4QCIB

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYISDDGSLKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHPYWYGGQLDLWGQGTLVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-PDGF-BB antibody - Light Chain
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 44
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB01
3UTOA 1JGUH 4HHAA 4WFED 1ZLWH 1N8ZA 3NA9L 1DSFL 1IC7L 3RRQA 5IFHL 5ERWB 5EUKA 1NUDA 1K4DA 3RA7H 4MXVF 4YIQB 1RIHL 3HNTH 1KXQE 4HUMB 3RDTC 3BZDA 3F7YA 3ULVE 4OAWB 3VGFA 2XWBB 2HT2D 4L8SB 3S37X 1YYLH 4Q74A 3FCTA 2DQEH 3MFGB 3UYOD 4HS6B 3A0OA 1N6QL 1NMCC 4ZTPH 1NAKL 2R4RH 1LMKA 3BIBX 2YOCA 2NY6D 2R15A 3FOLA 4G6FD 4A6YL 3FB7B 3SDDB 3WL9B 1KN2L 1I7RA 3ZLQC 1GGYA 3H42L 5EBLB 4GKSA 5A2FA 4KKAC 3MLYH 1KTDB 2V6HA 5IMKA 4NN7C 3SKOB 1M6OB 3SGKC 1QACA 1CGTA 3VWKC 3L7EB 3IXAB 1WBXA 4LQFL 1IBGL 1JGLH 3BW9A 1JTOA 3RZWA 1JZ4A 2FX7H 4P0DA 2OTWB 5IVOA 5FK9B 4M7LL 4Z7OF 2R0WH 3MLTA 3QPXL 4HV8A 4XVUD 2H9GA 3TC9A 1CQYA 2GYSA 1CXIA 1RIVL 4YXKL 1BJMA 3MRFA 4Y89A 5M7QA 4ZPVA 3HI6L 4WTXA 4A2MA 1XGPB 3FHAA 4Q9RH 4XCCL 3SGKA 1CLZL 32C2B 3KYAA 1G7QA 2I07A 3VWKA 2V9QA 1MLBA 4NUGL 1JGEB 3GSOA 1MWAH 2EDEA 4PREB 3SKJL 2DKUA 3IS1X 4K3JH 3QIUC 4HKXB 5ANME 3OR6A 2H3NB 4RA0C 4X6CE 1UQSB 1NKOA 2OQJA 2NY1C 1Q9WB 2DQHL 1CT8A 3AREB 4PRHA 3B9AA 4RFEB 5HHMD 5T3ZH 2PUQT 1CL7I 4HKJB 1F4XL 4FRWA 3U46B 4GRLD 2OJZH 2YKLL 3U9UA 1B2WH 4UB0H 3VH8A 4AIXA 4HF5L 1NEUA 2Q8AL 3LKNB 4XMPH 4U33A 4CVXA 1F58H 2W91A 1KLGB 3X3GH 4HGWB 3QCUL 1URLA 1AQKL 1ES0B 2B1HH 4TSAL 4PUBH 1CFQA 3QEUA 4WTWA 1A7PL 3D3VB 2B2XH 5CKAA 4U6XB 3F58H 4F2MA 3RIFF 4DKFL 4LRIC 2HH0L 4RDQF 5F7HA 2HLFC 1GPOL 3GSRA 1LO0H 5DF0A 1NMAH 4O58L 5EPMA 2FO4A 5A2JH 3TBVB 2I5YH 3I2CH 5TF1L 5J89A 4O2FB 3U30B 4JO1H 3A67H 3KPSD 3PHOB 2IGFL 4O02H 1FNSL 2IH3B 4LKCA 5I1AA 3AC0A 5E6IA 5ALBH 4FNLL 4N5UA 1MRCL 2F74A 4WIQA 4X0KB 1ZA6B 1LO2H 1INQB 5IHLB 4D0BB 3CAFA 1EFXB 4WO4D 4E42A 1QFPA 3NPZB 3KYKH 1QEWA 5J1TC 1GL4B 4LRIA 4LSUL 1RJZA 2VXVH 5L0QC 1D5IH 2YD5A 1E28A 4ELMB 3MUGA 2D31B 4XRCA 3BMWA 3ILQC 3QFDB 3LSOA 3RVTD 3S35L 5I1IH 1MHHB 2XXCB 4OFVA 4U1SB 1BOGB 4IIQA 4OZFB 2Y72A 4HH9A 2F8OA 4XWGH 5C0FB 1P4IH 3NA4A 2DBLH 3C8KB 1IM9A 1NGWB 2AK4E 1L0QA 4Y2DC 4LLQB 5GRXG 1LEIA 2OBGA 4ODUB 4OQTH 5L6YL 2DQUL 5DDHA 4CJ1A 1MFCL 3QHFL 5EU6E 1CFBA 4XB7A 2DRUA 4HMCA 4PJ8B 1J8HE 2L4OA 2Q8BL 1WBYA 2X42A 3S36X 1VHPA 3FB8B 4MB5A 1F4WL 4APQD 1OP9A 5FV2A 1IEBA 1QFWM 3IDMA 3HZKB 2EICA 4EN3B 5DJCB 1WFUA 4W70A 1M7IB 4Y2DA 1QSZA 4OCXH 3WIFB 2ZCLH 1KSRA 3BEWB 4ZFGL 5I66B 4FTVB 4C4KO 1EGJA 3IVKB 2FBJL 7CGTA 5IFJB 3O3AA 1TTFA 2FSEB 1NBYA 2VQTA 3UROR 1D6EA 1OGAD 2BSTB 4X5LA 5DO2D 3CX5J 3G5XB 1CU4L 4GG6E 3NIGE 5INDA 2YRPA 1DQMH 3EGSA 3QPQC 4LPUA 4MJ4A 5F70A 5T5FL 4ZNCD 2CKBH 5BW7C 1NUGA 4WEUD 2VDNL 2NY4D 3SDDC 5ERWA 3UMTA 5DK0A 1FH5L 1CLCA 4L9DA 3KPMB 2Q7YB 1QPXA 3VI3E 1A14L 2DWDB 1CTNA 3GSNB 4YHIB 1T2XA 3F12A 3GMMA 3O3BB 4Z7NE 4OAWA 2XWBA 3HRZA 2ADJB 1HEZB 3CFBB 1NCCH 1J0ZA 2BHUA 4QXUH 3TN0D 4MA8L 3OKOB 5JIKA 1TENA 5A3IC 1RUPH 2YK1L 3ARWA 5ALCL 5T1DH 3VJ6B 2E3VA 2EDLA 3U6RB 1AXTL 2EDKA 1T03L 3O6ML 5BW7A 5DK2B 2FR4B 5KVDH 4JY5H 2Z91B 3WL9A 4ZO8A 4EI5B 2MJWA 1DDHB 5EBLA 2DD8L 1AO7B 1RZ8B 1EEYB 4C58B 1OT2A 4GMTL 2F53B 3SKOA 1M6OA 4PJIB 5D7IE 4JO4L 4YZFF 2PXYB 4WCYL 3CVHA 1QBMH 3KPRA 3UAJC 3IXAA 4NSKB 4B7LA 2V5RA 5KOVC 4LEOA 1BAFL 5A16A 4X7EC 3S97C 2OTWA 3ZE2E 5FK9A 4H20H 4AEHH 3D9AL 3AREC 5GJSH 2FCBA 4XPTH 2ZSVB 4YAQA 4ZUWA 4Q9BA 4PV8B 5L2KB 3QCTH 4I13B 4HIIA 1W72H 1CIDA 1YPZA 4CKVX 1WAAE 3MYJB 4DUVA 4Y8DC 2FL5B 4AQ1B 3KLHC 3ARRA 5HDQL 2HKHH 3L95B 4OKDA 5HHOE 2H26B 2X4TA 1IEAB 4GRWB 3F7PC 4K23H 1UQSA 4NZDA 3PP3H 4YHPB 1Q9WA 3AREA 4RFEA 1FNFA 4K94H 1FNAA 2YD7A 1XF4B 4HKJA 5CMAB 3SE3A 5ACZB 1UWGH 3U46A 3TA3B 1UC6A 5ILTL 1OF2B 1JE6A 1OP3K 3U30C 1H3TA 3LKNA 2G60L 1ERNA 1T1YB 3Q5OA 2HRPH 4DZBB 2IALB 4HGWA 3CU1A 3GMLA 4M8QB 4YEEA 4DGVL 3NA9H 1EV2E 1WWAX 1NGPL 2R2BB 5IFHH 2G75B 4AIZB 3LRSB 1JN6B 4U6XA 1UM4L 4ZAKD 4FFVC 3EO0B 5D1ZB 1O7VA 1A6UL 3KR3L 4OFYD 1IQDB 1LP9F 1FHGA 3TBVA 3EZ8A 1INDL 4O2FA 2BFVL 3RWEB 4GAFB 3PHOA 3MLUL 4P9ML 5CZXD 2CSPA 4CL7A 1MH5B 3THML 4LPVA 4CAGA 3TO4D 3CNKA 1NAKH 5FUCC 2XG5A 2VDQL 3PDOA 1ZA6A 1OSPL 1INQA 4D0BA 1G9ML 1EFXA 4XPFL 1BM3L 3FFCB 5DRNB 1H3WM 5F1NB 2ZG2A 3RUGF 3D0VA 3RWFA 4AEIL 1MJJB 4KKLC 3NFPB 4JDVB 2IFGA 2QQNL 1AGFB 4MWFB 1UJTA 2VN4A 4ELMA 1CYGA 3Q6GL 2D31A 1XGRA 4PJ8C 4HG4J 4H26B 4OZHB 1Q72L 4L4TB 3MV7B 4M7LH 1MHHA 2VLJB 1BOGA 3NPSB 4OZFA 4QOKD 5C0FA 1AR1D 4EN3C 4HT1H 3C8KA 1FRGH 1T1WB 2D9QB 4JDTL 1F11B 1DUYB 3A6BL 3SJVA 4E41D 3HI6H 1I1AA 3V5KB 2CH8A 4UTBL 4PRAA 3W82A 4XCCH 2R9HC 5GSRA 1V05A 1CLZH 4Y4HB 2H1PL 1L6XA 3SBWC 2AQ1A 2ADIB 3DRTB 2WUBL 3E3QC 4PJ8A 5MP6H 4BZ1L 1DEEB 1IGJB 2CDFA 5E8PB 2VAAA 3SKJH 1CE6B 3BP4B 5IVZB 3FB8A 5DJ6A 1KIPB 3MV8E 1I8IB 5IG7B 1MCPL 4ZFOL 2DQHH 5MERB 2P1YA 2A74B 3V0WL 1ROWA 2P4AB 2VQ1B 3HR6A 2YKLH 3ROOB 2Q8AH 5D9SB 3VXMD 4JKMA 4NCC2 1HINL 4HK3J 3BEWA 1FC2D 5I66A 5DJDB 3QCUH 3QO1B 5IFJA 2FSEA 1AQKH 4DVRH 1WC7B 2BSTA 1A4KB 5FCUL 3G5XA 4V1DA 5K33A 4MNHA 3TYGH 5FYJE 4KV5F 1OVZA 1T21B 5F97E 5TPWL 1WCBB 4G9FD 1GPOH 4EI5C 1WLHA 3TPKA 4OFKA 3LMJL 3GRWH 3VFNA 3KPMA 2Q7YA 1RIUL 1JZ3A 3H3PL 2DWDA 3G6JA 1CS6A 3GSNA 4Z7WE 1DUZA 4J1UB 5EORH 2APWA 5H8DA 2IGFH 2BVOA 2PXYC 1X5XA 5DS8B 4YHZH 2ADJA 3VFUB 1HEZA 3CFBA 4R6UA 3ARFD 1QSFD 1KT2B 4NM4H 4DKAA 1Q8MA 1VFMA 3OKOA 1V3MA 2H32B 1MRCH 1J8KA 1S78D 1H3UA 3VJ6A 3U6RA 1DE4A 4OFIA 5IBUB 4QHMB 4TNWK 2ZCHH 2DM2A 4QHKJ 4N1CA 2FR4A 1HIML 1MREL 4LSUH 2YC1B 1CGSL 2Z91A 5E5MB 2NW3B 4EI5A 3WFHB 1DDHA 1RZ8A 3O2DA 5DQ9B 1JF1B 4YC2B 3ARGC 1R3IL 2IMNA 1PZ5B 1KENH 3S35H 2PXYA 5KS9E 4C56A 3MLWH 4U1GB 3FAXA 3WMSA 5CUSL 4NSKA 3MGTB 2FEEL 4RMWA 5DD5L 1PG7W 5EO1B 5DFVD 3SGJC 4TYUA 5MENE 2NY2B 4U6HB 1YN7B 5FYKL 2GK2A 1RURL 5EUOA 5FKPB 5H35A 4P2QA 2YA2A 2ZSVA 3TA3C 2NY7L 5L6YH 4FQCL 2DQUH 4Z8FH 4I0CC 4PPTA 1MFCH 4YX2H 5I75B 2FHFA 3KJ4B 3MYJA 4XCFL 3ARGA 1IGYA 2OZ4H 2FL5A 3KYOB 3B6SB 4PV9B 5IHUH 3CFDB 3L95A 3QWQB 5IMMB 3KVQA 4PY7A 2H26A 4I4WB 3T0BA 3S37L 1IEAA 1QD0A 3SGJA 1CXHA 1MHEA 4U3XA 1R5VB 4YHPA 4H8WL 3X17A 5D1ZC 4DTGL 5BJTB 1N5YL 2W60B 5GSVB 2AJXL 2E8ZA 1RHHA 2OJEB 5CMAA 1ZOXA 5GRJL 5ACZA 4G6MH 2DJUA 3OAYK 1C5DB 1OF2A 5MHSD 4P23B 1OARH 1NFDA 5JZ7C 1T1YA 1ADQA 2BNQD 2PTVA 1R24B 4X8XA 2IALA 4DZBA 1CU4H 4M8QA 4X8JB 3CLFH 3L3OB 1UB5A 3AM8C 3DARA 3D87B 1V7NL 2VDNH 5FYLE 4AIZA 4HIEB 3ZDZF 2E9WA 3LRSA 1JN6A 4JPWL 4GFTB 3MR9B 4M62L 5D1ZA 3ZYIA 4WTZA 1A14H 2X1PA 3UTTB 1AKJB 1IZKA 3B9VA 1IQDA 1AXIB 1DANT 3BUYB 3JWDL 5JIPA 1SM3L 3CH8A 4NKIL 3RDTD 3RWEA 4JZJC 3SDXF 4YBHA 3TH2T 2HJFA 1MH5A 1RZ7L 1HSAB 3AM8A 4ODHL 1Z9MA 1T03H 3NPSC 4MCYB 3TPUA 1C8PA 4OZIE 3QUZC 2RB8A 3OXRB 4Y7MA 3FFCA 3N06B 1C16B 2DD8H 5CILL 5DRNA 4E9LA 1WV7T 2CK0L 5EO0A 2R2HB 4GMTH 4GXUM 3NFPA 1DQQB 1AGFA 5I2IB 4MWFA 4JO4H 2A9MH 2ILLA 4KKAD 4JZJA 5INCB 2VXSL 4IOFC 1BAFH 3INUL 4L4TA 3MV7A 3VWKD 3D9AH 2VLJA 3D2UD 5DSCB 4Q97A 3QHZL 3QH3B 1T1WA 3O3DB 3QUZA 1F11A 4Q7DA 1GOGA 4D3CL 2PKDA 4PRHD 5EU5B 3MC0A 3MRLB 1WFTA 1Z9LA 3RGVC 3V5KA 1MEXL 1UCTA 4XB8A 4Y16B 3EOYG 2V2TB 3FONB 3N9GL 1EAJA 2UZYB 4HULB 3VXUD 2ADIA 5HDQH 5DVKA 1SYVA 1IGJA 2EDTA 1WQVT 5EA0L 3P4MA 4EUPH 3K8MA 5E8PA 2ICEA 1AIFB 1CE6A 2C3WA 2KZWA 4KUCD 1EJOL 2QADB 2EO1A 2HVKA 3H3BC 2CIIA 5D5MF 4X83A 1DBKL 3GSWB 4P5KB 3QIUD 2PR4L 2CJUL 1EA9C 1KOAA 3BZFA 4LLVB 1MRFL 4MXVE 2NY1D 1B90A 5DRZA 3ROOA 4DQOL 5D9SA 4MHHG 3EYOB 5MEQB 1BQHG 2V17L 2FEDC 2UZXB 3RGVA 1T0MA 2ESVD 5DJDA 1EH9A 3OPZL 3OR7B 5KVGL 4PJEF 1SY6A 4Z77A 5IOPA 5DHYB 2YPLB 1WC7A 3TJHC 3OGOE 4M5YL 1A4KA 3CDFA 3CX2A 2EYTB 5J12B 3CK0L 5JDSB 4XX1E 1UM4H 3QAZB 5MI0B 1M71A 4TUOA 1A6UH 1X5KA 4J3VA 3WIIH 4BSVB 4LPCA 5E56A 4YBQC 2HLFD 2BFVH 4YC2C 2E9IA 5IESL 1QFOA 1U0QA 4J1UA 5HGAB 4P9MH 3T65A 4I0KA 3THMH 4U1GC 2B1AL 2Q86B 1KT2A 2B8OT 2H32A 4LEXL 2NY2C 4Z7OE 3VXRA 4QHMA 1BX2B 4JG1L 4Z7VF 4XPFH 1BM3H 2X9YA 2XRAL 1EHLL 2YC1A 1CXKA 5E5MA 1MCWW 5D1XB 2NW3A 4AEIH 3VGAB 1IM9D 4JFOB 5E9DB 4Y19E 5DQ9A 5CGMA 5I75C 4FHBD 3PJSB 1UACH 3KJ4C 3Q6GH 4HPYH 2HLAB 1PZ5A 3L3KB 2ICES 1Q72H 1EMTL 1JPST 1J1XL 4BQ8A 1RD6A 1T5XB 3S4SB 4MB3A 4PGEB 1FFPB 2H2PC 3MGTA 3ILQD 1RULL 3O4OB 1FNGA 4FP8H 3BPLB 3KLDA 1YYML 3GIZH 3SGEH 4U6HA 3OKYA 5C0RH 1YN7A 1ZHLB 3LN4B 1EO8H 4LDEB 1BWMA 3E0GA 2HAZA 2I60L 1JZ6A 3TZVB 5LWYL 2QKIB 4WNQB 4P23C 1EVUA 4Y2DD 5CSZB 1A4JB 4OGXH 1HHJB 3CXDL 1DANU 3KYOA 4ZQKB 4PV9A 3D85B 4RGNB 3CUPA 3GKWH 1ORQA 4ZTOH 5IMMA 2WIMA 1RUML 3U0WL 3V0WH 3QZWB 4C55A 1LP9B 1YC8A 4JZNB 3V9FA 5BJTA 3H9SE 1N59A 2OJEA 3F7VA 4J8RA 4DK3A 3MJ9H 4XP9L 1HINH 1C5DA 5IB2B 2AEQH 5I1DB 4P23A 2EYRB 5F7KC 2Z35B 4QRQB 2Q76A 2FLRT 1CXLA 2J7LA 1R24A 3BYYA 4NBXB 2NTFA 5FCUH 5F9AC 5A40E 3L3OA 2AVGA 4OLYH 5TPWH 1YECH 3QI9A 3VU2A 2EIDA 3RUGB 4R2GB 3T2OA 3QPQD 2WSKA 4Q0XH 2E7MA 1C7TA 3IDJB 4OT1L 1GH7A 3PABB 4DN4L 3U9PL 3UTTA 2GTZB 1AKJA 1J05B 2XQYK 2Y23A 3T3MF 3BUYA 3G9AB 1QVOB 2DLEA 5EB9A 1U2HA 1KJVA 1U6AL 2DQIL 2W65B 4WTZG 3MCKB 1PY9A 3D6GA 4ZYKB 1I9JH 5FM4A 1NCWH 3U4BL 3F8UB 4KRPB 1HSAA 3MLVL 4MCYA 2NX5E 3STLB 1LO3H 5A3ID 1MREH 3EYSL 3KPNB 5C0CB 4JEGB 1JHTA 4PRPE 5DJ0B 1IC5L 3LB6C 3I9GH 1GYAA 1JZ5A 2VDOL 4U7KA 5HXMA 5C09A 3DO3A 1QP1A 2Z8SA 5C08B 5C0AB 2R2HA 5I6XB 4Y16C 4O4YH 5I2IA 2IF7A 1TJHH 3DO7A 3DIFB 3REVB 3MA9L 5DD5H 2ITCB 5INCA 5JA9A 4TULL 2QADC 4QRUB 3UAJD 5DSCA 3OB0H 4UNVA 3MV9B 4N9OB 5CWSB 4WRLA 4BQCA 3QH3A 3O3DA 2NY7H 3ARED 3LV3A 2N1KA 1RPQA 5EU5A 4I18B 2A1WH 3VDAA 5BRZE 1JF5A 2EH7L 1MCCA 3KWWB 3LEVH 4XCFH 4LSQL 4QRTB 1LK2A 2V2TA 2JJVA 5TDNB 1JPSL 2VDRL 2C7UB 4AK1A 4M61B 1JNNL 1YN6B 1CG9B 1NC4B 4IBLT 3I6GA 4EDWL 2Z8VC 2EDFA 1AIFA 2VB5A 5J12C 3S37H 1DQJA 3KLHD 3QAZC 5T3ZE 5MI0C 4Z7QF 1WCQA 4H8WH 4DTGH 3OKKA 4PJBF 5F6IB 3D3VD 3GSWA 1GC1C 5ETUA 1GOFA 1F6AB 5GRJH 1QRNE 4LLVA 5BZDB 4CMHB 4MD0B 1J18A 1J9CT 1FVEA 1DEDA 3TFKC 2DMBA 3EYOA 4O51B 5MEQA 3AVEA 4DKEH 4MZ3A 3IDNA 3LIZL 4JPVH 5M95B 5CINH 5DT1H 3OR7A 4NQVB 1SEQL 4U6VL 1FO0B 4WW2F 5DHYA 2APBA 4KZEL 2YPLA 3WFCL 2GT9B 1K4CB 4LHUG 5KTEL 2OI9B 4LLWB 5JDSA 1ZSDB 2P5EA 4QRRB 4M1DL 2LTQB 4FFYH 5KJRL 5D1XC 3TNMA 5HGDA 1EFXD 3ISWA 4FFVD 1SM3H 1F8TH 3F6IA 1P9MC 4NKIH 5DUBB 2X4RB 5E08L 5HGAA 4A6YB 1A6TB 2EIZB 3NZ8A 2YZ1A 5HYSG 4YZFE 3QUMH 4WWKB 1YMMB 3ET9F 4I2XE 4ODHH 1MY7A 3O4OC 1XGTB 4Y4KB 3BPLC 4OF6A 1KTLB 4WEBH 3W2DH 1O7SA 1X6LA 4I9WE 5BV7C 1BX2A 3QRGL 3B5TA 3V4PL 3U7WL 5I1CH 3MRCB 1G1CA 3MBXL 5CILH 3RWIB 4Y4FC 5D1XA 5GIRB 3TZVC 3Q1SH 2CK0H 4R7NB 3UTSE 3WFEH 4WY7H 1N5AA 5LG1A 2BRQA 3SJVD 1P9MA 3PJSA 4DZ8B 2CDEB 1F2XK 4KKLD 5J8OA 3L3KA 2UWEF 3D18B 3AY4C 2VXSH 2I9LA 5DMJB 1JZ2A 3INUH 4U1JA 1T5XA 4PJ8D 2CIKB 2EE3A 1UWXK 5FA3A 1XGQB 1RZJC 4F58L 3KGRA 1J0KA 1KXTB 4AT6A 1ZHLA 3LN4A 2ZZUT 1NPUA 2ATKA 1JYXA 4EN3D 4Y4FA 1GGIL 1B88A 3OAYH 4WNQA 3DROB 2NY5C 1OAYL 1U3HC 3CDGA 3I02B 1YEFH 2VE6B 2K7QA 3QQ9C 3FQUB 1A4JA 4LCYB 5IHZA 4RSVA 1LEGB 4FTVD 1T04A 2VR4A 5EA0H 2R9HD 3F7QA 4CU6A 3AY4A 4I3SL 2JB6B 2CDGB 4JFPA 3FO9B 4BQ9A 4X4XB 1FSKB 3HZMA 3IFLL 4V1DD 1I1YB 2EC8A 3KYMB 4R2GC 2CJUH 3LEYL 5GS0C 1KEML 1LO5A 4JZNA 3L5WB 5EU3B 5T5NF 3WCYA 1JTPA 2G9HA 2W9EH 4YGAB 3SDXB 4LLDA 5I1DA 2R0LH 4UMGA 2J6EA 1U3HA 2EYRA 3OPZH 4G6JH 3OTTA 4TOYH 4PGDB 3NIDF 2DI7A 2A6IB 4HCRL 1HOCB 2VDKL 2Z35A 4QRQA 3EDEA 3MCLL 3REWB 5GS2H 2IQAB 4OTXL 2YUWA 3NN8B 4DW2L 3ULUL 4KRPC 2X05A 5GRVK 2XNAB 2UZIL 1RJLA 2C3VB 1I3GL 1CICB 3PABA 2GTZA 3MROA 4HDIB 1BGXL 2J8UF 5I6XC 3GBNL 4EI5D 1QVOA 5IESH 4W68A 4PBXA 3SE8H 3MXVL 5LAXB 2W65A 4FQJL 4OLZL 3RKDC 2B1AH 5T1KA 3MCKA 5IKCB 2BSSA 2VO5A 4ZYKA 3VFPB 1OTTC 2PXYD 3FT3B 4LEXH 4ZFZA 4X4MA 3HG1B 4JG1H 1PW3A 3STLA 4QXTB 2XRAH 1EHLH 3KPNA 5C0CA 4K2UH 3QDHA 4OZ4B 4PLNC 5DJ0A 3S36H 5HY9B 1I4FB 1F42A 4MJ5B 4WHYG 2C1OB 4Y1AB 4I18C 1I7UB 1T3FB 5C08A 2LAAA 2PW1A 1OGTA 5C0AA 2IAMB 5L2KD 1KCKA 3ZL4H 5GGSB 4IJ3C 5JA8B 3ARGD 1JWSA 2QQLL 3REVA 1VFBB 1GZQB 2Q7NA 4BH8B 1U36A 4QRUA 4Y5VB 5B38G 4JGUA 3P0VH 3QEGL 5F6IC 3MV9A 1AGEA 5T33L 3FOMB 4LF3A 3BDBA 2FH6A 5TQ2L 2RAMA 2K1MA 1QTYT 2DI8A 4U0QB 1TFHA 3Q3GB 4I18A 4MGXA 3WIHH 1UT9A 3LKQA 5ESVA 3KWWA 3TA3D 1CDBA 5GPRA 3UDWA 3DXAB 3MRPA 5TDNA 1RK0B 3ZHDA 4PD4J 4KRMB 1FJ1A 2C7UA 5TDOA 5KBNC 3MODH 1YN6A 1CG9A 1NC4A 2OI9C 1RUMH 3HMXH 4JFHD 1AGDB 1WF5A 3P73B 5LCVH 2LTQC 5E4EB 4F7EB 5ID0B 1NH6A 2X89A 5B22A 4QHLB 1F6AA 2VMFA 4XP9H 5BZDA 1CL7L 1VCAA 4MD0A 1GZPA 1PG7X 2Y6SC 4K71B 5D1ZD 5GRUL 1DBBL 2M1KA 2QSTA 1RZKH 4JQIH 3HAEB 4OCMC 1DFBL 4EQ2A 5LQBL 4WWKC 5CD5C 1FO0A 4Z78B 5JZ7D 2GJ6B 3QHTC 1J8HA 2LVEA 4Y4KC 3L3GB 5I18L 3DX7B 1QQDB 4LLWA 4LLYB 1LHZA 4OM1L 3GSXB 1ZSDA 1Z3GL 2YD6A 4YDKL 4OT1H 3QNYA 1G0XA 1X7QB 2PO6A 5DRXB 4DN4H 1UCBL 4UDUB 4X9IA 2X10A 4F9PC 3DVGB 3FFCD 4H1LH 2DQIH 5DUBA 3V52L 1X4YA 2X4RA 4R4FL 2PTUA 3U7AA 1G9NL 4NCC1 4A6YA 2EIZA 1TITA 3ZO0A 1VGEH 3PQYB 5CBEB 1YMMA 1S7TB 1U8NA 3ZKXB 3MLVH 4XC3H 2WLZA 4Y4KA 3GK8H 3EYSH 3W5NA 4L4TD 3AU1B 3MV7D 4HIHA 4N90E 1TZGL 4JJ5B 2VLJD 5DUML 3TVMB 1IGIL 2CR3A 1MAJA 3RWIA 4LSTL 4ZODA 1JHLL 3D1MC 5GIRA 1SEBB 1CK0H 4N8CL 1RY7B 2PTTB 3QUZD 4R7NA 4F15B 1LE5B 4Q6IA 4F9PA 1YUHB 4G7YH 4DZ8A 2CDEA 2FHCA 3ESVF 1GOHA 1E4XI 3SEPA 1AC6A 1VDGA 1EX0A 2DM3A 1DLFL 4TULH 5E1AB 2WAHA 1P2CB 4ALAL 4R3SB 4TPRL 2BRRH 4PJ9C 2J4WH 1KGCE 2B5IB 2ICWJ 1FSKC 4IOFD 1U8IB 4G80A 2FX8H 4XP4L 4O2CA 5IBTH 3RPIB 1ZT4B 2QQQA 5CEZD 1BQUA 4CNIB 4FQLH 3NMEA 3RWJB 3MRGA 4CW1B 3S3SA 2EH7H 4P48A 4EUPB 4KK9C 3PV6A 1U8PA 4LSQH 4ETQA 4LDLB 2NNAB 4PJDE 3VXOB 5IB3B 4LGRB 2VE6A 4YFLI 1J0HA 1JPSH 2DICA 5D7IA 5GRWA 2OXHA 4LCYA 3RGVD 4JG0L 1JNNH 1MFDH 4Y8AA 4HWNA 2DF3A 3QUYA 3FQRA 4NRXB 2JB6A 5C0JB 4HZLB 4PJ9A 1XF3A 5KVFL 5E00B 2KKQA 2CDGA 1TVHB 4HZAA 3SOBL 3ILPA 3BKCL 3DRQB 3ZDZE 2BSED 3IDYB 2X7LB 3L9RB 4AYFA 2EDBA 3T4AB 4PYGA 1CCZA 1VEPA 2A9NH 3VXQB 1OD9A 5SWZB 4LARL 3VXSB 4HG4K 3O6FB 3LIZH 4JKLA 2N7AA 1WAAA 5F9JB 4XPBH 4U6VH 2A6IA 5H94A 4P3DB 1HOCA 3JWOH 4S0TD 3BO8B 4MVBC 3WFCH 2FEDD 4MX7B 3REWA 4JR9H 3HRPA 3RI5F 4PJHB 5KTEH 1WZ1H 3DX6B 5HHOA 1W0YT 5SX4I 1TJIH 2PETA 2P5WE 2QSQA 3TJHD 4DCQB 1A9BB 4OKVA 3VXRD 2C3VA 4XVTL 3DPBA 2AJSL 3IRZA 3VXPB 4HDIA 2IAMC 5E08H 5TFSL 5D7LE 2PYEB 25C8L 2BJMH 4YBQD 5HHVL 1SMOA 2H6PB 3AROA 4I3RL 4NC2B 5IKCA 4NBYB 5J1SC 5B39A 1KB5H 5IVXE 3VFPA 1U8KA 2ZWLT 3GBMH 1AD9B 4LLMB 1A1NB 3HG1A 4U6YB 1J87A 3V4PH 1QBAA 3U7WH 3MBXH 5K9QG 5AZ2L 3B83A 5GGRB 5CP3A 4WUKL 4OZ4A 3V0AC 1VPOL 2NY2D 2O5XL 1S7VB 2B39A 4XTRC 5I1JL 2N56A 2YPVH 4MJ5A 3L3JB 5L8KB 4NDMA 4NUJB 3O2VL 3LKPB 3RHWK 2C1OA 4Y1AA 1T3FA 3IAPA 5K59F 5TH2B 2IAMA 1RMFH 3EOBB 5C0NC 2BSRB 1JF6A 2Z93B 4H88L 1GGTA 1FLRL 1KYOK 5HVFB 1GZQA 4BH8A 3JZ7A 4KFZC 3QEQB 2H2PD 4FQHA 5E4EC 5D5ME 4N9GA 4Z18A 1IAII 3I3EA 5GGTH 3T0XA 5ESQB 2VJXA 4K71C 1S9KC 1OAYH 1LO4L 2XZAH 3Q3GA 1H8OA 4LPTA 4H0HB 4IRZH 2NW2A 4G8EB 4ZFOB 4O9HL 4OCWL 5TE7H 3UPRA 3NZHL 4P23D 2VIRB 3DXAA 4PJEE 1RK0A 1GHFL 4P2RB 4P5MB 3VFTB 3K0WA 3IB4A 1OB1A 3UYRH 3EIFA 5DMIL 1ZK9A 2HG5B 2NR6C 1AGDA 2OL3A 3VMPA 1X5GA 3P73A 1KEMH 3S5LG 5EN2B 5ID0A 1FAIH 1IGFL 4QHLA 3FKUS 3UO1L 1UA6L 5DRWA 1VGKB 4O2EB 3T3PE 1MHPL 4PRIE 1A47A 2AP2A 3UTTD 4LAQL 1AKJD 3QDMB 1XH3B 3MCLH 1TIUA 1BQLH 1FL3B 4OTXH 3B2VH 3HAEA 3TIEB 2OMNA 4Z78A 2GJ6A 3ZKXC 1S3KH 5HHPB 5HJ3B 3L3GA 2VLME 4NQDB 4WGVB 1F6FB 2UZIH 3DX7A 1QQDA 4LLYA 5E7FA 1T0PB 3UJIH 3SDYL 4Z7VE 3QIWC 4MLIA 1NAMB 3KPOB 1BGXH 3O81A 4F15C 3GBNH 4LCWB 4UDUA 4UV7L 4UT6L 5DVNA 3DVGA 5JW4R 3VDCA 1MI5B 3MXVH 4R96B 2UWEB 3D0LB 4TVPD 4FQJH 4OLZH 1FG2B 1G7LB 2NCMA 5E7BA 5JOFB 5F7EL 3TO2B 3CXHK 4MDJB 2A2QT 1WEJL 2OR7A 3PQYA 5D2NB 5GGUB 3W0WE 1S7TA 2B5IC 3GSQB 2D7MA 2A6DB 2VQUA 2DTML 1RQ5A 4XNUH 1WIOA 4Y2OA 1FZMB 2WP3O 3QIWA 5J6GB 2Q1EA 4F3FB 1LE5A 1X9QA 3LB6D 4YDJA 5D6CB 4Z7WA 2JCCE 4J3WA 3A6OA 2IMMA 3IJHB 3CFCL 5FO7A 3GJEA 2UV3A 1C12B 1D5ZB 4Y16D 1REIA 2QQLH 5CZKA 1A7QH 1CE1L 4RAHA 5E1AA 1P2CA 3HC4L 5DJAA 1ZHBA 3MLSH 3QEGH 3IDYC 5T33H 1BD2B 2QADD 4JRYB 3RPIA 1ZT4A 1I85C 4IM8A 2GSIA 3RWJA 1Q9OB 4O00A 4CW1A 1CGWA 5ECJE 1GXEA 2ORBH 4OSUL 5DJ2B 3O6FC 4PJ7B 3P0GB 2R1YA 5IB3A 4U1HB 2XI9A 4P57B 5DXWA 3LZFH 4EOWH 3HE7B 3ZKQD 4GAJL 4YPJA 1U9KA 2JJWA 5CEYA 5C0JA 2YPLD 5E00A 1DBMH 1TVHA 1BVLB 3GB7B 3GHEH 5EU7E 5MENA 3DRQA 4QTHA 4F8TA 1FC1A 3L9RA 3QDJB 2J8UB 3T4AA 3RX7A 4ORZC 1CL7H 2YA1A 3LS4H 1I85A 5GRYA 1P5VA 4OCRL 2AQ3A 4PRBB 1DBBH 4TSCH 5DC9B 3SQBA 3KAAA 3S3JA 4OF8A 3CSYB 4KAQL 2K3TA 3O6FA 1MUJA 3CGTA 1G9MC 3MJ7B 3DURB 5SWZE 4PGCB 1DFBH 4ZS6C 5F9JA 3HNVL 3TFKD 2FJHA 4MX7A 3EFFB 4AEFA 4PJHA 5SWSB 4I0PB 5I18H 3DX6A 2R0KH 3NIFF 2AGJH 4YDKH 4DCQA 1A9BA 1HI6B 2QQKL 3MRJB 3MTRA 1UCBH 1KJMB 2RR3A 3EOAB 1SBSL 3ZT7A 1T5WA 3GM0A 3V52H 1FZJB 5D1XD 4ZMAT 4R4FH 3RIAK 1EGJL 3BAEL 1G9NH 3ULUF 1IAKA 2OLDA 2CUIA 5KSBF 1MHCA 4J6RH 5E9DD 2GSGB 2CLVB 1CDJA 2PYEA 3LKRB 1DQDL 3IJSB 1BFTA 2DQTL 4NO2B 3UPAA 3MZTA 4JPIA 3MLRL 4NN5C 5EO9A 1SHMA 1AD9A 5ITBH 4LLMA 5IFAH 1L7IL 1TZGH 2NQCA 4U6YA 5DUMH 1T89C 1PQZB 1HHHA 3MRBA 1K85A 5B39G 1JI1A 1KCVH 5GGRA 1UWEH 4LSTH 1JHLH 4WFGD 1IRAY 1WVZA 2BY1A 4U31A 3L3JA 3LKPA 1UXSB 1QYGL 4Y4FD 3TZVD 3EOBA 4X6FA 2BSRA 3E6HB 2Z93A 4ALAH 1E27B 1OAXL 3KS0J 1OAUL 5GQBA 2W92A 4GAGL 5J13B 1HXYA 3D85D 1CGYA 2D2OA 4UILH 1NL0L 3QEQA 1JCKA 4Z7QE 5DMGC 1UZ6F 4OZIA 1T89A 1RI8A 2ZUXA 4PJBE 4M4PA 5LJYH 4MQ7B 5EOTA 4YDIL 2XZQL 1UH4A 2OX5A 5ESQA 3DHJA 3Q2CA 5DHVB 3DI3B 1ZWIA 4G8EA 4QXGH 1Q9LB 1NEZG 3CVHL 4JG0H 4HUXB 4PGBB 1U3HD 3JV0A 4HK0B 4AEEA 3QQ9D 4P2RA 2Y9RT 4RMUA 3B2UC 4P5MA 5AWNH 4OI7A 4YHLL 5KVFH 4XP5H 3EOTH 3BISA 5IP4A 4AENA 5D7KD 2HG5A 3BKCH 4WJ5B 4NQCB 3LH2L 2MMXA 3UZEA 1JWUB 2ICWB 4OZGE 1QO3B 5EN2A 2JIXA 4XAKE 4RISH 5IW6B 4R2GD 1TXKA 1VGKA 4O2EA 5GS0D 3ES6A 4HJJL 4AL8L 1ZS8B 3KPTA 3FN0L 4MDIB 4LSSL 4KK5C 4Z95H 2PYFB 1XH3A 5A2KH 2BVPA 1FL3A 5T1MB 5D71L 5HDBE 5D2NC 4NZRL 2V5SA 2YBRA 2LAGB 1KG0A 2GITA 5HHPA 4JQVC 2E27L 1IEHA 4JFFE 3NH7L 4KRPD 4ZUVB 3SDAA 4X98A 2BNRE 2ZKHL 4YWGL 3LDBB 2YS4A 3AS2A 4FXLA 4ACPA 5D72L 5C0CD 1NAMA 4NC1E 3B9DA 4PG2C 3RBSA 4M6MH 4WDIA 5TE6L 2BC4B 5TFSH 1MI5A 4R96A 2DQJL 4LP4A 5C0EB 2ZG1A 25C8H 5C08D 1FG2A 5C0AD 3HPLA 3PG2A 1L0XA 5JOFA 2PN5A 3MREA 5SWQB 4MNQE 3HC0B 4K7PX 5IWLC 3WXVH 3RKDD 5D2NA 3GSQA 4G8GB 3TGXA 5AZ2H 1OTTD 2K9UA 1U8JB 3E8UL 1DQLL 3OKMB 1VPOH 5I8CB 1UKSA 2NZ9C 1JV5B 2IG2L 1I3RB 3MV9D 5HTSA 5J6GA 3MA7B 4F3FA 4PG2A 5DYOB 5L9DL 4XXDB 3V0VA 5D6CA 1B4JL 3GJFA 1C7SA 4GRMA 3R1GH 4ZOEA 4H88H 5EZLA 4WI4A 4NN6B 1FLRH 1D5ZA 3HE7C 3U0TB 4JFEB 5IWLA 4KK8C 2DLTA 5E8EB 1FNEB 4LQ1A 1T2QL 3MCG1 1NC4D 4BSJA 3ZTJH 4PJGE 2AEWA 2I24N 4YHOH 4XNZB 1AGCB 3NGBB 3AS1A 4JRYA 3W5MA 4FQXB 5DC0A 3VA6A 4G6FB 4HJGA 1LO4H 2X89D 5AYUL 1G7PA 4RAUB 4O9HH 5DJ2A 4Y19A 5DD6B 4PJ7A 3PDGA 4L8DB 1H15B 4LFHD 3DUSB 3O2WL 3NZHH 4PP1C 1B4RA 4KMQA 4U1HA 3S3PA 3U0PA 3NIDE 3R8QA 1V7ML 3HE7A 5C07E 4I0PC 3JWDC 5DMIH 1BVLA 2H8PA 1CXEA 3DHMA 1EAPB 1IGFH 4PJFE 3UO1H 4QRRD 1BF8A 2AJZA 1PKQB 2CO6B 3UPCA 2FGZA 4IOIA 4ZD3L 4PRBA 5JPMB 4LAQH 2EEBA 4F7TB 1S9XB 4QHUA 1LILA 3MJ7A 4FQQA 3DURA 4HC1A 2Y6SD 4PGCA 3X3FL 5C9KA 3RTQB 5DHXB 3QEHB 4HIJA 5C92A 5DC4B 4MAYA 3C08H 4I0PA 2Y7QB 4YUEL 3KXFB 4WWKD 3DYOA 5CD5D 1YMMD 3SDYH 4Y4KD 3FQWA 1HI6A 4YLQT 3MRJA 5ESAB 1NGQL 1AGBA 3V6OC 3AS3A 1KJMA 3E6FB 3P2TA 3EOAA 4UV7H 2NYYC 4UT6H 3RU8L 1DP0A 2FIKA 1F90H 2KH2B 5FO8B 1XGUB 2XWJB 1FBIL 1VENA 2GSGA 2CLVA 1WEJH 3FRUA 3IJSA 4NO2A 2IANB 4OCLC 4FQIH 4JRXE 1A3LL 4IS6A 4Q9QL 2GK0A 4FFWC 2DTMH 5JR1L 5J13C 3RX5A 3EHBC 3F5WB 3JTTB 1YY9C 2D0GA 1PQZA 4S1DC 1MPAL 4CVZB 1J5OL 1NJ9B 4BKLB 5J0BA 3HPJB 1BEYL 2EDRA 3V6OA 3CFEB 3EDDA 1EO7A 2YEZB 2O93L 3PWLA 1JI2A 5M94B 2XA3A 2ARWA 4ONHB 2F8VA 2HMIC 1A6PA 3BRGC 1CE1H 1NLBL 2XN9B 3VD9A 3E6HA 3HC4H 3T4YB 4CJ0A 1E6JL 2DKSA 5E2UL 4KQ3L 5I8KL 1I9IH 3CZJA 1AC0A 4C59B 3EO1B 4PJ9D 3VI4F 4OIIH 4PRPA 2VZUA 1U8HA 4IMKC 3SGDI 3CH1A 4LMQI 4WO4B 3OHXA 3BEVB 1HWHB 3QIBB 5C9JB 4XHQA 4JB9H 1MJ8L 3DVFA 1CLYL 4PGBA 4GAJH 3BH8B 4WHTB 3OF6D 5GGQH 5LKNA 3WUWB 1E4JA 3OG4B 4AY0A 2VN7A 2X9XA 3BP5B 5HHOD 2VZTA 5CEXA 3FL7A 1TETL 1JWUA 2ICWA 3TBSA 3LDBC 1QO3A 5DVOA 4Q2ZB 4OCRH 2V5TA 4LGPB 4IMKA 2AXHA 3ALXA 5CBAB 1PKOA 4LSVH 4CU8A 1JMZA 3PUCA 4KAQH 4UNTA 1S7SA 1E4WH 2OP4L 1OCWL 4MDIA 1YEHL 3HNVH 4CGTA 2VKWA 4UT7L 5HVWA 4ORGA 1MWAA 4X7TB 1F3RB 4ZNEA 6FABL 4XP6L 4HBCL 3JVGA 2MSPA 3RVUC 1RU9H 1FORH 4UQ2B 4OD3H 2P47B 4MVBD 1XT5A 5K9JL 1FLTX 3V4UL 2QQKH 4ZUVA 3CDYA 3HG1D 4GH7B 1BPVA 3T1FA 3RL2B 1ONQB 5C0IB 3OB8A 5D4QA 1EGJH 3BKJL 1FN4A 8CGTA 3P0YL 1IVLA 1EXUB 2P8LB 3DLQR 4PJ5E 2BC4A 5C0EA 4Y1AD 1ADQL 3RL1A 1LWRA 4KJYB 2DQTH 1GCFA 2IAMD 2A38A 4NN6C 1AFVL 1MIMH 2VSDA 4BZYA 5SWQA 4RQQB 3PL6B 3MACH 2C1PB 2YN5A 3TH4T 3MLRH 2HT2C 3KDMA 3UC0L 1RUAH 4JN2B 1L7IH 5L88L 3S98A 4PJAE 4NNPL 4G8GA 3NGBC 3OKMA 5DI8B 1MCOH 4FQXC 3EFDL 1D5BA 5J1AA 4L4VE 1JV5A 4M3KB 4KUCF 3MA7A 4N0FB 4WFEE 4XX1G 1QYGH 2FD6H 1E6OH 1ZT7A 4OBRA 4XTRD 4KTYA 1YNLH 4HWZA 1YY8B 1RV6X 2ADFH 2QEJA 2VXUH 2BK8A 1UADC 3KJ6L 4S1SL 3ZDYE 1F00I 5JW5B 4PIRF 3G5ZA 5FUZL 1OAXH 1OAUH 1MCNA 1KCLA 1PD6A 1CFSB 4QF1B 5C0ND 3U0TA 3DXAD 3IXTA 4GAGH 4KJWC 2X1XR 1A6VL 2DTSA 3BD3A 4LVHB 5JUEH 5EFIB 1NL0H 1GGBL 1LGVA 3STZA 3VD4A 5JMOC 5AEAA 1AGCA 1WZMA 4YDIH 4HUVB 3WNKA 1EPFA 2KUTA 5D1QB 4L1HA 1G7MB 3ARSA 1MRDH 3WO3B 3PWVA 1D6VH 4XVJL 3UEZA 1QRKA 1T2JA 4EBQL 5ID1B 5DD6A 1H15A 1WWBX 3RTQC 1U92A 1MVUB 3TCLA 2CO7B 3HFMH 3H0TB 2R2CA 1YEKL 4CDHA 5BS0A 4NZUL 1MNUL 4H0IA 2HKFH 2GJ6D 1F4YL 1OM3L 3LH2H 1ZAGA 3MXWL 3R06A 4JHWL 1EAPA 1QUNA 1IT9H 2NR6D 1JGDA 4HS8L 3T77B 5KSBB 4HJJH 4WI8A 5JPMA 4LSSH 3CZFB 2W0KA 4F7TA 5JHLL 4OGYL 1A3RH 3NABH 2DMCA 5GZNC 3RTQA 4HEME 1MFEH 2XTLA 5D71H 2DQGH 5HHXL 4JZOA 2YRLA 2E27H 1SQ2N 1N7ML 1TCRA 3NH7H 3PQYD 2V2XB 4B0MM 2FGWH 4PY8J 4UUJB 2YXMA 2R29L 2ZKHH 3QG7H 4YWGH 4NFCA 3RWCA 3S96A 2FYYB 1A8JH 4LASL 4MMXC 3FT2B 2EC9T 3S34H 5F7WC 1HQRB 4L9LB 3E6FA 1LD9B 4P99A 3MJGX 4KVNL 4HWEH 2XYCA 3QIWD 5IF0B 1HQ4B 1SJVA 1RJYB 1MIEH 1TJGL 1S5HB 3O8XB 4ZS7L 1QKZH 5FO8A 2L7JA 1YJDC 2OMBA 2WWKT 5HHME 5GGSY 3V6FB 3PGFH 2IANA 4XZUB 3RIFK 5F9OL 1WBZB 4X7SL 4JN1L 5E8NB 3JTTA 1J12A 1AXSA 5KN5B 4HUUB 3RWDA 2IG2H 3HR5B 1WTGT 1QBBA 4HFUL 4RGMB 1NJ9A 1NCNA 4BKLA 4IMLA 2FJFB 4M7ZB 3X12B 1B3JA 3CFEA 1ZLWK 3M17A 4ZAKB 4G42B 2YEZA 3QIBC 4OF3A 2F54B 4HX1A 4MXWL 1T4KB 3QUKB 4M7KH 4NKMB 1A2YB 2EKSB 4M8VA 1PG7H 2XN9A 4NQXA 3BGMB 4P59L 2V7HB 4D94A 4AM0A 1T2QH 3BZEB 4B53A 2ZNWA 4TNWF 2BZDA 4G6AC 3TO4B 3KPSE 5F1KC 2C3HA 3GI9L 3EKCA 2ZCKL 5IT2H 5AYUH 3BVNA 1LQSR 5JW4N 4YHNB 3BEVA 3QIBA 5C9JA 5CD3A 4HLZG 3VXSD 4DKDC 1I9RL 3O6FD 1CFNB 3FTGA 1V7MH 1ULVA 3BH8A 4JO3L 4OZFH 4HUWB 5EBWA 2AXFA 2MCG1 2AK1L 2FECL 3GZKA 1W8OA 3BP5A 4U05A 4U1MB 4JVWA 5T1LA 4XNMB 3FO2A 2GAZB 1R3JB 2VLRB 3L6FB 5DD1L 5AYQA 5KSAC 1MAKA 1FVCA 1VESA 1VEMA 2DQCL 1G7HA 4IOSD 1A9EA 4XNYL 1V5JA 3MRNB 3X3FH 4FFZL 4OLWL 2CK2A 2EDNA 5EOCJ 4PGZA 3PL6C 1RK1B 5IK3B 2GY5A 4YO0A 2PYED 4JHAL 4X99B 4YUEH 2VOTA 4ZS6D 1FZOB 4TTDC 4CMMB 2ICWI 3AB0B 5F8QC 1YPZF 4XC1H 2IADB 1JBJA 4G8IA 5FYLD 4MB4A 5GRVL 5KSAA 3FQXB 4WFFD 4HWBA 4M1GH 3U82B 1JWMB 2CRZA 1ONQA 4LPWA 5LGHL 2YUXA 2UYLA 2P8LA 3DSNA 5TGBA 1FBIH 1ZHNB 4NQSB 1H5BB 2EE2A 2I25N 2P24B 4C83B 4KJYA 1G0YR 4GUPB 1A3LH 2OS7A 3H8NA 4NO5B 4RQQA 5C6TH 3JTSB 3K2MC 3D39B 5JR1H 4LVOB 4LVHC 5ITFA 4JN2A 3QO0B 1S9WB 4UIMB 1MPAH 1J5OH 1NC2B 3MGOA 1BF2A 2O61B 5DI8A 2VERN 5D1QC 3QEQD 1OGAE 1PX4A 1KN4H 3O6KL 2XICA 4KXZI 3GSNH 1PY4A 3QNZB 1FGVL 1N2RB 4ZSOE 3QRFM 5CLTA 1KC5L 1XR9B 2N4IA 1BBJB 1DN0B 3PP4L 2WINB 5KAQF 1X5JA 3GBLA 1C5BL 3GGWB 2GEEA 1E6JH 2DQDH 4KQ3H 5E2UH 1N3NB 1CFSA 1FL6A 4TN9A 4P2RD 5IW3A 5D2LE 5EFIA 3UTPD 4N5EC 4PJCB 4J4PC 1ZVYA 4GXVL 2HYMA 1I3VA 4L29B 4DN3L 4HUVA 1KPUA 4ZXBB 4TVPL 3O2DH 1JK8B 1XMWA 2X4NB 3ULUC 1G7MA 5DMGD 2JELL 3ZKSD 2BMKB 3S8WA 1IGTB 1MJ8H 5ID1A 2QTEA 4JM2B 1U42A 4MNGB 5EZJA 1KCUL 4K7FB 2LE9A 4KRNA 3QDMD 3H0TA 4HGKC 5JXEC 1OLLA 4X80L 2NXZC 1IL1A 2HP4A 5FGBC 1HH6A 4LLUB 3NIFE 5C1MB 2PW2B 3MLXH 3B2UD 4Z0XB 1HILA 1CGUA 4K7PL 4NQDD 4ELMF 1RUKL 1LEKB 1XGYL 4J4PA 5I73C 4HSQA 3QSKB 1F02I 4L9LC 4KK6C 3T77A 4NKDB 3TBYB 4NT6A 2OP4H 4YXLL 2X4QB 3O8XC 5FFLA 4I3GA 4PJDA 1OD7A 1ZGLB 4GBXA 1MI5D 4KWUA 6FABH 4XP6H 4KK5D 4HGMA 4GRWH 5JXEA 4GKNB 2OTUB 5I16B 3C9NB 1FG9C 5K9JH 1IAOB 1FGNL 5GGVH 3MRDA 2X4OB 2V2XA 5IQ9B 3ESUF 3WJLC 1PAMA 4UDTB 4RGMC 3TBTB 1FV1B 2FYYA 2EIBA 2VDPH 5B3NA 4M7ZC 4LVNB 3FN9A 3WXWL 4HHAB 4L9LA 1KB9K 3VWJB 3BKJH 4OLUL 3P0YH 1OSZB 1S5HA 4L3EA 3O8XA 4EVNB 4WHDA 1AFVH 1NMBH 3G6DL 1N64L 4HKZA 4JO2L 3V6FA 3O6LH 4FXKB 2DOCA 5FYKD 1J0JA 4YR6A 2VLKB 3OJVC 4NNPH 1PVHA 3HNSL 3M1BB 2DYPB 5E8NA 5BXFB 3GRWA 5KN5A 1UZ6E 2HJLB 3HR5A 3Q6FA 2FATH 4TQEL 3B9KA 5DWUL 1BD2D 3X12A 4JRYD 1MAMH 2BXZA 4G42A 2NZ9D 1WIUA 1AI1H 2M2DA 3RVVC 3KJ6H 4S1SH 4NO3B 4Y19D 5K9OB 4PBVC 1A2YA 2EKSA 1E4XL 4MXQC 3WDHA 5EC1B 4I5BB 3BGMA 5IVXA 1A6VH 1QSEB 6CGTA 3HE7D 3G6JF 1VFUA 1RZGB 4KK8D 1WBXB 1QHPA 4XPHL 4EBQH 3MLTB 4YHNA 4DWHA 4PS4L 3T0EB 3CMOH 3DYMA 4JFXA 3VFVB 3WLWC 1PX3A 2Z8RA 1ZHKB 4WEMB 1A22B 1CFNA 1KCSL 4NZUH 4PP1D 4ZPVB 4JJHA 3V2AR 3DMMA 4KDWA 1OM3H 4HUWA 4Q9CA 3AB0C 3EYQC 3CPLB 3MXWH 4KI5F 4RRPA 5BV7L 5SWSD 4I0PD 4U1MA 1G7QB 4XNMA 3VWKB 1R3JA 2BY3A 1MLBB 2VLRA 5DEGB 2HTKC 1HN1A 2B0SL 4XCNA 2VZSA 2VDLL 1H3VA 3MNVB 5JHLH 4RWYL 1CT8B 3VW3L 4RBPK 3B9EA 4QOKE 4UIKL 4YNYB 4K8RC 1TNNA 5HHXH 3S88H 4ZFFA 4MAUH 1IQWH 1ACYL 3U9UB 5EUOF 4LVOC 1N7MH 4E41E 4X99A 5CEZH 3BDYL 3L5XH 1MF2L 4JKPL 2JLLA 1FZOA 4OGAC 4CVXB 2HFTA 2R29H 1RZJL 1CDHA 1DL7L 2IADA 3QEUB 1NBZA 5C0GB 3C6LA 4H5SB 3FQXA 1SYSA 1JWMA 3IF1B 5EIIB 2J6EL 4ZS7H 4PRIA 1CD9B 2QJDA 1SY6H 3PP3K 1JNLL 2NYYD 4LNRB 1ZHNA 4M6OL 4GRWF 2DJSA 1NSNL 2P24A 3FRPG 2BDNL 2J5LC 4PB0L 2FJGA 5F9OH 5LBSL 3V7MA 3JTSA 5C2BL 1OY3B 3D39A 4LIQH 4OLXH 4X7SH 3RKPA 3VXME 1F3DH 1OOAA 3QO0A 5JW3L 2C4FT 5C6WH 5TE4L 1NC2A 4FFWD 3ZE0F 1NFDF 4HFUH 5GS0L 2O61A 3EHBD 4ZXBC 4LKCB 3P4OA 2X4UB 3ARDC 5E6IB 1YY9D 5EIQA 4S1DD 4N0UE 1N2RA 1PDKA 1XR9A 4ZDHA 4MXWH 4JM2C 1ZMYA 1DN0A 4NQEA 2ZOKA 2WINA 4D2NA 4G9FE 2R0ZL 1OTSC 2H32H 2HMID 5JIHA 1BP3B 2ZSWB 4D0CA 1XAUA 3WFZA 5CHNA 3W0WA 1N0XL 1A6WL 3RQ3A 2RCSH 3PE9A 4AH2B 3MUGB 3GI9H 3QCVL 4PJCA 2IPKA 1T66C 3LSOB 4G6KH 3WS6C 3NFSL 4JVPA 5CP7A 4YPGA 1QSFE 5L8JB 4NQCD 5TF0A 1JK8A 3ARDA 1IAIL 5HI3C 2GUOA 5A1AA 3IDXH 1KEGL 4IIQB 4XGZB 2BMKA 1UXWA 1IGTA 3QDGB 4F8QA 3IGAA 4NFDA 2JCCA 2MHAA 1I9RH 4JM2A 3NTCH 1EEZB 4K7FA 3FO1B 2R1WB 4MNGE 1G9EA 4RMVA 4XVSL 5DDHB 4LLUA 5I1GH 2AK1H 3NCBB 4Q58C 5BO1L 3GO1L 3FN3A 2WLYA 1GIGH 15C8L 3AMLA 2PW2A 2BNUA 3A6CL 5DD1H 4Z0XA 5CJBA 3RPKA 3N1MC 4MJIA 4DAGL 3WS6A 4LVNC 3VWJC 3WBDA 3TESA 4DJMA 1MFBL 3TBYA 4M6NL 4XNYH 3ZSTA 1CVSC 3BESR 1HXMA 4FFZH 4OLWH 2X4QA 2A0LC 2CPCA 4X5WA 5KVEL 4WI5A 4GSDH 1JNHA 3DX8B 1P84K 5C0BB 4JHAH 2JE8A 1EDQA 2CXKA 2Y4SA 4GKNA 4H0GA 1IAOA 3RVUD 5IQ9A 4JANB 2WNGA 2MPAH 2PNDA 4G8GD 1FV1A 4W6XB 5JQ6L 1AY1L 4WUUE 5GHWH 5INDB 5LGHH 3EGSB 3VWJA 2YZ8A 4CRPA 5CSGA 1UYWH 1OSZA 1MFAL 2IC2A 4KDVA 5D7SH 4BSWB 1U58B 3MSPA 1P7QA 4EVNA 5DK0B 2NLJA 1FO0L 3DVIA 3RZCB 1NCAL 2OM5A 4FXKA 1N4XL 5MHSE 3F12B 1P4LB 3GMMB 43CAB 2VLKA 3HRZB 3M1BA 2DYPA 2LV4A 2WK2A 4JFED 2GFBA 2OR9L 5BXFA 3VI4E 2BNQE 3UP1A 3O6KH 4NJAL 2HJLA 1FGVH 1KC5H 12E8H 4S1RL 5H37H 1JPGB 4FQXD 3BMVA 4S1QH 5A2LH 1J86A 3T0EC 4X6DB 2R2EA 4XT1C 1RZFH 4HXAH 5T3XD 4NO3A 4S2SA 5K9OA 3RVWC 3T0VA 5EH1A 5EC1A 4I5BA 1QSEA 3K7UA 3LS5L 5BS0D 1WT5C 4GXVH 4DN3H 3CVHB 5JNYA 4KJWD 1RZGA 1NCTA 3KPRB 5DLMH 4TVPH 5FGSA 3H6JA 4LEOB 5A16B 3SE9L 1QLEH 4NZTL 1CWVA 3T0EA 3RY6C 1L9MA 5DEFB 4WW1A 3VFVA 1ZHKA 4YAQB 4ZUWB 2YSSB 3RTQD 3DVNA 3VFGH 2W38A 4HIIB 1YPZB 4YQXL 4FZ8L 3CPLA 2XY1A 1WT5A 4K7PH 3B3IA 1OT1A 3KXFD 3FHQA 5DEGA 2AABL 5IR1A 3SKUD 2PF6A 2MCPH 1ODAA 3LN9A 2E8YA 2MWCA 2X4TB 3WSQH 4RRPG 2C4FU 4UNUA 3QULA 4HIXL 3RNKB 1HH9A 2AJVL 3DSFL 3MNVA 4YNYA 3RY6A 2ZUWA 2EIEA 4PRHE 5CZVL 2CGRL 4JCMA 4YHKL 3H9YA 2AAVA 5GZND 1FGNH 2HWZH 2IAND 4EEEA 1TTUA 1G7IA 5TDPB 4UINH 2X6MA 3GMLB 1U3YA 3VCLA 4OZGA 4QGYA 3VXUE 4JY6B 5E6IC 2HT3C 5C0GA 4OLUH 4H5SA 4DOHE 3WLBA 2ZNXA 3IF1A 5EIIA 4JM4L 4LNRA 4LSRH 1JFQH 4JO2H 4PTUA 3BIKB 5FIEA 3EYUL 1MCJA 2XN9D 3HNSH 4PJXE 1T1ZB 5FDWA 4KKCC 4NGHL 2ESVE 2JKXA 1GC1H 2R4SL 3DJ9A 4KTDL 1A7NL 3WDJA 1KTRL 1X4ZA 4TQEH 5DWUH 2X4UA 2P43B 35C8H 2P7TA 3QISA 3BXNA 4IIQC 1D3CA 3PDOB 4G7VH 4PG9A 5HSFA 2XZCL 4Z7UE 4CBPA 3VDBA 3QIBD 1E4XH 3D0VB 3RWFB 5IJVB 3QXAB 3WHE1 2ZSWA 2P45B 2GQHA 1DVFB 4AH2A 5C0DB 1XGRB 1T7YA 4X9HA 5FV1L 1BZ7B 2BVUA 3OKEA 4BUHA 4G6AD 1CBVH 2I27N 5DUPL 5I1EH 2RGSA 4MCZB 1A21A 4XGZA 2YUVA 2ADGB 3QDGA 1CI5A 1KCSH 3IDIB 1CZ8L 3SJVB 5DMKA 5I71B 1EEZA 2DM4A 3FO1A 3MRMA 2R1WA 2Y5EA 1I1AB 3MMEB 1XIWB 3I3DA 1EZVX 4PRAB 4X6BB 1EIBA 5GSRB 5BV7H 3CSPA 3BX7C 4PJGA 1CDYA 4KHXH 2CDFB 2VAAB 4M6AA 2B0SH 5DJ6B 2WBJC 3HUJB 5KSAD 3VW3H 3MOAH 2APTA 1BQHB 2EEDA 3DX8A 3B5HA 2XIDA 2ZPKH 4QY8A 3RZCC 5C0BA 2J8HA 1YEGL 2DWEA 1FFRA 3BDYH 5C07A 4POYA 3EUUA 1C5CL 4XWOC 3PL6D 3BSZL 5SX4H 2OL3L 1RZJH 5J56B 1DL7H 4JANA 4J3UA 3GMQB 4PJFA 4TTDD 4XPAH 4V1DB 1S7QB 2NY5H 4MNHB 4S0SD 2WBJA 1H3XA 3BKYL 5ISZB 2G2RA 1JNLH 2WMPA 2VYRE 4BSWA 1NSNH 1U58A 5BMFL 1K3IA 4PB0H 5LBSH 3VFNB 3D25B 3RZCA 3G6JB 5FKAA 3PWUB 1HKFA 4CDGC 1DUZB 1P4LA 3GKZA 43CAA 2BVOB 1WICA 4ODVL 1N0LA 5GS0H 1EUUA 1JPFA 3TP4A 2AXJA 3BHBA 7FABL 3C2AH 3OAUL 5DR5H 2EKJA 5FUOL 1DE4B 1JPGA 4AG4H 4KUZL 3CFIC 3O11B 5D1QD 5DQDL 5JHDB 3LEXB 3G5YA 4X6DA 3QUMA 5E94A 2YXFA 1KFAL 2R0ZH 3DGGA 3TV3L 1NGZA 3P30L 3LHPL 4F37F 3JBG7 4QRPB 5KW9H 4M1CC 1N0XH 5FYJL 4EJ1C 4OCNC 3GSUA 3OZ9H 2VRAA 4TSBL 2E6QA 2CMRH 3NFSH 4C56B 4M9OA 2X1WL 4ZUSB 4QCIA 1IAIH 3QUXA 4N5ED 3T2NL 3O0RH 1KEGH 1K5NB 1IKNC 4J4PD 2AV1A 5AG9A 4O5LL 3FQNB 2MQCA 1CD1A 4ONFH 1HHIA 5ENWA 3TH3T 3BGFB 3ULUD 4RFNB 4RBPH 4X4ZA 4U3HA 3KYNB 2W9LA 2VZ1A 4ODBD 4WU5B 5EUOB 5DEFA 3KPQA 4P2QB 5H35B 3SE3C 1JPTH 2Y07L 4YE4H 3AUVA 1TCMA 2YSSA 5KG9B 5JDJA 5BO1H 3GO1H 2EDJA 1GAFL 5ABDE 3WFDL 3A6CH 5JXED 3ARGB 1IGYB 2NXZD 4KGJA 1UGNA 3L5IA 1KBGL 4DAGH 4LBEB 1ACZA 4KGLA 5I0DA 3MLZH 5HPOA 4JFZL 1KLUA 2DL2A 4M6NH 4L3CB 4PY7B 4YFLF 3VG0L 1IKNA 5IQ7H 3RNKA 4U1LA 1MHEB 4KK6D 5KVEH 1R0AH 1IGCL 4P9HL 2OK0L 1RHHB 3O8XD 4L3ED 4YHMH 4U4BA 4ONGH 1B0RA 2W07A 1SVCP 3IFNL 3EO9L 5F71A 3X14A 3H7BA 2YWZA 3GSVA 4HUNB 1KIQA 4B5EA 3WFBL 4XPGL 1NFDB 1YZZA 2FB4L 2J88L 2Y25A 4TNVF 2ZOLA 5TDPA 3FZUC 2D7QA 5JQ6H 1AY1H 1UB5B 4JY6A 2AJ3A 3SKNB 1DSFH 1IC7H 1MFAH 5DGQA 4BQBA 1UJ3B 3MUHL 1DR9A 1XF2B 1NDGA 1RIHH 4LCIL 1FO0H 4HQQL 4KVCL 3D3VE 4LRNL 4AIOA 2F54D 2VLLB 5EC2B 4YDLB 2BOBB 3BIKA 1DVFC 2YD8A 1T1ZA 1MCEA 2HJFB 1R3KA 4D9QD 1N6QH 4OD1L 4L5FL 1SMAA 2GJJA 3BT2L 2XA8L 1OQXA 3TPUB 4A6YH 4HD9A 3V4VL 4PJ5A 3DUUA 1KN2H 4HKBB 4XMLL 5I8OL 5BOZG 5I71C 3H42H 5F3BB 3L1OL 1I1AC 1I8KB 5IJVA 3LVEA 5EO0B 1XIWC 3RVVD 3QXAA 3ZT5A 2IH1A 5FYLL 4MXQD 1MQKL 1DVFA 1BZ9A 1LK3L 4PJAA 5C0DA 5FHAL 5HYFA 4JZJB 1T7XA 4LQFH 1QFWL 1IBGH 4MSWB 1BZ7A 4PY8I 4YFDB 5DURB 4ELME 1S9YA 2VWEC 3TT1L 4L4VA 4NZTH 5HVGB 4NWTL 2VLRD 1JGVL 3L5HA 3C8DA 2H2SC 3QPXH 1INEL 1QHOA 4MCZA 5BZWB 3D48R 2ADGA 1RIVH 4ZO7A 5D93B 4YXKH 3QUZB 2JK5B 2VXTL 2QR0B 5DVMA 5FUCE 3QXTA 1YEIL 3IDIA 3QFJB 4OCSL 1OQOA 5FGCB 2EH8L 3G5VB 4N8VA 3MMEA 1XIWA 3KPPA 3WLWD 4YQXH 1FPTL 4X6BA 3SJVE 4OM0L 2AV7A 1RFDL 2APXA 1NCDL 4A2LA 4N0CC 3BD5A 4NUGH 2B4CL 1SYVB 3EYQD 3P4MB 2ICEB 4RX4A 2R39A 3HUJA 1EBAA 2HVKB 1GGCL 3PWPB 3DSFH 3SCMC 2CIIB 1CF8L 4X7CC 3OB0K 2HTKD 4PGJA 5EBGA 2JJTC 3BRDA 1BQHA 4WGWB 1HSBB 5CGYC 3BZFB 2YA0A 5BVPL 4LLAA 1F4XH 5CZVH 1TVBA 4NJ9L 3HMXA 5DRZB 4HF5H 4FOMA 4K8RD 2CLZA 1AQDA 4GW1B 4LHUB 3RGVB 1T0MB 3D39D 2KQNA 2WZPD 4Z77B 5IOPB 4TSAH 1UVQA 3GMQA 4OGAD 4FTVE 1A7PH 1FE8L 2E9BA 1NC2D 4CN6A 1I1FB 1S7QA 4JM4H 3E3QE 1KYOJ 5D7JC 1SJXA 1M71B 5ISZA 3SCMA 4DKFH 1B0GB 2HH0H 4JKKA 4TUOB 4X5XA 4V1DE 3JSSA 4XBGB 2JJTA 3QBTB 4M7JL 3TIDA 2JF1A 4O58H 5HYSB 2QL1A 5E5UB 4NQED 3D25A 3ABZA 4KI5C 3V6BR 1U91B 5TF1H 4KKNA 2ZP0T 2IQ9L 3OMZA 3PWUA 1RUQL 4NGHH 5LGJB 3IJYB 1FNSH 4KTDH 3PGDA 3T65B 3G6JE 1A7NH 3B5GA 1NAML 4H1LA 4FNLH 1GSMA 3K2UL 1VKXB 2DDQL 3BRFA 4ZXBD 5JHDA 3O11A 3VXRB 4NRYA 3ARDD 3BGFC 4JDZB 5D7JA 4RFNC 5K93A 3LEXA 3NCJL 5IM7A 2ITDB 3ZE1E 4GMSL 2A77L 4JM2D 3GFUA 4QRPA 3UX9B 5F7FA 1OTSD 2NXYB 3GUTA 1AO7E 1DLHB 2F53E 4ZUSA 5J4MA 4PJIE 4TUKL 2NPLX 3I50L 4U1NB 4RGOL 1T66D 5CKGA 1K5NA 4MJID 1FNGB 3GHBL 3FQNA 1NFKA 1IMHC 4XBEL 5HI3D 1KJ2B 2HFFA 3KYNA 4XP1L 4WU5A 4PLOB 1FYTB 1J1PL 1XCTA 4BZ2L 2YRZA 5KG9A 3QHFH 1U3JA 5L2KE 3RJDA 2Q8BH 4LBEA 3VD5A 2BCKB 3RGHA 3V79C 1L9NA 3CUPB 2AS5M 5ICZB 1OL0A 1ORQB 1F4WH 3CXHJ 4L3CA 3O4LA 1UKQA 4P2YA 1UJ3C 3VWJD 3VXTB 4S10A 1HZHL 4GRWE 1YEGH 1N59B 3F7VB 4J8RB 4YDLC 2Q3AA 2A0LD 1C5CH 1HE7A 4ZFGH 5C3LD 3BSZH 2Y36L 3EZJB 5FYKU 1IILE 5I1HL 2FBJH 3LRHA 2Q76B 2VLKD 5HYJB 3ZE0E 2NTFB 2DYPD 5D7IF 5BVJB 3BP7B 5T5FH 3K4DA 4FXGA 3SKNA 3HI1A 4JFHE 2VSCA 4MD4A 3QI9B 4GXUN 1F2QA 4HC1L 4LSPL 3ULSB 3T08A 1RAMA 1UJ3A 3HZVB 3HAEH 1XF2A 1FH5H 2XTJB 2VLLA 5EC2A 4UT9L 3HMWL 4NOFA 2BOBA 2E7BA 1KJVB 2D03L 5I1KL 3WO4B 1QSED 2W0FB 5JW4M 2FX9L 2XPGB 3OV6A 4KY1L 4MA8H 2E7LA 2XG4A 7FABH 1WAAF 3UTZA 2YK1H 5ALCH 5FUOH 1J88A 4UTAL 1FDLL 1AXTH 1P7KA 3O6MH 3BPNB 1HKLL 3P77B 4I48B 4APQA 2M8XA 4C4KT 5D93C 1KFAH 1JHTB 4HKBA 3TV3H 3P30H 1KLFA 3T0ED 5F3BA 5C09B 3NCCB 4BH7B 1I8KA 1UKTA 5IB5A 5HDOA 4PP2B 3FFCE 3RVWD 3RA7L 4TSBH 4QRSB 4WCYH 5IMOB 1NANI 4JFDB 5B38B 3DO7B 4MSWA 1MCHA 4M4RA 4OUUB 1OGAA 5B8CB 2GY7B 3IKKA 4OZHE 5ADOL 4ZSOA 3CFJA 3C5JB 3Q0HA 4B7IA 5BZWA 4L4TE 1KTKE 2LABA 3MV7E 4HFWA 3MOQA 3PXHA 5I30L 1JYWA 3IT8D 2VLJE 2JK5A 4LHJB 2QR0A 2WANA 3LV3B 3QFJA 1GJIA 5E95B 3EDFA 3S6CA 3G5VA 1GAFH 5DJXB 4IHOB 3WFDH 1LK2B 5D2LA 1KBGH 4WHCA 5F9WC 3MLYL 4N8VG 3AAZB 3I6GB 1UEYA 3TN0A 2DQFA 3NBNA 1DQJB 4KPHL 3UBXG 2W1NA 4NM8L 1I3UA 3PWPA 1P6FA 4R7DA 3OKKB 5E8OA 1JGLL 1AH1A 3CMGA 2FX7L 5ETUB 1HSBA 4JCLA 5CEZE 2F8XC 4G3YL 1W8NA 1HK6A 2MTPA 3AGVA 5ILTH 3EO9H 4W4NA 4GW4B 1FVEB 2R0WL 4BUGA 4XPGH 2G60H 3CSBA 4GW1A 4WFHD 3VG9C 4LHUA 5IB4B 2FB4H 2EDHA 3G9VA 3IDNB 4F33A 3MNZB 1I1CA 1TZHB 2YPKA 4DGVH 2LU7A 3P9MA 3DETC 1NGPH 5SV3A 1I1FA 3IFOB 1FFOB 4MHHI 3VFRA 2P5EB 5E6ID 3RI5K 1FIGL 2HT3D 2EE6A 4RA3A 4LCIH 4LRNH 4HQQH 1B0GA 5E8DL 4XBGA 1MWAL 3KR3H 4LIQE 3TNMB 5HGDB 1TZIB 4OF7A 1EFQA 5HYSA 2GW5A 1INDH 3ZKMC 1U91A 2NXYC 4D0DA 3MLUH 3NZ8B 5F6HI 5LGJA 3IJYA 1B2WL 1YEDA 3DX9B 4KKCD 1FVDA 2VDQH 5JXAL 1MOEA 1TDQA 1G6RA 1OSPH 1VKXA 3V4VH 2P46B 1G9MH 4QNPF 4JDZA 4XMLH 2B1HL 4PUBL 3K3QA 4XXCC 1OAZL 3ZMRA 4H1LG 3C5ZA 2ITDA 3QDGD 4KDTC 2B2XL 3K46A 3P4LA 1N5AB 5HI4C 3WDIA 5E70A 2QQNH 3F58L 1F13A 4PLKD 5FYLH 3C87A 3OAZH 3HN3A 3GMPB 2I9LB 3BKML 4U1JB 1DLHA 2I5YL 3TT1H 5L2JA 3IKCA 3SGDH 4U1NA 4JO1L 3A67L 5ADPL 4O02L 2DBJA 5FA3B 1G6VK 4JDTH 4OV6F 2VXTH 5F89A 4AT6B 5BV7B 2COQA 1KJ2A 1YEIH 4XXCA 3A6BH 1EERB 2EH8H 2ATKB 1FYTA 4JREB 4Y4FB 4KDTA 1LO2L 4R4BA 2ARJQ 4UTBH 1FPTH 4OM0H 3CDGB 1MVFA 5C0BD 3KYKL 1NCDH 2H1PH 1JMXA 1K2DB 4HEPG 2VXVL 2WUBH 1VADA 5IHZB 4BZ1H 4Z7WF 1T04B 4NZJA 3EDKA 4DFHA 2BCKA 4LK4A 2EDWA 5ICZA 3KPLB 1GGCH 1MCPH 4JFPB 5T3XL 3QI9C 1A6ZB 2DLGA 2IPTL 3HZMB 1S7WA 5BVPH 3VXTA 2WBJD 1LO5B 1X5LA 2XTJC 2IBZX 1BJ1H 4NJ9H 4KJQC 4XWGL 2G9HB 1UFUA 1P4IL 2DBLL 4LLDB 1MCIA 3RZCD 1U3HB 3WO4C 3MZGB 4EXKA 1JTTA 3PWNB 2XZZA 3PHQB 4XWOD 5HYJA 1U93A 4OQTL 5E03A 3IDGA 5BVJA 1J0IA 4OD2A 4RIRA 4YEFA 3TNNB 3BP7A 1T6VN 4ODWB 1ZKAA 3BPNC 4D9RE 3CLEL 5ANMB 4X6CB 1FP5A 3ULSA 2XQYG 4M7JH 2HA1A 3HZVA 1RJLB 3LMJH 1FFQA 4JGMA 1RIUH 3H3PH 3MBEB 4N0RA 1OP5H 3RWHB 3MROB 4GS7B 2LFGA 1MELA 4E41A 4M43L 4JVUA 4OUOA 2CXGA 3UTTE 2BY2A 2W0FA 4OCXL 5T1KB 4JFYA 2XPGA 1NAMH 2BSSB 3LKOA 3K2UH 4F7PA 5B8CC 4ZFZB 3KPRD 3P77A 4PJHF 3NCJH 1HIMH 4I48A 3ARUA 3VMNA 1CGSH 4GMSH 2RFXB 1MCRA 3Q48A 1N6UA 4G9DA 4NP4L 2VKXA 3MOBL 4KTEL 1U8OA 2APVA 4BH7A 1UENA 2PW1B 1OGTB 1SJEB 1IFHL 4PP2A 5FOBB 4OV5B 1R3IH 4TVPE 4GW5A 4QRSA 4J3TA 5DA4A 5IMOA 4JFDA 5B38A 4M1CD 5CUSH 2CRYA 4R0LB 2G5RA 2BP3A 3I50H 1JWSB 4U3CA 4OUUA 2Z4QA 3K1DA 5B8CA 3GJFH 4LHQB 3HLAB 4ZOCA 4U1KB 1B6UA 3CVIL 3C5JA 4QXUL 1RURH 5FYKH 4XP1H 3JV4B 1AGEB 5EDXA 1RUPL 3X13A 1YJDL 4MD5B 4MS8C 2DB8A 5T1DL 4LGSB 4LF3B 1QBLL 4BZ2H 4FQCH 2VH5L 3X11A 5E2JA 2WWMC 1H8SA 4EIGB 3FFDB 3LKQB 4JY5L 5ESVB 4W81A 5DJXA 4IHOA 2QLVB 4CADA 4IDLA 1P1ZB 3QT2A 1QFUL 3MRPB 1BFOA 1FJ1B 4IJ3B 3S5LB 4EI6A 5TDOB 3AAZA 4FMKA 1J10A 5ICXA 3WS3A 3BPOB 1HZHH 3PNWA 1N5YH 3QA3B 2AK4B 1WGOA 1Q94A 2AJXH 3LQZB 4LAJH 3OSKA 4CN4A 4AEHL 4OZIF 2GTWB 1GZPB 1EHXA 5E99L 4GW4A 1QLRB 1CR9L 3HS0A 2V9RA 5IB4A 3SQOL 5EU6B 2VL5A 1VFAB 3MNZA 3G04A 1TZHA 4CVWA 4K07A 1J8HB 2VXQL 4MA7L 3QXVA 1V7NH 3IFOA 1FFOA 3FZUD 4GOSA 3DBXB 5F21B 2YPLE 4LSPH 1JIBA 4JPWH 3QNXB 4M62H 3QNYB 2PO6B 4PJ5D 4UT9H 5F1OB 5F44A 4N8PA 2Q6WA 3JWDH 1TZIA 2DKMA 4K23L 5DFWH 3LOWA 3TYFB 2D03H 4QXWA 5F88B 3UCRA 3ULVC 3UJTL 3VRLF 2FX9H 1K6QL 2XQBL 3L3IB 5DJ8A 1DVFD 1K8IA 1RZ7H 1T80A 3DX9A 1P69B 1FDLH 4HWBL 5CIPA 1IC4L 3VRJB 1U8NB 4WUUA 1HKLH 4GG6B 4DVBB 1HYSC 1KPRB 1PGRB 4HIHB 4L4VD 4KRLB 4UOJA 2VISA 5FM5M 4JREC 2OSLA 3UZVB 4Q6IB 1U8MB 2XKSA 1NDMB 1I1AD 1I8LC 1XIWD 5E9DE 5CLWA 3GMPA 4D9LL 1FFNB 2BNQA 5ADOH 4QT5B 3QHZH 4ODXB 3TM6A 3VGEA 1GGUA 4RX4D 1F5WA 4G80B 3M45A 5I30H 1G84A 1T6WA 1YNKL 4O2CB 1QG3A 4D3CH 2H2SD 4MZ2A 1K9TA 2DJ4A 4WFGE 3MRGB 5DD0L 1MEXH 1ETZB 3PV6B 1U8PB 4M03A 4ETQB 4YDVA 4LCUA 3N9GH 1K2DA 5D7IB 2NY3C 1I8LA 4HLZH 2DIAA 4IRSB 3RDTA 3VRIB 1L7TL 1X5IA 3QUYB 4U1IB 3C5SA 3FQRB 4N0CD 4KPHH 1EJOH 4PJ9B 1XF3B 2FECI 3KPLA 4NM8H 5DHVH 3DV4B 1A6ZA 3ILPB 1UEMA 1DBKH 4RGNE 2X44D 5IVNA 4KZDL 1NLDL 2PR4H 4G3YH 2E5EA 1MRFH 5ISZD 3SCMD 3T09A 3MBEC 1MCBA 3P40A 4DQOH 4GS7C 1LP9E 4QGTA 5CGYD 2V17H 4HT1L 1FRGL 1HNGA 1BVZA 2H41A 5KVGH 4DGYL 4PJ7F 1S8DA 3PWNA 5H94B 3PHQA 4TUJA 4OF5A 1YEJL 4M5YH 2WQRA 3CK0H 5HHOB 3TNNA 1MY5A 3OKNA 4ODWA 1FIGH 5D7KE 5MP6L 2HTLC 5ANMA 4X7FC 1N6VA 4X6CA 3D2UA 5E8DH 5HDLA 1W0WB 4OKVB 1F3DJ 5JHDD 1IKFL 5D7JD 3MBEA 4P4KB 2O5YL 3RUGE 3RWHA 3I6LD 1I75A 4WI6A 2FH8A 4QRPD 1HDMB 4KI5D 4UOW1 4PB9L 4R0LC 5B39B 3LPGA 2CUHA 1PZUB 1U8KB 3VXUA 1ZT1A 4DEPB 5JXAH 4C56D 4KXZH 4JHZA 2XACC 3RVXC 1T7ZA 1OAZH 4DVRL 1PJ9A 4X4ME 2RFXA 1MCQA 2G5BA 2MOVA 3TYGL 3QIUA 4NDMB 5C8JB 5C0CE 4P2QD 3MFFA 3ROLB 4X4YB 1SJEA 5FOBA 4OV5A 3MO1A 3UDWC 2R1XB 4PJXA 1EMTH 3GRWL 2ESVA 1J1XH 3BKMH 5C08E 5C0AE 5C70A 2HFGL 4R0LA 1CFTB 1RULH 5EORL 1JYNA 5E2WL 5ADPH 4KHTL 3O9WB 1YYMH 1P6AB 2E7CA 3LQAC 3H7LA 4YHZL 3BPOC 3HLAA 4FQHB 4H25B 4U1KA 4N9GB 4NM4L 3JV4A 3O4LD 3L3DA 2VZVA 4Z7UA 1NEZB 4MD5A 2I60H 3LPWA 5LWYH 3MV9E 2ZCHL 2EE9A 2NW2B 3UPRB 3FFDA 1OAKL 4JRWA 1FZKA 1QA9A 3QXWA 1P1ZA 3CXDH 5JO5B 3U79A 2MFNA 1CN4A 1P5UA 3S5LA 1OB1B 3C6SB 1DBJL 3PIQA 3WNPA 3NAAL 5T3XH 5J6HA 3U0WH 4U0RC 2IPTH 5C3TA 3WUZA 1G7JA 1KENL 5FXCH 4YXHL 2OL3B 3MLWL 4KV5E 4JFQB 1MJ7L 2PO6C 3QA3A 2AK4A 4F9LC 3LQZA 4P3WA 5DRWB 2BVTA 2GTWA 3ZSSA 1QLRA 1NQBA 2Q87A 4WU7B 4PRDB 5EU6A 1VFAA 1XF5A 4Z8FL 4Z5RA 4WI7A 5DTFA 4YX2L 3H9HA 3U36B 4U7SA 5KANG 3CLEH 2RIKA 3MV8B 3DBXA 2OZ4L 1XZ0B 3IU4L 5LGKA 5IHUL 3OXSA 3QNXA 1H3GA 1F3JB 4L8CA 3U9PH 4QRRE 4F9LA 3BN9C 5KANI 3ORJA 4Q6IC 1PLGL 4M43H 4F57L 4QKXB 3TYFA 1U6AH 5F88A 3WKML 1FNLA 4KQ4L 5EOQL 3LN5B 4G6ML 3U4BH 3L3IA 5F9DC 2HVJB 4M9PA 3K80A 4L8SC 1OARL 1Y0LA 3VRJA 4GG6A 5EBMA 5DURD 5GS3A 4DVBA 1KPRA 1YMME 2B20A 4NP4H 1MFNA 1IC5H 3CLFL 4K8RL 3MOBH 4KTEH 3QIWB 2VDOH 3V7AE 3J7HA 3MLPA 3P11L 4N1HB 1IFHH 2GKIA 4YDJB 1U8MA 2JB5L 3QFJD 1H8NA 4Z7WB 4YIQA 5TJWK 1H0DB 1J1OL 1NDMA 1ZXQA 5FO7B 3GJEB 4IRSC 3QUYC 3FAWA 3MA9H 1FFNA 1PSKL 2IPUG 4X9FA 4L8SA 2XXMB 3GI8L 2KDGA 5DJAB 4QT5A 5FAAA 1QPPA 3CVIH 1ZHBB 4P5TB 4ODXA 2IPUK 4HS6A 1YJDH 5GGVY 1QBLH 3PWPD 4LVEA 3CCHB 2VH5H 2GSIB 1W0VB 4K9EC 1F97A 2FDBP 3QQ4B 3FB7A 3SDDA 5IHBA 2AJYL 1ETZA 2R1YB 1QFUH 1X3DA 5HGGS 4C54A 1KUMA 2VDRH 4LHUD 4IRSA 5KS9B 2Z31B 3VRIA 1KTDA 4U1IA 3ZTJG 1CDIA 2D9CA 3BZ4B 4EDWH 4JGJA 5J7CC 3FQTB 1X5YA 5CEYB 2A9ML 4WWID 2EDDA 3L7EA 5MENB 3DV4A 4ODSL 1YNTB 4QTHB 3SHSA 5CSBA 5E99H 4P4KC 4R4NC 1CR9H 4RMRA 3TWCL 4OF0A 1MUJB 3SQOH 1VA9A 1PEWA 1SEQH 3SDXE 4KZEH 3TF7C 2VXQH 1LVEA 4MA7H 2FJHB 1XGPA 3NCMA 4DEPC 1BIHA 1KPVB 32C2A 2YD4A 2D3VA 4M1DH 2R69L 3LRGA 3DETD 4QTIL 5KJRH 1JGEA 3FO0L 1W0WA 2YD9A 4PREA 4BK4A 3VGBA 4HKXA 1QSVA 2H3NA 1T5WB 3C5ZD 4P4KA 2XWTB 3MJ6A 3UJTH 1IAKB 1K6QH 1MHCB 2XQBH 3K74B 3ZKMD 1HDMA 5DGRA 4MQTB 1JVKA 2NXYD 2BVEA 3MQIA 4FG6C 4HWBH 1IC4H 1S5IL 4JPIB 1KELL 3O9WC 5EO9B 3V5HB 4YK4B 1KLGA 3QRGH 3VH8G 5GZOC 1ES0A 2IBBA 3RBGA 1HHHB 3MRBB 1I8MB 1JRHI 3BQUB 3HG1E 5EULV 3TBWB 3D3VA 5C8JA 1BFSA 4GLRI 1FYTD 4JAMB 3ROLA 3TT3L 4X4YA 3SN6N 1S7RB 4UZGA 5K9QI 3WIIL 4X6FB 3BWUC 4Y1AE 2R1XA 3DNKA 5HI4D 4D9LH 1TLKA 4KROB 3P3YA 3HB3C 1CFTA 2LU3A 2LU4A 4Z9KB 3O9WA 4NN5B 2IWGA 3VXNB 1HXYB 1AJ7L 4F58H 1YNKH 2IH3A 4H25A 1JHKL 4OZIB 5EOTB 4X0KA 1NEZA 5EU4B 1CD0A 4G5ZL 2YN3A 1GGIH 4ISVB 5DD0H 1WK0A 5EWIL 3QJFB 4XH2B 1HHKB 1ZWIB 1KB9J 5DJYB 4K3DL 5A43C 3W9DB