5TE6H

Crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade ae strain 93th057 gp120 core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
223
Chain Sequence
RAHLVQSGTAMKKPGASVRVSCQTSGYTFTAHILFWFRQAPGRGLEWVGWIKPQYGAVNFGGGFRDRVTLTRDVYREIAYMDIRGLKPDDTAVYYCARDRSYGDSSWALDAWGQGTTVVVSAASTKGPSVFPLAPSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Identification of a CD4-Binding-Site Antibody to HIV that Evolved Near-Pan Neutralization Breadth.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 33
structure length 223
sequence length 224
ec nomenclature
pdb deposition date 2016-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H01
3QH3A 4GXVH 4DKEH 3QUYB 3P0YH 5BVPH 3T0EC 4ONGL 5E6IC 1AIFA 5D96C 2X4SA 5L0QC 4D9QE 2FR4B 1G9EA 5GS1A 5JDSA 5C6PB 4JFYB 1DBJH 1NGQH 5FHAL 3BQUA 1JN6A 5F7YC 4S1RH 3D39E 1ZLVH 2APTA 4Z7NE 5BS0E 5FHBL 4XAWH 2DQHH 5EG6C 3D0LB 4JZJB 4MAYB 5EO9A 2FJGA 5D5MF 4HIXH 3MOAL 3QEQD 5ID1B 3MZTA 3V52H 2AABL 3P4MA 4DCQB 4P9MH 3GJFK 3WO4C 3VXUE 4Y8DC 4PB0H 1H3XA 4LKCB 1VDGA 1HKLL 1TZHA 3TZVA 2P5EA 3DROA 3U82B 1T04B 2E7BA 4P5KA 5D1QB 3SEPA 3K46A 5FUOH 5HGHA 3JV4A 1UYWL 3C08L 3O3BA 1HHIA 5DK2A 4Y5YB 4HH9A 3G5YA 3ES6B 4X6DF 4JZOB 2CIIB 4NM4L 1RZFL 1MLBA 4CGTA 2B0SL 4ODBD 4NBXB 3V6OA 1FN4A 4M1DH 2CLVB 5EULV 5E24E 1TQCC 3TT3L 5GGUA 3TBVB 2AEPL 2IAMD 3I9GH 3WFCH 1ZXQA 4PJGA 4UB0H 3RWHB 1F8TL 4O2EA 4G42A 2J2ZA 3GMMB 2V17L 4JFZH 3Q3GB 4LP5A 2HLAA 3G04B 2YSSA 3ZTNL 2NX5D 5BW7C 2AI0H 2R4SL 4OD1L 4HWZB 4AM0B 5DJDB 3X3FL 2E7HA 5FB8B 3CFDA 4MLIA 4PJ7E 5IESL 4QHLB 1MCEA 3RWDB 1BZQK 4NYLB 3O11B 3QCTL 4KI5C 1NFDB 2NY2D 2FSEB 1WISA 2A9MH 4PRDA 4YHKH 1RUML 1T66C 1RIHL 4D0CA 3RKDD 1MFCL 5DA0B 4O2FA 3HR5A 5ITFA 1U8KA 4RFEB 3IDNB 2DYPB 2NXYD 4N8CL 4OZHE 4TULH 1N7MH 4LCYA 2DQGL 1GOGA 1EMTH 4K23L 4JANB 2C3VA 5B38A 4UDUA 3HAEG 3WXWL 3JVGC 4Z78A 1A21A 2ZCHH 5BO1H 1KT2A 4B41A 5INCA 4U6VL 1CK0L 2VLLA 1V05A 5IUSA 4HGMA 4XNXL 3WFDH 3GSQB 4JQVC 1IM3A 4LVOB 3CAFA 3LB6C 3DUSB 1N5YL 3JWDH 4RFOL 3MRQB 3KHOA 2GTZB 4MQTB 4YHZH 1F45A 2R2BB 3ARGB 3QULA 1CXHA 1R0AL 1BLNA 2OBGA 2X1PA 3RU8H 3B6SB 4MNQA 3JZ7A 3QJFB 2VDQL 3HAEB 1FFPB 1YEGH 3RA7H 3IDJB 5ILTH 1QFOA 3W9DB 4R0LC 1KPVB 3S96A 2A74A 3GHEH 3NPZB 1DVFB 1DANU 1UZ8B 2DMCA 3WE6A 4BQ8A 1CGSH 3GSRB 3IJSA 4D0DA 1UA6H 3FB5B 2A6DB 3HMWH 3QA3B 1X5IA 4UU9A 4FQQA 3HG1D 2X42A 5ACZA 1HQRA 4LIQL 3GI8H 2DIAA 2GTWA 3ZLQC 4F33B 5IBLD 2VLJA 4YK4B 2PTTA 1QFWI 5EZLB 4LCCB 4P5TB 1PX3A 3KYOA 3ARYA 1XGPA 1RUQL 4ZTPL 3O41B 43C9B 1CWVA 3U36B 1DANT 2AK4D 4FQLH 3REWB 4QRUA 3O6FA 4ALAH 3WLWD 2NY7H 3UYPA 3LN4A 1A64A 4XNYL 3U9PL 1INDL 5E6ZA 1HOCB 2FIKB 2VAJA 4PBWD 4PLJC 2HLFD 4QRQB 5AG8A 2LAAA 1YJDC 4AEIH 1ACYL 2VDNL 2I25N 3BE1H 4W68A 1G9ML 3SGKA 4PJBB 5F72S 4X4XA 3H3PL 1MCSA 2A6JA 1SQ2N 3MGAA 3GSNH 1N3NB 1KJ2H 2AABH 2BFVH 1NMCC 1U8QB 4MHHG 1QRKA 4NQEE 3C9NB 4JDZA 4F3FA 1ZT7A 4KV5F 3BUYB 4R2GC 3NFNB 5IF0A 1CCZA 1FH5L 1NEZG 3QO0A 4B53A 4HUUA 4WI5A 4WU5B 3IRPX 2A1WH 5GJTL 3FN3A 3CLEH 4F58L 2D31A 1BVKA 5KS9E 3EOAA 1GC1C 4MJIE 1A8JH 1XCQA 4BSVB 5HY9A 2D7OA 3OTTA 1CICA 1YMHB 2X7LA 3S36L 4U1JA 1MHEB 1S7QB 2IEPA 2EDJA 4NZDA 3V2AR 1CTNA 3RIAK 2BVYA 1OARL 4ZUVB 4L9LA 4P46B 3ZDZE 3NN8B 3JV5A 1FZJA 1OAZL 1RZKC 2GY5A 5E2TH 2E9WA 5FDYA 4KJWD 1OVZA 4FNLH 3ARTA 4OFPA 1LD9A 1PG7W 5ID0B 2HVJA 3BWAA 3QDGA 4XP9L 1FNHA 1KCKA 4P23A 4R26L 1CGXA 1J8HE 2JF1A 5C8JB 3UTTB 2BVQA 1NEZB 2R4SH 2OZ4A 1R3LA 3QAZB 4D9RD 3GMRA 3GBMH 4GBXC 4OF3A 3TH4T 3OGCB 3K80A 2H26A 4OF6A 4AH2B 2IAMB 1RZIA 3KYMA 4LF3B 4RMQA 3OPZL 5CEYB 1AO7E 1PSKL 2FJFA 5EUOE 4Y4HD 1N6QH 3ILPA 4IRJC 2HFFB 1SYSA 3U0PB 3NABL 4GS7B 1RU9H 4ZPTB 4ACPA 1MI5D 2NX5B 3EFDL 4W4OA 2B4CH 3MRBA 1QBAA 3IDGB 4CU7A 1UM5H 4D9LH 1LO3L 5HD8D 5JIHA 4KRNA 3O4OC 4X0KB 4XPTL 2DWDA 3QP3A 1M71A 2PTVA 4I2XA 1KJ2A 2GW5A 2ZJSL 5IFJB 1JNLL 4WO4C 2NY2B 4U1SB 3OJMB 4V1DE 1NDGA 3WIIH 4GMSL 2IH3A 2FBOJ 5GJSH 3CDGA 1SBSH 4X7SH 5C3LD 3AAZA 3WUZA 1P5VA 1GGUA 4NQCB 2GKIA 3H9HA 4JY5L 3MBEC 3PGCA 3G6JA 5DEGA 1N5YH 2FX9L 1HHHB 3KPSE 1FCCA 2V7NB 1S7SA 4WI3A 5B22A 2R23A 4OQTH 4TRPL 3WYRA 4TVPL 4OKVB 1YNKL 2AEQL 5FYLH 1D5BB 1JGLH 2IGFH 1MRCL 3DLQR 4XPFH 3GSOB 5DVMA 4WTWA 1RFDL 1AD9A 2UVEA 4FZ8H 2IANE 1G7MA 1DDHA 2X4TA 1UKTA 1HCVA 4F8QA 1A1MB 3AXLB 4A2LA 1T83C 3IKKA 3DRTB 5CHNB 3NIFF 3KWWA 5HDBF 1KN4L 3JWOH 1J5OH 1NBZA 1P7KA 2ZNXA 3RWIB 1J1XH 2Y36L 4NUGH 4UBDC 3S4SG 5FO9A 4X5XA 1FE8L 4ZFZB 5BXFA 4PY7B 3HRZA 4YHNA 4DGVL 4HZLA 3CFBA 5C0AD 4XHQA 4G6AC 4GMTL 3RWJA 5DRXB 4JM4L 5EBWA 2YUWA 4R3SB 1CFVL 2DQCL 1L0QA 1TQBB 4K94L 2AJ3A 3EJYD 1WFTA 4UINH 4GKSB 4NBZB 1NUGA 5F9WB 5HYJA 2IMMA 1I3VA 1YN7B 3ZDXE 1Z0NA 3KPRE 4YE4H 4BFGA 5AEAA 1HSAA 1FNFA 1JNNH 5F1OB 3BJLA 3WJJA 4R4FH 3MRLA 4WFFE 5JHDB 3QUYA 2YK1L 4HLJA 3EKCA 3ARQA 4S11A 3UTSE 3K81A 3S4SB 3CMOH 4M7JL 3TPKA 2FR4A 4JFYA 4NC1E 5CMAB 1QSEE 1H3WM 3DMMC 4HK3N 5TPWH 3UC0L 4LVEA 2Z8RA 3D0LA 2AK4B 4JZJA 1ODAA 4MAYA 4RBPH 4WWID 4XNMB 1MAML 3GO1L 2ZUQB 3U46B 5ID1A 4OQTA 4ZAKB 4DCQA 3AY4A 4IHOB 2LABA 1MCDA 4LKCA 3V4UH 3BD5A 2ZKHL 4N8VG 4K2UL 4HQQH 4KKCC 1YA5A 1T1WB 2BDNH 5J13B 1T04A 5D1QA 1BZ7B 3EOTH 1MPAH 5CP3A 4Y5YA 3ES6A 2VKXA 4JZOA 4QO1A 4OLXH 1WT5A 2CIIA 5FGSA 2CH8A 5JDJA 2XOTA 3MUHL 3UEZA 4EN3D 3QHTC 2CLVA 4FMFA 3WUWG 4KZDL 1MFEL 1XGYL 4LPXA 3TBVA 5BRZE 1KCRH 1U8PB 3GM8A 4XAKD 3RWHA 1WICA 1T7ZA 1MFDH 5D7KE 3D48R 3GMMA 1WK0A 4JZNB 2RGSA 3Q3GA 4N8VB 3IJYB 1WBYB 3G04A 3IT8D 4AL8L 2F5BH 2HMID 4HWZA 3OJVC 4AM0A 5DJDA 3B2VH 4JM2D 4BZ2L 5J11B 1QR1B 5FYKH 5FB8A 2BERA 3VXTB 2CSPA 2IH1B 4LPYA 5AWNL 1GCFA 3RWDA 1JYWA 4NYLA 4G6KL 2BMKB 3O11A 3WUWB 3UAJC 1NFDA 2FSEA 3KGRA 3QB7C 3UZEA 2W9DH 3T1WA 4GG6F 4KTDH 4RFEA 3IDNA 3MMEB 2DYPA 4LCWD 2F8XC 1HEZB 2DTML 4OLVH 3LQAL 4OJFH 35C8L 4HUXA 2QSTA 2FECL 4JANA 1S5HB 3IKCB 5SWQB 4Y4HB 1JFQL 5FECB 2FX7H 4O2CB 3ROOB 1JWSB 5BV7B 4PJGE 1TXKA 4PJ8C 4K3EL 4KK6C 4LHQB 3GSQA 4UI2A 5CGYC 3C6LD 2W92A 1CE6B 4P2OB 3DUSA 2R39A 1BJMA 2CRYA 4EDWL 4IJ3B 5CJXA 3MRQA 2GTZA 5F7DB 3NMEA 5I76B 1UKSA 2R2BA 4NWTH 4I9WE 3ARGA 3EZJB 1YNKH 2VXQH 4RX4D 2DRUA 3ZHKA 2UV3A 3B6SA 4WWKD 3QJFA 5ABDE 4BUHA 3EYOB 1DBBL 5D2LB 1RFDH 5HVWA 3HAEA 1PAMA 4P4RB 3QJHB 1FFPA 1AGDB 3IDJA 3FO0L 3F12B 5I19L 3W9DA 5EU3B 4WW2B 4LRNH 1KPVA 1CT8A 2D7TH 2XRAH 3GEWB 1DVFA 1UZ8A 3K2MC 5EUKB 1KN4H 3GSRA 4S1QL 1WITA 2DQIL 3WKML 4OZGF 4BA8A 4C56D 2EDXA 5DQDH 1XZ0B 2A6DA 4Z8FL 3OX8B 3QA3A 3FFCE 3VW3L 1FE8H 1U91B 2RAMA 1A6VH 4QHKJ 3G5VA 3ZE0F 5ICXB 4F33A 1VHPA 4JM4H 1KJ3L 3RHWF 3ZDYE 1CFVH 5EZLA 2DQCH 3PP4H 4LCCA 4LOUC 4P5TA 1RIVH 1WFOA 3O41A 3B9AA 3U36A 5T3XE 3REWA 4KDTA 2I24N 4WHCA 2E7LC 3GRWL 3ZYZA 1DE4B 1UWEH 4LSVH 3VG0L 5KVFL 5LGJB 1HOCA 1ZGLM 3L3HB 2FIKA 4CN1A 1NCDH 3O3UN 4QRQA 3WCYA 5EWIH 1T7VA 4TTGA 3L1OH 3CPLB 3FCTB 5MP6H 2ATKB 4JO3L 4Y88A 4PJBA 4OSUL 4PS4H 1FGVL 2WUBL 3VFWB 4W6WB 4YFDB 3FO2B 4FFYL 4UAOC 1JPFB 4WDIB 1N3NA 2CUHA 2ZUVA 1NCTA 1MWAH 4M6MH 1U8QA 1B6DA 5D72L 1KGCD 3BRGC 5BV7L 1NGXB 1XFPA 4X6EB 3C9NA 1OT2A 4CVWA 4K2UH 3BUYA 1M4KA 1N0XH 3NFNA 1B2WH 4GKNA 4JAMB 1D5ZB 1YY9D 4WU5A 1G84A 4KRLB 4PRAB 3U6RB 1NGPL 1NL0H 4P2QD 1A0QH 1OTTD 4KHTL 4BSVA 3WO3B 3O81A 1MRDH 1YMHA 1MHEA 1S7QA 2OK0H 5C0ND 4YPGB 3MBXH 4ZUVA 1IT9H 1E6JL 1HZHH 4P46A 3NN8A 1MCOL 5T5FH 1BBDH 4KUCF 1EERB 3N1GC 3O0RL 3BKMH 2FHFA 5ID0A 3OR7B 1EEYB 1FLRH 2AJVH 1I9JL 5C8JA 3UTTA 2DQUH 1NEZA 4DGYL 1IC5L 4GLRI 1QFPA 3Q5YA 3OGCA 1U3JA 1QRND 2I5YL 5HYIA 3OB0H 4N0YH 4AH2A 4RMTA 4BH8B 3NCEB 2IAMA 4LF3A 4JJHA 3C2AL 1TLKA 1YNLL 4HK0B 3A6CH 1NMAL 5CEYA 4RGNE 3S35X 2IBBA 3AU1B 2IPUK 5EORL 1CIDA 2HFFA 4YX2H 4YGAB 1KOAA 4ZPTA 3EJJX 3F58H 5TF1H 2NX5A 2NQCA 1RV6X 1B0RB 4QRPD 4HUKB 4LPWA 3IDGA 3HI6L 1DBKL 2EDBA 1WEJL 1CFTB 2BNQD 2V5TA 1G1YA 32C2B 4UNVA 1I3RB 4X0KA 3TIDB 4AIZB 3WEXB 5IFJA 4UT9H 4U1SA 2CD0A 2CKBB 4U05A 2DM3A 3SJVD 5DLMH 12E8H 3QDGE 4LCIH 4NQCA 2V2WB 2QQLL 4AMKL 4PJCF 1HHHA 4LCWB 2V7NA 3FOLB 2PF6A 5DHYB 3GMLB 3RJDA 3UP1A 4FQ2L 5E99H 3CMGA 4YEEA 4OKVA 1RIUH 2EH7L 3U2SB 1F6AB 1D5BA 5JIKA 3NAAL 3GSOA 2DM2A 4K9EH 1YZZA 1RZ7H 4Q74A 4PRIB 1KEGL 4OLEA 3D9AL 4DN3L 3C6LB 1A1MA 3AXLA 2X1OA 3QFJD 4YJZL 1OAXH 2WWMC 3DRTA 5KSBF 5CHNA 3R1GH 1PJ9A 4G8GE 4UNUA 1K2DB 2JKXA 3LIZL 5C0BD 2EEDA 3DOSA 3RWIA 5JA8B 5E9DD 4Q0XH 4WWKB 1WTLA 5DD6B 4ZFZA 4PY7A 1NBVL 3Q1SL 2R1WB 2AV1B 3ARFA 4KMTH 1CBVL 3WJLA 2APWA 5DRXA 2HH0L 3TIEB 5JHLL 3N9GL 3UJTH 1DLFL 4GKSA 3BZEB 1I8MB 4FABH 4OLUL 1AE6H 1YN7A 1UZ6F 4C54A 1JK8B 3OZ9L 5EPMB 4C56B 4YDJB 5I1IH 5ETUB 2HT2D 3VG0H 5JHDA 1KB5B 1ZHLB 3ARED 1HWGB 1IBGH 5IMMB 1T2QL 3S4SA 3MV8E 3PP3H 4L3ED 1GJIA 1TIUA 1F11B 2JB5H 3RUGF 5CJ5A 4I1NB 1NAMB 2AQ3A 5CMAA 2WWKO 3BPLC 3GNML 2AQ2A 4OSUH 2VOTA 3MXWL 2AK4A 3B8YA 3BN3B 4XNMA 1PYWB 4CNIB 1YDPB 1I1AC 1FO0H 5CJOL 3U46A 4ZAKA 5JXED 4IHOA 4X7DC 3G6AB 1MCFA 4EIZC 3FQXB 3OAZK 2CKBL 1RJLB 1FV1B 1FNGB 3NCYS 1T1WA 2GI7A 4OAWB 1BZ7A 3LEVL 1DQMH 5J89A 2CDEB 3IYLW 4GRLC 4BSWB 5BMFH 4LVHC 1FPTH 4M00A 3VFSB 3ULVE 1GGBL 4TUJB 3GKWL 2YPVL 5I15L 1U8PA 3OMZA 4X4ZA 5KOMC 4W81A 3BXNB 2UZIL 2GSGB 1MIML 3B4NA 4PJHE 4JZNA 4M5ZL 4K8RL 4N8VA 5IM7B 3IJYA 1WBYA 5MERB 4ENED 4P2QB 3UJJH 1NKOA 3MA9L 3QQ9C 1ZT1B 3PWPE 1W72H 4Z7WB 2GCYB 1AXIB 4BFEA 5E6ID 1NGYB 1QR1A 3VXTA 1IGYB 2IH1A 2DL2A 3ARZA 5F7HA 2BMKA 3LQZB 1CLYL 2W38A 3P9MB 4PJXB 1BVLB 4P9HH 3WUWA 3HUJB 5EORH 4F9PC 3MFFB 1QG3A 1TJHL 1HQ4B 4QHUB 1FQ9C 4DOHB 3TLRA 4APQD 3F7VB 3SDXE 5H8DA 4HFWB 3O6LL 1A7RL 3UBXG 3QZWG 1DBML 2Y6SC 4Z95H 1HE7A 2VUYA 4U3XA 3MMEA 5FO7B 3FAXA 1QRNB 2I60L 2V6HA 1HEZA 1KB5L 2JTDA 3BGFC 4N0UE 3BKYH 1FG2B 1S5HA 5SWQA 5BOZG 4Y4HA 5FECA 4O2CA 3ROOA 1JWSA 1E4WH 1I8IB 1OAUL 4HIEB 1NAML 3HZVB 3I50H 4QRPB 1H8SA 3C5JB 1LK3L 2KKQA 3P0VH 2A0LD 5DJCB 4NCC1 3T0EE 5FFLA 1CE6A 5IB5B 5TE6H 3P30H 4P2OA 2BNQB 2ID5A 3O4LE 3UBXB 5F7DA 3QZWB 5I76A 1SYVB 2Q6WB 4FQ2H 4LKXB 3BZ4B 1CE1L 5I73B 4PRBB 4UOW0 3MLYL 3BZDA 2LVCA 1ZLSH 3EYOA 5I8OL 5KTEL 3LPWA 2FD6L 1RVFL 2K7PA 5D2LA 2DTSA 3GZKA 1H3TA 4P4RA 3QJHA 3MV01 1AGDA 4O5LL 3F12A 4HBCH 3PL6C 3S34L 5EU3A 1EBPA 3NPSB 4WW2A 2AXHA 5DO2C 3V0AC 1M1SA 5EUKA 3ULSB 3RY4A 4PFEA 5KW9L 3R8QA 4KI5D 1XZ0A 5DRZB 3OX8A 1CGVA 1NJ9B 2G60L 1U91A 1T66D 3MLSL 4UV7L 3AROA 3JXAA 1LP9B 5ICXA 3DURA 1I8LA 2EZ0C 2XG5A 3W9EB 3SBWA 4QXWA 4QGTA 2F54E 1JGDB 3QFJB 4JFFD 4P3CH 4JDTL 1G9NL 4EIGB 1BGXL 2J8UB 4J3XA 3B83A 3ZYOA 1BQUA 5HHXH 5C0BB 2E8ZA 1CDHA 1DE4A 5I0DA 4JKPL 3CSYB 1H5BB 4Q9QL 4MVBC 4NQVB 2IFGA 5LGJA 5C2UB 5D7IE 3L3HA 5IWLA 5D93C 2HFTA 3LB6D 2FB4H 3MNZB 1UEYA 3NVQA 1UACL 2FRGP 3CPLA 3FCTA 5EZIL 4DGIL 1MH5B 2ATKA 3VFWA 3MV7D 4XVTL 1DQDL 5L7XH 2EYSB 3FO2A 5D7JB 1JPFA 4WDIA 4ODTH 3AREB 5IROA 5EC1B 2B1HL 5HDQL 4YO0B 5E08L 1X5XA 4FQ1H 1NGXA 4L3EB 4X6EA 1U6AH 5DF0A 5C7XL 3GI9L 3I3BA 4HUWB 1T1YB 4JAMA 1D5ZA 3VDCA 3UPAA 3CDYA 4PRAA 2D03H 3B9DA 3U6RA 3FT2B 3RZCC 2NY3D 2R2CA 1I3GH 4NO0D 5C6TH 3LSOB 1MSPA 1N4XL 4YPGA 2B1AH 1A1OB 4Y5VB 5CP7B 2H3NB 3MTRA 5I15H 5EBMB 3IGAB 4OZIF 3TM6A 3F6LA 3OR7A 1PLGH 1EEYA 3LDBC 3OJ2C 2H32B 1OP9A 5HGAB 2CR3A 4P3WA 4HC1L 5IVXB 4PBXA 4PJBE 1FNLA 1MHHB 3FMGL 4JVWA 2KZ1B 5T5NF 1CL7H 5BVJB 1IKNC 3BJ91 4OGAC 1BFTA 4BH8A 4PLJD 4PGJA 5EC2B 4OIBA 3BMVA 4TVPE 4HK0A 1I7RB 3MACL 4ZXBC 1P7QB 1S8DB 3HNVH 3AU1A 2QQKL 2WP3T 5F8QC 5DUPH 4RSVA 3TEUA 2D2OA 1B0RA 4LSQH 2YHGA 3C09C 3ELAT 5I66B 3S5LG 2A38A 4Z76B 1CFTA 4XVJH 5E6IB 4B7LA 3S37X 4LRIA 1JF5A 3EDEA 3L3IB 2C26A 32C2A 4ODWB 1I7UB 4PLOB 1I3RA 3LKSB 3TIDA 3G9VA 4YHYC 4R2GD 4GAGH 5ERWB 3WEXA 4AIZA 3W5MA 4J3SA 5EH1A 3SDCD 2CKBA 4APQB 1QFWM 2JIXB 4NN6B 3TWCL 1KTLB 3HCVB 25C8L 2V2WA 4XMKL 3WFBH 3UTTE 3WO4B 6FABH 4LCWA 4O58L 3FOLA 4KKBC 2V9RA 5DHYA 3GMLA 4OGZA 2ZUSA 2XACC 1CE1H 5E1AB 5HPOA 5DJ8B 2NLJB 3U2SA 1U3YA 2M1KA 1F6AA 5BOPA 3QBTB 4PP2B 1YN6B 3IU4H 4L8DB 4PRIA 4QXUL 5CKGA 1FAIH 3E8UL 4KC3B 4FXLA 3C6LA 4TSCH 1B3JA 2FH6A 1MHPL 4GBXD 1P9MC 3G6DH 4YUEL 1H3GA 1IGCH 2J88L 5F3HB 1NQBA 1K2DA 2AGJH 4RX4A 1ROWA 3CU7A 1RHHB 3N50A 4NKOB 4WWKA 5DD6A 5JQ6L 1FFQA 1OY3B 3FJTA 5DYOB 1L4IA 1JUFB 2R1WA 5IHZB 4NZUL 2AV1A 4UMGA 3TIEA 1RZ8B 1CS6A 3UX9B 1IILE 3TNMB 5M95B 4K3HA 4NQCE 2UVFA 3BZEA 4MQ7B 1I8MA 3VGFA 4ODHH 1JK8A 5EPMA 4C56A 4YDJA 3V7AE 4WO4D 5ETUA 3PGFH 2BHUA 1KB5A 1ZHLA 1V7ML 4RISH 2YPLD 4L4VE 5IMMA 4YDKH 5IGXL 4RBPK 3SGEI 5I8EA 3CXDL 2NYYC 1WWAX 4XPHL 1Z2KA 4JHZA 1CZ8L 1F11A 4JFFB 1A3RH 1NAMA 4J1UB 4M7KH 4GG8B 5FCUL 5A2IH 4OLWH 1BJ8A 7FABL 2GHWB 2XZQL 4YXHH 4RWYH 4RFNC 3ZE1E 1PYWA 4CNIA 1YDPA 1S9VB 4CW1B 1G0DA 5DDHB 3IVKB 4PD4K 1BFSA 5HDQH 3EHBC 3G6AA 5ALBL 5E08H 5E8NA 2YBRB 3FQXA 1RJLA 4LL9A 1FV1A 4PRNB 4NFDA 3L5HA 1FNGA 1J0KA 4P3DB 4LU5H 5GRXG 5HHVH 5C2BH 4OAWA 3QI9C 3LZFH 1ZVSB 1QKZL 3PXHA 5ENWB 5HYEA 2JCCE 4FQCL 5HPMB 3MV7B 4BSWA 1K6QH 4RA0C 3VFSA 5F89B 1N4XH 2PO6C 4NRZB 5H35B 4TUJA 5JHDE 1HINL 2Z0BA 4R0LB 3FQTB 1TPXB 1LO2L 2OL3H 2RJMA 1T3FB 2EDFA 2HA1A 3MA7B 3I3EA 3BXNA 2Q86B 1WQVT 2GSGA 2OP4H 5CLWA 2BNRB 1D6VH 5JMOC 3V5HB 2W60B 4AEHH 5IM7A 5MERA 5FDWB 4P2QA 3UTOA 2NY3B 4NO0B 1ZT1A 4Z7WA 3H7BB 1T1ZB 2F53D 1NGYA 5I75B 1IGYA 3T0VA 3RI5F 4JG0L 1IAIH 2D4DA 3LQZA 1AQDB 3P9MA 4PJXA 1BVLA 1W8OA 2O61B 3HUJA 3DMMD 3FRPG 3NCJL 4MS8C 3MFFA 1I8KB 1HQ4A 2R29L 4QHUA 5B3JF 3RWCB 4NKMB 4OCXL 3F7VA 4DN4H 2DM4A 4PJEB 4HFWA 2H1PL 2D0HA 3U7YL 3UTPE 5EZOL 4JGJA 2R9HD 1AXTL 4N0FB 4Z7OF 2QADB 2PYED 3JV6B 4O02H 4PUBL 5I1LB 2H2SC 5FO7A 3SE4A 4UT7L 1QRNA 1I9RH 3WV0A 4R9HA 3KVQA 2DQDH 5HHOE 5CCKH 4KKCD 1FG2A 3TBWB 3HE7D 4BELD 1BBJA 4XBEH 3VXNB 4G43B 2J8HA 1I8IA 3AMKA 2J4WL 4HIEA 2AERT 3HZVA 4NPYB 4QRPA 1WGOA 4R90L 3C5JA 4IRZH 2IALB 5DJCA 3TVMC 1RZJL 3DX6B 5IB5A 2NTFB 1NMCB 3RWGB 3GJEB 2BNQA 4G9FD 4ZTOL 1CLZL 2Z8VC 3X12B 3UBXA 3QZWA 4N1EA 1SYVA 2B5IB 3IAQA 4LKXA 2Q6WA 4G6MH 4R2GB 3BZ4A 1X6NA 2F5AH 4C4KT 4N0RA 2DQJL 1H0DB 1YEHL 4PRBA 1B6UA 3N0PB 5E2VL 1BEYL 3SDCB 3PDDA 3QIBC 5GGSY 4H20H 2OI9B 4QRSB 5DC4B 2X44D 2BVTA 1EZVX 4R96B 1PBYA 3TJHC 1RD6A 5KVGH 1WZMA 1B88A 4A2MA 3ZL4L 1V7NL 5JOEA 1T4KB 3ULSA 1ZLWK 2W91A 2XN9E 4Y5XC 1TITA 3W0WD 3DVGB 5DD0L 3GBNH 3HE6D 3UAJD 2E6JA 5DRZA 3WXVL 2KH2B 1NJ9A 2Q8BH 4NDMB 2ZPKL 1RK0B 2R4RH 5MEOB 2UWEF 1LP9A 3DJ9A 5CILL 1QSFE 5I71C 1ZTXL 3W9EA 5IMKB 1VCAA 5JIIA 1A7PL 1JGDA 3QFJA 5HI5C 1IGML 1J1PL 2X89D 3QFDB 1X6LA 2J8UA 5IOPB 2YRPA 3L5IA 5C0BA 4N9OB 1KTRL 4LSSH 2YKLH 4PJ8D 4I77H 3CSYA 1H5BA 5EU6D 4KK6D 4NQVA 1C5BH 3BMWA 1KEMH 3EIFA 3QUMB 4Y4KC 1R3HB 1MAKA 3MNZA 3ZTJG 3QNYB 1C5CL 4NNPH 5I1JL 1MH5A 1Z3GH 3MC0A 4MD4B 4QRRD 2MQCA 1BFOA 5HGBB 1NCWL 5D5MB 1I85C 2EYSA 4LEXH 5D7JA 4W6XB 1L0YA 3SE3C 4DTGH 3AREA 4WTZG 5EC1A 2YPLB 5DEFB 5GGVY 1PG7L 4YO0A 3DVIA 4L3EA 3PWVA 2IG2H 4OB5L 4GW5B 4HWNA 4HUWA 3KPPB 1REIA 1T1YA 5IB3B 4MHHI 3GMPA 4FQXB 1QBLH 2AEIT 2RIKA 3HC3H 4TOYL 3FT2A 5ECJE 1EGJH 3HKFA 1VEOA 4X6DB 2HKFL 4PBVC 5AZ2L 4KHXL 3LPGA 2Y4SA 4MA8L 3LSOA 2AXFB 1A1OA 4Y5VA 2N7AA 5CP7A 3I3DA 3FFDB 2H3NA 2YD3A 5DC0A 5D6DC 1JTTA 4Q58C 5EBMA 4D3CH 1YEKL 4YBQC 3IGAA 5F7LB 4JB9H 3U48A 3N1MC 3NIDE 3OR6B 1EJOH 3K8MA 3ZT5A 1DUZB 5IJVB 1YC7A 2H32A 5HGAA 1JHKL 5IVXA 3GIZH 1JYXA 3C87A 1TJIL 1MHHA 1U41A 5BVJA 4OD2B 1MFBH 5B4MC 5F6IC 4PJIF 5EC2A 3UPRB 5DFVC 2Q76B 2QKIB 1I7RA 2YXFA 1P7QA 1S8DA 4UT6H 4PJ7F 5ESVB 4WI9A 3PHOB 4DKFH 5JZ7C 3L7EB 4OFYD 1A5FL 1FBIL 2F58L 4UNTA 4JN1H 3ALPA 5I66A 5I6XC 2R0KH 4Z76A 2F53B 4AG4H 1OW0C 3L3IA 5KVEL 4ODWA 1I7UA 5JW4N 3V0WH 1B0GB 3NA9H 3QWOB 2YN5A 3LKSA 4NJAH 4OZHF 2MCPL 5ERWA 3DMMB 1X9QA 3E3QE 4XNUH 3RGVD 5IBTH 2Q3AA 4G7VL 1TJGH 3LKRB 4APQA 2JIXA 3CU1A 2YXMA 5JR1H 1KTLA 3HCVA 4Y16D 4PG2C 4X8JB 1XEDA 1XIWC 4TNVF 2PYEB 3OKOB 3DXAE 1JPGB 4J6RL 2BVPB 2Q7YB 4C55A 4DAGL 3HE7B 5DJ8A 2NLJA 1BF8A 5D8JH 4PP2A 1YN6A 1EO7A 5D6CB 3KYKH 2YMXH 4QHMB 1EIBA 4L8DA 3NCCB 5SX4H 4NSKB 2ZZUT 4IMKA 4GQ9L 1MCIA 5F3HA 3JTSB 1ITCA 3OAUH 2BXYA 3QG7L 1S7WB 3OG4B 1RHHA 3FTGB 4NKOA 1H8OA 5DYOA 1G7PB 1JUFA 5IHZA 4NKIL 3QDME 2VH5L 5C09B 1RZ8A 4HF5H 2IBGA 4R8WL 3TNMA 3ZSTA 3O9WD 4LFHD 3SE8H 4KQ3H 5LXGL 4MQ7A 3CSBA 3W0WB 1T7YA 4AEFA 3HE6B 4EDXB 4C59B 3CFCH 4XGZB 2WBJD 3VDBA 4NQTA 2VO5A 4ZUWB 4M48L 1AJ7L 4M8VA 1LDPL 4XWOC 1MVUB 4PRIE 1A9BB 2R69L 4JFFA 5ITBL 4Q9BA 4J1UA 2EDTA 4ZNEE 4GG8A 1IAMA 4NC0B 2IJ0C 1I1CA 1BQLH 2XWTB 4MD0A 4P4KC 3QXVA 3WS3B 4CN6A 4QXGL 5C0JB 1S9VA 4PJ8B 4CW1A 1YJDH 2B2XL 2C3WA 5DDHA 3IVKA 4ERSL 5CIPB 4JQVA 3S3SA 1CLOL 2FGZA 2YBRA 4KK5C 3K8LA 2VDLH 4PJ9B 5FYJU 4PRNA 2O5XH 4H88L 4AK1A 1KLUB 3LHPH 2WWMD 4P3DA 5ADOL 3WN5B 5T1MB 2HWZL 3ARDC 2QHRH 1FGNL 1ZVSA 4QRRB 5LG1A 5ENWA 3UO1H 1A6UL 5HPMA 3MV7A 5I1GL 2HKFH 3AS0A 1PEWA 3QIWC 5F89A 2CXGA 1TTFA 4NQUA 1MVFA 3Q6FB 4NRZA 4GUPB 4ZS7H 5H35A 1WWWX 5KS9F 1EV2E 1QBMH 5DJAB 1D5MB 1P4BH 4UTBL 1UJ3A 3QDJE 4R0LA 3EYUH 5L9DH 3FQTA 1RAMA 1JGVL 4GXUN 4XP5H 1CDIA 1GC1H 1T3FA 1C1EL 4DZ8B 3MA7A 4KAQL 3T2OA 2Q86A 3BGAA 2CO7B 5HHNB 1AY1L 3MXVH 4OLZH 3ZDZF 2BNRA 2QSVA 3V5HA 3DTXB 2W60A 5E4EB 3IFLL 5FDWA 4NQDD 4YHLH 1RZKH 4NO0A 4HCRH 4XCFL 2VZOA 1EAPB 3H7BA 2DQEL 3LN5A 1T1ZA 5GXBB 5I8KH 4YBLC 3M45A 2OXGA 4M03A 5FO8B 5K9KB 2IF7A 2DQTL 1AQDA 2DD8L 1V3MA 2O61A 3NIGE 3TO4C 1AC0A 3TA3C 4U1IB 1I8KA 3CX5J 3RWCA 4NKMA 1RMFL 4JFOB 5EUOF 4PGDB 4PJEA 1QVOB 1X4ZA 3T65B 1I1AD 2DAVA 3U4BL 3SE9H 3CX2A 4RMRA 3JV6A 3RVUD 5I1LA 1BWMA 4NM8H 2IPTH 3I75B 5FUZL 2VXUH 2GY7B 1VPOH 1A6TB 4IM8A 3TBWA 3EO9L 2X9WA 3IF1B 3QUMH 3F5WB 5F96L 3VXNA 4G43A 4HG4J 1EVUA 1UH3A 3MCLL 4ZFGH 5JXAH 3OBAA 4H25B 4NPYA 3IDXL 1MJJB 3FRPA 4ZPVB 2IALA 5B8CC 4MA1C 3DX6A 2NTFA 3FB8B 3RWGA 1YEDB 3GJEA 1IL1B 2L4OA 1A6ZB 4J6RH 3X12A 4Z7WE 4PJFE 1E4XH 2QHLA 2X5PA 5F1IB 5IW6B 1H0DA 3HI1B 4FOMA 3RGVB 1MY7A 3KPQB 3SDCA 1N8ZB 1T20B 3U30B 3HNSL 1S7XB 4JG1H 3U9UB 4Y16B 3NH7H 4QRSA 4X9HA 4R96A 2XZAL 3DYPA 1R3IL 4YNYB 4NUJB 4PJAE 5DJ6B 4KKAC 1XCTB 1T4KA 3I2CH 5GRJH 2VMFA 3DVGA 3DO3A 1W0WB 1A7QH 15C8H 4NDMA 1RK0A 3JUZA 4EOWH 5MEOA 4LFHG 5IMKA 3VWKC 4WFED 4E0RB 4OM1H 1CXLA 1OQXA 3RTQD 1V3JA 4S1SL 3RL2B 1H3PL 3QFDA 4UTAH 4X8XA 3LEYH 5IOPA 1Q9LA 4PYHA 3L5WB 4JLRB 1TETH 3ZDXF 1A7NL 1VA9A 4CADB 5ESAB 5BJTB 2R0WH 4L3AA 5LBSL 1MCPL 4G80B 2Q87A 1E27B 1OAKH 1FYTB 3QUMA 1R3HA 5M94B 1UB5B 2I9LB 5HSFA 3O9WB 2UUDH 4PG9A 4MMZC 2APXA 2VDRH 3LH2L 4MD4A 3QUXC 5LWYL 1XGUB 3WIHL 5HGBA 1SJHB 1FNSH 5D5MA 3K4DA 1P5UA 2WBJB 1K8IB 4XI5D 3L7FB 2YPLA 5DEFA 1TCRB 2NW3B 3N06B 3OAYH 4KVCL 3D25B 4HLZG 4RNRB 3BVNB 4MMXC 5DO2D 5E8PB 4WHYH 5I30L 4GW5A 4CUCA 4KUZH 1MJ7L 1GPOL 3KPPA 2Q3ZA 4KUCD 3KPMB 5IB3A 4K7FB 2Z8WC 5C0RH 4FQXA 2R0ZH 3SQBA 5ACLA 43CAB 4Z0XB 2XTJB 4TSBH 2EIBA 5C0BE 4XPBH 2AXFA 3KR3H 4JKWA 2EZ0D 3FFDA 4LDOB 4WRLA 4F15C 5GGTH 1EK3A 1T83A 3BAEH 4YFLI 4A6YH 4YDVB 5C0IB 1TTUA 4WTZA 4X6CF 1OGAE 2A83B 1NLBH 4Z7UE 2PN5A 3MQIA 2LVEA 5F9AC 1IKFH 1KENL 3MUY1 3OR6A 4NZTH 4PRHE 4JFXB 1DUZA 3EYQD 4KTEH 5IJVA 2O26U 1CFSB 4KI1A 5GQBA 4CN4A 2BVEA 4XCFH 2PKDA 5DVNA 4KPHL 4MVBD 3VE0B 3WSQL 4XMLH 4OD2A 4MCYB 4L8CB 2LTQC 4PB9L 4TPRL 1MRFL 5E8EB 4CAGA 4QEGA 5JPNB 3UPRA 3EDDA 4BQ9A 2Q76A 2QKIA 3MRRB 3SOBH 3VXRD 5ESVA 3PHOA 3PQYE 5HVFB 2DKSA 1F4WH 3L7EA 1TFHA 5I1HH 3PWUB 3RIFF 1F97A 3U7WL 1YEEL 2P5WD 4NQDB 2R0LL 4OFDA 4WUKH 4DW2L 5MEPB 1Y18B 4GG6B 4HAGA 4X5LA 1DFBH 1VGEL 2BJML 4OCSH 2F53A 5HHMD 4DQOL 5FUZH 1MQ8A 1B0GA 1NGWB 3QWOA 3UJIL 2C1PB 4FA8A 5JOPD 1B0WA 3EO9H 3LD8C 5HYQB 4MQXC 1ADQL 4CDGC 3DMMA 5CD5C 2VZUA 1RULH 3LKRA 1RUAH 4U2ZA 4NNXB 1T03H 3RZCD 4NGHL 1I1AB 4N9GB 4X8JA 1CU4H 1U8JB 1DEEB 5C07D 2PYEA 1TCMA 3OKOA 2V5SA 4JM2F 1JPGA 4UIKL 2BVPA 2W0KA 4U6XB 3V7MA 3L5JA 2Q7YA 1OP3H 1UWGH 1F3RB 3HE7A 5L2KD 5A3IC 5JW4M 2XY1A 1DQTA 4U7SA 3TT1H 5A2JH 1CL7I 5D6CA 1GAFH 4QHMA 3F65A 2CRZA 1S3KH 5GGTA 4M61B 5TDPB 2OMNA 2VL4A 4X9IA 3ZMRA 4Q9RL 1ZHNB 4NSKA 5DR5H 3JWNC 4M43L 2WV3A 2BSSB 2RR3A 1YEIL 2YZ1A 4OGAD 1JF6A 3JTSA 4Y8AA 4LMQI 3LS4H 1S7WA 4ZXBD 4Z6AT 5E2WH 5E8DL 4OZGB 4L1HA 3FTGA 3RY5A 1JRHH 1K4CB 3BH9B 4M6NH 3NCFB 1G7PA 2AVGA 4GW4B 4FFZL 4K3DL 3WNPA 5EO1B 3ZKNC 5HGDB 5C09A 5D7LD 4RGOH 1OB1A 2QLVB 1SY6H 4MB3A 2MQ3A 4ZD3H 4KJPC 3BIKB 1Z6JT 2E5EA 4GSDH 1U2HA 3VI4E 3W0WA 3FO9B 3V4PH 3HE6A 4JRYD 1AI1H 4EDXA 4XGZA 5HHPB 5E4IA 4DK6A 3OKKB 3U4EB 4HPOH 4JPIB 4XB8A 4ZUWA 1W2KT 5DJ2B 1FP5A 4YHOH 1MVUA 5TDOB 3T2NL 1A9BA 4X99B 3RTQB 1T5WB 4LSRL 1L7IH 4OFVA 3BGFB 2X89A 5FAAA 4MA7L 2X70B 5F7WC 2IFFL 4HW6A 1NCAH 2XWTA 3BN9C 2FEEI 3U1SH 3L3OB 4ZS6C 3WS3A 4IRSC 5C0JA 4PJ8A 4QTHB 4TNWK 2W0LA 4JDVB 2EDRA 2OM5A 5J1AB 5CIPA 1GGIH 3LCYA 2VDMH 4PJ9A 1CLCA 2WNGA 3VG9C 4PGCB 3VGAB 1FYHB 1KLUA 3IDYC 3SN6N 3WN5A 2OR9L 3B5TA 5T1MA 3S6CA 3N85L 1YECL 4QRRA 5DMYA 1HN1A 2ADGB 2ADJB 2V5RA 3Q6GH 1RUPH 1ZEAL 3Q6FA 3RDTC 4GUPA 3OF6A 4JHAL 1NEUA 5DJAA 1D5MA 3VA6A 2YA1A 2DJUA 2ORBH 5EN2B 5H37G 1Z9MA 1VENA 1CDJA 1HIMH 2QQNL 5D4QA 1BIIB 4DZ8A 3VD4A 1EO5A 1ETZB 1IGIL 5HHNA 4RWHA 2GK2A 3DTXA 4WY7H 4QOKB 1RURH 3IDUA 3A67H 3LS5L 1SY6A 1E4KC 5DVOA 5IFAL 4WCYL 2VNCA 5F44A 5IMOB 1EAPA 5DI8B 4W6YB 5GS0C 1JBJA 2HTLC 3KXFD 2VLKD 4GQPH 3WIFB 2NYYD 4NKQB 5ADPL 5FO8A 5K9KA 2GJ6E 3QO1B 2VC2L 1UWXH 3T3PE 8CGTA 4H8WL 4I3SH 4TQEH 3RJQB 5K59F 1CYGA 1GGCL 4U1IA 3C8HA 3IU3B 3PV6B 4JFOA 4PGDA 2E7LA 1JNJA 1QVOA 3WNOA 3T65A 2DL9A 3BYTA 2GJJA 4LLVB 3W2DH 1AFVH 2VKWA 1NUDA 3FZUC 1KCUL 5D93B 5F9OL 5GHWH 5GRZA 3WIHA 3I75A 3RAJH 2AJUL 1RJZB 3MLRH 5CINL 3UBXI 2EE6A 1A6TA 4FQIL 4E41D 3VI3E 3IF1A 3GSWB 3F5WA 3VXRB 1ES0B 1AR1C 3QI9D 4NC1C 3RBSA 2F8VA 4BQ6A 4OFYA 4B50A 2NZ9C 3MRDB 4H25A 2BNRE 1MJJA 4KROD 4JFDD 5EA0L 1P53A 4GRWE 3FB8A 1YEDA 3C5ZC 1IL1A 1UH4A 4PJCB 5HHMB 2EXYC 1GOHA 1A6ZA 4JO2L 4QT5B 4ORGB 5F1IA 1EEZB 4KXZH 4NWUL 4LP4A 5IW6A 4IS6B 3HI1A 3HC0B 1ZWIB 4NZRL 3CLFH 3RGVA 3KPQA 1N8ZA 5E8OB 2NY5C 3PDOB 2DI7A 4WI8A 4HFUH 3INUL 1LE5B 1S7XA 3U9UA 4Y16A 1F4XL 2A9NH 2V7HB 1UGNA 5IVNA 5C07B 4PJEE 4G3YL 2AJXL 4YNYA 1OGTB 4G7YL 4NUJA 5DJ6A 3U0WL 4U3HA 1XCTA 4ODSH 1DL7L 3QRGL 2WAHA 5KSBB 2YA2A 2AJZB 2NY4C 4GJTB 5L2KB 5I8CB 1W0WA 2DBLH 3EYFB 4MS8D 4EQ3A 5EO0B 5CSGA 2AJYL 4NZJA 4RDQF 5DD3L 5GS1C 4LAQL 4K3DH 4FFZH 5CBEB 4DK3A 3HS0B 2K9UA 1BQHG 1KFAH 3BQUC 2WQ8A 2ERJC 2NY0C 4E0RA 1MOEA 2H2SD 3F8UB 5T1DL 2W65B 4M7LT 5EZJB 3RL2A 1NBQA 4YZFF 2DI8A 4XPGH 2UY7A 3L5WA 4JLRA 5FV1L 2W9EL 4EI5A 1WLHA 4YGVB 5DT1L 4FZEL 3TZVC 4CADA 4FTVD 5ESAA 5BJTA 4PJ5B 4G80A 1E27A 1FYTA 1CR9L 5D7LB 5D7SL 2EH8H 4XXCA 3V6ZB 1UB5A 2I9LA 5J6HB 3O9WA 3RUGB 1L9NA 1BQHB 4QXTB 5TQ2L 1GGYA 4Y19E 1XAUA 1XGUA 4JRYB 5C08D 4XNQB 1SJHA 2PR4H 3MV11 1WUNT 2WBJA 1K8IA 1IAKB 3QIBD 2A6IB 3L7FA 4JQIH 3HC4H 1QBBA 3CK0L 1TCRA 5GZOD 1KCLA 2NW3A 1IC4H 2WANA 1YYLL 5CZXD 3D25A 4RNRA 2L0DA 1QUNA 3BVNA 4PV8B 3TJHD 4CVZB 4HJJH 5D2NB 5E8PA 5T3ZL 5IG7B 3BISA 3DYOA 3B9VA 4K7FA 2MCG1 3K2UL 2RCSL 1P4IH 43CAA 4Z0XA 4LEOB 1KIPB 4M1CD 4ETQB 3O8XC 1FNAA 5KSUB 1T7XA 3NGBC 3IXAB 4ONOA 5FK9B 3ULVF 1EPFA 4YDVA 5C0IA 5DMIH 4HT1L 5HI5D 2A83A 3X3GL 2H2PD 3LRSA 3BKJH 2VIRB 4YWGL 4M6AA 2FBJH 4JFXA 3LS5H 4PJHF 1LO4H 4YQXH 2ZCLL 3VE0A 1OTSD 4HPYL 4I13B 4MCYA 5DTFB 4L8CA 3HFML 4IMLB 5E8EA 3OWEA 4Y4KD 4MNGB 2YPLE 4X98B 3DI2B 5JPNA 3VCLB 2DMBA 4LGPB 3HMXL 2O93L 3O2DL 3MRRA 3E2HB 3I6LE 3BP4B 1A6PA 5FYJE 3PWUA 2R2HB 5I17B 3QIUD 3V4VL 4NQDA 3FOMB 2WQRA 4XBPB 1QZ1A 4JHWL 5MEPA 1Y18A 4GG6A 3SDXF 1RUKL 4OV5B 3KXFB 2FATH 2VLKB 2FDBP 5FUCE 4M5YL 5B38G 3QUKB 1NGWA 2C1PA 5HYQA 4BZ1H 4K55A 1G7QB 5TH2B 4BFIB 5FGCE 2R56H 3MRNB 5DZOA 4HBQA 1CDBA 5DUMH 3SO3C 1VGKB 4RFNB 4NNXA 5H2BA 1MNUL 2O5ZL 1I1AA 3D5OF 4N9GA 4V2BA 1DUYB 2P8LA 1U8JA 1DEEA 4IOFD 4PREB 1WWCA 3D3VD 1QNZL 1PKQB 3BPOC 4R97B 5HI3C 5D71L 5CUSH 1Q72H 2ZCKH 4UV4L 4U6XA 4U1KB 4LCUB 1T7WA 1BIHA 3RBGA 4WI6A 3S35H 1RJCA 4L4JA 2EC9U 2Q7NA 1MCLA 4M61A 5I1EH 5TDPA 3STZB 5I1KH 4ZFFB 4KROB 4WUUD 4JFDB 3FB6B 2XQBH 1ZHNA 3B8SA 5IIEB 2BY3A 1U8MB 3G08B 2M2DA 4E5XB 1U3HD 5ACMA 4DUXA 2BSSA 2EDHA 3QHFH 4JFEE 4N1HB 3VXOB 3RVVD 5IFHL 5TQ0H 1FRGH 4OZGA 1FIGH 5E2UH 5TJWK 3NFSL 5JZ7D 2L7UA 3MPCA 1K4CA 3GHBH 3BH9A 5HVHC 1KELL 3VXPB 3BOVA 4GW4A 4B5EA 5EO1A 2ZOLB 2BSTB 5GRUH 5HGDA 3TBYB 2EC9T 4U1HB 3SGKC 5T1LD 2ICWB 1E0OB 3O2WH 1U42A 4MXWH 5CZVH 2PETA 3K1DA 4ZSOE 2Q8AH 3BIKA 2IADB 4I3RL 3FO9A 2WMPA 4F9PA 2CRMA 5EFIB 1D7FA 1L7TH 4RGNC 5HHPA 3OKKA 1BWWA 3U4EA 4JPIA 1CVSC 5H37H 2D9CA 5DJ2A 5D7SH 1NC4D 5TDOA 4X99A 3EBAA 3RTQA 2FJHB 1T5WA 5LKNA 4PP1D 3GK8H 2DI9A 3ULUC 3BSZL 5D7IF 4HIJB 2X70A 4WHTB 1FC1A 1CICC 4X5WB 5GGRY 4NN7C 3CSGA 5TF0A 1XH3B 1XT5A 1T89A 1BMGA 1TVBB 2VDOL 3L3OA 5JW5B 3ME0A 4L9LC 4QTHA 1BJ1H 2J1KA 4FTVB 4JDVA 3CFKB 3VGGA 1OF2B 4UIMB 5J1AA 1YYLH 3ARSA 1WAAE 4NQSB 5D70L 4GXVL 5BVPL 3P0YL 5DMJB 4PGCA 4P23C 4Y89A 5FM8A 1BFVH 1EO8H 3BEWB 3EOYG 5C09E 4E42B 3VD3A 2KUTA 3K2UH 2VLRD 3ETBF 1FORH 3ALWA 1DBJL 5C08B 3P3YA 1NGQL 5T5NG 2ADGA 4I0CC 2ADJA 4S1RL 3QIBB 1CD9B 4XAWL 2DQHL 4J12A 2EDOA 4M02A 4HIXL 3BPNB 5EN2A 2EE2A 3V52L 3KS0J 5SWSB 4QWWC 4P9ML 1LGVA 3ZHDA 5DA4A 1BIIA 4PB0L 1KLGB 3S36X 2AW2A 2IMNA 4LLUA 4OZIB 1ETZA 2KQMA 4Y5XB 1AKJB 3KLDA 1MCKA 1HH9B 4QOKA 2WUCH 5FUOL 2FLRT 3AGVA 4F57H 3IFNH 1WCQA 5IMOA 5DI8A 4ZUUB 4XWOD 3WIFA 4K3JH 3P11H 4M1DL 5C3TA 3QO1A 4K7PH 4NHUB 3DBXB 5C6WH 1H3VA 3AB0C 3EJZC 4U6TA 3I9GL 3WFCL 4PRPE 3IU3A 4UB0L 3LKQB 2HAZA 3PV6A 5A2KH 1U92B 4OGYH 1FVEB 1UCBH 3TCXA 4LLVA 5CEZH 4JFZL 4JHWH 3D2UD 2BSED 3I85A 1LK2B 2AI0L 3DECA 1YQVH 4KK5D 4M5YH 4Y4KB 1RJZA 5FOBB 2RQ8A 4C58B 3GSWA 5DC9B 3ARDD 1ES0A 3B2UC 5E94B 3C8DA 1OAYL 4TUKH 3MLXH 2VZ1A 1IM9D 4FMKA 3S97C 3MRDA 3QIUB 2O5ZH 2WIIB 3QIWD 2A9ML 5CD3B 4ZFOB 2P7TB 4YHKL 5CJQL 2HT3D 3G5ZB 4OCWH 1CD8A 4PJCA 4CMMB 2XTLA 5JORB 3QDAA 4ZYKB 5SX5H 4QT5A 2CQVA 4ORGA 4UQ3B 1EEZA 4TULL 3WD5H 1N7ML 1T6WA 3VFGH 4IS6A 2VDKH 3B9EA 2XG4A 1ZWIA 3HC0A 5A2FA 1B9ZA 1EXUB 4KMLB 4XNZB 1EMTL 1G6RB 1IE5A 1MCWM 5E8OA 3GSNB 3PDOA 2EEBA 3C8KB 3QPQC 3MYZA 3K4ZA 1LE5A 3VXME 2V7HA 2ZCHL 5BO1L 2GIYA 4CU6A 4MJ2A 4Z5RB 5J8OA 5C07A 2JJTA 3D3VB 4OLYH 1OGTA 3SKJH 3WFDL 5JOFB 1P84K 3WJJC 2MWCA 3CX5K 5KSBA 1Q0YH 1KJMB 2AJZA 3JWDL 3QUYC 5L2KA 5I74B 3TO4D 5I8CA 3EYFA 2ED9A 3TA3D 4YHZL 5EO0A 1FC2D 2DIBA 5ISZD 2FHCA 1GHFH 5MI0B 2MPAH 3GUTB 2EYTB 3L9RB 5CBEA 5DMGC 3RU8L 5I9QB 5M7QA 3HS0A 4WUUB 3LVEA 4KZEH 4NCC2 3VRIB 1U3HB 3THMH 2GT9B 3PDGA 4JZJC 2W65A 3RA7L 5EZJA 3LV3B 2NMSA 4WI4A 4HG4K 1DQLH 2ITCB 3GHEL 4D9QD 3WHE0 1NCUA 3DVFA 3AY4C 1CGSL 3DETC 4YGVA 2UUDK 3IB4A 1UA6L 3D39D 3GMNB 4OI9A 4PJ5A 3BW9B 5BS0D 3HMWL 1E4XI 2X6MA 4UZGA 2Z91A 2VERN 1NAKH 4TSAH 5D7LA 2RHEA 2ICWJ 3GI8L 3V6ZA 4Y5YC 4YC2B 5J6HA 5E56A 3RUGA 1FG9C 1BQHA 3MLZH 4QXTA 3VXUD 3OAYK 4JRYA 2VDOH 4XNQA 5EDXA 3VMOA 3AM8C 1IAKA 5ALCL 2A6IA 5KZCB 4FQLL 2UYLB 2YD1A 3ZE1F 4ALAL 2C4FU 3O6KH 2NY7L 3IJHB 4MJ4A 4PV8A 1NC4B 2ZOKB 4CVZA 1FSKB 5D2NA 4RGMB 4KKAD 1GL4B 5IG7A 4ZFOL 3MV9E 1Z0MA 2EICA 1W8NA 5GISH 1KCVH 4AEIL 3BE1L 4LEOA 2Q20A 1KIPA 1QLEH 4XVSH 1ZHBB 1TTGA 2JCCF 4ETQA 1K9TA 1U58B 3OQ3B 4MXQD 5KSUA 3Q5TA 2VQ1B 3IXAA 1YNTB 1UB6B 2XYCA 3GSNL 5FK9A 5C0CE 3VWKD 1KJ2L 2XWJB 1X5LA 2BFVL 4UILH 4Y2DD 4F2MB 2C4FT 1PW3A 1FYTE 1J0JA 3LMJH 2VIRA 5TFSH 4ZO7A 1G9MC 2OSLB 1C8PA 4YDIH 5C0GB 3FKUS 5HBBA 2A1WL 3CLEL 4JRXE 1WZ1H 5DTFA 5F7EH 4IMLA 1NCBH 4MNGA 4X98A 3VCLA 4EUPH 1A2YB 4QCIB 3BP4A 5EOQH 3S3PA 4LVOC 3QUXD 4LSTH 5E2TL 5I17A 2R2HA 4FNLL 4GT7A 5CJXC 3FOMA 4MLSA 3O3EB 4XBPA 2VYRE 4JREB 4HHAB 4FFWC 4OV5A 3KXFA 2VLKA 2XZCH 2XTJE 3OXRB 3OSKA 4S0TD 3QUKA 3GBML 2DBJA 3H42H 4NKDA 1UFUA 1BF2A 1G7QA 5DURD 5TH2A 4BFIA 4D8PB 1OAYH 3MRNA 2IWGA 1ZMYA 3GSVB 4HKJB 1VGKA 1M6OB 1N6QL 1DVFC 4JE4B 2WM0A 1MJUH 1RU9L 1DUYA 2DLEA 3D2UB 5CJQH 3RX5A 1KJVB 4PREA 2B4CL 2Q1EA 3CVHB 2B20A 1CQKA 1PKQA 1UM5L 4D9LL 5KAQF 4U1KA 2N4IA 4LCUA 4TVSa 2W9LA 1A6WH 3ARDB 5T1KD 3LEXB 4YK4C 4ZQKA 1VSCA 1IM9B 1BM3H 4P5TC 3STZA 4J8RB 3MLTB 2GQHA 2D7QA 4Y0GA 4ZFFA 3QIWB 1OSZB 4JFDA 1G7LB 3FB6A 3UTZB 3WIIL 5IIEA 2OCFD 1U8MA 5GJSL 3G08A 4E5XA 4TTDD 1SBSL 4X7SL 1EHNA 4KDTC 4J3VA 1YPZE 5L6YH 4GG6E 3VXOA 3S37H 1I1FB 4OQTL 2EKJA 3TBSA 1A3LH 5FYLL 4YXLH 3VXPA 1JGLL 2IGFL 3VMPA 4XPFL 4LQFH 2UWEB 2ZOLA 2BSTA 3TBYA 4U1HA 4MD5B 2ICWA 2HT4D 5FYJH 5K33A 4YBLB 4FZ8L 4XC3H 5F1SA 1VERA 2ED8A 3H6JA 2IADA 1ITBB 3X11B 4YXKH 4CRPA 4I48B 3TA3B 5CD5D 5JA9A 5EFIA 3JWOL 3QPXH 1J5OL 4PY8I 3ARBB 4H5SB 1GH7A 2YUXA 5ISZB 1J1XL 4NUGL 3JSSA 1VEPA 3WFZA 1K5NB 1KBGH 4G8EB 3SGJC 2WLYA 1UC6A 4HX1B 2NY1C 4ODXB 4OM0H 5DGRA 3HB3C 3KPLB 5F7FA 3TV3H 3WNKA 2FJHA 3FN9A 2GUOB 4HIJA 4R6UA 4WHTA 4O4YH 4NQED 2P8PB 3BEVB 4OZ4A 4UINL 4X5WA 3PWNB 4H26B 1XH3A 4ORZC 1JHTB 1TVBA 5JW5A 4YE4L 5ALCH 4P46C 4FTVA 4K07A 3D39B 1JNNL 4OZGE 2LV4A 3CFKA 3IS1X 4G8FB 4N5UA 1S78D 5BS0B 1OF2A 4UIMA 4R4FL 3WS6C 4NQSA 4MA1B 4Z0BH 4MJID 4M6OH 4Z7VE 2OQJB 4HWUA 2XA8H 4E42A 1JRHI 3BEWA 3CMOL 4K94C 2VXVL 4PGEA 2QR0B 2LQRA 3QAZC 4JY4B 4ONHB 1X5FA 2D7MA 5C08A 5TPWL 3KLAB 1U8IB 2XXCB 2Y07L 3QIBA 2IAMC 1BD2E 3K3QA 3KPTA 3ECBB 1G6RH 3KLSA 4FS0A 1J8HD 4NT6B 2DQFB 4DVRH 5SWSA 5C0FB 4KGLA 5TE4H 4HS8H 1J05A 1KLGA 5F93C 4QLRA 4OZIA 3V4UL 4Y5XA 1MF2H 1PD6A 4HQQL 4FP8H 1AKJA 5EOTB 2BDNL 1HH9A 1OT1A 1UWXK 1AO7D 2CMRH 4HJ0C 4HV8B 3EOTL 1MPAL 2J5LB 4JQXA 3S88L 4BYHA 3MX0A 4OLXL 3OV6A 4ZUUA 5GGQH 3QEQB 3VWKB 1FZKB 2Z31D 4Y2DB 1ORQB 4PJIB 4XRCB 2M26A 4NHUA 5IHUH 4MB4A 3DBXA 3LRGA 1KCRL 2B39A 4PJ7B 4F9LC 3LKQA 4CMHC 3BN9D 4FFVC 1MFDL 2ZWLT 4Y1AE 1IGFH 4ZS6D 1U92A 1PX4A 1FVEA 3IDIB 4XC1H 1MHCB 1GIGL 1LK2A 2F5BL 4I18C 4D2NA 4RIRB 5FOBA 3B2VL 1CGYA 5FYKL 3KPSD 4OZHB 2WP3O 3M17B 5E94A 3ILQC 3RVTD 3QUXB 1HHJB 1KULA 2NY6D 1VKXB 3QIUA 3EUUA 2WIIA 1F3DH 5CD3A 4ZFOA 4AYFA 2P7TA 4QOKE 2W9DL 3RDTD 1QLRB 3G5ZA 1OM3H 5MEQB 1ZLUH 4CMMA 5JORA 4ZYKA 5DJ0B 4KTDL 4AEEA 2CLRB 2VLME 3PNWB 2AK1L 4UQ3A 2NXZC 2CO6B 4OJFL 4OLVL 5DURB 2PYFB 3ARFC 1EXUA 4OBSA 3WJLC 1G6RA 5ANMB 2J3SA 1IEAB 1OCWH 5LAXB 3GSNA 1CIUA 3C8KA 1TQBC 1MWAB 3RNKB 2FX7L 4CL7A 5F9WC 1SEBB 1RQ5A 4Z5RA 4AIOA 3LAFA 2G75B 4NNYB 1UKQA 5IW1B 2HTLD 3DRQB 3RY6A 3D3VA 1VB9A 4R4NC 1GGTA 1LQSR 2QSCH 5JOFA 3QXTA 1JZ6A 3QG6B 1KJMA 2NXYB 3LQAC 1C12B 1LWRA 5IJKA 1S5IH 4M1GH 1X5KA 1SMAA 3KJ4B 5IBLC 1I9IL 5T1KB 3NZHH 2FO4B 4NWTL 2VXQL 5GGRB 3GUTA 3VFUB 1KLFA 1S7UB 2EYTA 4MX7B 3RL1B 4K71B 3L9RA 3M07A 4WUUA 1JGEB 3VRIA 4LARH 1QFWH 1U3HA 2CUMA 2GT9A 5T3ZE 4X80H 1OL0A 1HXMB 3FZUD 3LV3A 1AXSB 3WLWC 1WIPA 2EDWA 4LRNL 4PJDE 2V2TB 1QA9B 2D7TL 3CXHK 4PD4J 4PJCE 2ITCA 2XRAL 4ZAKC 2EIEA 1KPUB 1ZK9A 1QSED 3ZT6A 3SQOH 1JJUA 5DQDL 3QXAB 3GMNA 1MUJB 3BW9A 2N1KA 5J13C 5KJRH 1EH9A 4J4PC 1INEH 5JNYB 1A6VL 4MYWB 2P8MB 1MY5A 3PP4L 3LD8B 3BI9X 3CSPA 1P6FA 1RIVL 4OIAA 3PUCA 5IMLB 1FL6B 4MJ6B 2OXHA 2UYLA 4YBHA 4ODUB 1HI6B 1UWEL 4LSVL 3IJHA 4OUOA 3HG1B 1PY4A 1NC4A 4C57C 2ZOKA 5E0QA 4JO1H 2VXVH 4EXPX 4AJ0A 2ZUUA 3W81A 1NCDL 4NQEB 5BRZD 3CVHH 3SDAC 4I5BB 1HH6B 5EWIL 1ZANH 2Y1VA 5J11C 3L1OL 4P2YA 5MP6L 2Y07H 5D7KD 4PS4L 2VL5B 3FQNB 1O7SA 1ZHBA 4YHMH 3PE9A 1U58A 4EVNB 2VQ1A 4BM7A 1YNTA 1UB6A 5EIVA 3D0VB 1N64H 3MLWL 4MJIB 2XWJA 1MWAL 4M6ML 1AGFB 4PJ5E 4BK4A 3C60C 4F2MA 5EU5B 4IIQB 4OIIH 1ND0B 1DSFH 1XGRB 1F4AA 3PWLB 1N0XL 1B2WL 2X4PB 2OSLA 4P59H 5C0GA 3DSFH 3RHWK 3S88H 1J1OH 1NL0L 4ELME 2RFXB 1A0QL 3L6FB 4WJ5B 4WV1C 4Y4HC 5IVZB 5BV7C 1MRDL 2OK0L 3QT2A 3MBXL 1NBYB 1F4YH 1A2YA 4QCIA 2IQ9H 1IT9L 1HZHL 5D2NE 4XP4H 5T5FL 1BBDL 5AZEH 4P2OC 3BKML 1AO7B 4IJ3C 2KBGA 1FLRL 3O3EA 4M93B 5DXWA 1K85A 5IT2H 3JUYA 1GIGH 4AQOA 2AJVL 2DLGA 4HHAA 2DQUL 2QV2A 3OXRA 3M8OH 2Z31B 2ZNWA 3F7QA 4OI8A 3QQNA 4HDIB 4N0YL 4QHLA 4D8PA 2CK0H 4WW2C 3A6CL 3K4AA 3GSVA 1VFAB 4HKJA 4I9WD 1M6OA 2MTPA 1OP5K 2P5EE 3PJSB 1U9KA 4XP1H 4YX2L 2D0FA 5E5RB 3D2UA 4HWEH 3O8XD 1KJVA 2Y06H 3F58L 5TF1L 4LASH 3CVHA 4JO4H 1KC5H 3H3BC 3VH8G 3PABB 3BWUC 4JFPB 4F7TB 2AK1H 5FKPB 3IDYB 5IKCB 3Q48A 3V6OE 4MNGE 3ARDA 4OUUB 3OKYA 1I8LC 4PJFF 3LEXA 3SBWC 1FO0B 5IW3A 4LLWB 1ZSDB 1IM9A 2NY6B 3LKNB 1CDYA 4UT9L 4J8RA 3MLTA 3CDCA 3DUUB 3QIWA 1OSZA 1G7LA 3MOBH 3UTZA 1MI5B 3FFCD 5DLML 4HUVB 1IRAY 12E8L 4LCIL 3ZKSD 3DX7B 1I1FA 4C4KO 2D9QB 4PLKD 4F7CB 4U4BA 2YD5A 4PJAF 1OSPL 1I9IH 2CGRH 1ED3B 3VH8B 1CTOA 2FCBA 2BRRH 1NCCH 5IWLC 5E99L 5EIIB 1C16B 5D1XC 1RIUL 1TZGH 5DQJB 5T3XD 3CH1B 2EDDA 2HVKB 2UWEA 4K9EL 1DQJB 1F4HA 1RZ7L 1DBAL 5IK3B 5MHSE 4MD5A 4X4MA 1M05B 4RQQB 1OWRM 2P43B 3X11A 5IROC 1OAXL 4AT6B 4I48A 3R1GL 3TA3A 2QQQA 3ARBA 4HWBH 4H5SA 3FB5A 1JF1B 5ISZA 1HNFA 4BKLB 1W72B 4Q0XL 1KIQB 1K5NA 5E7BA 4G8EA 4FQHB 4HX1A 4ODXA 3KPLA 1EEQA 3NCBB 4JFDE 5HI3D 4KMTL 2VABB 2VRAA 2GUOA 2QL1A 3OHXB 2VTFA 2P8PA 3UJTL 4D94A 5FOJA 3BEVA 3F6IA 3PWNA 1F90H 4FABL 1AE6L 4KMQA 2EIDA 1QSEB 43C9A 3E3QC 3D39A 4G8FA 5I1IL 5BS0A 2NPLX 3G9AB 2JJSC 3MO1B 3MJ7B 1IBGL 5J12B 4MNQE 4XCCH 5JPMB 1JHLH 2OR7A 5C0AB 2OQJA 1XGTB 1CFNB 2YUVA 1JTOA 2JB5L 2QR0A 4ONHA 4JY4A 1OD7A 3Q2CA 3KLAA 3TH2T 1U8IA 2VDPH 4GRMB 5GS2D 1J0YA 3ECBA 4KQ4H 4NT6A 1FO0L 3MLWH 2DQFA 5C0FA 4X6CB 4X7CC 4HH8A 1AD0B 5BRZB 2VQUA 1RY7B 5EOTA 2VLJE 2E3VA 1NDMB 2X4NB 4Z7UF 4RGND 4U1GC 4HV8A 3BDBA 1DQML 1UH2A 3IETB 3OKDB 2FX8H 4UUJB 4OT1H 5BMFL 2CLZB 1FPTL 5KSAD 3QEQA 2EIZB 3VWKA 2P49B 1FZKA 4LK4A 2ERJB 4QY8B 4Y2DA 1ORQA 2FJGB 4PJIA 4HWBA 4XRCA 4R7DB 3EDFA 1YY8B 4U6YB 3DYMA 2JE8A 3EOBB 1JZ8A 1OQOA 1EBAA 3W39B 3IDIA 3O3DB 1MHCA 5J3HC 2VWEE 5C08E 4OCRH 3FB7B 4M7LH 3MRHB 4WI7A 3UJJL 3J8F7 4EN3B 3P0GB 1W72L 4L5FH 5B39B 4P23D 5KVDH 4OZHA 3M17A 5SWSE 1TVDA 1BAFH 5SX5K 5LGHH 3QUXA 1HHJA 1ERNA 4P9HL 2C9AA 1VKXA 2RBLA 4K8RC 1JMZA 1QYGH 3U0PA 1F02I 5DWUH 4JPWH 4R4BB 1I3UA 5GGVH 1QLRA 2JJVA 4DFHA 4O2EB 5MEQA 2VR5A 5SV3A 4ISVB 4WWKC 4Z95L 4NC2B 4QWWD 2CLRA 4JM2B 3ULUE 3MRCB 3MJ9H 1TENA 3PNWA 3BT2H 3RP1A 3IXTB 1OAQH 4LPUA 5FA3B 2PYFA 5ANMA 3BKYL 4G8GD 1IEAA 5LAXA 5I1AB 5F1KC 1MWAA 2X1WL 3RNKA 3TH3T 2R8SH 3T04D 2CR6A 1E4WL 1SEBA 1WVZA 2OJZH 5K9JH 4N8PA 1P69B 1CGWA 2AJSH 3O8XB 5L88H 1FL5B 4NNYA 3I50L 5IW1A 5K9OB 3DRQA 1ZS8B 3NGBB 4LSDA 1WBXB 2FEDD 3P0VL 4OCMC 5TE6L 5ICYB 3P30L 3QG6A 3ZT7A 2ZG1A 1C12A 4OKDA 1OSPH 1TNMA 3CH8A 3EJZD 1F00I 2K3TA 5T1KA 2FO4A 4WGWB 3QXUA 4OI7A 5GGRA 4J3UA 1S7UA 3VFUA 4MX7A 3RL1A 1ZLSL 1JGEA 3AS3A 1KXVC 1A14H 1DBAH 2R1YB 3FFCB 1Z9LA 3B5GA 3N1PC 1HXMA 2WLZA 1HYRC 4HBCL 1K3ZA 4XP6H 1AXSA 4ZNCD 2V2TA 3MV8D 1T0NB 3PIQB 1QA9A 4JEGB 3EW3B 3BPCB 3Q0HA 2X9YA 1KPUA 3B2UD 4Q7DA 1WV7T 3SCMC 1OTUC 4QTIH 3QUZC 2F9BT 3QEUB 3VI4F 4DEPB 3QXAA 1MUJA 5EB9A 4O9HH 4LHJB 4I2XE 5JNYA 4MAUH 3QHZH 4HSQA 1MIEH 4ODVH 2P8MA 3TCLB 1HDMB 4R3SA 5EOCH 2P48B 3EYSH 1Y6MR 3BDYH 4P3CL 2YR3A 4OQ1A 2XFXB 3G6JE 5JUEH 5IMLA 1FL6A 2AQ1A 4MJ6A 5HHXL 1PQZB 3IAPA 4ODUA 3VGBA 1HI6A 4MNHB 3HG1A 1SM3H 4WEBH 1ZLVK 3ULVD 4OCLC 4NRXB 3BPOB 1ZGLP 2CDFB 2FB4L 5DHVH 2W0PA 2YWZA 4NQEA 3QUYD 4I5BA 1G9NC 4JFHD 2ZUYA 2GTWB 1HH6A 1WZKA 4LNVA 4Z7QE 5C0NC 3U0TB 4H1LH 1AH1A 1LO0H 2OTWB 2VL5A 1HHGB 3FQNA 3MRIB 5DMGD 5L7XL 4EVNA 5TDNB 5I1CH 4ODTL 3D0VA 5FF6B 4MJIA 1AGFA 1AHWB 3PWPD 2H9GB 1WF5A 3EZ8A 5EU5A 1LNUB 4IIQA 4FQ1L 2G5BB 5C86A 1ND0A 1K4DB 1U6AL 1XGRA 1URLA 2AXGB 3PWLA 1EEUA 1DJSA 3L3DB 2X4PA 3SE4C 3DETD 1OLLA 5BZWB 4OZFH 4KKLD 5HVHB 5HYJE 2BOCB 2D03L 1A4KB 1XR8B 1CGUA 2RFXA 4C83B 3BRFA 4GLRH 5FIEA 3UYRH 3LPFA 1I3GL 3J7HA 3L6FA 4WJ5A 5LQBL 2Y23A 5C6TL 2XA3A 5IVZA 1MCBA 4KWUA 4CJ0A 2L7JA 2B1AL 1NBYA 1H15B 5GS0H 3QEGH 2E27H 1Q0XH 3BYYA 3C6SB 3U79A 4WFGD 3T3PF 1AO7A 1PLGL 5HJ3B 4JPVH 2DKUA 1EHLH 5I73C 1EA9C 5KSAB 3SKOB 4ZOAA 2Z31A 5J6GB 5GRWA 1SVZA 3T0ED 1CL7L 2VITB 1BVKB 4HDIA 3EOAB 3O4LD 4NN7B 4GAFB 5FYLE 1VFAA 3VI3F 3HNVL 2Z92B 3PJSA 5DUPL 4LSUH 5CAYB 1S9XB 1X5ZA 4Y4FC 3BDXA 2Y5TB 4LSQL 1LD9B 5C71A 3BKCH 3IFPB 3PABA 4GRWF 4JFPA 4F7TA 4XVJL 4RDQG 5FKPA 5IKCA 3HI5H 1JPSL 4OUUA 1A02N 3AFLA 1FO0A 3IKCA 4LLWA 4GAGL 1ZSDA 1INQB 3LKNA 4G8IB 1AR2A 3DUUA 5CJ8A 5A1AA 5J0BA 4LIQE 5J06A 1MI5A 3HNTH 4HUVA 2ICWI 4LLAA 3MLPA 2MNUA 3I84A 3WFBL 3DX7A 4XWGH 4Z7OE 2HKHH 6FABL 4F7CA 1KG0B 2F54D 1F6LL 3MRBB 5DK3A 1Q8MA 1ED3A 3VH8A 4BJLA 4G8GB 1UM4H 1C16A 3ESUF 5EIIA 5DQJA 3A6BH 5TE7H 3CH1A 4XCNB 1E4KA 2HVKA 1MEXH 3IU4L 1DQJA 2HFGH 3KS0H 1VFUA 1D5IH 1NFDE 4FFWD 5IK3A 3SJVB 1FAIL 2AV7B 2OL3B 1M05A 3H9ZA 4RQQA 5DJZB 5E5UB 2FEEL 2OLDA 3CZJA 4TSCL 2HT2C 3MODH 5D7JC 1J0HA 3G6DL 2ZG2A 1IGCL 4AT6A 1JIBA 4YFEA 5I18H 2YRZA 4WFHE 4DUVA 1NUFA 3H9HB 2AGJL 3L3JB 1JF1A 3PGCB 3VGDA 1W72A 4BKLA 1KIQA 3OB8A 2F15A 4FQHA 1QPXA 3SDDC 2VABA 2E8YA 3MV8B 3OHXA 4NHCH 2C3HA 4U2YA 1BZ9B 3H3KA 3H9SD 1QSEA 1XF5B 3FQUB 4ODHL 2G5RA 5E9DB 4YHPB 4N0CC 4LHUD 4RCAA 3PGFL 3MO1A 1T21B 5DD5H 3MJ7A 5J1SC 4RISL 4YDKL 5JPMA 5C0AA 1XGTA 1CFNA 3F7PC 1UJTA 3TN0C 1PG7X 2ICEB 2X4RB 4PGZA 4U33A 3UDWA 4X4ME 3L5XH 1E6OH 2E6PA 1A3RL 4BK5A 4M7KL 3CFBB 2YD8A 4OLWL 3OKNB 3BGMB 5GSRB 4YXHL 4GRMA 1FJ1B 4RWYL 4UOJA 5F71A 3RPIB 5FYKE 5IBUG 2BY2A 5AYUH 2XQYG 3DUHA 4X6CA 4KY1H 3VRLE 1AD0A 5BRZA 5DZLA 4LU5L 1NDMA 4TVPD 2X4NA 5HHVL 5E03A 5C2BL 3LZFL 5F70A 4PJHB 5ICZB 3IETA 3OKDA 4UDTB 4U7KA 4UUJA 2CLZA 5LQBH 1K6QL 2EIZA 1I7ZB 2WBWB 4QY8A 2NY1D 4CU8A 3HB3D 3PWPB 3NTCH 4APQC 4NN6C 4R7DA 1YY8A 4U6YA 2OL3L 4JPKH 3TNNB 1KN2H 1QHPA 1HXYB 5LCVH 3EOBA 2OMBA 5IBUB 5LJYH 2OP4L 4HXAH 3W39A 2AEWA 1D6VL 4OGXL 4P46D 3O3DA 4AEHL 3FB7A 2W0FB 3P73B 3MRHA 4U31A 2X2YA 3SDXB 5IEKB 4EN3A 1HCFX 3QCUH 5T3XH 5B39A 1WIOA 3UTTD 1HKFA 3OAZH 1ZLUK 1RK1B 2A0LC 1IAIL 3RFZC 3MFGB 4IMKC 1Q38A 4N0UB 3ARXA 4IDJH 1MFAH 2A77H 2VXSH 4R4BA 2PXYC 4DN4L 2VB5A 3DX9B 5FEBA 3WFEH 2R1XB 3EO1B 4OBRA 2CIKB 2V5MA 4ISVA 2AKRB 3T0EB 1MQKH 4JM2A 4O02L 3MRCA 5D96B 3MLUH 5F1NB 1I7TB 1N6VA 3D69B 3QEQE 5L0QB 3IXTA 4OCNC 1JPSH 1I9RL 5FA3A 2DQDL 3O4LB 4GAJH 5CCKL 4PJIE 3KAAA 4HXBH 5I1AA 4XBEL 4HJ0D 5CEXB 4QGYA 4WEMB 3FT3B 3O8XA 1FL5A 5K9OA 1ZS8A 2VSDA 2ARJQ 2DIJA 5LGKA 1WBXA 2JELH 1TNNA 1Q1JL 3F7YB 4IRZL 3O6MH 3E0GA 1S9YB 1JPTH 3GB7B 5ICYA 4TUOB 4KVNH 1CFBA 2ATPB 1IC1A 2C3GA 4NQCD 3O2VH 2DN7A 3ULVL 4G6ML 4OD3H 2F5AL 4DKAA 4FFVD 4M4RA 3LQMA 5EU7E 3X17A 5IP4A 1JGUH 3F7RA 2ADFH 1OPGH 2EDQA 4HUXB 2R1YA 3RI5K 1KCSH 5GS3A 2V9TA 3FFCA 2VXTH 1SEQH 1RZJC 2ZSVB 4H20L 3CCHB 4L4VD 3LOWA 3CC5B 5GS2H 2NX5E 4P57B 3KLHC 1T0NA 3PIQA 5KVGL 1TQCB 2W07A 3HZMB 1IFHH 3BPCA 2F54B 3T77B 4XZUB 3ILQD 2HYMA 1QO3B 3FRUB 1MFNA 4ZO9A 3QEUA 3GBNL 3T0BA 4IRJD 3MCKB 5ANME 2Q8BL 2WW8A 4ONFH 1IQWH 2R4RL 3KJ6L 2GJZB 2BVOB 3TCLA 3BP7B 1HDMA 2BOBB 5D7IB 4MZ2A 1IGTB 4X7TB 1C7TA 4EBQH 1L6ZA 3R4DA 2NXZD 4LHUG 2XFXA 2ZG3A 3ARFD 4YH6A 1UJ3C 2AAVA 3RVXC 1CT8B 3ULUH 1TPXC 2ADIB 4MJ5B 1PQZA 5KBNC 2BVUA 1QFUH 1Q9WB 4LSSL 4YDLC 2YKLL 4MNHA 4I77L 4P2RD 1M7IB 3KYAA 2YS4A 4NOBA 4NRXA 4R4ND 1C5BL 3MRPB 1TMCB 1WAAF 1IC7H 1WBZB 3MBED 2NY3C 1KEML 2CDFA 3UXFA 5JHDD 3UCRA 3ET9F 3G5VB 1B4JH 1X4XA 5CBAB 4I0PC 3H9SB 4NNPL 3U0TA 5I75C 3E6HB 1Z3GL 2VR4A 2OTWA 3MRIA 1HHGA 3RX8A 5DUBB 4G6JH 2OZ4H 2F19H 4LHUB 1A7OH 5TDNA 4LEXL 2ZUXA 5DJYB 3BO8B 1R5WB 5FF6A 4DTGL 1AHWA 2H9GA 1LNUA 2Z93B 1A1NB 2G5BA 2IG2L 1K4DA 2AXGA 2MSPA 2ARWA 2QADC 4ZAKD 3REVB 4XT1C 4ONGH 3L3DA 1EVTC 5BZWA 1QBLL 1F5WA 2CDEA 3MRFB 3HC3L 4UBDD 2BOCA 1A4KA 1XR8A 5DSCB 1EGJL 4C83A 5FHAH 1N26A 3V8CA 4J4PD 3SDYL 3UTPD 5FHBH 1S7TB 3W5NA 4G6AD 3HG1E 1H15A 3MOAH 3MGOB 3B5HA 1BOGB 4P49A 3C6SA 1CG9B 4D3CL 5HHOD 4JB9L 5HJ3A 1HKLH 4OGXH 5K93A 1EUTA 1EJOL 2B5IC 1ACZA 4GKNB 4MXVE 3GIZL 5KSAA 3MGTB 3SKOA 1UYWH 1A9EB 2AK4E 3C08H 5J6GA 1R5VB 2GCYA 2NY1B 4HUNB 3SDCC 5FGBA 1MFBL 4NM4H 1ZKAA 2VITA 1RZFH 1MREL 3T08A 3AVEA 2B0SH 2OI9C 4HJGB 3SDAD 2I07B 4ZOCA 2HRPL 4UT6L 3TT3H 2Z92A 4DKFL 1IJ9A 2AEPH 1S9XA 4XH2B 2N56A 1F8TH 2Y5TA 4M7ZC 4JN1L 2V17H 3IFPA 5DVLA 2R0KL 3C60D 3ZTNH 5GPRA 4AG4L 4OD1H 3V0WL 3NA9L 4NJAL 2XN9D 3X3FH 1INQA 4G8IA 3GM0A 4XNUL 3P40A 3TYGL 5IBTL 5IESH 4W70A 1TJGL 5JR1L 3QCTH 3QCVL 1Q1JH 1K8DB 1JVKA 1QSFD 1RUMH 3FL7A 1KG0A 1NSNL 1RIHH 1MFCH 3V7AG 3MUJA 3ULVH 5I16B 4G8GA 4P2OD 3T3ME 4N8CH 4KRPC 1NPUA 1CXEA 2DQGH 4XCNA 5D8JL 2XI9A 3VMNA 3KYKL 2YMXL 4K23H 1FDLL 3SJVA 3WXWH 2AV7A 3X13B 2OL3A 3DWTA 2D7NA 5DJZA 4LSPL 4U6VH 1CK0H 3ESVF 3S7GA 1U0QA 2E7MA 4J23A 4D9RE 4XNXH 3RKPA 3OAUL 1V3LA 3L3JA 4CMHB 5F7KC 3LY6A 4RFOH 4HULB 4YHIB 4L8BB 1HILB 1XR9B 4ZG1A 3SGEH 4FQXC 1H3UA 3KJ6H 2VZTA 1VFOA 1R0AH 4I18B 2OTPA 4L4VB 1NMBL 4JN2B 1T1XB 2VDQH 3VXSD 1MI5E 3OGOE 3MV8A 4GBXB 4HF5L 5FUCC 3ZE2E 3SE8L 1BZ9A 2BXZA 4KQ3L 3BX7C 5CP3H 2P24B 1XF5A 3FQUA 5E9DA 2Z9TA 4TNVK 3VRJB 1IEHA 7CGTA 4GO6B 1N5AB 4IRJB 4YHPA 3CFCL 1T21A 5CZKA 1ZHKB 5CGYD 5D2LE 3WNMA 2ICEA 1CXKA 2X4RA 1C7SA 4LIQH 5GRYA 4Z9KB 4U7MA 2NXZB 1JL8A 1R5IB 3O4OB 3ARFB 1BQLL 3OKNA 5D1XD 2J6EL 3BGMA 5GSRA 4WO4B 1FJ1A 1KXQE 2JCCB 1CGTA 1RUQH 4ZTPH 4Z7NF 1YJDL 4P2RB 3RIAF 3RPIA 3DV6B 3MBEB 2VDLL 2RB8A 3TF7C 2O5XL 4KDWA 4XNYH 3U9PH 3T4AB 1INDH 3LHPL 4JVPA 4G9DB 1LO5B 2QHRL 4G5ZL 4PJHA 5ICZA 3UO1L 3WDIA 4UDTA 1UCTA 3HRPA 2D3VA 1ACYH 2VDNH 3SDYH 1I7ZA 1G9MH 4ZDHB 2DDQL 3H3PH 3PWPA 5JXEA 4ZS7L 4ESKA 1QBML 1P4BL 3T2PA 3EYUL 5L9DL 2YD6A 4XP5L 1GC1L 4LOUD 2R9HC 5C0AE 3TNNA 4J3OC 1HXYA 4HGWB 1IVLA 5FGRA 3OB0K 3MXVL 4OLZL 3VDAA 2XXMB 2B8OT 5KAQG 2W0FA 3P73A 2CJUL 3HE7C 1FH5H 1A47A 4YR6B 3SDXA 1RZKL 4YHLL 5IEKA 4HCRL 3VU2A 3U7AA 5GJTH 4F58H 1CDGA 5I8KL 4U1NB 1W0VB 1MREH 1PEZA 2BRQA 3DXAD 1RK1A 1XF2B 2Z8SA 3S36H 2HRPH 4N0UA 5HHOB 4X6CE 4WHYG 3P4OB 3ARUA 3OKLB 3AM8A 1FHGA 1OARH 3HAEH 1O5DT 1OAZH 2VQTA 3DX9A 3A0OA 4QYOB 2R1XA 3EO1A 2CIKA 4XP9H 2AKRA 4JCMA 3T0EA 3SE9L 5E6IA 4R26H 5F1NA 1I7TA 3D69A 4NM8L 2IPTL 2JB6B 3JTTB 4L9DA 2VXUL 3O4LA 3SDAB 3C2SA 1VPOL 3R0MA 4P2CG 2I27N 5DD1L 3QUML 1WFUA 5CEXA 3TYGH 1RHFA 1QSVA 3VGHA 3FT3A 3OPZH 4ZFGL 3QCVH 1F2QA 5JXAL 1PSKH 3HE6C 2XNAB 3F7YA 1J86A 3NABH