5TE6H

Crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade ae strain 93th057 gp120 core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
223
Chain Sequence
b'RAHLVQSGTAMKKPGASVRVSCQTSGYTFTAHILFWFRQAPGRGLEWVGWIKPQYGAVNFGGGFRDRVTLTRDVYREIAYMDIRGLKPDDTAVYYCARDRSYGDSSWALDAWGQGTTVVVSAASTKGPSVFPLAPSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Identification of a CD4-Binding-Site Antibody to HIV that Evolved Near-Pan Neutralization Breadth.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 33
structure length 223
sequence length 224
ec nomenclature
pdb deposition date 2016-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H01
3X3GH 1FFOB 4WWKA 3FT2B 3FO2A 5A2KH 4Z0XA 4JDTH 5HHPA 1NLBL 3CAFA 3HNVH 1CGTA 3EW3B 4LPWA 3T3MF 2A77L 4RGMC 3SDXB 4MS8D 3BWAA 1FJ1B 4JN2B 3SE4A 1VACA 5JR1H 2P4AB 2VRAA 4M5YL 5J13C 4F7PA 2JIXD 3NZ8A 1FV1B 5GRJH 3BAEH 5GGSB 5F9JA 5AZEH 4UV7H 3VXNA 5LJYH 1U8KA 3MLZH 4XNMA 3T08A 4NCC1 4PV8B 2Z8RA 2NX5D 5EA0H 4PRPD 3LEYH 3P30L 2EDNA 3CFCL 1DL7H 1C16B 5HGBA 3WD5H 1ETZA 3R8BB 3I02A 3EDKA 4G8IB 4AH2A 5DMYA 1S7SA 2FB4L 1HEZB 4U4BA 4XCYA 1LNUB 4WWID 4YX2H 3VGAC 5CEXA 5KW9L 3VXUD 3ZDXE 2DIJA 3O3BA 3SGDI 1BD2E 5EO0A 3DO7B 2ESVE 4GT7A 2GQHA 4AEHL 3ZHKA 3IRZA 4HMDA 4P2QA 1AR1C 5BQ7B 4PJEA 1MI5B 1CDCA 2DLHA 5CJQL 3P4OA 2Q8BL 3E6FA 4JFED 1QFUL 2UY7A 3DV4A 5I1AA 4Y8AA 4UTBL 3F5WA 1ZGLA 1YPZB 4X99B 2BSSB 2HN7B 4HXBL 4RFNB 4NKQB 4QO1A 5DYOA 4G80B 4GKZA 4BH7A 1CU4H 1UXWB 4X6BA 2YMXL 5E08L 5KJRL 4PRBB 1I1CA 1IQDA 4WY7H 1K3ZA 1OT2A 1ZTXH 5D7JB 3U1SH 5D1XB 4ZSOA 4ZUUB 5J8OA 4N68A 3VJ6B 1IC5H 5TFSL 3O45A 1D3CA 1F2QA 3NN8B 1MCWW 2F5BH 2AS5M 2ITDA 1NKRA 2D9QB 2YPLA 4DK3A 4QTIH 5FK9B 1M71B 1SM3H 4KI5E 3E6HB 3VFUA 4QHUB 3QQ9D 1WWAX 3I85A 2ZOLA 4MVBD 4PY8I 2ZPKH 2HT2C 2DQIL 5ERWB 1YZZA 2FYYB 3QUYB 1V7NH 4HIIA 1QR4A 1H5BC 4ZOEA 3GSNL 4GXVH 1KPRB 1T83C 4N0RA 1LO4L 4ODTH 2C1OA 4C55A 3LAFA 8FABB 3FHQA 3M1BB 4ZFGL 3F7YA 3D3VD 1LEIB 4MHHG 3I50H 2E9JA 1AKJD 3V0VA 2DQTL 1CK0L 4PJXE 3VCLB 3REWB 3HE7A 3MQIA 1T6VN 2OTWA 3L5HA 3L3HB 3U9UA 3MBXL 5IV2B 3MRHB 1MWAL 2WUCL 2PW2B 1GOHA 1CLZL 1W8OA 4JN1H 4OFVA 1MJ7H 1BD2B 4DEPB 1U91B 5EOCL 3LKRB 1P7KA 4L4VE 5DUBB 1JI2A 2ESVB 3NGBC 4J8RB 5CP3H 4DGVH 3EYUH 4I0PB 4UB0L 3JTSA 1A1MB 4CN1A 1VADB 4QKXB 5TF0A 1M05A 3WNOA 1NCWL 2HMID 2EIZB 3O2DA 1MFAL 1CDBA 3RL2B 3OL2A 4Y19B 1LO0H 4E42B 3GSOB 4OLWH 3UJIL 4NN5C 3D85B 3GJEB 4FQQB 4NO0A 1FIGL 5C8JB 4NRXA 2EO9A 5DJAA 2O61A 5F1KC 2O26U 4HH9B 1QRNE 4CVXB 4F7MB 1GGCL 2B39A 1FFNB 4RMSA 25C8L 2PN5A 5GS0D 2XWBA 4HS6A 4HIJA 4N5UA 1WFUA 5IB3B 4DQOL 1G6RB 2BFVL 1UZ8B 4XCEA 2B4CH 1RV6X 2UZIH 1ZHBB 4UOW1 3KDMB 3ZMRA 4K9EC 4L8SC 4HIEA 5CGTA 4KUZH 5IBTH 1CYGA 4K7PX 1WZKA 2GITB 4J3OC 1S7RA 1N5AB 3QFDA 3NCMA 4POUB 1F3DH 1NGPH 1BJ1H 2CIKA 5FGRA 2ZUYA 3FT4B 4AMKL 3JWOL 5JNYB 4Z78A 1ORSB 5A2IH 3BEWA 1PG7L 3CCHA 2RCSH 4NWTL 4R2GB 2DD8H 3RNQA 4IRJB 3VXPA 1XGTA 2R0LL 4QHMB 1FFQA 5JO5B 1DQDL 4HAFA 2BVOB 2AJVL 4KGLA 3LKOB 1AGCB 4Z76A 1ONQA 4HX1A 3L5XH 4PJXB 1CD1A 3BPOB 1OAUH 4JGMA 1T21B 5L2KE 3O2WH 5ESVA 2ERJC 4KQ3L 4EUPH 5E1HB 3O6ML 4HIHA 5C0CE 1KXVC 4L4VB 2B5IC 4LLVA 1U8PA 1D9KC 4DFIA 3PHQA 1UCBH 3EJYC 1S5IH 4FA8A 5SWQA 1RY7B 5DMGD 3RAJL 3DOSA 3TYGH 3PV6A 1WV7T 4NQVA 5TQ0H 2FBJH 1RZIB 1ZAGA 5C0NC 3THML 5T33L 3UAJC 4WO4C 5F3BA 3MRIB 5L88H 2LAAA 5I1IH 1HHJB 1Q72H 3D9AL 4R3SA 4XMKH 2V5TA 1A6AB 1H3UA 1QRNB 1IAOA 2AK4D 4RMWA 5C0JB 4LKCB 3WV0A 3BP6B 1OGAA 1XF4A 2WWKT 1WBYA 3PGFH 3LEXB 4WW2F 5ETUB 1EUUA 1GGIH 3NAAL 4JO3H 2Z8WC 2VN4A 1I85A 4OLZH 1WCBA 2MQCA 3SY0B 5FHBH 2VH5H 3OR6A 3WMSA 1IMHC 4CDGC 4QNPE 2XYCA 3C5ZA 3I9GL 1MHEB 4ZODA 1ZA3B 1S7UA 1U8MA 3C9NB 1JHKH 2BNUA 4ENEC 4JFOA 1P84K 3NFPB 5C3LD 4NC1E 4WI9A 4AT6B 1VCAA 1R3LB 3QXAA 3SJVB 1D5MB 3TJHC 1KB9J 4X7FC 3O11B 4Y1AA 1ADQL 2NY0C 4LIQE 3GMNA 1NBZB 1YY9D 5CP3A 1CFNB 4EN3A 3RGVB 2F53A 3RBGA 4FZ8L 4PJBF 3S98A 2GSGA 2HTLC 3UYOD 1RUMH 5BZWA 2VZVA 3S36H 4Z6AT 3V0WH 5DUPH 2V2TA 4F37F 4F7CA 5A3ID 3QO0B 2X42A 3MRFB 3OZ9L 1UC6A 1Q8MA 3MLVH 3TPKA 3C8KA 3WHXB 5L2KB 4U1IB 2C3WA 2VSCA 5DJXB 5F6IB 4KROC 1E4XH 1AY1L 2VO5A 4R4FH 5C0CB 2C4FT 4J3VA 3KLAB 1KIRB 3QXTA 1JFQH 4NQCA 4Z0XB 1KB9K 4JFFB 5LBSL 2X70A 5DQ9A 1D7FA 3QPQD 3O4OC 3S35H 4HUUA 4J1UA 4HG4K 1Z0MA 2HLFD 1QBAA 3BWAB 4ODXA 3L9RA 3HI6L 4IDJL 5C07A 1JPFA 1VACB 4HK0A 4P4KD 4HWEL 3RTQB 3SOBH 5K9KA 1DTUA 5I18H 4F7PB 1JYNA 1Q9LB 4H0HB 4U3XA 3VXNB 4LSSL 5MHSE 2PR4H 4PJ5D 2IAMA 5ILTL 4U6HA 5D7LD 3TYFA 1CDHA 4URTB 4RFOL 1LE5A 4NN6C 3QI9A 3F12A 5I1HH 2NTSP 3RVXD 4EI5D 3HNTL 3OPZL 2X7LB 2BX5A 4WFFD 4AH2B 1IAIM 1MCBA 1UM6L 2ZOKA 1S7SB 3VFVA 4XCYB 3D18A 4G7VL 1MF2L 5FM8A 3PHOB 3TVMD 4HFUL 2YN5A 3X13A 5BO1H 1E28A 3DROA 4Q6IB 1CGSH 4CU8A 2V17L 1CF8H 3QUZB 1HYSC 5AWNL 1TXKA 1RUAH 2PUQT 2W92A 4XPHL 1KJ2H 1P4IL 1DBAL 3QDGE 1H8OA 2ADGA 3J8F7 4HKZA 3KLHC 1IEHA 2G60L 4NFCA 1YEIL 2IPTL 3ARBD 1A6UL 1AJ7H 2XQBH 3W9DA 5KSAA 4GKZB 4OGAD 1FC1A 1MCIA 3GM0A 1TPXC 2FATL 1UZ6E 3BD4A 4OM0L 3SQOL 2XN9D 2NXYB 5ALCH 1ZLSH 3CFJB 3BZFB 2APXA 5EC1B 3FN0L 2Q87A 1KXTB 3N0PB 1H3WM 3O45B 4FRWA 5DRXB 4WWKC 5C0AA 4QXGL 3O9WB 5DDHB 4WU7B 5JXEA 2WMPA 1IGCL 1T66C 3PDOB 2NY4C 3IDYC 1RZFH 4WFED 5FHAL 4LHUB 4ZXBD 3HPLA 3SE4C 3IDGA 1NQBA 4XAWL 1RUKH 2C3XA 3MMEA 2CGRH 4KKAD 1NUDA 2DKUA 3QULA 3TN0B 4DK6A 1I9EA 1WZLA 4BK5A 2HRLA 4UOJA 5ELIA 1CLCA 1UH3A 4JDZB 4P23B 1QQDA 43CAB 2HVKB 5L8JB 3F7YB 4YNYA 4JM2C 1DDHA 4GBXD 1R3IL 4BZ1L 2EDEA 4U33A 5KAQG 3HE7B 5DD5L 3VFGH 4OJFH 1TTUA 4U2ZA 3U9UB 4M43L 3AMKA 5FAAA 1LD9A 2R2CA 1OL0A 3TBWB 3QFJB 1QKZH 1YMHA 4R97B 4LFHG 4M6AA 1N3NA 4QXWA 1Y18B 2WNGA 1J1XH 2NY2D 3SDAB 3RI5F 2NR6C 2CLZA 1AD0B 2R2BB 2V7NA 4JZJB 4Y88A 4Z7NE 3CDCA 4R9HA 3JTSB 1UWXK 1U6AH 5ID1A 5DVMA 4JRXD 3AS3A 1TJHL 2IFGA 1KF9B 3QDGB 3AAZA 5KVEL 1IKFH 3CXHJ 4U3CA 2E6PA 3QIBA 2AEQH 4OZFG 2Y7QA 4NRXB 4G9DA 1Y0LA 3IGAB 4WFHE 5DJAB 2O61B 5D5ME 4KV5E 3PWLB 4RISL 3U36A 4LSVL 1G6RL 3OXRA 2FX7L 4M7ZB 1JGLL 2ZWLT 5DR5L 5JW5A 1I9RH 1RUPL 1OGAE 3KR3L 5EUOE 2Y6SC 5I30L 4HS6B 3LIZH 4HIJB 2H3NA 1R0AL 3GMMA 3M17B 3NA4A 3FONA 3OJVC 3V7AG 1WAAA 3O8XB 1OP3H 3WLWD 1OAYL 1G9NH 1I1AD 1MIMH 1F45A 4XBGB 1T2XA 1QO3B 1PY9A 2BRRH 3L3IA 3CLFL 1S7RB 4ZUSA 3QFDB 3TEUA 1ED3A 1ZVYA 1UACL 2NY6C 4KHXL 3VFNB 2VIRA 2CIKB 1ZANH 4H8WL 5HHQB 2XQYG 4P5TA 2YZ8A 3T77A 4Z78B 5E6IC 2FBOJ 1WZ1L 1TVDA 3X3FH 2ZCHH 1WFTA 4BKLA 4D9QD 3KYOA 2A74A 4YXKL 4NJAL 3HE6C 4ONHA 4Z76B 2NY1C 3EOTL 2CPCA 2JK5B 5CIPB 4HX1B 4CMHB 1EAPA 3D2UB 1CD1B 1KJ2A 4OB5L 4H25A 2DIAA 2VN7A 2Z9TA 3VFTB 4NJ9H 3TH2T 1IT9L 2DRUA 1P4BL 5ESVB 3BE1L 5I76A 1G7QB 4LPYA 1DVFD 3QQNA 4LLVB 4NQCE 5IW1A 3LQAH 4OIIH 2GJ6A 4OCXL 3RVUD 1F02I 1IGFH 1JNHB 5HD8C 3UDWC 5ITBL 1RU9H 1OB1A 3QHTC 3D0VA 5C07E 4HQQH 1Q9KB 3ILQD 5TJWK 5CLWA 1FRGL 1YDPA 2ZP0T 3MOAL 4K7PH 3N9GH 4NWUL 3BMVA 3IDMB 2RBLA 4KAQL 4YHKL 5D5MB 3LPWA 4W68A 3VWJB 3SDCC 2AW2A 4GO6B 4LSRL 1ZT7B 5K9OA 4TOYL 3TT3H 1JGEB 1MLCB 2UZYB 2CRMA 3QCVL 5EUOB 2B20A 4NOFA 1T1WB 4P2CG 5L2JA 3GRWH 1JWUA 1WBYB 4F7TA 2AGJH 5ACMA 3QWRA 2R9HD 4LSDA 3WNMA 2R0WH 4R90H 4M6ML 4LDLB 5DEZA 4DGIL 1NEZA 2VITB 3MNVA 5GGRY 2F5AH 4U1LA 1MFNA 3OR6B 1EJOL 5KOMC 1X5JA 1OD7A 2WBJA 2OXHA 5F6HJ 2FGWH 1YQ2A 4OZGA 1GIGL 4YXLL 1S7UB 5E2VL 2J4WH 5GGVL 4D0CA 4YO0B 1YJDH 2H32H 2BNUB 2HP4A 1JUFA 1UADC 4JFOB 5C09E 2CUHA 3GUTA 4HKXB 1HWHB 4QTHA 2VJXA 2PYED 3EOBA 3GMNB 2Y06L 1WIUA 3ARRA 3P0GB 4EN3B 5GZNC 2EDTA 5BZWB 3RZWA 4P46A 5D2NE 1UB6A 3PV7A 2NY5L 5I0ZA 4PJDE 3BXNA 5B39G 2V2TB 2E7HA 3K7UA 4KH2A 4G8FA 3B9KC 1OP5K 4DJMA 4XX1G 5E56A 1K8DA 4QRPD 3C8KB 4LVHB 5J9PA 3ZTJH 3VRIA 4R0LB 4WHYH 3L1OL 2X70B 4XP4H 5KN5A 1BBDH 4K07A 4EVNB 5E8NA 4HS8L 1TQBB 3V6OA 5CJ8A 1Q38A 5KVGL 1XZ0A 3NTCL 3L9RB 3QCTH 5C07B 1JPFB 3B2UC 3FN3A 4HK0B 5DQDH 3BVNA 3RL1B 5IK3A 4FQIL 4TULL 4G7YH 3NFSH 5IEKA 3GB7A 4MB4A 3F6LA 4N0YH 4DKDC 2DMBA 4JR9L 2W9EL 5ICXB 5IQ9A 2VDKL 4Y16A 5B3JE 5IB2A 4KPHL 5DVOA 4Z7UA 4D0DB 2YRLA 1LE5B 4PJIF 1J0YA 2WLYA 2YD9A 4L3AA 3QI9B 3D6GA 3RFZC 3GGWA 3C6LC 4XWGL 2WWMD 1MH5A 1U3HA 3ULUH 1OT1A 2DS4A 5FYLD 3BT2L 5C0DA 3AU1A 4GRLD 3TV3H 4TSAH 4LKXB 4L9DA 4FXGA 2WM0A 4LIQL 2AV1A 3X13B 2HG5A 4FG6D 5C09B 1FPTL 4PRNB 1MCHA 4CBPA 2VXQL 4NM4H 5FYKD 3KLDA 5IP4A 3ROOB 3B3IA 1YEGL 4XXDA 4HCRH 4HKZB 2ITCA 1RFDH 3V4UL 3WKML 1HDMA 5BRZA 4R8WL 1OHQA 4ONFL 5D2NB 4WI2A 3NH7L 5CZVL 4PJDB 2Q1EA 2FZ3A 4WRLA 5GRZA 2AI0H 1DQLL 2FHFA 4UILL 3NIFF 4ETYA 1ZE3C 3K4AA 1KJ3L 4QGTA 3HAEH 1TETL 4HSQA 3LS5H 3P0YH 2J3SA 4P2YA 5JW4R 3EUUA 1DQMH 5JIIA 3DHMA 3GI8L 3GRWA 3K2UH 1FNLA 2HFGL 4NKMA 5IGXH 1IJ9A 2C3VB 2XRAL 4RRPA 2Y9RT 3SKOA 3FMGH 4EXKA 2UVEA 4E41D 2B4CC 1NBVH 4QF1B 3VD3A 5F7DA 3QUKA 3QULB 4DVBA 3DLQR 2MKWA 3G6JA 3BKJH 2APVA 2H32A 5HDOA 5LGJA 1G7LA 3U0TB 4L9LA 4KVNL 1DEDA 4PJAF 1DDHB 1BIIA 3WFBH 3EOAB 4HJ0D 3BYTA 4JB9H 4PLJC 4PGBA 1YEFH 1UM5H 1FFPB 5I8CA 4CJ1A 3MA9L 5IIEB 3O4LE 4G6FD 3FRUA 2K7QA 4ZUWB 2ATKA 2DQJH 4FABL 4G8GE 4RFEA 3WIIL 3GSWB 1J1OL 1FGNH 4GUPB 3CUPB 4KTEL 2ZUSA 5CGYC 1AQDB 2XG4A 4NNPL 1PX3A 1A4KB 1KPVA 4PD4J 1L7IL 3QXUA 3H9SA 5HHME 4IMLB 5ITFB 1IGTA 3HNVL 1TITA 1HOCA 3D0LB 4U2YA 2VDLL 3JZ7A 4EQ3A 3MXWL 1BIHA 5CSGA 3QIBB 5JR1L 1MY5A 1XF1A 2VZ1A 1P9MA 4G9DB 4ZYKA 2ADIB 1BF8A 4HV8B 5GRJL 1X5GA 3U4EA 3BAEL 4GLRH 4U6VH 4JLRA 3U36B 5IBLD 1JMXA 1MFBL 5KSAC 3FCTA 1NCCH 1I75A 3G5XA 4TRPH 1FLRH 5JW5B 3MUY1 1MRCL 3HUJF 4XCNA 5EA0L 5LG1A 4O02H 4YFLI 4PTUA 2ZUUA 3KPNA 4R96A 5IHZA 2CJUH 1CZ8H 4PD4K 3FONB 5T3ZD 4UBDD 5IG7A 5K9JL 1VSCA 5EIIA 2IPUK 4LVOB 5LAXA 4I2XA 2J8OA 2FDBP 3ARZA 3ZLQC 5DHYA 1U36A 2A6DB 1JZ6A 4OZGE 3BI9X 1PG7W 2JB6A 2QQLL 4LCYA 1U8IB 1EGJH 3ZL4H 4K3HA 3MV9D 3BH8B 3QG7L 4JO4L 3O6FB 1EV2E 5DJ6B 2Z31B 1T1YA 3CPLA 5T1MA 3STBA 4HJGB 3VXME 1N5YH 2VIRB 3ZT5A 5DRZA 1FZJA 4MQTB 3TO4A 4P5TB 3CC5A 1D5IL 2X4UB 4NKOA 3QG6A 1NCAL 4U7KA 2X4RB 2ADFL 5A16B 2A74B 3S34L 4GKSB 1ZHLA 3V8OA 3TFKC 4U1MA 4JAMB 5C08D 1YEJL 4JG0H 4HCRA 1QRKA 4U1KB 4ETQA 4TTGA 4QRRA 3O4LB 5IVXA 2ZJSH 1U9KA 3QIUB 1S7TA 2HJFB 4G8GB 2XKUA 1MOEA 4WY7L 2CD0A 5I76B 1ZTXL 5IB4B 4YUEL 3U1SL 2P5WE 1UEYA 2NLJB 4Y4HB 5DEGA 2YEZA 2IQAA 4LRNH 3TGXA 2VDML 2D9CA 5FYJU 4RIRA 4I9WE 4PY7B 3ZDZF 1RZ8A 2F5BL 5HHMB 2D7PA 1DBBH 5C1MB 3V6OE 3E1F1 4OCYL 2QBWA 1A6WL 2FEDC 4BSWB 5GGQH 1CGUA 4UIMA 1SM3L 5T1KB 2H1PH 2R56L 4K7PY 1YDPB 4X6CF 1NGZA 3IFLL 4HBCH 3UTTD 5E03A 2ZPKL 2LAGB 3G5VB 4M9OA 3ZSSA 5K9OB 4NO2A 4TSCH 1XMWA 3QO1A 2D31A 3HMWL 4LVEA 5BV7B 1BX2A 5E8OA 3MV7A 1PW3A 3QUXC 2O5XH 4F8QA 4ZPTA 4MZ3A 1M1SA 2PYFA 2UYLB 1P7QA 3WIHH 4EDXA 3CK0H 3MNVB 1OTUC 3RUGE 3A6BH 2YSSA 3KGRA 4TQEH 5D9SA 2EDQA 3TZVB 4OZGB 1S78C 1XGQA 2DDQL 4LU5L 2VDRH 4JN1L 1NAKH 3VGDA 4KDWA 3GSXA 4BJLA 2P8PA 2CXGA 1BVKB 3H42H 3VXMB 2FNBA 2GJZA 5BVPL 1NGWA 5DC4B 2ZZUT 4M5ZL 4QTHB 2CDGA 4F8TA 4M4RA 4HF5H 3GBML 5EU6D 3EOBB 3NIGF 4OLWL 2BC4B 4OGXH 1I3VA 2BY2A 2R0KL 5E5MB 5IMOB 1C7TA 5BRZE 2KUTA 4P46B 5IVZB 3ARVA 4FQXA 1CFQA 4G8FB 1MQ8A 4ODUA 4NM8H 4X4ME 1K8DB 4L3EA 5LGHH 1S7VA 3C08L 3DMMC 1N4XH 4EUPG 2YXMA 2H26B 1DUYA 5D7IE 2I5YH 5ALBH 5BZDA 2G5BA 3VRIB 2P5WB 2X9XA 5SX5H 4V1DD 3L95B 5IT2L 2I26N 1IQWH 4N8VA 5JQHC 2UZIL 3LHPL 4JHBA 4PJ8D 1FNAA 1EEUA 2QADB 1YNKL 4P3CH 4TVPD 4QXTB 3SCMB 1XZ0B 5SWSA 1FNSL 5DS8B 4S1RL 3BN9D 3IJYB 1F6AA 4Z7WF 5IEKB 3GB7B 3ZDYE 1XIWC 1H3PL 4LLDA 4NHUB 5HGAA 4HC1H 4QYOA 4U31A 4B53A 4MQXD 2F54A 5IB2B 3G6JE 3GIVA 4WTWA 2J6EH 1WC7A 3GMLA 4J3WA 2RCSL 5I19H 2DD8L 3VWKD 1EXUB 3C5JB 4QOKA 2BY0A 1T7ZA 4PUBL 3RZCA 5IM7B 3MGTB 1E4KC 3FQWB 1A5FL 2W0PA 1RPQA 4WGWB 1ND0A 3OXSA 4NKIH 4X83A 3RUGB 4UAOB 4X9FA 1TLKA 4LLYA 4PP2A 4LCWD 2EIBA 4O9HL 4YWGH 1CICD 2BSTA 5J1AB 4KJQC 5I71B 1ZLWK 3TNMA 4OQTL 5I1KH 4FQ2L 5BS0D 1K5NB 3PL6B 5E2WL 1ITBB 2UVFA 3RDTD 4PJFF 5J1TC 3MOQA 2BVPB 4M7KH 1S5IL 5I74B 3DURB 2GTWA 3B3IB 4X4ZA 4XXDB 3MUGA 3MRDA 3HZVB 2ITCB 3Q1SL 2FBJL 2A2QT 1MFCH 3B9VA 2VC2H 3SKNA 1HH9B 5L88L 5BRZB 1DLFL 1WUNT 1BOYA 1JWSA 1QBML 1Q72L 1BBJB 3MFFB 4OSUH 4U1JA 2JJTA 4NQXA 4Z7OE 3X11A 2FECI 2VYRE 2ZSWA 1GVIA 1WTLA 1SY6H 4MQSB 4JM4H 3DYPA 3ZE0F 4F3FB 4Y0GA 2HLAA 4YPJA 5CJOL 3REVA 3CSBA 1D5ZB 5DWUL 5HY9B 5KSBF 3ULVD 2Z92A 2Y25A 3N1GC 5D7IB 4OZHA 3SPVA 1GGIL 5F89A 2I60H 2DMCA 5E2TH 4JO3L 5KOVC 4EKXA 4ZFFB 5BVJA 1T03L 1YYMH 4XI5C 3MBEB 2EDXA 3TT1H 5FHBL 1XGRA 5LXGL 1NMCB 3OKYA 1EZVY 4IIQA 5EOTA 1S9YA 4JQVC 4ERSH 2R4SL 1YNTB 5EB9A 4Y7MA 3S6CA 2X4OB 2XZAH 4O58H 4JRWA 1G9NC 3S5LA 2G75A 3AREA 3WIHA 2FHBA 1MAJA 2ICCA 4Q97A 2HH0H 1R3HA 1PLGH 1YYLL 1F3DJ 3ARGD 4GG8A 1ORQB 1PQZB 1BJ1J 5ANME 3G6JB 3K46A 4Y16C 1P53A 2H32B 2BNQA 3K74B 3STLA 2D2OA 4I0CC 1G7LB 2Q7YA 5J1SC 5C6TH 4YEFA 3DUHA 3DVNA 1UCTA 3DX7A 5IB1B 4W4NA 1XF2B 1XR9B 4PGBB 3EGSA 4LBEA 3WFEH 2NCMA 1VFUA 5I8CB 1M6OA 5DGQA 1U3HC 2VISA 3F58H 1PGRB 5MEPA 3FRUB 5IVXE 2ATKB 3ARFD 1HHKB 1RZJC 1QSFA 4ZPVA 5FM5O 4BFIA 4I4WB 4DKFH 1IGMH 2DYPD 4HIXL 4G3YL 4NZUH 4JFEE 5MEOA 3HC0A 4ZUTA 4S1SL 4CRPA 2F19L 4MD4B 1HOCB 5C0FA 4DKEH 4XNYL 1WISA 1BZ9B 2OJZL 2DIBA 3SDDB 3DVFA 3B9DA 4QXUH 5FA3A 4PV9B 3LQAC 1FNGA 5I18L 1NGXB 2V2XA 2JJVA 3C8DA 4M00A 4ZS6D 5DJDB 3SHSA 1NCBH 2YUZA 4XZUA 5IHUH 3FCTB 2EDDA 5DJZA 1WWCA 4KUCD 1FO0H 2YWYA 4X8JA 5E7FA 1FLTX 4XMLH 3RWJA 4K8RH 4PTUB 1O7VA 4KY1L 1JGUH 1NDMA 2XT1B 1YECH 3CIQA 4MMZC 4HC1A 5EIIB 1IC4H 5LAXB 5D8JH 1BPVA 1JHLL 5HYQA 2JIXB 4Y5XB 3TA3D 1JWMA 4BZ2L 5I1CH 4GAJH 4L8CA 3U9PL 1G7PB 3VRJA 1RUQL 4F7EB 5F7KC 3VRLE 1A1NB 3BP4A 2CK0H 4I0PC 2X1OA 4YK4B 1K4CB 1VFAA 1DBKH 4LOUC 4WEUD 2J8UF 4RAHA 5CMAB 1QBLH 3D3VE 5DRZB 1CF8L 1AHWA 3S37X 3RY4A 1HHGA 3QG6B 1AR1D 4M7LH 3P9LA 5ANMB 1NEZG 1L7TH 1YJDC 5MI0C 2XZZA 5FGSA 3EFFA 1GZQA 3T0EC 5FCUH 4KK9C 4L9LC 1IEBB 4U1MB 5J56B 2XY2A 1AFVL 3QIWA 2GK2A 5TF1L 1Q9WA 3MRKA 1I9IH 5IVXB 1MFEH 3IU4H 5B8CA 2VL5A 2BCKA 5ADPL 4IRZH 4NC0B 3H9YA 5DEGB 1W2KT 5F7HA 3PDGA 2IQAB 4LCIH 4JFEB 4RIRB 4Y4FC 3ME0A 2VXTH 3I6KA 3T09A 5BCAA 3O3DA 3VXOB 3W5MA 1C7SA 1QSEA 3WE6A 4LQFL 4DN3H 3HCVA 4NZDA 4H0IA 1R5VB 1T5XA 5FA4B 1NGZB 1RZ7L 3QPXH 4M93B 3U7WH 1JHTA 5CWSA 1F3RB 2X89A 5C0EB 4OLUH 1KEMH 2J5LB 1P2CA 1MLBA 5BV7L 4CJ0A 4GG6A 1DBJL 4YZFE 5EN2A 4N0UE 2MNUA 4R2GC 5LKNA 2QV2A 1Q9OB 2HT2D 3OMZA 5BXFB 1XGYL 5EU3A 5KSVA 5E8OB 2BVUA 1HXMB 1Q1JH 1RULL 4ZPTB 4GLRI 3CFBB 2PYFB 4LSTH 4KUCF 4JANA 1A9EB 1UQSA 3BKYL 43C9B 1CXEA 1C5CL 2DBLH 4KMLB 5I1LB 3OGCB 2VABA 4FXKA 1U95A 5EFIB 4FFVC 3IETA 5F7UA 3JV4B 3UTPD 3OKMB 3ULUC 1UWGH 2GJZB 2H2SC 1KNOB 2MPAH 3D3VB 3TO4C 5F1NB 1CVRA 4RA3A 2N7BA 4EJ1C 4LLUB 2GK0A 3D69B 3PWNA 4U1HA 3KHOA 2ZG3A 1R5WA 1RSFA 1MI5D 5JHLH 1JN6A 1A47A 5IW6B 4IRSC 3DUSA 3QRFM 1HQRB 1YUHB 4Y2DD 7FABL 3R8QA 1KCKA 5F9OL 4YHOL 2GY7B 3EYFA 1Q0XL 2ZUQB 4P49A 35C8H 3OKEA 4HPOH 3MR9A 3UC0L 1ZSDB 2ARJB 1DUYB 2OK0H 5BZDB 1IM9A 3G5ZB 3MA7A 3RX8A 2G5BB 2B0SH 2XPGB 2NY7H 1F8TL 2O5ZL 4LASH 3DXAD 4NNYB 1G7HA 3O3AB 4I18C 4KMTH 1I7RB 1MIML 1U3JA 1GC1L 1FO0A 2V9TA 2OZ4L 1IEAA 2R1YA 4KKLC 4NZJA 1JGVH 4RAVA 1YEDA 1D5BB 1A14H 3MV8A 5J12B 4HFWA 4QY8B 4GQPH 2AK4E 3OHXB 4D3CL 3IFPB 3IFNH 3RWHB 1EBPA 2BY1A 2Q7NA 1FL3A 5DK0A 5AZ2H 1J12A 1S7WA 4OFPA 4U1GC 2BHUA 4WGVB 4XWOC 4LLDB 1A3QA 1KC5H 2BJMH 1ZANL 4OKVA 4QHNB 2CDFB 2P8MA 4N0UB 5FKAA 5IFAH 4FZEL 3A67H 3PJSA 1YC8A 4U6XA 3GIVB 3WXWL 3FRPA 3CDFA 2DKMA 4X4YB 3UJJH 2MHAB 3IDUA 4FQ1L 2VZUA 5IMMA 3SDXF 1CE1H 3FHAA 2AXFA 2B2XL 3RVWD 4NSKB 1ND0B 1RVFH 2D4FA 2HFFA 1TFHA 4PGJA 4U1NA 2VDNL 4NJ9L 5FGBA 4AL8L 3VGBA 5IFHL 4PR5A 1LE9B 1JYWA 1QSFE 2VZ3A 4PP2B 1FNHA 4WUKH 1G7JB 3C60A 1DUZB 1NC2A 3FB7B 4OIIL 2VDQH 3FO9A 2X9YA 1HI6B 4Z9KB 2GTWB 4LP4A 3MUGB 4CAGA 1FE8H 3EJYD 1JF5A 3R1GL 3W39B 3HC4L 2Z0BA 3N1PC 4RGNC 2XWTA 1RURL 2VAAB 1A1OA 1SBSL 5IOPB 3PWVA 4KVCL 4U1JB 2OTUB 1MJ8L 3EO0B 4FQXC 3QDJA 4NZTH 4TSBL 3TT3L 4X6FB 1CWVA 1CFBA 1J5OL 5JDJA 1T4KB 3P0VL 3WFZA 2HLAB 2A6KB 2W0FB 3BH9B 3ARQA 3OAYH 1FSKC 2CLVA 5F88A 2Z92B 2EEBA 3IDXH 1SEBA 5F89B 1KG0A 3ZTJG 2R0WL 4N8CL 4F15B 3BHBA 1VA9A 4XC3L 4WHYG 1A4JB 4WI7A 1ZOXA 3GKWL 2QSCH 1XGRB 1AXIB 4OUUA 1OD9A 1YPZF 3WS6C 4IIQB 5EOTB 4X6DA 2FIKA 3VU2A 3ARDA 3QEUB 4IM8A 5HYSA 3GJFH 4PJ5E 5EU5B 3QZWB 2AK4B 2J4WL 1PYWB 5C9JA 3AREB 2XKNB 5DTFA 2A6IA 5ICZA 4WEMB 4R4BA 3S88L 5JOEA 4OD3L 3TNNA 1MJJA 4MXWH 1DN2A 3BO8B 4HLZH 4ENED 4JZNA 5KG9B 4XP6H 1HH6A 1QYGH 2PO6A 2EH8H 1I3GL 3BX7C 3STLB 5J6HA 3B83A 1JPGA 4OFKA 2ZCKL 4RMTA 2NY0D 3RU8H 3RZCC 3AGVA 4M1GH 4JJHA 1H8NA 2NXYC 2VISB 1SQ2N 3PWPA 1L6ZA 5MEPB 2HTLD 4MNQD 3JWDC 3WN5C 3L3GA 1QSFB 1MAML 2ARWA 3CD4A 2EZ0C 2IPKA 3GMRB 3O9WC 5MEOB 3MJ8B 3HC0B 3IF1B 2X4SA 4RDQF 5F1IA 2IH1A 5J6GA 4G43B 1WVZA 3MO1B 3MRRB 4L4VD 3S9DB 5I75C 1UJ3B 2YD5A 3HZMA 1T5WA 3BIBX 4RCAA 3QCTL 2UV3A 4YDVA 5DQDL 2XN9E 3MLSL 3TN0C 4KKBC 3VW3H 3VFMB 3ZDXF 3WL9A 5GHWL 3GSUB 2IGFL 4GG6E 1DSFH 2FSEB 1ZLVH 1LMKA 3NABL 2VLKA 1W0VA 2P47B 4P23C 3MTRA 4NRZA 4LSUL 3AM8C 1G7IB 4NHCH 3VXTB 1F97A 2OMBA 4R4NC 3BGFB 4ZAKA 3RPIA 5TH2A 2IG2H 1ACYH 5HGGS 1QRND 3HAEG 1TVHA 4B50A 4JPWH 2CSPA 1OWRM 1DN0B 3QP3A 4P4KB 1EUTA 32C2A 4A2MA 3PXHA 3OKDA 3A6CH 1RMFH 2HKHH 2ZG1A 5HYQB 4NRYB 1JIBA 1JWMB 2YD1A 4L8CB 5JTWA 3VRJB 2VDPL 4MXQC 3LVEA 4CVZA 4F33A 2A6JB 1IGIH 4PJ5B 1VFAB 5J3HC 2NNAA 1KELH 4FMFA 3V6ZA 1KIQB 3MLRH 2PF6A 4NM4L 1MCJA 4HCRL 4EI5B 3P9LB 1FHGA 3DRQB 5TGBA 3V5KA 4HEPG 1RFDL 4H1LB 1HYSD 3MLWL 4O2CA 2DICA 3BGMA 3LZFH 4FQLH 3LPGA 1MNUL 3HKFA 3LCYA 4OFYD 5ID0A 1S7XA 2AJXH 1N0XL 5DD3L 1LP9E 1NFDE 4KI5F 3KLHD 4HHAB 4JG1H 4GRWE 3VFOA 3QIWB 2ZKHH 1NAMH 5GJTL 2SEBB 3G08A 1BQHA 1H15B 5B8CB 1DE4B 4JRXE 5D72L 3RIAF 1NGYA 2A9NL 1I7UA 5MP6L 4ZDHB 2W59A 3CFEB 3P0YL 3KJ6H 5L2KD 3TBSB 1JJUA 1JVKA 1R3JB 1DQML 5F9WB 1EMTH 3B2VL 3QDMD 5BJTA 4HZLA 3MV8E 3FL7A 3TCLA 4WWKD 4PJXF 3K2UL 1TZIB 2E6JA 5FUZH 3TJEH 1FG2A 4UT7H 2DQUH 1CIUA 1FL6A 3WUWB 2XN9B 1FBIH 3FQXA 4XBPA 1JHTB 5CWSB 3FMGL 5H35B 2B8OT 1K6QL 2BHZA 2YD2A 1JPST 1D6VH 1KCVH 4MA3B 4GG6B 3LS4H 3MXVL 2R1WA 4WI4A 4GW5A 3KPSA 3GJFA 1FDLL 3GNMH 2I07A 1WICA 1TCRA 4N8VG 2QQQA 4RNRB 5DVNA 3BKJL 4YIQB 4ZQKA 1BZ7A 4D8PB 4HULB 5E94A 1MCPH 1ZGLP 3AFLA 1HYRC 4HS3A 1K4DB 5CEYA 1CGWA 4HGWA 4MD5B 2BERA 1YN7A 4JB9L 1VENA 4LSPH 2HFEA 4ZXBB 2VMFA 5D7SL 1QG3A 1JNNH 5MEQA 4PYGA 2IPUG 4FXKB 5CUSL 5L7XL 4LAJH 2VLJA 3IETB 4YPGA 4P57A 5ENWA 4LSQH 1SJVA 1F90L 1I7ZB 5GIRA 3ARUA 2FEEI 2MCPL 4GBXB 1JNLH 3BMWA 1AHWC 5F96H 2FR4A 1S3KH 5HXMA 3PWNB 4OFDA 4P2QD 5F70A 3FO0L 4OZIA 1J8KA 2XFXA 1R5WB 4JKPH 1EK3A 1ZGLM 3K1KC 2VLRA 2FX9L 1LP9B 1NFDB 5C2BL 2NY2B 4GRWB 1NCCL 1YEHH 3RWEA 2JJSC 3F7RA 3EDJA 3ESUF 1LHZA 3MR9B 4JRXB 3RPKA 3MRNB 2IADB 4YHNA 2OLDA 3O2VH 1IM9B 5AUMA 1CZ8L 5F7FA 1JZ7A 2Y6SD 4N5EC 1A7NH 2XACC 4U1SB 3MYJB 4RAVB 5GS0L 4XP9H 4FN0A 3G6AA 2NZ9D 4OIAA 2DM4A 3ZL4L 1DCLA 3SGEH 1FL3B 4MAUH 2YPLD 3D39A 1S7WB 3W11D 5GGUA 2EDJA 5FUCC 2YK1H 4YDJB 3VA2C 4HUXB 2P8MB 2NY6D 3GM8A 1W0WB 1I1AB 4YEEA 4XNXH 5EBLA 5FO9B 3IVKA 2K9UA 3L6FA 5MHSD 5IMMB 1I1FA 3HFMH 2AXFB 5EWIH 5EOQL 1CLOL 2QHRL 3DX6A 4FFZH 5E6YA 2HFFB 3S5LG 3VFSA 2EH7H 2HJKB 5IJKA 2COQA 2NY1D 2DQCH 2N7AA 1CE6A 4R0LC 1X4YA 3HE7D 3C60B 3VH8G 3HS0A 1NAMA 3ROLA 3RQ3A 4HJJL 1R3KB 2XZCH 3DARA 1NCNA 1JTOA 4Q6YA 3BZEB 3ILPA 2PTTA 3DSFH 2VZOA 3MJGX 3BKMH 2B1HH 5HD8D 2PW1A 4QRPE 5E4IA 3NCYS 3P77A 2XWTB 4LNRA 4QNPF 2D3VA 4HUWB 1JPSL 3O6KH 4ZNEA 4DGYL 2FWOB 4YAQA 3D25B 2ZG2A 4YC2B 4NO0D 3MLXH 4TSCL 4GAYA 3OKLB 1MUJB 5DA4A 4Y5VA 1F4YL 3QH3A 2GCYA 1SEBB 2YUXA 5DFWH 3GSVB 1KG0B 5AYUL 1Q0YH 3BHBB 5LCVH 1V05A 1V3LA 3WIHL 2QQNL 4PJIB 4OUUB 3VG9C 1K8IB 4K8RC 1IGJA 4TQEL 4OZ4A 2CO7B 1PKQA 1QR1B 2VDRL 5MERB 1NAKL 4Q0XH 3TWCH 3Q3GA 5ICZB 1WCQA 3TNNB 1MJJB 4XCCH 1LK3H 3P3YA 4JZNB 5D1ZA 4JFDA 1AGEB 3IFOB 1MCSA 4P4RB 1YEEH 5J6HB 4OCWL 3VE0A 5FYLE 2OP4H 5D2NC 2NQCA 1D5XA 1OSPL 4YGAB 4MSWA 3HMXH 2GTZB 2KH2B 3MRPB 5GZND 1ZT4B 2HT3D 1Z5LB 3OKKA 1UEMA 3HTLX 5C3TA 1ES0A 2YPVH 5FF6A 4LHJB 3BESR 1E6OH 1N4XL 5HYEA 5ALBL 2A0LC 2BMKA 1EEYA 3W2DL 5ICYA 4MNGA 2X4NB 2X4SB 3VMPA 1M4KA 1IQWL 4FP8L 2IH1B 4POZC 3DWTA 2N56A 1FVCA 2Z4QA 4NYLB 5FO7A 1IGYA 1AD9B 3WIFA 3WS3B 3FTGA 2I25N 1JZ3A 1A7RH 1KUMA 5CD3B 4QRPB 1XCTB 3ZKMC 4PLNC 3WL9B 4WNQB 4POYA 4NQDA 3LKPB 4KRPC 3KPPA 3RWGA 4XNZB 3OB8A 4I48B 4X0KB 2AK1L 2WIMA 5GSRB 1KTDA 3AROA 5BOZG 4F57H 1JRHL 4IOFC 1QA9A 2EKJA 2ZUWA 6FABL 5I19L 4XH2A 5JHDA 4NT6A 2BDNL 3TM6A 5I8EA 2VE6A 32C2B 3B4NA 1OGAD 4U3HA 5I2IB 4K2UH 3QCUL 5D1QA 5A1AA 4E0RA 3EDEA 4ZFZB 2Q86B 3B43A 3LN5B 2HT4D 5K33A 4PREB 3E2HC 2CRIA 4V2BA 3ZZ1A 4YWGL 3CFDA 3CSYA 3PNWA 4CVZB 1QHPA 4HLJA 5HGHA 1UZ6F 2AERT 2X4PB 1N6QL 3C5ZD 3V6ZB 3GI9L 4CNIA 2Q20A 3P9MA 1OCWL 5EG6C 2NW3A 4J12A 1IAIL 2V7HB 4L29A 1EHAA 4X7EC 2EYTB 2PO6C 3ARSA 4M7LT 4O2CB 3BGMB 4ORGB 4AENA 5ID0B 1NGQH 3JTTA 5CKAA 5H37G 5BMFL 2M26A 4Y1AD 3P4NB 4EN3D 3V6FA 2F53D 5H2BA 4RZCA 5GGTH 1LK2A 4CW1B 3H0TA 1OM3L 1RHFA 4R7DA 2NYYC 3UZQA 2VWEC 2H45A 4P3WA 1DFBH 1A9BA 1MEXH 1X5XA 1P1ZA 4AYFA 3DV6A 4A6YB 5ACZA 4HT1L 5INCA 5SWZA 1AGDA 3ELAT 1YYML 3BQUC 1TZGH 5EULV 4TNVK 5BJTB 1CG9B 3TCLB 5I1GL 4KZEH 3OX8A 2AXHA 2QQKH 4NQCD 3T0BA 4K94L 1RIUH 4XXCA 3EDFA 2XZAL 4EIGB 4EIZC 3D39E 5DD1H 3FQXB 2DWDB 3OKNB 4XBPB 1INEL 3B8SA 2ZSVA 1RQ5A 3I2CL 5C07D 1HHHA 4UNVA 1HHIA 1H3VA 1TTFA 1V8HA 4K3GA 1TCRB 3MRBA 4X7SL 4ZQKB 2OMNA 5E8PB 3EOYG 5CJXA 5LQBH 1EPFA 4HS3B 4H20H 2IAMD 1K2DA 4HGWB 1N59A 3VFRB 1BOGB 4Y4KA 2GKIA 2QSTA 3WFEL 3IJSA 3NCJL 4PS4L 3QI9D 1F00I 3U48A 5D5MF 4ZNCD 1A3LH 5INDA 3HMXA 4H5SA 5I9QB 4MJ6B 3BIKA 4OTXH 1JF6A 5JORA 2VQTA 4NZUL 1YN6B 4WW2A 1PDKA 1EO5A 2FJHA 5GIRB 2Y5TB 2DQFA 2E27L 4BQ9A 4P2RA 1J0HA 4MJ5B 1FH5H 4WV1A 1B3JA 1MQKL 3WKNA 1N6VA 4QXUL 1WWWX 1IE5A 4G6FB 2XFXB 2YPKB 3WFCL 2OSLB 4ZNEE 1Z3GL 1HN1A 5JMOC 5C9KA 3V6BR 2YA0A 4OF0A 1I7TB 3VGEA 4A2LA 3RWEB 5BV7C 5JW4N 2V2WA 3WFDH 4Z7WE 3H3PL 4L4TA 5KSAD 4JQXA 1M7XA 1V5JA 4U05A 2AV7A 3DBXA 2R2EA 4NNXA 1YECL 5DF0A 1F58H 3RI5K 1IC4L 4GW1A 3TZVC 3O3UN 4PGEA 2X9WA 4HW6A 4PJ9C 1EEQA 1PKQE 1XF3A 1MCFA 1BGXH 3RWDB 5C0AD 5EIQA 1S7QA 1BVLB 1C08B 2WBWB 4O4YH 2D7TL 5A2LH 4BQBA 1UKQA 3VG0H 1P5VA 2AQ2A 3SKUD 1XGPA 5JXED 2OI9C 3H3BC 4OQ1A 4QRQB 4X6EB 4GSDH 2Q76B 3ZKXB 4P5MA 2J88L 3UBXB 2DBJA 5GRYA 4ZFOA 1BQUA 4I77H 4K9EH 3SGKC 2A73B 3SGDH 1IL1A 4ELKA 2OL3H 5EC2B 3L6FB 5FCUL 1FNEB 5JPNA 4X7TA 5HJ3B 4CN6A 2O5YH 4RQQB 1N2RB 5FDWB 5JZ7C 1MRFL 3MV9B 2KZ1B 4JGUA 4JPKH 3VFSB 2ENYA 3TFKD 4JREC 3CZFA 2KKQA 2MMXA 1Z6JT 4HZAA 4OD1H 4WI3A 5D6DC 5GISL 2AKRA 2OXGA 4JDVA 3VXRA 4OV5B 4XAKD 3HZYA 4G6KH 3ZE0E 1ZT1B 5GGTA 4O2EA 4CGTA 3PP3K 1DQQA 3SCMC 1ODAA 5C08B 3IKKA 4YHLH 5F21B 3KYAA 1FZKB 2UUDK 3JWNC 4DN3L 4AM0A 4PRHA 1ZK9A 2KL6A 4L8BA 4DCQA 3MRCA 1RAMA 4GOSA 4NN7B 3KS0H 1KEML 4OLUL 5CSZB 4YAQB 1I3UA 3KLSA 1SYSB 3LKSB 1BEYH 3UX9B 4V1DE 5L9DH 2ICWA 3CDGA 1EDQA 4F2MB 4Z7WB 2JTDA 3MROA 4GS7B 4TVPE 4XRCB 4Q74A 2OX5A 1Q1JL 3K1DA 2Z91A 3F7VA 1KB5B 1RJZB 3UPCA 3LN4B 4UAOC 3SDYL 4P3DB 4DZBB 2ADJB 1WBXB 4F9LA 2PXYA 1GL4B 1IGJB 2X44D 5HVFB 5IR1A 2FLRT 3PL6C 2DBLL 1PKQB 3S3PA 3F65A 4CADA 4M61A 4K23H 4NUGH 4LGRB 3DUUA 1WIPA 4FQCH 4O5LH 3P11L 3T0WA 1H5BA 4PRAA 2XA8L 2P8LB 4UT6H 1UYWL 1SJXA 3DI3B 3I3EA 5D1ZB 5JOFA 3KYKL 2BVQA 1RIHH 1NDGB 4G8EB 3VE0B 5ISZA 1D5XB 2AEPH 5TDOB 4P5TD 3SGEI 2WP3O 4MSWB 5HYIA 4EI6B 2EYSB 3QXDB 4YR6A 5BS0E 5TDNA 1G1YA 2HRPH 3OKKB 3O3EA 1B0GA 3X12B 3RHWF 1F4WL 1IKNA 3H6JA 1T20B 3VA6A 3KYMB 1HZHH 1URLA 5B3JF 1EEYB 1D6EB 3OJMB 1RD6A 4P2OC 4UV4L 5DFTA 1IRAY 3GHEH 2E8YA 1FVCB 1OQOA 3DRTB 1A14L 1IGYB 2GJ6D 2IH3A 3FTGB 4OZFH 3UTQA 2FJFB 4X8XA 3IFNL 4WENB 2FO1A 1IBGH 3QQ3A 2C9AA 1PBYA 3X17A 5AZ2L 1RZGA 4JPVH 3ALWA 5HYJA 3ULVE 1XF5A 3HLAB 5HPMA 4V1DB 3L5WA 2R2HA 1KLFA 4L3CB 3SE3C 1KBGL 4PJ8B 3GMPA 1T0MA 4S11A 4XH2B 2MOVA 1KEGH 5DHVH 4NT6B 1OARH 5DT1H 3ZYOA 3T65B 5KZCB 4N9GA 1GOFA 3JV6A 1U93A 1BAFH 3QWRD 3MCKB 2OL3A 3WEXA 3NFNB 3CFDB 4ODHH 5KSUA 5B21A 5FUOL 4C58B 5F8QC 1OF2A 2VDOL 3U2SB 2WBJD 1KCSL 4YGVA 3VWKB 5FYLL 4BSJA 3SDDC 2VR4A 4CNIB 1UXSA 1WAAF 4P2RE 1RK1A 1CD9B 4L29B 3OR7A 3QHFH 1CXKA 3LKNA 3LRSB 4JHWL 1MRDH 2YA1A 2Q6WA 1S9KC 5DK2A 5EZIH 1CICB 4MMXC 4MQ7B 5CEZE 4YHIB 3UPAA 3V6FB 4A6YL 5BS0B 1RI8A 3W9EB 4RZCB 2VXUL 2ZCLL 5DJ0A 3DVGB 2AABH 4NZTL 4FS0A 3BD5A 4P46D 2DLEA 1HILB 4PRDB 1OPGL 4HPYL 3ZE1E 1A9BB 4MS8C 5FYJH 1A6ZA 4P9HL 1G1CA 3QR2A 4GAGH 1D9KA 5D93B 1KCLA 1CLYH 4G42A 4E9LA 1DZBA 2YKLH 5D96B 3CVIH 1HXYB 2R8SH 1DLHA 3NOIA 2DOCA 2R23A 4UQ2A 4LLMA 1TMCB 3BPCA 5F7NC 5I6XC 5IESH 4XI5D 4WO4A 3Q5TA 4JFHD 1FAIH 3DYMA 3UJTH 2E7BA 2NW2A 1FVEA 2M1KA 2WUBL 2ORBL 2QADD 2AQ1A 2BRQA 1MCOH 1UM4H 4XB7A 1KTLB 4XC1L 4MXWL 4MA7H 4OM1L 5IF0A 3Q6GL 1NL0H 4ZMAT 3EO1B 3RWIB 4XP6L 1QYGL 3WLBA 4JY5L 5E1AB 4GRMB 2VLMD 1N59B 4Y16D 3RU8L 1FN4A 3VXQB 5IWLA 1M7IA 4AEIH 4PB0L 5CHNA 2LU4A 4XNQA 5D1QC 3V4PH 1CD0A 3LRHA 2HWZL 4MAYA 4NPYA 1H8SA 1ZLUK 5C0BA 1U3HD 3VXRE 1HSBA 5LWYL 4Z5RA 5ECJE 2FJHB 5DJYB 3CZJA 4K71C 5HVHB 5T3XH 4P2RB 3BP7B 3WFHB 1IM3B 2A38A 4M93C 4PRHE 1AQKH 4NUJA 2J5LC 1BFSA 3UYRH 2D03L 3ARFB 4M3KB 4OAWA 1CXFA 4PTTA 1YMMA 4P59H 4OZGF 4DZ8A 3VW3L 4S0SD 2AJYL 4M1DL 1F5WA 5CCKH 1QZ1A 2DYPB 4OZFA 4ZOBA 1A7PL 5BRZD 2V2WB 3L3JA 3BPLC 2MQ3A 4ELMA 2E7CA 1KSRA 2EKSB 4LPUA 4YDLC 2IG2L 3UO1H 1ACYL 4L5FH 3SE8H 4XVJH 5I66B 2R0ZL 3QQ9C 4K3JH 4HXAH 3IDJA 3ZKSD 4JPWL 2WZPD 3SO5A 1KPUA 1S8DB 2GUOA 3A6CL 3L7EB 4RGMB 2HKHL 2AJSL 4F80A 4MA8L 4KHTH 5DHVA 4JY6A 2NY3D 1GJIA 2LTQB 3L7FB 4JKMA 5TPWL 3STZA 5IMLB 3U4AA 3QSKB 3CLEH 2B1AH 3IS1X 4ZD3L 1XGPB 3MCG1 5KVFH 1LEGB 3LV3A 4P9MH 5DRNB 1WJ3A 1R24A 2FL5A 4FXLA 4JO1L 4ZTPH 5B38A 2YD3A 5T1LA 4KRNA 5FYKH 2ICWI 1IL1B 5ESAA 3TA3B 2XZQL 1T1XA 4X7TB 4Z0BL 2W9DL 5IMKB 4JRYA 5T5NF 3BPNC 4Y4KC 4Z8FL 3MOBH 1EHLH 3VGAB 2HMIC 3CZFB 4GKOA 2I9LB 1CGXA 3MGAA 1PG7X 3TBTB 1HCVA 1ZVHA 6CGTA 1EFXA 1L6XA 4JDVB 1A8JH 5EZLA 5HTSA 1T7XA 1PSKL 2DQEL 3FKUS 2EDLA 1YNLH 2XNAB 4OLXL 4WW2C 5H94A 1FZMB 2F8OA 1B0RB 4YHMH 1NC4A 4OCRL 4GW4A 4RBPH 5TDPB 1EMTL 3PG2A 3HI5H 1MCCA 1FG9C 3KPRA 1JV5A 2AJUL 2DLFH 4WV1C 4HWNA 4JFXA 3H9SD 4PRHB 4MLSA 2IMMA 3V5HA 2DQUL 4Z18A 1GPOH 1FBIL 3MRCB 2E6QA 3OJDA 4GMTH 1VGKB 4HKBB 4UNTA 4U0RC 1NSNH 3U6RB 3GKZA 1KB5L 1J1PH 3OB0K 5LGKA 4KQ4L 3TBVA 1GYAA 1B2WH 5F44A 2B7DT 4XGZB 1FGVL 1NLDH 3LKQA 3N06B 3WCYA 4LNVA 1AH1A 3DGGA 3MRJB 3E8UL 4JQXC 2Z91B 5HHNA 4BQCA 5L8LB 1JRHI 1AP2B 1JNNL 1NKOA 4FQJL 1AXTL 4UUJA 3SKJH 1RZKL 2Y07H 3OKOA 2EICA 4LLQA 3V52H 4JZOA 4OCNC 1U8LA 1II4E 1AO7A 3OV6A 3HPJB 4TPRH 4WHTA 2IC2A 3LMJL 3WDIA 3NA9H 5D7IF 3CXDL 4FFVD 1ZLVK 3ES6A 3K4ZA 3ULUD 3MGOB 1BJ8A 1EEZB 5JOFB 2DQDH 4NQSA 2FLBT 1X6NA 2CR3A 4MJ4A 4YFEA 4JM2A 1ZA6A 4WEBL 3TO4D 4HMCA 4UDTA 1EX0A 3ISWA 4YQXH 2R1XB 1IAII 4ZUVB 3OAUL 5TDNB 3VFPB 3ETBF 4ODWB 2D0GA 4M4PA 1W72B 2VXVH 1WEJL 2AJZB 1B0GB 5DMGC 3T4AA 3ZDYF 3LSOA 4UIKH 5I8KL 2IQ9H 3IDIA 3BW9B 5DJ8A 5B39A 2IFFH 4PGCA 5DMIL 1MCRA 3G6JF 4H26B 4QRRD 1DP0A 1HQ4B 1QFHA 2GEEA 5D6CB 2P1YA 1X7QA 3FOLA 1MCLA 5I1JH 3KNBA 1BZQK 4Y2DB 1FORH 4NN5B 3QB7C 1A0QL 3UTQB 3LDBC 1J10A 4J3SA 4Y5YC 3MJ9H 4W81A 3S96B 1TZHB 4OF3A 1V3MA 3H7BA 1F13A 1ZHKB 4MX7B 1U8HB 4N0FB 2ATPA 3FQRA 4TVPL 5I73C 4LRIC 3DXAB 1OW0C 2BXYA 2LE9A 1QVOA 3BZDA 3K0WA 5GRWA 4XWOD 5EU7C 5GSVA 2H6PB 1A2YA 4PGDA 1V3KA 1JK8A 2JELL 3VD9A 3QBTB 1S5HA 5JW3L 1KTKE 3RA7H 4APQA 1JF1B 4L8SB 2EH7L 3A0OA 3T1FB 1HKLH 1U8JA 4F9LC 3MV7D 4B7LA 2PXYC 3WEXB 2BSED 4OD2A 4QCIA 1AXSB 2R69H 4Z7OF 5ESQB 4S2SA 4OF8A 1UB5A 1YY9C 1P7QD 3B5TA 2P24B 1OAXL 1OF2B 5HDQH 3OJ2C 4WI5A 4GXUN 3NCFB 4YGVB 2RR3A 12E8H 1A6TA 2OR9H 3BOVA 1UJ3C 1UXSB 2XZCL 5FCSH 2NTFA 5E6IA 2CXKA 3Q6FA 1OAQL 4ALAH 1RK1B 2DJ4A 1SHMA 1IZKA 5E6ZA 5CP7A 3MJ6A 4DW2L 4F9PC 2JKXA 1RJCA 3LKNB 4MNQE 3PP4H 3HE6A 1XCQB 4HUVA 3EJZD 3FQUB 3ZKND 1NFKA 3O6KL 4LLWB 2HVJB 3AMLA 4YHZH 4RGND 1GGBL 4MNHA 2OQJA 3ULUF 3HZKA 3RVTC 3QPQC 5DC0A 2ERJB 3O41B 3DX9A 4ELME 1BJMA 3MLXL 1SEQL 2AJ3A 4FQXD 1IKNC 1NLBH 1MHCB 3KAAA 1H3XA 5EBWA 2B5IB 5FB8B 5I15L 1KLGB 4KK5D 4G42B 1MHHA 1Q0YL 1TIUA 4L3ED 3MLYL 2H9GA 2YC1A 2XV6B 5CKGA 3UDWA 4D9LH 2DL9A 1AGFA 1YY8A 1B9ZA 1DLHB 3PUCA 4M5YH 3V7AE 1BLNB 1U8OA 3N85L 1M7DA 3ULVL 3P73A 3C09C 4WO4B 2F8XC 1JPTH 5CZXD 1KCRL 5IVXF 4JCMA 1CFVL 2IANA 5DURD 2IBBA 3NPSC 2YRPA 3PGDA 3RVXC 3SDCA 4EZMA 2KPNA 5SWSD 4G9FA 1DQJB 4YBQD 1XFPA 4I8DA 3SE9H 1LK3L 3KPMA 3RY6A 4MWFB 3DHJA 1FL5A 4NO3A 1J86A 2CLRA 5CILH 4BFEA 4GAFB 3HRZA 4TUKL 3WLBB 3ALXA 5FM4A 3TF7C 2FB4H 5C0IA 4ISVA 4OI7A 4X6CA 3TVMC 2F54D 5KW9H 4JRYE 1M7IB 3T2PA 4QOKD 4AEHH 5FFLA 1J87A 1P6AB 3RZCD 4NPYB 3EHBD 3DETD 4UDUB 1QFOA 3NVQA 5I17B 4P5KA 4C56A 1KIPA 2R39A 3QNXB 2Q8BH 3ARBC 1XAUA 3GSRA 1QFUH 3HR5A 5HHOA 4PRIA 3TPUA 4WI8A 4OGAC 2NY0B 1N26A 4G6ML 1UFUA 5CEZL 2AP2A 2NXZC 1C5DA 5TE4H 1X5YA 3KPLB 3ZT7A 4MNQB 1QLRB 4ODVH 4OAWB 5F7EL 5E08H 4QRSA 3AS0A 3VRLF 5DZOA 3B9KA 1KT2B 3MRMB 1SYVB 2Z93B 5FECB 1T22A 4WUUA 4EOWH 4OZFB 4KKBD 3EFDL 4LEOA 5ADOL 1G9MC 3MJ9A 5TFSH 5SV3A 1I8KA 1UKTA 4ELMB 1QFPA 2GY5A 2YS4A 4O2FB 5L0QC 1AR2A 2XKSA 3QDME 3WXVL 1WWBX 4ZXBC 5IROC 1Q94B 4R7NB 5K59E 4L4JA 3IDJB 4R4ND 4KXZI 4B7IA 4ZTOL 1ZHNB 4MA1C 4X4XA 4KKAC 2CDEB 4M03A 1KPUB 1TVBA 2GUOB 2M2DA 2WINA 3L3OB 3TIDA 3VGFA 2DQIH 1CDGA 1JYXA 3T4YA 2DQGL 3QYCA 2WIIB 3GSNH 4Q9RH 3K8KA 1OSZB 3UTZA 3T04D 3I75A 1DBML 4MXQD 1LO5A 4ZFGH 4M1CD 3GK8H 3ARED 3BSZH 3EYVA 5CINL 1S9WB 5T1LB 4NN6B 5E00A 1B6DA 5DI8A 5ESAB 3T8XB 3DJ9A 3FB6B 5FOBA 5IB5A 1HWGB 1G0XA 5JDSA 3MBXH 3C6LA 1REIA 2NY2C 1XR8A 1MWAH 5DEFA 2WUCH 4JRYB 4BH8B 2BNQD 5IWLC 1J88A 4KZDL 5EOCH 3HI1A 4NBZB 3BRGC 5GGTL 1T3FA 2XWJA 5M95B 3ZYIA 1U3ZA 4MAYC 4YZFF 1DFBL 1EFXB 1MEXL 5GRUL 1KTRL 1FYHB 1MHPL 1NCWH 1QFWL 1MFAH 4XX1E 3EAKA 3DYOA 4P2QE 5GRXG 4JY4A 1BQLL 4PJEE 1H0DA 1QSFD 3UJIH 4MCZA 2V5YA 4QRTA 1FIGH 15C8H 4OLVL 5DSCA 1A6PA 4KZEL 4JFXB 3NCCB 2DI9A 1GGCH 5C70A 4R6UA 2QSQA 1WQVT 5LVEA 2E7LC 1VKXA 1I8IA 3BDYL 3WLWC 2C7UA 1I1AC 2DWEB 4NIKB 4UT9H 1TPXB 4Z7QE 1TNNA 1ZEAL 1JYVA 3NZHL 2BSRA 2EDKA 4XNUL 5E99L 1J8HA 2BFVH 3FFCA 5HYFA 4JFPB 3UZEA 3DNKA 5A40E 5FKPB 4ZSOE 1CFSA 3QDMB 3F62A 4NDMB 3S3JA 5LQBL 1UVQA 4H20L 4P99A 4K7FA 4WWKB 4GQ9L 3FO2B 3MFGB 5HHPB 5IFJA 2YPLE 4TTDC 3CFKA 1CTOA 3IDYB 3EZJB 3BISA 3OKOB 1F4AA 3HG1A 2UWEA 1J9CT 3FZUC 4OTXL 3NZ8B 2APFA 3FFDA 5F9JB 4NWTH 1U8KB 4XNMB 3RKDD 4OZHF 3G04A 1DQDH 2AJVH 1KN2L 4NQSB 1VEMA 1W72L 4HH8A 3QJFA 2IWGA 1DVFC 5HGBB 5E24E 5IUSA 1ETZB 1OQXA 2AAVA 3I02B 1CBVH 1EZVX 4MDIA 1QP1A 4MJ2A 1CVSC 3WJJC 4HWBL 5CEXB 2QL1A 3LSOB 3O3BB 1N8ZA 2F9BT 5B39B 5EO0B 4PGCB 4Z7VA 3QIWD 3ILQC 4RGOH 5C6WH 3RAJH 4P2QB 2OBGA 4LEXL 4LF3A 1X7QB 1FYTA 4PJEB 2VXSH 3THMH 4IS6A 4TNVF 4EUPA 3KNBB 5T33H 4RAUA 3BUYA 4U6YA 3P4OB 3QJHA 4YJZL 3P40A 4N0CD 5HHVL 3EO9L 3E6FB 5I1AB 5C6PB 3DV4B 5SX4H 1MREH 3F5WB 1ZGLB 4K3DL 3VG0L 3B9EA 3H7BB 1S9VA 2P48B 4KU1A 2UY6A 5DYOB 3V4VH 1QSED 1ZVSA 4BH7B 4X6BB 3FB8A 3LB6C 4D0BA 3RWFA 5L6YL 4TUJA 4IOIA 3EKCA 3NAAH 1IQDB 2X89D 2F74A 3GSNA 2EXYC 4K9EL 4BFBD 5GSVB 3ARPA 3FQTA 4ZSOB 1JK8B 2OJEA 1MCKA 2O5YL 3EYOA 3I9GH 1CXLA 3W0WA 3FO1A 3KPQA 1L9NA 4Q2ZA 2ITDB 1AGBA 2YPLB 1F4XL 3ORJA 1U8JB 3TIEA 2IALA 4XT1C 1WBZA 2GAZA 5CLTA 4OD1L 3VFUB 1MWAA 1UB5B 3MRGA 2C1PA 5KTEL 2NY6B 5EPMA 4C56E 1A02N 2ZOLB 2W65A 3CMGA 1U0QA 2CMRH 2YXFA 1P6FA 1ADQH 4M6OH 5GGRA 4HIIB 4J3UA 4LHQB 5E70A 3MJ7A 5HI4C 5IEHA 4NKDA 2NTFB 4FZ8H 5CBEA 1Y6NR 2C1OB 3T0VA 4Z77A 4YHLL 5CP7B 1F3JA 2Q8AH 3DI2B 3GHBL 3U46A 3HE6B 3ALPA 2NY1B 3OZ9H 5TE7H 3V0VB 2K1MA 4M48L 2VLLA 1WK0A 2A1WL 2PTVA 2OTWB 5CFHA 4UU9A 4XVUC 4CMMA 1UH2A 2ICES 4X5WA 2QEJA 3OTTA 5LBSH 5IQ7H 1P7KB 5EBWB 4G6AD 4S1QL 4WCYH 3CDYA 1MHHB 4YHYC 2DM7A 2YC1B 1YEKH 3HI6H 4IDJH 1AGFB 1M05B 4HWEH 3QRGL 1IM9D 4RWHA 3D48R 1U8OB 1UWXH 4KDVA 2VSDA 1XT5A 3P73B 5F93C 4LSSH 2A9ML 4NO0B 2AXGA 3DIFA 4YXHH 5ILTH 4K8RD 4BFGA 3IAPA 4NQTA 4DAGL 3SDCB 1T2JA 3MV8D 2JF1A 1KGCD 3UBXI 4LGPB 2XWBB 4GRLC 1HCFX 3HNTH 3OPZH 1RIHL 4HWZA 5D2LA 5J57B 1UM6H 3QUXA 2AEPL 4DUVA 5C0IB 4LCUA 1U8QA 3PQYA 4HDIA 3VD5A 5FO8A 2DF3A 4XCEB 4FG6C 4Q9BA 5IKCA 4G7VH 1MF2H 4KTDL 4APQC 5J89A 2HRPL 4HIEB 3CXHK 1CR9H 2VQ1A 5DJCA 4HFUH 3F7QA 3C6SA 3ECBA 5FIEA 4GG6F 3VMNA 5B38G 4C56B 3U79A 1FZOA 1QPXA 3IXAA 4XPHH 1DBAH 4EDWL 2G60H 1YEIH 1CXIA 1E4WL 4Y1AE 3C60D 3DTXA 1R6VA 2I9TA 1ACZA 3BEWB 5DVKA 2IPTH 1C5DB 3CCHB 1A6UH 1NC2D 2F53E 1RZJH 3RNQB 4H88L 4I3RL 1XGTB 3VXPB 4J6RL 3INUL 1HIMH 1IBGL 4OM0H 3SQOH 2JJWA 5F9DC 1ONQB 1I8MA 3B9KB 4JPVL 2WLZA 4NFBA 3VFWA 3FN0H 3P4MA 1T22B 2GSIA 4PJGA 3ZKMD 4N90E 3DMMA 1I8KB 3FFCE 1TDQA 4HIHB 1CDYA 4GMSH 3QDJD 3BZ4A 3U7YH 4RX4A 1U8PB 1OARL 3PHQB 4OLYL 4X4XB 1Y6KR 4JQIH 4BA8A 5FHAH 3K80A 4CL7A 1C1EL 1TVBB 1IFHL 5I9QC 5SWQB 3NIDE 4PY8J 3PV6B 1LO2H 4XAWH 3OSKA 4NQVB 1BM3L 1LP9F 1NFDF 2XTJC 1QACA 4GRWF 3HG1E 2UWEE 3T4YB 3H2WA 4ODHL 4JKLA 5F3BB 4I3SL 3RWCA 2BP3A 1HINL 3UTZB 1XIWA 3I75B 4R3SB 4HJ0C 4FFYL 1OGTA 4UINL 3ARDD 3T2OA 1IAOB 3MRQA 1R3IH 2CO6B 3RY6C 4BZ1H 3TO2A 1OGAB 1XF4B 3UPRA 3GBNL 3QHFL 2YBRA 1ADQA 5DI8B 2C26A 5DD5H 4X98A 1V7ML 3JV5A 3WYRA 2LU3A 3V79C 3FOMA 1LILA 1E4KA 1MPAH 5EZIL 1UWEL 1WCBB 2PO6D 1KFAL 2APBA 1U92A 4NP4L 2AABL 2XWJB 5CJBA 3R06A 3C5ZB 1FFOA 4MJIA 5E5UB 2FO4A 5JUEH 1I1RA 1U8MB 3PWPD 5KS9A 1GHFL 3SDXA 3HR6A 4MCZB 3QXAB 4Z95L 4QRTB 1FJ1A 1OTSC 5IBLC 4DVRH 4KK6D 1RK0A 2R8SL 4Y1AB 1FV1A 1HKFA 4PGZA 1LDSA 2F53B 4LSVH 1G6RH 1SMOA 2GSGB 4PV8A 4KJWC 2Z8VC 2FX7H 5DR5H 1JGLH 4UBDC 1VKXB 1I8IB 3KR3H 1UM4L 4F7CB 1G6VK 2WK2A 3E3QC 4RMRA 5AG9A 4K3EL 4MA7L 4YE4H 3RIFK 5J4MA 1KULA 1OAYH 2J8HA 1UH4A 3O6LL 1OP5H 3I3DA 4G8IA 3RIAK 4ESKA 1UVQB 2VLKD 1LNUA 4NQCB 5C0AE 3RX7A 1JL8A 5T5FL 3CLFH 5DQ9B 4ZAKD 3ZKQD 1T7WA 4HUUB 4J1UB 3OAZK 4JQVA 1CL7L 1UACH 3DO7A 2PKDA 4KHXH 1PEWA 2VKXA 2XIDA 3RVVC 4ODXB 4NFDA 5BQ7A 4H8WH 3VDBA 2UWEB 4PBWD 3GZKA 1N7ML 5K9KB 4XPFL 4DWHA 4XP1L 1DANU 1WZ1H 1VPOL 4LARL 4XPAL 1KIUA 2DQHH 2IAMB 4ZO9A 4NJAH 3G04B 4YXKH 4U6HB 4F58L 1DEEA 3TYFB 3TESA 4HUKB 5JMRA 3EOTH 2BSSA 3T2QA 4U6TA 4OB5H 2EE2A 1O5DT 4LCCC 4YH6A 3F12B 3QNYA 3SGJC 1IT9H 3IAGC 4PRBA 3BE1H 4XAKE 5B4MD 2ZOKB 5CCKL 4PLKD 3VFVB 5D7JA 3S97C 5D1XA 1C5BL 2G2RA 3VJ6A 5C0GA 4OCXH 3NN8A 2P5EA 3D18B 2ENSA 3AC0A 5I1EL 5ITBH 4K3JL 1T7VA 4HXAL 5FK9A 1E28B 4ZO6A 4K55A 3DROB 1GAFH 4LF3B 3E6HA 4IS6B 4EUPB 3MNWA 4QHUA 1FRGH 1LO3L 1I9JL 5B22A 2ADGB 4NWUH 2R4RH 4KAQH 4YHKH 5ERWA 2FYYA 3QUYA 4PB9H 5JW4M 3GO1L 4LSRH 1RZKC 4TOYH 3MUJA 1KPRA 1I3RA 1MFDH 1INDH 3QCVH 3QEQA 1IZJA 2N1KA 1ZVSB 2DB8A 3LY6A 3ULSA 3W9DB 5KSAB 1OAZH 1SBBA 3QNZA 1X5IA 8FABA 3M1BA 4P9ML 1MIEH 3FB8B 3DECA 3WSQL 4D0BB 1LEIA 4M6MH 2F74B 5D2LE 4DGIH 2V9QA 3VCLA 3REWA 3FQTB 1WAAE 3L3HA 3PQYE 1EJOH 3KPSD 5IV2A 3MRHA 5E2UL 3AY4C 5C0AB 3EYSH 1GIGH 4YXLH 3CNKA 5HPOA 5E2VH 3RKPA 1BD2A 1U91A 3LKRA 5DUBA 2IALB 2ESVA 4J8RA 3VXSA 1DJSA 1T7YA 4X9GA 3KVQA 3QA3A 4I0PA 2VQUA 5HI3D 5EPMB 1L4IA 3HPLB 1VADA 3IDGB 5GS1C 5AEAA 2EIZA 2BOBA 3G9AB 3MMEB 1YA5A 3J7HA 4Y19A 2Y06H 3GSOA 1AC0A 4I1NB 3PWUA 3TCXA 3D85A 4NKDB 5F72S 3GJEA 3GMOA 2VLJD 4J4PA 4RWYH 1QQDB 3T0EA 1OAKL 4HH9A 4YNYB 4WVRA 4CVXA 3HNSL 3LRGA 1FFNA 4LMQI 4GMTL 4U7MA 4PJGE 1NSNL 2X1XR 5IB3A 1LD9B 1J1PL 1G6RA 1YMHB 2VLRD 1N3NB 3L1OH 1UZ8A 3O2DL 2H2PD 1NLDL 1VHPA 5GGSY 5CD5D 2DTML 3KDMA 2X10A 4HS8H 2CLZB 2V7NB 2GJ6E 3X3GL 3WO4C 4Y4FA 3UP1A 5KVGH 5ID1B 3NTCH 4JDTL 1N5AA 3UBXG 3G6DH 3AAZB 2Y07L 3JVGC 1GH7A 3V52L 4JR9H 2DI8A 2W9EH 3EYQD 2Y7QB 5KANI 2LV4A 1Y0LB 2VDKH 2E9BA 5JNYA 4TPRL 4AK1A 5AZEL 3JUYA 2A83A 4UV7L 4L1HA 3MLZL 3NA9L 4PBXA 4IRJA 2NZIA 1RJLA 4QHMA 3OXRB 5JO5A 3D39D 3LKOA 2ED7A 4XWGH 3LEYL 2H3NB 3FAWA 5SX4I 1DL7L 3GMMB 3QUXB 3CH1A 3BT2H 3PQYB 1T21A 4HDIB 5FO8B 4YQXL 4HGMA 3WD5L 3RDTC 4WI6A 5JXAH 2JLLA 5DJCB 2VQ1B 2VXVL 3L3IB 4MJIE 4LIQH 3ECBB 4YX2L 4UIKL 4ZUSB 3CGTA 1FPTH 1ED3B 2IFFL 2VXQH 3QHZH 5KS9E 3AB0C 3EBAA 1G9EA 4C4KO 1RZIA 5I1JL 3T77B 1EO8H 3WKMH 2I9TB 3MRIA 5K9QI 1YQVH 1HHJA 4BKLB 1LEKA 3KJ4C 4X5LA 3NH7H 3JWDH 5CZVH 3KYOB 1A6AA 3L5IA 3MJ9L 1DQLH 4IRSA 4ONHB 4LLAA 5DFVD 5C0JA 4UILH 1EAPB 4LKCA 1KJ2B 3BP6A 1KJ3H 4H25B 2IJ0C 3VFWB 1CU4L 4ODSH 4PJGB 5FXCH 3LEXA 5ETUA 4NC2B 4WTZG 1C12A 3CJJA 3SY0A 3VMOA 3BZ4B 4DTGH 3GI8H 4I18A 5IW1B 1IC5L 5IW3A 2EDRA 2GJ6B 2X40A 4OZIF 4JFHE 2HFGH 1GGYA 4HUMB 1MHEA 5E4EC 3U4BH 1ZA3A 4XP5H 2XRAH 4QTIL 3ARGC 1OB1B 1HKLL 3HAEA 3D0VB 4RBPK 3NFPA 3X14A 2BNRA 4AT6A 1R3LA 4JCLA 3SJVA 1D5MA 1AE6H 3RWCB 4Q7DA 5HDQL 5HVHC 3LD8C 1XIWB 1GOGA 4QWWD 1OGTB 3LQZA 1V7NL 1CFNA 2AXJA 2VLME 3RGVA 2OR9L 3MRQB 4GXVL 4ODTL 4AEEA 4Z7UE 4UTAH 3ARFC 4YBLC 1HSAA 2P49B 2YBRB 5L2JB 1JWUB 3JWOC 4F7TB 4M3JA 3MA9H 3CVHH 3QO0A 1BREA 4QLRA 3I50L 3MRFA 5D1ZD 3WHXA 4JFDD 2Q3ZA 2H41A 5DJXA 3WIIH 2HYMA 4JE4B 3V8CA 4YHZL 1U92B 1NEZB 4U1LB 3IKCA 3MCLH 1XEDA 5C0CA 3KLAA 2WBJB 4DN4H 4NNPH 1KIRA 3R06B 4MJIB 4JKKA 1GCFA 2P5EE 4IJ3C 1L7IH 2EDWA 2FO4B 4JFFA 2BY3A 2AEWA 1MJ7L 4D0CB 3T2NH 3MODH 2VDLH 1JUFB 5KS9B 4DGVL 2VR9A 3EYUL 3I3BA 3LN9A 3MXWH 1UT9A 4ZS6C 3F7PC 4D9LL 3GUTB 2LTQC 1RK0B 3RTQA 1LO0L 2IF7A 1Q9LA 1MFBH 1JPTL 3SBWC 3U30C 1UB6B 1MRCH 3QEQE 3BXNB 5DXWA 1CN4A 1TNMA 2LABA 5EBMA 3DSNA 4ACPA 3SE9L 4LP5A 3O81A 2EO1A 3TA3C 5K9JH 1B0WA 5EH1A 4NQDD 5J9PB 2X7LA 5CILL 4QRUA 5E0QA 4G6JH 4M9PA 1TQCC 2QQLH 5KN5B 4XHQA 1A64A 2B4CL 3BDBA 3WS6A 5E8NB 3QG7H 4JO4H 5JHDD 1KCUH 3PHOA 2RGSA 4KUZL 5IBTL 3VXSE 4I3GA 4Q6IA 2P44B 5KZCD 3BVNB 3DO3A 3QUZA 5J06A 1KN4H 3NMEA 5D1QD 5IK3B 5MENA 1D5IH 5CIPH 4Y19E 1NCAH 1NGPL 1BVZA 4FTVA 2ADFH 1ZV5A 4EXPX 5IQ9B 5JOPE 1EGJA 1EO7A 3S34H 2BZDA 4B41A 4Y16B 1DEEB 4Z7UB 1YEJH 3MSPA 5TE4L 3T0EE 1FCGA 2X4TA 3QNYB 1PKOA 4ODVL 4ZS7H 1X5AA 3GGWB 5FYKU 2ZUXA 1MH5B 1U3HB 3L5XL 1J0ZA 3CFJA 3BZFA 5EC1A 1OAUL 4YUEH 4EOWL 3WN5A 4NOBA 5C0DB 3AU1B 2G2RB 3O2WL 2EXWD 5C0GB 2VDMH 5DRXA 2P5EB 4FXGB 1IC1A 4BM7A 2EC9U 3O9WA 5DDHA 2AV1B 4OCYH 4WU7A 2HG5B 1A6WH 1ZLWH 3H9SE 3NCBB 3PDOA 1FFRA 1UCBL 2R56H 3MNWB 3IFLH 1H3GA 4LHUA 3TYGL 4RMUA 2W9LA 5TQ0L 1AC6A 4G5ZH 5SWZD 2X5PA 3TN0A 2DM3A 1HDMB 4Q9RL 5I1IL 1I3RB 4P48A 5L8KB 3QEQB 1Z2KA 4XMKL 3ULSB 2FZ3B 1VESA 3HMWH 3QNZB 4JDZA 2BVTA 4OF6A 3ET9F 2HVKA 4P23A 43CAA 2DI7A 3AM8A 3GK8L 3S4SG 3BSZL 4OFIA 3PGFL 1EVTC 2NY3B 3I6LD 4I2XE 4OLZL 3TBWA 3QFJA 4YBHA 5GGVY 2DDQH 4LU5H 2VH5L 1Y18A 1NBYA 2CUMA 3SDAA 2WQ8A 3NBNA 5HVGB 1AD0A 2R2BA 4JZJA 3CVHA 3QA3B 5F6HI 3VXSB 4NKMB 4Y4KD 5BVPH 3T0DA 3EJJX 3ULUE 3T0AA 4M5ZH 2BOBB 3SKOB 1JHKL 3GBMH 3QDGA 3VD7A 1A6VH 3D5OF 5F7DB 2C4XA 3QUKB 4CVUA 3PWUB 4DVBB 4Y2DC 2R0KH 3GMOB 5DD0H 3VH8A 15C8L 3IGAA 5MI0B 3Q2CA 5LGJB 2QLVB 3T0EB 3PWLA 4RFNC 4L9LB 4L1DA 1BIIB 3IJHA 1E0OB 3K8MA 5H37H 4X7DC 4P2RD 1RUML 3S36L 3V0WL 3C08H 5DUPL 4UT9L 4QRRE 4J3XA 4PJCA 3M17A 1QEWA 5D7JC 3MLVL 4RFEB 3O8XA 5D1XC 2FH6A 1OLZA 5IT2H 1E4XL 4IEFB 2YUVA 5CEZD 4XBGA 3LHPH 4R4FL 3QEHA 4IDLA 1QO3A 1LDPH 5KANG 1JFQL 1YNKH 1KPVB 3K4DA 4Y4FB 5D70H 3H9SB 1FNSH 4S1RH 3MRLA 4FFWC 4L4TD 4KJYA 1IGTB 3S35L 2WBKA 4S1DC 5EO9A 1JNJA 2GT9A 3M07A 3VFNA 1OY3B 2BNRE 1H3PH 3SJVE 5HHQA 3SOBL 1BFOA 3QUYC 2YOCA 4ZYKB 3U4EB 3JV0A 5DC9B 2LU7A 4JLRB 1EIBA 2A83B 3RVWC 4OLEA 4JVPA 5GJSH 3G5XB 2PR4L 1RJLB 1MSPA 4PUBH 4XCNB 1F4HA 1A5FH 2JK5A 5CIPA 3D2UA 2JCCA 3KPNB 5JLZA 3MV7E 4R96B 4AJ0A 5IHZB 3CH1B 3VFTA 5I1HL 5IG7B 5DO2C 3AS1A 1G84A 3UMTA 1CBVL 4O9HH 4I2XB 2J6EA 4LK4A 4OQTH 1J0KA 1G7QA 4FQ2H 4DEPC 5DHYB 4GFTB 5E2WH 5K9QG 2JB6B 4Q9CA 4LCYB 1MCDA 4JFFE 4WU5A 3ULVF 5EOCJ 5GZOC 1JNHA 4W6YB 4RGOL 4CKVX 1T1YB 3CPLB 5T1MB 4AQ1B 5D4QA 5BO1L 5DLMH 3Q1SH 4KRLB 1CGSL 4B0MM 1FZJB 1EHNA 3TO4B 1Q9KA 2VXSL 4LPXA 1RUAL 3CC5B 3VXRD 4NKOB 2G5RA 1DLFH 1KJ2L 1LEKB 1QBMH 1QFWM 4RGNE 3IDMA 5D5MA 4HWUA 4J4PC 3VWJA 4GKNA 2WQRA 1MREL 1ZHLB 4IRSB 1P84J 1ZT7A 2EDBA 1JGEA 1MLCA 1AJ7L 3VD4A 4JHAH 2XQBL 3V4VL 5EUOA 5CJOH 4ETQB 1T1WA 5DWUH 4PRHD 4QRRB 2JJSA 4L3EE 1S7TB 1C12B 4NQEA 5ALCL 1J18A 3RHWK 1T03H 1ZLSL 2EDYA 5GS3A 2VITA 5LXGH 2LVEA 2YEZB 4I18B 2ZUTA 1JMZA 2VERN 1SY6A 3RRQA 5EO1A 1ZS8A 2R4SH 1RZ8B 3BDXA 4KI5C 4LAQH 4YO0A 3HAEB 5SWSE 3CSGA 4UIMB 1RZFL 1YYLH 3X14B 2R29H 2BNRB 5F7MC 5MENE 1CL7I 3QUMH 4HKXA 4U1GB 1RUKL 2PXYD 4TNWK 2CMRL 4FTVE 2CGRL 4M6OL 3RY5A 3ZE1F 2YHGA 3LQZB 5J11B 4HG4J 4NO2B 1ERNA 2XG5A 2F54E 3CX5J 4IRJC 4H8WC 2GYSA 3QO1B 2L0DA 2D31B 4UZGA 3UZVB 1HSAB 2Q8AL 4QOKE 1BX2B 3BPOC 3MV7B 5T1DH 5TE7L 4M62H 4ZO7A 1P7QB 4X9HA 4W4OA 4EDXB 3VFGL 1WTGT 4OJFL 3IKCB 5ISZD 4GXUM 4KJPC 4O00A 2YSSB 4HIXH 1LGVA 4G3YH 5D9SB 4R0LA 1QKZL 1XGQB 2EEAA 3BRDA 5IQ7L 2OS7A 4S1SH 3RVTD 4BQ6A 1J1XL 2D7QA 2F19H 3GSXB 4XCFH 3T3PE 4EVNA 4WCYL 4IBLT 2P8PB 4XNYH 1UA6H 3CX5K 2OJZH 1U6AL 1NGWB 1YEKL 2VKWA 5DA0B 1AI1H 2CDGB 3RL1A 2P7TA 4N1EA 1IKFL 4RGNB 2I24N 2AEQL 5ICXA 4U0QB 1IILE 4YXHL 1P69B 2J7LA 4FQXB 5I16A 1CFQB 4BELD 4D0DA 4KY1H 5EBMB 4ODUB 4BUHA 1MCWM 4AQOA 4L3EB 1I9RL 3CMOH 1S7VB 1FSKB 3LIZL 5HYJD 4QRUB 2DLTA 4OZHE 1JHLH 4BZ2H 4XPTH 3U9PH 3QFJE 4PJ7A 1G9NL 1RUQH 5KVDH 4N8VB 3T1WA 4LKXA 2BVEA 2J12B 5DURB 3HB3C 5HHXH 1CR9L 2BRRL 3K3QA 1CDUA 5SWSB 2BHYA 3KWWA 5C09A 4PRNA 1NJ9A 1QNZH 4RDQG 2Y36H 1F6AB 4OQTA 3ROOA 5MENB 3NACH 3S8WA 1F2XK 4FTVB 2IMNA 4S0TD 2EE6A 3PXJA 4OGYH 4QYOB 5HGAB 3RGVC 5C0RH 2F54B 1X4XA 2BNQE 1WC7B 3GMLB 3X3FL 2ZCHL 1AFVH 5D2NA 3Q0HA 5DHXB 1RZJL 4PJDA 2X4TB 5TF1H 4QOKB 3OG4B 1HIML 3RZCB 2NXZD 5BW7C 1X5HA 1NCTA 5F6IC 4PJCE 5ADPH 3OXSB 2NY5C 3WN5B 4LLYB 4CDHA 4DFHA 2BSTB 3TNMB 3FAXA 5F7WC 3G5YA 4NQUA 4GMSL 1CFTA 3U7YL 5FEBA 3LQAL 3MLUH 4JQIL 4LQFH 3W81A 1IGFL 1RZ7H 2APWA 3UROR 3RTQC 5I75B 1LO2L 2C3VA 1D9KD 1I4FA 1RU9L 2F8VA