 3P4MA 4X99B 1CGXA 5CCKH 4EXPX 4YFEA 3MRLA 3ORJA 3F7YA 1F4XL 4I9WD 4IDJH 4JJ5A 4JDVA 1KPVB 4JRYA 2IBGA 1KCUH 5KVEL 1N64H 3HLAB 2NNAA 5T1KB 1OD7A 3C5SA 1BPVA 2ERJC 2FJHB 5DVMA 3T3ME 3QDMA 1NJ9B 5AYUL 4JHZA 4P3DB 3R8BB 5I73B 1F58H 5AWNL 1FYTE 4M03A 4QHUB 5JOPE 3SDDC 3UTSB 1TZHB 4KRPD 3HMXL 3ULUF 5B39B 1AE6L 4TSCH 3RWIA 4LSRL 2X05A 4HK3J 4R26H 5CSZA 1R5IB 2V9QA 4OCWL 4EN3A 1C5CH 4E9LA 3PDGA 5E0QA 1BX2A 4A6YB 3QQ9D 4NZRH 5AAMA 3MNVA 4FTVE 1CXEA 3O2WL 1S7QB 1S7WB 2IC2A 4ZO6A 4KRLB 4Z7WA 3EDEA 1UH4A 3L9RA 2Q20A 1WAAE 3IJHB 4LCIH 2CR6A 3V8OA 5FUCE 2BSSA 3RGHA 4G9FA 4ENED 1A5FH 4WFFD 5CBAB 1RFDH 3QIBB 3WDJA 2LVEA 1T2QL 1EO8L 5HI5D 5CJXC 1TJIL 2VZVA 2Y72A 1J1PL 3WIHL 4YFLI 4D0BB 4PIRF 4HIXL 3O2WH 2LTQB 4OLYH 4R90L 4Y5YB 3TPKA 1OGTA 1RVFH 2XXMB 3C8KA 2ZNWA 4HGWA 1L6XA 1IQDB 3QQ3B 1N5AA 5EOCJ 1RUAH 1D9KB 2MJWA 3W0WB 4BQ8A 3IDJB 4U0QB 5TGBA 1JJUA 1Y6MR 3O2DH 5K9KB 5ICZB 2Y5TA 5IR1B 4HH8A 3GJEA 3FN3A 3MRMB 5H2BB 4IS6A 2WNGA 4YK4B 3WMSA 1PVHA 1CFNB 2IFFH 2CLRB 3KR3H 2OLDA 4MQSB 1IC4L 4M6OH 4NHUB 3UMTA 4HFWA 3QH3B 3BPOC 1KIQB 3TH4T 4OZFB 4PJIF 2AERT 4GS7B 3SBWC 4RFOL 5E8EA 3AU1B 4RFEB 5IESL 3VJ6B 5DR5L 4DN3H 4MAYD 4FFYH 5IW1A 5ADOH 4P23A 3KXFD 4Y16A 4FFZH 1MVUB 5FF6B 1JYXA 1DQQA 4OKVB 4RFEA 3VXPA 1KNOA 3DIFB 1QYGL 4QHLA 1VKXB 1BZ7A 3H42H 4DUVA 1LNUA 2BY1A 1EBPA 2Y23A 3OJVC 5LGHH 1X4XA 4ALAH 1DQQB 4OKVA 3PABB 3P4NA 3G5VA 4NQXA 1G7LA 4Q0XL 1MAJA 5IBTH 3T0XA 5AZ2L 5CJQH 1AD0B 2H32B 4QO1A 4RCAA 3EJYD 2FZ3B 3BQUD 4OZHF 3QDJE 3UJJL 3K81A 4IMLA 3I3DA 4JY4B 2ZNXA 5C0BA 3PWLB 3WE6A 2VKXA 3G5YA 3D0VA 3QIWC 4N0UA 3GK8L 3VWJA 2P8PA 1OLZA 1T1XA 1BJMA 1REIA 1QOKA 3KWWB 1MPAL 2DQFA 3ZT5A 1MCDA 4OM0H 3F6IA 2ZOKB 5JIHA 5TJWK 2YS4A 1KCVL 5C0IB 4OTXH 1UB5A 1AR1D 3KPPA 2AEQH 2VR4A 2DBLH 5IF0A 4X5LA 5IKCA 5BZDB 4ISVA 2R1XB 1H5BC 1N5AB 5HI3D 1Z9LA 3EYOA 4XPGL 4JFOA 3KYMA 4O4YH 3W2DH 2DQTH 3V0AC 1T4KB 3FO1A 1U93A 4X8JA 5F1NB 4Y4KA 3FHQA 3HG1A 3VGDA 3K1DA 5C86A 1CN4A 1UZ8B 4PRIB 2PYFB 3MNVB 3P30H 3W11D 4F9LA 2I24N 4P5TC 5IFJB 1WWWX 1FHGA 1PEWA 5ANME 2A73A 1RHFA 4UUJA 1W72B 3S3JA 2H26A 5HD8D 3U0TA 4AK1A 1P6FA 3DETD 4P3CL 3O6FB 2EKSB 4H1LA 2RBLA 3TYGH 2VZSA 5CIPA 1CIUA 2ADJB 4TNVK 1VGEH 5EZLA 3W2DL 4I2XB 1A3LL 1NGYB 2VWEE 4MXQD 5IQ9B 5BVPH 5IWLA 3PGFL 5F70A 1JWUA 2CMRL 3FFDB 3C60A 1Q0XL 1BECA 4GT7A 4PV9A 4OSUH 4L5FH 2UZXB 4NO2B 1NGQH 4I0PB 5EB9A 3RNKB 5HHQB 4ODHL 3VWKA 1BLNA 3MLWH 3PWPE 3GMOA 3PV6A 2J12B 3VD5A 4C57C 5IB2B 3UP1A 5E2UL 1UA6H 3JSSA 4O4YL 4ODSH 4X0KA 3AAZA 3QDMD 1FNLA 3HFMH 5HGBB 4LQFL 3V7AG 5DJZB 1HNGA 2A77L 3DX7B 5KTEL 4GH7B 3JWNC 4TVPE 1UACH 1VHPA 3GSNA 3BKCL 3GSXB 4FXKA 4V1DE 1G7JB 2VISB 3BKJH 4HV8B 3HI6L 3SE4A 2C1OB 2DDQL 1MLCB 4ZFZA 1KG0B 3VXUB 4D9QD 3RIAF 4LLQB 5HI4D 4WEBL 4WV1B 2VISA 3MUGB 3MMEA 4NC1E 1WEJL 1BM3H 1KPUB 1QFWM 4FZ8H 5IB4A 3TO4A 1VSCA 1ZT7A 2DLIA 4LNRA 4QKXB 4APQA 1H0DA 3U83A 2Z35B 2WUBL 1J12A 4LGPB 2VZ1A 1GPOH 1UACL 4HS6B 4S2SA 4X6BB 3RY5A 2X4UB 3DVNA 1FNFA 4H5SB 4ODHH 3P11L 4XVSH 3X14A 3B9KD 1NCBL 5I9QB 4WO4C 5C0AD 1QG3A 4G9DA 5IIEA 1T5XB 4LP4A 2ICES 5C9JB 4M43L 1NDMB 5CGMA 3U46A 1U42A 1JUFA 1OTSD 2DYPB 1OWWA 3JWOL 2WUBH 5E8OB 1JF1B 2BX5A 2AV1B 1CBVH 4X6FA 4W4OC 2HT2D 5CS7A 2Q8BH 2BZDA 5KVMC 1U8LA 3SO5A 4HK3N 4M6MH 5CBEA 5KN5A 2HFFA 4P59H 4YNYB 1NDGB 4L3ED 4ZD3H 5ANMA 1UZ8A 1RIHL 5F7FA 4EI5B 3X3GL 5EOCL 1FIGL 5DEGA 3U4BL 3CZJA 3VWKB 5EO1B 5C0GA 3MOAL 1UB6A 3O4LE 2PXYA 4ZAKA 3RL2B 4G9FE 5EC1A 4ZQKA 4ZUTA 4RWYL 5JDSA 1YNTA 4KGJA 4R0LB 2CR3A 3QDGA 1KJMB 4H1LB 2EKSA 2KBGA 4ZO9A 2VERN 3LZFL 1RQ5A 1FDLH 2OK0L 1CD0A 1F3DJ 1YNTB 4KHTL 2YSSB 4CNIB 2NXYD 1H3XA 3D39A 4OJFL 3BZEB 3RL1A 5A43C 3G6JA 4PRIA 4LCIL 5CEZE 3HPJA 4ZAKB 3B2UD 5GS0D 3ZMRA 1GZPA 2FZ3A 2VOTA 3AREA 3VGAC 1FFRA 4R4ND 3KDMB 3CDGB 4YWGL 2ARJA 3VWJD 2IH1A 1UGNA 3CLEH 1RZJL 2W0FA 3O3BB 4NFCA 3TBSA 5F7UA 4H0IA 4CN1A 1BQHA 4LHUG 3TPUB 4ZUUB 2Q1EA 3WNPA 5C07A 5FUOH 1A1OA 4IIQB 4XTRD 4AEIH 4PLOB 3UJIH 4FNLL 2X4SB 1M6OB 4XP4H 4HIJB 4PTTB 4Q58C 4BFEA 3D18A 3QAZC 5EA0H 4OZHE 3NIFF 4O2FB 1GXEA 4JFFA 1IGYA 3F12A 4ZPVB 3VXQA 5FECA 1BD2B 5JPMA 2QSCL 1IEAB 4U7MA 2XTJB 3LKOB 1IC5H 5EZOH 1F3RB 4Y4KD 2JLLA 4ZFOB 1U41A 1S7XB 4MB5A 3WFCL 2JKXA 5ID0A 5EO0B 3LPGA 4OV5A 3WS6A 3BP5A 3AY4C 3H6JA 3QUMH 5D1QC 1OTUC 3ZHDA 4PJDF 1NMCC 3LEVH 3LKNA 5D1XC 3Q5TA 4FQXB 4K7FA 3QDJA 5EFIA 2R0LH 4NZTH 1Z6JT 1U8QA 4FFYL 5IFHH 2YMXH 4NIKB 3VXMD 2DOCA 2A83B 5I16A 1F11B 1E4JA 3WCYA 1RU9L 2Q86B 3RWHA 4L4TE 2B1HH 5ADPH 5SWZB 5DSCB 1KPUA 4UT6H 3EHBC 3SJVE 4MMXC 4HT1H 4WCYL 5DRZA 4TVPH 2NR6D 3QEHB 3SGDH 4HG4J 4OLZL 4N1EA 2IF7A 4X7FC 4XGZB 4YHOH 3CU1A 2B1AH 6CGTA 3WUWG 4YHKH 4J12A 3VXSE 3KYKH 4UV4L 2OP4H 5F71A 4GKOA 1WIUA 2BSSB 5EFIB 5MEND 2V2TA 3O11B 4TPRH 4OFDA 2EE2A 4L4TB 4WJ5A 1P6AB 3H9HA 2XY1A 3S88L 2BNUA 2D03L 2X42A 4DGIH 2DM2A 5J13C 4LNVA 2NY1C 4NRZB 2ICWJ 4MB3A 3PP4L 4QXTA 1JGVH 5DS8B 2NY6B 4KAQL 1NAKH 3QIUA 3GMLA 3TT1H 1GGYA 4HWZB 1EO5A 3SGKC 4OLXH 1FNSL 2OM5A 4OZGF 1BD2A 2V9TA 4Q6YA 1R3LB 1ZT4B 3GFUA 1OGTB 3C8KB 3EO9H 4ELME 1MJUL 1U8MA 4MJ2A 4TNWF 3BYTA 1KJ3L 4HIJA 1JPTH 2XTJE 4O58H 2R2EA 4NHCH 4Z77B 3JV5A 5HHNB 5E6YA 3PHQA 4HEME 5F88A 3QFJE 1V5JA 4C59B 4ESKA 2KDGA 5FYLH 3ZO0A 1LD9A 4OUOA 4UTBL 1JGVL 4NZJA 3P0YL 4JB9H 4G8IB 1NANH 4RNRA 1LO4L 2P5WE 2XA8H 3LKPA 3OKDA 4LLUA 4KDWA 1RZ7L 1ED3B 1Q38A 4N0CD 4LAJH 2X41A 3SDCB 2J88H 1RFDL 3S37X 4UQ2A 3D39B 4AL8L 5CGTA 4GW4B 1KN2L 2P49B 4V1DA 1YNKL 1KGCE 1OT2A 1YDPB 3VXNB 4AT6B 2NLJA 4YHYB 5E1HB 1JNLH 2R9HC 5ACZB 4RRPG 3ECBB 3FKUS 3D5OF 4FMKA 3DPBA 3L7EB 4ONFH 3DIFA 3MODH 5FXCH 4CBPA 1WISA 2VXUL 3NCYS 2I9LB 3SOBH 5I75B 4MJIB 1EEYB 1SJHA 4P3DA 5DRZB 4X5XB 1AGDB 4FFWC 3IVKA 1CF8L 2VDLL 4NRYA 5IW3A 2J88L 1YN7B 4F8QA 3C09B 3MUJA 4WFED 1NBQA 2IJ0C 4XPGH 4HH9B 3BEWB 2LTQC 1IAII 4PJ5B 4O51A 4KROB 3G5YB 3REWB 4UIMA 3OR7B 1C12A 3STBA 3QZWB 5HDQH 1NCWL 5IK3A 3O9WA 2R29H 4MD4A 1IZJA 3R1GL 1MCEA 4F2MA 1A64A 3QUXD 1MFAH 3HC3L 4JHAH 1MFBH 4Z18A 1EA9C 3H9SB 4NQED 3BO8A 3MTRA 1QP1A 4Q2ZA 4NJ9H 1L7TH 1I8MA 1MOEA 1KLFA 2FEDC 3MROB 3O2VH 3MOBL 3X3FL 3HRPA 4L1HA 3D69B 5DI8B 3RI5K 1AP2B 5GS0L 1UYWL 3D18B 4NO5B 3L3OA 3GKWL 4PJ7F 3K4AA 3PWPA 1NGQL 2VQTA 3IFPA 2IBZY 5I75C 4X4XA 3S35H 5KSAC 3FRPA 4L4JA 4YUEH 4ZFFB 3ZTJH 4LCCB 4XB8A 5DHVB 5EBWA 1NGWA 4C56E 5C07D 4RMUA 3FB6B 1BOYA 3GK8H 4QRSA 3V0VA 4NSKA 4OT1H 4K71C 5I1IL 3O3EB 4OM1H 1XF3B 3TBTA 4LCWA 1NC4B 4IRSB 3U9PH 1L6ZA 5FYJE 1GOHA 4K7PL 4J4PD 1KGCD 1HH6B 4Y2DA 1IBGH 1OOAA 1BFSA 4XMLL 1OLLA 4YHIB 5C7XH 4XXCA 1XF5A 4GG8B 4JANB 1G7PA 4Y2OA 2AS5M 4U1IB 2VUYA 1FAKT 1NMAL 3JTTA 1D5BA 1BQUA 1S9YA 4OCLC 5CHNB 3DSNA 1H8NA 5D7LB 1YJDC 4G43A 2NY3D 1FN4B 1I8IA 2HFEB 3WFDL 5EOCH 1G1YA 3SDAA 3AAZB 4ERSH 3V5KB 2DYPD 3OV6A 5HYJE 2FJHA 1CE6A 1WT5A 3FQWB 2I26N 4PLKC 4YDJB 3C87A 3C9NB 5IT2L 3S96B 2JJSC 4K23L 2JIXB 4Y4FD 1CLYH 1ZA3B 4MD5B 3PGDA 1TNMA 1SEQL 3IF1B 1LEKA 1MI5D 5KVDL 1QACA 2EEAA 5FO7B 1X5GA 4OKDA 1JGDA 3RWGB 2JF1A 3RA7L 2HFFB 4WU7B 4XAWH 5DD3L 5I74B 1AFVL 2HRLA 5GZOD 1FORH 5KW9H 1OHQA 2RR3A 4EUPH 2XN9A 2BVYA 3UTSA 3UX9B 5LGKA 1MCKA 1OAXL 5IT2H 3MLWL 2YBRA 1H5BA 4NN5C 4KRNA 4I13B 4NO3B 5AYQA 5HXMA 1QSFD 5SX5K 1T6WA 2F58L 5DS8A 4G9DB 1IM9B 4PGZA 3VDAA 1OAYL 3ARED 3K2UH 3QPXH 4AG4H 2UYLB 1BD2D 2YN5A 2RFXB 4G6AC 4JDVB 1AKJB 3NAAH 1TZIB 5DHYB 4WUUE 2V9RA 2IBBA 2I9LA 1J7VR 2D0FA 1FAIL 4EXKA 1XGUB 3CIQA 5EZIH 4RWYH 1BOGA 5TQ0L 4QRQB 3TO4B 5IB4B 5J4MA 2WWKT 1I9JH 2DMBA 2QQNL 1S7SA 3NA9L 1FBIH 3GO1L 2NLJB 4TRPL 1MIEL 5KSVA 2GJ6B 3PHSA 4HIHB 1D5ZB 2R4RH 2C5DC 2KL6A 4R2GB 5T5FL 4ZS7L 3SDCA 4DGYH 2GIYA 3WL9B 2CLZB 3WLBB 5DQDL 4LLVB 3FTGA 2A9ML 3DOSA 3UTTB 1TETH 3ULVC 4WVRA 3BAEH 1I8LC 3ARBA 3MGTB 3SDAB 1IGFL 5GHWL 3IJSB 5GGUA 4YDVB 1RZJH 5T5NF 1AO7B 4CUCA 5IVZA 4DTGH 1BLNB 3ES6A 1U2CA 1QFOA 1YNLH 3RVUC 5BQ7A 1KNOB 2IPKA 4RGOH 2XQYK 3HMXH 1XFPA 1B4JL 4JN2B 1V3MA 1KJ2L 3QWQB 3C2AH 3HPJB 4KKBC 3G6JB 1P7KA 4UDUB 2V5RA 2WIIB 1V7MH 4AMKH 4LCWB 1FVDB 1I9JL 3L3DB 4JPWL 2KH2B 1IAIH 1J1XH 1UCTA 1FBIL 3GO1H 3NFSH 4HS3A 1T7WA 2EYSB 5B8CA 1T1WB 1S7RA 3C6LB 1CL7L 3SDXF 4NHUA 2HKHH 5K9OA 4LDOB 5I8KL 2CSPA 3QDGE 4FTVA 2FECL 3BT2L 1JIBA 3MSPA 4HBCL 5E99H 1N5YH 5TE6H 1CD8A 3IFPB 3UCRA 1BJ1J 4HUNB 1JPSL 4OCXH 1CR9H 1DEEA 1JF5A 2BDNL 2H8PB 1FVDA 2AXHA 1T7XA 1NH6A 3ZTNL 1AY1L 1T83A 2FYYA 3CFCL 4PRPA 3V6OE 1MQKH 5IB1B 5J13B 3UXFA 3IFNH 1TJIH 4ZUWB 3ZSTA 3DXAB 5IF0B 4DKAA 4XNQB 2FX8H 4X6DB 4ONGH 3SHSA 1SVCP 1NGZA 1ZHBB 5HYQB 2KQMA 3CJJA 4Z0XA 5TQ2L 4U3HA 4R0LA 3AM8C 3BZDA 3UAJC 5F97E 4JFYA 2R56L 2CKBH 1EUUA 2F8VA 1MRFL 4JVWA 2ICCA 1P4LA 4G8GD 2BNQB 1N3NA 1WFTA 4XCNA 4M1CD 3ZTNH 4QF1A 1YPZB 1FV1A 5K93A 1NDMA 1S5HA 4XC1L 3ES6B 1XGPB 4TVSa 5HYSB 3MGOB 4LEXH 5F72S 1ZEAL 1CFVL 3WN5A 3DSFH 4NZUL 5EC2A 1PKOA 4POZD 4LGSB 4AQ1B 5T3ZE 1DUZA 4Z7NF 1IGYB 1GC1H 4HPOL 5I1AB 3RWDA 2EIZB 3ZT7A 1CD1A 2EYTA 4H88H 3C5ZA 3O3AB 2OMBA 4C56B 2MNUA 3WL9A 3WLBA 4BQ6A 4LVNB 3BSZH 3L5IA 3E8UH 4HKJA 1Z5LB 2FECI 4XP6H 1YECH 3BJ91 1HHIA 4GMTL 5CEYB 3OBAA 2BSTB 3TN0A 1JWSB 2FIKA 4Q0XH 1NBVH 4XXDA 3ZYOA 2WUCL 3SKMA 1JMXA 1HSAB 4NKMA 3WUWA 3QNZA 1XCQB 1AGCB 1JHLH 5GRXG 2A38A 4M1GL 1E4XI 1N6VA 3FOLB 2LFGA 5D9SB 1QBLL 3QH3A 1UT9A 3DMMB 1AGFB 3ALXA 4JZJB 4LLWA 1RZGA 1WAAA 2YEZA 2YSSA 4CNIA 1R5WB 2NR6C 3KNBA 1MAMH 4KUZH 3BN9D 4PJFF 2Y4SA 5DJZA 3PHQB 3QRFM 4NQEB 4MXWL 3GHBH 1CXIA 2VN7A 3GIZH 3FQUB 2AJZB 2J1KA 4NNXA 2AJSH 3VFWA 3CK0L 4QTHB 2HJFA 1ZK9A 3SGEH 2NTFB 2PN5A 3D85A 2RCSH 1EEZA 1RJZB 2ATPA 1ED3A 1B9ZA 2I9TB 2X9XA 3SOBL 5KS9F 3QQ4A 2E27H 4PTTA 5DHXB 1OW0A 4UQ3A 4HHAB 4M7KH 5E7FA 4R96A 1YPZF 3H9SD 4E5XB 2O5XL 5C07B 3MZGB 2ZUYA 1PX4A 2ZSWB 2EDDA 3O8XC 5DQJB 1TPXB 4Y4FC 1QLEL 3RZWA 3MV11 4RA0C 2VQUA 5HPMA 4OFKA 3IS1X 3CXHK 3TNNB 2V5SA 3FJTA 2QBWA 1D5IH 3G04A 4MDJA 3V0WL 2ATPB 1OQXA 3FT3A 1QRNA 3HRZB 3MRGB 4MHHI 3CXHJ 3DO3A 4KJPD 5I1HH 3ET9F 2R1YA 2YUXA 3OKEB 5IFAL 4QYOB 3LS5H 1CDYA 1Y6NR 1WJ3A 1PG7W 3TWCH 1Z3GH 1P53A 5BZDA 2XTLA 3GSRA 3G08A 3L6FB 3RGVC 3MOBH 4P2QB 1CBVL 1ND0A 2PXYC 1GL4B 1M7XA 4YQXH 4YO0B 5HVGB 2GKIA 3LIZL 4CAGA 1FLRH 4LGRB 1AGFA 3DMMA 4JZJA 3ULVL 1AXSA 1A7QL 1MFDL 4U1JA 1YEJL 4WFHD 5LG1A 1HILB 1MNUH 5I17A 3E0GA 4N0YL 4NN7B 4AQOA 5B38A 1MCPL 2X1OA 4YXKL 3HFML 3BESR 4NO0B 2NY5L 3AB0C 1TCRA 3EKCA 5LVEA 3TYFA 1Q1JL 5DQ9A 1F8TL 1IAKB 1A7RL 1RV6X 3JTSB 1NLBL 3EYUL 1QSEE 2W65A 2A2QT 4X6CA 4ZO7A 3STZB 1PSKH 1BREA 1JTOA 5A2IH 4X4XB 2VDRL 2QV2A 3PWNB 1SY6H 3WEXA 5HGHB 3L3OB 4L8CB 4PLJC 5F6HJ 1E4KA 5GXBB 1CD9B 2MQ3A 3VXMA 1PG7L 2FX7L 4MJ6A 4UIKH 4XPTL 4RIRB 4HW6A 4KMTL 2EDFA 1NCAH 3ZYIA 5F1SA 1X4YA 1PFCA 1AHWC 1HH9A 2P5EA 4YDIH 5IW6A 4GAYA 3QRGL 4M5ZH 3ZYZA 5L0QB 4NKQB 1KJ2A 1DJSA 3RTQA 1KPRA 2X1PA 4RMWA 1CLYL 4TTGA 2GY7B 5F7LB 1FL5A 1U3JA 1CG9B 2JB6A 3CLEL 1QSEB 1SY6A 3VFRA 2G60L 4KJWC 2DQIH 5MENA 2Y07L 3RQ3A 5EZLB 4KJPC 3QIBD 3RWCB 4P4RA 3O6KH 1PG7H 2FX7H 4FG6C 4NZDA 3GSRB 4YX2H 2C3VB 1RIUL 2RJMA 4WTWA 3GJEB 4L4VA 2V5TA 1JGUH 1MJ8H 1IT9L 1DL7L 5DVKA 4PJXE 1A7NL 3DVGA 4JGJA 4AIZA 2ERJB 3NFPB 4F58L 4H0HB 5FGCB 2VJXA 5D72H 4A2MA 2C7UB 5CLWA 4JM2F 4ZFZB 2Q8BL 1X3DA 1NBYA 4O9HL 2IQAA 2P24B 2CLVA 1QFWI 5H8DA 3GI9H 3MGOA 4CGTA 3TO2B 2N56A 1OTTD 1U8JB 1OWRM 3QEGH 2KZ1B 5EU7E 2VL4A 4L29B 3WLWD 3MLVL 3MR9A 2JE8A 2APFA 3BZ4A 4JVPA 5I1IH 2P8MB 4LCYB 4WI2A 3QUKB 4JRWA 3WIIL 3L3JA 3OGCA 1MJJB 3K4DA 5LAXB 2AKRA 2ITCB 1C5BH 1MHEB 4EIGB 3OPZH 1QBML 4JLRA 2DM4A 5IG7A 1RZIB 5E8OA 1BMGA 1MRDL 3MX0A 4P2OC 5DMGD 1ETZA 4JGMA 2FHFA 5B38G 4YLQT 2B2XL 3LEXA 3O6KL 3E2HC 5BS0D 1FFNB 4GAGL 1CE1L 4UTAH 1EK3A 5IMMA 4DVRL 2GTZB 2OK0H 5ITBH 1BZQK 1PX3A 2A1WL 1EFXB 2J8UF 2B4CH 1KIPB 4YHMH 4N68A 1MCOH 1U8PB 5DJAA 4M61B 4XNYH 3N50A 3DURA 2FH8A 3O6LH 5JA9A 2X9WA 1MLBB 2WP3T 4WDIB 1TZHA 3W9EB 1UADC 2CPCA 5TE4L 4QOKD 1RUQH 5GS1A 1I7RB 4GRLA 1G9ML 4G6MH 2R69L 4DKEL 3FB8B 1DN2A 5D2NA 4HJGB 2ZOLB 3BGFC 4M6OL 3SDYH 3IFLL 2EZ0C 4U1MB 2Z31C 4XPFH 5JHDA 3IVKB 1DE4B 3D85D 4MYWB 1WCQA 3NCCB 4MVBC 4F7CB 4OCSH 4HIIA 3RIFK 4Y89A 4J1UA 5KANI 4U6XA 2WAHA 2VMFA 2GUOB 3ZZ1A 3UZQA 2AV7B 4C58B 2IFFL 4LEOA 2H2SD 5IUSA 4U3XA 2F58H 4YHZH 2J6EL 4WFEE 4G5ZH 1Q0YL 4HUUA 4HUMB 3HC0A 5AWNH 3WJLC 1IGTA 4RZCB 4KMLB 4N5ED 1W72L 4Z78A 1RK1B 2E9BA 4XCEA 1A6UH 3HI5H 5F6IB 4GRLC 3H7LA 3MLZH 4WEMB 4HGWB 4UAOC 5C0FA 3HG1E 2GTWB 4O2FA 4PJEE 2BK8A 4JFYB 5AYUH 3QG6B 3N1QC 4OGZA 1JZ7A 1FNHA 4K8RH 4Z7WE 2NX5E 4FQ2L 1YECL 3QIWD 3B5GA 4GW5B 3MUY1 4OCYH 3SE8L 2A6KB 15C8H 3OZ9H 3DMMD 1S8DA 2XRAH 4LSRH 5JW4M 4J3VA 5JW5A 2CKBB 5D1XB 2CDGB 3MNZB 1GAFL 3OKLB 4QNPE 1Y18B 3WIFB 2W9DH 1A02N 3Q0HA 4Y2DD 3KS0H 3BHBB 4XCFL 3QIUB 5HJ3A 1CT8B 2EXWD 4LSDA 3FFDA 5D2NB 3Q48A 5E8DH 3CZFB 1XIWC 4HKZB 1ZS8A 4LLDA 5HGDA 1S7TA 1AD9A 1D5XA 3KS0J 2OR9L 5FYLD 4X7TA 3BWAB 5FOBB 1A8JH 4P4KA 5EPMA 5HGAB 1A7PL 2I07A 4RGOL 4U2YA 1ZSDB 3JWDC 1IGCL 1KB9K 1A0QL 2XZAH 5EU5B 3P0VH 4PJGF 2X4OA 4QXWA 1HIML 1L9MA 1T2QH 1I3RA 4RFNC 3KHOA 3U82B 2AKRB 4PUBH 1OM3H 1U91B 2YWYA 2XWJB 4P5TB 4QY8B 1BJ1H 1AQDA 2P1YA 3O41A 4NDMA 2HYMA 2GW5A 2Q76B 4Z95H 1J0YA 5A3ID 3PWLA 3WE6B 4I3RL 2YD8A 3MV8A 3W0WE 4I3GA 3RVTD 2EE3A 1A7PH 4XRCA 4JJ5B 5D1ZD 4HUXA 4ZO8A 1P4IH 1A47A 5C0DA 5ANMB 2DWEB 4WNQB 2FWOA 4HUKB 4TUJA 4ODSL 3HZVB 2QKIB 4PRBB 3OJDA 1X5KA 4I3SH 4XWGL 3ALPA 5CJOH 4L8BA 5I73C 1XF2B 3CLFL 3UO1H 4NC2B 2C3XA 1LP9A 2IQAB 2P24A 1UWXK 5LGHL 1AC6A 2NY3C 2HMIC 1JGLH 4N0UB 4OF8A 4CVXA 1TTUA 4R6UA 2R56H 4KJYB 5FB8B 1MQ8A 5E2JA 3D87B 3RY6A 1A6TA 4IIQC 3TLRA 1JPTL 3G6AB 3LHPH 3VFGL 1WF5A 1OW0C 1NMBL 3QZWA 2QL1A 3PQYE 5FUZL 1KELL 1AKJA 1NUDA 2O5XH 4KKLD 3PGCA 4OQTL 4D9RD 3GSUA 5IVZB 4KDTC 3DRQA 4K3GA 4WUKH 4NT6B 4PJEA 1UWGH 5HDOA 2APXA 3HE6D 4LEXL 1MY5A 2NY6C 4X6DF 5KSAB 4JDZA 5ITFB 4EQ3A 1LDPL 2GJZA 4XVSL 5DEFA 3AM8A 2JJUA 3MCLL 3T04D 4AEEA 3FT2A 5DRXA 5DUPL 1KPVA 4JRYB 5FM5O 1G6RL 1ZWIB 4GRWH 1BZ9B 4XWOC 3WJJA 5GGTH 3VCLA 3WS3A 3U36B 4LPUA 3EFFA 5KVDH 3BQUB 3BVNB 3VFUA 2CO7B 3TCLA 2AABH 3HCVB 3MJ7A 4MNQD 1OP9A 3CX2A 4OD3H 2AJYL 4Y5XB 1A9BB 3DYMA 3IYLW 4U1GB 4FQCH 1WCBA 5KW9L 2DQUL 4ODXA 5GS0H 4PB9H 3DUHA 3BPCB 4QOKA 3QRGH 4LLAA 4NUGH 3QULA 2BY2A 5C0DB 3VXSB 4JRXA 5BRZA 1SMAA 2AQ2A 1MI5B 4EI6B 2Y5TB 4BZ2L 4MD5A 3JWDH 4Y88A 1JBJA 2OTWB 3EYQD 2X4NA 2A6JB 1NSNL 1N7ML 2IQ9L 1GGBL 3LKPB 4HQQL 3MV9B 5T1MB 1UWGL 4WHTB 5JHDD 1YUHA 2DQDH 2IANB 1I1RA 4XMPH 4Y5YA 2AJYH 5JNYA 3WS6C 4JY6B 4JKKA 5D7IF 3CK0H 1R5VA 2OS7A 5ID1A 1RUPL 1DN0A 1OARL 3GBMH 4U1SB 3MXWH 3QCVL 1IT9H 1DL7H 2X10A 1D5BB 3AREC 3BDXA 2GITA 3CFJA 5J7CC 1RJYA 2X4OB 4YIQB 4XHJD 2FGZA 2XWTB 4M6ML 3WNMA 1PYWB 4U05A 5HGAA 5HHOB 1F13A 4HWZA 3UBXB 1ORQB 4F33B 1HH6A 5I1DB 1JGDB 3RWGA 3T0DA 5J3HC 3VH8A 3Q6GH 3MLVH 1NCDH 2HG5A 1OAKL 1YEKH 2YD9A 2QHLA 1A6WL 2OCFD 5I8EB 2OL3A 1L0QA 4JAMB 4L5FL 1F90L 4QRSB 3V0VB 3BKJL 4QRUA 1J0KA 3CMOH 3UPRA 1DBMH 4XVUC 2YPLB 1MF2L 1U36A 3LOWA 3W11C 2XWTA 1IEBA 3RY6C 1DDHB 4DKFH 3I84A 3V5KA 3P9MA 2PYFA 2AEPH 2A6KA 3UBXA 1I1AC 1ZA6A 3OXSB 3TEUA 3QJHB 1OF2B 2P5WD 4G8GA 2BOCA 3U4BH 3RZCA 2AQ3A 1C1EL 2J6EA 3MLYH 3MJ6A 5EZJA 4LASL 2HH0H 1OARH 4GRWE 2YXMA 1A6WH 5B3JE 4XHQA 4TULL 1YYMH 2FH6A 5I16B 3MRPA 1R0AL 2AJUH 2ESVD 1HXMB 5I8CA 5HHOD 3NCMA 3V6ZA 2JJTA 1FG2A 5F1IB 5BXFB 3HB3D 1GSMA 1MFDH 4PP1C 5E5MB 5ESAA 2MCPL 4G9FD 3BPCA 3KVQA 3RWCA 1U92A 3BPNC 4G6KL 4IBLT 5EO0A 5A2JH 3K2UL 1UXSB 5GS0C 1VEMA 2XWBB 3EFDL 5C9KA 4D9QE 4C56A 4CADB 5BV7H 1SM3H 3C5JB 4MA8H 3LMJL 3QEQB 4N0FA 5DRNA 4KI5F 4ZXBB 1A9EA 4OGAC 5C70A 4JY4A 5C0BB 3ULUH 4L9LC 5C08E 4F3FB 2EC9U 5DJ0A 5ABDE 4EI5D 5CLTA 4U6HA 1CS6A 5DK3A 1IGJA 4TYUA 3BVNA 1HHHB 1W8OA 5EU6A 4X83A 3KXFB 1PGRB 2R0WH 4RIRA 4L8BB 2ARWA 3JWOH 4N0RA 3L7EA 2XQBL 2A1WH 4PJAF 4RWHA 2B7DT 1C7SA 1OVZA 4K2UL 2D7PA 3LKNB 4PJDA 1UZ6F 2CLRA 3SGDI 1IGML 5DMGC 5KSBB 5HYJD 4ZD3L 4X7EC 3FO0L 3QDGD 4D8PB 1PW3A 4MAYA 4G6KH 1FVEB 35C8H 1BVLB 3D39D 2Z93B 4KKAC 3ZL4H 5TH2A 3TIEA 5TF1L 3NMEA 2ADFH 1HILA 5I17B 5IKCB 1KUMA 1LVEA 5E24E 2YWZA 2VN4A 1T0MA 1YEEL 1UWEH 4FQIL 1OTTC 3MNWB 4XBGB 3QI9B 4L9LB 2UY6A 4NQCD 2XKUA 4WV1C 1T0MB 2GT9A 4O58L 1HZHH 3GRWH 1HNFA 1DBBL 4KKNA 5C07E 2FBJL 3QUYC 1NBVL 3K8LA 5I1KL 5IMOA 3ARPA 3TP4A 4KZEL 4YHZL 3E3QE 5M7QA 2DJUA 3UJIL 4ZG1A 4MD0A 4QRRA 1Z9SA 1S7QA 1IKFH 3G6JF 2IMNA 4LSPL 4OFPA 2C3GA 4NNPL 3UTZA 5I8OL 3H9HB 2AJ3B 4EN3B 2MOVA 3VRJB 1CTNA 5JUEL 3IFOA 3DVGB 3V2AR 2F8XC 2VDPH 3TO4C 2F74A 3GIZL 1F2QA 5F89A 3ARSA 3Q3GB 3BH8A 1V3JA 3QNXB 4M1CC 4YDKH 5C0FB 4MCZB 3QDJD 5SWQB 1FZMA 3WJLA 5MEPA 4JRXD 5BRZD 3WXVL 1OL0A 2R9HD 1R3LA 4BK4A 4Q97A 3I85A 4Z78B 1IC7H 2DLHA 3LV3A 3UTPE 1XR9B 2NY0C 4P9MH 3MO1A 4H0GA 5DMIL 2DMCA 1I9EA 1AI1H 2JB5L 1VEPA 2LAAA 1AO7A 3B83A 3VFSB 5JR1L 3T4YA 4QRTA 4WTXA 4OIIL 4Z7WF 1YNKH 1RZ8B 1I9RH 1X5XA 5MEOA 2GCYA 4CDGC 1OSPH 1FLTX 2YEZB 4L8CA 2HJKB 4HPOH 4W6WB 3OR6B 1OP3H 5IVXB 1TCMA 2ITDB 2YPVH 4X4MA 3KYKL 5HYFA 4FP8L 3NABH 1GC1L 1X5YA 1K8IB 1JGEB 3WHE1 3FFCE 4C4KT 3QUMB 1MQKL 3MJ9L 2OJZL 1QZ1A 3T2PA 1OM3L 3U46B 1INEL 4HT1L 1S9WA 3X11A 1MHCA 5C0EA 3TWCL 3PP4H 4X9GA 4P9HH 4NFBA 4OM0L 5JLZA 3WSQL 4F15B 1G9NH 4YK4C 5K59F 3ZKNC 5GGSB 1HOCA 1I3GH 5B38B 1IGTB 2YUWA 3QEQA 3R0NA 2V5MA 3RTQC 1QQDA 5MI0C 1A7QH 1BD2E 3EAKA 5JHLL 4ZYKB 3MJ9A 2BCKA 2VLKA 2XI9A 1Z2KA 2Z35A 1S7UA 4WUUD 4UI2A 1DQDL 5HHOE 1GHFH 3ZDXE 3ELAT 1BJ8A 2UWEA 5E8NB 1KULA 4PY7A 5DFVD 1FV1B 1ZHKA 3UAJD 2B5IB 4CMMA 1VGEL 4KVNH 1F8TH 1BX2B 2H6PA 4R7DA 3V8CA 1GIGL 2BERA 4X7SL 4APQD 4PJ8C 4HV8A 3QWRD 5JXED 4HX1B 4PTUB 3ZKMD 2AP2A 5AUMA 4RAHA 1YQVL 2Y5EA 4R7NA 1XMWA 1HYSC 3HAEA 1MJJA 4YUEL 1ZHBA 4I0PD 3FCTB 3VGGA 5E2UH 2VC2H 1WFNA 4P5KB 3UTQB 1I1YA 2PXYB 3KPNB 4BFIB 1BIIA 5B3NA 5M95B 3CX5K 2HP4A 5DUBA 4U1GC 3O8XA 2J8UA 4MNQB 1JCKA 3KYMB 1NCUA 3DX9B 1F6AA 4EI5A 1L0YA 3A6BH 4R8WL 3OTTA 4LK4A 4ZS6C 4HLJA 2HRPL 5ICXB 3BGMB 4S1RL 5DUMH 5DJAB 4FQXC 1AGBB 2WMPA 4RGND 3SO3C 4PJIA 4O00A 2OZ4A 3FAWA 5BOZG 1FO0L 4XCYA 2CUMA 1UM5H 1XF4A 2VLRA 4GRLD 4L3EA 2EYRA 3UC0L 1BAFL 1E4XL 1EJOL 4P4RB 3KPOB 4E41D 5GRYA 2VDML 4U1HA 5LWYL 3GMPA 1QR4A 4XC3H 1WFOA 1Q9OB 4R9HA 1N0XL 4LCCA 2OL3H 4Y2DB 2N7AA 3SKNB 3OAUL 1KT2B 5ICXA 4GQ9H 4FS0A 5DRXB 1G7MA 2FLRT 2HRPH 1FLRL 3MC0A 5I71B 1RAMA 4OBSA 1DQTA 4IRJA 4PP2A 1II4E 1E4KC 1CGSL 3AMLA 4LAQL 1WZ1H 4I3SL 4X9BA 4XWGH 4XZUB 4LQFH 3H2WA 3KXFE 3A6OA 1EJOH 4QGYA 3PQYA 3DYOA 4ZFFA 2FO1A 4HKXB 1FGNL 3RBSA 4F37K 2PTVA 4PY8I 2XNAA 1DANU 3P11H 3QI9A 4Y19B 1OP5K 5I1JL 4XBPA 5GGTA 1UCBH 4OZGB 2VSCA 3KLDA 1QSEA 1NUGA 4HBQA 3V4PH 3VD4A 4BH7A 3MRCB 1IAKA 2B2XH 5EC2B 4WWKC 2WINA 2Y06L 1RZKH 3PUCA 4NKIL 5HVHB 3L3GB 5DJCB 3LN5A 4LCWD 5BMFH 2QHRH 1WZ1L 2FD6L 2DIAA 3T3MF 1OTUD 4HUVB 2V5YA 3QA3B 3MFFA 1IKNC 5IM7B 2EECA 3DHJA 5CWSA 3JV4B 3IDIA 3ABZA 4NKOA 4X6CF 1YMHB 1QSVA 4DCQB 3GSVB 3QXWA 3IRZA 2FX9H 4KK5C 4U0RB 1FNEA 1LO0L 2DAVA 4ZTPL