4QCIB

Pdgf-b blocking antibody bound to pdgf-bb
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSYISDDGSLKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARHPYWYGGQLDLWGQGTLVTVSSAKTTPPSVYPLAPGSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-PDGF-BB antibody - Light Chain
publication title Characterization of Binding Mode of Action of a Blocking Anti-Platelet-Derived Growth Factor (PDGF)-B Monoclonal Antibody, MOR8457, Reveals Conformational Flexibility and Avidity Needed for PDGF-BB To Bind PDGF Receptor-beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 44
structure length 214
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qciB01
3DXAB 4J3XA 1YMMA 4RDQG 3CFKB 5INDA 1EGJA 5IFHH 1S7RB 1FHGA 3F12B 3UZVB 3RWJB 2YPLE 2WLYA 1JGUH 2C3WA 2L0DA 4I4WB 4UNTA 3K81A 5FOJA 2CDFB 3DECA 3KPMA 5F3HA 3WLWC 1RZ7L 5JNYA 1S78C 4O4YL 2BVTA 4X6EB 1FAIH 5B8CC 1K2DB 1CR9H 3RDTC 1N4XL 4YK4C 4KVCH 5ABDE 5E4EB 1V3JA 2UZIH 4XPHH 2IEPA 2AXJA 5JO5B 3BEWA 4AIXA 3ARFD 2P4AB 3WMSA 4V1DE 1QA9B 2X4NA 5DRXA 3VCLB 1NEZA 4MCZB 3NFNA 2OJEB 2X9YA 2DLFL 5DSCA 2H26B 5C0ND 5CUSL 4QOKA 3DROB 4LEOA 4NWTH 2G2RA 1RVFH 3ARBB 3EW3B 4W4OA 3HC4L 1DUYA 1C1EL 4PJXE 1BBDL 3ZHDA 5HHOE 2R1XB 5DUML 1N5YL 4P46B 3BP5B 1G9MC 1XR9A 2W60A 5FA3B 4KZDL 5T3ZD 4PGJA 1JGLH 2VXTL 5IHLB 3RI5K 3A67L 1N0XL 4HHAB 1A0QH 5TF1H 4PJEA 1S3KH 4WI5A 4DZ8A 1X6LA 1OSPL 4XP6H 3MRJA 3IU3A 3RZCD 2NXYD 3TJHD 4MXVF 4XWGL 4J3UA 3PWPA 4B7IA 4TVPD 3ULUD 2HJKB 4JHZA 1IGYB 4HXBL 5HGGS 4M7KL 1T1XA 4JZNA 4OAWB 1FH5H 2ICWA 4HJ0C 1MHCA 1AE6L 4ETQB 5BS0D 1KPUA 3KNBA 3G6JF 4MX7B 1BREA 5FA4A 2BNRD 1ZHNA 3CX5J 1I1CA 1J1OL 1HKFA 1UJTA 2IAMD 4WUKH 3KPRB 2PW2A 5JUEL 3SGEI 3AREB 2VDNH 4EBQH 2QJDA 3BHBB 1KCVH 1AXTH 2CO6B 1K4CA 3TN0B 5GZND 2NY2C 1LEGA 1ZOXA 1ND0B 2W1NA 3B83A 3GBLA 3HMXL 1KCRH 1F42A 3D87B 4JGMA 3TBSA 1OTTD 4XGZB 2NY3B 5DT1L 3VRIA 4UU9B 4CJ0A 2IPTL 5EOQH 5H35A 5T1KD 2B4CH 2Z8RA 4PJHE 5F1KC 3KLHD 5CKGA 1U41A 2CMRL 2LTQB 3BKCH 2DKMA 1FFPA 3N85H 3QAZB 5GS1A 1EEZA 1HILB 1RURH 3MV9E 1I9JL 1MJ8L 4N0UE 5EC1B 3TNNB 3TJEL 3QIBB 4ONGH 1CL7L 4BM7A 1HCFX 1AO7D 1I9RL 1H5BA 1N6VA 4OLXL 2WBWB 3F7YA 3SDYH 1AGEB 4Y4KA 2VQTA 4M8QB 1V3KA 4OZFA 1QQDA 3V9FA 2A73A 1MCCA 4X8JA 5IFJB 2A83B 2HRPL 4K2UL 5FHAL 3T04D 3C9NB 4PJ7B 4MAYB 4WCYH 3UPRB 3GMOA 3MA7B 4UOW1 3FOMA 4F2MA 3S37L 3ARPA 4LSRL 3FCTA 1U8JA 2NY4D 5HYQA 1WZLA 4JFPB 2BOBA 4PJDA 5F1IB 4G9FD 2DOCA 4OCYL 1YQVH 4UV4H 4OJFL 4P2QA 3KS0H 3I9GH 4PGCA 2IGFL 4IRSB 3NN8A 1T03H 2JLLA 5DMIL 3EO9H 4RFOL 1MPAH 1IC7L 5C8JB 4QXGL 5GRJH 3V5KB 3SDXE 2GJ6D 4LLWA 2PR4L 1WZKA 3DMMB 1FAKT 1CQYA 3VXNA 5EFIB 4Q6IA 1P4IL 4FXLA 3HZYB 3VJ6A 3WIHH 3O11A 4MA1B 3S8WA 1HHIB 2Y7QB 1DEDA 1DBBL 2DRUA 1RU9L 5C0GB 4Y4FD 4OGXH 5C0AB 1JUFB 3ULVC 4FQXB 3RNKA 1HSAB 1NBVL 1KTLA 5CD5D 4QHKI 5AYQA 5GZOD 2QQNL 1MF2H 3FRPG 2ZOLA 3SKJH 1Y18B 1T22A 2VDML 3VXMA 3E3QC 4HGWB 1LWRA 1H5BC 3S34L 2X2YA 1NMAL 5LBSL 2R0WH 5IV2B 3AS3A 3CFBB 1Z2KA 2JELH 5T1DH 2ZPKL 3P4NA 2AEWA 3O2VH 4WEBL 1WISA 3HI6L 4PRHE 4DAGL 1NCCH 4PREA 1F4XH 3U30B 4A6YH 4U7SA 4AEHH 1SBSH 2M1KA 1FSKC 4ISVB 5I18L 4FRWA 3IS1X 1BZQK 2H3NB 4ZS7L 1XF5A 4RGOH 1B90A 3IJHA 4JDTL 2NY1B 2XZQL 3PDOA 3BFOA 5DJYB 3NCCB 5D2LA 1FVCA 4R4BA 1E28B 4N0FA 1U95A 3H9SE 4ZTPH 5TDNA 4F58H 4X0KB 2DI7A 2VXUL 1X5LA 4PJDF 1OGTA 1AIFB 1LK2A 1ZWIA 1DVFD 1EIBA 1MNUH 2BNQD 2HAZA 3UTTA 4HKXA 1AP2A 3ARWA 5IW6A 5KSBB 3D2UD 4LLVB 5F71A 3SPVA 5HYJD 2EECA 1RIHL 4JFYA 2VLJB 2A38A 1YZZA 3HKFA 1MI5B 4NQCD 3MQIA 1NAKL 4Q6IC 3UTZA 3FN9A 4KI5D 5DWUL 5EUKA 1IGJA 2VDRH 1O7VA 1JWUB 4ZUUA 4RQQB 3ALWA 3D39A 4MGXA 4JM2C 3WUWA 5D72H 4U1LA 2ATPA 3GSOB 1DFBH 5H2BA 5CINH 1CD1A 1H3XA 5EU5A 4OZIA 1SM3L 3UTQB 1MFEH 3VXUB 4JRXE 1RD6A 2EE2A 1N5AA 2V2WB 2FD6L 2Z8SA 1IAIL 2AJXL 5E6ZA 3UYPA 5I1DA 2A9ML 2DQIL 2YZ1A 1JPSL 5IJKC 4LF3A 4U6YA 1OQOA 3S5LA 3BPNB 4YO0A 4XB7A 1DLFL 3L3GB 3MTRA 5JDJA 5CWSA 5IB1B 5ANME 3SGDH 3IJYB 4AH2A 3H2WA 2Q76A 1NCAH 2HTKD 4POZC 1K6QL 2K7PA 3MRRB 2AKRB 1NBYB 1RUQL 1FE8L 4MDJA 1VB9A 1F4YL 1NUFA 4LQFL 4FABH 3CU7A 3V6BR 2FJGB 3KPNB 3P30H 1BVKA 5F44A 1HI6B 4C56B 3BSZL 3Q3GA 2VZTA 1BVLB 3BVNB 2RCSL 3JWDC 4Q0XH 3IJSA 4QHLA 4OZGE 5C0JB 4BKLB 1VFAB 5TDOA 5D7KE 1NJ9A 2A6DA 4NO0B 1DBAH 3IDYC 4EEEA 5F97E 1KIPB 1VKXB 4MB5A 2D7MA 2BSED 1JI1A 2VH5H 2I26N 4NP4H 5KJRH 2ZG1A 5J4MA 4OZHB 1EHAA 4HK0A 4LCWA 4U1HB 1DQQB 2D7OA 4XMLL 4H20H 4OF0A 1CICA 1KCUL 2V2XA 5JOFB 3IDMB 3OQ3B 5CEXB 4DN3H 3SDCD 3FHAA 4R3SB 3DX8A 3DV6B 3E6HA 4OLZL 4JFDE 2C3VB 4U31A 5FXCH 1UM6L 1I3GH 2EKSB 3JV4B 4RIRB 5F89A 4JHBA 2OSLB 4NRZA 2G60L 5EU7C 4X7EC 3QZWB 3WE6B 3QNYA 1UXSA 4OZIF 5CBAB 3W5MA 3QI9A 1EJOH 2ZSVA 3ULSB 3OZ9H 1J5OH 4HIIB 1ES0B 1YYMH 3FO9A 2UV3A 1W0VA 3FTGA 1KPRA 3AM8C 3BDYL 1EJ6A 2NPLX 3OR7A 4HGKC 4WO4A 3VA2C 3VD9A 1CGSH 3SOBL 5HHPB 1MOEA 5IVXA 4DK3A 1S9YA 5EIVA 1MHHA 3D25B 5SWZB 2NZ9D 1BGXH 5AAWA 5HHNA 3PXHA 3MRFB 4MDIA 5F7LB 3O6ML 1H3VA 3DRQA 5BRZA 1C16A 1WBXA 3KYMA 5CILH 5JXAH 1YEJL 4DN4L 1XF3A 1BLNB 4XH2A 3VG9C 2H2SC 5E24E 1KJ2H 4XP1H 5JW5B 2R2BB 4KZEL 4UTBH 4MAUL 3J7HA 1OAQH 4M6MH 1FG2A 4Z7VA 2OTUA 1QLRA 4M1GL 3C2SA 4RZCB 3VE0A 4YXLL 5DYOA 2EIDA 3REWB 4C55A 4HWBA 1OP5H 3MODL 1H8OA 1I8IB 1PLGH 1RUAH 1JTPA 1FL3B 3KWWA 1OD9A 2CJUH 5A2LH 3HRZB 1DUZA 4QRSA 4NHUB 2DI9A 4HIHB 1LO3H 3HG1B 3KPRE 2MFNA 4J3SA 4HWUA 2HKFL 1XGTA 5IEKA 3IKCA 1K3IA 2KH2B 3C6LB 4DVBA 5D1QB 1TPXB 4PRAB 5F96L 3O3DA 4MS8C 5I1KL 3TGXA 3CH1A 3GB7A 4X7SH 3PDDA 3VI4F 3O45B 5FB8B 1GGCL 3QI9C 4KJYA 1T4KA 1I8KA 4NN7B 3DNKA 2APWA 2DQEH 5L2KA 1IEAA 2X4UB 2R0LH 1WBZA 4YJZL 1RZJC 2EDTA 1DBJH 4BH7B 3B9KA 1FJ1B 2OR8A 1BFOA 2GUOA 5HPOA 3IU4H 4ODVH 5DHXB 4YXKH 1UB5A 4JFQA 4RFEB 2V7NB 2VSDA 2BRRH 2UVFA 1WBYA 1A1NA 3HZKA 1HHKA 1TZGH 5DR5H 3SE9H 4R4NC 3BISA 4KMTL 4O51B 5E0QA 5JTWA 1AD0B 4XTRD 4BQCA 3DX7B 2DIAA 4FQLH 5E9DA 2ZCHH 3GKZA 3B9DA 4JVWA 4FFZL 4U0RB 4I18C 3HPLB 6FABH 5FO9A 1KCSL 4XBGB 4PJ7E 2HVKB 1TJHL 1T89A 4MJ5A 4JZJB 3RGVD 5T1MA 4FQCH 3LQAL 1P4BH 3LKRB 1IGTA 4KDTA 5T1LB 3MJ8A 4PV9A 1NGYB 2UY6A 1EUUA 3ESUF 4PB0H 1OP5K 3DGGA 4R97C 1AD9A 2BSSA 3BP6A 2NNAA 3BP7B 2CIKA 1Q94A 4C4KT 3QO0A 5MEPB 4U1MB 1W0WA 4XZUB 4R6UA 1CFNA 1DQTA 4XPFH 3H9YA 4PJGE 3MLXL 4JCLA 4OB5L 3C5SB 2F19H 1NCWL 1MWAL 1FNEB 2Y06H 5FYJU 5J1TC 2D9QB 4F33B 1J05A 4GUPB 25C8L 2X4SA 1BX2A 2WANA 2VN4A 3I6GB 3U0TB 3EYFA 4C54A 5EO0B 2I60L 4LAJH 5C0AE 2YSSA 2Y07H 4P23D 3S4SB 4IRZL 2ITCA 1A64A 1YUHA 1A6AB 1CLCA 2ZCLL 2OK0L 3BZFB 1BOGA 4RGND 3PWJB 4JANB 3MBEB 1FV1A 3OWEA 4PGDB 5BZWB 2I07A 1A6ZB 4YPGA 4OCLC 1T5WA 1A3QA 3T3ME 1UZ6E 1TVBA 3T77B 2DM4A 2YPLD 1IM9A 2CDEA 4LPTA 4ODUA 5D96B 4PRIB 4XNQB 4IDLA 4UIKH 4G6AD 3LPFA 2BMKA 4QRQB 1CXIA 1G6VK 1MHEB 1JNLL 3MJ9A 4JZOA 2P5WA 2GK0A 5L7XH 2DDQL 4DTGL 3GI9L 1BD2D 4NQVB 1QSEA 1S7UB 1AC0A 5FUCE 3C60B 3VA6A 5DC4B 1X5YA 4KDTC 4Y4HA 4PPTA 1IL1B 2EDWA 4L1HA 1WCQA 2PN5A 3FRUB 3LMJH 3ZHLA 2K7QA 1WFNA 4QNPF 4XPBL 4V1DD 3O4LB 1OY3B 5IBUB 5IVZB 2HJLA 4ZUVB 5L88L 3F58H 5L6YL 3DI2B 1CDBA 1ZT7B 4GRWF 5KSBE 5D71H 1F6LL 2F54E 4G8GA 1YYLL 4KJPC 1G6RB 4DKEH 3K46A 2VLJE 3D3VA 4V2CB 1A2YB 4NNPH 3SGKA 1MI5E 4PJ9C 1HNGA 5EZOL 4PG2C 5JDSA 4MB4A 1U0QA 5J6HB 5BV7C 4G6FD 5GPRA 5JQ6H 5EU6E 4LLQB 2HT4C 3OXRA 5K93A 5TFSH 3V6FB 2QQLH 5A40E 1HEZB 3T0XA 2IPUK 3GMRB 4X4YB 1X5ZA 1TZHA 3VXUE 1A9BA 3MREB 1B3JA 3V6ZA 4XXDB 1BQHG 1U8QB 4K8RC 4OKDA 1ZLSL 4D9QE 3LPGA 3ALXA 4GQ9L 1OARL 4RAHA 3DJ9A 4P9ML 2L7JA 2VLKD 4XC3H 1T3FB 3SCMB 4R90L 4ZFGL 1V7MH 3WN5C 4JFZH 4R2GD 4ELKA 1RIUL 1NAMH 3ZYJA 4PLKC 4U6XA 2OM5A 3EGSA 3BESR 3V79C 4LNVA 3H42L 4PJAF 1FL5B 1U2HA 4PB9L 5FO7B 3TT3H 4PRDB 4ZUTB 3Q5TA 3KPQB 5DD6A 3LY6A 3FFCA 3P73B 4QRTA 5JORB 5F9OL 2APTA 3EJZD 1LO5A 4IRJD 1U8MB 2FB4H 3PL6D 4EUPA 5K9KB 1V7NH 4KMLB 5D9SA 2ORBH 2XA3A 3RWFA 4RX4D 1F3JA 1IGMH 4LCUB 2WINB 1Q0XH 3U79A 1BQSA 5KG9A 4OZHE 3RTQA 1PKQA 4KUCD 2Z31C 5IMMB 2Q7YA 4K94L 3I3DA 3MV9D 3ELAT 4PJCF 1D5MB 3BH9B 3SGKC 3UYRL 1WK0A 3QUYB 3QDJB 2F8OA 4O02H 1NMBL 1MJJA 3TCLA 1UADC 3KXFA 2V6HA 5HPMB 1LP9A 3I3BA 3O8XB 3WJLA 3BPLB 1A3LL 5I1AB 1OQXA 2FHBA 5ECJE 2GSGB 5FYLD 3A6BL 2JCCF 2W0PA 4H25B 3AS2A 2W0LA 2XN9B 4MD5A 4YDJB 4EXKA 3QEQD 4C83B 4OLYL 4OLVH 5HGDB 2GHWB 4EDWL 3ZKXC 3V7MA 1IAKB 1G7MA 3AU1A 3NZ8A 4KC3B 4ZUSB 2OTPA 2AK4B 3VRLF 2JB5L 1JNNH 4HS8L 4YDVB 5MENA 2NY6C 2DICA 4S1SL 3T2NL 5GHWL 1A4KA 1DN0A 1RZGA 3SKMB 5JPMB 2VQUA 3GRWA 1FPTL 4KPHL 2XV6B 3RVTD 1K8DB 1R3IL 3DYMA 3LEXB 5DHVB 4O58H 3JBG7 1CBVH 4XX1E 5SWZE 1FVEA 4QYOA 2WWMC 5I9QB 1JF5A 4QCIB 1Y0LB 4L8CA 2WBJA 5T33H 2PCPA 3HS0A 4Z8FL 4U1IA 3U7WL 1K4DA 2VABB 3ZLQC 4QTIL 5SWSD 1A3RH 1PYWB 2IFFH 3MNZB 3E6FB 1EUTA 3IETB 4OD2A 3TNMA 1RJYB 5LCVL 1TQCC 1RPQA 4XRCB 3FQRA 5JW4N 1T20B 1CIDA 2APBA 3ME0A 1G7IB 2OMBA 2KZWA 3WUZA 4MB3A 1YEFH 3MJ6A 1YA5A 2EYTB 1JFQL 3RU8L 4F15C 2FECI 1LD9A 5TH2A 5CZVH 1EXUA 3RDTB 4HKJA 4M00A 3WJLC 3DSNA 1WZ1L 2YZ8A 3HG1E 1P6AB 2XWBB 1G9ML 3ARFA 1UKSA 4PRHD 3VFRA 1LP9F 1G1YA 4YHIA 3TO4D 1GZQA 1ZTXH 3AMKA 3O9WA 4J1UA 2FJHA 5IB3A 3FHQA 3K2MC 4PTTB 4XBEL 3FT2A 2Y5TB 2HN7A 2J8UB 4XNXH 3MJ7B 3RWHA 3LCYA 4P4RB 5DK0B 2IF7A 4JFFE 4U1KA 3THMH 3IF1B 3ORJA 4JO4H 3S37X 2AV1A 2VDOH 3M17A 2YWZA 5CGTA 4KRMB 2CRYA 4FZ8H 3VXRD 1QFOA 2CKBL 2N56A 5DJXA 2QSQA 4DEPC 1VHPA 2CXGA 4UV7H 1JPTH 5F8QC 2J1KA 3RZCA 4MQTB 1CFVH 2DMBA 1YMMB 3GM8A 3WFBH 3EIFA 1DQDH 2WWKT 2R1YA 5INDB 5BS0A 5I8OH 2ZUSA 4R9HA 5JIIA 8FABA 2DN7A 1MCOL 4JPIA 5BOZG 2DQFB 3KPMB 4O5LH 5F3HB 5JNYB 2R2CA 2NY0B 3OL2A 5TQ2L 2GY7B 5I1IL 4S2SA 3FQWA 4OSUH 3U1SL 1NANI 1KCLA 1BF2A 4Q9QH 2BOCA 2VO5A 3TWCL 4GRLD 2G75A 2NY2B 4U1JA 4LVOB 3RL2A 1S9WA 3ARFC 4K71C 2Y36L 5D7SL 3BEWB 5AUMA 1PSKH 4ODTH 1YEEH 4M6OH 5J13B 4LVNB 5D7JA 2X4NB 1NGZA 4Z6AT 5DRXB 2EDOA 1NEZB 3PABA 4MJID 3NFNB 5C0NC 5FYJL 5E08H 5EU3A 4QOKB 3FL7A 5LXGL 3PWVA 4NKMA 5D7KD 4TUKH 1BQLL 1DUYB 4JKKA 3QXTA 3TVMD 2UY7A 1UM4L 3MGAA 3X17A 2AW2A 3PV7A 1B4JL 1XR9B 2W60B 1KTRL 4LPVA 3S9DB 1QACA 5D7IA 3R06A 3G5ZA 4PJEB 3BE1H 3I2CL 4WI4A 4PRIE 4DZ8B 2JIXA 2NXYC 3RZCC 3TJHC 4AG4H 5C2UB 3MRJB 2OJZL 2OXGA 3X3GH 2X89D 3ULUC 3IU3B 2WUCL 4LQ1A 4X6CA 3RBGA 2IBBA 3PWPB 1JHTA 1IM3A 4JFDD 2ZUQB 4YZFE 2CUHA 5FF6A 3GKWH 2WUBL 5BVPH 1T1XB 4JZNB 3VD5A 1KB9K 2ICWB 1MHCB 1XCQA 3KYKH 1KPUB 3KNBB 3MROA 4ZNEE 4HEME 1IFHH 3GK8H 5FA4B 2IAMC 3M45A 1ZHNB 3PP3H 4YWGH 3K4ZA 1TDQA 2A2QT 3L5HA 4Z95H 2GJ6A 2PW2B 3GGWA 1MCNA 2EDNA 4B7LA 5JR1L 4FFYH 5GZNC 3GMNA 1EERB 2BVPA 5I15L 4Y1AE 4FP8H 1K4CB 4ELMA 4OKVA 5E2UH 1LEGB 2AAVA 4D0BA 1AGFA 1OTTC 5D5MA 3MOQA 2PETA 3TBSB 4X80L 2KL6A 1SBBA 3VRIB 3KLHC 1LHZA 4P46D 4ZUWA 3VD4A 1JBJA 5E2TH 5GS1B 1EEZB 5FKPA 4WI7A 4I77L 3N06B 5IEHA 2ITDB 4GKOA 4NWUL 4ETYA 2FSEA 1FCGA 3G6AB 35C8L 5IKCA 3SKUD 3F7YB 5DGRA 4J7RA 4Y4KB 5GGTH 3HC3L 4OZFB 3BJLA 1TETL 1QQDB 1GGBL 2A73B 3G5VA 4X8JB 4PRBA 3VWJA 4NQEA 1KN2L 3OKKA 5DLML 1IAOA 4QHKJ 1FSKB 1EO7A 4M7JH 4S11A 4UTAL 2PO6D 4H88L 3GMOB 3U83A 4DGIH 2YKLH 3FOMB 4R8WL 4F2MB 1RV6X 2NY4C 3RUGF 3DV4A 4HWZA 2X6MA 3FCTB 1IARB 2BRQA 1FIGH 5HYQB 1EMTL 4G9DA 3KPRD 1LGVA 2BOBB 3ARED 2C4FU 3EOAA 4H5SA 4PJDB 4X6CF 4LSQH 4OD3L 6CGTA 3VGFA 4M62H 1LDPL 5CIPB 3P4OA 2A77L 3TN0D 4P2QB 1IC4L 5E99H 1QSFD 4PGCB 4X7DC 3PP3K 3NN8B 5I73C 5HYJA 1FGVH 4DVRH 3LIZH 5DJDA 5LGHL 1D5IH 4LLWB 1YNKH 4LPXA 3VXNB 3HI5L 4HC1H 3KPSE 4N8CH 5ILTH 4Q6IB 4OGAD 4GSDH 1JF1A 1QNZH 2YMXH 3B2VL 3IGAA 3T4YA 3VJ6B 3O11B 1NPUA 4O2FA 4Q9RH 4KMQA 1KF9B 3IDGA 4Y4FC 3I6KA 4PGZA 3QDJE 5B38G 3ZO0A 1EO8L 5CD5C 2IBZX 5GZOC 4DQOH 4QXTA 3RNKB 3EYSL 1MFDL 1KTLB 1DZBA 5AZ2L 4D9LL 4YPJA 4QRUA 2DQUL 1Q9WA 2ZOLB 3JWDL 1C5BH 1T22B 2QSVA 3VXMB 1YEKH 5D93C 3KDMA 5I1LA 5E03A 2UWEA 2XN9E 3DVNA 4LIQE 1XIWD 3FB6A 1FBIL 4DKFL 1ZGLM 1GPOH 43C9A 5FKAA 1FP5A 1T7WA 4K7PL 4NHCL 3P4NB 4TSBH 4J3OC 4PJIA 2HFFA 2AK4E 4D2NA 4Z7NE 4PREB 4Z7UA 4UDTA 4K3EL 4JJ5A 3MCKA 3RAJL 5A2JH 2C3GA 4OCSH 1K9TA 3BYYA 1OWRM 1XF5B 5T5NG 1FVDA 4PBVC 3IJHB 2XG4A 1CYGA 1J9CT 5DJZA 3PDOB 4MNHB 1H0DA 5J56B 3QB7C 5D2LB 1FVCB 3VFPA 5ACZA 1PJ9A 4R4BB 4N0FB 2QL1A 4RA0C 4M03A 1U95B 2L7UA 3IDYB 5TDNB 2VDQH 4UAOC 1DVFC 2R0ZH 4L3EE 5SX4H 1OGTB 2R29H 2NY7H 1LK2B 4XCNA 1ZWIB 1CFTA 5E8DH 3ROOA 2BC4A 3UTTB 4OIIL 4HKXB 1AP2B 3HC0A 2O93L 5IW6B 3AUVA 3SPVB 1B0RA 1N59A 3QCUH 3NVQA 4I0CC 3EZ8A 4JFYB 4X4ME 1MQKL 4KI5C 3SDCA 1N7MH 5C0AD 3AMLA 3UTZB 3PHSA 2YPVL 4FQXD 5EUKB 1IGJB 3QFJE 3W0WA 2J6EA 4BZ2H 4ZUUB 4K55A 3D39B 3H3KA 1YNTA 1YPZF 3WUWB 1J1XL 2O5XH 2ATPB 4U1LB 4Y5XA 1ETZA 4K23L 5H2BB 4NC1E 1NBZA 2DTSA 1T2XA 1CD1B 5EORL 5EU5B 4OZIB 2EDEA 1N5AB 3QXDA 4KRPB 4H8WL 2V9TA 4K3HA 2NW2A 5DFWH 5I1DB 3LRGA 4U6YB 3OTTA 1S7TA 3S5LB 3WBDA 4YO0B 2D4FA 1VGKA 3MO1A 3L5XH 2HTKC 1UWEH 2D7TL 5CWSB 4AH2B 2Q76B 1IEHA 2ZOKA 4XPTH 2P8MA 4M6NL 3CLFL 3MXWH 4KK8D 4UNVA 2DWDB 4MDJB 4PJIF 3MX0A 4DOHE 4HZLA 4Z7UF 3CVIH 5D6DA 1BVKB 2YD5A 5KS9F 4UI2A 4KTYA 3Q3GB 2DJ4A 5KANI 2XZCL 2O5YH 3O2WH 2ARJQ 4X9BA 2HH0H 3IJSB 4QHLB 1IBGL 4JPVH 5TDOB 2F54D 4DW2H 1NJ9B 4ZDHB 2A6DB 5GRVK 2VLJD 2ICCA 2LAAA 4MXVE 3O0RH 2AEQL 5ELIA 3K8MA 1BBJA 4HLZG 1DQMH 3ZKSD 1G6RH 1AI1H 1CT8A 1YMME 2XFXA 5EU6D 5GJSH 1X4YA 3TBTA 5ADOL 5GJTH 4LCWB 5E5UB 1EH9A 2QHRH 3G6JE 1CICB 2EDYA 5FM4A 3SDCC 3W9EA 2V2XB 4OFYD 4NM8H 4Z7WF 5EIQA 3LSOA 3VXUD 3OR6A 4UZGA 5CJOH 3DX8B 5IJVA 3E6HB 4JQXC 4D9QD 4Y5XC 2WIIA 2VDPL 5F89B 2FHFA 4NRZB 4ESKA 1CF8L 1PAMA 3WV0A 3LRSA 3UJTH 3QNYB 1UXSB 4PJBF 1HE7A 4PUBL 5E1AB 2ZSVB 3TA3D 3FAWA 3FO9B 1W0VB 3FTGB 1KPRB 1QTYT 2BVUA 4WO4B 4L9LC 4ZOCA 2GYSA 2OL3L 5L8JB 2VAAA 2FX9H 4MQXD 3HCVA 3QJHA 4QOKE 1OSZA 5IVXB 1BM3L 2NZ9C 4W70A 4RCAA 1S9YB 1MHHB 1HINH 5T3XH 5HHNB 4MDIB 4ZYKA 3MLUL 5BRZB 4LSUH 1C16B 1WBXB 3KYMB 4HUUA 5TPWL 1KYOJ 4XXCA 2YR3A 1CDJA 1XF3B 2IQAA 1QRKA 2R56L 4CBPA 3F7VA 4XH2B 1ORSA 3WFDH 2C26A 4B50A 2LV4A 3VFMA 4XNYL 4JO2H 2X44D 2MCPL 4Z7VB 2OTUB 1QLRB 3SKOA 3PWPE 2M26A 5DD1H 1KACB 2EDDA 5DYOB 1NFIA 1I7RA 3BPOB 4X6DA 2FGWH 5IF0A 2EXWD 1JYVA 2YOCA 3KPTA 4LLUA 1UH4A 4NUGL 3KWWB 1MCQA 1JGVH 2DLHA 4LDEB 2K9UA 4G3YH 1DUZB 2XZAH 4QRSB 2NXZD 4XT1C 2VQ1A 3LRHA 2XOTA 3K3QA 2CIIA 4LIQH 3CSBA 3MCLH 1XGTB 5IEKB 3IKCB 3DVFA 3MV11 3WDHA 5CGMA 3CX2A 4DVBB 1YEIH 2XZZA 3EJYD 1I7ZA 1X9QA 3HMWH 4CN4A 3JWNC 3RHWF 1MRFH 3LZFH 2E7HA 3CH1B 3GB7B 3S3PA 5GS0H 4KJYB 1T4KB 2AJVH 1I8KB 4BQ9A 1CGVA 4TPRH 1IEAB 3GO1H 1FFNA 1XGYH 3KG5A 4LNRA 1EK3A 1G9EA 1WBZB 3DVGA 5SWZD 4YUEL 1NGPL 5C6TL 3CFJA 3B9KB 4J12A 3ULVE 4YXHL 1SEBA 1VEOA 1BFOB 1MCPH 2GUOB 2Q3ZA 4GKZB 5DQDH 3U4BL 4P3CH 5DHVH 1W8NA 1UB5B 4JFQB 5F7EH 3C8KA 2A6KA 5KVDL 2YD1A 2FX7H 4MZ2A 1WBYB 4GH7B 1A1NB 3HZKB 2YPLA 3HR6A 1HHKB 4XTRC 5IQ7L 5IBTH 1KENL 1DSFH 3G6DL 1L6XA 5E9DB 1NLDH 4OF6A 2E7BA 1U8NA 3BIAX 3VFGH 4K3JH 2R69L 1O5DT 5A2FA 2NTSP 3KS0J 1BD2A 4BUHA 4YGAB 3L3JA 3RGVC 2AJSL 3BP4A 5JOPE 2Q3AA 3NGBB 3VXOA 3KJ6L 4MJ5B 1V8HA 3MRPA 5F9WC 1HHHA 1T2JA 5T1MB 2DQGH 1ZK9A 1G1CA 1IGTB 2VUYA 4Q9BA 3MJ8B 4PV9B 3HG1D 4EN3D 3B8YA 3LKNA 4PJDE 4MLSA 4V1DA 3DGGB 1AD9B 2BSSB 3C6LD 1YN6A 2NNAB 2CIKB 5JXEA 1Q94B 3QO0B 3OAYK 3ALPA 3UROR 1W0WB 3S98A 4YBHA 2Y9RT 1CFNB 4AEIH 4K8RL 3MLRL 4FFVC 3GZKA 5KTEH 3EDKA 1YDPA 1ADQL 3S4SG 4HQQH 1Y6NR 5JIPA 1AR1D 5BW7A 3ILPA 5A1AA 5I71C 1X7QA 3H8NA 3OGOE 4JFFD 4XP5H 2XA8L 2CLZA 1J05B 2HYMA 3F6LA 5BV7B 4I1NB 2X4SB 4RAUA 1BX2B 1OM3L 3O3EA 3EYFB 4Y7MA 4NJ9L 4JPKH 3CD4A 3KGRA 3MFGB 4P23C 4UILL 1VPOL 2YSSB 4KKBD 2D0HA 4RGNC 4F8TA 3DX6A 1YUHB 3SJVA 1Q0YH 4XMKH 1BOGB 1EBAA 4YX2L 3ZTNH 3VXME 1FV1B 2I07B 3O2DH 2VLKA 2H32A 4YPGB 3BO8A 1T5WB 3NACL 4GMSL 1N2RA 4OT1L 1TVBB 3CCHA 1J1PH 4IHOA 1UM5L 2CDEB 4ODUB 4G6AC 2ENYA 1EGJH 2BMKB 4ODHL 4JZOB 4LSSL 2P5WB 2GK0B 1KJ3L 3BT2L 3B8SA 1CK0L 1WC7A 4KRNA 2ZUTA 5F7KC 3KYOA 4AL8L 1I1YA 4X7CC 3B6SA 4BA8A 1DL7H 4NRYA 4Y4HB 4KKAD 4ACPA 1VFOA 4IRJA 5D2LE 3R8BB 3PL6A 1MCWM 4QXUL 3E2HC 2W9LA 1FYTE 4ZD3H 2BERA 5EA0L 2W65A 3ZDXF 3MSPA 2HJLB 4N0YL 3Q5YA 4XVJL 3MV9A 4L5FH 3NAAH 2CGRH 2EE3A 1A6VL 2VC2L 3MOBL 3D3VB 5ENWA 4KDWA 2QSCH 5IMOA 1VGEH 1F90L 1LK3H 5JDSB 4UIMA 5C6WH 4MMZC 1F4HA 4JM4H 3Q6GL 3C2AH 3MBED 1QR1A 4OLWL 5DZNA 3QEQA 5TE7L 4OZIE 4IIQA 3X14A 4NFBA 1TZHB 2ARWA 4LMQE 1A9BB 2YXMA 4PRID 4QF1B 3V6ZB 1CXKA 1BQHA 1A7QL 3BRFA 4JKPH 2AK1H 4URTB 3MLZH 1M4KA 3C60D 4R2GC 5DUBA 4ONFL 3L7EA 5JIKA 5MEQA 2EICA 4HPYL 4ELKB 4JKLA 3GIZL 4JQIL 1UCBL 3G9AB 1OVZA 5L2JA 2BJML 1ZT1A 4U6XB 2RAMA 3EGSB 3SDXA 1TVHA 1PG7H 4HDIA 3M1BA 4Y1AD 2AJYL 4NM4L 1F6FB 3I75A 3I6LE 2YA0A 3WO4C 3EJZC 3V0WL 5DD6B 2XXCB 3FFCB 4IRJC 1AQKH 1DBKL 4QRTB 3PL6C 5SWSA 1S5HA 1LO5B 5IHUH 4EUPB 5D9SB 1D9KD 4WNQA 5GS2D 3RWFB 1F3JB 4GJTB 3UJJH 2HLFD 5KG9B 2Q8BL 2DKUA 3RTQB 1PKQB 1TQCB 1JZ2A 2Q7YB 3KHOA 1LVEA 1CVRA 1JGEA 1OW0C 4LCWE 2EEBA 3CK0L 3RVXD 5IROA 2V5MA 1FORL 2FCBA 5EBMB 4TTDD 5DVKA 2EE6A 3BD5A 3CZJA 2VLME 5EOCL 5C0RH 1R5VA 3ULVH 3PIQA 4FNLL 5DD3H 4F15B 1MJJB 3C5JA 3TCLB 1MFCL 4TRPL 3KXFB 2DQHL 1LP9B 5J8OA 3FT4B 1FGNL 3P0YL 4Z78A 2AABH 1MFNA 5GSRA 2AXFA 3VI4E 3GMPA 4IIQC 4MD5B 4OZFH 2NTFA 2W07A 1PG7X 1OAYH 1G7MB 1XR8A 3AU1B 3NZ8B 4X8XA 2YWYA 1X44A 2QKIA 1IGIH 5MENB 1BQUA 2FLRT 1DJSA 1ACYH 1H9VA 1FNLA 3RWEA 2D03L 5DRWA 1BIIA 2B2XH 1A4KB 1DN0B 4LCIH 4OF3A 3NIFF 4HT1H 1S7VA 2P46B 3VXRA 3P9MA 3GJFB 1N64L 2VLRA 4JVUA 4PGBA 5KVGL 3X3FL 3T8XA 1FVEB 5SWQA 1CLYH 4YE4L 5KW9L 2XWJA 3KPSD 4HIXH 5EZIH 4L8CB 2WBJB 1HK6A 2PCPB 3HS0B 5EOTA 4U1IB 3JTTA 3O6LL 1T80A 5I19L 3FO2A 1WUNT 4KJQD 2W9EH 1K4DB 1QLEH 2NX5A 3GBNL 2ATKA 5EU4A 1JYWA 1JZ6A 3QDJD 3TNMB 4OD2B 1X5HA 5CEZE 3SDAD 4BZ1H 4O4YH 3P0VL 3WKML 4Z7VE 1CE1L 3FQRB 3TP4A 4Y89A 5IROC 3TESA 3SGJC 3FO1A 1HQ4A 3GDBA 4K9EH 2XN9D 5ESAA 1LD9B 5TH2B 1EXUB 1QFWM 4HKJB 4TOYL 2B0SL 3N0PB 3V6OA 1CLOH 3BIKA 4YAQA 2VXSL 3T0VA 3TO4C 4R7NB 5DMYA 32C2A 4K71B 3VFRB 4F57H 1ONQA 1F8TL 4GAJH 1GZQB 3KPLA 4MJIA 3O9WB 2DL2A 1R6VA 1VADA 4J1UB 2FJHB 5IB3B 1NDMA 5FCUL 5GGQH 4HZAA 4PGEA 4TVPL 4OZGA 3VXTA 4P2OA 4TTGA 4HWEL 3FT2B 4OM0L 5DUMH 2BFVH 4F80A 2HN7B 3RWHB 4JR9L 4U1KB 2VXTH 3O3BA 4G7VL 3CDFA 4L3ED 5I0ZA 2D2OA 2AV1B 3MV8A 2P48B 4DJMA 4N1HB 3M17B 4JHWH 3SN6N 4NO2A 4FXGA 1IT9L 2ZCKH 1MFAH 5DJXB 3SDDA 3IDXL 3ZSTA 2NXYB 5E9DE 4JPWL 1VESA 3QFJD 4RGMC 4JFDA 1AE6H 5J11C 4KTDH 2R1YB 4NOBA 1WV7T 5BS0B 1CN4A 3GHEH 4FN0A 1MJUH 1MFBH 1A4JA 3NFSL 8FABB 1RFDL 4HPOL 1KXVC 2F8VA 5CLWA 2E7LC 3RIFK 4JPIB 4QNPE 3S36H 4L1DA 3C09B 4S2SB 4OF8A 3FQWB 4YHKH 4X99A 4GRLC 1CS6A 2G9HB 4GRWE 2BOCB 3OKDA 5DA4A 4FZEH 2G75B 4U1JB 2XXMB 3RL2B 1S9WB 1NFDF 1FZKA 2YBRA 4Q7DA 1Q1JL 5AUMB 5CLTA 3S88L 2A1WH 4QO1A 5D7JB 4OCRH 1NGZB 1IQWL 3BJ91 2X1OA 5E2VL 5FHBH 1OAZL 1RK0A 1S7SA 3BP5A 3PABB 2E5EA 5I74C 5EU3B 1ED3A 2DTMH 5DEFA 1FNSH 1J87A 3PWVB 2HFEA 3TVMC 3FO0H 1GJIA 3WXVH 5DDHA 5MI0C 2FGZA 4XNUL 3QUMA 1SQ2N 4GAYA 1YMMD 2EIEA 3HE7D 4GAGH 1MCRA 3BQUA 5D7IB 3PE9A 3R06B 1ERNA 3VXSE 4Z7OF 5EC2B 2PO6A 3G5ZB 3IT8D 3GIVA 3QT2A 4P59L 1K8IA 4LARL 2DLTA 2JIXB 2NY4B 4OFPA 4WVRA 4X6CB 1SY6L 2NY0D 1UQSA 4PJAE 1JHTB 1IM3B 3DO3A 5FF6B 5GGRA 5C08A 3Q0HA 2P5WE 4LPYA 5F7UA 5F1OB 3LHPL 4LGSB 3TF7C 3BN3B 5DFTA 4MA7L 3C5ZD 1XCQB 1ND0A 2E6PA 3V4PH 1QSFA 3MROB 3SO3C 2DLIA 4QRPA 4ENED 4WWID 1YECL 1JL8A 1Q72H 3NMEA 2XIDA 3MRIA 4BQBA 4U4BA 1EHLL 2GT9A 1WWWX 3TIEA 2GJ6B 3GGWB 3L3IA 1T1WA 1LO0L 2OX5A 3UMTA 3V5HA 3GMNB 1KT2A 2BVPB 2Z9TA 1TZIA 3QIUA 4ELMB 4OKVB 3OAUL 4D0BB 1GGYA 5C0CA 1ZVSA 3HI1A 2CR3A 1AGFB 1A7PH 5D5MB 4WV1A 4QOKD 2EZ0D 3FT3A 3QPXH 2VR9A 1E4JA 1RZJH 5TE6H 4TNWF 3BKMH 2HP4A 4XWOC 4LU5H 4ZTOL 3SE3A 4P46C 1S9XA 2EDKA 3QNZA 4Z76A 5HHVL 4ZUWB 2WLZA 2JCCE 2VYRE 5FKPB 3QEGH 5IEHB 1XGRA 1XIWA 4PJ7A 1G9NC 1E4WH 2FSEB 5IKCB 2GY5A 3MA7A 3OXSA 5A16A 4NZRL 3VRLE 1W2KT 1QKZH 3CVHL 3SQOL 1FNGB 5DD0H 4HMEA 1A6WL 3G5VB 3MLTA 3PWPD 4PRBB 3VWJB 4FQ2L 4NQEB 3OKKB 5IB4A 4XCFL 1IAOB 1NCBH 2PO6C 5GQBA 5CEZH 1X5XA 2J88L 2AEPH 1KB5H 1P1ZA 3K0WA 3LQMA 3LS4L 2P45B 4OI9A 2WW8A 3DV4B 5F9JA 4Y0GA 3F7RA 1OAUL 4HWZB 4PJGA 3UZEA 4HWBH 4KAQL 4PY8I 3AREC 2HFGL 5I1GL 1VFBA 4G9DB 4KU1A 4JO1H 3EOAB 3NCYP 4H5SB 3TN0C 4OM1H 3G08B 1ZHBA 5IESL 4HKZA 3P4OB 2EIBA 2R4RH 2FX8L 15C8H 4OF5A 1MJ7H 4HJJH 1FL6A 4NGHH 1ZAGA 1OB1A 5HYJB 2LAGB 2MHAA 5DJDB 2J4WL 3QISA 1FYHB 1S5IH 1XEDA 3PF2A 5DA0B 5ID1A 4OGAC 4XP4L 2LTQC 3W82A 5IT2H 1JF1B 1PKQE 3IGAB 3T4YB 1FNAA 1Y18A 4O2FB 1NGQH 4WV1C 4HGWA 4PJFA 2VB5A 3IDGB 2ICWI 2DQCH 2J2ZA 3AAZA 3EO0A 3I6KB 4IMKA 4P3DA 3SE3C 5GISL 5B38A 1TJGH 3KXFE 4Y4KD 4QXTB 4YEFA 1LP9E 2DQIH 3CMGA 4QRUB 2EYSA 3OHXA 1Q9WB 2QQKH 3SE8H 5I30H 3MLWH 1XIWC 3MNVA 1YEHH 4G42A 3CH8A 3KDMB 5I1LB 2R15A 3DVNB 3FB6B 5JOPD 5IQ9A 1L7IH 1JGUL 1VACA 43C9B 5FKAB 3U2SA 2DD8H 5IP4A 4PJIB 2HFFB 4HAFA 1C7TA 2P42B 4Z7UB 3TH3T 1D6VH 1U36A 4UDTB 5DFVD 1JK8A 3D1MC 4M93B 1FAIL 4JJ5B 3MCKB 1CR9L 3T0EA 4KVCL 1FVDB 4WHTA 5DJZB 2UZIL 4ZAKA 4XPHL 1H0DB 2ED8A 2F54A 2GCYA 4G6KH 3VFPB 5ACZB 2ZZUT 5EZJA 1N6QH 4G7YH 1AGCA 2DLEA 4MXWH 3GSUA 1MCLA 2F58H 3O81A 4HX1A 4MA1C 4XCNB 4MNQA 5EU6A 1CFTB 3ROOB 2BC4B 3CXHK 3HC0B 4PS4H 3F7QA 4Z7WB 4R26L 4UINH 1B0RB 1N59B 3I02B 1XF1A 2UUDH 4NWTL 3PWNA 4OFYA 1RVFL 2EO9A 4FQXC 4DZBA 3SDCB 3OKMA 5BV7H 1J88A 2W59A 5ICXA 2E9WA 3W0WB 1NC4D 3UAJD 3Q1SH 4IOFD 2JJVA 1T83A 3RP1A 1HIMH 3QWOA 4ZPTA 3VXMD 4LASH 1KLGA 4EJ1C 2M2DA 4Y5XB 1ETZB 1JGLL 1CXLA 4IMKC 4MJ6A 1NBZB 2DQDH 1A0QL 5TF1L 1XAUA 4DGYH 4KH2A 3ARTA 1S3KL 5CSGA 5KVFH 3ILQD 4XP6L 3QXDB 3U30C 3FFDA 4TSAH 1J0YA 3TA3A 4LBEA 3TCXA 1HYRC 4IM8A 5TJWK 2NW2B 2EDRA 3U0WH 1UWXH 5BVJA 3KPNA 4YEEA 5FUCC 1S7TB 1FH5L 2CUIA 1ZT4B 5KZCD 1VGKB 1X4XA 3MO1B 4W68A 2MQ0A 3L6FA 3MJ9H 4KK8C 2ZOKB 1ZA6A 2VISA 2VJXA 2P8MB 1KEGH 4C57C 4WUKL 1M71A 3TO2A 1FYTD 3O4OB 2VDNL 4HZLB 4EBQL 1KCVL 1AXTL 1DBMH 2EDHA 4YFEA 4JY5H 4JAMA 2YHGA 2C1PA 1MCHA 3RGHA 4ZG1A 1KCRL 1YEDA 4MAUH 3K7UA 5T5NF 1KIQA 1A47A 5EOQL 2QADB 2FWOA 2B4CL 2FYYA 1BBJB 4XC1H 1YY9D 2IMNA 4J2XA 3BKCL 1CT8B 2E6JA 2XFXB 3N85L 4Y16D 3TBTB 1RURL 3JV4A 4GO6B 4RIRA 2IH3A 3BGFB 3F65A 3SE4C 2UUDK 2W91A 4ONGL 5BS0E 3H7BA 1YNLH 3W9EB 5BZDA 3QNXA 2G5RA 3LSOB 1TQBB 4HFWA 4M5ZH 4M3JA 5FOBA 3SDYL 3KPPA 1OOAA 5CBAA 3OR6B 2HKFH 5FECA 4WFFE 4KRPD 1T83C 5IJVB 2WIIB 5GGVH 2AV7A 2ICEA 3NCEB 3VFVA 1GGCH 4WCYL 3LRSB 4KQ3L 4J6RH 3QWRA 3TA3C 3U4AA 2W38A 3U46B 4YFLI 1KBGH 1FZOA 3K4AA 1HSBA 1UWXK 4UT7H 4AEFA 1ZANH 1GHFH 3BKJH 5C2BH 3NCMA 1YQVL 3N1FC 4UV4L 3IVKB 4MQXC 1ACZA 4K3DH 3U7AA 5DC9B 1FG9C 5ERWA 3I6LD 2VAAB 1BLNA 4FXKA 3P77A 3HCVB 3QJHB 1HZHH 1T03L 1WITA 3CFIC 3EO9L 5K33A 1MPAL 5GRJL 1JZ7A 4N9OB 5J7CC 1CTOA 4G8EA 3V0VA 3CSYA 4HUUB 3WIHL 1GH7A 1RULH 2GTZA 4EUPH 5F72S 5D7IE 1W72A 3L5IA 4EOWH 2IQAB 3F7VB 5AZEL 1CICD 3RUGE 3GEWB 1ORSB 4U2YA 1FL3A 2VLMD 3MRNA 4UOW0 4OGXL 4WUUA 3VFMB 4AZ8A 4FQIH 3BZEA 4X6CE 4EN3A 3SKOB 4JREC 1MF2L 3NA9H 3SKJL 5SV3A 1NFIB 2EXWC 3BXNA 1I7RB 2GTWA 5IF0B 3RY4A 4LLUB 2R0WL 2NXZC 1AC6A 3MV01 1ITCA 2JELL 1JMXA 3MUGA 5T1DL 2N1KA 2VQ1B 5KBNC 3O2VL 5F3BA 2DKSA 1NCCL 1QSZA 3QEHA 1F4XL 2GJ6E 2CIIB 1IILE 3BDBA 3CIQA 2DQTL 3EJYC 4AEHL 2ZUYA 3PP4L 5H94A 4G6MH 3UX9B 4M9OA 4JFFA 2YPKA 1I7ZB 3GBMH 1JNJA 4WO4D 3U4EA 5I8CA 4RGOL 3EJJX 4PLJD 5D5ME 1RK1A 1IKNA 1WWBX 3S35H 2CPCA 3SO5A 2CRZA 3DHMA 1FFNB 4LNRB 2E9JA 1OP3H 3DVGB 1B88A 3RI5F 4F58L 3CFJB 5CMAA 3SHSA 2P7TA 4RGNB 1SEBB 3GRWH 1PQZA 2GK2A 1MNUL 3C8KB 1FRGH 2A6KB 2O5ZH 4M02A 5CHNA 2YPLB 3OX8A 3MR9A 3ZYZA 1CWVA 4GKNA 5CEZD 3P3YA 1T0NA 4JVPA 1BVZA 1E4XH 3QEUA 3DSFH 2VDRL 2E8YA 3ZE1F 5GRUH 5KSAA 4S1RH 1U8NB 2BCKA 4NQEE 5D72L 1UACH 1BD2B 1MREH 1FNHA 1DFBL 3L3JB 3BKYH 3BP4B 3VXOB 5TE4H 5CINL 4N0CD 4J4PA 5F7DA 3MRPB 5FUZH 4U0QB 1LQSR 1HHHB 2COQA 1MFEL 4O2CA 4A2MA 3T4AA 2K3TA 4EN3C 2MWCA 2R9HD 1DTUA 3MLVL 4KFZC 2BDNH 5EPMA 1U91A 1IC1A 3LKNB 3E2HB 3C6LC 4V1DB 2CQVA 3HPJA 4Y2DA 1TPXC 3OB8A 1QZ1A 1YN6B 1A14H 3D9AH 3I6GA 2W9DH 4NN7C 5C09A 4MXQD 1NCAL 3LKPB 1YDPB 5KOVC 1AR1C 2X4OA 3D5OF 3WSQH 4FABL 4LSTH 3B9KD 3ILPB 3P30L 1JZ8A 1X7QB 5DO2D 2CLZB 4CMMA 4RAUB 5BZWA 2P8PA 3LEYL 1IKNC 1P6FA 3O3EB 4Q0XL 4F9LC 5IFAH 1BWWA 5HSFA 1OP3K 4KKBC 3UC0H 1J0JA 1ZLSH 2KQNA 3QPQD 1DBAL 1A1MA 5GGSA 5T3ZH 5I76A 3DX6B 4U0RC 3SJVB 5E9DD 1SJXA 3MRMA 4NP4L 5KJRL 5FIEA 2APXA 1SYSA 2VLKB 2H32B 3BO8B 4OCMC 5F9AC 4JZJC 4P57A 4CNIA 4H20L 1N2RB 4X4XA 2B20A 3C60A 5FYJE 4ZNEA 3CCHB 4CADA 4IHOB 4XVUD 4DN3L 3ULUH 4R2GB 4PJIE 1B0GA 1RZKC 2X40A 4Z7UE 2HA1A 1UEYA 3OKEA 5KS9E 3L95A 3EDEA 2R8SH 3JV0A 1I3GL 5K9QG 4Y1AA 1WC7B 4OLEA 3KYOB 4KKAC 1I1YB 1OL0A 3G5XA 5T5FH 2RQ8A 1CFQB 3B6SB 4GLRH 5CJXA 4NRYB 2IG2H 4LL9A 1F6AA 3WO4B 4S1DD 3PV6A 4IRJB 5DJ6A 3PL6B 4MZ3A 4JY4A 1EJOL 3TV3H 5J06A 5EBWA 1D9KA 4YBQD 3OZ9L 1J5OL 1YYML 3TBWA 3S6CA 4NZUH 2X4PA 1CGSL 3MV9B 1HCVA 4Z7WE 4U1SA 5C71A 2MSPA 1HEZA 2BVYA 5BO1H 5ENWB 4JHAH 4RSVA 5IMOB 3MREA 2YXFA 1BGXL 1I75A 5ETUB 3W0WE 4UIMB 1MRDH 3MBEC 1IQDA 3BOVA 5I1EH 3DX9A 4DGVH 5JXAL 5CILL 1QR1B 3ARGD 1LEIA 3QEQB 3NOIA 4PJBE 1KJ2L 5D96C 4E42A 4XP1L 3VXSD 4IIQB 3X14B 4IS6A 2A6IA 5EULV 4RWYH 2A74A 4UTBL 1OAQL 3H0TA 3N50A 4M6ML 1BQHB 1QFPA 1HOCA 1M7XA 5I6XC 2P5WD 5BOPA 2JB6A 3C60C 1FPTH 3KPQA 1PLGL 1RUAL 4W6YB 3BZDA 4UMGA 5E6YA 5DUBB 2CJUL 3L7EB 4Y4HD 5EH1A 5MEQB 5TF0A 4EUPG 2PYEB 4HJGA 1LO3L 2OZ4H 2EIZA 2XQYG 1UGNA 1ZT1B 1ZA3B 4MD0A 3SDXB 1TVHB 3T0AA 2F9BT 4HDIB 4QGTA 4AYFA 3KPSA 3M1BB 3U7WH 3KYNA 5CJXC 4LGPB 3I75B 4X7SL 4PJ8A 4X9FA 1WAAA 5SWSB 3QUXD 1EHNA 1UCTA 5E95B 1D9KC 2EH8H 2DQEL 3HZVA 2AVGA 2A6JA 2R0LL 4WNQB 2B39A 3SDAA 2HLFC 1DBJL 4LCYA 1N8ZA 2WQ8A 3P0GB 3RVXC 5B3NA 1JGEB 2VDKH 3IU4L 4ODVL 4TTDC 3QHFH 2V17H 1UVQA 4YXKL 4H25A 3U7YH 2JJTA 2BRRL 2C7UA 5C0IA 1R5VB 2GSIA 4NBZB 2E27H 3PIQB 3VDAA 1TNNA 1TZGL 3SY0A 5DR5L 3V0AC 3C5JB 1WFTA 5J0BA 1MELA 2ADFH 3QQNA 2ZCHL 2X1PA 4Z78B 4TN9A 6FABL 5FYKE 1KNOA 5GSRB 2AXFB 4ZXBD 3GMPB 2ZUUA 4QLRA 2NTFB 5DQJA 3X11A 3UEZA 1XR8B 4FQCL 1P4BL 2IQ9H 1NCDH 5F7NC 3BMWA 3R1GH 2QKIB 4PB0L 4LOUD 1JPFA 5C0EA 5KVEH 4L3EA 3RWEB 2ED7A 5DRWB 1BIIB 3IS0X 2X9WA 4GQPH 5EO9A 5C9JA 4HCRA 3HNVH 2ESVD 1S7VB 4XPFL 1KFAH 3KAAA 3P9MB 3VXRB 2GFBA 1PYWA 2VLRB 4PGBB 2F19L 3T8XB 2JE8A 4FS0A 1QYGH 2Y06L 5SWQB 2DQJH 4OIAA 2XWJB 3QFJA 3V8CA 1CDHA 4KJQC 5EOTB 1AXSA 3RTQD 3EZJB 3JTTB 4RGMB 3FO2B 4ZFFA 1BP3B 1INEH 2NX5B 5L9DH 5FO8A 2ATKB 5EU4B 7CGTA 1WAAF 3SDAC 5C07A 2YD8A 3UBXG 4PJXF 3R8QA 3IKKA 2Y07L 3KXFD 4TNVK 4Y8AA 5FDYA 1QP1A 2YK1H 3TWCH 1CXFA 2JJTC 3FO1B 1HQ4B 3P4LA 3OKNA 4EQ2A 5ESAB 1Y6MR 4L29A 3L3KA 4XVSH 1V3LA 1KTDA 1U8HA 3BIKB 4UIKL 4YAQB 4WHYG 3EFFA 4JO3H 4RNRA 32C2B 4TQEL 4FHBD 2VZ3A 1F5WA 1ONQB 2V5YA 3FB7A 5L7XL 3CXDH 3KPLB 3QBTB 4MJIB 1KELH 1VADB 3MRKB 3PNWA 4PGEB 5IR1B 4OZGB 3VXTB 8CGTA 4P2OB 4NFDA 3VD3A 3UZQA 5E8EA 2H6PA 3MXVH 3T3PF 5HI3D 2DMKA 1OTSD 2XKSA 3H3PH 3W2DH 4OUUA 4GRMA 4RGNE 3O3BB 1S9KC 5MI0B 5F9DC 1NCNA 2WBJD 4Z0BH 3HE7A 3MV8B 4YHMH 3F58L 5HVFB 4LPWA 2XKNA 2ZWLT 4NO2B 5D71L 4FXGB 3G6JA 4FQJL 5EDXA 4DKEL 4NNPL 3SDDB 1F4WH 2DQFA 5J9PA 4KQ4H 1M05A 1JWSA 3QULA 3U9UA 5JQ6L 4JFDB 3P11L 4NC1C 1BD2E 1CGYA 2RB8A 5JQHC 4X7FC 3OB0H 4WHDA 2O61A 3C5ZA 4FQHA 5TFSL 1GAFH 2QQLL 2BVEA 4KV5F 2J6EH 1A4JB 3SO3B 4EDXA 1ODAA 3ZDXE 1A6UH 4BQ8A 2LABA 1I7UA 2FO4A 4X99B 4OCWH 2HWZH 4JFOA 4XC3L 2FIKA 3O9WD 3OKDB 5DXWA 4G6JH 4CW1A 2EEAA 1PD6A 1IGFH 1J12A 1PX4A 1V7ML 1FZKB 2YBRB 4JFZL 2FZ3A 1DEEA 1NAML 4MQ7A 2MKLC 1INDH 3CDGA 4CU8A 1MIMH 1RK0B 4CRPA 1S7SB 3TT3L 1L7TH 4F8QA 3GSWA 4H26A 3OF6A 4WTZG 1BEYH 1ED3B 5DEFB 5JHDD 1XZ0A 3HC3H 4G5ZH 4UBDD 4WFGE 4IOIA 3WYRA 2HFEB 1V7NL 2ORBL 3VGHA 1VFUA 5DDHB 3BMVA 4U1GB 1IGML 3SJVE 3HE7C 1Q0XL 3QUMB 4GAYB 1ULVA 4EI5D 2VLKE 3BQUB 5C70A 4U3HA 1CFBA 2PO6B 3QXUA 3GIVB 4CU7A 1K8IB 4O02L 1AXIB 5EG6C 4M9PA 3LPWA 4NPYA 2NY0C 1JYNA 2ZKHH 5I8KH 1A7RH 4WFFD 4TSCH 4OIBA 4AIZA 1UQSB 4RWHA 5B21A 1CLZH 2AJ3A 2LU7A 3B5HA 3OB0K 5GGRB 5FM5O 3C5ZC 5C08B 4HBCH 4ZO6A 4ENEC 1AY1L 4LVOC 2WMPA 4OBSA 1QSFB 1I1AA 4OLVL 3GSNH 4QRPB 7FABH 3MRIB 4WW2F 2Y1VA 5J13C 2LFGA 4OQTA 2GT9B 4LVNC 5FYKH 1IEBA 2OS7A 3Q48A 4GS7B 3TIEB 3R4DA 3L3IB 1T1WB 1JNNL 5D7JD 3VGBA 3V5HB 1KT2B 3GHBH 4IMLA 1TZIB 4PY8J 1J8HA 3QIUB 5C0CB 1ZVSB 4WFEE 1U3HA 2EZ0C 3HI1B 2ITDA 4TUOA 2P1YA 4W4OC 5LG1A 4WV1B 1XGUA 3FT3B 3G6AA 1CZ8H 1U8KA 4O58L 3LS5H 3FQXA 4HUVA 4X5LA 1Q9OA 1S9XB 4H1LG 3QNZB 2K1MA 4Z76B 1QLFA 4L4VE 5FYLE 5T33L 4NBXB 2ZNWA 3PGCA 4UT6H 1XGRB 1XIWB 3MOAH 3QEQE 1A3RL 4K7PH 4NHCH 1YJDC 3LOWA 1F11A 2IFFL 1MIEH 3OXSB 5A16B 2JIXD 4Z5RA 2ICWJ 4ZMAT 1E4KA 3IRPX 2HVJA 2ZUQC 3MLTB 5F7HA 2WZPD 3MYZA 1EX0A 1YEFL 2ERJC 5IB4B 4JG1H 5CIPA 3QJFA 3AROA 2QBWA 2BY3A 1P1ZB 3HB3D 4PRPE 5CZVL 3ZE2F 5H8DA 3TYGL 1EEUA 5F9JB 2PYEE 5D1ZD 4PJGB 3D69A 2DYPA 4UNUA 4BSVA 4LVHB 1VFBB 3TT1H 5L0QB 3OPZH 1UJ3A 3VMOA 4U33A 2MQCA 1ZHBB 4HKZB 1ZTXL 1ZV5A 2B5IC 1FL6B 1NUGA 3HNSH 5SWSE 4WTWA 3U82B 1OB1B 3BN9D 4JFXA 2MHAB 2E7CA 1II4E 4XNXL 1KLFA 5ID1B 2X05A 3VWKA 5EUOA 5J89A 3QHZH 1J1XH 1NC4A 5GS1C 5HDLA 3THML 1HKLH 5JW4Q 4JO4L 4CDGC 2VDOL 4HH8A 3D0LA 4I13B 4PJFB 4OZ4A 1I3RA 4FZ8L 1JN6A 3AAZB 3EO0B 1WF5A 4P3DB 4Y4KC 4NQXA 3TH2T 3QUZD 4HS6A 4YGVA 2AERT 5B38B 5E00A 2QSTA 4UV7L 1JPTL 1CFVL 2EYSB 3OHXB 2VR5A 4NKDB 2VXQH 3VWJD 3WFBL 3VRJA 4NQED 3LKOA 3MMEA 1DQDL 3MNVB 4G42B 3RY6A 1F02I 1MEXH 1C12A 1CQKA 4LRNH 3ZHKA 5I8OL 4J3WA 5IQ9B 2PW1A 1HXMA 3BDXA 1K3ZA 1VACB 4MNHA 2X70B 3U2SB 1IC5H 3DYPA 3BEVA 5DFVC 3UCRA 4O5LL 1FYTA 1JK8B 4XCYA 1M7DA 3K4DA 1BOYA 4MQSB 2NR6D 4OSUL 4ZNCD 2F5AH 2MCG1 4R4FH 4Q9QL 4AQ1B 1ZHKB 3T0EB 1Z3GH 4WHTB 1MQ8A 4ZAKB 2PNDA 4N0RA 3VXRE 2F54B 2MOVA 2GCYB 5DS8A 2AEQH 4M48H 2VLRE 2KUTA 1UJ3C 4JG0L 5EZJB 1PSKL 4ODTL 4LP5A 1YEEL 4M6OL 1AGCB 1HNFA 1QFUH 2VXVH 3GSUB 4X9IA 5F21B 4FQ1H 4HX1B 4ZPVA 3CFCH 5EU6B 4MNQB 4Y16A 3P40A 5E08L 1CCZA 1L0XA 3ES6A 5D2NE 2AJUH 2FBJH 1U3YA 4IOSD 2NX5E 4M61B 3PWNB 3OKOA 2FATH 4K9EC 2EDXA 4DZBB 4TUKL 3OKMB 4L4TA 3S96A 3HMXA 4OCXH 2PTUA 3UAJC 4IOFC 5ICXB 3SEPA 2FBOJ 4HK3N 5EUOF 3LH2H 2HTLD 2BY1A 5GRXG 3QWOB 1CD0A 4ZPTB 3BGMA 1KLGB 1R3KA 3N1QC 3GM0A 4R96A 4MJ6B 5ALBH 3ILQC 3RX5A 5FYJD 3BE1L 4I48A 4ZODA 3V6OE 4AG4L 3FFDB 4Y5VA 2VLLA 1FN4B 4RAVA 3TA3B 2H32H 3X3GL 4LBEB 2DWDA 2H45A 1XF4A 3VGDA 1CFSA 1KTKE 1RJCA 3RY6C 2OR9H 4BSWA 1NGXA 5BVJB 3GKWL 1F3DJ 5BVPL 3ZT7A 4TULH 4MJIE 1EVUA 3KYKL 1GGIH 2PXYA 3RX7A 43CAA 3L6FB 1FNFA 1IFHL 3GK8L 4J23A 4F9PA 4GBXD 1ZA6B 1XGQA 2VISB 4XAWH 4ZDHA 3RIAK 4LLYA 5EBGA 1FZMA 4Z95L 1M71B 3TO2B 1B9ZA 3M8OH 4QEGA 3QP3A 1IAIM 4FFYL 4UOJA 4FP8L 3DGCR 4JAMB 3MV8E 4NKIH 5E2UL 3JWOH 2C1PB 2XTJB 1S7QA 3FN0H 4Z7OE 1YEDB 2EYRA 3QSKB 1VEPA 3VFWA 1KIQB 4I3RH 4M4RA 1CU4H 1YY9C 3O3AA 2FWOB 4DUWA 4FQQA 2FYYB 4Y16C 3W0WD 1IZKA 1MAMH 1L0YA 4XAKE 1RUKH 1YY8A 5E2TL 1JHKH 4JREB 1JJUA 2IH3B 1EZVY 3H7BB 4P5MA 3MC0A 4Q58C 5BZDB 1H3PH 3QNXB 4U1NA 4KRPC 4JRYE 4HFWB 4OF7A 4AJ0A 2NXZB 3HN3A 3KPPB 5FYLH 5BXFA 5GGTL 5FOBB 2ID5A 4QTHA 2DM2A 4GOSA 5FECB 5E1AA 1ZMYA 2KBGA 1QPPA 2AV7B 1AFVH 2ICEB 1GL4B 3VFVB 3NIDE 1BHGA 4M7JL 3B3IA 4Q2ZB 1G84A 5F7FA 4WW1A 2IH1A 2BNUA 4DGIL 2YKLL 3QDME 4U49A 2GIYA 3CC5A 4BQ6A 1FZOB 1HSBB 2ED9A 1ZLUH 4YXHH 1FIGL 1UKTA 5DD5H 4D9RE 4LSQL 4M62L 5I1CH 5ERWB 3O6KH 5E99L 4F9PC 5F88A 4G80A 2DAVA 4FXKB 3P77B 5I1HH 1FGVL 3VMNA 4DVRL 3LIZL 2I5YH 4RMSA 4CVZA 3KR3L 2CLVA 3OJMB 3ZTJH 1D5IL 5JA9A 1UYWH 2QADD 4FMKA 3V0VB 4G8EB 4HC1L 4NDMA 4N8CL 5ILTL 5ALCH 4NIKB 1QNZL 5DZLA 2YMXL 3F5WA 3CSYB 4RFNB 2GTZB 4FMFA 4Q9RL 1CICC 1W72B 3CDCA 4HF5L 3V8OA 3QDGE 4P5TD 3MRNB 4ZQKA 3FJTA 4UT9L 4WUUB 2B7DT 1JE6A 4DQOL 4QRRA 3L5WA 3BZEB 1RIVH 4EN3B 4ODXA 5DJCA 2YC1A 3DHJA 5C0FB 4NJAH 5C08E 1C5BL 5HYFA 3BXNB 3INUH 1YEKL 3STLA 2GTWB 3I84A 5FYKD 4YC2B 1QSFE 4Y19E 3FOLA 1N3NA 4RMVA 4QRPE 1GPOL 3MUGB 4D94A 3U9PH 4TSBL 2QV2A 3UTSA 5F3BB 5MERA 3QEHB 4LCCA 2HLAA 2VITA 5H94B 4WO4C 3WFEH 4JFFB 2YPKB 4WWKD 4H0HB 4GKZA 4PLJC 5C0CE 3U4EB 5HI4D 4OCSL 3ARVA 5I8CB 5GIRA 3EKCA 1RK1B 2H1PH 4MCYA 5LQBL 2M8XA 1FDLH 2FEEI 3TPUA 2D31A 5HGAA 3SKNA 2YUVA 1A7OH 5GRVL 5A43C 1Z0NA 4B53A 5CMAB 2VDQL 2P7TB 1EAPA 2R0ZL 4U2ZA 1H8SA 1PQZB 2NY7L 2R29L 3BZ4A 4HFUH 5CCKH 5F7WC 4HH9A 5E8DL 2OLDA 1F58H 5KSBF 1X5FA 1I3VA 1FZJA 3QCUL 5CHNB 1I9IH 4DKDC 3OX8B 3GNMH 3MR9B 1SYVA 4W4NA 1N7ML 2XPGA 4GKNB 3ARDA 1T0NB 3HE6A 3QEUB 4LSSH 4K7PY 4BZ2L 3BPOC 4F7EA 4F37K 5KSAB 1OT2A 2BCKB 3RVWD 2Y25A 2O5XL 4X6BA 4N0CC 1QEWA 2DIBA 3B9VA 5C3LD 3S7GA 5F7DB 3CXHJ 2R9HC 5DJ8A 1MH5A 4O2CB 3K1DA 2Q86B 1JHLH 3T4AB 4U6VH 2E9BA 4I5BB 4OI8A 4FFVD 5EPMB 3K74B 1U91B 2XQBH 4EXPX 2HMID 3WLBA 2Y23A 3HPJB 4Y2DB 4BH8A 5IMLA 3B5GA 1D5XA 3W11D 3TZVA 1L9NA 4MXQC 3L5XL 3LAFA 1A6VH 1MHPH 3QCTH 5ITFA 1UWEL 2A9NH 5C09B 4LLDA 4XPTL 2X4OB 3B9KC 5E8PA 2R39A 4P9HL 5DO2C 2EH7H 3CVIL 4OLWH 4C4KO 4W6WB 2V5SA 4CMMB 1XH3A 2P8PB 1YMHA 3ARGA 4PJFE 1WQVT 2O5YL 3O2WL 1VA9A 2HH0L 3QPQC 3T0DA 1A7NH 4JPVL 3VXSA 4DW2L 3LDBB 3KLDA 4OV5A 1A1MB 1A8JH 5GGSB 3O0RL 5I76B 2F5BH 3KHQA 3E0GA 1DQML 3MRMB 4PJAA 5EN2A 1G6RL 1AI1L 5GJSL 2Q8AH 4LSPH 1SYSB 1T0MA 5GJTL 3NGBC 1T89C 4X6FA 5I6XB 4CNIB 4P57B 4X4XB 4XVUC 2XWTA 5J12B 4NM8L 4CADB 4Z0XA 1B0GB 3FAXA 5CJOL 1ZLVH 1JZ5A 1SJEA 3OKEB 5HHQA 3L95B 2CK0H 2GKIA 2WM0A 4LEXL 3ZMRA 2C9AA 4B0MM 4Y1AB 4M7LH 5JXED 4PJCA 3T0EE 4S1DC 3G5XB 2DI8A 5L8LB 4PYGA 2EDLA 1FFRA 3UJTL 1F6AB 3QUXA 5BCAA 3PV6B 4EIZC 1FCCA 5DJ6B 1M6OA 4YBQC 4JY4B 2Q1EA 1D9KB 5EBWB 2XACC 3H9HA 3TBWB 3DARA 1MCFA 2X4PB 3PQYA 2JCCA 4MNQE 3AY4A 1NH6A 2FX9L 4U1SB 1FFQA 3WDJA 1MAKA 2I24N 4WFGD 4NQSA 4YQXH 4OD1L 3PGDA 1MVUA 4QF1A 1HINL 5T3XL 5D1XB 2N7AA 3VD7A 3WO3B 2Z93A 1IQDB 3SJVD 4BYHA 2DM7A 3ARGC 3DX9B 4LSUL 1G9NH 1EPFA 4ZXBA 1LEIB 3QHTC 3WIFA 2YUZA 1TIUA 4E42B 1QBBA 1YN7A 1P53A 3WFDL 4IS6B 2A6IB 4YHPA 2A74B 3QUMH 2WQRA 5B39G 4EZMA 3VXPA 4JO2L 3H0TB 3G5YA 4XPGH 4UQ2A 5DD1L 1HOCB 2ADIA 4KHTH 2YRLA 1ZSDA 4KROB 2UVEA 5KSVA 1SEQH 3ZTJG 1VERA 2JB6B 2FGWL 1T21A 2HKHH 5E6IA 1QFWH 2QLVB 4Y4HC 2WP3T 2ESVA 1QO3A 1JGVL 4M1DH 3LKSA 4G3YL 2XZAL 4ZOBA 2DJSA 3IDNA 1ZLVK 4HJGB 3D85D 2Z35A 5KW9H 2EIZB 4LIQL 4MD0B 3MCLL 4JGJA 3O6LH 1G7LA 3KPSB 1I9EA 5DVLA 1YEIL 2IAND 3SGDI 3JVGA 4F7CA 1YQ2A 3KYNB 4IDJH 2HRLA 3HMWL 3BX7C 1ZS8A 2XTJE 1OCWL 3QUXC 1MRFL 3LZFL 4WFED 5I16A 3IFNH 4PJ8B 5GS0L 1YEGH 2AJVL 5EBMA 5ESQA 3BPCA 3HZVB 2A6JB 3GO1L 4J8RB 4BSJA 1XGYL 1Z9SA 3SDAB 4LCYB 1N8ZB 3AY4C 3FT4A 3RKPA 1MWAA 1MCPL 4L4VD 4QHNA 2WP3O 5HYSG 5DQDL 4P3CL 1UVQB 5F7EL 4APQD 4L4JA 1NSNH 2C7UB 5E2WH 2B1AH 2FX7L 5C0IB 3RPIA 2GSIB 2HFTA 4NQDA 3UO1H 3HR5A 3SY0B 1HQRA 3DURA 5I8EA 3B5TA 5IBTL 4MNGA 1DSFL 1TTUA 3MNWA 2V9QA 4GMTH 1NLDL 5FDWA 4ZXBC 3VFGL 1R3JA 4K3JL 4KUZH 4NSKA 2BXYA 1J10A 1KNOB 2BSTA 4RISH 5DQJB 3X11B 4PRPD 4GKSA 3HHRB 3C8HA 1BFTA 2NY5H 3EHBD 3UP1A 2DQGL 3GJFA 2PYED 4NCC2 4JR9H 4LOUC 4K07A 4P2RA 5CBEA 1I85A 2Q7NA 4X5WA 1JPFB 1MLCA 3HUJA 5C0EB 4L3EB 4LLAA 4GW5A 5EO9B 5C9JB 4AEIL 3H9ZA 1NFKA 5KTEL 3TM6A 2IPKA 1PVHA 2GFBB 2RBLA 3LQAC 4XCCH 3DPBA 2DJUA 4HQQL 3O3UN 3ZE1E 3JVGC 3RTQC 3QFJB 4RBPH 3NPSC 4XP5L 1AXSB 4ZFOL 1RY7B 4ZFFB 1B0WA 5HXMA 1QG3A 2ZJSH 4JPKL 5FO8B 5I17A 5KSUA 3ET9F 5C07B 4WUUE 3UBXA 5DVMA 2KDGA 5GGUA 3SBWA 1BIHA 4HLJA 4R7NA 1Q0YL 4XMKL 2OQJA 5DC0A 3I50H 3ZTNL 3UTOA 5IM7A 1KCKA 3ARRA 2QEJA 2V5RA 2E9IA 1BJ1H 1QBMH 3OKNB 5DRZA 4L29B 3L3KB 1J1PL 5EOCJ 3FONA 4O9HH 1KTDB 1U8HB 3EFFB 5K9OA 4RNRB 1DQLH 3NABH 4YZFF 4DOHB 5C1MB 2R23A 1RSFA 4PBWD 3FB7B 4ODSH 3LN9A 3CZFA 1IKFH 1UXWA 3PNWB 2P24A 4HXAH 5JHDA 1BFVH 1DL7L 5HHXH 1IZJA 3ETBF 5HI3C 1VFMA 1I85C 4WY7H 4OBRA 5GXBB 2VLRD 5E8EB 1JYXA 1OTSC 2H6PB 4OLUH 3EUUA 4ZD3L 1A1OA 2WBJC 4OUUB 4GRMB 1JCKA 1P7QA 3HUJF 3HE7B 4MYWB 2AP2A 4EI5A 4L5FL 2XKNB 3RX8A 3G6JB 3NAAL 4LARH 2CGRL 2FNBA 5DUPH 2NX5D 1K5NA 4HIEA 5ADPH 2FEDD 3EDFA 1C5CH 2QSCL 4L3AA 3V52H 1VGEL 4RBPK 2WIMA 4HMCA 5J9PB 1LK3L 1T04A 3V4UH 1M05B 4GG6A 3OG6B 1JWSB 3QULB 3U9UB 3GMMA 4JM4L 3C2AL 3IFLH 3HFMH 3MV7E 5C7XH 2O61B 3C5ZB 4FQHB 2G9HA 3DUUA 3WHE1 1GGUA 1A5FL 3UDWA 4NNXA 5AYUH 1U58A 3SBWC 3P9WB 1CDGA 4EDXB 1KPVA 4GXUM 4PP1D 4D8PA 1QRNE 1T6WA 1I4FA 4XP9H 4X7TA 4Z18A 2WWKO 3WIIH 3O9WC 1I7UB 2FO4B 2NW3A 2AK1L 2P5EA 5E94A 2SEBA 4JFOB 2FIKB 1TMCB 3MLZL 1DLHA 3QIWA 4CW1B 4OGYH 2EC9T 3EFDH 5C09E 1HH6A 4P2OD 2FZ3B 1F97A 1DEEB 1PDKA 4ORGA 4MQ7B 4HUXA 5HHVH 3CDGB 2X4QA 4QT5B 5E1HB 4HGMA 1PG7L 3LEVH 4IJ3C 2ILLA 3GSWB 4H26B 3MV8D 3RY5A 4LAQH 1KJMA 4WTZA 1AQKL 1J11A 4UBDC 4NOFA 5CSZA 1XZ0B 5EWIH 5IHUL 5EC2A 3RUGA 5BMFH 4IOIB 3SDDD 1CDUA 1XFPA 2VN7A 3UJJL 1BAFH 4EI5C 2XRAH 5MP6H 3EOBA 4XAKD 2VERN 4MVBD 5B8CA 3LS4H 2ERJB 3QRGH 1NL0H 5C0RL 3ULVL 5DD3L 3WCYA 3NTCH 3OMZA 4HLZH 3C09C 4JRYD 5D1ZA 4NPYB 5E70A 1FLRH 4AIZB 4ERSH 9CGTA 1CVSC 1FO0L 1ZEAH 2AJ3B 3X13A 4LLMA 4KVNH 4GG6F 2AABL 4HKBA 1J0IA 4K94C 4FTVD 4GXVH 3UDWC 4OQ1A 1I1AB 3ARZA 4ZFOA 4AMKH 3PDGA 1OAYL 2B5IB 12E8H 4ZO8A 3R0MA 5D70H 3QDMD 5D7JC 3EAKA 2R1WA 1IEBB 3QXVA 2VR4A 5HYIA 4AK1A 4JQVA 1IGIL 4ZFZA 1LNUA 4E41A 4XWOD 4D9RD 3HLAA 2KZ1B 4IMLB 5ACLA 1ACYL 5IB2A 1J8HB 2B2XL 4D0DA 1U3HB 4LCIL 1KEMH 4HT1L 4TUOB 4XNZC 1BJ8A 1F3RB 1XGUB 2ADJA 3RA7H 1OLLA 1T66D 3QUZA 1U8KB 1U8IA 3CFEA 3VGAC 1I7TA 3IAPA 3RQ3A 3FQXB 2DBLH 4HUVB 4PLOB 1Q9OB 4HUNB 1FNGA 1F4AA 1CLYL 1TLKA 4NYLB 5TQ0H 1QLFB 1UZ8A 4H1LA 4HIXL 4L8DA 5EZIL 1JRHH 2D9CA 5INCA 1RUPH 1MSPA 3PGCB 3BQUD 5GRZA 2W9EL 4HUMB 4JB9H 3C87A 1DN2A 1QLEL 3QO1A 1PGRB 3QDGD 2E7MA 4BUGA 1F11B 3DBXA 4I3SH 4YDKH 4RMUA 4BZ1L 4CAGA 1RUMH 4Z5RB 2CKBA 1W72H 2HVJB 3QG7H 1S7XA 4KY1H 3HAEG 3RWDA 4L3CA 1KOAA 2H41A 2H8PA 1RZFH 2AGJH 5C08D 3G08A 4JN1H 3HB3C 4ZSOA 2I25N 3QJFB 4K9EL 1B4RA 4Y19D 5D1ZC 4QRPD 5H37G 3VW3H 4NKOA 3D69B 2DYPB 5HBBA 2RGSA 2XTLA 1CLOL 4BSVB 3AFLA 1NUNB 2HT2D 1QPXA 1MVFA 4ORZC 1BZ7B 5MHSD 3F7PC 4YHZH 1UJ3B 4F57L 3EYQD 5GGRY 1YPZA 2VDLH 2JJUA 4GAJL 3QIUD 4R26H 4HULB 4AQOA 2X10A 5C0CD 3BN9C 5GGQL 1WAAE 4JFXB 4M1CD 4JQVC 2BFVL 2J8UF 3VWKB 4M6AA 5EUOB 1OAXH 4L8SA 1QFWI 4CMHB 4LKCA 4YNYA 3ZT5A 1NC4B 5D8JH 4UDUA 5LAXA 4NO3A 1T7VA 1LE9A 1OTUD 3D0LB 1LO4H 4JHWL 3HZMA 5FUOH 4OZ4B 1I3RB 1QVOA 3BWAA 3QUZC 3VG0H 2ZCKL 1AQDA 1JN6B 3QR2A 1MFAL 4HG4J 4NQXB 1ROWA 4HS6B 4YGVB 5E00B 1HH9A 3VWJC 1DDHA 3C8DA 1PZUB 1NAMB 3BYTA 3GSVA 1OPGH 5KS9A 5IHBA 5C0BA 1JGDA 4KTDL 3LKOB 2AJZA 3MMEB 3VRJB 2R4SH 4BK4A 4XVTH 1C12B 5ITBH 4PBXA 5KZCB 3C08H 3GHEL 2PW1B 1HXMB 1R5WA 4N90E 4I3GA 1MJUL 1MFBL 4LKXA 1RZKH 4EVNA 4GBXA 4KGJA 4PJ5A 3T3PE 3BEVB 4S0TD 1Z6JT 5IHZB 3S36L 5A3ID 4AEEA 3WNPA 4YDIH 2ZSWA 1FYTB 2NR6C 4XCYB 1M7DB 4PP2A 1JF6A 3V4VH 4YHKL 2J8OA 5KN5A 3WL9A 4M5YH 3ZDZF 4FZEL 2V7HA 3N9GH 4Z7WA 3I02A 5DS8B 3K80A 4I9WE 5FGCE 5GSVB 2A1WL 1TNMA 4OCRL 4KGLA 4ZPVB 5FHBL 1KN4H 4Y16B 1FO0A 3ES6B 1TENA 2DTML 4KV5E 4ALAH 5CJ8A 4MLIA 1B2WH 1FNSL 4PJBA 2BVOA 3OKOB 5C07E 3ARYA 4L8SC 3P4MA 1NCTA 4L4TB 1JIBA 3S96B 3FO0L 2HTLC 4PTUA 3WXVL 1EO5A 5FEBA 4JKWA 5DJ0A 3BGMB 1L4IA 1R3KB 3IFOA 4GAGL 2P47B 4KQ3H 4R96B 1ZT4A 4PJEF 5K9JH 3L5JA 2X7LA 4I48B 1QBLH 1T1ZA 4Y5VB 2VLLB 4RAVB 4M93C 2HT3D 1KYOK 4EQ3A 1UH3A 1XF4B 1CFSB 4BSWB 4Q97A 1NGXB 3L1OH 4M7ZC 4KK6D 5EZLA 2PXYB 4JN2A 3RNQA 3T0ED 3V4PL 4GBXC 43CAB 4ZAKD 1JWMA 1Q72L 3OGCA 1XGQB 1RMFH 5FK9A 4LLYB 3WS3A 4IEFB 1FZMB 1FQ9C 1MCKA 3FMGH 3MRCA 4X9GA 4PR5A 2H2PD 5AD0A 1DANT 5F7YC 4JM2A 4MNQD 5AZEH 1PFCA 2JJSA 1S7QB 1UENA 1UT9A 2YD6A 3U0PA 1MUJA 1GIGH 2G5BA 5GS2H 1A7PL 2EYRB 5FGBA 2ZP0T 1TTGA 3QPXL 4P5TA 4UB0H 5D4QA 1RZJL 5TE6L 2F53D 3VFWB 3BKML 4KHXH 1Z0MA 4LU5L 3O3AB 3QYCA 4P2CG 4FQQB 5F7MC 1G7JB 1SJVA 5HI5D 3WXWH 3ULVF 5C9KA 5FCSH 4NNYA 4YHLH 2PTVA 3CFDA 1YY8B 4LSVH 5IJKA 3DYOA 4WEUD 5LGKA 4NFCA 3QEGL 5DF0A 4XNMA 4P5MB 4UQ3A 4BFGA 1E4WL 4U1NB 5BXFB 3QQ9D 1QKZL 1WICA 3U46A 2DQTH 4QTHB 5DD0L 3PP4H 4D3CH 2R2EA 4KXZH 5ICZA 3HNTH 4FQPA 4KKNA 5FV2A 5E5RB 4WWKA 3IVKA 1NCBL 3B3IB 5CEZL 4WI6A 4O2EA 3M07A 1S9VA 2AEPL 1KB5L 4WW1B 1R24A 2IH1B 2BNUB 3WD5H 3NCYS 1H8NA 4G8FA 3CC5B 3O4OC 4HWBL 5D7LD 5D6DC 1OGAE 4JO1L 5IVOA 3LV3A 1QHOA 4OM1L 4POYA 1MY7A 5JOEA 2R4RL 1QHPA 15C8L 3GUTA 1MJ7L 2XTJD 4HJJL 5F88B 5IGXH 2Y4SA 4G80B 1PY4A 2I9LA 4NGHL 2EDQA 3K2UH 4CVZB 2IJ0C 2QADC 2CLVB 1S5IL 2YD3A 4XHJD 5IT2L 3PJSA 4NDMB 2NCMA 4XMPH 2JJSC 2P49B 1KC5H 3BGFC 3F5WB 5FGBC 2OMNA 1NGQL 4JM2F 4NZJA 3RIFF 4P5TC 1U92A 3NH7H 2X1WL 1CGXA 5IUSA 3ZE2E 1E0OB 4TUJA 2DQCL 4WGVB 1TQBC 5C0DB 2D7PA 3MLVH 3K1KC 4ZQKB 4QRRB 1TJGL 3L5WB 4ODXB 3IXTA 5DJCB 2YC1B 3EDDA 4HMDA 3MUZ1 2QQKL 3NCJH 4OTXH 3SE8L 5I30L 1E27A 3MLWL 2KQMA 3AM8A 3STLB 1YEHL 3S97C 3VFTA 4DKAA 2RHEA 1OLZA 1OAKH 3FOLB 1MRCL 1N3NB 1L7IL 5JW3H 1U6AH 5IIEB 5CFHA 3QWRD 2DD8L 4P4KD 4Y2OA 3UTSB 5MERB 3GFUA 4LCCB 2HLAB 1D6VL 3UTPE 2VWEE 2VITB 4WWKC 2B1HH 3LEYH 5HI4C 4WGWB 3KLAA 1J8HE 1NC2D 2V9RA 3MJGX 4CGTA 5GIRB 1TJIH 5D2LF 4MCYB 1T2QH 4G6KL 3A6CH 3TPUB 2D31B 5HGAB 3SKNB 4BFEA 2AI0H 4N8PA 1CIUA 1N6QL 3DXAE 4G7YL 5IBLD 4HCRH 4MXWL 1EAPB 3NZHH 2F58L 4KTEH 4XXCC 1V3MA 3BZ4B 4HH9B 1N26A 4S1QH 3EYOA 4PS4L 5I2IA 4UINL 1FZJB 4YFLF 4CU6A 3T2PA 1SYVB 2XPGB 4WUUD 5BV7L 3ARDB 3HE6B 3RVWC 3Q1SL 4F7EB 1HIML 4CKVX 2W0KA 2CKNA 4LASL 5ICYA 2EXYD 1S7WA 2FH6A 4NZTH 4X6BB 4PD4K 3ZL4H 4YBLB 5CP3A 1QEWB 2AQ3A 4GRWB 1FFOA 2DQDL 3WFCH 4DGYL 1Q8MA 5DJ8B 1MH5B 1V5JA 3LKPA 5KVFL 1JRHI 5K59F 2ZUVA 4KWUA 4TSAL 2HMIC 1J0ZA 3RL1A 2OP4H 3UJIH 3ZE0F 3U0WL 3WLBB 2ADGB 2HG5A 1WLHA 3W11C 4BH8B 2W92A 4RRPG 5IMLB 4XPAH 1D5XB 3EOTH 3TZVB 5LWYH 3KPOA 3QCVH 1EFQA 1U8PA 5ITFB 3MJ9L 5DVNA 4LLDB 5BQ7A 4RMRA 2Q87A 1KEGL 5AEAA 5E8PB 4H8WC 4YHOH 5EUOE 3VI3F 1DCLA 3MA9H 1VENA 1JPGB 1DBML 4JY5L 4I18A 5ISZA 1XH3B 1E6JH 1CD8A 2H9GA 4NRXA 1YMHB 3ARGB 4CN6A 1FC1A