4QCIB

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYISDDGSLKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHPYWYGGQLDLWGQGTLVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
molecule keywords anti-PDGF-BB antibody - Light Chain
total genus 44
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB01
3PP3K 3MUY1 2QQLL 3QWRA 4K8RC 4ENED 1T4KB 5T3ZH 1ZTXL 5GGSY 1CD1B 2AKRB 3SE8H 3I50L 3N9GL 3T3MF 1N7MH 1D5BA 4X6CA 2A77H 2VL5A 4P48A 2KPNA 3A67L 4Z76A 2HFGH 4OGAC 5A43C 4P5KB 4J23A 1LD9B 2V17H 2EDYA 1Z3GH 4LARL 3ARBA 3IJHA 4OUUA 1FN4A 3MV01 5J11B 3U46B 3DUUA 5C0FA 5FB8B 4OD3L 2FZ3A 3GSOA 1MJUH 1OB1A 5GRVK 4DZ8B 1MI5D 1GGCL 4FTVE 2JELL 2W0FA 4DEPB 3QRFM 5I8CB 2FLBT 5ENWB 3HAEB 5EUOF 2X89D 5I71C 5E1HB 4N68A 3IAPA 2GJ6B 4JN2A 2WWKT 2GAZA 3ULSB 5TE4H 1J88A 4ZFGL 1FL6A 4FA8A 2QADB 1CFSB 5IB4A 3QUMH 2ESVD 3C60C 1Q0YL 2IEPA 3RL1B 3FFDB 4IRZL 2CGRH 4FQQA 1ZKAA 5J1SC 4MD0A 1WJ3A 3AAZA 3KJ4C 1J8HB 1REIA 4OIIL 1YY8B 3PQYE 2YEZB 4HKXA 2YK1H 4S1QL 3UZVB 4K94C 3P2TA 3V5HA 1LO5B 1WBXB 3PHSA 3LD8B 4UTBH 1A6WH 3FN3A 1CT8B 4EI5D 3VH8B 3U36A 1KXQE 4OFDA 4R9HA 3RKPA 4AEEA 3FOMB 3RGVB 2EICA 5D7SL 1AGCB 3EUUA 5IK3B 4LLMA 3PIQB 2FSEB 1KN2H 3RVXC 3MRKB 5HHOB 1KUMA 2BVPB 3BRDA 3QSKB 4KRLB 4LLWB 4UAOB 3ZYJA 5E00B 4RCAA 5BRZA 4JM4H 3O9WA 4WEBL 1FJ1B 3AS3A 5GS1B 3QIUB 3QJFA 4JO3H 1MWAL 3I9GH 1O7VA 1K5NA 3WLBA 2IGFH 1B90A 1OAKL 4M62L 4O02L 5EZOL 1IC7L 4Q97A 4X7CC 3MV7E 1HXMA 3T1FA 2YWZA 3VRLE 5CJ5A 2G75B 4QOKA 3CFDA 5HHMB 4P57A 1OQXA 1TZIB 3UTSA 5B8CA 4FZEL 3GDBA 2CO6B 1WBYB 5D1ZD 3L3GB 2IPUG 5IBUG 1E4WL 4H25A 4FMFA 4RFOH 1XR8B 2OJEB 3O6FD 3S96A 2E7BA 5C0BB 1FP5A 1AXSB 2R4RL 4PJBB 1ZHKA 4UV4H 4Y1AD 4R4BB 5BMFL 1KSRA 3OB8A 1XF2B 3FO2A 3TBVB 3CSYB 4Z95L 5C0JA 1DFBH 4K55A 3FO0H 1OGTA 3OKYA 5FGSA 3RTQC 4KDTA 4F3FA 4JRXB 2XA8H 2NY2C 4Q9RH 4JFDA 3LKPA 2IMNA 5JO5A 1BQHA 4PRPB 4Q0XL 4MQ7A 5IB5A 4Z7WA 5FA4B 1JWSB 1H3PL 4CVXA 1D5ZB 2A1WL 5ISZD 3GMOB 2EYRB 5J1AA 1FZKB 3CDFA 1AO7D 5DMIH 4OLVL 5E99L 4XTRD 3UJJL 1R3JA 4PJAE 5C07E 4NNYA 2HKFL 4KROD 3VG0L 5AAMA 3H9SE 4GG8A 1E4XH 4Y19A 4ETYA 3ULUF 4JRYE 1QSFB 4JFFA 1ZV5A 3IF1A 1PLGH 3EO1A 2BMKB 2ARJQ 3SOBH 3QYCA 3JV6A 4YGVA 1CGXA 3CXDH 4GW4A 2KQMA 1AO7A 2BVQA 1KJVB 1FC2D 4QT5A 1TJHL 1ZWIB 3B9DA 5KW9H 5MI0C 3VFMB 3QQ9D 1CFNA 4R7DA 2BJML 3LV3A 3RUGE 3SE9L 2Q6WA 3D18B 3QO0A 3WUZA 5DGRA 2Z35B 5E7FA 4ZD3L 4XAKD 1FFOA 2L4OA 1QQDB 2YUWA 3O0RL 1PG7L 1K85A 3VW3H 2BXYA 2ED7A 1B4RA 1OGTB 5AG9A 2Y36H 4TYUA 1GYAA 3OG6B 1CVRA 4D3CH 4FQ1H 4IS6B 2J3SA 3PXJA 2Z4QB 4E41D 5KVFH 4XGZB 4O2EB 2VOTA 1BVLB 1G0DA 2P8MB 2OR9H 5DRXA 2F53B 4Y4FA 5EUOE 3NIFE 3T1WA 2YD9A 3I75A 1ZVSB 4XVSH 3DGGA 4ONHB 3LCYA 1XF5B 4K8RD 2J2ZA 5BOPA 2BNQA 2VQ1A 2W9EL 5HHME 2HRPL 3E2HB 1JCKA 3NVQA 4UAOC 3T4YA 1JF5A 2QQQA 4OGYL 4ZUWB 1A9EA 3UC0L 3CFKB 1J1PL 3FO1B 5CIPH 3W0WE 4Z7NE 5KAQF 5E2VL 1QEWB 3O3AB 1MFDL 4ZO8A 4AEIL 2DLHA 4N0CD 4BK4A 1P5VA 3G5XB 5E8DL 4A6YL 5C0BE 1JRHI 3R0MA 3MLVH 3KPRB 3RZCA 1HWHB 5FA3B 5KVDL 5EDXA 1L6ZA 3DXAE 1HHIB 5ACZB 2FB4L 2CH8A 2DN7A 4HSQA 5F1OB 4KY1H 3PWPE 1T3FB 3O8XD 2MQ3A 4LSQH 4S11A 3SJVA 3ARGD 1JGEA 5GZOC 1UZ6F 5DJDA 3S36L 1IEHA 4OD2B 4YHML 43CAB 4KVCL 4M61B 4PRPE 1ONQB 2AJVL 4X4ZA 2FX8L 4R8WL 3RX5A 3VWJA 2AGJH 3FRUA 2CR3A 2WWMC 4HMCA 5IEKA 4GKZB 4L4TE 5MEPA 4P2RE 1P7KB 2ICES 3L7FB 4Z77B 5DJ8B 5IVNA 3ARGA 1T5WB 3FFCA 4JFQB 4HX1A 3GBML 4MA8H 4O2EA 3RWDA 3HI5L 5DRXB 1NAKH 1BX2B 1GL4B 1NGWB 4NQCB 2FZ3B 3GSOB 4DN4H 2OMBA 4OZHB 4QCIB 1MHPH 2E7LC 5FAAA 1X6LA 3ISWA 5DD5L 1MFBL 4OGXH 4WHTA 5A40E 4I0PA 2ICEB 2VE6B 3UEZA 4LSPH 3MRLB 4L1DA 1C7TA 1U9KA 3H2WA 3K4DA 4MD4A 5K9JL 3P9MA 4RAHA 5ANME 3QUKA 1LE5B 1ETZA 4AT6A 3BZFA 1MCWW 1FLTX 3P4OA 5CLWA 1JWUA 2WIIA 4XPBH 1FSKB 5A1AA 2P5EB 2ZUTA 1SJHB 25C8H 4NKOB 3G6AB 5HDQH 3LB6C 5DUPL 5JPNA 2WK2A 1FFQA 1T20A 5FYLL 1KEGL 2KQNA 3T65B 3I84A 4M7LT 1F4YH 2NY6C 3W5NA 1IC4L 4MNQA 5F9JA 3LH2H 4Y4KA 3NPSC 1YEHH 4LAQL 4NZJA 1ZMYA 4OF6A 1T1WB 4U1LA 1A3LL 3FRUB 5IJVB 4G7YL 3PWPD 3HPJB 4HUKB 4Y5XC 3ILQD 4YDVA 1IAIL 4MYWB 3ARGB 3PWVB 1J0KA 3MLSL 1BP3B 3H3PL 5MP6H 1LE9B 1IGIH 2HRLA 1A6AB 3MLRL 3G5VB 1BIHA 1YMMD 1P84K 3MV8A 2JCCB 5FYKU 4FS0A 4QO1A 1MLCA 3C5ZD 4G8GB 3ZT7A 1N6UA 2DQGH 3VH8G 3SDAA 3WIHA 1H3UA 2NYYC 4F15B 1CDBA 1T1XA 1UQSB 4WDIB 4AL8H 5I8KH 3KWWB 5I16B 2AK4A 3U36B 1EHXA 3N06B 4M6AA 1T66C 5E8EA 3W39A 1YNTA 1AQDB 2LAAA 2J8OA 3C2AH 3QUKB 4LDLB 5J56B 2EE2A 5AYUL 1BQHG 1NMAL 3FT2A 4QRRA 1TQCC 3DV4A 2PR4L 3GO1L 4LHJB 4NSKA 4YXKH 2GCYA 4LRNH 1ZLUK 4DVBA 5B8CB 5HGAA 3MLYL 4NBXB 2QR0A 5JHDD 3B5GA 4XTRC 2IPKB 1JPTL 2B20A 2K7PA 4NM8L 2Y5TB 32C2B 4XXDA 2YD6A 5DI8B 4LVNC 2QHRH 1YPZF 1A2YB 3MZGB 5GSVA 4ETQB 3O81A 1N4XH 1N8ZB 3ULUC 1IC4H 5IQ7L 4WO4C 3EO9H 5M94B 3RWEB 1L0YA 5D2LA 4NQCE 3ALPA 3GMMA 4YHLL 2XZAL 4XVTH 1A6VH 1IAOB 3KS0H 5AYQA 3QUZA 5HGBB 1QLEL 4M3JA 4LEXL 1CFVL 5L6YH 3QQ9C 4G6AC 4NM4L 4J4PA 3IDUA 3INUH 2GYSA 3EFFB 2PF6A 1R24A 3OGCB 3S9DB 3RNKB 1FLRH 4U1IA 1DL7H 3BGMA 4OCSH 3OGOE 5J12C 1WGOA 5GJTL 5JR1H 4HHAB 1T0NB 1D9KD 5I2IB 1UQSA 4NO3B 3TBVA 2AK4B 2P5EE 2X4OB 3MRGA 1FQ9C 3SN6N 3DARA 1DLHB 3HE6B 1DBKL 4JQVA 1U6AL 5KANI 5IMLB 2X1OA 4CAGA 1MCKA 3VXRD 3UTOA 4QRPA 3ARTA 3RWJB 3NH7H 5I19L 2ZJSH 3C6LC 5JDSB 2O5YH 4P3CL 5F97E 4YAQA 5FA4A 2NX5D 4Z7WB 1OM3L 2YS4A 4MJIE 4O9HL 2FJFA 5CMAB 3IFOB 4YFEA 1J05B 2CKNA 3D6GA 2DWEA 1GGTA 5HI5C 4DUXA 1RURL 5LBSH 4UINL 3D0LB 4Y4HD 5DQJB 3T0EE 1IGML 1TENA 2GUOA 3TYFA 1QLFB 3MV9E 1S7RA 1DUZA 3GKZA 3NTCL 2L7UA 2BRRL 1VFBB 3C5JB 4FQ2H 4LGRB 4N0CC 4QXGH 1SEBB 3HCVA 4YGVB 2CUIA 4GG6E 5E03A 4XNZB 3ROLA 1UEMA 3QZWA 3MLXH 4XVTL 5EU3A 2GT9A 2EEDA 2G60H 3MOBH 3X3FL 3CSGA 5H37G 3GIZH 1HHGB 1BPVA 4MA8L 3IU3A 4IRSD 3ARGC 2F54E 1BVKA 3BSZL 5IROC 1HH9B 3GKWL 5DQ9B 4W81A 4BQ9A 4K71C 4NQEB 3C6SB 1FBIH 1CL7H 2QBWA 1M7IA 2ZOLB 1XGQA 4RMVA 3K0WA 2XWTB 3WEXB 3U48A 1QEWA 1T6WA 2APWA 4K8RH 1A7QH 1FZJA 1TZHB 2VLJE 3CFCH 4NKIH 4HIIB 3HNSL 4FNLL 2BNUA 1KTRL 1SEQH 3QEQE 4ODWA 2HAZA 3KJ6H 3QFJD 4HC1H 1AY1L 4WTZA 5SWSA 3MNWB 1JF1A 4YUEH 2F53A 3KPSA 4PJAF 2WUCL 3DMMC 3RVTD 3MRPB 5E9DE 1GOHA 3MLPA 5B8CC 2HLAB 1BZ9B 4OCYL 4UILH 1ZANL 1QKZH 4TOYL 1X3DA 2X44D 1DQJB 2ZSVA 4NQVA 4GLRI 3VWJB 5ICYB 4GRMB 1DN0A 1AC0A 3MQIA 5EO1B 5GIRB 5JZ7C 4Y16A 1IGJB 3MLUL 4MXVE 4AIZA 1XIWC 2CIKB 3I3EA 3QBTB 4JQXC 2I5YH 3QFJE 3LB6D 3Q1SH 3QO1B 1RJCA 1G0XA 1KJ3L 3VRIB 1GXEA 3WKML 3N9GH 3HG1D 3OJDB 4OIIH 3DHJA 3SKMB 1ROWA 3DVNA 1M7DB 1OLZA 3EYQC 5DJDB 5C08E 3MRLA 5IHZB 2JKXA 3KS0J 3W11D 2FGWL 4JM2F 4MJIB 4MXWL 3JV4B 2OI9C 4X9IA 4P23A 4Y5YA 1I3GH 2BNRD 2Z92B 3GMRB 5EH1A 4XT1C 4AT6B 3UYRH 3ESUF 5E1AA 5FUZL 4JR9L 4XZUB 2BNUB 4K3GA 3SKNB 2PYEA 1CQKA 1ZEAH 4FNLH 1NBZA 3RBSA 5DSCA 3JTTA 4NCDA 2GK2A 3C5ZC 3RKDC 5CEYA 1FFPA 4IDLA 3VE0B 1CL7I 1JHLL 4FN0A 2Z31D 2D2OA 5F7FA 5C0IA 3NCJL 3PL6A 3BRFA 4U0RC 3O6LH 4OI8A 1Y6KR 4HWBH 4PJ8C 2EDJA 1S7TA 4H1LG 1HILB 5DTFB 3FKUS 2CK2A 3REWA 4G8IB 3BN9D 3HPJA 2FDBP 4I18B 1ZT4B 1ETZB 1KCUH 5A3ID 3ES6A 1V5JA 5IJKC 3F7YB 1RZ7L 5D71H 2W9DH 5H2BB 8FABB 4X7SH 4GRLD 1TNNA 1JHTB 3IXAB 2FEDC 5EOCJ 4YZFF 5BCAA 4HKBA 1NC4A 2BSED 2B4CC 1H9VA 3ULUD 1RPQA 4OZFA 5D6CA 1MEXH 3V4PL 3GMNB 3KWWA 4KK8D 5DC9B 5JLZB 3ARFB 3HAEG 1TVDA 2EE6A 3DUSA 1ES0B 5DWUH 3FB5A 5GS0H 4G6AD 2ILLA 3S4SG 1KFAH 2APXA 5J9PA 3STZB 3CMGA 2DLIA 3KYOB 4ZFOB 1MCOL 4NPYB 4Y5XB 3I6LE 2ZUUA 3U1SH 1IT9L 1A6AA 4I5BB 1T0PB 2EKJA 2CMRL 3DUUB 2O5YL 3NCMA 3N1PC 5FKPA 1HQRA 3TT1L 3WXWL 1T2JA 3TV3H 3OXRA 3NIGF 3OR6A 1D6EB 3B9KA 3ZYZA 1S9WB 2R56L 2YPLB 3SKUD 1N0XL 3C87A 1VADB 5IBTL 2VABB 2R69H 1B6DA 3C5ZB 4RMSA 1QLRA 4F15C 1QUNA 3G08A 1TJGL 4FABH 3T3PF 1IAOA 1UKQA 4I18A 1RZKL 1X5JA 2I27N 3KPPA 3C6LD 1JNLL 3CPLB 1Z9SA 1EFXA 1AXTH 1N6VA 2HTLC 5ADPH 3EFFA 4PJEA 1AQKL 1OCWL 1U8MB 3BUYA 5AEAA 3WFZA 3PGDA 2EO9A 5HGDA 4XP4H 5HI5D 3AAZB 3O4LE 5I18H 3BP5B 5DK3A 3GUTB 2IBZY 4KKLC 1CFVH 5TH2A 4Y4HC 1NC4B 4FQXC 5L8KB 3AS2A 3HE7B 4L3CA 5F1KC 5I1EL 4J3SA 2R29L 2CDEB 2CKBH 4OF5A 5CCKL 2AJXL 4LSTH 4NN6B 3TNMA 4QXUL 4WU5B 2Z8VC 5GJTH 1BIIA 2PCPB 2VDNL 2WP3O 4MAUL 4M7LH 5B38A 4WTXA 3NCCB 1KTKE 3PDOB 4Y0GA 2H45A 2JIXD 1WWWX 2A6JB 4IRSC 4AIOA 1CD9B 1RZJL 3W2DL 1GAFL 3QQ3A 5INCB 4W6XB 3E6FB 3AB0C 1ZXQA 3FB8A 3MO1A 3M45A 4CW1B 3DROB 5DD6A 2FWOA 5GS0C 2ARJB 1KEMH 2R23A 1UXWA 1ACZA 2XA3A 1H8NA 4JFYB 3BJ91 4JVWA 1MCSA 3O6FA 4DKDC 3PWLA 5EBMA 4YWGL 3ECBB 1BJ1H 5JUEH 1OPGH 4JAMB 2DJ4A 1G6RA 4FQXA 3FN0H 5D7LE 1BQSA 4X6CF 2VAJA 1S3KH 3VXTB 3VXNB 3PWJB 1IE5A 2HLFD 4ONFH 5EWIH 5JDSA 1ZOXA 3AUVA 2X4SB 3GSNB 4XMKH 4JB9H 3BDYH 3CMOH 3DMMD 3RVTC 5SWSD 4J2XA 3ROOB 4YXLH 4XPAL 5E6IB 3HC4L 5F7WC 4GRWE 3QUMA 4OUOA 3MOBL 1YJDL 4NWTH 3WFEL 2IFGA 2J4WH 5IW1B 5L88L 4JGUA 1XF2A 4Q9RL 3NN8A 1BFOA 2YUZA 2EKSA 2R9HD 4F9PA 4IDJL 3IJSB 3GZKA 1SYSB 3AS0A 2VDML 3O6ML 2FBJL 4LHQB 1CXKA 2XRAH 3C5SA 4CDHA 2VXUL 3U4BH 1TZHA 4FZ8L 2ZSWA 5CGMA 2OYPA 4LLVB 1QSVA 4P4KD 1PEZA 2GI7A 3FCTB 1S7UA 1LVEA 3LOWA 5C09D 1J5OL 2WBWB 1PW3A 3WE6B 4NQSB 4WCYL 1NCUA 4C54A 2VLMD 5JHLL 1T89C 1BVKB 4JY5H 1VKXA 1JMXA 1U8JB 4JFZH 5D2NC 3MXWH 1LDSA 3DURB 4NUGL 1F2QA 1GOGA 4LCWA 2DBJA 1TJHH 3NCJH 3X11A 4X5WB 2OBGA 4M1DH 1CDYA 3HR5B 3PABA 1CYGA 4X5XB 1MF2L 5IIEA 2A9ML 4F7CB 4UTAL 5FO7B 5FOJA 1Q9OA 5DJYA 5SWZB 3UTPE 2YR3A 1QVOA 3KPQA 3OMZA 4XCYB 5EBWB 1RJZA 3WNOA 4KRMB 3VRIA 2BY3A 4CN1A 1EEZA 1MCQA 3WIFB 5BVJB 4XMKL 1XGTA 5FYLH 1EJ6A 4NO0A 4I4WB 2YWYA 5T3XH 4XXCC 1TTGA 1HI6A 4XMPH 1A5FH 1KBGL 4X7TA 3WFEH 1BFOB 4JPKL 1H5BA 2F58H 1J18A 3BN9C 4JO1H 3BQUD 2R1XB 4PRDA 4G43A 1VFMA 2V2TA 5IR1B 5BZDA 3KDMA 4HBCH 1ADQL 5FHBL 1DVFB 1K4DA 3ZDYE 1FL5A 4XCCL 3TN0D 3WN5A 2FGWH 1G7JB 2X4PB 2W9EH 1RK0A 3C09C 1N2RA 4L29B 4U1JB 2QSCH 4JO4L 3MLRH 1NBZB 1VGKA 2QQNH 4EQ2A 3JTTB 1A7QL 3MOAH 1KG0A 3QIUD 1X7QA 4PREA 4BELD 4KTEL 4PS4H 3C6LA 2EDKA 1B0GB 3QG7L 1Q8MA 4EVNB 1MHHB 2R0ZL 2OTUA 5I9QC 4KK8C 3FO9B 5ENWA 3LKNB 1Q9WA 2IADA 5C6TL 2AJZB 5FUCE 4FMKA 3TBTA 1F42A 4L9LA 4OF3A 2J5LC 1MFEL 4N8CH 1U2CA 5E8NB 5I30H 5EIQA 1C12B 4GRWB 5C6PB 1TDQA 2JTDA 1EJOL 3L3KB 1RVFL 4MX7A 4D0DA 5KSBA 4O58L 5DZLA 4QTIL 3AM8C 5TGBA 3VI3E 5I17B 1XGTB 1XF4B 2LU7A 1N26A 3RJQB 2LU3A 4O00A 3O41B 2XTLA 4HEME 5DFVC 2C3VA 3WO4B 4ZOBA 1I3VA 3GSQB 1LO5A 1WBXA 4QHKJ 2DQIL 5EOTA 1WEJH 4FABL 4L8BA 4M61A 12E8L 1H5BB 5CEXB 3P73A 3ILPA 4WFGE 1HILA 3O2DH 4P0DA 1A7NL 2PXYC 4PJ5A 3FOMA 3ARDA 3S35H 4PGZA 5LGKA 1KN2L 4X8JA 1S5HA 3RTQA 1JUFA 2I25N 5ISZB 4MXWH 3LEYH 5F7LB 5I1CH 1G7LA 4HAFA 4AL8L 1FL3B 2FX9H 4FQXD 3S5LA 3A6CL 5D2NA 4PJ7F 3J7HA 5SWZE 4HUUB 4LCYB 3LN9A 2ICWI 5IBLC 4E5XA 3BYYA 2VE6A 1PX4A 4KJWD 1AGDB 2F15A 4JFPA 4Z7UA 4E41A 2VLRB 1G1CA 5C0CB 1PEWA 4WUKL 4WI3A 1F4XH 3SPVB 2V6HA 3MRJA 5DHVH 1UACH 1CLYH 3QXDA 4N0FB 1JYWA 3T1FB 4GQ9H 4K3EH 2R8SL 4OCXL 2R56H 2IAND 4MA3A 1ULVA 2YPKB 1RAMA 1LEKA 3MBEC 2NXZC 3E1F1 4NRYB 1A3QA 1FYTB 5DRNB 3DX7B 2I60L 2DQHH 3S37X 5IQ9B 1MRDH 5GSRA 4TSAL 1T21A 4DKAA 1Q9KA 5J12B 5LBSL 4W6YB 1X44A 4L3CB 3HFML 3PGCA 3OL2A 4XPHH 5FECB 2FIKA 2KZ1B 3LEXA 1RULL 2I9TA 3EJZD 1GOFA 2P8PB 1NLBL 4QXTB 5C0EB 4FG6C 2NY0C 4U6XA 4NWUH 2VZSA 4M7KH 3KPPB 1MJ8L 5ESQA 5CSBA 5CD3B 2A1WH 4D3CL 1U41A 2BOBA 5KSBF 4K7PX 4RA3A 2E5EA 2YD5A 2XQYK 4OLVH 5D93C 5DEFB 5E99H 3L5IA 2HFGL 2O5ZL 2B4CH 2H26B 3V4UH 1D6VL 4R4ND 4G8GA 3GKWH 5KSAC 1IQDA 4JFPB 4JDVA 5MEND 4Y19B 3IDGA 2WIMA 1CL7L 4MA1C 2EC8A 3OKEA 4IJ3B 2CLRA 1ZSDA 4DKFL 4P4KC 3F5WB 2IAMA 1FNLA 43C9B 3LS4L 1BOGA 4LLQA 4LKXA 4QT5B 4PJGA 3X13B 2B1AH 2GY5A 4LASH 1WCQA 2VZUA 4S2SB 2X4SA 5GRUL 3K80A 4PRBA 5MENA 3QDGB 4UNUA 3QQ3B 1FZOB 4NNPL 4X6DE 3HI1B 4UUJB 6FABL 4J1UA 1UVQB 3HPLB 4I48B 4JDTL 2PO6A 3L3HA 1A2YA 2DJSA 3KYMB 5F1NB 3G04A 1G7IA 1OAYH 1RZFL 2EKSB 2CDGB 2WQ8A 4RWYL 5F21B 4OZ4B 1JK8A 3IJSA 4U3HA 1T03H 4F7MB 1U92A 2JJUA 4BKLB 4MJ5A 3Q2CA 1EHLH 5CGTA 5EU6E 1ADQH 3BP4A 4IDJH 3O3EA 1KJMB 5FOBA 5GGQL 3WE6A 3X3GL 4M7LL 4WO4B 2PW2B 4LCIL 1XF5A 4PGBA 1CIUA 2P7TA 3KNBB 1QOKA 5JMRA 4GMTH 1MCNA 4GW1B 5GGRB 3BQUC 4I77H 1EH9A 3PJSB 1SEQL 3O3AA 3PQYB 2XKNA 3WYRA 2AEQH 4ZOAA 2CLZB 2CLVA 3KYNB 3QIWC 4ZDHB 5IG7A 2HFTA 2HT2D 5K59E 2YC1A 5KS9E 1TMCB 4M7ZB 4MQSB 4GAYA 5CKGA 4O02H 4Y19D 2UUDH 5HVHC 2DIAA 4L4JA 2BSRA 2QTEA 2MJWA 4KTDL 4JZJC 4NKMA 2KUTA 3RIFF 2NLJA 4GT7A 1RFDL 4HGWA 4G3YL 1C1EL 4Y5VA 3TESA 1P6FA 2V9RA 3U83A 3WIHL 2UVFA 3JUZA 4H5SB 3T77A 2V2XB 3V4VH 2YHGA 2CDGA 1NFDA 4G6MH 3IS1X 4PRDB 1KLGB 3VFRB 4CDGC 3AMLA 1MWAA 3I6KB 4I2XB 1FIGH 3ROLB 5MEPB 1DVFA 1I9RH 2IH1A 4RISH 3BH9B 1K8IA 4LPUA 4PJ9B 5F3BA 3BKMH 4MVBC 4P5MB 1I8IA 5IFJB 5C1MB 4FFWD 1BAFH 2W60B 3WIFA 3MLSH 3F7RA 5DFVD 4UB0L 4C56B 4JZJA 1GZPB 4PJEF 2ARWA 4MAYA 1DJSA 1Z0MA 3BDBA 2ICEA 1BGXH 4NRZB 3RDTB 4OLZL 4GMTL 3BKJL 2PXYD 4KTEH 4PS4L 1CICC 1K6QL 1JTPA 4ZUVB 2D7NA 2YD4A 4EUPA 4LCUA 1MRCL 3MXWL 4Y5VC 1QFWI 2E7LA 1B88A 1TCRA 4HWUA 1HDMB 1UJ3A 3CAFA 4Z7OE 5DYOA 1TIUA 3VFSA 4NP4L 1OAQH 4L29A 4U1JA 1H15B 2IF7A 1JF1B 4OLYH 5GS2H 4RZCB 4CADA 1XCQA 3HZMB 5GPRA 2J8UB 2EH7H 4ZNCD 3RX8A 3MBEA 3QDMA 1BD2A 4PB0L 1NEZA 4I0PD 2Q8AL 5FM4A 2AXGA 1LNUB 2EECA 3D39A 2C3XA 5EZLB 3LRSA 4CVZA 1IM9B 5D6DC 5D7JD 3R06A 4F7TA 4HLZH 1J12A 2DQUH 4JO2L 4RWHA 2APTA 5DD3H 4PG2A 1T2XA 2BSTA 1R0AL 1YJDC 1I4FB 1KB5A 5F7EL 1HSAA 5F7HA 1KBGH 12E8H 3QWQB 3MBED 3QDMD 5IMOA 5FV1L 3X14A 3BW9A 4TSBH 3STBA 2KZWA 4JRYB 3BXNB 3BMWA 3VFWB 2PW1A 4R0LA 5J7CC 1U95B 3CDGB 2XPGB 3GRWA 4EQ3A 1ED3A 3VFUB 1YEKL 3L1OH 3V4UL 4ELME 4HG4K 2Z91B 3EJZC 3LEYL 4HQQH 2IJ0C 3MRJB 1KJ2A 3PP3H 3TZVA 1N59B 4P9ML 4Y8DC 4MXQC 1CGVA 5DUBB 4O51A 2M2DA 3ZTNH 4ZPVB 3TYGH 4HZAA 5IB4B 5B38G 4XZUA 3SKNA 4PLNC 1LEKB 1FN4B 5FK9B 4P5TB 1GAFH 2DQFA 1KC5H 3JTSA 5I30L 2BC4B 3SO3C 1YN6B 3QDJD 3NMEA 3TH4T 4YHZH 5F6HJ 1X5KA 1CZ8H 3RI5K 2X9WA 4DZ8A 2Y9RT 2DYPD 5LVEA 1NFKA 2VXQL 4F33B 2GSGA 3HE7D 2RIKA 3RGVD 5CBAA 5KVDH 4P49A 2DQHL 2X4TA 1SYVB 4UINH 1IAII 4QF1A 1CXHA 1DBAL 5F9OH 3SCMA 5EUOB 1PBYA 4DUWA 3D3VB 3HFMH 3GMMB 3MJGX 1AR1C 4U6XB 4UT7L 1NGZB 4JKLA 3L6FA 1CFSA 5C0AB 5IMKB 1NFIA 1URLA 5H2BA 4D9RE 1KCRH 1QRNE 1TETL 1MVFA 2JIXB 5JQ6H 3W0WB 3OGCA 4N8VG 3BPOC 4PJXF 1I1YA 1QFHA 3QHTC 4OFYD 4K9EH 1EMTL 3BIBX 4FQ1L 4HKXB 2DI7A 4L4TD 3EYVA 3KPRE 4ORGA 3RIFK 3OG4B 1FAKT 5DURB 5IVZB 1CGTA 2X4OA 4ZUUA 1AD9A 3IAQA 3CK0L 5SX4H 1KCVL 4MXVF 4EEEA 4MB5A 5HD8C 2O5XL 3AVEA 1JZ3A 1W72B 2UZIL 3QPXL 4WHYG 1DR9A 4FQIL 5EO0B 4JQVC 3VXMA 1FRGH 1KEML 4LLDA 2ZCHH 4WV1B 3IKCA 1GGCH 3VA2C 5C0DA 4QKXB 1EBPA 3IFOA 5DO2C 5E00A 5FCUH 5LAXB 4GAJH 1KC5L 4XHQA 3ZYIA 4H0GA 3UCRA 3OAZK 3WHXB 4M6NH 4HIEB 4ZD3H 3QAZC 1LQSR 4LLAA 2CIIB 1BBJA 5D72L 1S7RB 1HWGB 3QXUA 3A6OA 4HWNA 1L9MA 3G08B 1LEGA 1P4BL 4PRPD 5DUML 4A6YA 1ZSDB 3CDCA 1NDMA 4XC3H 5C9JA 5ID1A 5DJCB 1QR4A 5IVXB 3UDWA 3ESVF 4DZBB 1RHFA 4XVJH 3GBNH 1M71A 5JXAH 4LK4A 4NJ9H 1VSCA 4U4BA 1U8QA 3LMJH 5T3ZE 5JW4Q 4YBLB 1AGFA 2FX8H 4HUMB 4WU7A 1WBYA 3P9LA 5LQBL 5FF6A 1HKFA 3VGAC 1C8PA 4P2QB 4AH2A 4S1DC 1YC7A 4QY8B 4XRCA 3IRPX 3RL2A 1EMTH 3QEQD 5BQ7A 3TZVD 1IEAB 3HC0B 4EOWL 3G04B 2HT4D 5IMMB 1FE8H 2FECI 3DSFL 4QHUB 4M8QB 4QHNB 4MJ4A 4OGYH 1UM6H 3O8XA 1CR9L 3BKCH 5I1DA 5E95B 3SQOL 4RDQG 5JORB 4JRWA 2H8PB 5J4MA 1J7VR 1YYMH 5HHXL 4DK3A 2H1PH 1Q1JH 4GAYB 3NABL 4OAWB 4L1HA 3I02B 4HS3B 4P46D 2UY7A 2FB4H 1BZQK 1VGEH 4EUPH 2VDQL 3WUWA 1NBYA 4FFZH 3UC0H 3X12A 3MRFB 4YNYB 4P2OB 1DEEB 5C0AE 4TN9A 5DC4B 1CICD 1EO5A 1ZT1A 5D5ME 1TXKA 4WNQA 3EAKA 3ZL4H 2JCCE 2NR6C 4KI5F 3WS6C 4BQ6A 4DGVL 2E27H 5ID1B 1SJXA 1X5AA 4ZXBD 2ORBL 4TVPH 1A14H 1QRKA 4BYHA 4PJXB 5KANG 1IGCH 1FO0H 3QHZL 2ZOKB 2LQRA 1I1RA 1OQOA 1MH5A 3C60A 1BECA 5SWQA 4BFEA 3P9LB 5GISH 2DQCL 4I0PC 1NAKL 4IOIA 1JNNL 3C8KB 5IW6B 5KTEL 1KTLB 4X6BA 4Y4HB 3WJJC 4JM2C 2ZCKL 5D7JC 5LCVH 2N7AA 5KN5A 5F7EH 4XWOD 1DQDL 3BWUC 1X5HA 3JV4A 4HCRL 4L4VE 2XN9B 3VGFA 3BN3B 3M17A 3D85A 1P2CA 5JHLH 1LP9F 4XNZC 5HGHB 3HI6L 2FJGA 4ZUTA 5T1KD 3EOBA 3QDJE 2Y06H 4MSWA 4YIQB 2HKHL 4OAWA 2C1PA 4ELKA 3UPRA 5I8KL 5DD5H 4TSCL 2LVCA 2E8ZA 2JJWA 4FFVC 2HKFH 3TNNA 1OB1B 5C9KA 4Y2DB 1IT9H 1OF2A 4NP4H 2FCBA 4NQED 1FIEA 2GJZB 3MRHA 4MXQD 1S7TB 2QEJA 4OSUH 1NGXB 4NO2A 4LOUC 1YNKL 3BH8A 3TWCL 2Q8AH 1YEHL 4I9WE 1SMOA 4P2QE 3O45A 3HMWL 1Q9LB 3B83A 1W0WA 2I9LA 1VFAA 3BZ4A 3VWKB 4JKMA 4N8VA 3OKNB 3D25A 1KPVA 3THML 5DEGB 1MCEA 4UMGA 1R0AH 1BX2A 4DFHA 4O2CB 3DRQB 4M5ZL 1MRDL 2XPGA 4J3OC 3IDJA 5IW6A 1I9RL 3RIAF 2JB5L 5EUKA 4I4WA 5SV4A 2Z31A 3MRNB 1QLEH 3BHBA 1ZT7B 5DJ6A 5CGYD 1DQQA 5JXED 2Y72A 3RRQA 2DLFH 3HNTL 3QIBA 1T04A 1ONQA 3TF7C 2BVEA 2VSCA 4QRUB 4NJAH 4M48H 3W82A 1AR1D 1HCFX 3TCXA 2X4UA 2NTFA 4MDJA 1P2CB 4PJDA 1XGUA 5EU7E 2D31A 4HXAL 5E70A 2WIIB 4QXUH 3LVEA 3VXRE 4LLUB 1L0QA 3RWDB 3JTSB 5C09E 4NQUA 3IJYA 4UI2A 1SBBA 4F80A 3PV6A 4Q2ZA 1IL1B 3FQRA 4NQXA 3KPSD 4LDEB 1PZ5A 2IBGA 1NCDH 2ZUQB 1VENA 1A64A 2YPLA 2ATPA 1Q9WB 2IADB 4NCC2 3TA3D 1MAMH 3F65A 1UB5B 1IKNC 1NMAH 4NGHH 4K7FA 5HD8D 1N59A 3FAWA 5D1QA 3MFFB 3MA9L 5I66B 5C2BH 1H8SA 2IAMC 3DMMB 2ID5A 2AEPL 1EEUA 5I18L 3DRQA 2BC4A 1NGPL 2XN9E 2BXZA 3VXPA 3MCLH 1N4XL 2JE8A 4YR6A 3VCLA 2VLJB 4RQQB 1HYSC 4AZ8A 5FKAB 3MODH 2VIRA 1CD1A 4RAVA 1JGVL 1QSEA 4JDZB 4OLUL 3RVWC 1GZQA 2DLFL 2DWDB 4OZIA 2RAMA 2X4UB 5DLML 1NANH 2E6QA 5IHLB 4QRRB 3MGOA 5FHAH 2CUMA 2GCYB 3GHEH 4HPOL 5GGQH 3CH8A 1X4YA 5ACMA 4DAGH 5IM7A 2ICWB 3HMXA 1FGVH 5L2JA 1S7XB 5DD6B 3TZVC 3ARXA 3HUJB 5DI8A 3K4ZA 3UX9B 4Y7MA 3QCVH 4WI4A 3V7AG 3DRTB 4PJFF 1N5YH 1OGAE 5EG6C 1UYWH 3ARFD 2W92A 3UBXB 4G80B 5BOZG 5D1QB 4JAMA 3HC3L 3DO3A 1NH6A 4UDUA 1OTSC 2GTWB 4KHTH 4F9PC 3MREB 2XFXB 3QNXB 1YEJH 4R7DB 4KKCD 2VITB 1D9KB 3GBLA 4HS6B 4N9GB 1CFTA 2OX5A 3RNKA 3CX2A 4EBQL 1JI1A 1UWEL 2JJTC 3A0OA 4ODSL 5GISL 4J6RL 1NKOA 1T0NA 5TQ2H 3QUXB 1JL8A 4MHHI 2B8OT 2VIRB 1X5ZA 2CIIA 2VLKA 4YEFA 5H94A 5C3LD 3MNZB 1GZQB 5HHNA 5TDOA 5C08D 1E0OB 2VR4A 5LCVL 3TIDA 2AI0L 3JZ7A 4P3DA 2VUYA 2WW8A 4GAGH 4S1SL 1FHGA 3W9DA 4KPHL 3GGWA 2B4CL 4E9LA 2DQCH 2ESVA 4TVSa 4BFIB 2F5AL 1P7QB 4NZUL 4HBCL 2D03H 2D7OA 4LLWA 4EI5B 1T1ZB 1U8OA 5L7XL 5BO1L 2VAAA 3AU1A 4WEMB 4XH2A 2X1PA 3WUWB 1C5CL 3UTSD 4G5ZH 2D7PA 5F6IB 5EA0H 2WQRA 4GKSA 1RIUH 4XWOC 2C4XA 3OKOB 1FNGA 1JN6A 5AYUH 3U1SL 5ALCH 1A9EB 4KJPC 4DGIH 3TP4A 1DZBA 3O8XB 2E8YA 4HUWA 1E6JH 3EYSL 5FO7A 2ZUQC 5HSFA 4PP1C 4DW2L 4M1CD 3HC3H 5T5FL 5T1LD 3RIAK 5FYJE 3O6LL 1M05A 1F2XK 4FFVD 3FRPA 4BSWB 1HHGA 1L9NA 3EOAB 4X6CE 2CRIA 3I02A 4HS3A 4YHYB 4HDIA 1UVQA 3GBNL 4PBWD 4I3GA 4MCZB 2X1WL 1JGEB 2J88L 3MLZL 5DVMA 4NQEA 5HDOA 3C6SA 3BIKB 4OCRH 3TYFB 1UM4H 1FO0A 4XP4L 2DQTH 4OZ4A 3ARBC 2PNDA 1U92B 1UKTA 1QD0A 3GGWB 3KDMB 2E7CA 2EDHA 4GAGL 3CJJA 1GGBH 4Z77A 1Q72H 2ZOKA 3BPOB 3EBAA 4HK0A 1OGAB 3M1BB 1SY6A 1IKNA 2ICWJ 4I77L 3LIZL 4APQC 1A8JH 4MJ6A 1A0QL 1JFQL 3TPUA 2OLDA 4Q58C 3WCYA 4XXCA 5JXEC 4GQPH 1MHHA 3WLWC 5FV2A 4LSPL 3VFNB 4UNVA 3RWHA 2J6EA 4JFFB 4KDVA 4WRLA 2CQVA 2ZG1A 2A73B 3MTRA 4WFED 1T83C 5I1IH 3VU2A 5E8NA 1CBVL 5EO1A 1CF8L 3SDCB 3H7LA 4Y88A 3IVKB 3VGEA 3KLSA 1K4CA 4ODTL 4ZAKD 1LEIA 1NJ9B 1PD6A 3B3IB 1MCDA 2QL1A 3BE1H 3CFBB 3O2VL 1B0WA 1FVCA 4JZNB 3U0TA 4KAQL 1CCZA 1M7DA 2R0LH 4N0RA 3TA3C 4KU1A 1P1ZB 1QQDA 4X0KB 1ZHNA 4MLIA 3DPBA 2EYSA 3MPCA 4TNVK 4Q6IA 3HTLX 5B3JE 2JB5H 1G7MB 1GGIH 5KS9F 4S0SD 3UTPD 5F9WB 2NY1C 1F3JB 4PRIE 3GMRA 3QPQD 2BDNH 5EC2A 2ENSA 5I8OH 1FNEB 2V7NA 4HK0B 4JCMA 4YPGB 1I8IB 1JPSH 4HPOH 1G7LB 1HYRC 4CGTA 3MV7A 3MODL 5HYJE 4NIKB 5C70A 1GZPA 3WL9B 5CINH 2IANE 5EUKB 4PR5A 2DMKA 4QOKE 3CIQA 4L9LC 2O5ZH 3RVWD 4GG6F 4K07A 2CRMA 1LP9B 1PKQB 4WUUB 3BQUB 4O5LH 4YBQC 1P5UA 1JPGB 2VL5B 3RY6A 1ZHBB 4P23B 3GSWB 2A38A 3ARDD 2XWBA 1F4HA 5E7BA 3KYKL 7FABH 5J1TC 5TQ0L 4H88H 4OSUL 3BPLC 5F71A 3FFDA 3T2NH 2DM4A 4G8FA 4D9QD 3EYUH 5IQ9A 4MLSA 1FNFA 3ARWA 2Y1VA 4XPHL 3WFCH 2C1OA 2R69L 1CDGA 3WD5L 2BHZA 1UWEH 3DX6A 3QQ4B 2OJZL 1P1ZA 3DWTA 4BH8A 3U6RB 1JF6A 3C8HA 3LKRB 4LVHB 5HYSG 3MRIB 4L8CA 4RNRB 2AGJL 4G8IA 5I15H 1OTSD 1IMHC 1YEJL 2P48B 1XIWB 2IH3B 1U8PA 4PJAA 5C07A 4V1DB 4Z7VE 2Q20A 3A67H 1EAPB 5HYQB 1T5WA 3H9SA 3CCHB 4HPYL 3U9PL 2ATKB 3BXNA 5CJOL 4JFFE 3RL1A 1MCWM 2PW1B 4R0LB 1QNZH 2EIDA 2ICWA 1HSBA 3HHRB 5FHAL 1L0XA 2H3NA 4Z8FH 5T1LA 3QIUA 3QJFB 2FLRT 2NY6B 5FO8A 4IRJA 3TJHD 5SX5K 3WLBB 4U6VH 3VFGH 4U7KA 2P44B 4JO4H 3F62A 1QLRB 2DWDA 2MTPA 1T22A 1I1FB 5F1SA 1I85C 2D0FA 2VYRE 3P0YL 3QCVL 3EHBD 5JUEL 3AREC 4JN1H 4M3KB 4NZUH 3OXSB 4P57B 4HFWA 2X2YA 2GTWA 1MAML 2ZJSL 2DI9A 4XPBL 5IK3A 3QNXA 1EO7A 4OT1H 1KIRA 2P42B 4ONFL 4PRHE 1L7TH 1OHQA 1JE6A 2DQDH 3AREA 1YEGL 5GS1A 1ZHKB 2NNAA 6CGTA 4P9HL 4KJPD 1CG9B 4NFCA 3SGDH 3PG2A 3QEHB 3WDHA 4PP1D 4LKCB 4X4MA 4N1CA 4I3RH 2BOCB 2ZNWA 3IDIB 1ZS8B 4ZMAT 1HINH 2KL6A 4KI5D 5J0BA 3HB3D 3VGDA 4QOKB 3B5TA 5HYQA 3S97C 2G60L 2OMNA 3BP4B 5T3ZL 1LP9E 4NCC1 3W0WA 3STLA 1U3ZA 3QAZB 1HOCA 4XVUC 3IDMB 4HMEA 4YC2C 3WNKA 3BOVA 4YHNB 1ZLWK 1XR9A 2V7HA 4P2OC 4ORGB 1AXSA 4FHBD 3ZHDA 4F37F 5I1KL 2YD2A 2QSQA 2Y07H 4WY7H 4K7PY 2QQNL 3PWLB 5EBMB 1NAMB 3NZ8A 2AEQL 2X89A 3LZFH 2MSPA 5FEBA 2B0SH 4M62H 4LBEB 1V3LA 1E27B 1AGBA 4NHCH 2VN4A 2LVEA 5SX4I 1ZGLM 3MRCB 4LLDB 4NFBA 4ODWB 4APQD 3MLWH 4CVXB 4ZO7A 1RZ8B 1PKOA 4HDIB 3B2VH 3WLWD 2Y5TA 4P5TD 4OGZA 4JG0H 4M8VA 4HIEA 3C9NA 1OAXH 4V1DE 5DFTA 2DM7A 5ISZE 4IJ3C 2NPLX 4YHKL 3TIEB 4PTUB 1CG9A 1YC8A 4IRZH 3MV7D 1XGRB 5HI4D 1SYSA 4M43L 5JHDE 2XT1B 1YEFL 5LQBH 3K8MA 4FTVB 2Y23A 4LEXH 1M7XA 2FO4B 2XQBL 3U0PA 1A7PH 4M02A 5FFLA 3S37H 1G7PA 1QFWM 1CFNB 4FXGA 2VLRE 4ZS6D 4LLYB 4WU7B 4EDXB 4U1IB 5HXMA 3G6DH 2F58L 4AH2B 2FHFA 2X4NA 1OWWA 2R15A 3QT2A 3K8LA 1RJYA 2AQ1A 1WAAF 3CVHA 3Q5TA 5J8OA 1VESA 1OP9A 4QHNA 2NY1D 3TH2T 1J8HE 3IU4H 5ID0A 3QPQC 5IMLA 1LO4H 2MQ0A 2K7QA 2EE3A 2JB6B 5KVEL 3NIFF 3RWFA 5LKNA 3KR3L 4F9LC 5E1AB 1G7HB 3VG9B 2Z8RA 4GBXC 2YZ8A 1H15A 4MGXA 1V8HA 3B3IA 4GW5A 1NUFA 1UXSA 1RUMH 4APQA 1U2HA 2DBLL 1F90L 1WITA 3SJVB 3X12B 5DJAB 4LGPB 3C9NB 3EYOB 4GXUN 5F9WC 3B9EA 3HS0B 1VACB 2HWZH 1IM9A 4JPWL 2X9YA 5IWLC 4Y1AA 1JNHA 4PYHA 3QG6B 5DVOA 2HTKC 2V2TB 5ITFA 1QFWL 1P7KA 2AJUH 5JW4R 3T09A 3PHOB 5KTEH 3T3ME 4V2BA 1I9EA 1OARH 3RUGF 1A6ZA 2J7LA 4MQXD 5DFWH 1BBDL 2FIRT 4XC1H 3O9WC 4HUVB 3PNWB 2VH5L 3FJTA 3MV7B 4JZOA 4LP5A 2QSVA 3MLTB 3MRMA 3GSVB 1MNUH 1YEIH 4NWUL 4XBEL 1EX0A 4G8EB 4HKJB 4NKDB 4PIRF 4LF3A 4H20L 4JGMA 2EYSB 3CXHJ 3EW3B 1PY4A 4X98A 1A0QH 1INQA 4PJFB 5D8JL 2LAGB 4M1GH 4XP6H 5CZKA 2VXTH 4F2MA 3M17B 1MUJB 5A16B 3RAJL 1C12A 3DJ9A 1CLYL 1WICA 4U1NB 5AG8A 5EIIB 4KZEH 4ZS7H 4ELKB 5IFAL 4YHPA 1I3RA 2YBRB 4P5TA 1BQLL 4NQCA 3C6LB 3TJHC 2HLAA 5TDPB 2G5BB 4PR5B 3UTTA 1NUNB 4FQCL 2ADIB 2GSGB 1EIBA 1RZIA 2GJZA 5C3TA 1BVZA 1KIQB 5EOCH 5E94A 1PKQA 4LPCA 4WUUA 3SQBA 3C5ZA 1AIFA 4L9LB 3IDYC 5KOMC 1JNJA 1QRND 5DMGC 2XWBB 3HZVB 1NGZA 2VISB 1JNLH 4PJAB 5C07B 3PWVA 2N56A 2DDQH 5CD5D 5DUMH 4IEFB 3UJIH 1A6ZB 2C3WA 4HGMA 1QSFE 3EGSA 2IQAB 5LG1A 3VGAB 1MLCB 3VWJD 5C0CD 3ARSA 3O41A 1VFUA 3UP1A 4AYFA 1J10A 1FVEB 4IRJB 3SDAB 1XGYH 2VXVH 3LQAH 4G9FE 3S36X 4ERSL 2Y6SD 4LSVL 5F9JB 1INQB 4MJIA 3RUGB 4N0FA 1U8NA 3DSNA 2MWCA 1JBJA 2NTFB 2DJUA 4MDJB 3IAGC 4ODXA 2PXYA 3P4NA 3T4AA 4J4PC 5B3JF 4OV5A 3U9UB 1XIWA 1CS6A 4BK5A 4NSKB 1CGUA 3IJHB 4PJCB 5L2KE 3U7YH 5CZXC 3MV9A 4LIQE 4XVUD 3ULVC 1OP3H 4E0RB 3WFHB 4AEIH 4P2OD 1FFPB 4CW1A 4I2XE 3NABH 32C2A 4XXDB 1RUPH 2K3TA 1CICB 5MEQA 1K8DA 2ADIA 2W0FB 2HJLB 3RVUC 1R6VA 4KDWA 1TQBC 1X9QA 4OM0H 5ALCL 4R0LC 3MV9D 4K7FB 4PB9H 2Y7QB 1T22B 4BZ2L 3QXDB 5C7XL 2O61A 3DVIA 4PB0H 4DK6A 3EJJX 1U8LA 2Q3ZA 1W0YT 3KAAA 4ODSH 4YC2B 5L2KD 4EI6A 2YPKA 4PJHA 3Q5YA 4OLXL 1I9IH 1WQVT 4JDTH 3GK8L 4MAYD 1FYTA 5DRNA 5EU5A 1EGJA 2MHAB 2H41A 4LPTA 1U3YA 1U93A 2DYPB 4WW2B 3VRJB 2GSIA 3AGVA 1SJEA 1UC6A 3HG1E 5C0ND 2EXWC 2NX5A 4BFGA 3WNNA 5J13B 3IDGB 4PP2A 5HI4C 5IMMA 2NY3B 1LO2H 1PG7W 2GJJA 1EHLL 1AP2A 4OQTL 4M4RA 3H0TB 3BI9X 2VDMH 3IB4A 3O6MH 2J8UE 5FYKD 3UBXG 5E9DA 3VJ6B 4QRPB 4U1KA 5C0AD 4UDTB 5ESQB 2H2PD 1AH1A 3OKDA 4ZS6C 4NPYA 3REVB 2E6JA 5CZVL 3SDAD 1FPTL 2UVEA 4I5BA 2EDTA 2HFEB 1KT2A 5CJBA 3RY5A 1PYWB 4XMLH 3MJ6A 1P53A 5F7NC 4GAFB 2PTUA 2AJ3A 4X9HA 1OY3B 4P23C 4KK6D 5ESVB 4P2RB 1FJ1A 5EN2A 3BPCB 3D0LA 3L3HB 4JM4L 4YZFE 1IAMA 1S9WA 1IVLA 1JYVA 3T0XA 1GC1H 5GJSL 3TIEA 2EDOA 3MROB 1M6OB 1Z6JT 3X11B 2Y7QA 1CFQB 2AXJA 1A14L 4OZHE 4Y4KD 1BHGA 2G75A 1QA9B 4PJ7A 3X13A 1CXEA 1UT9A 4J6RH 2KH2B 3MRCA 3LQZA 2DBLH 5EU5B 3BEWB 2EDBA 5HHPA 3G5ZB 5DVKA 1LK3L 3QCTL 5ERWB 4HD9A 5HYFA 1RSFA 1BAFL 4I48A 4M03A 5T3XL 1A4JA 3QUXA 3TLRA 4BA8A 1S78D 5FYKL 1UZ8B 5GZND 3H3PH 4LIQH 5CCKH 2ZOLA 3Q0HA 1YPZE 2PTVA 5IF0B 2HTKD 3WEXA 1IM3B 4OLZH 5ID0B 2I07B 1KTDA 4QGTA 1VPOL 3HCVB 3MGTB 4NDMB 4DTGH 1L7IH 2CLVB 1F8TL 2CLZA 1NCBL 3KYNA 3MJ9L 5FHBH 2BNRE 2XKSA 4MQXC 1X4XA 3WN5B 1HHHA 5BXFA 4EDWL 2VDRL 5DQDH 4FRWA 3Q3GA 3NCFB 3FB8B 3MO1B 4EDXA 4GS7C 3D3VE 2VERN 2YRPA 5FGCB 2HH0L 2W1NA 5MHSD 4JFXA 4Z78B 2VLKD 1ZA3A 1HK6A 2FRGP 2UWEB 5ICXA 1DBKH 1JNHB 3TBTB 5GJSH 5F88A 1CXLA 1N3NA 2DQEL 4BZYA 1EVUA 5D7IA 3FT3B 2OZ4H 3ZDZE 1DN2A 1UENA 5CP3H 3RWFB 2CIKA 2JCCF 3FHQA 3VDAA 2KKQA 5EB9A 3V5DA 4P5MA 5IT2H 2DDQL 4U7MA 3CC5B 3NACH 3GSVA 3SKMA 4RFNB 2WNGA 1T7XA 3KPNB 4JLRB 5A2KH 3QUYB 4P4RA 3V6OE 4HFUH 4G7VH 4K3DH 5LGHL 1FFOB 4NRZA 1KN4L 4L8BB 2V2WB 4JY6A 1T04B 4EN3C 4UT9H 1RUQH 4GRWF 4O4YH 4PJFA 4XI5D 4QRRD 5D1XC 4Z76B 1IC5L 1DN0B 4A2MA 4XAWH 4Y16D 1QR1A 3B43A 2A83A 2P24B 3UYPA 2Z8WC 1KB9J 1RMFL 4WJ5A 5IEHB 2AJYH 1PFCA 1YEKH 4UU9A 4I9WD 15C8L 4UOW0 1INDL 5BJTB 3PNWA 1BMGA 5BV7H 3QI9C 1C7SA 4O5LL 4EDWH 4C56A 5CEYB 1RZKC 3GRWH 1HNGA 4HUUA 3EDJA 1A02N 4Z8FL 2BNQB 2CMRH 2VQ1B 1L6XA 2Q76A 3GO1H 4XP9H 4WV1C 1YYML 4DVRH 4YDKH 3HAEA 3IGAA 4LF3B 4Z7QF 4H0IA 5E94B 1YMHA 4QWWC 4WFFE 1UB5A 1IARB 5D96B 4OM0L 4J4PD 1WV7T 4YHIA 4PYGA 1GRWA 2R2CA 1KB5B 2XTJD 3DTXA 1LO0L 4UQ3A 2AAVA 3WFCL 3ULVD 1MIEH 4X4XA 4ZXBA 2NTSP 2QHLA 3AY4C 3H9HB 3IETB 2WUCH 3WFBL 1CE1L 3QXAA 3ALWA 3L9RB 1AQKH 4TPRH 2ZUVA 3VE0A 3RVUD 3KXFE 1BD2B 4JREC 3PL6D 2IG2L 1U3HB 1G9MH 1IGFL 2Y36L 5EZLA 4ODHH 5EPMA 1DBML 3JBG7 1ZHNB 4NJ9L 4ZYKB 1BOYA 4K3DL 1KIQA 1H8OA 3U82B 1UCBH 4K7PL 4OLEA 5B4MD 4LSUL 3OPZH 3BPLB 4GKZA 4JY4B 4LHUA 4UIKL 5J6GB 3JWDH 4IHOB 5CINL 3OAUL 3OAYK 5IMOB 5H35B 4P46A 1FNEA 2V7NB 1SY6H 2RFXB 4RIRA 4WW2F 2GFBB 4H0HB 4KKBC 1NCAL 3FONA 3P30L 3GBMH 1C5BL 3BPNC 4JR9H 3SKJH 5C0NC 1EFXD 4AM0A 1YYLH 3FHAA 3D3VD 3HI6H 1QSED 1FFNA 1NGYA 1MFBH 4OGXL 3N85H 4KRPB 1NEUA 3GMNA 2NW3A 1ZVHA 4PJIE 3GSXA 3P9MB 3OHXB 3B2UD 4LPWA 3FB5B 2F54B 4O51B 1I3UA 4FQCH 4OKDA 1S9YB 3SDAC 4WFEE 4BM7A 4DQOH 4PJGB 1E6JL 4PJEB 3WD5H 1IC7H 3U7AA 2X1QA 3NTCH 2EDNA 5FKPB 5IKCA 4UUJA 1NAML 3BMVA 2PETA 1WVZA 1MQKH 4ENEC 2NY7L 3VXSB 1MHCB 1IGCL 1QBAA 1UB6B 1T0MB 5JQHC 3NZHH 3MNZA 2A2QT 4GSDH 4U49A 1YEEH 4ZUUB 4QF1B 4KPHH 4Y4KC 3MLZH 4M5ZH 2R4RH 5E9DB 3BSZH 5IGXL 3AFLA 4UTBL 3SQOH 4QRSB 3D9AH 2YXFA 5CSZA 5CJQL 4MMXC 2RFXA 1T2QH 4PV8B 4LCWE 1DFBL 4JQIH 3QFDA 3G5VA 1P7QA 3MV8B 3BGFB 3VD4A 1BEYH 3BVNB 3MUGA 1FZKA 1E4XI 3D1MC 1I8LA 1S78C 1F3DJ 2XYCA 2IALA 2CDEA 4W70A 4XNXH 5I16A 1CE6B 1ZEAL 4WUKH 5BZWA 2QV2A 2EEBA 4G6KL 3SDXA 1OAZL 2OK0H 3G6JE 3LN5B 4HLZG 1GSMA 2VN7A 3PWJA 2ZG3A 3RWIA 3ZZ1A 1WIPA 5DDHA 1FH5H 3K74B 4J3WA 4YHOH 2PR4H 5FGBA 4AY0A 4RFNC 1EVTC 4DEPC 4XWGL 3UZQA 3S88H 3MJ7A 5DJ0B 4URTB 3UYOD 4WTZG 1VEOA 5KSAB 4XRCB 4OCRL 4FQLL 4IMLB 2R23B 1UZ8A 4OF0A 5TE6H 3TC9A 1IILE 3DUHA 5GSVB 4ODUB 1A7PL 1CK0L 1OWRM 5AD0A 5T33H 3NCBB 1NC2A 4DWHA 3VGHA 3QZWG 4PJBF 4PG2C 5CILH 1FIGL 3SGDI 2CJUL 4NT6A 4MB3A 1OCWH 3RVXD 3NACL 5C0GA 3V9FA 5HI3D 3RDTD 1BFSA 3RP1A 4YO0B 1AGFB 5CUSL 2CO7B 1Q0XL 2UZYB 1J1OH 2AJYL 4PJIB 3MUGB 4HAGA 2BVYA 2E7HA 5A2JH 4JZJB 3I2CH 3QUMB 4XBEH 3KYAA 3N1QC 5E2TL 4QRQB 3RL2B 2QLVB 5FUZH 4HXBH 1MCOH 1MI5E 5DQDL 4KQ4H 1MCPL 5E8PA 3U79A 2Y4SA 3ZSTA 1S8DA 2ERJC 4KUCD 1IM3A 2PO6C 2UZXB 3HE6A 2J5LB 4LKXB 3DVGA 3V5KB 5F93C 4PJXA 3ME0A 3O3BB 3VXSE 1AGBB 1OPGL 3ZHLA 4LHUG 2EC9T 5CP7B 5K9KA 4LU5L 1IGTA 1N0XH 1G6RH 2B5IC 3DX8A 4LQ1A 4JPWH 4PY8J 1IC1A 3AM8A 4D9LH 2X70A 4PJ5E 3I6GB 5IV2A 1U91B 5IUSA 2DS4A 4CMHC 2NW2B 3MYJA 1CLCA 3IS0X 1NGQL 4QWWD 4EXPX 4LCWB 1TPXC 1HIMH 3Q6FB 4XNMA 4C83B 3BZDA 2XTJC 4O2FA 1CDCA 5D2NE 3UROR 4RGMC 5B39G 4ZNEE 2PTTA 3HUJE 3EOTH 3O0RH 5C0GB 1A9BB 1FL5B 4GFTB 4GKNB 5I6XB 1XGPA 3VGBA 1J0HA 2R4SH 4G42B 4F57L 2AP2A 4F58H 2EC9U 3PL6C 4NO0D 2MCPH 3GB7A 2EO1A 3L1OL 1UA6L 3G6JB 1RMFH 3UJJH 2P8LB 2VQUA 4ZFZB 1CN4A 3U2SB 1RHHA 2R0WH 5IHUL 1ITBB 3ZT5A 4Q9QL 3BH8B 2VNCA 1WFOA 1YZZA 5I0DA 2W91A 4QHLA 2YC1B 1A1NA 5KW9L 3T2NL 3OKNA 3F58L 4C4KT 4OIBA 1I1CA 5D7KD 4OCXH 1G1YA 1O7SA 3QULA 5HPMA 4RBPK 4APQB 3UO1H 1ZLVH 1S3KL 2Q86A 4ZFGH 2WAHA 4YH6A 3DX6B 2OTUB 4KUZH 3S3SA 4KDTC 2K1MA 1I7UB 2DIJA 3U6RA 1U36A 4NQDE 2F74A 3OBAA 4JB9L 4U6YB 5DK2A 3ULVH 4TPRL 2XWJB 3VFRA 2BNQD 4CU7A 1KGCE 4DKEL 1QFUH 1HHKB 1OLLA 3V0VA 4JFEE 3SBWC 1IGJA 4AIZB 3L6FB 4ZUSB 1D5XB 3LH2L 3RTQB 5DK0A 4S1QH 1MI5B 3MLUH 3H9HA 3UTQA 4F8QA 2M8XA 4HWZA 1RK1B 3TA3B 4LFHD 3DVNB 1FYHB 3K1DA 4E5XB 1V3KA 4GUPA 4U6VL 3BEVB 2QADC 5J3HC 5EOTB 1J1XH 5A2LH 1GGUA 3QIBB 5IOPB 4OD1H 3MUZ1 5JPMA 4X98B 5ABDE 3CFCL 2VUOA 4QRUA 5E8EB 4DFIA 5L0QC 1FL6B 1EXUB 4HWBA 4P5KA 2R2HA 5E5MA 3QCUH 5EOQH 1QG3A 4DKFH 3HZKB 4HT1L 4JO3L 5HHVH 2XKUA 3ZDYF 3V0WL 5INDA 3U46A 5C0FB 4YHOL 4OCYH 4LASL 1RUKH 1R3LB 2CDFB 2Z93A 4HULB 3H7BA 4G6JH 5D2NB 3W5MA 2AXFB 4IIQC 1XCTA 1UYWL 5ADOL 3L7EA 1NEZB 4Z7QE 2G5BA 3UTTB 5J11C 3L3DB 1R3IL 4WW2C 5EU6A 1WFUA 4XPTL 3K2UL 5D9SB 5F96L 3NCYS 3MOQA 1WAAA 2I24N 1EJOH 4OQTA 3UXFA 5E2WL 3SE8L 4HEPG 3CU7A 3BWAB 2UYLB 4CVWA 5HHOA 3HI5H 2BVPA 3VMOA 1N5AB 2WMPA 1J0ZA 1T21B 4L8DA 4PRHD 5E6ZA 2GK0A 1UB6A 3VXOB 3VH8A 4M93C 4M8QA 3U7YL 1MEXL 2P8PA 1C5DA 2HFFB 3BJLA 4M5YH 3PP4H 1DQLH 4XBGB 4DCQB 4ODXB 2DQJH 3GNMH 4ZPVA 3F7VB 1G7QA 4R2GD 4D8PB 5HI3C 5D1ZB 3RDTC 1F4XL 4KXZH 5K93A 3RWJA 1MHEA 3DLQR 2RHEA 4WW1B 4DJMA 5CIPB 4RRPA 5C0BD 5I1CL 5EOQL 3B4NA 3DBXA 4KZDL 1FG2A 3LPWA 3LPGA 1YN6A 4PJCF 1BM3L 2AERT 3VFPA 4UTAH 5BW7C 4ZOEA 2ZPKH 4PB9L 2NY6D 2DLTA 4KGLA 1YDPB 4IIQA 3FT4A 3VFVA 5H94B 3Q48A 3S88L 5I74B 5I75C 1A21A 2W38A 3UBXA 3QUYC 3I3BA 3SCMB 3ILQC 2OTPA 3WNLA 3JWOC 5AZEH 4KHXL 4LNRB 4F3FB 4TVPL 1BOGB 4LLQB 1JHKH 2UYLA 3QHZH 2X9XA 5JO5B 1ZLVK 5AZ2L 4B41A 3BESR 5C07D 5FO9B 4WFHD 2XZAH 2EYRA 4WFGD 5J1AB 3D87B 3MJ7B 2YN3A 1EUTA 1PG7H 4R6UA 3VRJA 4OFPA 3UDWC 1HIML 5DMKA 4Y4FC 2X4NB 2PO6B 3X3FH 3BP7B 3OJVC 3CVHB 1T6VN 3T0VA 2VLKB 1NLBH 4B0MM 1FNGB 4IRJD 4JGJA 1JPSL 5AD0B 3NFSL 3L3OB 1N6QL 1WTGT 4H26B 2B1HL 2MQCA 4JFDD 2JB6A 1A7RL 1I85A 4FQIH 5CIPA 1IKFL 3QJHA 2JF1A 1RIHH 3BPNB 1Y6NR 2EDRA 4U3XA 1YQVH 3MNWA 3D18A 3QO0B 3U0WH 1KXVC 4WI2A 5GRJH 4Q9BA 1J8KA 2NY4B 4OZIF 3VWKD 4P3CH 4PGBB 4Z0BL 1BBJB 1VACA 4WO4D 3OKOA 3RGHA 4KUZL 1RZKH 1NBVH 1M6OA 5T1MB 1DLFH 1I1AD 4X7DC 4G9DA 1KLGA 4UBDC 3TWCH 3VFOB 3CXHK 1KIUA 4L5FH 2XKNB 2B1AL 1ZAGA 5AUMB 2GTZA 3PHOA 5IG7B 4ELMA 2H2SC 4GKNA 3BZ4B 3VWKA 5TDNA 4XGZA 1A47A 1D5MB 5LGHH 5C0CE 1NCCH 1DANT 4LIQL 5CILL 1KN4H 1W72H 2BHYA 2W60A 4OTXH 1OOAA 2BSRB 4UV7L 3ZKNC 4CVUA 1YMME 1VHPA 4L3EA 2AJXH 4AG4L 1C08B 4H20H 3CFJB 4NC1C 3MYJB 5IB1B 3SDCD 3P11H 1FAIH 2D7TL 2PYFA 4MZ3A 3O3DB 1CR9H 3BKCL 2ZCLH 15C8H 5E56A 1MJJB 2V17L 2OR9L 4NDMA 3VGGA 2X1XR 3D69A 3L5HA 3VI4F 1NMBH 4I0KA 2ZUSA 4QHLB 4RGMB 1A9BA 3OAUH 1CDHA 1K2DA 1T80A 5I1KH 3ARBB 1HHIA 3P40A 4LSRL 2F8VA 4Y89A 3FQWB 4R4FL 2EDFA 1I3GL 4J8RA 3TVMA 5HHVL 4PJHF 1D5IL 3LKSB 5AWNL 3FQXB 3SE3A 1P4IL 4JZNA 1BJ1J 3U0TB 4TULL 2B0SL 2QADD 3VD5A 3TBSB 3PWNB 2W0PA 4LEOA 1I8MA 2DQEH 4P2OA 3PL6B 43CAA 3QEGH 4P2RD 5IESH 5T1MA 3R06B 5GGVH 4F7TB 3MMEB 4X5XA 5IIEB 3MCG1 4ZO6A 3WFBH 4WI7A 5LWYL 1P4LA 4HWBL 3KPRA 3V2AR 4M6OH 5M7QA 5TDNB 4YXLL 1A1NB 4Y19E 2D4FA 3QUXC 1I7RB 4HLJA 5K59F 4LCCB 1IBGH 3QULB 4RRPG 4U1GB 5L88H 4YX2L 4LFHG 4GOSA 3QUYA 4P4RB 4P2YA 5HVGB 3WMSA 4GUPB 4K9EC 2FHCA 4Q6YA 3CLEH 3GMPB 3JWDL 3LRSB 4LVOB 3L3IB 5IOPA 5JPMB 1QSEB 1CT8A 3LY6A 3VFGL 4JPKH 1E6OH 1KCKA 4JG1H 1INDH 1G9NH 3K81A 3GSRB 4R3SA 3H42L 1J1PH 1TVBA 3QB7C 4NKIL 1LILA 1VCAA 5DJ8A 3PV7A 5GHWH 4XCFL 4OZGE 1MRCH 1N2RB 5DZNA 4JHWH 1A1OB 4ELMF 3NPZB 3SKOA 1S7WA 4I8DA 1Y0LA 4CN4A 4PGEA 3DO7B 1TLKA 3RZCD 2XZQL 4Y4KB 1MRFH 5IESL 5MEOB 5EUOA 5KSUA 4YK4B 1YMMB 3DX9A 4LPXA 1NSNL 3X17A 1JPTH 4YHYC 1OAXL 4FOMA 3H9SB 1WTLA 3T0DA 1WCBA 3CZFB 4ISVA 1KPVB 1KIPA 3VXUB 5GS2D 4NKOA 1WFNA 2A0LD 1WT5C 3EYQD 2F9BT 1MFNA 1LGVA 3GSQA 4PUBL 4YHLH 4F33A 3TBWB 2YN5A 4YDIH 4NZRL 4TQEH 1NKRA 2N4IA 3DXAA 3I3DA 3QUYD 4PP2B 3BP6A 5D9SA 2EYTB 2IFFH 3CSYA 4OZFG 4I18C 1YNTB 3PWPA 4PG9A 4WY7L 3GI8H 4RGND 4Z0XB 3N0PB 4P3DB 5C92A 3SJVE 1G9NL 4HFWB 1U8PB 5EO0A 4BZ1L 1QSFD 1BQHB 4PRPA 3CVHH 3IDNB 1L7IL 3MJ9H 5CUSH 2JIXA 2JCCA 3TCLB 3UBXI 2Z31C 5LAXA 3ZDXE 3AU1B 1GIGH 2IQ9H 4PGEB 3DO7A 4XCEA 4L4TA 3LS5L 4OIAA 1JGUH 1V3JA 1KNOA 1MIML 3OAYH 4G6KH 4P2RA 4U1SB 5EN2B 4OBRA 5T1LB 5K9QG 1R3JB 4PJ8D 5F9DC 4GXUM 3VFVB 1MAKA 3FFCE 2LFGA 1PDKA 5GGSA 3V6FA 5IFAH 1JN6B 2GJ6A 4JN2B 5IVZA 4OKVB 1S7QA 3IXTA 3OX8A 4WWKC 4JKPL 3ECBA 4OJFL 1SMAA 1MRFL 3TV3L 5A3IC 2DKSA 5I66A 3CSBA 4DOHE 1CLOH 3OXSA 4L5FL 4GRLC 1F11A 1ZWIA 3JWOH 4UOW1 2G9HA 5DUPH 3GSNA 4JG0L 5BV7B 4R2GB 4NUJB 3ZKXB 1CZ8L 4NRXB 5ERWA 2ZP0T 5DR5L 3SGEH 4F9LA 2YPLD 2AV1B 1OGAD 3UJIL 4NO3A 4UBDD 4OZGB 3P4MA 4WWKB 5IF0A 2R2EB 3DETD 1CVSC 1DBJH 2FYYB 3CU1A 2H2SD 2O26U 1KENH 3JXAA 1BGXL 2Z4QA 4FXKB 3IDXL 4G9FD 4MNQE 3O4LD 3ZKND 5BXFB 2NXYC 1CD0A 2VDNH 1U3JA 4F57H 4NBZB 1B2WL 5HGGS 3D39D 4Z7WF 1V7ML 3KPRD 2FO1A 1J5OH 1F3RB 1N5YL 3OB0H 5I1LA 1IEAA 3HC0A 2FECL 3VXUE 4PJ8A 3CSPA 2XTJB 5SV3A 3KR3H 3KVQA 4YLQT 2UZIH 4O9HH 4QRPD 4U1HB 4H26A 5DMJB 2HTLD 2DD8L 1X5YA 3WBDA 1KXTB 1ACYL 1F11B 1AD0A 4ZQKA 5DRWA 3V5DB 4K71B 4LRIC 4TULH 2VITA 4LLYA 3OKLA 4KKLD 1U8KA 1CGYA 5BVJA 2PUQT 2YMXL 4NRXA 4BZ2H 9CGTA 4HFUL 2DWEB 4PJDE 1J0JA 5D1QD 3QQNA 4NO0B 3THMH 4X6BB 4Y4HA 5EORH 3EDFA 5CWSA 1MNUL 1YEIL 3KJ4B 1CI5A 2NY4C 3NOIA 2ZNXA 4D2NA 1F6LL 4GXVL 5BV7C 2YD8A 1MCHA 3GM0A 3DV6B 4NQCD 2HT3C 2I5YL 4L8SB 5FGRA 2R1XA 3QEUA 4G9DB 3ALXA 2AI0H 3M8OL 4JHZA 1FZJB 1F3JA 1FCCA 4KGJA 3RVVD 4WVRA 5F1IA 3V79C 4MJ5B 3LKPB 3QUXD 4ZODA 3FFCB 4JFQA 4XX1E 1PQZB 5D96C 2VDOL 3V6ZB 4CNIB 1N6QH 4Q0XH 3GRWL 4PREB 4MHHG 3PWUA 3ZTNL 4QNPE 1DEDA 3WL9A 2OL3L 1OF2B 2Y07L 1I8MB 2P7TB 3KNBA 1C08A 1Q94B 2VC2L 3F7PC 4I0PB 1GC1C 1SM3H 4JKKA 3QNZA 1MCJA 2F54D 3F58H 2BMKA 2XWTA 5GS1C 5ICYA 3IFPB 2A6DA 3PQYA 2Q7YB 1TFHA 3F12A 1OL0A 1AO7B 2BVQB 3DTXB 2HLFC 3QEGL 3HG1B 2A6IA 5C6TH 2DD8H 4DGVH 3KPMA 1CE1H 1UH4A 2JK5B 2ORBH 4NQTA 3B8SA 2Z35A 3VD9A 3IDJB 3TNNB 3RZCC 4X99A 2HVJB 4QRPE 4NC2B 1PY9A 4LEOB 2J8UF 2NMSA 2Z9TA 1UCBL 5FIEA 4UV7H 5F96H 1ND0A 5E9DD 5IB2B 2A9NL 4Y2DD 1NFDB 3ILPB 2E27L 1FZMA 1BWMA 2D0HA 3GHBL 5A16A 5BRZE 3QCTH 1J11A 2WINA 3MLXL 4FZ8H 1RJLB 2PTTB 3GFUA 2XG5A 1P4LB 3MYZA 2VWEE 1F58H 3G6JF 3LEVL 4PJ9A 5F3BB 4JO1L 2GFBA 3QO1A 2W59A 4NOBA 3V4PH 1RUAH 3GJFB 4AQOA 5ACLA 4FQHB 5IVXE 4RFEB 3SY0A 2OR7A 3GMLB 4XCFH 4KJQD 2IQ9L 2NQCA 2R0KH 2SEBA 3U2SA 1ERNA 1R5VB 3UTSE 4E41B 4ZUWA 4N5ED 1Z0NA 1WIOA 3SO5A 3RPKA 3P4LA 3GSXB 4M6ML 2P47B 4UILL 4F2MB 2F54A 1AQDA 4PJDB 4JN1L 1KLUA 4Z7NF 4YDJA 2MCG1 3S34H 5FYJH 3EGSB 1I3RB 2YBRA 3BYTA 3CFBA 4FZEH 1E28B 1QTYT 3BE1L 1O0VA 3P77A 2IPKA 3T2OA 3GIVA 3Q1SL 3H6JA 1QFOA 4PD4J 1IQWH 4N1EA 4RQQA 5E2WH 3PGCB 5C0IB 4EBQH 5CFHA 4U31A 5IQ7H 4Z7WE 2P5WE 2EYTA 1WZ1L 1QYGH 3NAAL 2BFVH 3I6LD 1RU9L 2F53E 2OL3A 5MEOA 3EFDL 4NFDA 4KWUA 4LMQI 3UJTH 4NM4H 5J9PB 4HWEL 3HKFA 3GJEA 3LQAC 4LL9A 1A6WL 3MC0A 3VD7A 1AE6H 3G9AB 1KENL 4JRYA 4UT9L 3QFDB 2DMBA 4E0RA 4TSBL 2IQAA 1OP3K 1R24B 2X05A 1KPUA 3IDMA 4FQHA 3ZKSD 4WIQA 5L2JB 4YHNA 1INEL 2MOVA 2V7HB 1AO7E 1LO2L 5DMIL 3BGAA 1EEQA 2SEBB 4IOFD 4NJAL 2R0KL 3T0BA 3BQUA 2XNAA 1GC1L 3A6BL 3CVIL 5B21A 4TTDC 3OX8B 3RUGA 3ARQA 4JPVH 3MJ9A 4Z0XA 1MWAH 1J9CT 2A74A 1PZUB 2XZZA 3BZFB 1BJMA 1A6PA 3MGOB 4X7EC 2J6EL 4NQEE 5C08A 1MLBB 2NXYD 2BZDA 5ETUB 3QDGA 4TUKL 4L4VB 1CFTB 5CMAA 2Z8SA 5TH2B 2AEPH 3GIVB 4HG4J 2D7QA 3O11A 3HN3A 1SJEB 1S5IL 3JWOL 1MREL 1NGPH 2H9GA 4MWFB 5EO9B 3QEQB 1G7IB 2VABA 4BFBD 4KK9D 1S7QB 2C7UB 1HXMB 2FNBA 4RGOH 4FFYH 2DB8A 4W68A 3RBGA 4JRXA 4RBPH 2AQ3A 2BNQE 2NY5H 4JFDB 5DWUL 5FM5O 5GS0L 3REVA 4PRID 3MACL 2FR4A 3BO8B 4GRWH 1JWSA 4C56D 1DBJL 3O3EB 2G9HB 4HPYH 4JFED 3U9PH 3VI4E 2VJXA 5MP6L 2DLEA 3TO4C 3A6CH 3GUTA 5IBLD 2NZ9D 3OTTA 4R90H 5HPOA 5C0BA 2NY4D 3EYVB 4QRQA 4MAUH 1HZHH 4R4BA 2Y06L 3QFJB 3TYGL 1QBLL 2AEWA 3O6FB 3CGTA 1CFQA 4K8RL 3QHFL 3RVVC 1S8DB 3R0NA 2EE9A 1A7BA 2E9JA 4WCYH 4YXHL 4GQ9L 1I8LC 3VJ6A 2VDOH 5D4QA 1T1YB 1MHEB 2NXZD 4JFOB 5C08B 1AD0B 4DVBB 2CK0L 1IAKA 1LO3H 3LQZB 3N85L 3ZSSA 2AJSL 1U8HB 2P5WB 5ITBL 3RX7A 3SGKC 2HRPH 5ADPL 4K3JH 3E6HB 1TCMA 1HCVA 1KOAA 4NQDD 5FCUL 3RY4A 5TF1L 5EO9A 4PJ9C 4XPFH 2QHRL 1UXWB 2FD6L 1N8ZA 5CS7A 1FO0B 2UV3A 1S9XA 3O2DA 5DR5H 2NY0D 5EWIL 4HW6A 5C09B 4YQXL 4NQVB 2BOCA 2ADFH 1H5BC 3IDIA 3WFDH 3JV6B 3D5OF 1WC7A 3BUTA 3WS3B 2IANA 2EEAA 4OCWH 3VXNA 1OAYL 1RZFH 4KY1L 5CKAA 3EYFA 5K9QI 1HHHB 2OCFD 3R8BB 2EXYD 3STLB 5D7LD 3WS6A 1PVHA 4R4NC 1NBQA 1U8KB 4GBXB 2D7TH 3I75B 1R3KB 5KSAD 3DGGB 4ONHA 5ANMA 5EFIA 4OLWH 4F7PB 3N50A 1AFVL 2FX7H 2MPAH 2R2BB 3NIDF 1I7TB 4OCSL 5SWZD 4Y2DC 4PJEE 2D9CA 1HXYB 2VDPH 2AK1H 2UWEA 4G5ZL 3LKQA 1NAMA 1P6AB 4NHUB 5I1DB 1B0RA 4F7CA 1Q9OB 5DJYB 5FUCC 1UM6L 4I3SH 1KPRB 1WK0A 5EBWA 4PY7B 1RUAL 2ENYA 4NHCL 5LJYH 1WBZB 3BKYL 5GRUH 4YK4C 4NGHL 1MELA 5HHXH 2P8MA 1YQ2A 4HK3N 4XBPB 1UZ6E 5E4EB 4IOSD 4ZSOE 4KJQC 1ZVSA 5ITBH 4ZPTA 5DQJA 4N5EC 1RZIB 2ERJB 5E2UH 4PTUA 1F4YL 3MV8E 2ED9A 1JPFA 3TN0B 5FUOL 2N7BA 5I1GL 4G43B 2BSTB 1OAUL 1YEDA 3WS3A 5DS8B 3UPAA 2P24A 3WFDL 1BWWA 2W9DL 3LQMA 2VISA 2P49B 3WIHH 3RPIB 3RNQA 2GHWB 1D5MA 2BCKA 3TVMC 2AK4E 2E9IA 4ACPA 4Z18A 1Q72L 3B5HA 1Z5LB 1N64H 1CQYA 1V3MA 3TT3H 5D7LA 1A7NH 3B8YA 4PBXA 5J89A 2GIYA 3HZYA 2DQTL 4OD2A 5D6CB 5DD0H 5DJXB 4JQIL 1F8TH 3LKQB 1ND0B 3EZ8A 2AABL 2EDXA 2VXUH 3TZVB 3MNVB 1ZHBA 4YHIB 3D85B 4RSVA 3ULUH 4Z9KB 1FVDA 1A3RL 4KJYB 4U1GC 4UQ3B 3RY6C 1V7NH 3O2WH 4ZTPH 3D0VB 1A1MB 1JTOA 5F3HA 3T0EB 5CBEB 1U3HC 3UPCA 3U4EB 2RJMA 4WJ5B 4XPGH 3U7WH 1BD2D 5T5NG 1UJTA 1CU4H 1DCLA 3MV9B 1SJHA 4OCLC 4G8FB 4NC0B 5I17A 5D2LE 1R3LA 3VA6A 4TUKH 4YUEL 1HH6A 4WEBH 4GG6B 4RFEA 3SY0B 1JZ8A 1UH3A 3OXRB 5CBAB 1A6TA 2NY7H 5FYJD 1MREH 4HIJA 4MD4B 1DQJA 2ZSVB 3MRIA 1JV5B 5E2UL 4L8CB 1S9VB 4OF8A 5F7YC 2UWEF 2C26A 5J6GA 5I1GH 3HRZB 1FNSH 1LE5A 3CLFH 3GJEB 4ODTH 3CPLA 2OXGA 1U8IB 4YDJB 2BCKB 3HAEH 4PUBH 4CJ1A 1DBAH 5F9OL 1PJ9A 3NBNA 4XC1L 2P5EA 1N5AA 4G7YH 3BIAX 4HKZA 1E4WH 4RFOL 5KZCB 2A77L 4LNVA 1XH3A 3KPLB 1WUNT 1QBML 2I26N 5E2JA 4L8SC 4OFIA 4KK9C 1MFCH 5DJXA 5I1HH 2X7LB 5CEXA 4PJDF 3QNYA 3OHXA 5L7XH 3INUL 4MNGA 1R5IA 2DICA 3QHFH 1JYXA 4LHUB 1T89A 1W72A 3RTQD 5HDBF 5F3HB 5CBEA 3T0EA 1ORSA 2MKWA 5CZVH 3ARVA 1AKJA 4P46B 4RIRB 2NY2D 3UYRL 3I9GL 4YHPB 1BM3H 4QRTB 2OI9B 1JVKA 3TEUA 2MNUA 1LO3L 2IGFL 5JW5A 2NZ9C 1KJ2L 3FQUA 4QTIH 5JHDA 4XWGH 3QPXH 3O11B 1JWMB 5T5FH 3BPCA 3WHXA 3D48R 1PZ5B 2NNAB 1FGNL 2ATPB 3MLYH 1T0MA 1WIUA 2JJSC 2XXCB 5J6HA 2IMMA 5FM5M 1PLGL 1YA5A 4JCLA 4G8GD 3QH3B 3RWEA 1LEGB 5C9JB 3SDDD 4YQXH 2A74B 4OF7A 2EDWA 1QA9A 3F7YA 1NGQH 1WWBX 3ARPA 5KVMC 1GPOL 1SVCP 1OTTD 1JZ7A 3OKMA 3SE9H 3GM8A 3K3QA 4HKZB 1LK3H 4U6TA 1P9MA 5EORL 3MBXH 1A4JB 5T1DH 4AEFA 5I8OL 3NN8B 4BZ1H 5F7KC 3WN5C 5M95B 5HJ3B 1R5WA 4RA0C 4XP5H 1R5IB 5D2LB 5C0EA 4KMTL 3RGVA 3MGTA 5DMYA 3SDYH 4LBEA 1NCBH 1GIGL 3RWIB 4EOWH 3KYOA 1UWXH 1QBLH 4QRSA 4ZFOA 4JANA 2EXYC 5GRXG 2F8OA 2FR4B 3W0WD 3QA3B 1U6AH 1RZ8A 3FQUB 5IM7B 5I1IL 1R3HB 5DVLA 3HPLA 4PRIB 3L5XL 4Z6AT 5KSAA 3HE7C 4LSRH 3RGVC 3TT1H 4V2CB 3WXWH 4JFEB 2X4QB 3KYMA 1K5NB 1QLFA 3NA9L 3QFJA 1MF2H 4Y5YC 3F7QA 4WNQB 2D0GA 1MFAL 4NNXB 3GMQA 4FP8L 2BJMH 1RUKL 5HYJB 4J12A 3VFOA 5KG9B 1IGMH 5F89A 1IGYB 1E27A 2AK4D 5T3XD 5DDHB 1J87A 1J0IA 4HS8L 1F02I 3BUYB 1IAKB 3BD4A 3C60B 1D9KA 5SWQB 3BP5A 4XC3L 5CAYB 5DJ0A 2XIDA 5E8OB 1U93B 2DYPA 3WDJA 1VDGA 1IZJA 4RMWA 3O8XC 2NX5B 3FB6B 1I7TA 4C59B 5FDWA 1HI6B 4YHMH 5GZOD 2GUOB 3FMGH 4X6EB 3SCMD 5BS0E 3ARRA 2PYFB 3S4SB 2HG5A 2XXMB 4ZDHA 3UTTE 2WWMD 3G9VA 4PY7A 4JANB 3TVMD 4XNYH 4MSWB 1F58L 5GGUB 5IEHA 5DO2D 4FXGB 3BAEL 4UU9B 1NPUA 5DXWA 1T1ZA 2VDLH 1AC6A 2OZ4A 3KPSB 4M5YL 3IU3B 4EZMA 5E2VH 5ESVA 5I1JH 4ZPTB 2BY2A 2CK0H 2FH8A 3BKYH 2NCMA 4TNWF 3L5WB 4JFYA 4OT1L 4QYOB 4LCCC 8CGTA 1X5XA 5D6DA 1HE7A 4GRMA 1MPAH 4GW4B 3ZE2E 3MJ8B 2R1YA 1U3HD 3L3KA 1ZANH 4JREB 3OKKB 1MVUA 4G9FA 1T03L 1J8HD 1B3JA 5IROA 1M05B 3RJDA 4GMSL 3GI9L 4BSWA 5TGBB 3S34L 3B2VL 4G6FB 5HHPB 2Q6WB 1I1AA 1YUHA 3AMKA 4S1DD 1MJ7L 5E8OA 5AZEL 3N1FC 1TJIH 1OSPL 5GGTL 4Y5VB 4BH7A 2HT4C 3ZDXF 5FYKH 3ZHKA 4RWYH 3HS0A 1S7SB 5CJOH 1MFCL 2YZ1A 3LDBB 5HVWA 4X6DA 2BRQA 5JOPD 2VZVA 4N5UA 3WJJA 4JY4A 4NOFA 3H9YA 3S3JA 3BGFC 5DD1H 5DD0L 1MHPL 4QTHB 3WJLA 1IEBB 4M48L 4JFHD 1BVLA 1A1OA 5MERA 4HCRA 2CSPA 5HPMB 3HZMA 1ZLSL 3PP4L 3IJYB 1CXIA 1W8NA 2GEEA 5I1JL 4MD5A 3FAXA 1AGEB 1MAJA 1RHHB 2NR6D 2F74B 5DK2B 1C1EH 3CFKA 3FO1A 5DHYA 1HHJA 2NYYD 1JV5