4QCIB

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
214
Chain Sequence
b'EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYISDDGSLKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHPYWYGGQLDLWGQGTLVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-PDGF-BB antibody - Light Chain
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 44
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB01
2ZP0T 1L4IA 4Q74A 4F2MA 3HE7C 3ZE2F 1XGRA 1Q72H 2BNQA 2GSGB 2XT1B 4FFYH 4RMUA 4PJ9B 3LB6D 4OGXL 5D1QD 4WI9A 5H2BB 2ZNXA 2ZUQB 5T1LD 1VA9A 1RUAL 2P5WB 1YQVL 5GZND 4JFHE 3S35X 2L4OA 1P2CA 5ERWA 1CR9H 1N8ZA 1DQQB 5DHYB 4JHZA 2ENYA 5J3HD 5CJQL 4AIOA 3QUKB 2YOCA 1YEJL 3H7LA 4R7NA 1RZJL 3H9SD 3BP7A 3OWEA 4J6RL 1G7LA 1TDQA 5TDOA 4AEIL 1Q9KB 2XIDA 4FTVE 1VGKB 3B83A 1H3XA 3EGSA 2X4OB 1T20B 4DKDC 1F6LL 2A74A 2P44B 3ARPA 4WWKD 1U8IB 3ARBA 4JFED 3IS0X 1I9IL 3IDIB 5EORH 3FN0H 4ETYA 3D87B 5F96L 3IDXH 3L1OL 1OOAA 4H88H 3EDFA 3R0MA 4QRPD 3S37L 4AIZB 4KUCD 1YUHB 4N0UA 3PL6B 5GGRB 1S7XB 4H25A 1CFSB 1GIGH 5IVOA 5DK2B 4X5XB 3MO1B 2E8ZA 1JF1A 1EO7A 1KENL 4JANB 3UXFA 1FL3B 2BVOB 2LU7A 2A6DB 1DQJA 4Y4HC 4AL8H 4AEFA 3B9KB 1GVIA 4QXTB 2EE3A 2FO1A 1FVCB 3HAEH 4FQXA 3FTGA 4Z8FL 4BQ9A 2ADGB 4JQXC 3I2CH 1QSZA 5IBTH 4K2UL 5LBSH 2X05A 4X4ME 1RK1B 4ODTL 3TN0A 4U4BA 1K2DA 4I3SL 4O2FA 3UJIH 2NXZC 4LSUL 5KSAC 4Y1AB 1T22B 4E5XB 2GTZB 4NN6B 1ZWIB 1L9MA 4J3WA 1WBZA 2D9QB 3D0LB 3HMWL 3IT8D 1F3DH 3VRJA 1Y18A 1TNMA 2FX7H 2FZ3B 5IMKA 3QUYC 1BBDL 2BERA 4HLZG 4X8JA 1MJUH 5E4IA 2XZAL 3PGDA 3OX8A 1X7QA 1OAKL 3DVNB 4HS6B 4LVNC 2ESVD 3CLFH 3MROA 4WU7A 4YHOH 25C8L 5GGSA 1LEKA 3D3VE 5ETUA 4M7LL 4U7SA 2VDNH 4IRJC 3PDOB 5FOBA 3SOBH 3T0AA 2LAGB 3WFBL 3SE3A 4L8CA 1P7QB 3ZL4H 2QBWA 2E27L 2OJZH 4LKXA 4AH2B 4C59B 3EZ8A 3FFCB 3QIBC 5MP6H 4QRTB 2AK4E 3SPVB 1NGPH 1HI6B 3O2DL 4M5ZL 1RI8A 3GJEA 4NQCA 1JPFA 1OGTB 4IIQA 1OM3L 4EI6B 4HUUB 5C6TL 5BW7C 3N1MC 4L9LC 4O2EB 4KKCC 2ARWA 3C09C 5EA0L 4K3JH 4PJ5B 4UDTB 1FJ1A 1OGAB 2PKDA 3AMLA 3U7AA 2GJ6D 2ZUUA 3REWB 3B2UD 1QSEA 4CMHC 4C83B 3B6SA 4XNMB 2HVJA 1MCBA 1F58H 4J2XA 2P8MB 1A7OH 2IMNA 4G9FE 3SJVA 5I1JL 2YHGA 4DGVL 4ELMF 3SKMB 4DFHA 2DM7A 1MNUH 4PGDB 1CD0A 3UYRL 3QULA 1XGYH 2NYYD 3EO0B 4Z0BL 1U6AL 4G6KL 2ITDA 3MCLL 2QV2A 2EIEA 3ZE0F 4PRAA 1RULH 3SDCC 3U0WH 3RU8H 3JBG7 2ZCKH 2EZ0C 1KGCE 4G8GE 3NTCL 3KHOA 1WEJL 3NCYP 2NNAB 3ARVA 4ZO6A 5EIIA 4GAJH 3L5XL 8FABA 5DYOB 3TBWB 4X6CE 4YDLB 2AKRA 2FHFA 3QDJE 5DHYA 4PJGF 1AE6L 4U49A 4X9HA 2OS7A 4HIEB 3NBNA 4YC2B 3V0WL 4Q6IA 4EI5D 5DZNA 4O2CA 2HG5A 1Q9KA 2DQGH 3DX7A 4HW6A 1JGEB 4PJ7A 4XCYB 4NQEA 3DVIA 4IOIA 1EEZA 2FX9H 1JZ6A 4R2GC 2X4OA 4N8CH 1T20A 4OB5H 3U9UB 4EUPG 4I48A 3GI9L 3QXUA 4UBDD 5IGXH 3IDIA 1P4IL 3BGAA 3O3EB 4RGOH 1UCBH 5CBAB 3IETA 2Q8AH 4AIZA 4B41A 2IPTL 3MOAH 4JO2H 2LTQB 3VRLF 1MFAL 4M4PA 5DK2A 2WV3A 1SBSH 4IDLA 1KJ2A 2PTUA 1GC1L 4ZAKB 2GUOA 1LEGA 3K2UL 3X3GL 5FUCC 1A6ZA 2DM3A 2GTWB 1VFOA 4CMMB 1UJ3A 5ECJE 1S9VB 3KDMB 1KN4L 3PWPE 4BK5A 2YWZA 1IC1A 2ICWJ 3G08A 1ZSDA 4OSUL 3VFWB 4HG4K 5I30L 2HTLC 2Z31D 1NGWB 1UCTA 4HCRA 4NZRH 3PWJB 2XTJD 1VACB 1FCGA 1NMAH 2VLJD 4PGEB 3MLWL 3ULVC 1JNLL 4ELMB 3G5VB 3F6IA 2WLYA 4Y1AA 1GOHA 2LVEA 1ZWIA 1F90H 4PV8A 2YPLE 3VD9A 1ACYH 5FA4A 2XQYK 3OQ3B 2Y06L 5GQBA 2YPKB 2YUXA 3D25B 4MXQC 4Y16A 2PW1B 4MLIA 4IRSD 3KPMA 3OPZL 4IJ3B 2YSSB 5D7LE 4O5LL 4PJAA 1PLGH 2ZUXA 1EUUA 5INDA 4KUZL 3EYVB 4PJHE 2BHUA 4HS6A 1YDPB 2NY4C 2VITB 2P5ED 4R6UA 2V5RA 4OD1H 2DQHH 4NO3B 3LDBB 3UPRA 5IK3B 2J2ZA 4WI5A 3SDYH 5KSBF 5JHLH 3T0VA 1AO7E 4PJGB 3SCMB 2YA1A 4HIXL 1DANT 3MV8E 2ITCB 4OQTA 5E6ID 1V7MH 1LP9F 5EG6C 5H94B 4K7PY 1QO3B 2N7AA 4OIIL 1UB5A 1DDHA 5HTSA 3HB3D 3ZHDA 2DJSA 3R1GH 3VFUB 4JO4H 5JIIA 3CPLA 4Y4HB 4Z78B 1W72H 2DQUH 2CLVA 4FRWA 4LEOB 3OKMA 3WS6C 2FJHB 1IGTB 1H5BA 3WMSA 3GSNA 4QOKB 4Q7DA 4NQXB 1OGAA 4JFQB 4BQCA 3WFEL 3RX7A 1TVHB 2ZOKB 5IFJB 3DUUB 3OAYH 3REWA 3NABL 1NKRA 1J0IA 1HYSD 2P8MA 2R29H 1INEL 3I3BA 4TUKH 1MCIA 4PGDA 3JWOL 4ZFOL 3EO0A 5F21B 2VDLL 4HH8A 5HSFA 4WNQB 3DX9B 1F6FB 4TVSa 5FXCH 2VERN 4G6MH 1HSBA 3MJ8B 2NNAA 2Q86B 4JY6B 1IFHL 3NIGF 1UYWL 2IBGA 1J5OH 4ZPVA 1LVEA 4PG9A 3TBWA 4NZJA 1KBGH 2ZSVB 3VFPA 4URTB 2A77L 3QPXL 3A6CH 4R97B 1ES0A 5IROC 4NO2A 4MCYA 3AROA 2O5YH 4GRMB 4ONHB 1G9ML 5EDXA 4LCWB 1KPRB 3CSPA 1KJ3H 4B7LA 1RU9L 4HIEA 1ODAA 3X11A 1IGIH 5FDWA 4NSKB 4OV5A 1EEUA 1AFVL 4PR5A 4CN4A 1CDBA 3OXRB 1T1WB 2BSSB 2HFEB 2WWKT 1UFUA 1GOFA 1HWHB 4QWWC 4TPRH 5C0ND 5C0GB 1OPGL 4QT5A 4R8WL 1P84J 2ZPKH 3C09B 3L3JB 3RWGB 4X9FA 2GJJA 3RTQA 5I9QC 4Z7UF 1B4JL 3FAXA 3LCYA 4HIHB 3ZTNH 4CMHB 1BX2B 3TCLA 2HT4D 1B88A 3QWOA 5I8EA 3W5NA 3AREB 3C5SB 5J0BA 1QR1A 2ATKB 1DUZB 2L0DA 4R7DB 4P4KD 5KSBB 1I8MA 3GSWB 5I71B 3V4PL 5I16B 2FJFB 3NA4A 4RGNC 2R2BB 4HCRH 1YEDB 1LP9B 4LNRB 4MA3B 1P1ZB 5LKNA 35C8L 4PYHA 5DI8B 2EIBA 3EJYD 2GSIB 3CCHB 2PXYB 3EJZD 3MQIA 4ZAKA 2AW2A 3FO0H 2NY1B 5IVZB 3HE7A 4QXWA 1WIPA 4KK9C 2Z93A 4JQIH 1S78D 4KC3B 5CEZL 3H42L 5I17B 2GTWA 4I0PC 5GZOD 2H26B 2YK1H 1CFQB 5CILH 3QCVH 3KDMA 1EHAA 3O2WH 5I1GH 4PJEE 4KI5C 1TZIA 1V3LA 1NGWA 1FZOA 5E9DA 2F8OA 4X99B 4ZO8A 4PLOB 4UILH 2D03H 2O26U 3G5VA 4ELMA 1KIPB 4P46D 5D96B 3O8XD 2F53A 1RHHB 4EQ2A 4PBVC 1LO5A 4FQ2H 4OQTH 1AR2A 2YPKA 5C0AB 3S3SA 1XGTA 5F9DC 5HYEA 1I1RA 2AJUL 5D2NC 1EJOL 4RMVA 3PP4L 5CEYA 3BYYA 4NO0B 2WP3T 4M3KB 5CCKL 1BWWA 5F88B 5GRUL 3A6OA 5I76B 1QFWH 4K3EH 1YDPA 4ZUTB 4MNQD 1OWRM 5MERB 3JTSA 1K4CA 4KV5F 3VI4F 1LHZA 3UROR 3CFDA 2V7HA 4NYLA 5M95B 3GSNH 4PJGA 4LBEB 3VRIB 2ITCA 5SWZB 2BHZA 2WM0A 3MLYH 2IQ9H 3QIWD 1BGXL 3DRQA 3QI9B 2RBLA 4Y4HA 5KN5A 5IHLB 1CFBA 4ZD3L 1SYSA 3EOTL 3VWKC 4U1HB 1KFAH 2DYPB 3QA3A 3RVXD 4BQ8A 2AJZB 4JQXA 4DUXA 2EDFA 4NNYB 2AVGA 2DLFL 4Z7UB 5AG8A 1TVHA 4X7SL 4MA1C 2UZXB 3CH8A 4EQ3A 3CMOL 2GT9B 4UT6L 2XZZA 3L6FA 4ZTPL 4EEEA 4PP1D 5KSAA 5CJOH 3VFNB 3RAJL 5F7EH 5C7XL 3MOBL 1VSCA 1CIUA 4AQ1B 1A22B 1U8QA 4FTVD 1XGQA 4L3CB 3HC3L 2OQJB 5IHBA 2R2EA 2B5IB 3IF1A 3F12A 4GW5A 4UTAH 3RVVC 4XP4L 5DHVB 4KDVA 3ARFC 3QUYA 3MJ8A 5JDJA 2K7PA 4WIQA 1AGEB 2Q86A 4FMKA 4S1RH 5BMFH 3LQAH 3T0XA 4P23C 2MCG1 1QSFE 3VFSB 2P46B 2ZSVA 4R0LB 2F74B 3VDBA 1TIUA 5ABDE 5KVDH 2IANB 4IRJA 4RFOL 2I9TA 4PRIA 3GUTA 1UA6H 4ONHA 3GDBA 5HHNB 1DLFL 1KPRA 5D1XC 4BZ2L 3B4NA 2GJZA 2WNGA 3BIAX 3HNSL 3SGJC 5F7DA 4LAQL 5FM8A 1A4KA 3QIBA 5F8QC 1FNEB 4NSKA 4YXHL 4OCMC 3P30L 4LEXH 2BVQA 5IB4B 4XWGL 2B4CL 1FNAA 1EGJA 4U0QB 4G8FB 4KRPB 3SKUD 5BW7A 5I66A 4L9LA 1D5MA 1MRFL 1VPOL 3INUL 5L2KD 1AC6A 3T65A 1BX2A 2ZZUT 3KYNA 5GGVL 1CLOL 2ATKA 2VL5B 4MQXC 2FBJH 3N85L 3QEQB 3VI3F 4YHML 4XCFH 4KXZH 3DETC 4D0DA 1YY9C 3KPSA 3DYPA 2AJSL 3GBML 5DVNA 2J5LC 1KEML 1G6RH 2IBZY 4MA3A 3I3EA 4CUCA 4NRYB 3SDCA 3L3OA 3TIEB 5DRWA 3VWJD 2BSTB 4JFFE 2PF6A 4NQDD 5SWQA 1BD2A 1U3HD 3GKWH 3G5YB 3MJ7B 4R96A 1FPTL 1XMWA 3QO1A 3D3VD 4K23H 2E9WA 3WKMH 3IJSB 4NO5A 3HA0A 3LN4B 4LRIC 2BDNL 2Z8SA 4HQQH 2N7BA 1KTDB 3DGGB 1KIPA 1YNTB 2HMID 5CKGA 4F57H 1GZPB 4UUJA 1RHHA 3QEGL 3K1DA 3OJDA 4L8SC 3GSVB 4KVCL 3QIUC 5E6ZA 2X89A 4ZS6D 2GW5A 1OARL 4KROB 1I8KA 4GMSH 4YPGB 1A1MB 4F7MA 4NO0A 1K4DB 4HWZA 1FFNA 2NZIA 4HAFA 3MRJB 3ROOB 1OTSD 5I9QB 4YDVB 4D9LL 1IBGH 4LSRL 2E6JA 1CGSL 1F11A 4U1SA 2EECA 1U8JA 3LN5A 1I1FB 2BMKB 4G9FD 4BFEA 4OZHF 2OL3H 3IXAA 3VXRD 3MBXH 2BNUA 3MRDB 4GAGH 1QP1A 4NM4H 3MRBB 5LAXA 2AABL 2DDQL 4HC1L 4LBEA 2H6PA 1S7QB 3QWQB 3QPQC 5CWSB 1NGXB 5JDSB 1KSRA 4JZJC 1ZLSL 2ZUVA 4WEBH 1GSMA 3C8KA 2B1AL 1PKQB 3RVWC 3VGFA 2MPAH 4XGZA 1PW3A 3BMVA 3QFJA 5C0FB 4XVUC 5D1ZD 1PZ5A 3F62A 1M05B 1P4LB 3K4ZA 4JQVC 3T4AB 1ZOXA 3QO0B 4X7CC 3TO2A 4QYOA 1QRNA 4TVPH 4LPCA 2AJZA 2XG4A 3ARDC 4GKSB 3Q0HA 1UM5L 4NNYA 2YWYA 4GMTL 2FSEB 3R06B 1X5AA 3U2SA 3TBYA 5DSCA 3OXSA 5JIKA 5ALCL 1J0HA 2IBZX 3KJ6L 3BP6A 4Z0XB 3NCFB 3CK0L 1MIML 3QDGB 3PHOB 3G5XB 5FYJL 3VFNA 2L7JA 2G5RA 3FO2A 1NCBL 1CDUA 5DD6A 5D4QA 2NY0C 5J12C 3MZGB 5DHVA 1HDMB 2KL6A 5F7KC 4NWUH 1ZVYA 4XNYL 4PP2B 2JF1A 3LS5H 3TJHC 1FLRH 2I60L 2VLKA 4AQOA 1J1PL 4OCYH 2R9HC 1KPUB 1OP5K 2F54A 2ZKHL 5FECB 4NQSB 2X2YA 4EBQL 1BVKA 3HC4L 3LPWA 5I74C 3EOAB 3WJLC 4HAGA 2CDGB 5HHNA 3BD3A 4J4PD 4BZYA 4C56E 4JN1L 4MDJB 4WEMB 3BIKB 4NRZB 1JYWA 1U9KA 2DQEH 4GRLB 4Y4FC 5JHDE 3UEZA 3WFHB 5ICZB 3EYSH 2R0KH 4OD3H 1Q1JL 4I77H 4UT7L 2MQ3A 2A9MH 4P9ML 2JJUA 5IB4A 3QJHB 3LN9A 5C0RL 5B8CB 1FVEA 5GS0L 3WS6A 2E7CA 1C5BH 2BXYA 1E4WH 1JRHH 3O6ML 1UACH 3TJEH 5BOPA 3BGMA 4XNUL 4XBGA 5GS2D 2LAAA 5DT1L 3IDMB 4OZHB 2VL5A 2VAAB 1E6OL 4UZGA 5HHOA 4LSSH 1I7TB 3B43A 3HUJF 4XMPH 5CP7B 5KJRH 1A7BA 1DN0B 2YPLD 3HCVB 4N9GA 3WL9B 4QRQA 3HAEG 4YBLC 4IS6B 3MV9B 1N0XL 4K55A 1YJDC 5IV2A 4JLRA 4X98A 5D93C 5DZLA 2AJ3A 1OCWH 3QUXD 2BSTA 1N59B 3LY6A 4YBQD 3QYCA 4HKJB 4Y19D 2J6EL 3DIFA 1M7IA 3OF6D 4KGJA 3ECBA 4K8RC 4XP1L 1EAPB 4Y2OA 4G43B 2C1PB 3WIIH 2DKSA 3MA9L 2CRMA 2XRAL 1N3NA 4MD5A 5T1KA 2IPUG 5IROA 3EKCA 1KLUA 3TC9A 1U8LA 3BE1H 1KTDA 2CO6B 4KAQH 3BP5B 1YNTA 3IYLW 1IEBA 4Z7WA 1YEIH 1GZPA 1IT9H 3MRMA 3S88H 3S5LA 1MWAL 4KKBC 1YEFH 3GSVA 1H3PH 5JW5B 4NWTL 4DCQA 2IQAA 4KK5C 2Y5EA 4KJPC 1HKLL 4WCYH 3RZWA 3OJMB 4HGKC 1U58B 1K4DA 4CVZB 4Q9QH 1UVQA 3MRJA 1YQ2A 4JFZH 4LCYB 4QY8B 3ROOA 1FC1A 4M00A 1E4XH 2G5BA 3RDTC 4HXAH 1A8JH 2Q7YA 4UI2A 2Y07H 4DEPB 2A1WH 2NTFB 1AGBA 3IVKB 2X70A 5E8DL 1VFUA 3ZKNC 1QLFA 2YXFA 1GGBH 4FABH 1WAAE 4NC1C 1R5IA 5CWSA 1S3KH 4X83A 4WO4C 3ULVH 1D5ZA 4KZDL 1QVOA 1P4BL 5HVHB 4FHBD 1RVFL 3VJ6B 1M05A 2FCBA 5ILTH 4YIQB 4I0PA 3QO0A 5IW1B 4RGMC 4HWBA 4P0DA 4I18C 5DMGC 1CYGA 3K1KC 1BZ7B 4LSDA 5BVJB 2FSEA 1JI1A 1MFEL 2Z92A 4JRYA 3DTXA 1INQA 5EU5B 5CP3H 1CF8L 4Y5VC 3QDGA 3PHOA 1GH7A 1RZ8A 3HUJB 4XAWL 4QTHB 1ADQH 2DTSA 3IDNA 5C0DA 3MSPA 2FHCA 5IB2A 1XF3A 4DKFL 1NCWH 1XIWC 3CXDL 2YKLH 3SKJL 4XVJL 1AI1H 3BT2H 1HDMA 5D2NA 4XNXL 1CBVL 4CADB 2YD4A 5GRVL 3RWIB 1HHJB 2BNRB 3I50L 3ZLQC 4FFWD 1Z0MA 1A7PH 5FHAL 1Z9OA 1TNNA 5D7KD 5CZVH 5J6HB 3DROB 1VB9A 4ZFGL 1WZLA 4CW1A 4YGAB 2A73B 2CDGA 1QFUH 1EEQA 5JTWA 4KHXH 5EZIL 2ARJB 4M1CC 5IF0A 4NZDA 3NFSL 3Q1SH 3ARRA 1I1AB 3E6FA 2Y5TA 4MCZB 4M9OA 2BY1A 1NFDE 5GSVB 3Q48A 2GAZA 3FB7B 2I07B 5E70A 2P24A 3OAUH 1EDQA 1IAIM 3PWLA 5GS1B 1EO5A 4P5TB 2D7QA 3HLAB 1OP5H 4PJFE 1Q0YL 5I8KL 3UJTL 3VXTA 2YBRB 3WD5H 3X14B 1JTTA 3BO8A 3IFNH 3OG6B 3EFDL 2IAMD 3P0YH 1DN0A 1B6DA 1CZ8H 3WL9A 5I73B 1JFQL 2XXCB 5DJZB 3WSQL 3R8BB 2NY0B 4GQ9L 3ARFA 3L3KA 3U46B 1EVTC 3TBVA 2V7NA 3BKCH 1MPAL 4NHCL 3FRUA 4I0CC 3VG0L 3IFOA 1MJ8L 4P23A 1S9YA 3U7YL 2C1PA 1LEIA 3TFKD 2QQKL 1I4FB 3IFPB 5IESH 3QCUL 2OM5A 3UYPA 5AG9A 3QH3B 4K94C 4HSQA 5D1XA 5T3XD 4NQVB 4FFZH 4OJFH 1JPST 4IRZH 4PIRF 3SGJA 4Q2ZB 5T5NG 3LKOB 4YHNA 3V52H 4BQ6A 4DVBA 3LEVH 4H1LH 5KOVC 3K81A 3SDAC 4A6YH 3LZFH 1U58A 3T2NH 3ES6A 3RPIA 3UPCA 5B38B 4HKXA 3PWNA 1DBJL 4CVZA 5C0BB 4LHUG 2YUZA 5FYKE 1W72B 2YN5A 3D69B 1R5VB 3RNKB 1KULA 3HHRB 4G42A 2HT2D 2VH5H 4HWBH 4FZ8H 1RZJC 3D0VA 4P5KB 3W2DL 1P7KB 1HIML 4RMQA 1VEMA 2R15A 1KTLB 4KJQD 5AUMB 4YBLB 2ORBH 4OCXL 4LCCB 3RWCA 1U8HB 4YDJB 1G9NL 1ZEAL 4S11A 5JOFB 3HG1B 1MJ7L 2BVEA 3QZWG 4X7TA 3HNVL 4NCDA 3ULUE 3VXUA 1Y6KR 3KYMA 3T0EE 3EYOB 3QUMB 4YLQT 4U1IA 3L5WA 2AXHA 1I8IA 2EYSA 1ZGLP 3HPJB 5FUZL 3RPKA 2XFXB 5E7BA 4D0BB 5BVJA 3UAJD 3FONB 5C9KA 5CS7A 4DN3L 2XACC 4MD0B 4N0YL 5DVKA 1EPFA 4LRIA 3VRLE 1CE6B 4WTZA 3LH2L 4PB9L 4RAVA 4JHAL 3MLSL 4U3XA 3HUJA 2NY5L 1OSPH 2DQJH 1T1YA 3CFEA 4L8SA 3QIUA 4F7EA 2WBKA 1LK3L 5IVXA 5CGYD 1MCNA 4LPXA 3P4LA 1BQSA 1AD0A 1PJ9A 1UZ6E 3S7GA 4U1NA 1PEZA 3MUJA 4JO3H 3RWIA 7FABH 3QUZD 2X4TB 3THMH 1W0VA 2YXMA 3O9WB 1D7FA 2K3TA 3VFGL 1HHHA 3R8QA 4PJXE 3LRSB 4LCWE 5J6HA 1CVSC 5I2IA 1AXSA 2OTWB 4JKWA 1NC4B 5ADOH 4OLUH 4BJLA 3JWNC 4X4ZA 1ONQB 2FGWH 4OZIE 2PO6B 4OFDA 2E9IA 1EEYA 4U1MA 4JZJA 4YE4H 2ARJA 1OLZA 3REVB 3O6FD 1L0YA 1T0NB 2IG2L 3C08L 1S5IH 2IFFL 3G6DL 4JFFD 3VG9C 2DWDB 4LVHB 1HH9B 1MEXL 4JQVA 5I0DA 4G3YL 5TF0A 3G6AB 5B21A 3KJ4C 4XMKL 4DJMA 4I18B 2ZCHL 3ARDA 1NUGA 4Y88A 2GHWB 3OKKB 3Q5TA 1T7ZA 4LIQE 1YPZE 5KSBE 4XPTL 5F89A 3PDDA 2AXFB 4FP8H 4YHPB 1LP9E 4WU5B 3V7AG 4YFLI 1DUYA 2KKQA 5KAQG 1KIRA 2Q20A 4H20H 3T1FA 5E99L 5A2JH 2DTML 1CN4A 2VZSA 2YEZA 4Z95H 5EUOA 5ID1B 1XAUA 4Z5RB 3U46A 1QNZL 4BH7B 1CG9A 1ED3A 2EYRA 3WO3B 2AI0H 5IB3B 1L7IH 5JR1L 5TPWH 1NQBA 2MFNA 3WJLA 4O4YL 4D0CB 3SKNA 1AGCB 4EDWH 3GBLA 1QLRB 5IM7A 4W4OC 4PJIB 4NQVA 1LDPH 2D0FA 2HLFC 4OGAC 1PSKH 5I1HH 1D9KC 1ZHKB 1T04B 5C0AE 4CVXA 3LKOA 1FZKB 3BRGC 4Y4FA 5EPMA 1Z5LA 5EU6A 1K3ZA 2DQCL 4Z76A 1UWXH 3NIGE 4MNGB 3KXFA 3ETBF 2XWTA 2W0FA 4P2OB 5B39G 4MQ7B 3OJ2C 2FWOB 5HGHB 1T1ZA 4MX7A 4QTIH 3DVGA 1QHOA 1XCTB 3TO4D 4F9PC 4OD2B 3WNPA 3MYJB 3RNKA 2Y36L 2VDPH 1AP2B 1TCRA 3HI5L 3BDYH 4QGYA 5SWZE 5ADPL 4IHOB 3E2HB 4P5KA 3V4VH 3V2AR 5K9JL 1ORQB 1A9BB 4JPVL 1KTLA 4M43L 5AUMA 5TE7L 4F58L 1KC5H 1CFVL 2W9DH 1CICD 1TETH 1U8HA 3IKCB 3N9GL 5D5MF 2YMXL 1ZT7B 2R2HA 5DXWA 12E8L 3OB0K 1S7UB 1T1XB 3RIAK 1HQRB 3FT4B 5GRJL 1NBVH 4Z7UE 4P5MB 3NOIA 3EYOA 2YD8A 4R4FH 1FAIL 5F9WC 3HPLA 4MLSA 5L7XH 5GPRA 5ISZA 4BFIB 3MLUL 1N64H 4LLMB 1ZHNB 4NOBA 3LKNB 4AK1A 2OI9B 5F6IC 4C56D 2WIIB 5I15L 3JWDL 4LVOB 3HC0A 1GC1C 1I7UB 5JHDD 3GMQB 1WC7B 2XZCH 3WUWA 3C2AH 3O0RH 4MA7L 2BZDA 4XCNB 1FP5A 1NCAH 5I1EH 3SDAB 2HJLB 4WUUB 3QQ9D 3IDGA 1KNOA 4W4NA 1FN4B 5I8OH 1ZA3A 3UTPD 1YEEH 2OTPA 3AXLA 1D6VH 4G6AD 3HMXL 3JTTA 2IANE 2X4TA 3JVGC 3RDTA 1OTUD 2QSVA 4Y7MA 1JWSB 3RGVC 5C86A 1YEGL 5LGHL 1NCCH 3S35L 2NW3B 3D39E 2R8SH 4JG0L 4EN3D 1Q9WA 1A6TB 1K85A 1NC4A 3GMMA 3WLBB 3KPLB 1HKFA 1MUJB 2C3WA 4JGMA 4NBXB 2R23A 5E0QA 1Z3GL 1I1YB 2OSLA 4UOW0 4WO4A 2EDJA 4KQ4L 1BVLA 3OKNB 4ORGA 1M4KA 3EYUH 4BZ1H 3MGOB 4IMLA 4XPFH 1HOCB 4FN0A 1X6NA 5E2UH 4TYUA 1G6RB 5CIPB 1OAYH 4PGJA 1JUFA 3BW9B 2Z91B 4GS7B 3TVMC 4I18A 1FDLH 4XNZB 1U8KB 3OKKA 3MBEB 4POZD 4X5WA 4YXKL 4HS3A 2R4SL 4U1KB 2OK0L 5IQ7H 4JRXA 4XBEL 5C07D 2AXFA 5ACMA 4Y5VA 3W82A 5HGAB 3BUYA 2MKWA 5IMOA 4ZUWA 1U93A 1G7HB 2NR6D 3FQUA 1R3HA 3K8LA 2G9HB 3MLZL 4RRPA 4X80H 2Q3ZA 5C0IB 3UJJL 5CMAA 4FQHA 1XIWA 2NTSP 5DMYA 4DQOL 3HNTH 5D5MB 5EOCH 5ID1A 4HGWB 2V2XA 4GOSA 4IOSD 3HZVA 1ITBB 4KJYA 3G6JE 4XP5H 3MLRH 1CWVA 4KUCF 4TOYH 1ZS8B 1P7HL 1NAMA 4WFHE 1XZ0A 1QLEH 5D72H 3P4OA 4LRNL 5TDPB 3H0TA 4PGCA 3FMGL 4D0CA 3EYQD 4YQXH 2P47B 3JWOC 3LEYL 4WFEE 1S7WA 5HYJD 3V6ZA 5TQ2L 1SJVA 1FFPB 3U4AA 3HI6H 2OL3B 3HR5B 3T2OA 2AJVH 1EHNA 4ZSOA 4YDKL 2EICA 4JDZB 1KEGL 4RQQA 3RL2B 2Z35B 1WFUA 4S1SL 2FWOA 5KVEL 4DKEH 2NPLX 3P9WB 4F3FA 3E8UH 1DSFH 2AP2A 1H3TA 4KDWA 4OD2A 5DGRA 1PYWA 1G9MC 3M17B 4R4ND 3MRQB 1WWAX 3GBNH 4UIKH 1RIHL 2JIXB 4JO1H 4E41B 4M9PA 1ORQA 5E8OA 3NFNA 4N0CD 1PKQE 3MCKA 4GXUN 2YC1A 1WVZA 4Y4KC 3VMPA 4KHTH 1QEWB 4N0FA 2D7TH 3ZKMD 3Q5YA 4OM1L 4NCC1 2Q76B 2CKBA 3FB6B 1J1XL 5D1QB 1TQBB 3FT4A 1UH2A 5FO9B 5T1LB 1J0JA 3WFDH 4KMTH 4MA8L 3RNQB 3GGWA 2OXGA 3KVQA 4M5YL 4DUWA 4K71C 3SE9H 1RSFA 4V1DE 1DBAH 1DL7L 2K9UA 3CVHA 3VI3E 4L5FH 2DLHA 3QNXB 3H9SB 3EHBD 1TZGH 4UAOB 2AJYL 3GSRB 1JPSH 3IU4H 5DD0H 4ZODA 4PLKD 4JFPA 2XZQH 1I7UA 1IQDA 3BEWB 3MNWA 5E08L 3C5ZC 5JQ6H 5DK0A 3D9AL 1JZ7A 4XCNA 3GI8H 4G6JL 4WWKB 4JFEB 3SDAA 1H0DB 2K7QA 2PNDA 1J0KA 5I1DA 2QHRL 2B2XL 2OJEB 4QRPB 2EE9A 1OAZL 2VQ1A 3K4DA 2X40A 1BEYL 1IGYA 2DLGA 3RVUC 4UDUB 5LG1A 3C60D 2CIIB 2NW3A 3DMMC 5KS9E 3SO5A 4EZMA 3WLBA 4QEGA 3U4BH 3MPCA 3QDME 3BIBX 4Y5XB 1EFXA 3TESA 1I1YA 1PGRB 4YX2H 5BV7H 2ICEA 3EOBB 5DO2D 3LRGA 3T09A 1RJLA 3BWAB 3BMWA 2HAZA 3QHZH 3ET9F 5AEAA 3RVTC 5DDHA 4OZHE 4P57A 4M4RA 2OYPA 3LHPH 1AC0A 2J4WL 4HMDA 4HWUA 3N1PC 1BOYA 1SVCP 4LSQH 3MRRB 4KTEH 4Q9RH 1FYTA 1RPQA 2EDXA 1NAMH 1RUML 4HG4J 4YHKL 5GGQL 1CU4H 4OF3A 4L3EA 5CD3B 3KLDA 2EE2A 4ONGH 3QG7H 3HFML 4Z7NF 1DE4B 4OKVB 1A7RH 2HFTA 3BPLB 2ESVB 2W0KA 4HGWA 3GMNA 1U8NA 1DFBH 5BS0D 4NJ9H 5FYKD 3GB7B 4I3RH 1QZ1A 3GO1H 3IAQA 3ZKXC 3ZYJA 4WHCA 4Z7QE 3PHQB 3MUGA 4Z9KB 2CR6A 4JY5L 2QSCH 2Y1VA 3IAGC 1FFPA 2ATPA 2X42A 4LQFL 5F8RC 5C0NC 3UYOD 1I75A 4YHLL 4RWHA 3ALXA 3BPCA 4JDTH 2VXTH 1CXFA 1T4KA 3ULUD 3ARTA 4OAWA 4IDJH 4WI2A 3T0ED 4HXBL 1R0AH 2GJ6B 1F4WL 5CKAA 5EOQL 1YYML 2CKBH 2GK2A 1AIFA 3MA7B 4LU5H 2BNQE 3M17A 3GIZH 3RWJB 3E3QC 3CIQA 3MRQA 1T0MB 3O3BB 2DQTH 3DUHA 5E8PB 4LLUA 1F4XH 1L6ZA 1B0GA 5KG9A 2OR8A 3O2DA 4L1DA 3S9DB 2B1HL 4P9HL 1QEWA 4K94H 3VFTB 4FQIH 1EBPA 3NIFF 2B4CC 5DUBB 3C9NB 1PQZB 4MB5A 1CQYA 1IEAA 3LS4H 4FXGA 5FO9A 2XV6B 5MENA 4HWNA 3KGRA 1OTTC 5ENWA 4JY4B 1CTNA 3ZT6A 4OGXH 4N8VB 5DUML 2CMRL 4DW2L 5FCUL 5LGJA 4PS4L 1RUAH 1YQVH 4QHKJ 4EI5B 4OLYL 4E42B 4ZFFA 2KQNA 4OBSA 1MFBL 1BZ9A 4W4OA 5CJQH 3P4NB 1YEJH 5D2LF 4IOFC 1D9KA 5J1AB 4HJ0D 3BEWA 2MCPL 3UCRA 2CR3A 3VA6A 4J6RH 1FE8H 1YY8B 1UM4L 1XGUB 4N0UE 4AEIH 1T7YA 1JL8A 3W81A 1JZ2A 2BNRE 1XGPA 1YA5A 5TJWK 3TNMA 3CFBB 5DFVC 4U0RC 4Q9BA 5SV3A 4F9PA 4NCC2 4PJCA 2HN7A 4CNIB 3GSUA 1P53A 3S4SB 5F96H 2C4XA 4I8DA 1KJMB 2A6IB 5B3JF 3NZHL 3TBSA 5AZEH 1JPGB 3AS1A 5C08A 4UU9A 1TTFA 2E7HA 4I4WA 5L0QC 4JE4B 4PJ8D 2PYEE 3S3JA 1KENH 3JZ7A 4QRRA 2YD5A 2B0SH 1QUNA 3PJSB 2Z31B 1S7RB 4JGJA 4DAGH 3HZMB 3SKOA 1CXIA 3QEHA 3ZHKA 1UC6A 2XTJB 2VLJB 2YUWA 4Z8FH 5LQBL 3RP1A 1A02N 5GSRA 5EBLA 4K2UH 1RZFL 4RCAA 1HK6A 1G7QB 4ZUVA 3VXPB 1KG0A 4K7PL 1F02I 4ODTH 5ANMA 4I3SH 4LSUH 3S5LG 3H7BA 3OKEA 5J13B 5CD3A 4IRSB 3CU1A 1A3RL 2G75B 5D7SL 4TULL 4W70A 3SDDD 1F3JA 3U7WL 1R5WA 2P5EB 4O51B 15C8L 3IDUA 4QHUB 5T3XH 1BBDH 4YXLL 3ZE1E 4P2CG 1XR8A 2XZAH 3JVGA 5LWYL 1OAKH 2R0WL 2V5TA 3RGVA 2VKXA 3VFRA 5JIPA 2E7LC 25C8H 2WUBL 3FN3A 3PHQA 5E6IB 2R2CA 2X4RB 4M7LH 1IKNC 1MREL 2QTEA 3CXHK 4P2QA 2NY7L 1WIUA 4H1LG 1J0YA 3T3PF 5DD3L 1ZLVH 2MJWA 5D2LB 1NBYA 1FNGA 1QSEE 4JPKL 4U6VL 4L8BA 4HKBB 1WTGT 3H6JA 5CAYB 1VFAB 2R1WA 5DLML 4ZUSA 1NEZB 4NFDA 5ACZA 3BZFB 1KN2L 4M5ZH 1KB5H 2HYMA 1A21A 2XWJA 4DWHA 3SQBA 1J8HA 1YNKL 3TVMA 5EZJA 1OM3H 1MF2H 5DR5H 5F7WC 1T7XA 1BQHA 1D5XB 1BF2A 3CSYB 3CSGA 5EO1A 4U1LB 3ESVF 2EYTB 3QHFH 4AENB 2BVUA 4P2RD 1I3RA 2AEPL 5EO0B 4CJ1A 1TTGA 4NKDB 4DGVH 4MJID 3UYRH 2HWZL 3HG1E 1EXUB 1WZ1L 4Z0BH 1U6AH 4HBCL 1UM6H 1GCFA 4JM2C 3MCLH 5GS0C 3WDJA 3C9NA 1PQZA 1YC8A 2J8UF 5F72S 4JFYB 3NCMA 4P3CH 1A64A 1IJ9A 4HZAA 1YMME 4HV8B 2EDLA 5D6CB 1K6QL 4NPYA 2FL5B 4UQ2B 1S9WB 3L5XH 2X44D 4EIGB 4OTXL 4PJ7E 4NQEE 1EJ6A 3D39D 3GEWB 2HMIC 1GGCL 1W8OA 3SBWC 4NQUA 4F37F 5I8CA 1LO4L 2FDBP 3FN9A 5D9SA 3P4NA 4X7FC 1R24B 4RSVA 3TT3H 2H9GA 3VA2C 1K5NA 1YY8A 1XGUA 3JV5A 4GH7B 1H9VA 4WGWB 5EH1A 1CDHA 3PV7A 1IKFL 2EH8H 2PYFA 4P48A 3LKPA 3CFBA 2EC9U 2C1OB 4P4KB 5BO1L 4CNIA 1T6VN 1P4IH 2VWEE 3KPPB 5HJ3B 2MKLC 2NY6D 2DQDL 3WNLA 1T89C 1NMCB 4KMLB 1HH6B 2G60H 3IGAB 4R3SB 3EDJA 2IPTH 2EH7L 2IBBA 1YN7B 4ERSH 4RBPK 4Y4KA 3U0TB 3RIFF 1UG9A 1PDKA 5D1ZC 1OP9A 4UTBL 3GIVA 1KACB 5HPOA 4H8WL 1GC1H 3BRFA 5TGBA 3V7AE 3OG4B 4MYWB 1TVDA 4LLWB 1MI5A 3K2UH 3OZ9L 3WHE1 3X3GH 3RZCC 3PJSA 5F44A 1NGQH 5LCVH 4XX1G 2W65B 1RAMA 3T2PA 4WFHD 1KN4H 5ICXB 4CU8A 3V5KA 4K07A 1QKZL 1UH3A 5IKCB 4P46B 2RFXB 5I30H 3L3GB 3O3DB 2MMXA 1TQCC 4I2XA 4PJAE 3O8XB 4K7FA 4OFYD 4WFED 3VXPA 3MRLB 2IPKB 4XAKE 2AV1B 3KLHC 3B9DA 4OZGF 5J8OA 1JNLH 4HUXA 1OW0C 2CLRA 2NX5A 3FT2B 4YNYB 4LGSB 3RI5K 2Y06H 2J8UB 2P5EA 4MNQB 5EOTB 2EXWC 3QG6B 3ZYIA 3BSZL 4QHUA 1EZVY 3OPZH 4O5LH 1S9XB 4KPHH 5HY9B 4PRPD 4KJWD 4M48L 1VESA 2I27N 1LD9B 3STLA 4PJIE 1IM9D 3DMMA 2X4RA 3BPOC 2VABB 3LMJL 1C5DB 1MHPL 3VXOA 2BSRB 1WJ3A 1FNHA 5KANI 4HT1L 5I1AA 1OB1B 3BJ91 4HIXH 3QIWB 4ZPTB 3BVNA 2D7MA 2APFA 3O81A 2JLLA 4JM2F 4MNGE 2HJFA 4OIIH 5FV1L 3ZTJH 3CDYA 2H1PL 5KVGL 3KPOB 3IJYB 4JDVB 1CI5A 1Q0XL 2D7OA 3IDYC 4NZTL 2MSPA 3KPRA 4NHUA 4V1DD 3IRZA 3FJTA 3VXQA 3EO9L 5I18L 3WFEH 4WTZG 3NABH 1NUDA 5EIVA 1JZ8A 5EO9B 1R3IL 4FTVB 5E95B 43CAB 3IAPA 4YK4C 3OKDB 5FKPA 1CVRA 3OKOA 3EOYG 5E2WH 2QQLH 3GSOA 3QUXC 5HD8D 4KGLA 5SWSD 3D18A 3JWOH 1EXUA 2V2TB 3UTSA 4B0MM 2XICA 1G7JA 1UZ8B 5GXBB 3AB0B 4LKCA 1MRCL 3KYKL 4HV8A 1S7TA 2HKFH 3WYRA 1ZK9A 1JVKA 5IHUL 3I75A 2VE6B 4UQ2A 1IFHH 5C1MB 1ZT1B 3MNZB 5E8NA 4WW1B 4WV1C 3F7YB 2A77H 1JMZA 3QPXH 3SY0B 2E9BA 5FF6B 3QDMD 4YO0A 1ZA6B 3TM6A 4OZGB 1G9MH 2VLRE 1BF8A 3LEXB 5HGDA 1RU9H 1U91B 3GSQB 4MWFB 1ZAGA 2V2WB 5H35A 1AFVH 1EZVX 3MUY1 1V3MA 4PRHE 4X6CF 5L2KB 3RY5A 3AM8C 4LLYA 3W0WD 3MRHA 2Y6SC 1RMFH 5IJKC 3MRNB 1HQ4B 1N26A 2D31B 3ILQC 5E56A 2R4RL 4ORZC 3QDHA 2ERJC 1B4JH 5L6YL 2VXSL 3M8OL 1D6EB 3TZVD 3Q6FB 1SEQH 4ZXBC 5JO5B 4PV9A 1JHKL 4R3SA 5A2LH 3WS3B 1AY1H 1BLNB 3VWJB 2ZG2A 5KSUA 4NQDB 4RX4D 2BXZA 3DXAD 5IJVA 4UINL 3AFLA 1U3HB 3WFZA 2OX5A 4M7ZB 3MLTA 5DJ0A 1LE5B 5IEHA 1FFQA 4LLWA 4ZDHB 2F53E 3D3VB 1N7ML 2W91A 3H9YA 3QXAB 5BZWA 2GY7B 2AV7B 4XC1L 1WUNT 1ZHBB 1Z9LA 2WQ8A 3CD4A 2XN9A 3K46A 1X44A 5IKCA 5EUKB 1LO0L 1SBBA 1U92A 3C6LD 4O02L 1CGTA 2AV1A 3GMLA 2RQ8A 2LABA 1KXTB 1MRDL 5D5ME 5EBGA 1G9NC 3WCYA 1HN1A 4KY1L 5JXEC 4ZNEA 3FT2A 4FOMA 5K9QG 3PG2A 1CFTB 2DI8A 3RRQA 4RFNB 2EXYC 4FFWC 4X6FA 1UB6B 1IGJB 3ARGD 1M71B 2H2SD 4FG6C 3BDBA 1EJOH 3PP4H 4ZS7L 1HXMA 1BFSA 4G9FB 3VGEA 3RIFK 3VXRB 5CCKH 5GRUH 5B4MC 5HYSB 2UWEE 2BNQD 1CR9L 4PGBB 1LD9A 4X9GA 3MXVH 2W59A 3VD4A 4HIJA 2NY5C 4XHJD 5I1LB 5J1TC 4APQD 1AQKH 5F7NC 1B6UA 1II4E 1CLZH 4ZPTA 1GZQB 5D1ZB 1OWWA 4OCWL 4WI7A 4PJHF 5GHWH 2B8OT 3A67L 3TGXA 1LK2B 4DGYH 4U1JB 1BGXH 4X6CB 5HDQH 4JKKA 3KPOA 4F9LC 5EN2B 3EOTH 3HE6C 3BH9B 3AVEA 1ACZA 4HUMB 5EORL 4TVPE 1EIBA 4YPJA 1PKOA 2SEBB 5FAAA 2DLFH 3OR7A 4H88L 4X7SH 4HC1A 5SX5H 4DVRL 3ARBD 2IAMC 1KCLA 5HI3D 4KTDL 3DV4A 2FO4A 1UEYA 3CMOH 5EO9A 3KPQA 3V6BR 4U33A 1GIGL 3OKDA 4BKLB 5DJ6B 2ICES 3WUWG 5C7XH 3MOBH 1ND0A 5A16A 3HS0B 4N5EC 3HC3H 2EKJA 2HJKB 1QBMH 3SQOL 4EUPH 5AWNL 2C9AA 1P5UA 4XP4H 4J3OC 3ROLA 2X7LA 4AJ0A 3TFKC 2HFFB 4AY0A 1CXLA 5BOZG 3EFFA 5LBSL 3HRZA 4HIIB 2E7LA 1I9JH 4FQXD 4WW1A 3D85D 3F7YA 4O58H 1IKNA 1OQOA 4Z18A 5IHZB 2JE8A 4JKPH 1LE9A 5FF6A 3RWDA 3PXHA 2DWEB 2DQFB 4NZUL 2CUMA 1SYVA 1DLFH 1U91A 2MOVA 2PYED 1DZBA 4LAQH 5CZXD 3TT1L 1FL6A 1JWUB 2FX7L 3AU1A 4UV7H 2QEJA 3KPSE 5T1DH 4YXHH 1NLDH 5AD0B 3P30H 3ARZA 5BV7B 3IRPX 1MJUL 4NT6A 4X4MA 2B4CH 5F9OL 2FIRT 1HQ4A 2H2PD 3CLFL 2VZVA 3S6CA 1VPOH 5IG7A 5C09E 5DJCB 2H3NA 4NUGL 2VDNL 3B9AA 4XXDA 4FXLA 1AGFA 1HSAA 1BD2E 2YPLB 4JN2B 3SOBL 2QADC 5C6PB 4M8QB 5JLZB 2EDWA 1RJZB 3PGCB 4YUEH 1TJGH 3K80A 1BLNA 3QUXB 2IGFH 4RRPG 5MP6L 4LDOB 1JCKA 3GBMH 4Y19B 1JWMA 5EBMB 2LQRA 2BVPB 4JM2A 4LPTA 1U3HA 4PJHB 3MJGX 1EFQA 4G5ZL 5TE4L 1LE5A 2VAJA 2BCKB 2VDQL 3A0OA 3D3VA 2R1YB 3QXAA 5AYQA 2Y9RT 5ESVB 4NQCD 1ZHBA 43C9B 1FPTH 4WV1B 3U79A 2FATL 3KLAA 1C08A 1A7OL 4YEFA 5KW9H 3SBWA 4JG1H 3PABA 2AK4A 4LHUD 3GFUA 1MNUL 1QSED 2BDNH 1NFIA 1BJ1J 3VMNA 3SJVD 5JORA 2ESVE 3HZKB 2J6EA 3VH8A 1RULL 1FORL 1MOEA 3NH7H 4PJEF 3L3IB 4KVCH 4XPGL 5EC2A 3QUZC 3CDGA 4MAYC 1OARH 2V9RA 1BIIB 1IGJA 4GAJL 2NY2D 4RMRA 2XNAA 1RD6A 3DV6B 4M93C 5IBUB 2P7TA 3V7MA 5DGQA 4HULB 1RJYB 1IILE 5FUCE 2MQ0A 1KPVA 2Q3AA 4LSRH 1CGSH 1NDGA 3IXTB 1T89A 3JWDC 3NIDF 1AGDA 3L5IA 1MWAA 2UY7A 4WDIA 2GFBA 5FO8A 5I1LA 2XPGA 3NZ8B 2AABH 1MCDA 4MNHA 4NKMA 4G8GA 4J1UB 2NY3C 3D1MC 2W60A 5D1ZA 5K9KA 3ULVE 1U2HA 4U7KA 3P3YA 1ZLSH 2GJ6E 4MZ3A 4G8IA 1T66D 4X5LA 2B1AH 4U1JA 1QRKA 1YMMD 3T77B 3RZCA 3CJJA 4AM0A 5MEOA 1FRGL 3QDJA 1ZVSA 3BH9A 5IGXL 1BM3L 4OZ4A 5E7FA 1W8NA 2NW2B 2OR9L 3MRKB 4NQED 4ONFH 1UCBL 4JFDA 1UM5H 3BD4A 3FRPA 4M6MH 1JGLH 2Q8AL 3P9MB 5DJ2A 2WWMC 1JNNH 1B0WA 1AHWC 4TUOA 5FK9A 4JO2L 2VLKE 2BOBA 5ALCH 1OW0A 2GY5A 3CK0H 4HHAA 3GMPB 5DJ6A 4S1DC 5FYJH 3UBXB 4HUNB 2H8PA 5JA9A 3WHXB 1QACA 5JZ7C 4P4RB 5IMLA 3T8XB 2GIYA 2GQHA 4HZLA 1KB9K 1Y0LB 5I1CL 3QRGL 3LD8C 5E00A 1S9KC 3UBXG 4XPBL 2P48B 4R4BB 3H8NA 5GIRA 4NZRL 3TYFB 4FFVD 3O3AA 1N5AA 3MLXL 4LLQA 3DX8B 2ZKHH 3U48A 5BVPL 1MCOL 3LKRB 5E2TL 2Z0BA 1N0LA 4MMZC 1ZV5A 1A6AA 1F90L 1I7ZA 1RZ7L 2A6KB 4JN1H 5HHOE 4Y5YC 4GBXC 1SQ2N 1A3LH 2AQ2A 4C57C 4BSWA 3PWPA 4PJEB 5HHVL 5AD0A 2AS5M 1Q1JH 1PLGL 3MRFB 2P8PB 4NJAL 3PWVB 3AC0A 5GS0H 2CDFB 3FCTA 1VFBA 4Y16D 3O6MH 3QXTA 1S7SA 5F3BB 2IAMB 5JHLL 1N6QH 3HR6A 4UT9H 5DT1H 3F58L 1CD9B 5FA3A 3H9HB 1A0QH 4M8QA 1E6OH 2ED9A 1NFKA 4HPYL 1V7ML 5CZKA 4PJ9C 3DPBA 3QUXA 1I7RB 1IARB 2FEDC 3NN8A 3CDFA 1K8DB 4WHTA 5D7LA 3BH8B 4OCSH 2ZUQC 3R1GL 4G80B 1BJMA 2BVPA 3PQYE 4PJHA 1W72L 2DQUL 2VLMD 4OZFB 5B22A 2XTJE 1W0WA 2VLJE 2J6EH 3GJFB 5MEQA 2QKIB 3MRIA 5EBWB 1QTYT 4GUPB 5HI4C 1AO7A 4XP1H 3MV8A 1SEBA 1PBYA 2R56L 5IOPA 4WV1A 2JB6B 3IDJA 2YD1A 3P2TA 1CS6A 1YJDL 3N1QC 4TUKL 4L3AA 2JTDA 5FGSA 4U6YB 2QSTA 3IFLH 3VXSA 5GGTH 3QQ9C 3QUML 4DZ8A 3GRWL 2ADJA 5L2JB 4JFXA 4KFZC 1U0QA 5CINL 5DRXB 4G6ML 3AM8A 4MDIA 5HDLA 3PL6C 3JSSA 2ADIA 1VFMA 5CLWA 5IJKA 3BHBB 2GK0B 1J5OL 4JKMA 5IT2H 1E4KC 3BISA 3DRTB 4I13B 1H3GA 3WNKA 1AXTH 5IW6B 2EO9A 3LKSB 4F33A 1DQDL 4FZEH 1OP3K 2A0LD 3B9KC 1KJ3L 4CDHA 2CLZB 4L9DA 4KI5E 4EDXB 1IGIL 3TIDA 4JRYE 5DQ9A 1JHLH 4C4KO 4TPRL 4KZDH 3CC5B 1PVHA 1T6WA 3UO1H 3V6FB 4HH9A 4PYGA 1H8OA 1RVFH 1ZXQA 3V8CA 4RMTA 5E5MA 4NN6C 2VN7A 4MXVE 2NLJA 4PY8I 4TSAH 1A6UH 3LRHA 3NPSC 5BZDB 3RTQD 2VIRB 2IADB 3FQTA 2VLRD 4HKZB 1BREA 1Z9SA 4PJBF 3GM8A 3ZZ1A 5TFSL 5JXEA 5JXAH 4XAWH 1QYGH 3FO0L 4PRHD 3MREA 5HPMB 1ZGLM 2E7MA 4JQIL 3QUZB 4K3DH 4P4RA 4XVJH 3GMOB 1TZHA 4XNXH 1CBVH 3QCVL 5HDBE 5DJ8B 4DTGL 3R4DA 3B3IA 1QA9B 3HE7D 4DZBA 3I50H 1BPVA 1TITA 1G6VK 3EYQC 1FO0H 2AJXL 5FHAH 2P8LB 4YFEA 1HHGA 3S96A 1RQ5A 4P99A 2FH8A 3DX8A 1C12B 4KRMB 3G9VA 3MMEA 3O6FB 1TFHA 1V05A 3GJFK 4NM8H 4JFFB 5E9DD 2A6KA 1C1EL 3FQWA 3NFSH 4P59H 2RCSH 2FHBA 1KV3A 3EIFA 2F53D 3PP3H 4Z6AT 1UKSA 1MQKH 1WICA 3UTQA 3U36A 3HE6A 2FD6H 2P8PA 2CIKB 4XPHL 2WBJD 4LOUC 3FFDA 4I5BB 4NC2B 3IS1X 1JZ4A 3AY4C 2C3XA 1Q0YH 2HT3C 3HZYB 2IAMA 4F7CA 3FO9B 3CZJA 1A5FH 4XX1E 3TNNA 4CU6A 1T7WA 1R3JA 2X4NB 1RV6X 4U6XB 4J8RA 4NUJB 2IQ9L 3I6KB 1K8DA 2VDOL 2YD6A 3BH8A 4G80A 1DLHB 1JFQH 3WKNA 4XP9L 1FG2B 4YDLC 1HILA 4OZFA 2HLAA 4GQ9H 5DJXB 4PG2C 1SJXA 1U8PA 3NAAL 1GJIA 4F80A 1F4HA 4NRXB 1RIVL 1WQVT 4NHCH 4YC2C 3VG0H 3QWRA 4QHLB 1CK0H 1MJ8H 3DUSA 3RKDD 4BA8A 3U7YH 3OL2A 4LAJH 3S36H 1HXYB 5FV2A 4ZMAT 5CJOL 1QSVA 1S7VA 3QCUH 4PLKC 2O61B 3RGHA 2BOCA 2VL4A 2W9EL 2V9TA 4U6YA 4P9HC 3KS0J 4PJBB 4FMFA 4GRWF 3ARUA 5INCA 4JPWL 1WFOA 2CD0A 2NXZD 1FFRA 5KSAD 4MNQE 4OF8A 5TDNB 5J6GB 2ZG1A 3IJHB 3OKLA 5DRXA 1BBJA 5D71L 4LASL 3TO4B 2LTQC 3GHEL 1BQHG 3MFFB 3QUYD 3DRTA 4GKNA 4PJDB 3V0VB 1H15A 3P77A 2DLTA 3VXUE 3JXAA 4GXUM 1J05B 2PW2A 5LXGL 1FSKB 3SDXF 1UA6L 3WE6B 5E24E 1FV1A 1CICB 1JV5B 3SEPA 3ZTJG 1HIMH 2BP3A 4IRJD 4ENEC 3SGDH 4PRID 1LMKA 3KNBA 2NCMA 3LPGA 4OCXH 5HYFA 1PEWA 1GRWA 4MJ6A 4LEXL 3CC5A 1QSFA 1G9NH 3QIBD 4FQQB 1EBAA 3T4YB 2GCYB 2WUCL 1AXIB 4U31A 2A83B 5IVXE 4YZFE 3FQXB 5DFWH 3I02A 1T5XA 3U6RB 4N8PA 4C56B 1WAAF 3MRGA 5J9PB 2XWBA 3G5ZB 4HJJL 4XCFL 3WEXA 4DN3H 1VKXB 5JHDB 3I6GB 4N0YH 5FB8B 1FL5A 4IJ3C 4HKZA 3LH2H 4PB9H 4Z7VA 1G6RL 3TV3H 3H2WA 4JHAH 3MLSH 4KK8C 1AKJA 1ETZA 3KPSD 4JZOA 3LDBC 2DF3A 3MODH 4GFTB 5E1AA 1BFTA 1LK3H 3QUZA 1OLLA 4MAYA 1UXSA 3GKWL 3SCMC 4MAUH 4YWGL 3SDCD 1JK8B 4QKXB 4WTWA 2EZ0D 2ZUSA 5C09D 3U4EB 4ETQB 1QA9A 2I26N 1G0XA 4EN3B 5DVMA 5FDYA 3WKML 1S8DB 3BKML 1BD2D 5DRZB 1Y6MR 1XR9B 1MELA 4OZGE 3VFGH 4OF7A 5C0JB 1V3JA 3FQNB 1HNGA 4BELD 5HI5C 1FZMB 3DX6A 4PRNA 1KYOK 1AR1D 3SE8H 4F57L 2V9QA 2X4PB 4GRWB 1UWGL 3MRCB 5KSVB 1OF2B 1U95A 3VGHA 5L2KE 1QQDA 2BJML 5GGUB 4GMSL 4GKZA 1RK0A 2IFFH 2VJXA 3L5JA 1QFHA 3HMXA 1MEXH 4O00A 5ICYB 5KVFL 4GW1B 1FH5H 2X89D 4XMKH 4X4YA 2PR4H 2VZ1A 5C07B 3X17A 2DIAA 4HJGA 1F97A 4R2GD 5CHNB 3LVEA 5I1KL 3FOMA 5DVOA 2OL3L 5GISL 3MBXL 3NPSB 2VR9A 4NM4L 3FO9A 4N1CA 1AHWA 4N90E 3SDXB 1G1YA 2CK0L 4NQDE 4QHMB 4RWYL 1HE7A 1NFDF 2AQ3A 1A1NB 2IALB 2EDEA 3I6KA 1FGNL 1RY7B 2HRPH 1DLHA 1OSZB 4F7TB 4PJFF 2DTMH 3KYAA 2HTKC 1PG7W 3C5JB 1IC7L 4R97C 4ODUB 1VCAA 2FLBT 3W9EA 5D70H 4AT6A 5IUSA 4TVPL 1ORSB 5HHQA 3M1BA 1UXWB 4NRXA 1TVBA 3DYMA 3QFJD 4WW2F 3MR9B 4ALAL 3EDKA 4DN4H 4FQCH 1MAKA 5HYJB 3TPKA 1QRND 3OAZK 2VSDA 3FO1A 2N4IA 4BFBD 2X4QB 5HHPA 4KZEL 1UGNA 5IB5A 1TJHH 2HTLD 2YZ8A 1RZGA 5DZOA 4A2LA 4QLRA 4MJ5B 4RMWA 1ZHLA 4BH8A 4OLEA 3ULVD 1GYAA 4Y5YA 4GBXA 5J6GA 3NGBB 3TBTA 1NJ9B 4L4JA 2VOTA 3AREC 4DKAA 1S5HB 2DQCH 3VXRE 1J88A 1IAIL 5I71C 1BZQK 4IM8A 1HHIB 3GKZA 3CNKA 4MXQD 4MD4A 2XA8H 1NANH 2RIKA 5E2JA 5H37H 3B5TA 4D8PB 1O0VA 4L8DB 2PXYC 2NY4D 2Y36H 5EZLB 2NY1C 2VLKD 5ADPH 4X7EC 3MLPA 2GSGA 4GAFB 2Q6WB 4PJ9A 2F54D 5K9JH 3OR6B 1M6OB 5BJTB 2NXYD 3MXWL 3LV3B 5H2BA 4TSBH 5TE7H 4TUJB 4F58H 2P5WA 4OD3L 1X5KA 4HEME 1P84K 1CFVH 2A9ML 1DQQA 3N9GH 2YMXH 12E8H 4GLRI 4TNWK 3QUKA 3KHQA 5GRJH 1E4WL 5JOPD 1NL0L 3FB5B 4LQ1A 5D96C 4HF5L 2A83A 4EUPB 4YAQB 1I9EA 3I3DA 1VGKA 4JJ5B 5I19L 4LSSL 3GK8H 1VKXA 5JHDA 5FB8A 1NFDB 1NAKH 4XMPL 1LGVA 1KCVL 3DSFL 1U8IA 3ULUF 5TF1H 1B0RB 4H8WC 5HHOD 3RKPA 3JWDH 5DQJB 3D48R 1CLYL 1VGEL 3GMRB 3C87A 3X12B 5F7MC 2BFVH 4PJFB 1EV2E 1YUHA 3Q3GB 1MLCB 5SX4H 4NC1E 3PL6A 5GGRA 1S7XA 4XTRC 3V4UH 2HKHL 4CGTA 1CFSA 4ZFZB 3C60B 4X4XB 1E4KA 1JK8A 4J12A 4X5XA 3O45B 3U4EA 3MO1A 4WW2B 4WHYG 1NBQA 3L7EB 4JANA 1FL3A 2BVOA 1A1OB 2G2RB 2A6DA 3QI9C 3DI2B 3SO3C 4OI7A 1FNFA 4CVUA 3BE1L 1YNLL 3B9KA 4JG0H 4QXTA 3BZ4B 1FVCA 4KKAC 3G9AB 4X6DE 5T1KD 4QCIB 3TYGL 1UZ6F 3S88L 2DBJA 4G8EB 2X4PA 2KPNA 1X5IA 1YEFL 2ADGA 3VFVB 3X13B 1H3PL 3PQYD 5ID0B 5EIQA 4KQ4H 2BHYA 2IH3B 1RK1A 1WBXB 4XRCB 4PJXF 2OZ4L 1T22A 3S3PA 1Y6NR 4G7YL 4E5XA 4QWWD 2GTZA 1BVZA 1E4XL 4M61B 4FQJH 5FKAB 4OZIF 3D0LA 1SM3L 5DEFB 2B5IC 4XP6H 4MVBC 4YXKH 2FZ3A 2OK0H 1T03L 4XBEH 4QHMA 4Y19E 1ZLUK 1A1NA 3DVNA 2RGSA 2IALA 2VDKH 4RGND 3KYOB 3BP4B 5BS0B 3MLZH 1I8LC 4OUUB 4R0LC 4F7TA 5C8JB 1YPZF 4POYA 4ODUA 3NPZB 3PDOA 2XQBL 1DQMH 1P7QA 4ZSOE 4KK9D 3QQ3B 1C7SA 4AH2A 5EU3B 3F5WB 3FFCA 3I85A 3K8MA 4JR9L 4QRTA 1MHEB 5K9OB 4I0PD 3SPVA 5DA4A 1HI6A 4WY7L 2X4QA 1OGTA 4PB0H 4KI5D 4EI6A 4HUUA 1CL7H 4KRPC 4O2EA 3LEYH 1KIQB 4PJ5A 4UDTA 3PWUB 4JRYD 3T0EB 1A3QA 1BIHA 3CXHJ 3LSOB 4C83A 4XNMA 1CXHA 1NJ9A 3BT2L 4YDKH 1S5HA 4XNQB 1KUMA 2ZJSH 3DO3A 4KVNL 4M02A 3ZDZE 2VB5A 2X4UB 3SKMA 1ZGLB 1MCPL 2CK2A 4S1SH 1A7PL 3VFMB 5CZVL 3AY4A 4YHYB 3W39B 1UADC 5AYUL 4DK3A 2NZ9D 1KELL 1UT9A 3V5DB 2H41A 2JCCB 2Q6WA 3R0NA 4Q0XL 4S2SB 1PZUB 2W0PA 5BJTA 3NCCB 5DYOA 4OLWH 3Q1SL 5EFIB 5DMKB 3VGAC 5C0EB 1YECH 1IC4L 4PG2A 1DJSA 2OMNA 4PRBB 4RAHA 1J1XH 4HFWB 4PJXB 2YD2A 5J06A 4NGHL 4DGIL 3V0AC 4MA8H 3VWKD 1KCUH 5D8JL 4OZIB 5C92A 5DD1L 1JGEA 4KROC 4N5UA 2PCPB 4P2YA 1BFOB 4XCYA 1OAXL 1DBMH 3J8F7 2AJYH 1HHKB 1KJ2H 2DI7A 3U9UA 2IC2A 3E6HB 1FNSL 4XI5C 4W81A 3O3EA 5CBAA 5D7KE 3WUZA 1YPZB 4JHBA 2DQIH 5FGCB 1NEUA 3L3DB 2QLVB 3RVVD 2QHRH 3ARFD 3ARYA 3BKYH 2X5PA 2KZ1B 4WW2A 4U2YA 1OAZH 1BEYH 5IESL 4EXKA 4OCLC 4KTYA 4P23D 2EDDA 4FFZL 4OJFL 4YH6A 5DC4B 4CMMA 4JFOB 1S9VA 3VD7A 4G8EA 4ZTOL 3V52L 3X13A 1T7VA 3VFWA 5ID0A 5D1XD 4OGYH 3LEVL 1FYTE 1XCQB 1RUPH 4R9HA 3PWJA 4XH2B 1VACA 1PX4A 3OBAA 4A6YL 3LZFL 4PGEA 3T2NL 3WLWD 4L3EE 5DMIH 3ZMRA 4OIBA 3B8SA 1K3IA 2UYLB 2GITB 1MHCB 5JA8B 2VDRH 5J57B 4ELKB 3NIDE 4W6WB 2R0LH 1HCVA 4FZ8L 5DEFA 2J4WH 1W0YT 3D25A 2LU3A 3P9LB 2PW1A 3RX5A 1WLHA 4KU1A 2IF7A 3RUGE 5HD8C 1IM3B 2YSSA 4X9IA 1A6VH 5C0CE 1TPXB 3EYVA 2ORBL 4MQXD 3SDDB 5GGQH 4FQLH 2VITA 4NNPH 3VH8G 3DETD 1YY9D 1A2YB 3H3PH 4NO3A 5IK3A 3QCTL 4P3DB 3SCMA 2XG5A 3O4LE 2CDEB 1R3LB 5HVFB 5T3XE 1NGYB 5IB1B 5H94A 1QO3A 4LGPB 3QAZB 2FH6A 5IBLC 3VXUD 4GRLC 5ITFB 5E2VH 2OTUB 3VFUA 5FYKU 1M7DB 5HGBB 2QQQA 4RNRB 3SO3B 1ZANH 4MQSB 4Z78A 3UX9B 5B8CC 4LEOA 2FJHA 1IGTA 1VADB 3LQZB 2BRRH 5FHBL 2H32B 3BRDA 4QOKA 4JY5H 4NQXA 5HHME 4JFQA 3PWUA 3T0EA 2ZOKA 3G6JF 5IMMB 1KLFA 3DUUA 5IFJA 1WITA 3RWEB 4YR6B 4YHLH 2J7LA 4JCMA 1C16B 4BK4A 3N06B 2P45B 1MFDL 1OD7A 2L7UA 3NFPB 3QIUD 5TH2B 1MLBB 3QNYB 4LSVL 4P2RB 1FFOB 4HS8L 5EOQH 1QPPA 3W39A 1V5JA 2ED8A 4WNQA 3DX9A 1MH5B 4MJIB 3FQRB 3WFCH 4M7JH 1XH3B 1CGYA 3V5DA 1FVDB 5E03A 4JY6A 4NKIL 1KCRH 3MLVL 4YE4L 1MJJB 3M07A 1QOKA 4D2NA 3DURB 2C3VB 2B1HH 4ISVB 1CCZA 2WK2A 2O5XH 3ALPA 3QPQD 4WI3A 4GRMA 4PRBA 4PJXA 4LCWA 4LVEA 3RVWD 3D39B 2XYCA 4OFPA 5A43C 4XMLL 5JPNB 4HUVB 1JPTH 3OXRA 4K9EL 5DUMH 2FJGB 2CMRH 1T1WA 5FCUH 2BSSA 3VXME 4DW2H 2HFEA 3ARDD 4GG6F 2W92A 5C0GA 1GOGA 1BFOA 1FO0B 4ZUUB 4OLYH 1HHKA 3WIFB 4XVTL 1WWCA 3L3JA 3RWGA 2I24N 4L4VE 2R39A 4HIHA 5E94B 1WCBB 4Z95L 1JZ5A 2XKSA 3AREA 3C5SA 1UM4H 4L29B 1DUZA 3HKFA 4DEPC 4ODHH 4R7DA 5C08E 3PGFL 5KSBA 3GSWA 5I16A 2FJFA 4HUWB 2R2BA 1SJEB 2AI0L 2NY0D 1YEDA 1LP9A 4LNRA 4L4TE 4QRRE 2NY6B 1P1ZA 5DI8A 2GSIA 2DJUA 2PXYA 3CCHA 4N90D 4PRDB 4XHJC 4RFEB 4M1GH 3TJHD 5HVHC 5IVZA 2R9HD 4Q9CA 4APQC 2D9CA 2EO1A 3WV0A 4HPOL 5I17A 5I1HL 5F71A 1P6AB 3OHXB 4FNLH 1K8IB 2H26A 1CFQA 3NZHH 4LF3B 4XC3H 4TSCL 2CRIA 1BOGB 5FYLD 4Q6YA 4H5SB 3G6JB 4HX1B 4YHZL 3VGAB 4LSTH 4X99A 3VFOB 3GZKA 4Y4FD 5EU6D 5KS9F 4ODXB 1KXQE 4XCEB 4QXGL 3KXFD 2VDPL 1NGZB 1WISA 4IMKC 3RA7H 1G84A 5LQBH 2XKUA 4LCIL 5C0AA 4N0RA 5A3IC 3FZUC 4WJ5B 4AG4L 3P9LA 3CFJB 5FM4A 4I1NB 3V6OE 2X9YA 4K7PH 1N6VA 1KC5L 5F88A 4HK3J 5I76A 3SDDA 1EMTL 4ZUTA 1TENA 3DO7B 5MERA 1D5BB 4LPYA 4P3DA 5D7SH 3O11B 3STZB 4TULH 4PRPB 3C8DA 1LO2H 3VRIA 5SWZA 1IM9B 4PTUB 3O6LL 1DBKL 4LFHG 3OKYA 1N64L 5LWYH 2ID5A 1Q9OB 1I1AC 2R0WH 3QI9A 4LGRB 5HGBA 4RNRA 3BJLA 2F8XC 4GG6B 2OMBA 2WUBH 3OTTA 4PJBE 2WIMA 2FEEL 4OUOA 4U1HA 5ISZD 5CSZB 1MREH 1AJ7L 1AD9B 2DYPA 2NY7H 4M6OH 4S1QL 5GS1C 2H32A 3AAZB 5DD3H 4P5TC 3O2VL 5C2BL 1QFWM 4JPKH 4U6HB 4Z7UA 3O0RL 3MJ6A 4NNXB 1MCJA 2VZ3A 1NCAL 1YMHB 5I1EL 5HBBA 2YA2A 2GT9A 4S10A 4OIAA 4V1DB 4KKBD 4PJDE 4Z7QF 1KN2H 3NFPA 5L8JB 5TH2A 4KK5D 3QNYA 5IR1B 4KJPD 1YNKH 3H3KA 2X1OA 5I73C 4L3CA 3CH1B 2OQJA 1VERA 3N0PB 4YHIB 3PV6B 3FQRA 1EHLL 3FB8B 1XH3A 2A6JB 1JN6B 5SWSB 1FVDA 3RDTD 3ZKSD 3NMEA 1AGEA 1G7IB 1J8KA 2KBGA 3WXWL 5I1IL 1RIUL 1IAKB 3VFSA 4UB0L 2R1XB 3ZKND 1I8LA 4R0LA 2F74A 1EGJH 3S34H 4PFEA 1JGDB 5E2UL 4HBCH 4PUBH 5J7CC 2IANA 4PTTB 1G7MB 4WO4D 1OAYL 2ZSWB 2YD9A 2DBLH 3MOQA 5FIEA 1X5ZA 4HK0B 5KS9B 1K6QH 2UUDK 1FNEA 1ZLWK 3QDMB 3S36X 5IQ7L 3G04B 5DMGD 1JZ3A 5D7IE 1EAJA 3QSKB 4G8FA 3WIFA 3UTPE 4QRSB 4JRXD 3NVQA 4RMSA 4X80L 2Z4QB 4U7MA 4JAMB 3W0WB 4M62L 3HNTL 1MSPA 5E94A 5EOCL 1WZMA 3HAEB 4QF1B 4TTDC 3I9GH 1MVUB 4DK6A 2I5YH 1KJVB 3ILPB 3QEQA 4EVNB 1J10A 1DBBH 1XIWD 4ZQKB 1IKFH 1IGCH 4ODBD 2OLDA 3TZVB 2APVA 5SV4A 1L7TL 1QLEL 4LCCC 1H8NA 5D72L 4NRYA 1MI5E 2VC2H 5ALBL 1I9RH 3TIEA 4FXKB 3WIHA 4GRWE 3DXAB 2DQDH 5F1IB 3G5YA 3MJ7A 1T21B 3DYOA 2WANA 1F6AB 4GJTB 4XBPB 2DM2A 3WO4B 2VISB 1T83C 3WN5C 4M1DH 3CX5K 3IJSA 1CT8B 4M1CD 2WINB 3LN4A 3BWUC 3VFOA 5C07E 1MCRA 5CBEB 2NX5E 3DGGA 2Y7QB 2AXGB 1QFWI 3C6LB 3SDXE 1YEKL 1XFPA 1C8PA 1NGZA 2FIKB 3BD5A 5EU4B 1YC7A 1QKZH 3GBNL 1F2XK 4MSWB 4JO1L 2AQ1A 5FOJA 2BVTA 2H45A 5I75B 4YPGA 2V5YA 1A1MA 2HFGH 4JVWA 1MCFA 5DVLA 4YDVA 2D7TL 3MX0A 3O9WC 3U0PB 3ARGB 1FIGH 1I1FA 2BMKA 3L95B 4F2MB 3TF7C 3MRDA 4WI4A 3MRBA 3WFDL 4KMTL 5T33L 2VWEC 2BNQB 5A2FA 1S7QA 3BSZH 5HYJE 2PO6C 3SE9L 1NGXA 5JDSA 1OVZA 5T1MB 1HZHL 1PKQA 1TZGL 1PX3A 4M48H 3W11D 5ERWB 4LVHC 2O5ZL 4APQB 5C0FA 4XVSH 1P4LA 3MTRA 3T4AA 2LVCA 1MHPH 1LILA 5DD0L 4R7NB 3DOSA 4HT1H 3AAZA 4GKSA 5DHVH 1G7LB 3BZDA 5F6HI 4LPUA 3VE0B 5T5NF 4NNXA 3ZE1F 3R06A 5H37G 5J11B 4V1DA 4Z0XA 2OP4L 2H1PH 3QJFB 5KVGH 4WUKH 3G5XA 1Q0XH 1RUQL 2A74B 4NZTH 3ARBB 3UTSE 1KTKE 1KLGB 2EIDA 1IGMH 5HXMA 5I18H 3KR3L 1T0PB 4EKXA 2YD3A 2FB4L 2A6JA 4N0UB 4U1GB 1GAFL 4H25B 1R3IH 4PP2A 1G7IA 5BV7L 4A2MA 3MGAA 1IAKA 4AEHH 1KPUA 2A9NH 1JF1B 3F7RA 3KWWB 2RJMA 1EFXD 5FECA 4NQSA 3EOAA 5F7UA 2IPUK 3P73B 1M7XA 5KTEL 2JJSA 4FQXB 1MRCH 3D85B 3FTGB 3KYKH 4MDJA 1KOAA 3PE9A 3BIKA 4NRZA 4GRLA 3QDMA 1H3UA 1JTOA 3WFHA 5ICZA 3NCEB 2HH0H 4KTEL 2EEBA 4MS8C 3QJHA 2PYEB 4FQ1L 1K2DB 4LLDB 4O2FB 5B8CA 4P2OC 3O4OB 3HI1B 3LKQB 5HHXH 3E3QE 1WBZB 1FYTD 1BMGA 3CFCH 1Y18B 1A7RL 1R3KB 3IDMA 4OZHA 2VAAA 4GSDH 1DFBL 4EVNA 1I7TA 3E2HC 4L3ED 4PJ7F 5DEGB 5IMKB 3V79C 2UUDH 4NJ9L 2UZIL 4X8JB 4ZQKA 5CP7A 3PGDB 3GO1L 5FO7B 1UKQA 3HCVA 1X7QB 3OX8B 5GGSY 3BN9C 3MROB 4IS6A 3MV9A 5GGSB 5TQ0L 1LEKB 1N59A 4HKJA 4KK6C 2J3SA 5L6YH 4YFDB 3M8OH 3UMTA 5FOBB 5C0CD 1X9QA 9CGTA 1T21A 5DUPL 2J8HA 1EAPA 4L8CB 1BQLL 5FM5M 4G43A 5IFAL 4LKXB 4EJ1C 2EEDA 2VISA 3NACL 4UINH 4IDJL 3O4LD 2OI9C 2WINA 4NQCB 3OB8A 1I3VA 3M45A 4IIQB 4M6NL 1H3VA 3BP5A 1N7MH 3A6BH 4LVOC 5ESAB 1FJ1B 1SY6L 4LHUB 5T3ZH 2ADFL 4LU5L 5DD5H 5JW5A 1QSEB 2F58H 3GIZL 3U30B 3B6SB 3I6LD 2HVJB 3WDHA 5M94B 4UIMB 4OCNC 1LO0H 5DFTA 3SJVB 1F4XL 1OHQA 2V6HA 1T2QL 5BS0E 5HHMD 4LCYA 4QY8A 3QULB 1WCQA 2DLIA 4UNVA 1MRDH 2C3HA 2ITDB 5KAQF 4QXUL 1RUKH 4KY1H 2NY2B 2VXVL 1N4XL 4PRAB 3LS4L 2NTFA 3IVKA 2JKXA 3QZWB 4NP4H 2ILLA 5JW4N 3Q5OA 4PJAF 5EIIB 4ODSL 8FABB 4OCRH 4ZS7H 7CGTA 5T1MA 1JBJA 1MFNA 5MEND 1MIEH 3EZJB 2AKRB 4APQA 1N5YL 3VJ6A 4YIQA 3BX7C 4OT1H 5IW1A 4GS7C 4Q6IB 1SVZA 1FE8L 4XNZC 1YMMB 1K9TA 4O2CB 3MBEC 2HG5B 3VE0A 1BZ7A 2HLFD 4OGAD 3WN5B 1MCHA 1D9KD 4NN7B 4OCWH 4RISH 3DX7B 4WGVB 3BXNB 2WBJC 3A67H 5DQDL 5EU5A 4PJ7B 4NQEB 3DVFA 4PJIF 4IOIB 1EEZB 3QJFA 3OGOE 1IAII 2YPVH 4I48B 4V2BA 4QTHA 1H8SA 1KLGA 3ZDXF 4IMKA 3VXMD 4LARL 4RAUB 2JCCE 2X1XR 5GGRY 3IETB 1V7NL 4FQPA 4DVRH 5F1OB 1SMOA 5AZEL 4CADA 4KTDH 4W6XB 4L4VD 3WDIA 2WAHA 5FGRA 1HHJA 2BNRA 4HFUL 1B4RA 2DD8L 5FYJE 1MVFA 4CKVX 3KWWA 1KJ2B 3F7PC 1U3YA 2B0SL 3DROA 5C08D 4EOWH 2VZOA 2GUOB 1TTUA 1LEGB 3C2SA 1LO3H 2A73A 1A6ZB 3SQOH 1XF2B 4KQ3L 5AWNH 3NA9H 3RKDC 4DAGL 3P73A 1UJ3B 4L4TD 1JRHI 4QRRD 4R90H 3D85A 5IIEB 4OLVL 3G08B 5I6XC 1ZSDB 2VXUL 1I1AA 4NDMB 3ZHLA 3B2VL 4MCZA 2Q8BL 2APXA 4Z7OF 2P4AB 2CJUL 5GSVA 1NSNL 3FB7A 2I07A 4LLDA 2PYEA 5DMJB 4JREB 3O6KH 4CVWA 5GS1A 4KKLC 3HI1A 3HLAA 4P5TA 3LKQA 4NZUH 1J0ZA 4OLXL 4PV8B 5FGCE 5FA4B 2XTLA 2YBRA 3TT1H 3X14A 5JMOC 1R3KA 1JGVH 3AMKA 4GW4B 1U2CA 4Y16B 5DEGA 5AZ2L 3PXJA 5T3XL 3EAKA 2JB5L 3KPMB 4HWEL 3X3FL 1P5VA 4PJAB 5INDB 5FO7A 5F9OH 1AH1A 4Y2DD 3RWHB 5DJZA 3UPRB 3LB6C 4NUGH 5D1QC 1B9ZA 1F5WA 1TQBC 3OAYK 5DWUL 3RGVD 1PG7L 5GZNC 4X7DC 4GG8B 4BFGA 5J3HC 4UNTA 4P2QD 1UB5B 1DDHB 1GGTA 1I4FA 3IFPA 2X6MA 4MJ2A 3CPLB 4UAOC 4M03A 2AGJL 3BKJH 1KB5L 5H8DA 4G5ZH 4B5EA 1XF4B 3QH3A 1X4XA 5TE4H 2CLVB 1WZKA 3OKMB 1MF2L 5DR5L 5AAWA 1H5BB 2VDQH 5B39B 4Q2ZA 2F8VA 3GSNB 3MV01 5ESAA 1E4XI 4LHUA 3QHFL 1J8HD 3TVMD 1UWEL 4F15C 1F8TH 1GGIL 4WWKC 2J88L 4UIMA 2FATH 2EEAA 2BC4B 5B38A 4AIXA 2EDOA 5C0BA 1BJ1H 1W72A 3D69A 5T5FL 1UM6L 1R5VA 2XQYG 3TP4A 1JIBA 2XXMB 4CL7A 2X1QA 2VDML 1FORH 1IE5A 4P3CL 1OAUL 3SGKC 1P7KA 1HSBB 4XPGH 3QZWA 4LSPH 5FEBA 4Y5XC 2C4FU 4ZPVB 4LCCA 4PG9B 5BQ7B 3VFPB 4XPAL 4YDJA 1A7QL 5JOFA 1AR1C 3HG1A 3BPNB 1ES0B 4NO2B 4MCYB 3QUMA 4JFDE 3GRWA 3TT3L 1A7NL 4CU7A 3X11B 2F19L 3HPJA 1YMMA 2R69L 2V17H 1VDGA 2XFXA 5FDWB 4D0BA 4OV5B 1CDIA 4PR5B 5IFHL 1T83A 2CUIA 1JHTB 3FONA 3WN5A 4MD0A 3BXNA 1F00I 2UWEF 1CE6A 4HK3N 4P2RE 2EH8L 3S8WA 4QT5B 1CE1H 1J1OL 4MHHG 1X5LA 2VXQL 3VGBA 1U8OB 1FRGH 3RTQB 4MJIE 3MJ9L 1BM3H 5LJYH 2VLRB 2OR9H 3TCLB 4RAUA 3QWOB 5I8EB 1QR1B 3CVIH 1SJHB 1DEEB 3BPLC 2G60L 3SE4C 4Y89A 1I8MB 2FX8H 4ERSL 4PRHB 5KOMC 2PN5A 2FECL 4X0KB 3KPNB 3O9WA 4LMQE 3ZDYE 1J18A 1KIUA 2KDGA 3LRSA 4Z77B 1FC2D 3HE7B 2OTWA 4Y4KD 4UMGA 2Z93B 5LCVL 1NGQL 4KMQA 1XF2A 1ONQA 2ED7A 2PO6A 5I1CH 3QRGH 5IIEA 4XPBH 3REVA 1MI5D 3ZYOA 1T0NA 4NDMA 4TQEL 1TZIB 2DWDA 2EDRA 1FZOB 1HH9A 5E9DB 3LIZL 3MLXH 3G6AA 2WBWB 3B2UC 5BVPH 1Q94B 1MCOH 5E2TH 2F53B 1RZ7H 5ELIA 2F5AH 2I25N 1LO5B 1A6WH 4TRPL 1KYOJ 2WBJB 1XGTB 4GW4A 4YHPA 2NX5D 2NYYC 4WU5A 5HHVH 3C5ZD 1CGWA 1QG3A 4Q58C 5CEZD 5CEYB 4KPHL 4NJAH 4XHQA 4ZOEA 4DOHE 1CGVA 5FYLH 4Q97A 3JTSB 1K4CB 3RWHA 1LDSA 3TA3D 3CFDB 2V7HB 4NYLB 3JV6B 4Z5RA 3RVUD 3MV7E 1BWMA 2NXYC 4BH7A 3F58H 3QFDB 4GG8A 5GJTH 3DMMD 4HPYH 1J7VR 2QR0B 5IB3A 3VD3A 5BRZE 3UZEA 3DRQB 3OV6A 2FRGP 3UTTE 5KN5B 3VXSE 2UWEB 3K74B 1AGCA 4EI5C 1SYSB 4GXVH 1F4AA 1QLRA 2F5BH 3DWTA 1XF4A 1MAML 4PJIA 3UDWC 3QA3B 1N6UA 1BAFH 1IC5L 5B39A 1ZHKA 2B39A 1T04A 2VQTA 4GQPH 3ZSSA 5LVEA 2XKNB 5I6XB 1FZKA 4P3WA 3KPRD 4JVUA 5JUEL 4JPIB 4IEFB 3RVTD 2F15A 2R56H 4UBDC 4MNGA 2JELL 3L6FB 2GKIA 2NXZB 2BC4A 4P2OA 5KSAB 4MQ7A 5HGHA 1YJDH 5E2WL 2QQLL 1XCTA 1U8QB 1XGQB 4B50A 1MAJA 3MYJA 3JUZA 4PRPE 3WXVL 2OR7A 1AP2A 2R2EB 1EERB 3QUMH 4K8RH 3IF1B 3F12B 4GW5B 4IHOA 3GRWH 5CINH 3QUYB 2HKFL 3UTSD 1A9BA 2DKMA 4LVNB 1UENA 4OLZL 4GG6E 3T08A 3IKCA 5BQ7A 1ZT7A 1S7UA 1T1XA 1HQRA 4IRJB 2ZCLH 3F6LA 2I9TB 2RHEA 4PRIB 3GUTB 1YEHH 2BY0A 2Z8WC 4P5MA 3RJDA 1DQDH 4MZ2A 3KLSA 2Z31C 2GJZB 1MQ8A 5F7DB 5CSGA 4U3HA 1A4KB 2XTJC 3QIBB 4BFIA 4LLMA 1BFVL 1ZHNA 2YUVA 1JHTA 3LKNA 2BVQB 1D5IL 1RMFL 4UNUA 2WIIA 4CBPA 4D3CH 3BN3B 5I66B 4L9LB 1D5MB 4H0HB 3OB0H 1U8OA 5J13C 3T65B 3GMQA 4GAYB 1WC7A 5SWSE 4IRSC 2VLRA 4F15B 2R0ZL 3KYNB 1SEQL 2HJLA 4WUUA 1SJHA 3ULVF 4XCCL 4K7PX 1DEEA 5FCSH 1FN4A 4D0DB 3KPSB 1AY1L 2E7BA 4PRHA 4X0KA 5L9DL 3KG5A 3KPNA 4LHQB 4RA0C 5TFSH 1JWSA 2BK8A 3SDCB 3L3OB 4Z77A 5DRWB 5C09B 5E6IC 1A6TA 4FS0A 3KPLA 1ITCA 5SWQB 1MUJA 2UZYB 1BD2B 4YDIL 3EDDA 3HB3C 3H9ZA 1SHMA 1MFCH 1DTUA 4R96B 3OKNA 3QXWA 4DTGH 3MC0A 3QO1B 1L6XA 3MGOA 1HOCA 1OTTD 2AJXH 4NO5B 1G6RA 5CIPA 2EDNA 3BW9A 4WFFE 3W0WE 1X4ZA 2XN9D 2Z91A 4M6AA 4XT1C 1Q94A 3FHAA 2BSED 1U8KA 4UUJB 3MBEA 1HYSC 3OJDB 4V2CB 1C1EH 3RHWF 3U1SL 4IOFD 4U1KA 2CUHA 2WBJA 4D9QD 1I8KB 6FABH 1MCQA 5TE6L 3GHBL 4R2GB 1MCWM 1UEMA 5HGAA 4F7MB 4HWZB 1FFNB 1G7HA 2NZ9C