1INQB

Structure of minor histocompatibility antigen peptide, h13a, complexed to h2-db
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title How H13 histocompatibility peptides differing by a single methyl group and lacking conventional MHC binding anchor motifs determine self-nonself discrimination.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, D-B ALPHA CHAIN
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2001-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1inqB00
3LH2H 3WE6B 5D6CA 4YZFE 2WUBH 1DQQB 1J5OH 4NC1E 4BQ8A 1TFHA 1QP1A 2RCSL 4ZQKA 3WD5H 5CZVH 1P4IL 3IDXH 2H26B 1F90L 5EC1A 4P5MA 1AXTH 1OF2A 4MA7H 5TGBB 4OCSH 4ESKA 3OHXB 1VEPA 4NFCA 5JOFB 3E2HC 4GSDH 5FV2A 1UA6L 4ODUA 4WI6A 1UZ8B 1TTFA 5E2UH 1QPPA 1W0VA 1N3NB 5C71A 1NFDA 5D7KD 3MV9B 4UV4L 4FFZL 4XWOC 1C7TA 4NWUH 4WEBL 4K9EC 3V4VL 2BJMH 4XX1G 3LEYL 5JPMA 3WFDH 3QUMB 2VDPH 2X4SB 4C55A 3TCLB 4OUUA 3QDJE 5EIIB 3HUJA 4S2SB 3V7AG 4KROB 4UIMA 3DV4A 3BPCA 2IAMB 4HD9A 2DMCA 4OM1H 5EG6C 4F9PA 3IJYB 5MI0C 2CLZB 4F7TB 1LEIB 4FXKA 4RMRA 2BY1A 1E4XL 5F7DA 1CK0H 4QRQA 3G5YA 3MREB 1MCPL 1A9EB 1NCUA 3BWUC 4W4OA 3HE6B 5DMGC 1A0QH 1SHMA 5D5MA 1KN4H 1ZE3C 4J4PA 3LCYA 3LKNA 5FHBL 3QUZD 1WCQA 4RAUA 4YGAB 4XP5H 1NUNB 1CVSC 4GQ9L 4OZ4B 3AB0B 3RVXD 5C0AE 1VA9A 1BF8A 4F9PC 3LQAH 3BGMB 3EYQD 4YDJA 1NCAL 4PJHE 1AO7D 3GSRA 1JNHA 2MWCA 5B38B 3OB0K 1RZJL 4LSSH 2IGFL 3EDFA 4OCMC 3C08L 3FJTA 5D71L 5D1XD 1D9KD 2VMFA 4MA1B 2F53A 4I2XB 1NCDH 1HSBB 5LWYL 2FSEB 3AU1B 3VCLA 1OSPL 2OI9C 5EBWB 4JRXE 3IFNH 1DBAH 2DTMH 1U41A 2P7TA 4PJXB 1DQJB 1CQYA 2AQ2A 1U3ZA 2PN5A 3S4SA 4J3UA 3OKLA 5GRVK 3IFPA 4WJ5B 5D93B 2SEBB 1ZVHA 3EDJA 3SDDD 5LGJB 3BYYA 5CJQL 1I3GL 1FSKB 4KGLA 1B0WA 4EI6A 5E8PA 3WE6A 3OKOA 3ZT5A 4RFOH 4LMQE 5LJYH 2BNRE 1IGIH 4N0YH 4JKKA 3G6AA 5E2WL 1IM3B 5I8KL 4Y2DB 2IANE 3MV8E 2BOBB 1WFOA 4PJDB 3UJJL 2QLVB 3LDBC 5SX5K 3MA9H 1SEQL 5DJDB 4Y4FC 2BY0A 5IB2B 4PJXE 4Y5XA 1KELH 4NZDA 1DDHA 1QSFD 1MFEH 3AREC 3FQNA 3RVUC 1F4XL 2FIKB 3HCVB 3FQWB 3BN3B 2E8YA 4HGWA 4APQB 5CLWA 1F6LL 5D2LF 1UC6A 1MSPA 4BQ6A 4PGBA 1IKNC 3G5ZB 3K3QA 4A2MA 1ERNA 1XF3A 5E00B 2H45A 1CDIA 3RVUD 1QSZA 3HI6H 1HI6B 4IIQB 1PG7H 2CRZA 5I1DA 4HIJA 1JI1A 5F1IB 4ODHH 4KVCL 1YEDA 2ADJB 1NBZA 5I8EB 4JY6A 2BX5A 1CLYH 2MCPL 1DCLA 4WU7B 4DCQB 4YPGA 1MWAA 3F65A 3UYPA 2I9TA 5I9QB 1CFQA 3X3GL 1QA9B 3DUSA 3LKSA 3TV3H 1J10A 1ODAA 1CL7H 1EFXA 4L4TB 5IT2H 3SKOA 3PWPB 2WP3O 4HG4J 2DOCA 5LGHH 5IJKA 2X1PA 3QUXA 5TF1H 4P4KA 3TPUB 4KKLD 4ZTPL 3KYAA 5CJOL 5FO9B 3MRGA 2NY7H 1ORQA 5CSGA 5HHXH 3OKNB 2C1PA 3EDKA 3BESR 1QBLH 3V8CA 4U1NB 4HUXB 5IMMA 3O4LD 2R15A 2I07B 4UOW1 4PIRF 4XH2A 1VFUA 2FO1A 4TVPL 3BUTA 4MJ5B 3O9WD 1FG2B 1SJHB 1ZGLA 1J7VR 1OSPH 1INDH 3VG9C 3E2HB 1D5ZA 2PKDA 4I3RH 1WISA 2IPTH 5CBEA 2BDNL 4J3WA 4YH6A 2D7QA 3ULUE 4R26L 5ERWB 1TQBB 4UNUA 3MRNB 5GS0L 1Z6JT 5DMKA 4JZJC 2NR6C 1GHFH 1V7NL 1EO8L 1G9NC 4MA3B 2DL9A 4YBLB 5TQ0H 3HNVH 4K2UL 3AAZB 4AENB 2VL5B 4UQ3B 1ACYL 1JTTA 4LVEA 1ONQA 3FO9B 3U1SH 3UPAA 1Q9OA 5K33A 3IKCB 1AGEA 3QWRD 1MRFL 5D7JD 3TJEL 1CGWA 1VFBB 1J0KA 1QR1A 1KCLA 1FO0H 1SBBA 5HHOB 3VRLF 3QXAB 3FQTA 5KW9H 1BJ1J 1CICA 1N64L 5F9OL 3STZA 1XZ0B 2A6KB 4DTGH 4G5ZH 3MGOA 2WBKA 5JHDD 4QHLB 3VXTA 4HX1B 3V2AR 4HIIB 5JXAH 4CN6A 2NYYD 2AQ3A 3DVFA 4ZQKB 2IAMD 5D1QB 1FNSH 4PRPD 2X4TB 4EJ1C 4XVTL 3VD9A 5IBTL 1YEKH 3CCHA 4NQVB 3QI9B 4DK6A 2Q87A 4NN6C 3MZTA 4K3EL 1JMXA 3VFGH 1I7TB 2VDQH 2MCG1 3IRZA 1FDLL 3DXAE 3IXAA 5HI5D 1YA5A 4Y19B 2FX7L 2Q86A 3T09A 5GJSH 4OKVA 2YD3A 3S37L 2ADFL 1NFDF 2NY5L 2X4UB 4NGHH 4XCYB 4RBPK 1X6NA 4JZOB 1KTLA 3KG5A 5J9PB 2K1MA 4I3SH 4L5FL 3BMVA 5I30H 4HGMA 2OI9B 4I4WB 4XPAL 1T1YA 5C86A 3ZDYE 2DM3A 1QHOA 1U3YA 4LCYB 3D39B 5GJTL 1JVKA 4JE4B 4WU7A 4DCQA 2R2HB 3QCUL 3ARFC 3MRFB 1JTOA 2HFGL 4OZFG 1D7FA 4W6YB 1YNLH 5TQ0L 4NKMA 3PWPA 4M3JA 3QXUA 3T3MF 4XC3L 1E6JH 2EYSB 2NZIA 3N85H 5IMKB 4YIQB 3TN0B 1Q38A 3L7EA 1YMME 4MNQE 5BS0B 2BNQB 4OD3L 3QR2A 1JK8A 2OR7A 4HSQA 2AGJH 4YFLI 2CK0H 2D3VA 2OL3B 5JNYB 2BMKB 3O4OC 4NPYA 2NXZB 2VAAA 3PWNB 4UDTA 1PDKA 1IEAB 2V17L 1U93B 5T3ZE 3PABA 2DQTL 1XGPB 3RUGF 1WK0A 2DAVA 2CKNA 2B39A 1KCSH 1CF8L 4QYOA 1XCTB 5HSFA 2YXMA 3BUYB 4IRJA 3WJLA 1M71A 1FNGA 4QRRD 5KBNC 2EDDA 2YZ8A 3FONA 3WS3B 3WDJA 3KPSE 2Z4QB 1J0ZA 1QRNB 2A9ML 1R24A 5KZCB 3T0EA 1MAML 3QAZC 4UINH 4F80A 3U79A 3MPCA 3MNVB 4N90D 5ICXB 1H3GA 4PJ9D 5HI5C 1WWAX 3D0VA 1MAJA 3NCYS 3QDJD 3RZCA 2KQNA 3BIKB 3MLUH 5DGQA 5T3XL 3PHOB 3ZDZE 3MLWL 4J2XA 3QXAA 3AXLB 2YA0A 1EEYB 3CFIC 1CICB 1XGUB 4NO5A 3QDGB 3GGWB 2ICEA 3U9UB 1V5JA 2V7NB 1E4WH 1TZGH 4ODWB 1LO5B 4FQLL 4NT6A 4RGOL 2QQLH 3IYLW 2B0SL 2WINB 4FQIH 3ZE0F 4JGUA 1NAML 5ESVA 3EBAA 4WI8A 1EAJA 3JV5A 4NBZB 3SPVB 4ERSH 1A7RL 5JW5B 3W82A 3VDCA 1PKQB 2AJ3B 1G0YR 1F4WL 4UB0L 4YDIL 2HG5A 3MX0A 2VWEC 1FRGL 1NC4A 5SWZE 3DRTA 1BOYA 2E8ZA 2H32A 4N8VB 5DVNA 4G8FB 4FTVD 4G6KL 3QUML 2E7BA 4Z9KB 1G9ML 1MRFH 4CNIA 1RJLA 5C09B 3CXDL 1KPRA 2NY4B 1BOGB 1OCWL 4HK3N 2JJVA 4LVHC 4EUPB 4MX7A 4S0TD 1J8HB 3DOSA 1BD2D 4YDVA 1OGAE 3EO0A 1NUDA 1M7XA 5K9QG 4EVNA 3RPKA 2R0LH 1SJHA 4N9OB 3HMXA 1DUYB 1MAMH 4JFDB 1QSFA 3BW9B 3O2WL 1K3ZA 4HWBH 1ITBB 3LVEA 4GKSA 5HHQA 4XVTH 2XKNB 2Z91A 4HIJB 4XPAH 3WYRA 2FRGP 3I85A 2EICA 5EU7E 4NOFA 4NDMA 2I60L 3FMGH 3RVTC 3KYNB 3TVMB 4G9FE 5FKAA 1EJOL 5ANME 2O5XH 1MUJA 2EC9U 2OK0L 1P7KA 1IC1A 5EZLA 1TZGL 1R3LA 3SKOB 2YUWA 5KS9E 5D9SA 4HF5H 5F72S 5SWZA 1OW0C 4QOKA 1A1MA 2NR6D 3H7BA 1G0DA 3STZB 4DVRL 4L4VA 3SGDH 5BJTB 3VXQB 1NKOA 5FYJE 3D87B 1R5IA 1HQ4A 5E5UB 2Y5EA 1BWWA 1V05A 2A73B 5SWSA 4OCYL 5ALCL 3G6JF 3AS2A 3P4LA 1HOCB 3DVNA 5CZXC 4MA8L 5D1QC 5F9WB 2HT4D 2P24A 3DWTA 1P69B 1RJYB 1WC7B 4EIGB 2XA8H 2VE6A 2HLAB 4FMKA 1DR9A 1RZFL 2DQGH 5B39G 3SDCD 1RUML 2RIKA 2YA1A 4LHJB 4OFVA 2ICWI 2IFFH 4U1KA 2EZ0C 3T2NL 5CHNA 2X41A 3VD3A 4YPGB 5K59E 4WTWA 4WUUE 3ZHKA 2V17H 4JG0L 1S5HA 2FX7H 4OF8A 4EBQL 3EO9L 4OD2B 3KLAB 4Y5XC 3MMEB 1A3QA 5E99H 1S7TB 2VL5A 4UQ3A 5D2NA 4HC1H 2JF1A 4NT6B 1J1OL 1H5BA 4I8DA 4CMMA 3U4EA 3NZHL 1RZIA 1B9ZA 4XNXL 3DUHA 1CD8A 1QO3A 3A6CL 3VJ6A 1DQDL 1TVBA 4K3JL 2NXZD 4MWFB 3KPOA 4UT7L 2VISA 3LQZB 3VXMB 2XFXA 3GSNL 3QQ3B 2CIIA 4MXQD 1R3KB 4JKPH 4YDKL 3U7AA 3CXHJ 3KJ6H 3P9MB 3VWJD 5I1AA 4YXLH 3E3QE 5DFVC 1J11A 5MI0B 4TN9A 2P5WD 5EZJB 3TNNB 4LAQH 4A6YH 3HC0A 5EU5A 3LPGA 2J8HA 3DIFA 5DSCB 3IDMA 4LU5H 4BSVA 4AEFA 4R9HA 1WTLA 1M7IA 2PO6B 4JO4H 3AS1A 3PDOB 1RUPH 3ARGB 1K4CB 3EJZD 4GG8A 4HAFA 5EO1A 3WNMA 4KWUA 4JFDA 2IANB 3MV8B 3KWWA 1OQXA 5HGAA 2FX9H 4BH7B 4PGDA 4OB5L 2A83A 5C0IB 4PY8J 1RU9L 1ZS8B 4IDLA 3RI5K 3F5WA 5CD5D 25C8L 3IKCA 4ETQB 2DDQH 1G7JA 4ZNCD 1AHWB 2HFTA 4R0LC 3OGCA 1T89C 3M1BA 3WIFB 4DK3A 2EE2A 1SEQH 3HAEA 4ZPTA 1WFNA 2AAVA 1T7VA 3HC3L 3TBTA 1CZ8L 4NFDA 5I74C 4JO2H 5ADOL 2FHCA 1FNGB 1YEJH 1Q9WB 2ZUXA 2W0FB 4AJ0A 3GFUA 5E8NB 4NQXA 1T5WA 5I75C 1U91A 3C2AH 3WLWC 4YHKL 1A3LL 4UDTB 4XNMB 3RIFK 5CIPA 5I71C 5ALCH 3UC0H 4CGTA 4QGTA 3VFMA 3QDGD 3VI3F 1RJZB 1RJYA 3W2DL 1T1XA 1XGPA 5LGKA 2QHLA 4JJ5B 3BZFA 1I85C 1IFHH 1LEGA 2P5WE 5FIEA 3RWCB 5I1EH 1M71B 1DVFD 1N8ZA 4RMTA 3SKJH 3VXUB 1W72A 4C4KT 3H8NA 4KUCD 4LNRA 2OS7A 4NKIH 5DJYB 3RNQB 2D03H 1OF2B 5GGTH 3OKDA 1S7QA 4QXUL 4KI5E 3ROOB 1AE6H 1WBXA 2HT3D 4ZS6C 1MPAL 5D72H 2D0GA 3C60D 3CFJB 1SJEB 1JZ2A 1A14H 2IH3B 2ARJA 1RFDL 2Z31B 1I1AD 3SCMA 5CAYB 2J7LA 2YPVH 4R7NB 5FM5M 3V7AE 1WLHA 2X4QA 3OAYH 1FZMA 2P46B 3WFEL 5J12C 4AT6A 5DLML 4G9FB 3B9KB 4JPWL 2VAAB 3PWNA 4JQIL 3GK8L 3U7WH 2DQGL 3O6MH 4L8DA 5JO5B 5T3XH 1ZA3A 4R97C 2AV1A 1AKJB 2J4WH 3Q6GL 4Z7QF 3BQUD 2AEIT 4APQC 4C58B 3Q3GA 1FFNA 3KLDA 4JAMB 4UU9B 1FGNH 3VA2C 2WIMA 2FZ3B 1A1MB 4KDTA 1QPXA 4D9LL 1K85A 4M4RA 5EU7C 1I8IB 1DSFH 2PTTA 4DVBB 1KEGL 4P2QA 3VMPA 1RIHL 1H5BC 4D3CH 4XNZB 5B4MC 4M7LT 4KXZH 3H9SB 4FTVB 3LRGA 1HOCA 1D9KB 4LLUA 4PG9B 3HUJF 4GAJH 4U1JA 2JIXB 3TA3B 2CH8A 4ZTPH 1FYHB 1A6UL 3OSKA 1FE8H 5GGRB 2P1YA 5FK9A 3SDXA 1B0RA 5I16B 3ULVC 4WFEE 1D3CA 1T7XA 1Y18A 2ATKB 3WS6A 4A6YB 2SEBA 2AV7B 3QXDB 4G8GB 5K9KB 1FNLA 3ARED 4LLVA 1GGBH 5H35A 4HV8A 4KI1A 4J6RL 2VLJA 1UH2A 2IPUG 3I6GB 3JSSA 3PDDA 2OM5A 2GK0A 3OBAA 5TGBA 4M03A 4QHKI 1A22B 4R26H 3MFGB 1LO4H 5E9DE 1I9JL 3G6AB 5T3XD 3ZE0E 2ENYA 5IMMB 2HH0L 4YK4C 3ARBA 5DD3H 3MJ7A 1S7VB 4BFIB 3O6ML 3MRKA 3OWEA 1JNLL 2VUOA 4YHMH 3RP1A 3H9HB 4N0FA 1FFPA 1QFWL 3K4ZA 4J1UB 3O41B 2DQIL 1J0YA 3QQ9D 5KAQG 4M1CC 2HTLC 4LCWA 1KCKA 5KSBA 2WWMC 2BNRA 1WT5A 1BQHA 3L95B 1KN2L 2NY0B 5D2NE 3NOIA 3DSFH 4HBQA 5GRUL 3ES6B 4X6CF 4JRXD 2FX8L 2DI8A 43C9A 3VE0A 4P3CL 4EQ3A 5INCB 3IDJA 4OCWH 3RWHA 4WW2A 2D03L 1N59A 3LQZA 3CFEB 3VXMA 5F1OB 2P8LB 2UZYB 5GRWA 4P46B 5DWUH 5GS0D 2CK0L 2IQAB 1E4JA 4LGSB 1XZ0A 1VDGA 2A6KA 3EYOA 3C5SA 3QEGL 1NC4D 3NA9H 3PIQB 4ONFH 5I19H 3RWGB 1AQDB 4W70A 5CGMA 1YEIL 3W39A 1DQLL 4WU5A 2C26A 3I9GH 4QRPE 3SE8L 4K23L 1AHWC 2HRPH 4Z7UE 3UBXA 4OM0H 2DQEL 3U48A 3MXWL 3GB7B 5E8OB 3SDYL 3OB0H 1WITA 3INUL 2EXYD 3GEWB 3I75A 4NKDA 3EOBB 3S36H 2VISB 1HQ4B 4Z5RB 4L8CB 3S88L 1HSAA 3WBDA 1F4XH 1X7QB 1AO7A 5DRNA 5CGYD 1SEBB 3BP4B 1ZLSH 3SOBL 1RQ5A 2GTWB 2UY7A 3GM0A 2QADC 3QDJA 3KNBB 4MAYC 4WI3A 5I75B 3DETD 1KCUL 5GGUA 1LD9A 5ILTL 4LASL 1T22A 5DSCA 3IXTA 3QP3A 4ALAL 1FL3A 4HWBA 3PGDA 5D7LD 1IM9B 3ARDD 1N5AB 2J12B 4KJYA 4M6OL 5EZIH 4EXPX 3V4VH 1HHGB 35C8L 4Y5VA 4E0RB 4TULH 4FMFA 3PE9A 5BV7C 4JO3H 4V1DD 2D7PA 1C5DA 1X5ZA 3U7YH 1G6RL 4Z78A 1GJIA 2A38A 2PXYD 1VGEH 1KYOJ 4MD0A 5CWSA 3MLTB 3UAJD 1RZGB 4PRBA 4X6DB 2V6HA 1QSEB 2G75B 2I07A 3HMWH 3U1SL 1FRGH 1JGEB 1RUKH 2APFA 2VJXA 2BOBA 1UT9A 5GS1B 4OF5A 4KMTL 1GGCL 2F74B 5IEHA 3KPLA 4Y16A 4YHOL 3WFHB 2CUIA 4NOBA 43CAB 1VEMA 4R3SB 2EO9A 4YUEL 2ZNWA 4M1DH 5C07A 3KPSB 3DI3B 5AG8A 4L8BA 4CVXB 2GIYA 2J8UA 4H20H 2VR9A 1I1FB 4NWTL 1F3DJ 3E8UL 3O2VH 4E41A 1TPXB 1VGKA 5BCAA 5C1MB 1P9MA 3QO0A 5TE6L 2Y06H 5IJKC 5KJRL 4MCYA 4LP4A 3O9WB 4TVPH 4QWWC 1KGCE 5FUCE 1NGPL 1CDYA 1A2YA 4D9LH 1FBIL 1MJUL 4UILH 1WFUA 4Z7WA 3TYFB 1KN2H 2NY2D 5BW7C 3CFDB 1OAKL 3DYOA 4DN4L 3VFUB 4WW2B 5B3NA 3V5HA 5DHXB 3VMOA 3Q6GH 3IJSB 1FP5A 3DURA 1KB5B 3WUWA 3BKCH 4Z7QE 1OGAA 2LQRA 3LPWA 2HJKA 3RJDA 1AHWA 1ADQH 2VAJA 3KJ4B 4RDQG 4Y19D 4OIIH 3RHWK 1CLZH 2NYYC 4Z7UB 2Z92B 2Y6SC 5F88A 3GBMH 5TPWL 4AY0A 4KZEL 5J06A 3ZO0A 4KPHH 4PYHA 4PJ9C 2XTJB 3RVWD 4LBEB 5DYOA 2ZUYA 4OFPA 1J0JA 4ZDHB 1U95A 3SCMB 4MYWB 1UCTA 2VH5L 3OR7A 12E8L 4PYGA 4XHJC 1MJ8L 4AM0A 4KQ4L 2ID5A 4BK5A 3VA6A 2YSSB 2C3WA 1U92A 4HEPG 5DRZB 4Z8FL 4NO0D 4HS3B 3OKMB 2OYPA 4AEHH 5FV1L 3MNWA 3T04D 3ORJA 3W0WA 4YFDB 3D2UD 1MJ7H 4U6VL 5GGRY 3RY4A 1B4JH 4U3CA 4Z76B 1MWAH 1JYNA 3D85A 5KSVB 4ODVH 1ZT4A 3GI8L 2NLJB 3TBSB 2AEQL 5CP3H 3ARFD 3IFOB 1SM3H 4LSTH 3V9FA 4Q97A 4L4TE 3NCJH 2JJWA 1CE6B 3CD4A 2E3VA 2BERA 3QDAA 4U1HA 3PWLA 4X7SL 4MVBD 5FFLA 2JB5L 1OAUL 1WTGT 2VXUL 1IAOA 3EFDL 1EGJH 2NNAA 5KSBF 4QHUB 2YRLA 2WLYA 3C09B 1MCRA 2V5TA 1RV6X 3H9SA 3EJZC 1O5DT 5J0BA 3S34H 1N0LA 4XBGB 1I9IL 4YHYB 1NCAH 4WEMB 2KQMA 3X12A 5I74B 4ZYKB 4FABL 3SQBA 4HIEA 3RDTD 3RA7L 4F7CA 5IVXE 4WWKB 3A0OA 4XXDB 3GBLA 5AAWA 1QBAA 1XEDA 4HT1H 4P2RB 5KSUB 3LD8B 3CK0L 1CLZL 2ZCLL 1KB9J 4WWID 5SV3A 1W0VB 2IPUK 1WUNT 3QI9D 3NTCH 1SBSH 3O8XA 3IDYB 1OTUD 2R2EB 4G43A 5ITFB 2FYYA 3RDTC 1AGFB 2HP4A 5CKGA 3FCTB 5DJ0B 1OP9A 1SYVB 1LO5A 3VI4F 1M05B 2VWEE 1LK2B 2Q7YA 1C5BH 4GRWB 5INCA 4ELKB 5JZ7C 2HFFB 5HJ3A 3U9PL 5LGHL 4FZ8H 1G7LA 4Y5VC 3GSNB 2VOTA 2ZSWB 3UJJH 1NGWA 4PJ5E 3LKRA 3LN5B 4U6VH 2HRPL 4YHLH 2V2TB 1XIWC 3Q5OA 4K9EH 4PTTB 3O3UN 1CFSB 1NCDL 3PL6C 4FTVA 1KXVC 3O6FC 3SGJA 5J6HA 3BPNB 4JM2B 2YPKB 3D39A 5GHWL 3L5XL 2NXZC 1RZJH 1INDL 3I50H 3TN0D 5ID0A 3VGFA 3HI6L 3NPZB 4JR9L 1GGTA 1B0GB 5HGDA 3CVIL 4GRMB 2AXHA 4JGMA 4JZJB 4G3YL 4UQ2B 4XP9H 4G8GA 2P5ED 2AJSL 4FN0A 2BNQD 5FYJL 2FBOJ 4EN3B 5I0ZA 2CKBL 2VLJB 4WHCA 4WFHE 1G84A 5IQ7L 3DTXA 1U42A 2VYRE 4K71B 5D8JL 5DEZA 2DTML 3ZKSD 3WO4B 2BC4B 4JY5H 1YECH 3SE4C 4AQOA 1E27B 5E5MB 5T33H 1FYTB 2F54A 4HFWA 3TIDB 4KVNL 3TV3L 4DOHE 4KQ4H 3QA3B 4QRTA 3TNMA 1P4BL 1NDGB 2VITA 4YFEA 5ACZB 2M8XA 1C08B 3D0LB 3BMWA 5AWNH 5HXMA 3VMNA 4IMLB 1PZ5A 4O02H 4XZUA 1J8HD 4YHOH 3MCKB 3BPOC 4O9HH 3P4OA 3UPCA 4MMXC 5F3BB 2DQHL 1MUJB 3WCYA 4S2SA 5KN5B 3MUY1 5M7QA 5A40E 3O6FB 4TUOB 5F96L 1FFQA 5C9JA 1MCWW 3HPLA 1D5IL 4P2RA 1RVFH 3KPPB 4MJIE 1HHJB 4HKBA 4P2OB 4I9WD 3TLRA 1K5NB 3F6IA 3LN4B 3QWRA 2MJWA 4ZTOH 3V4UL 2K7QA 1LO2L 4PRAB 5T5NF 2NY2B 3RZWA 1NMBL 1HH9A 1PG7W 5CEZH 2XTJE 2HJLB 12E8H 4WDIA 2HG5B 5E0QA 2CD0A 1PQZB 3EKCA 4P23D 3FT3A 5I71B 4LBEA 3WO4C 1ZEAH 4DWHA 2FJGB 2J88H 3GMLB 4G6FB 1KIRA 4OF0A 4XI5C 5C09A 1T1XB 1U92B 5E2VH 4DN3L 1IGCH 3D18B 5JPMB 2YZ1A 1VFOA 2HT2D 4DQOH 3GJFB 3QDMD 2HFEB 1NSNH 2CJUL 3GRWH 2EDHA 3MMEA 3RKDC 4MXVF 3P9WB 4Y16D 5ENWB 3O0RH 4OT1H 4OUUB 5EIIA 1YNKH 3JWDC 3AY4C 5D6DC 5T1DL 1TJGH 1RZIB 1IAII 1LO0H 3EFDH 1EXUA 3LKOB 3KYKL 4K8RD 3ZHLA 3FRPG 4G6ML 1OB1A 2PYED 1MHPL 2ARJQ 1CDJA 4F7PA 5C0RL 5DD6B 2WUBL 3D2UB 5A16B 3TO2B 4LCUB 1G7IA 3VW3H 1XF4B 2EC9T 4X8JA 5D1ZA 4OLZH 2BVOB 3OX8B 1T89A 5FF6B 3VRIB 1YDPB 1MQKH 1KJVA 4JQXC 4NUGL 3ZSSA 2R0KH 3X11B 3HG1D 1XCQA 3SE9L 1GXEA 4OJFH 3VRLE 5JQHC 2DWDA 2EO1A 3BAEH 4MGXA 4ODBD 4R8WL 3MBED 3ZDZF 4HK0B 2H8PA 1UWXH 4Z0XB 4WNQA 1VENA 2BXYA 2EE9A 5DVOA 3RAJH 1T2QH 3LEVH 4PJHA 3S35H 3GBML 5TPWH 5FOJA 2ESVB 2Y7QA 2JK5A 2MNUA 3OZ9H 4I1NB 4WWKD 5SWZD 3UTQA 1DEEB 5B3JF 1YYML 5DT1H 3RKPA 1B2WL 2D31B 5JLZA 1R5VA 4MS8C 4RWYL 3AAZA 2DQJH 3VFUA 1IGCL 2VDKL 5JHLL 1P1ZB 1T20B 4J6RH 1FGVL 3ULUL 1IL1B 1RSFA 1CBVH 1WGOA 4O02L 1QR1B 3QEGH 4LHUD 5E6IB 1CWVA 5E56A 1ZA6B 1U8JB 4JJ5A 4NC0B 3U0WL 4OZGB 3FCTA 2Z92A 3MV9E 2P5EB 4QF1B 4F7EA 4WUKL 4WW1B 4HIIA 5H37H 1EHNA 2LU4A 1KTRL 3PWUA 3MRRA 2LU3A 2BY3A 3W81A 3F12B 5GGVH 2A0LD 5ESQB 3VFPA 1S7UA 4DZ8B 4L1HA 1UADC 4RFNB 3LKPA 5IMOB 4PJEB 1JWUB 3SDDB 1GAFL 3ARUA 4JPIB 5IESL 4BQBA 1G7PA 5EU3B 1CXIA 4XRCA 4F8QA 5JR1L 4JM2D 1FC1A 1Q94B 1KG0A 4LARH 1T7ZA 3C60B 4NO2A 5DRXB 4OFIA 5M94B 4JM2A 4XP9L 1LO4L 4N0FB 4Q74A 3TCXA 5H2BB 4PTUB 3WHE0 2GQHA 2FJFA 3TYGL 3AM8C 4D9RD 2Q76A 3TBYA 1WFTA 3REWA 4DN3H 4I4WA 4OZIE 1UEYA 2R23A 1NL0L 2IBZY 4MJ5A 5JHDE 1KJ2L 4XPTL 2FJHA 3UPRB 5GSRA 4AMKH 4KJPC 1BJ1H 1PAMA 4OGZA 2EDFA 4XVJL 5L7XH 2ILLA 3VXSA 2B8OT 5CBEB 4LKCB 1AH1A 5IFJA 5F9WC 1I7TA 1NPUA 1PSKL 4APQD 3QEQD 1ORQB 2ZJSL 4DEPC 4DKFL 3UJTH 1PKQE 4GRLD 1AJ7L 5IUSA 4MD5B 3BPOB 3E6HB 1R3IH 4BSWB 3HI1A 4JKLA 2F9BT 1ONQB 3FO9A 4GG6B 5JZ7D 1RVFL 4HS8H 4AIZB 4L3EB 4K3EH 3VFGL 5BOZG 5I1JH 1ZVYA 3KXFB 4P4KD 5DD5H 3O6KL 5ESAB 2UUDH 5HYJD 4JFED 4YGVB 4WY7H 3EFFB 3EDEA 3PGFH 1B0RB 5I16A 5DTFA 1T5WB 5TE4H 3O4LA 2X70B 4UV7L 4K23H 3UZEA 3FRPA 3BWAB 3C9NA 5DUPH 3O11A 4JN1H 4NCC2 4PG2A 2DMBA 2E27H 3PP4L 4UAOB 1XR9B 5HY9B 2BSTA 4HFWB 3TIDA 2G9HA 5HHOA 3VXUD 3OZ9L 2BMKA 4NPYB 1MREH 5KVGH 3IXAB 3LHPH 2BVEA 4IRSD 5E2JA 1NSNL 2CJUH 2C7UB 5IVOA 1FG9C 4X4XA 1AD0A 3VD4A 5CILL 5K9KA 1PEZA 3ARTA 1JHKH 2AXJA 4H5SB 2FX8H 3MRDB 3SHSA 3OAZH 4MB5A 2XWTB 4D9QE 5JW3L 5J1TC 3GHEL 5F3BA 1OTUC 2QKIB 2W0LA 3LQAC 4FQLH 5E8EA 1DBAL 5T1LB 2ZKHL 4X6CB 4WUKH 4WV1C 2EDLA 1MNUL 5T3XE 4DW2L 2DI7A 4LNVA 4JG1H 3KDMA 2G2RB 3LKPB 2Q86B 3AREB 4XP1L 3ZDXE 3OMZA 4XNUH 4ZOEA 3SDXF 4V2CB 1OAXL 2XNAA 4U49A 3TT3L 3STLB 2IGFH 4NWTH 4PLKD 3K1KC 1MIMH 4H0IA 1KPUB 1YN7A 1LDPL 4CVZA 1WZ1H 4ONHA 4RRPG 4ZAKA 5KSBB 3FN9A 1EUUA 1IGIL 5GS3A 3ZT7A 4G80A 2BSSB 4ZUVB 2GTZB 4LMQI 4WRLA 4P4RA 2KL6A 4HDIA 1AQDA 3WIHL 3V6ZA 2GJ6E 1BBJA 1UM6H 1UYWL 4G8EA 4HS6A 4LLDA 3WXVL 5AG9A 5T5NG 1NGQH 3UBXB 3ULVD 2VXVL 5I1KH 1KGCD 2FZ3A 4W81A 5IB5B 3U46B 5JW5A 2ZP0T 2VQTA 1VGEL 3GIVB 3GSNH 3L6FA 2LV4A 3MOBH 5FYJU 3TIEA 2A6JB 4IOIA 1OARL 4GAGL 3PGCB 3BUYA 4IRJB 4MQXC 5CS7A 1ES0A 3MLYL 4YXLL 4LHUB 2X9XA 4PRHB 3X13B 3KPTA 4LIQL 5I17A 1CN4A 3U30B 4XP6H 2AABH 1ZT7A 2W0KA 2DMKA 4XHJD 4JQXA 4Z8FH 2OK0H 5FO7A 4DKEH 2CKBB 2FX9L 3GB7A 3RY5A 1YC8A 1T20A 4H1LG 3HC4L 2I26N 1MCBA 4WW2F 3BKYL 4WVRA 3VFSA 1ZANH 1R3LB 2ESVD 5E4EB 4JO1L 1EK3A 5E6IC 4FQPA 4CAGA 4M6NH 4PJ8D 4KZEH 1KELL 1F8TH 3V5KA 3VXQA 2PYEB 2APVA 2VC2H 1O0VA 1IGYA 5F6IB 2X7LA 3NCEB 4J7RA 3LAFA 5FKPB 4AMKL 4FXLA 5D7IF 5MERB 4LPTA 3OXRA 3MRHB 4WCYL 2FH6A 3BZDA 3O6LH 5IBUG 1OP3K 3EJYD 4N90E 5DEFB 3GMPB 3MXVH 1AY1L 2IMMA 1AR1C 1KV3A 1KCVH 1JF1A 3DRQA 3D6GA 3QO1A 4JRXB 1LO3H 3HA0A 1YEGL 4JN1L 2XXMB 1FBIH 5CP7A 3BP7B 4HLZH 3H2WA 4PPTA 3S6CA 3OTTA 3PWPE 4Y4HD 1BOGA 5I1CL 4D9RE 1KIPB 5D7IE 4XB7A 1HYSC 4R6UA 4PJ5D 2AJYL 2YUVA 3L9RA 5I1IL 4ETYA 5IESH 5DMIL 4L9LA 4GBXC 5C0GA 1FLRH 5DZLA 1SY6A 3TESA 4ODUB 1H5BB 1XF2B 1YNLL 1NC4B 2Y23A 4G5ZL 2B5IB 3QULB 5D8JH 3TO4C 4DKFH 4KY1L 4WWKA 3S98A 4X7CC 2Q20A 1U6AH 4JFZL 4RQQA 2NY2C 4PBXA 3IJSA 4E41B 4BA8A 3ABZA 1RUKL 1U3HC 1G9EA 2ARWA 4XC1L 2D4FA 3IDUA 4HLZG 4HT1L 2ZWLT 3WFBH 4MJIA 4UNVA 2W59A 2GTZA 4L29A 4OZHB 3UTTE 1JWUA 5I8KH 4RGMB 3V5DA 4K55A 1JF6A 5I76B 4EI5C 1Z0MA 1QFWM 4G7VH 2HFFA 3B5HA 2OTUB 5EBLB 5I1JL 3D69A 4RCAA 1VEOA 4MZ2A 5BRZE 1QSEE 2D31A 2A6JA 4IOIB 1BREA 4WY7L 3EGSA 3WNPA 4PTTA 3IS0X 5IGXH 4NN6B 2PCPA 25C8H 1L7TL 2YEZA 2W91A 1T2XA 5IROA 5GZOD 1DN2A 2H2PC 2R23B 4ZAKD 1EVTC 5DS8B 4L8SB 1BBDL 2PXYC 1CLOH 1AGDB 5IF0A 1FIGL 1FO0L 1U8JA 4NQEA 5T1LD 4EI5A 5C09D 3IFPB 2M1KA 2NTSP 1X4ZA 2XZAH 3W11C 1HQRA 5GQBA 4KHTL 2DKMA 1MI5D 4LFHG 5LQBL 5EO0B 1WEJH 3NFPA 3I50L 1X5KA 4PBWD 1QSEA 2G75A 3UTPE 3AU1A 3KLAA 5GGTA 2EDBA 3DTXB 5FKAB 2MCPH 4JPIA 4JHWH 1UB5A 3K1DA 1U91B 3AC0A 4LEOB 2OSLA 3GNML 2P8PB 1DQJA 2R0ZH 3IU3B 3ULUD 1DE4B 3C87A 4XNMA 3QHFL 2FHFA 4QXGH 4CU6A 4XXCC 3ARPA 2C1OA 5L88L 3I3EA 1HZHH 3BO8B 1A8JH 5DTFB 3S5LB 1NAMB 4NGHL 2OQJA 4X6FB 4BH8A 5C08A 4GMTH 4KROD 4KH2A 2ZKHH 3TCLA 3O11B 1N8ZB 2P5EE 3DYMA 1BLNB 4L3EE 5ID1A 3MLXH 1UH3A 4YBQC 4XAWL 4ZUWB 3LB6C 2XZCH 5F1SA 1UFUA 3DMMC 5E24E 5D96C 1L6XA 4DKAA 2EEBA 1CGYA 5KOMC 3S9DB 2MPAH 2Z31A 2C3HA 3MBXH 1NMAH 4FA8A 1MFCH 1L0QA 2Y6SD 2UVFA 1DN0B 4MJ6B 3KLHD 3GMQB 4IRSB 4LVOC 3CU1A 3DUUA 3G04B 3MXVL 2XQBL 5HHME 4BSJA 5AZ2L 1EHLH 1MCWM 3SO3C 3NCYP 4D0BA 5GISH 5DWUL 5BV7B 1GH7A 2JCCF 4LNRB 4XC1H 3HLAB 4OGYL 6FABH 3CCHB 3TBTB 5IHBA 4MQ7B 3O8XD 2HYMA 1YNKL 1HXMA 2YMXL 1S9YB 4JDVB 4PREB 5E1AA 3I6LE 3BZ4B 1A6AB 4PJCE 1K8IB 1UCBL 5D5MF 3MRGB 3GMMB 4QWWD 3RWDA 4CU8A 1F3JB 4HJ0D 5SWSE 2EECA 5T1KA 4QXUH 4M48H 1F02I 3WO3B 3PV6A 1HH6A 4KVNH 5IVXA 3D3VD 4TQEL 3OF6A 4GRMA 1CE6A 4JZJA 4HXBH 1ZT1B 3NCCB 2ED9A 3ARGA 3NN8A 3BH9B 2BZDA 4H20L 4LDOB 4CDGC 1TENA 1ZGLB 1FYTD 4TYUA 1H3WM 5GZNC 4E5XA 2ZUQC 3Q3GB 2ZCKH 4FQCH 2DQDL 4FG6C 3V4UH 3RGVA 1KF9B 5CBAA 4UINL 4XPBH 5GRVL 5F96H 1CD1A 1YPZE 3GMRB 4RA0C 3VWKA 4JM4H 5F7YC 2X4NA 5IFHL 4F2MB 3OGCB 1WAAA 1JNLH 4PJGE 5D1XB 5HDQH 1AI1L 3QWOB 1HKFA 4RAVA 1JGUL 1MCFA 1RK1A 2XNAB 3WLWD 1Y6MR 3VXSD 1YJDC 1SQ2N 3JV0A 4PLKC 1BHGA 4KTDL 2R8SL 4Z7VF 3PL6D 3SBWA 3UZQA 4YDLC 5HYQA 2VLMD 2Z35A 1FZMB 4A6YA 1FJ1B 5I1IH 2PW1B 4RMWA 1KULA 5C08B 4G9DB 4LCWB 5DJCA 3EO1B 2Y25A 3MJ8B 4P2OD 1DVFC 1MOEA 1LDSA 5BMFH 4AEIH 1XF2A 5AZEH 5E9DD 1XF5B 2LU7A 1I1AA 3SGKC 1OT2A 1UCBH 1II4E 1XF3B 5E00A 1F58H 1B88A 1TITA 3LKRB 4RGMC 3LQAL 4ZO8A 3FT3B 4K7PH 2CIKB 4K94L 2CXKA 4OZFA 5JDSA 4Z7WE 4CKVX 5I6XB 4LSQH 2FNBA 4JHAH 5CSBA 2NY7L 2DQFA 2D7TH 1ZOXA 3MA9L 4YR6B 3VFRB 5C7XH 4C56A 2X1QA 1FORH 3Q5TA 4EN3D 1IAKB 4KTEL 3RPIA 2DS4A 4NM8L 1M6OA 2N1KA 5DMYA 4M1GL 2R2BB 4XXCA 1B4RA 4WI9A 5F71A 1F6FB 2JCCB 3UO1H 1WCBA 5GGRA 1MJJA 3GSQB 5C8JA 1C5CH 4RRPA 4C56E 2E6PA 5DMJB 2PYEA 2OLDA 3HRZA 3QJFA 3OL2A 5EBGA 1IKFH 3QXDA 2AJYH 3LZFH 1JTPA 1LO2H 1MFNA 2EYSA 5CJQH 4E41E 4XBEL 3UBXI 4XPFH 3NACH 1IRAY 1T1YB 2Q8BH 5DO2D 1LEKB 1MQKL 2Z31D 5GS2H 2HVJA 4GT7A 1XH3A 1WV7T 3T3PF 1AFVH 5FF6A 3S3SA 4BKLB 4KFZC 1B3JA 5KSAC 3LKOA 5EDXA 4F37F 1QBMH 4AH2B 2GW5A 1IEAA 4L3AA 1QUNA 3JWOL 4EVNB 2MTPA 5BXFB 3O8XC 3F7YB 1U8NA 4GRWE 4M00A 1TVHA 5EZOL 3L3OB 3I6GA 1CT8B 2F19L 3T4AA 3L9RB 5TF0A 4HPOH 4Z78B 5JUEH 3GNMH 5CWSB 2ICWA 4R0LA 3N1PC 5L8KB 1MFDH 2EDNA 5DHYB 4KPHL 1T1WA 4S1QL 1ZLVH 2C3GA 5DQDL 1CGSL 1PZUB 4N0UE 4RFOL 1NMAL 2X5PA 3MNVA 4I3RL 4BSWA 4F33A 3IXTB 1H3TA 4X7TB 5EZLB 3S5LA 3T2QA 2I5YL 1S7RB 3EJYC 4J1UA 5D1ZC 3P2TA 1LP9B 4XBPA 1NFDB 3IDNB 3OPZH 4I48B 4UT6L 5ITBL 3RIFF 1I85A 1E4KA 3P0YL 4S1RH 4PJHB 5D1QA 2V5YA 2JJUA 3C5SB 1QKZH 4QXWA 3VFOA 1P4LA 5JR1H 4XVSH 4ODVL 4PV9B 1I8LC 4LSRH 4XTRD 4PGEA 4JG0H 4NJ9L 3DETC 1XIWD 4RFEA 1IMHC 3NCJL 3RWHB 4UIKL 3O9WC 4JFQB 4OZIA 5HYSB 4XVUC 4Z7WB 1MFBH 3D69B 2CLZA 2XTJC 1MRDH 3CFDA 3TFKD 5DGRA 4HCRA 5GRZA 1A6WL 5E95B 4JRWA 4U0RC 4OTXL 4KK5D 1JN6A 1KJ2H 3HE6A 5CHNB 5DS8A 1Z3GL 1NFKA 4M5ZH 3FHAA 1EMTH 1VPOH 4LK4A 2F5AL 4HGKC 4TVPD 1AGCB 5FGRA 1T04A 4NKOA 2W9LA 5E6ID 2P44B 4OD1H 3QJHB 4CN1A 3G5XB 3B9KC 4LU5L 4OCXH 2WK2A 3QIWD 4JZNA 4X99B 5TQ2L 4N8PA 1HNFA 2VC2L 5DJXB 5E7BA 5D70H 5E9DA 5GGSA 4YHLL 2BP3A 3UDWA 3PWVB 1A7OL 4OIBA 2AVGA 1KPRB 2CMRL 1NBYB 5ANMB 1X5XA 1NCTA 5BW7A 3HAEG 3CVHB 1WWBX 3NA4A 4Q9RH 3NAAH 3ZDXF 5C6TL 3SGKA 1OT1A 5F89A 2ZOKB 2WWKO 2GY7B 5L6YL 4ZFFA 3KPRD 2P7TB 4GG6A 3JV4A 2Z8SA 4LLYA 3GMOA 1RJCA 4I3GA 4W6WB 1G7HB 4GFTB 4BJLA 1ZSDB 1FIEA 1CIDA 5HYQB 1FVEB 5EU6E 4W4NA 2GEEA 4KUZL 1EEUA 3MRBA 4EI5D 4NHUA 5DUPL 3KLHC 1DANU 3FT2B 4XWGH 4NFBA 3CIQA 4X4ME 3T8XB 3MJ6A 4YHPA 4HJGB 3K81A 2X40A 3VFWA 1HN1A 5IOPB 5J56B 1RK1B 3U30C 4X0KB 1KEMH 4AZ8A 3ULVE 3QCUH 3DMMD 3IJHA 5HPOA 2H9GA 4ZPTB 4Y5VB 3BIAX 4JO1H 1U8KB 3C8KB 2MQ0A 1ZGLP 4D0DB 1CXHA 1QRKA 4WW1A 3VFSB 4M61B 2MOVA 3S37H 3ROLA 5DJCB 1QBML 1C1EL 2UZIH 4XNUL 1U8OA 4JPKL 1KLUB 4QHUA 1XR9A 1B4JL 3VFOB 1SYVA 4I77L 3IJYA 3RX7A 5JOFA 3GMNB 3NCMA 1U8PA 2ADGB 1EEQA 2EDOA 3NFNA 3KXFE 2W60B 4RIRA 4UT9L 3ALWA 4R3SA 1BJMA 3DGGB 2FGWL 3NAAL 4M1GH 3WHXA 2AK4E 2AEPH 4U33A 4AM0B 3FRUA 2FDBP 1QSED 4WUUD 3JTSB 4GSDL 2P47B 2UVEA 4LIQE 4WI2A 3G6DL 1Z9SA 3MO1A 2OTPA 4MCYB 3S34L 2DQCH 1R5WA 5C0BE 3PL6B 1T0MB 4G80B 1D6EB 4PV8B 1ZTXH 3X14A 1UKTA 5F7NC 4ZDHA 1LEIA 1U3HB 5DI8B 2CXGA 1JPGA 2DLGA 3OJVC 4X99A 1JZ8A 1ZWIB 3ALPA 4P3DA 5A2FA 2IBZX 3U7YL 1Z3GH 2HKFH 4LPVA 4V1DE 3H42L 4NQEE 3BDXA 1E4WL 5EOTA 4HZLA 1NC2D 1JWMA 1L0YA 4DW2H 1KENL 2AI0H 1A6VH 1DQMH 5HYJB 5KVMC 1FE8L 4PJ8A 5CD3A 3I6LD 2YA2A 4KJQD 2G60H 2BRRH 1IQDB 1DFBH 4HIXL 1Z5LB 4OCWL 1URLA 3KYMA 2J3SA 1A7RH 4ELMF 4I9WE 1IVLA 3FFDB 1J86A 3O4OB 5LKNA 1JYWA 3DUSB 2D9CA 5SWSD 5C8JB 5F7UA 3H9ZA 4Y4FD 1HEZB 3QUZB 1PKOA 3RHWF 1AQKH 1LVEA 5EU4A 1B6UA 2R2EA 3D5OF 2QTEA 3OKMA 3N06B 3SDCB 3SCMD 2H2SC 3IKKA 4P2QB 1IM3A 3E1F1 3C2SA 1CXLA 2O5ZH 4Z76A 3RBGA 4OM0L 4FNLH 3OKNA 2NY3D 4Y4HA 1OD7A 2F54E 4R2GD 4PY7B 5FYLH 1CFNB 2VABA 4XP4H 3EYVB 4EOWH 4PY8I 1S8DA 3QYCA 2VLKA 3CZFA 4DJMA 5TFSL 4FQXA 2HRLA 3CDGA 5IBLC 4DUXA 1NCWH 3VFRA 35C8H 2HMIC 4GKOA 5IBUB 5KVFH 5EUKB 4EI6B 5HDLA 1KJMA 3QUMH 1PG7L 2G5RA 3JTTA 4JRXA 4NNXB 1P6AB 1HQRB 1I8KB 2EIEA 3V79C 5I1GH 4LSVH 3VXMD 2ICWB 4R0LB 1EZVY 4ELKA 1UZ6F 1IGTB 3KDMB 3RVWC 3O3EA 2HJLA 1MHPH 3IU4L 2X9WA 3U0PA 3K2UH 15C8L 3VXUE 4L3CB 3RQ3A 3BRDA 2EDYA 1M7DB 3GSVA 4PJAB 5FYLE 3DRQB 4GW4A 3WIIL 5DJXA 1AD9B 3RGHA 2VQ1B 4OBSA 1VERA 4MAUL 3C5ZD 1N5YL 1NBQA 4XPHH 1TCRB 4AEHL 1MEXL 3F62A 1H3PH 3KPPA 4BUHA 1JV5A 3UMTA 5JA8B 1ITCA 1R3JA 3DROA 4MQTB 5CMAA 3IDMB 4HS6B 4WUUA 2MPAL 4E41D 4PRIA 4GG6F 1Q1JH 3AMLA 5IQ9B 2R9HC 4FQCL 4OZFH 2X4TA 2F53D 4MJ4A 1BFVH 4OI7A 1G6VK 3MBXL 2F53E 3RIAF 1ES0B 1EGJL 4PJ5B 3RAJL 4DFHA 2VQUA 5EBLA 4YWGH 2VZVA 3DVGA 1BBDH 4XZUB 3GSWA 5I1LA 3H9SE 3LIZL 5TDOB 4Z18A 5I8EA 4YBHA 1GL4B 3MLXL 4NQDB 1QEWA 1CDBA 4Y88A 1L7TH 1ZT7B 5C70A 5DVLA 3GJFA 1QHPA 5J6GB 3NH7H 2VL4A 1B0GA 5HGDB 1PBYA 4GBXA 5D2LA 5DQJA 3CDFA 1CD9B 3IDNA 4HPYL 3CVHL 2F8XC 3QDME 1KEML 3C8KA 3V52H 3QUZA 4LSPL 1JZ3A 2GITB 5IKCA 1EPFA 4HUMB 1MH5B 3WFBL 1HXMB 3PDGA 3HHRB 3I3DA 1CI5A 4JANA 3TO2A 5A16A 2KH2B 5TH2A 4Y5YC 2PYEE 3DX6A 4NNYB 3MUGA 2VLME 1RJZA 4XPHL 2IG2L 3DVIA 2C3VB 3JUZA 4ELMB 4Y4HB 1B6DA 3T0DA 1NCCH 5C07E 1DE4A 5SWQB 1IJ9A 1SVCP 5GGSY 4PJDF 4JCMA 3T77A 4Y1AB 4O00A 2LFGA 2R1WB 1PZ5B 3AXLA 4X7SH 1CGTA 1KCRH 4RZCB 5EO9A 3L5JA 3RNQA 3QIWA 1IGFL 1T03H 2QHRL 4OLXL 3WNKA 1T6VN 2DN7A 3FOLA 4UBDC 5EIQA 1ADQA 3GMRA 1MVFA 3JWNC 1X4XA 1JGVL 1NGPH 5H8DA 4FP8H 3P73A 3FFCB 1H8NA 2BNUA 2FD6L 3EYSL 2Y1VA 3BO8A 4G9FD 1U8KA 3VXTB 1V3JA 3CJJA 4HMCA 2D7MA 1JHKL 3MGTB 5FB8A 5ALBL 3CPLA 4HW6A 4PGZA 4ELME 1IZJA 4P5TA 3WFCH 4CNIB 1XGUA 4XNZC 1BAFL 5F6HJ 3QIBC 4DGIL 3MRJA 5GIRB 4KMQA 1LILA 1F6AA 3GIZL 3VG0H 1FZJB 1VKXB 5IW3A 4O2FB 1U8PB 5HGGS 1LP9E 2X4RB 4HUUB 4U1GC 4P2QD 4YO0A 3D0VB 1OPGL 2OP4H 3RZCB 2VDLH 5AAMA 2IAMA 1IAIL 3GMLA 1PKQA 5D1QD 4LDLB 4XPBL 4ZAKC 4EEEA 5JMOC 3TT3H 2YD4A 5FHAH 5F7HA 4M1CD 2VDML 4E42A 1YEJL 5A3IC 2BVPB 3T0ED 1DQML 2GFBA 5AYQA 5HI4C 4K8RL 3UTQB 3ARBD 2NW3A 2H32H 3N1QC 1YJDL 4GLRI 1X9QA 1NLDH 3BP6A 1U93A 2HWZL 1MCCA 4LHQB 4RMUA 4MXWH 1WAAE 4H25A 5F8QC 4YDVB 4PRID 1F11A 3HB3D 3RVTD 1RUQH 3AVEA 5CILH 1MHCB 3CU7A 1JNHB 4PREA 1GC1C 1UB6A 3T65B 4IMKA 1A6TA 4L4VB 2BNQA 4PJ7E 1U3HD 1C5DB 4H26B 2VDNL 3P11L 1KJVB 3NZ8B 5I30L 1T66C 4ENEC 3VGAC 1FN4B 2XN9D 1OHQA 1FV1A 1FNAA 2GJZB 3VGGA 1IQDA 2EDKA 2HVJB 4Q2ZA 4FQJH 4KJWC 1TZIB 3L3JA 3DLQR 4Q6IC 3HC4H 4N68A 4TVPE 4IEFB 2OZ4A 2PYFB 1DUYA 5BS0D 3ZE1E 1GOFA 1IGJA 4PJ7B 1AD9A 3C6LD 4QYOB 5IG7B 4QF1A 5IW6A 1ZXQA 3QG7H 3QG6B 1IAIM 1NCNA 3H6JA 3HE6C 3PL6A 3MBEB 2CDFB 1IGML 1Q0XL 1QFUH 5EUOA 1HWHB 5J1AA 3V4PH 8FABA 1NJ9B 1IGTA 4KRNA 3ZKXB 1S5HB 4M7KH 1UACL 3P4MA 2E6QA 3TVMA 2FBJH 1MCEA 5FHAL 4PJBA 3SKJL 2QQNL 4NYLA 3VXRD 1LO3L 3DYPA 3WIIH 5ABDE 2AEQH 2YD7A 3LIZH 2F5BH 2GYSA 5I8OH 1E4KC 3FFCA 3P73B 3VGAB 3MV9A 1MLBB 3AB0C 3EYUH 4JJHA 1N6QL 1XMWA 5E2UL 1F2XK 2GUOB 4ZFGH 4DGYH 2HTKD 4R97B 5E2TH 3RDTA 5B39A 2EDQA 5I15H 2A6DB 1N6UA 4ODWA 2V7HB 3C08H 4RNRA 4XP4L 1NAKL 3MRPB 5DC0A 3DX8B 2IQ9H 5KAQF 5KSAD 3FL7A 5GIRA 4YX2H 3IRPX 3C09C 3BEWA 4F58L 1TZHB 1UEMA 3VGHA 1CICD 2KPNA 5KS9B 2PNDA 1A9BB 4YBQD 3TJHC 1CE1L 2J4WL 2H32B 4N8VA 4ODTL 1S9YA 4JDVA 3SGEH 4CBPA 1IC4H 2HJFA 2EZ0D 1CD0A 4RGND 1S5IH 4MWFA 5D7LB 1A4KA 1V3LA 4PRDA 1KPVB 1WSST 3T0WA 5HHVH 3M17B 4GQPH 4RAUB 4YNYA 1H8OA 2OJZL 4PRHA 4IOSD 2XPGA 2AK4A 4L3EA 3CMOH 3OG6B 4WO4D 1GGUA 2BSSA 2GJ6D 3R06A 2JCCA 5J4MA 1ZK9A 5B38A 3H7BB 1JPSH 3F7VB 2RFXB 3VXNA 5L0QB 2V5RA 1GZPA 2L7JA 4Y1AA 5EPMA 3EHBC 3UAJC 1OGTB 3O81A 3MUHL 1J0HA 3P9MA 3E8UH 4JDTH 3QNYB 4IRZH 3SKMA 3KYNA 1FNEB 1C7SA 3VW3L 2AXFB 4TNVK 3KPNA 2A1WL 5HI3D 1AY1H 1S7XB 1MY5A 4MDJB 5FO8A 4ETQA 3RL1B 4PJAF 4GBXB 5KVDL 1OWWA 1WF5A 2ZUUA 3JV6A 3HZKB 4MJ2A 2OXHA 5DA4A 3T0BA 4ALAH 1I4FA 4U1MA 4H5SA 5FA3B 4LCWD 2ITCB 3EOTH 5DHVB 2VDNH 5E2VL 2EYRA 5CMAB 3MLZH 4Z95H 3QIBB 4JVWA 4JFEB 4PUBL 2VLKD 2YD1A 3GRWL 1BZ7B 1G7QA 1QRNE 1LNUB 4U1LB 3SY0A 1HCFX 4RGOH 5B8CC 3NCBB 3A67L 4L1DA 4JCLA 1P5UA 3UP1A 3I6KA 2ENSA 4MQSB 1XFPA 1K4DA 3ARRA 2HKFL 2AK1H 4YC2C 4ODSL 5IB5A 4U6YA 3ULUH 1KPUA 1YN7B 4K8RH 4FG6D 1RZ7H 4KKBD 3P30H 2Y36H 4Y89A 4Z7VE 3H3KA 3V6OA 1JF1B 2XTJD 5I19L 4HKZA 4P46C 2E5EA 4WGVB 3UTSB 3QIUA 3CXDH 1P4LB 1XR8B 3JVGA 2A2QT 4JY6B 4ZUUB 5T1LA 4M7ZC 3LS5H 1J1XH 4BM7A 1XGRA 4BYHA 3DX9B 5AUMA 3OKDB 1RURH 4NCC1 1KYOK 1BJ8A 3I84A 3LV3B 1KXTB 2RB8A 3L3HA 1T2JA 1UXSB 3SDAB 4DGYL 3SE8H 1FFNB 3NFNB 5I0DA 4XVUD 5EULV 2IBBA 1U2CA 4GLRH 3D48R 1GGIL 3VFNA 3LPFA 3QSKB 3IAGC 3RWCA 1MIEH 1HCVA 1QQDA 3U36B 4H26A 1KC5L 3AM8A 4N9GB 1CU4H 1J1PH 4ZUVA 3ULVL 1JHTA 3BP6B 2EKSA 3HAEB 5ISZA 4AT6B 5F1KC 2VLRB 2FGWH 2DYPA 1BX2B 4YE4L 1MFBL 2N7BA 4WTXA 1HILA 2VXQL 4U6TA 5ENWA 4OQ1A 2WQ8A 2VIRA 4QY8A 3PWJB 3WHE1 1S9WB 4U6HA 5GGSB 4Q58C 2P5WB 2VN4A 4PJIB 3CSPA 1CT8A 3T4AB 1FO0A 4YUEH 3NPSC 1JPGB 5TF1L 4Y2DC 4QOKD 1XT5A 4O2EB 1T5XA 4NHUB 4MCZA 3C5JA 4I0KA 1UH4A 2AW2A 4F7CB 4OV5B 4N5EC 2HN7A 5F44A 4QTHB 2PCPB 2YEZB 1FFOA 3MROA 3GI9L 1VESA 5HYFA 4AK1A 1EAPA 4JFOB 1JGLH 3BZFB 3GMOB 1TCMA 3BI9X 1MHCA 2GJ6A 2Q1EA 4PLJD 3K46A 3L7FA 1XF1A 2EH7H 3DMMB 4I13B 4G43B 5ITFA 4K71C 5IVZA 3L1OH 1TNNA 2CDFA 2X1WL 4CL7A 1NJ9A 2CUHA 5GGVL 3VXRB 1U58A 4HIXH 3HZMB 4JREC 1L4IA 3DX8A 3MRHA 2W9EH 5D2NC 5HHNB 4U1JB 4YPJA 1FIGH 3FB7B 4EIZC 1W72L 1IEBA 4LEOA 1KLGB 4FFWC 3EJJX 4R7NA 3LN9A 4Z7VB 1UVQA 1UWEH 1YEDB 4O5LH 3DBXB 3MCG1 2NX5B 3EZJB 4PRDB 4Z6AT 3MNZA 1P84K 2YRZA 3GGWA 1NAMA 4B0MM 4HEME 5KW9L 3CFBB 1HH9B 4L29B 1G9NH 4OLUH 4PJGF 4BK4A 1I8KA 3MGAA 1GHFL 1W8OA 1MELA 3PWUB 1TIUA 3O3AB 3QQNA 4N8CH 5J89A 2W60A 2B5IC 1QYGL 5JW4R 5IB4B 2EDTA 2OTUA 1SJEA 4HKXB 4ODHL 1NL0H 1F4AA 3MJ7B 5HYSG 3P30L 1MIML 3KPMA 1N2RB 2OL3H 2JLLA 3O2DL 3VXNB 3L3HB 3GKWL 4NKDB 5HHPA 5IBLD 2X4QB 5ECJE 4F7PB 1UACH 3KPRB 3MC0A 4ZOAA 2P42B 4BFEA 1Q94A 2XIDA 5K9OA 3ULUF 3LSOA 4L8DB 1KENH 2GJZA 4EDXA 1QQDB 3M8OH 3GRWA 5D1ZB 3TBWB 4Y16C 3VGBA 1MIEL 3RWGA 1S7XA 1A4JB 2BSED 2DLFH 4PV8A 4ZD3L 2W9DL 4EI5B 1GAFH 2E7CA 4WUUB 1A64A 3IFLH 5FYJH 4K8RC 3WSQH 4RMQA 2FLRT 4FRWA 4XPFL 1L9MA 3B9KD 4LRNH 4S1SL 3WFZA 5I1GL 1IKFL 2LAAA 1A7QL 3BW9A 3O6FD 3BRFA 4BH8B 1LK3L 1CFVH 2AXFA 3TF7C 4M02A 1FGNL 2PTVA 4GBXD 3QFDB 1VADB 5AZ2H 5ICZB 3MREA 3SY0B 4POUB 5HHOE 3RBSA 1BMGA 1CS6A 3ME0A 1DVFB 2E27L 2DD8L 3UTSD 2B2XL 2DB8A 3P0VH 5FYLL 1RZ7L 1C5CL 2ZG1A 1EBAA 3MV7E 4FFYH 2RFXA 3OXSB 1DLFH 3I75B 4P2OA 4G42B 1YNTB 1PYWA 3C6SA 4PB9L 4YHIA 4MVBC 4PRNB 2XRAL 3BGMA 5C0CD 3FTGB 3ROLB 4NBXB 1H9VA 2GJ6B 1N26A 4YBLC 2DTSA 1G7QB 3KS0H 1YMHB 2ADIB 1WICA 2PW2A 4LCCA 5DR5L 3MLVL 3QI9C 4UZGA 2NPLX 3GMQA 4IRSA 1QSFE 1DEEA 3TWCL 5CBAB 4CJ0A 3HZMA 3SKUD 3MJ8A 4LOUC 4ZPVB 3SKNB 1KCRL 1FL5A 3OPZL 4UT6H 5ITBH 2UZXB 1CFNA 2VABB 5AUMB 1A7NL 4EDWL 4NSKB 3GBNH 5DD0L 1AIFA 1KIRB 4L9LC 2YK1L 1JRHL 1R6VA 2X4UA 5DURB 5AYUL 3CDGB 3ULVH 3KPLB 4Y16B 2QQQA 4JRYE 4TSBL 3BQUB 5FYKL 3DURB 3FB6B 4UV4H 1RZKH 1MFDL 4X9BA 3VD5A 2IFGA 4JRYD 5I6XC 2DQFB 1BQHB 3L95A 5CUSL 4P23A 2AJXH 3BVNA 3HTLX 5IW1B 3SPVA 3EO1A 3ARDA 5E8EB 3CLEH 1R0AL 1CR9H 1FH5L 1QTYT 3B9EA 4PGJA 1OVZA 1TQCC 4LRIA 1I7ZA 3RY6A 2JB6B 5SV4A 1S9XB 1VB9A 1S3KH 5J3HD 1CG9B 1YPZA 1X7QA 4QRSA 2R1XA 5GRJL 2A77H 3UTOA 5HI4D 4GMSH 5IFJB 1A7PL 1NBVH 2XT1B 1FAIL 5ISZB 4EUPA 1Q8MA 2VUYA 1GGYA 4HXAL 1U8LB 2OXGA 3OJDA 3ULUC 3VXME 2XRAH 3RWIB 4C56B 3HNTH 4QY8B 2JJSC 4Z7UA 4F8TA 2GHWB 5DR5H 1T83A 2ED7A 2MKWA 4HFUH 2EXWC 1HIML 4LGRB 3QUYD 5L2KE 5SWZB 2CQVA 2VDMH 1KIQB 1EIBA 3ZKNC 1BQLL 3VFVA 4CADB 5ICYB 3MLUL 1RZJC 1R3HA 2R69L 5K93A 4GQ9H 1UA6H 4LCWE 2FECI 2BOCB 2MFNA 4KTEH 4JB9H 3O6LL 3I6KB 4WTZA 4U7MA 5ICZA 4AL8H 1INQA 2ED8A 4QKXB 4P2QE 5I17B 5CZVL 4ODXA 1KFAH 2FHBA 5D9SB 3M1BB 2V2WA 3BOVA 4OCSL 4D9QD 5I8CA 2MHAA 3O2DA 4KK6D 4NQDD 3S4SG 4OZFB 3QIUB 4X6BA 5BJTA 5GGVY 2RR3A 4WJ5A 3TT1H 3C60C 3V6BR 5IB2A 4WGWB 3UXFA 2O5YH 2X89D 5LQBH 5F3HA 3H3PH 2IADA 2XZQL 4HWEL 1AFVL 2QKIA 1T80A 1OTTD 1UXSA 4UTBL 2YC1A 2ZUTA 2NXYD 4NZUL 1OAYL 4V1DB 5HJ3B 1T1WB 3WFHA 3MBEC 3EW3B 2XN9E 4HWZB 1KB5A 3WUWB 1N2RA 1QNZL 2NY4C 1UM5H 4LCIH 5HI3C 5KSUA 1MF2H 2DD8H 4DUVA 2CMRH 2OCFD 3RVXC 4P3WA 5HDBE 4OD2A 5C3LD 4G9DA 4TUKL 4F57H 2X4SA 1Q72L 4I0PA 3HG1A 4LRIC 4MSWA 2YWZA 4U0RB 5EU5B 4GRWF 5A2IH 3ARFA 1K3IA 3BKJL 5EA0H 3UBXG 5DFWH 1XF5A 5DYOB 4FQQB 2DQHH 4FZEH 4X9GA 1ZVSA 4JB9L 1MFCL 2Z8RA 3V6OE 4Z7VA 3QJHA 2GK2A 1REIA 2OJEA 4M93B 1AP2B 1ZLWH 4UT7H 2EDRA 3MGTA 5FB8B 2HWZH 5BV7H 4F15C 3KXFD 3ZYOA 1HHHB 2UV3A 1L9NA 4HBCH 3S8WA 4LARL 5C0CB 4PJIE 3SOBH 3TJHD 1S7WA 5C0FB 1CLOL 2IBGA 1BBJB 3QUXC 5DQJB 1BD2E 1E27A 4RNRB 4C59B 3EO9H 3WIFA 4HGWB 4APQA 2AV1B 4NZTL 5DJ6A 1Z0NA 2YPLA 3ZSTA 3G9VA 2I60H 3FMGL 5CCKH 4B7IA 4JO4L 2VZTA 2LABA 4NZRL 4RISH 1YEHL 3RUGA 3SO3B 2PUQT 1LWRA 4OKVB 3X13A 2QSQA 1G7JB 1JUFA 3SJVE 2R4SH 4LPYA 2BOCA 3D3VA 2C3VA 2OTWB 1C16A 4YAQA 4MNHB 1FHGA 3U4AA 3S5LG 4P59H 1BVLA 4TUJA 3K8LA 4IOFC 4K7PL 4PJEF 3VG9B 2XN9B 5FEBA 4MZ3A 1PG7X 2WBJA 1WWWX 1H0DA 4Z0BH 3T3ME 1IGJB 2PW2B 1LP9F 4XMLL 1NAKH 2CLRB 1IC5L 3F7RA 3Q6FB 1IGYB 3C6LC 3FKUS 1GC1H 5CIPH 5KJRH 2VXUH 3G6JA 3TN0A 4RMSA 4HWUA 1JZ7A 5EOQL 1NEUA 4UOW0 3T2NH 4NQVA 4KHXL 4MD4A 4F33B 2D4DA 5BVJB 1W8NA 4JDZA 4LDEB 3LEXA 1S5IL 3JBG7 4HKJA 1D5ZB 5ADPL 4GUPA 2B7DT 3BQUA 1PYWB 4JREB 5FDWA 5HHVL 4GW5A 1NLBL 3H42H 4XBEH 2XQBH 2WV3A 1K9TA 2ADIA 3MGOB 2F58H 3QUYB 4M6ML 5F7LB 3RDTB 3BVNB 3BP5A 1KTKE 4LLQB 3W2DH 4FFYL 1MF2L 4ZPVA 3SKNA 2JJTA 3CDYA 2HVKB 3MRQA 4NO0B 4QNPF 2CDEB 4NJAL 3SGEI 3T0EB 1FVDB 4W6XB 3JV4B 5MEOB 4PRHD 1MEXH 4KAQH 1X5LA 3R0NA 2A9NH 4WHYH 3LN5A 1OP5K 1DEDA 4MNQD 1A9BA 1P4BH 4LLMB 4B53A 1WVZA 4YXKH 2EXYC 4F57L 1VADA 1U8QA 1JI2A 1LGVA 4R2GC 1JWSB 1BD2A 1U8LA 1MPAH 3PHSA 2Y07L 4V2BA 4WFGD 3QZWB 2VSDA 4LF3B 1QNZH 4HZLB 1QLRB 3PNWB 1YN6A 4OKDA 1BVKB 1YDPA 2OL3A 4HUNB 4PRHE 4Q6IB 4UT9H 4ZS7L 1BZQK 1XGYH 3IDGA 1I9RL 3GSOB 4PRNA 2JB6A 2OBGA 4NC2B 3ISWA 2P43B 4YEEA 1JNJA 3D85D 1N4XH 1ACYH 4XB8A 1T03L 3ZL4L 3HI5L 1IE5A 2FWOA 2V2XB 3RX8A 4IS6B 3D18A 3BIBX 5EU6D 1WT5C 2CDGB 3CVHA 1C12A 4HUXA 5D6DA 1UM4H 1IFHL 1D9KA 4LLUB 2HFGH 4IBLT 1FNEA 4KDTC 2O5ZL 5FYLD 5IP4A 3VFMB 1W0WA 4HH8A 3QUKB 5DMGD 3VRIA 2V2WB 4P99A 1EXUB 5EIVA 2BNQE 4PJ7A 3W0WE 4RISL 1J05B 4MLIA 4TUJB 3MRIB 1NMCB 3BKML 2PF6A 3RGVC 3ARXA 2NZ9D 1EEZB 2YS4A 3BGFC 4Q0XL 5FA3A 3JWDL 4WO4B 1EMTL 4YHNB 3NABL 5I2IA 4YQXL 1PY9A 2YOCA 2BNRB 3B2VH 2R4RH 1WBXB 3MLTA 3SDCA 4KK9C 3V7MA 5IJVA 3IU3A 1INEL 4OCXL 5TQ2H 4DKEL 43C9B 2ZOLA 4Q7DA 3RI5F 3WN5B 1KCVL 3HZKA 3QWOA 3NIFE 2QV2A 4PJIF 1G7PB 4JR9H 3ILPB 4X83A 8CGTA 1UZ8A 5FYKD 4J3XA 4U7SA 1QBLL 3FB5A 4MDIB 2OQJB 1I9JH 1K5NA 4I0PB 5JOEA 4ZOBA 1R5WB 1OARH 3IDIB 2R29H 2DIJA 2J6EH 2YD8A 2Z35B 1WBYA 1S7WB 3FZUC 5GRYA 3BGAA 3TZVD 4J3SA 1HHKB 1NDMB 3REWB 1FORL 2CO6B 1TDQA 1J8HA 1RURL 2AXGB 3E0GA 3HUJB 1MI5A 3CVIH 5ESQA 3VFPB 2QADB 4RGNC 3DV4B 1MVUA 3DGGA 4Z7OF 2BHYA 1IL1A 4NQCB 1KB9K 1NUGA 2FGZA 3SDAD 2I24N 1JWMB 1QKZL 4H0HB 4QRPD 1P7QA 1GYAA 3DUUB 3G04A 4CDHA 4Y5YA 4GJTB 4ISVB 5IB1B 4NQDA 2GCYB 2DM2A 3F12A 5FOBA 5ESVB 2AK1L 3B9DA 5GGUB 4PR5A 3BDYH 3DX9A 1UWGH 4N1EA 2H8PB 4ZSOB 5B8CA 3HE7A 4IDJL 2OJEB 5TDNB 1QO3B 3AS3A 2MKLC 1TPXC 2BVOA 3VI4E 4IS6A 3DNKA 2A9NL 3L3DA 1I1YB 4PJGB 2W1NA 5CJ5A 5AD0B 2FL5B 4O2EA 1MCHA 1YY9D 2VLRA 4BZYA 5DUBB 5EORH 1TNMA 3K4DA 4HWBL 5IB3A 2IG2H 1CQKA 1YEIH 4O58H 4NRXA 3HN3A 3QIBD 1S9WA 2HAZA 1OM3L 4PJAA 1GOHA 4XMPH 4KJWD 3ILQD 5SWQA 1MCOL 4PB0H 1AO7E 2D2OA 2XKNA 2Z91B 4JKWA 2PO6A 4L8BB 3HG1B 5FCSH 1TCRA 3IGAB 1F2QA 1TXKA 3QNZA 3WIHA 1OW0A 2QHRH 4LLQA 4NQDE 5HGAB 1A1NB 1VCAA 4KHXH 1NLBH 2UYLB 3RY6C 2A73A 5SWSB 5ICXA 3LEYH 2X42A 4P5KB 4NJ9H 2DLIA 3DSFL 4UIMB 5ADPH 1NUFA 1RMFH 3RKDD 5IEKA 1ZLUK 3VWKC 1YEFL 4ZYKA 1MCSA 2R56L 2HT2C 3HS0A 1EJOH 4QOKB 4LKXB 3TN0C 1F13A 4ERSL 2PXYA 4XVJH 3QEUB 1OP5H 1TETL 4CUCA 1FLTX 4GRLC 3JTTB 1JFQL 4LSUL 4KAQL 4NNXA 4OUOA 3BP5B 1N0XH 2FH8A 1J8HE 4YHIB 1CL7L 2ZJSH 4I48A 4R2GB 3O8XB 5CLTA 1MI5E 5DVKA 2OMBA 2VDOH 4Y5XB 5IVXF 4OIAA 2XA8L 2Y9RT 4QHNA 4IJ3C 5D1XC 1ZV5A 3GIZH 3ZMRA 5CEYA 1P7HL 3G5VB 1LO0L 2Q7YB 4QRUB 4FXKB 1M7DA 4UILL 5CSZB 3NZHH 5KSBE 1FC2D 5IV2B 4UI2A 4K3JH 4WV1A 1FVCB 2CLVB 1OTSC 2WUCL 4U4BA 1UXWA 2BXZA 3UZVB 1JHTB 3D3VB 3VH8G 4X6DE 3J8F7 4Y4KC 1QVOB 3K2MC 3QWQB 1QLFB 5IM7A 1LEKA 4ZS7H 3L5WA 4KI5F 2IFFL 2UWEA 3HZVB 4ZUSB 5HHOD 3VH8B 3QT2A 4PP2B 3QPXH 3GSXA 2EIBA 5B38G 2GCYA 5K59F 1F6AB 3HNSL 3GSRB 2LAGB 4HDIB 5T3ZH 3OKLB 2HMID 1MCQA 1YQVH 3BGFB 3VFTB 4BUGA 4QRQB 1M7IB 2XZQH 4QHMA 3QQ3A 1NEZA 4U7KA 1PSKH 5C08E 4KRMB 1HYRC 1EBPA 3GIVA 1A5FH 2W65A 3D9AH 3EHBD 2FSEA 4MD5A 5DF0A 2VXSL 3Q1SH 5EN2B 2I25N 1GPOL 4S10A 2EE3A 3MSPA 1GVIA 3F5WB 5IHUH 2NLJA 3KJ6L 3WN5C 4G6JL 3OAUL 4U2YA 5DD5L 1BGXH 1YUHB 4M3KB 3K80A 1IARB 1TZIA 3PWLB 5EORL 5FYKE 1IQWL 2CPCA 4RZCA 5IHZA 4BFBD 7CGTA 4FZ8L 5E2TL 4QGYA 4I0PC 3KWWB 2FWOB 4FQXC 6CGTA 4M8VA 4X5WA 4LHUA 4X4YA 3EUUA 4OZGE 1BFOA 3BPCB 1SJVA 3QNZB 3FO1A 4M7LL 3VCLB 2P24B 2D7NA 3WXWL 4GMTL 5IGXL 1S7QB 2QQNH 2QQKH 1Q0YH 1K2DA 2G5BA 1UQSB 5F7DB 3OXRB 1FV1B 5FYKU 2NX5D 2NY1B 1RK0A 3GSNA 2YD6A 5ACLA 1BD2B 3FQTB 1ACZA 3TT1L 4YHZH 3HPLB 1CU4L 1J1PL 4FXGA 3LKNB 1JF5A 5FK9B 3SDXB 4B41A 3MACL 3H3PL 4XI5D 4YFLF 4GAGH 1HINH 2IAMC 4OZ4A 2BVYA 5CP7B 4ZFOB 1A1OB 4LLDB 4XAKE 2CUMA 5J57B 4DVRH 4O51A 3C8HA 1S78D 4OZIB 1TVDA 5DO2C 1VHPA 2AJVL 1DBBH 2VN7A 4IIQC 1ORSB 4X5XA 2R69H 4FFVC 3T2PA 1S9XA 5DVMA 1Z9MA 3ETBF 1PLGL 5E9DB 4LAQL 3JXAA 4X9FA 4OLYH 4DGVH 3QEHB 4P4KB 2C9AA 1JN6B 3CMOL 3MRKB 1LDPH 1RMFL 4OZHE 3UTTB 1UXWB 1FYTE 1YEKL 4HUWA 1RI8A 1AGCA 3THML 1HHKA 5BV7L 3MJ9H 1ZA3B 5MEND 4XMLH 3UTZB 2LE9A 3MUZ1 3FO2B 5LBSL 4KGJA 4OZHA 1C5BL 4NQCA 3AGVA 3MRFA 2Q8AH 4EN3A 3CX5J 4JY4B 5HTSA 3L6FB 5TFSH 3OAYK 3B83A 4JRYB 4BH7A 5CJOH 3W5MA 3EZ8A 1GGIH 3VFTA 4O58L 3QG6A 1HXYB 4GW1A 1XGQB 1EH9A 4FNLL 1NH6A 3TBVA 2XWJA 3RFZC 3CSYB 3L3JB 4GKZB 4JM4L 1Q9OB 3T2OA 1EO8H 2XPGB 1CDGA 3ARDC 4XTRC 3ARBB 5HHMD 3ZLQC 3D39E 3W9DB 3C8DA 5H37G 1F5WA 3CC5A 5ALBH 2E9WA 3B4NA 4JFFB 4UTBH 4HPOL 3LMJL 1U36A 4OD3H 5EC2A 3BHBB 4J8RA 4OFKA 4ZG1A 1KUMA 2J88L 1DUZB 3ARQA 4XNQA 2KZWA 3QFJB 2V5SA 1MHEB 1A6VL 4JM2F 1FL5B 4PG9A 3LY6A 4LIQH 3BEWB 4OF7A 5FCUL 5INDB 3MV9D 3NFSL 3V0WL 1P7QD 1NGXA 3VE0B 1N64H 1FNSL 3GHEH 5T33L 4JFEE 1BQSA 1HHJA 5F1IA 4HX1A 4P46A 3OR6B 3N9GL 3D3VE 3TVMD 1RUAL 2IQAA 1MHHB 4G3YH 3ARBC 4LLVB 1HHGA 4TUKH 5B3JE 4XVSL 3BISA 1KPVA 3LZFL 4NO5B 5F1NA 4E9LA 2V9RA 3O41A 3M17A 2UWEF 2IH1A 5H94B 5HGBB 3VWJC 4TTDC 2ADFH 4O9HL 1KB5H 4NCDA 1RFDH 3CFCH 3CZJA 1IZKA 1FDLH 3QQ4B 3B6SB 5CEZD 3QUYC 4POZC 4QT5A 2EE6A 3R8BB 2VDRH 3TPUA 3ZHDA 3H9HA 3U0TA 3MLRL 4JLRA 3K0WA 2C1PB 3P11H 5C07B 5KTEL 3TH3T 1ND0B 1F4YH 4GW5B 1JGDB 5IB3B 4PBVC 3JWOC 4F9LA 2EKSB 1F4WH 4ZTOL 5ID1B 5JW3H 5EFIA 1G7HA 3JWDH 2BVQA 3ESVF 2VIRB 1WZKA 3BX7C 4NKMB 1ETZA 2PTUA 5EO0A 3VFVB 3MXWH 5IHZB 1HZHL 4LLWB 5F70A 4JY4A 4WIQA 3KYOB 3QH3B 1BFSA 1BGXL 1OAZH 3I9GL 3RNKA 1UZ6E 2GSGB 1F8TL 3MUJA 5LXGL 1YC7A 4U1GB 5KN5A 4JFYA 5CEXB 4M5ZL 3U82B 5JNYA 1YEEH 4Z0BL 3QIUD 3RL1A 1I8MB 4R4ND 5E1HB 4DQOL 4ODXB 1RUQL 4YHZL 1LD9B 1MCLA 2NY5C 2DYPB 3WJJA 1OCWH 5J3HC 3UO1L 3PHQB 4PRPA 1KN4L 3WXVH 3FFCE 2XKUA 4K07A 1H0DB 1E0OB 5E6ZA 1CDHA 4FQ1L 1KLUA 4XT1C 3UTSA 3SJVD 2XI9A 2GT9A 5DRZA 2F15A 4JVPA 4Q9RL 1BIHA 4PJBE 1JCKA 4XCNB 5FUOH 2KKQA 4Q0XH 2WINA 4MXWL 3NCFB 1CK0L 1DBJH 1EUTA 4OI8A 5EBWA 1GIGL 4KJYB 5M95B 2A77L 3CUPB 3MLVH 1NGXB 1ORSA 3A6OA 1IC4L 4FXGB 1DANT 1KLGA 2H1PL 5FCUH 3OG4B 4HKJB 2R0WH 4HJJL 3QDGA 2VZUA 5FDYA 2R0ZL 4HKZB 5KVEL 2Y5TA 5D6CB 2J8UE 1D5BB 1GSMA 1T0NB 4H8WL 1RIUL 1F4HA 1MCDA 32C2A 1CBVL 2P48B 5IIEB 3G6JB 5C0RH 5DFVD 3VXRA 1T4KA 2X10A 3EOYG 3RVVD 3IDYC 3O9WA 1FNHA 3RU8H 4W4OC 3ZDYF 4OZHF 4RAVB 1Y0LB 3TM6A 3RWEA 3WLBB 4S1SH 3LEXB 5LXGH 1U9KA 2WSKA 3FO2A 4ZFGL 2VNCA 5E1AB 1J1OH 3KPSA 3IETA 3KPOB 4Z7NF 3P9LB 3G6DH 3N0PB 1UVQB 5HHPB 4EUPG 1I3RA 1DN0A 2ZUWA 3KPQB 4JLRB 3V0WH 3PIQA 1P2CB 3QHZL 5C0FA 2VSCA 1JWSA 3BKCL 1JMZA 4F9LC 1CZ8H 4JFHE 3CPLB 5EZIL 4MCZB 2X2YA 4D0BB 4L4TD 4G8GD 4UAOC 4AG4H 3FOMA 3EO0B 3MA7B 4U31A 2BFVL 1ZT1A 4TULL 4OLEA 5FYJD 1QLRA 3PNWA 4N8VG 3QDMB 2Q8AL 4HK0A 2L0DA 4KUCF 3SDAC 3LMJH 4PJFF 1QFPA 4B7LA 5BQ7A 5LWYH 2DJUA 3DXAD 3RTQB 1NMBH 4Y4KB 5C0ND 3V5HB 5E99L 1YZZA 2FIRT 4H88H 4A2LA 4KTDH 3PV7A 5EBMB 3MYZA 3N1MC 2DM4A 1DUZA 1GRWA 2CSPA 4WFGE 2A83B 5C0IA 5DJ8B 3CSYA 2RBLA 4N8CL 1NBZB 1G7MA 3D25A 5D2LB 5INDA 4XGZA 1DVFA 4G6KH 5A2LH 4U1IB 2XKSA 1T2QL 3LEVL 3R0MA 2YK1H 3S35L 4KI5D 4Q9BA 2VE6B 3VRJA 3FHQA 1AQKL 3MRMA 5A2KH 3UCRA 4KKAC 1BZ9B 3VXPB 5KOVC 4K94H 2AEPL 2VR5A 1XGQA 3BDYL 3F7YA 4X6DF 2QSCH 2NZ9C 1JGEA 3NFSH 3MJGX 3HFMH 3O2VL 4NQED 3DGCR 2AS5M 4GH7B 2CRIA 3CNKA 3ZE2F 3CH1B 2CIKA 4MNGB 1YMMA 4LPWA 4XCEB 1KG0B 2O5YL 4JGJA 1FG2A 2XFXB 5JIIA 3STLA 3KPRA 4PJHF 4CW1A 4G42A 4DZBB 3OKKA 5HVWA 4JFFE 1C08A 3QXTA 1ED3B 3GUTA 4I18C 5DJAA 1KB5L 1G0XA 4HUVA 2VLLA 2XA3A 3DXAA 3VXOB 2CKBH 2C4FU 2NY1C 3SDDC 3UTZA 3VI3E 5IB4A 5HHNA 4JFFD 1J87A 1Z9OA 4OSUL 2OR9H 4JO3L 2WANA 3CLEL 5D93C 1KNOA 2E6JA 2X09A 4CU7A 4UQ2A 3BT2H 3GJEB 4JFXB 4RWYH 4OLWL 1RPQA 4J3VA 3QQ9C 1SYSB 1DBKL 4N5UA 4XNYL 1F58L 3WDIA 3HAEH 1AGFA 2AI0L 1BEYL 4ENED 4WFHD 4GKZA 3ZKQD 4TSCH 3C5ZB 1K6QH 1MRCL 2R56H 4Y5YB 3FZUD 3TZVC 5C0AD 1J88A 1MJ8H 4ZFFB 3VWKD 4FHBD 5FXCH 4LPXA 4NUJB 4PJCA 2FR4B 3FQRA 4QRRA 1DFBL 4NRYA 2H41A 4JAMA 4JZNB 2CIIB 2WWMD 1NGYA 5JDJA 2F53B 5TDNA 2NY0D 4HLJA 3QUZC 3MV01 4PP1D 2GFBB 3K8MA 4JPVL 3P0YH 5IFAL 4DKDC 4HBCL 3W9EB 5IROC 3TBWA 1MFAH 3X3FL 4YHML 4D2NA 4KU1A 4HZAA 1KEGH 1V3KA 1T6WA 2APBA 2EDWA 3ZT6A 2RAMA 1INQB 3OJDB 1IC7L 1OGAD 4X7TA 2GJJA 2LTQB 3L5WB 2D0HA 1EHLL 1BECA 3L3IA 3MR9B 5GHWH 3GO1L 3EYSH 2BNRD 4N0CD 4EKXA 5C09E 2PYFA 2YBRB 2JJSA 1A5FL 3D9AL 5B22A 3V5KB 4DOHB 1CLCA 3A67H 3QRGH 1OD9A 3TC9A 2DBLL 5I66A 4PJFE 3SQOL 3PUCA 1IBGL 3QIWC 4AENA 5MP6L 1RD6A 3UJIL 1FZKA 4ZUTB 1Y0LA 1IQWH 3BFOA 3FB5B 1JGLL 4MDIA 2VLKE 4RSVA 3W0WD 2FJGA 1DQLH 1YY8A 5ERWA 1I75A 3SO5A 3V6FB 4XCFL 5I8CB 3MCKA 1DBMH 2C3XA 3TEUA 2IWGA 1GCFA 1WBYB 3FT2A 1J1XL 3BN9D 2GT9B 4Y1AD 2RCSH 4G8GE 3RZCD 3LN4A 2FEEL 4Q9CA 4HH9A 3OJ2C 4QRPB 5MHSE 4GG8B 3MACH 4OAWA 5DLMH 2Z31C 2PR4H 1CG9A 4IRJC 2VLJE 3WJLC 2NTFB 3REVA 2J5LC 2XXCB 3QISA 4NM8H 2VERN 2PXYB 3RNKB 1A7QH 2YN5A 4Y19A 3IF1B 1X5AA 5DJ2B 4M61A 2O5XL 2YPLE 2HTKC 1Q0YL 32C2B 1W72B 1RIVL 3R1GL 5F7EH 5DRWB 1RHHB 4N0UB 2I9TB 1T3FB 2J1KA 1I1AC 2P5EA 3WL9A 4F7EB 4CJ1A 1TZHA 1YEFH 5DURD 4Y4KD 2LVCA 1KTDB 2K3TA 1OAYH 5I1CH 4MSWB 1A3RH 1DLHB 5FGSA 3DO7B 2R2HA 3MYJB 4PLNC 4NQEB 2EC8A 3S97C 2LVEA 3MRMB 4K3GA 5GS1C 1KBGH 2QSCL 2Z93A