5TE6H

Crystal structure of broadly neutralizing vrc01-class antibody n6 in complex with hiv-1 clade ae strain 93th057 gp120 core
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
224
structure length
223
Chain Sequence
RAHLVQSGTAMKKPGASVRVSCQTSGYTFTAHILFWFRQAPGRGLEWVGWIKPQYGAVNFGGGFRDRVTLTRDVYREIAYMDIRGLKPDDTAVYYCARDRSYGDSSWALDAWGQGTTVVVSAASTKGPSVFPLAPSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Identification of a CD4-Binding-Site Antibody to HIV that Evolved Near-Pan Neutralization Breadth.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 33
structure length 223
sequence length 224
ec nomenclature
pdb deposition date 2016-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5te6H01
3HS0A 2PTUA 3KLAA 4HUNB 1MQ8A 3G5ZA 4OIBA 3ARWA 4MCZA 5I18H 2BFVL 3WLWC 2Y4SA 1ES0A 1OW0A 5CILH 1O7SA 4BFGA 4YHYC 4X6CA 1JHTA 1R5VB 2A1WH 4JAMB 4QOKD 3E6HB 2NXZB 4AEIH 4HUUB 4PGEB 2FEEI 3U36A 2BRRH 4Z6AT 5A2JH 3BT2H 4KTDH 1BZ7A 1MHPL 4TSAL 4NQVB 4LKXA 2J6EA 5JORB 1XF2A 4X98B 1NFDE 1T7VA 2APWA 3QZWG 4IMLA 4JO4L 3WFDH 4J7RA 2YWYA 1GHFL 3PWUA 3L9RB 5FKAA 3PWPA 1WTGT 2A38A 5E08H 4GRMB 4CNIB 5EC2B 4JFED 1J8KA 3JWNC 3SGDH 3VG0H 1T0NA 1FG2A 4G9FD 5B38G 3WIHA 4PJ8B 4PY7A 5JLZB 5KN5A 3MUZ1 1M1SA 3ULUE 4G9DB 4LCIL 3UPAA 5FA4A 5KSAD 3AUVA 4ERSH 3OHXA 1KJVB 1OAXH 1CD9B 2MQ3A 2R9HC 3IVKA 5FKPB 1Q9KB 3HE7D 4MB3A 2R4RL 4PJDE 5H35A 5I1CL 5CJ5A 3VFOA 2F8OA 3BP5A 3DETD 2X9WA 4XVUC 4PRNA 4M5YL 5JDSB 5BS0D 1YMME 1A7RL 1EHAA 1NMAH 4RGNB 5I66A 2VOTA 1IM3B 1YEDA 5I9QB 3X17A 4ZNEA 4P2QB 4LVOB 5D6DC 5FUOH 5ACMA 2GHWB 4OIAA 4K71B 3F7RA 4QRQA 3VMPA 3E3QC 3R8QA 4DUVA 1VFAA 5EOCH 1MIEL 3O6KH 1NCWH 1R3IH 4JY6B 5FAAA 4DUWA 3HMXA 1BVLB 4I2XB 1HNFA 1P7HL 4JB9L 2APFA 4MLIA 1I7ZB 4QCIB 4OZGB 1JGDB 5TF1L 5ILTH 4Z8FH 5INCA 4X4YA 3UPCA 1WFOA 3JTTB 3VFUA 3GMOB 5J06A 4XPFH 3MYZA 4NHCH 3MLSL 3K2MC 2VXVL 1P4IH 3U7WH 1LDPL 4FQQB 2YA2A 5T3XL 5FA3A 1TZHA 2VC2L 5EBLB 5E8OB 2UVEA 4Y16D 5EG6C 2AXFB 1TTFA 2R23A 4X5WA 4HLJA 3GBLA 4QXTA 5DVLA 3RJDA 1RUQH 2P8PB 4RAUA 5GS0D 3OAYK 3QPQC 5CSGA 4ETQA 1XF5B 1S7QA 5B8CA 4IOIA 3ROOB 1B4JH 4HIXH 2VLKA 2R0KL 4XWGH 5ESVA 4IRJC 4HGWA 4PJ7F 4GW5B 4EUPA 3ARZA 1CGWA 2YD9A 4MJID 1CU4L 3U6RB 3DVIA 4AIZA 4Y4HC 3QDGA 2VLJA 3QJHB 4NOFA 2DQIL 1KLGB 1JHLL 2W9DH 1JGEB 1OF2A 2F5BH 4G8GE 2ICEA 1QR1B 5CGYD 2NNAB 3JV5A 3LB6C 3AFLA 1JGLL 5IR1A 3AXLB 3LPGA 4WTXA 3IDNB 3TYGL 2HVJB 4X6DB 2ORBH 4LKCA 3C6LA 2GTWB 2G75B 1OAKL 4LVHC 3KYMB 2DDQH 3EYQD 4YHNB 1MI5B 4IRZL 2HT3C 2CJUL 5T33H 5C08B 1XCQB 4WGWB 3QHFH 1FNHA 2VYRE 3ES6A 1A1OB 2OCFD 5LWYH 4TVPD 1X4XA 3U0WL 3V6FA 4K7PY 5IB1B 1U95B 2ZSWB 3EW3B 5T1LA 3NZHH 4HWEH 3WIHL 3STBA 1MLCB 3BH8B 3FHAA 1BQSA 3E3QE 2ZUTA 5FHBH 1BFVL 2OS7A 3F58H 1J9CT 4U6HA 2JIXA 4QF1B 3NGBC 5AEAA 3DV6B 1AD9A 4GUPA 5FYJD 1WWAX 3G5YB 4RMQA 4XBEL 2CDGA 4OM0H 1FV1A 1KCLA 5A1AA 5DHXB 3ZHLA 3VRJA 5D2NC 4DN4H 4NWTL 1U8IB 2A6KB 1CICB 4ODTH 2E7LC 4NDMA 4ELKA 3L5HA 1EO5A 3IAGC 5FUZL 1HXYB 1EMTH 3V0AC 1GAFL 5LAXB 3DI3B 3RGVC 5FO8B 5IFAL 3HPLA 4PJFF 4JZNA 4ZS6D 3QIUB 3HMXL 4WWID 2ITDA 1XGQA 1Y18A 2GW5A 1MJ7L 4JFDB 1T1ZB 4XPFL 3RUGB 1ZT1A 4R96B 1K4DB 1RZ7L 3EUUA 4KKAC 4U1GB 3HFML 3KXFB 3SKUD 3KPRE 3MFFA 2O61B 4TPRL 3ZE0E 1A5FH 4YR6A 1YPZA 4P2CG 4KMTL 1FVEA 4HXBH 1S7SA 1KSRA 1DQDH 3UBXA 4JPVL 3EO0A 5FM4A 3QCVH 3O3AB 3DPBA 4PB9H 1C16B 2FHBA 1BD2D 5IQ9B 5H37H 2MJWA 4AG4L 5GGVH 5D93C 5CWSA 2YPVL 5GS2D 1FN4B 3QPXH 2EDOA 2VZVA 4A6YL 4LPTA 1MUJB 4CBPA 5F7LB 2YRZA 4F7MB 3BI9X 5I76B 4D0DA 1F45A 5E56A 4QRRA 5HPMB 1PG7H 2ENYA 2ZCLL 5IT2L 3QIBD 3FB6B 4F7CB 3CPLB 3O11B 3HI1B 1PAMA 4NC1E 2PO6B 3REWB 4FFWD 1F58H 1T04B 5D1ZC 2ZWLT 4OCMC 2H9GA 4BZ1H 1D3CA 5IG7B 4H1LA 1RUML 1AGCB 4S2SA 1QLFB 3R06A 4JFZH 1AXSA 1E28B 4MXVF 2BMKA 1Z9LA 3NZ8B 5I1GH 3O6LH 5I1JL 2ORBL 1LE5A 3HS0B 3KLAB 1PX4A 3G5ZB 3ARQA 4MCZB 1J8HA 4JCMA 1GJIA 1RUKL 4JR9H 3RVTD 5EZLA 4X6CB 1JHTB 5I1EH 1ZTXL 3BGFB 1N0LA 2QLVB 4JRYD 3U36B 5D2NE 1F4WH 1BZ7B 1F3DJ 2AJUL 2DQHH 1ODAA 3QXAA 4LKXB 1XF2B 3CH1A 4OUUA 3QJFA 3O9WD 4IMLB 3X3FH 2EH8H 4GKOA 4PJGA 3PWUB 5FKAB 1IT9H 3PWPB 2XKUA 5HGAA 1IKNC 3KNBA 4RSVA 1BF2A 2YK1H 3G6JF 5IV2A 5GRXG 4AT6A 1T0NB 5I8KH 1ZGLA 1FG2B 2XRAL 1UB5A 4UILH 1JNLL 3OX8A 4PY7B 1NLDH 1A7BA 4I3SH 4NQED 4R6UA 4Y8DC 1BECA 1ZWIB 1IGCH 1D5XA 3LS5H 2DMKA 3WFBL 4ZFOL 1K2DA 3OHXB 4NBZB 3AMLA 3IVKB 1QNZH 4PRHE 2FJHA 1E4WH 1AC0A 3BYTA 5GS1A 3C09B 5I1IH 5H35B 1AKJD 2R2HB 3B9DA 3VXPA 4ZSOE 3BP5B 4PRNB 5EORH 1T66D 3Q6GH 1HEZA 2P46B 4O5LH 2BNRB 2BNUA 4C58B 3RWGA 1YEDB 4JQIL 1ZHLA 3HG1D 3L7FA 4HWBL 3MXVH 5DD0H 3O2VH 4DFHA 3IFPA 2AXHA 4QRQB 4KRPB 1VFAB 4AENA 3LMJL 3MRHA 4RA0C 1ULVA 5I1DA 3X3GH 3V4PH 3CSGA 4IRSC 2M8XA 1OY3B 1HOCA 2YPLE 4N9GB 5JW4M 5INCB 2Q7YA 2NXZD 4X4YB 4XNUL 3U46A 2CH8A 3VFUB 5D2LF 1TJHL 2DB8A 3P77A 3QA3A 3NA4A 3HE6A 1WZKA 1YEEL 5L2JA 4Q2ZA 4P46C 3WIIH 1P84K 4U7SA 4NNPL 3TF7C 1TNMA 2HTKD 3BPCA 1TZHB 5FA3B 4F7TA 2X42A 4C54A 2OZ4H 1JZ5A 2R23B 5M7QA 3UYRL 3KYAA 4X5WB 4OQTA 1I1RA 3GBNH 1HH9B 2XY1A 3D39E 4I0PA 1S9XB 4L3EA 3QRFM 4QXTB 4A6YB 3HNVL 4TTDC 4PJ8D 4GRWB 5ETUA 4RAUB 5F7WC 4P0DA 4QRTA 4ETQB 2BNQA 5B8CB 4PGZA 5GZNC 5C0EA 3AROA 3EYUL 2VLKB 5ESVB 4DW2H 4H8WC 4HEPG 3SCMA 5F3BA 2C3XA 4EUPB 5FGRA 5DVMA 1I8LA 2AJ3A 4AIZB 3QDGB 2VLJB 5HYQA 1OT1A 1F6FB 2G9HA 4U6XA 3ZDZF 2ICEB 4JY5H 5SWQA 1UVQA 5IQ7L 4YHML 5IR1B 1HHJA 1PX3A 2ZPKL 5HHQA 4RGND 1JE6A 4C59B 5JW4N 2VO5A 4LBEA 2QQLL 4P2QD 5LVEA 2AABH 4LKCB 3TP4A 3WN5C 3C6LB 2I9TB 5F1NA 4DKAA 2ICWJ 1RK0A 1SVZA 4C83B 2CRZA 1VGKB 3HNSH 4MGXA 4UV4H 3BAEL 5GGTL 4WW2F 4LNRA 3LY6A 1NCDH 3UX9B 3HC4H 5C0AA 1NLDL 3LAFA 4YHKH 1BIIB 5DGQA 3OPZL 5T1LB 4D94A 4N0FB 2J3SA 4JPWL 1S78C 4U6HB 1KJMA 4FFVD 2JIXB 1A2YA 1MRCH 4MA1B 5C0DB 4WW1A 1R3KA 2DM2A 1IARB 4GUPB 2F54E 4Q9RH 5E2VH 1JWMA 1FDLH 1JBJA 1OQXA 4M8QB 2CDGB 2D0HA 1FV1B 5I1AA 1C5BH 2Q20A 2NY5C 5I8EA 2R0WH 3WBDA 1RI8A 4NDMB 1CVRA 1KC5H 4ELKB 2FX8H 1G9ML 1MFNA 2YBRA 4K2UL 1RMFL 1JRHI 5JQ6L 3I9GL 4W81A 5DMIL 1FNSH 5IVXF 2DD8H 1EO8H 4M9OA 3AGVA 4MA7H 3HPLB 1DBBL 4JZNB 5GXBB 5LGHL 4L1DA 3H0TA 4YBLB 2ITDB 1XGQB 4AIOA 1MPAH 1QLEH 1S9VA 1HHIA 1CXLA 1N6QL 1YJDC 5JHLL 1HYSD 3MCG1 4RMTA 4UNVA 1AFVL 4YR6B 1HKLL 1YPZB 2XQYG 4POYA 1CG9A 1S7SB 4LSTL 4IEFB 4PGCB 1MI5D 3OAUH 1F5WA 3UBXB 5HD8C 4F2MA 1H3WM 5C08D 3SDCD 3EFDL 3EO0B 2ITCA 4UV7H 5A16A 2PYEE 3HUJE 2DQTL 4MX7A 5TE4L 3QWQB 4LDLB 5CWSB 1B6UA 1WAAE 4GBXC 1DBAL 4EOWH 4K23H 1MOEA 3TV3H 1KB5A 1TJIH 3FQRA 4D0DB 3MA7A 4QYOA 1S8DB 4HLZG 5IWLA 2OL3L 2H32A 1UH3A 1IGTA 3A6BL 3U1SH 1UWGH 1OARL 3GSNH 3NN8A 1K8IA 5CEZH 3BUYA 1M7DA 3WDJA 4YEFA 2A6DA 5DHYA 2H9GB 1QSEA 4H1LB 4S2SB 43C9A 3R06B 1NAKL 1AXSB 3NCJL 3RNKA 2BMKB 4HC1L 1CICD 1MQKH 3QXTA 3N1FC 1LE5B 4LRIA 1MCQA 3MV8A 1OTUD 1FGVH 2J8HA 2G2RA 4U1LA 1J8HB 2AQ1A 1IMHC 4XBGA 3VD7A 4XPAH 4TNVF 3PXHA 5EZLB 3LEVH 4Q9QH 3QIUD 4M7KL 3F6IA 5T5FL 1NAMA 1SBBA 3FQTA 5ELIA 3UZEA 4JFDD 4ELME 1JFQL 4LDOB 3LKQA 4HCRA 4K3DH 1H8NA 3NCMA 3QXAB 1MJ8H 3KXFD 3Q1SH 4NQDA 3CH1B 4OUUB 3QJFB 1TTGA 2VDNH 3WNMA 2AKRA 1A7OL 4W70A 2FNBA 5L7XL 2VDKL 2IPUG 3GJFH 3KNBB 4LLMA 5IV2B 4QTIH 1UB5B 3ARYA 2W0LA 2BJML 4HZLA 1DP0A 2GI7A 4FA8A 5BO1H 3W5NA 3HE7C 3CMOH 1MAMH 3EDEA 2V5MA 3BH9A 1D5XB 1CF8H 1EBPA 2YWZA 3DETC 4XH2A 1K2DB 1RHHA 2QEJA 3C5SA 3HNTL 1L9NA 5E2UH 2PO6D 4Z76A 5GS1B 3GHBH 3VXPB 4M7ZC 4M6OL 5AUMA 4N5ED 1OTTD 1MPAL 1HEZB 2BNUB 1ONQB 1VGEH 5EPMA 3RWGB 3SOBL 3ZKSD 1A6UL 3IFPB 1WT5A 4KU1A 4OD1L 2QHRL 2K7QA 3O8XA 1WFUA 3MRHB 1G9NH 2CLZA 4APQA 5I1DB 4Y2DA 4ZQKB 3SBWA 2VKWA 3S36H 3LH2H 3TNNA 1HOCB 2JE8A 2Q7YB 3U46B 1VENA 3CXHK 5CBAA 3L5XH 4RMVA 1IM9A 2WQRA 3P77B 3ARUA 3QA3B 4HAFA 1EUTA 4J6RH 3DTXA 1DQJA 1N0XH 4Q2ZB 5IBUB 2DICA 2VIRA 4QOKE 4K7PH 3BPCB 4PJBA 4XP1H 1JHKH 4F7TB 4RMRA 5F88A 3PWPD 1UWGL 4YHOL 3GRWH 4CGTA 3ULVC 3TBYB 5IEHA 3GK8H 4I0PB 4L3EB 4LSVL 4X83A 4R4BB 1FPTH 3C2AH 5ETUB 4HUXA 1AHWC 1SQ2N 3D3VA 3EFFA 2BNQB 4JFEE 1IVLA 3WJJA 5C0EB 1UQSB 4G9FE 3SQOH 1WBZA 1P69B 2RAMA 4QHMA 2RJMA 2WSKA 5F7YC 3SCMB 5F3BB 3GMRA 4LARH 2ZNWA 3LIZH 3VG9C 2QV2A 4MA8H 1QRNA 2AJ3B 2V2XA 1MSPA 5CD5D 5HYQB 2BRQA 2G9HB 4U6XB 4Y5YA 2VZTA 3EJZD 4NN7C 5SWQB 5IM7A 1HHJB 2BK8A 4QWWD 5HHQB 1P84J 1CZ8H 2DQDH 1NEUA 2BNRD 5EO0A 3QG7H 4LBEB 3BKCH 4EIZC 1AO7A 1BOGA 1NAML 1Q0XL 3AS1A 1SBSL 1OM3L 4KRPD 4R4ND 4IMKA 5BS0E 4HCRL 5F1NB 4BK4A 3MODL 1RK0B 1YNTA 3S88H 1P1ZB 1XGTA 1LEIB 5F8RC 2EYRB 4LNRB 3G6DH 1KEGH 2V7NA 1I9IH 4HK3N 3GMMA 3GSQB 2RCSH 4NRYA 4Z7WE 2B1AH 2BVYA 1QYGL 4JFHD 4LPCA 4CDHA 3BRFA 2LU3A 1NBQA 4TTGA 1NCUA 3V4UH 3D6GA 4YDKH 1CFSA 4BFBD 4DAGL 4O2CA 4X6FB 1KJMB 3F7QA 4MAUH 1SYVB 4P2RA 5BRZA 1R3KB 4RFNB 4C4KT 4G3YL 5FOBA 1JWMB 4OZFG 3GHBL 3DX8A 4JE4B 1VHPA 4PJ9A 4G7VH 5C6WH 5I1AB 3PDDA 3RY6C 2VDPH 3Q5TA 2YN5A 5I8EB 4H20H 3EOBA 3EOTL 2XPGA 1Z9MA 4ZS6C 1OGTA 2VLKD 5EFIA 3PDOB 2YBRB 5GGQH 1KB9K 4DKFH 1NUFA 2X6MA 3QDGD 4KJWD 4EXKA 2VLJD 1R5IA 2A9MH 3H0TB 4OGZA 2UZYB 2CLVA 1MREH 3MCKA 1S9VB 3RVVC 1HHIB 2CIIA 4GG8A 2BY0A 4MA3A 4Z18A 5DT1L 2IH3A 2ILLA 3C6LD 5HVHC 1ROWA 1AGDA 4KAQH 3TO4A 3WDIA 5T3ZD 1CG9B 5C0JA 2FD6L 1WK0A 4OGXH 1CIUA 4P9HH 4F2MB 2ITCB 5A16B 4MMZC 3BKJH 4MX7B 3TEUA 4HPYL 2Y9RT 5LXGL 3QIBC 4NHUA 4OFKA 5FYKH 4DVBA 2YR3A 1MWAH 4FFWC 1A4KB 3ARGB 5T1LD 3FMGH 5EBWA 1KB5B 1U3HA 2H1PH 2J4WH 5JO5A 4TVPE 1NCBH 5ADPH 2Y36L 3RVWC 2H32B 4UTAH 1IGTB 4OF6A 2JIXD 5GZOD 5IUSA 1C1EH 2Q8BH 3BUYB 1M7DB 3C08H 3U9UA 1WWCA 2A6DB 5DHYB 2QKIA 3VW3L 5DJ8A 1LO0H 2P24A 3OV6A 4W6WB 43C9B 5FYJE 3RVTC 3MO1A 1FO0H 3RNKB 1CQYA 3PGDB 4E0RA 1YC7A 2R8SL 4G8EB 4LVEA 5GISH 4LMQE 4TSBL 4P23A 2G2RB 4U1LB 2ZG2A 1PEWA 4XBGB 2ADFL 3BO8A 3HI6H 4M43L 3ZTJH 3JTSA 4M6NL 4URTB 1XF3A 4FTVA 4H88H 4OF7A 2ZZUT 1NAMB 3FO2A 3FQTB 3S96A 1A6TB 3ABZA 3MNWA 5BQ7A 1A14H 2IPUK 1A3RL 3A6CL 5ERWA 5IMOA 2WP3O 4NQDB 2ED8A 1IZKA 4AQ1B 2GK2A 2JCCE 1HI6A 1U8QA 2AKRB 4E9LA 1HIML 3QDJB 3IJHA 2A9NH 4LLMB 4OBSA 2PR4L 5DD1L 5K93A 1GC1L 2VR4A 5KS9A 2FX9H 1Z6JT 4HZLB 2AJVL 5F96L 2HWZL 3OAYH 4XP9H 3TWCH 5HDBE 1HXMA 5JW3H 1U36A 3JWDL 1BD2E 2QSCH 4QRRD 4U1NA 4JVWA 1P4BH 3EDFA 4XH2B 1Q38A 1RHHB 1T66C 2Q1EA 1PG7W 1BZ9A 4JG0L 4FQCL 4Z76B 2MCG1 1U58B 4NWUL 3ZT7A 5KVMC 1TCMA 4EI5A 1FIGL 4EIGB 4RMUA 5AUMB 1AQKL 3BD3A 4KZEL 4ZTOL 4LQFH 3RIFF 3H7BB 4F9LC 1M71A 3ZO0A 3L3GA 5D7JA 1M6OA 2DQEL 2X1OA 4RQQA 2NXZC 2V2WA 4BZ2H 2EDTA 3RFZC 1CDHA 5DA0B 4JVUA 3K8KA 1CK0H 1J8HD 1G6RL 3O8XB 1XZ0A 1KIQA 4J3UA 1QFUH 2B0SL 2CLZB 4APQB 4JGJA 4Y2DB 4N0YH 2QQKL 1J0IA 5DYOA 3F65A 4XCFH 2HTKC 3TNNB 1P6FA 3LKSB 2DM4A 1D5IH 4M1CD 1LEGB 3FB5A 4ODSH 2X4OA 5E2TL 5CBAB 1IM9B 1BP3B 5I71B 5E8PA 3PV6A 4GQPH 4LSQH 2VIRB 2X2YA 4PJBB 3ALPA 2FBJL 2XXMB 4JRYE 1KCKA 1EAPA 5DMYA 5F88B 4F3FA 4K3JL 4OSUH 5L9DH 5J1AB 2QL1A 2HKHL 5LBSL 5I19H 3GNMH 1RUPH 4PBVC 3JXAA 4CN6A 1YEFH 4HUXB 3SGKC 5IK3A 1JI1A 4XNQA 3D3VB 3EFFB 4JGUA 5K9KA 4KQ3H 2H2SC 1UJ3A 35C8L 4AQOA 4KVNH 2NQCA 4QHMB 1JK8A 4NQEE 3GMRB 4HEME 5F8QC 4RGNC 1OCWH 4ZODA 4M5ZH 1QRNB 3P0YL 2V2XB 1CGXA 4GAGL 3M45A 2DLEA 1KEML 3CXHJ 3S4SA 1S9KC 3STZA 3E1F1 1SJHB 5IM7B 2NR6C 1ZKAA 2UYLA 1A14L 5D70H 3QFDB 1CXIA 1AO7B 1BOGB 2EDQA 3ZDYF 3ARTA 1N6UA 4PJEB 3CDCA 3JSSA 1CR9L 1XF4A 3D18A 1YNTB 3HG1E 3MRKB 1XGTB 3W82A 5D71L 5IVNA 3QUZA 3OGOE 2YD4A 3BPNC 4MQ7A 1B0GA 4L5FH 5K9OA 4NO5A 3KPPA 4FFVC 5EUKB 4YXKH 3GMMB 4NRYB 4YXLH 2VXUL 3TWCL 4OI7A 2I60L 3HE6D 3FQWB 1ADQH 2VLLA 1PEZA 2WANA 4J4PA 4LSUL 1CFSB 5ITBH 3HB3D 4O2CB 1VFOA 3BD4A 3UDWA 4P2RB 4OCXH 2G60L 3UTTA 5BRZB 3ULUF 2XWTA 1KCSH 4BK5A 4MS8C 4L8SA 5E1AA 3BPOC 4I0PD 4L3ED 5FOBB 1JGVH 4I3GA 3DX8B 4JZJA 1I3RA 3ARPA 3TC9A 3LN4B 2BNQD 5CZXD 3EOBB 2J2ZA 5BMFL 4JO1L 2FH6A 1IGYA 2XPGB 4JCLA 4JN1L 5EFIB 3SCMD 5D1QA 1JZ7A 3QZWA 4QRPA 3KPTA 5ICXB 1HYSC 2W9LA 2HLFD 4XCFL 1PD6A 1R5IB 4FQJH 3DMMA 1SY6H 4QHUA 4ONGL 1A64A 2W07A 2IGFH 2OP4L 4JM2A 5TJWK 1T7YA 3V6ZA 2CLVB 1TLKA 5B38A 3RWJA 3MCKB 1MF2H 3SDCC 1NGQL 4XC1H 2CIIB 4GG8B 2F58L 4WCYL 5HI3D 1XGUA 4JO2L 4MA3B 1FZOA 4JRXA 2IH3B 2OTPA 1AGFA 2E7BA 1AGDB 3L5WA 2XI9A 3TO4B 4ODVH 5C0JB 4RGNE 4P2QE 4PJIA 4CVXA 1GRWA 3BKYH 3OF6A 3DVNB 2LFGA 25C8L 2N7AA 2RR3A 2V6HA 3UJJH 1MIMH 4NHUB 2C3WA 3DUUA 4I2XE 4WNQA 4DVBB 2JJTC 3WSQL 1CE1L 1RZ8A 4POUB 3MJ6A 4FP8L 5EBWB 1U3HB 2X89A 3DSFL 5JO5B 3VXNA 2R15A 1KB9J 3VWKC 3P30H 5TE6H 3ARBA 1J0KA 2CXGA 3TYFA 3UEZA 2VZ1A 1KJ2L 3LN9A 5CHNA 4DKDC 2DRUA 3KYNA 3MTRA 1A6PA 5J13B 3HAEH 3U9UB 3C2SA 4XMKH 4XCCH 1NJ9A 1OTUC 1QFWI 3MBEC 3PJSB 3STLA 2P24B 4PTUA 3BZDA 5JXEA 4LLUA 1T7ZA 3AREA 4K94L 5IB2A 3MO1B 4UBDD 2L7UA 2DF3A 2MHAA 2D9QB 4XB7A 5C0FA 1L0YA 3QIUC 5HY9A 1AY1L 1MRDL 4P23B 1XT5A 4UQ2A 4XMPL 4LGSB 4E41A 4QGYA 3OG6B 3MLZL 4L4VA 3BO8B 3JTSB 2DJ4A 4LIQE 2R69L 4FTVB 5IHUL 2ATPA 4XTRC 4KRMB 3S37H 5D7SL 4XXDA 5ALCL 3S96B 4GW4A 4EBQL 3MNWB 1NEZA 4XP6L 5JMRA 5BZWA 1KYOK 1U93A 5FGSA 2KH2B 4UQ3B 5IMOB 2FGWL 5B21A 3IS0X 3ZMRA 1YEGH 1HI6B 7CGTA 1U8QB 3IJHB 1KXQE 4Q7DA 5EUOF 5FCSH 3MRFA 2YC1A 2WINA 5KS9B 4WTZG 1JGVL 4AMKH 1YDPB 2IPKA 4KKCD 4WJ5A 2X4RA 1MI5E 1OAUL 4G6JH 2YA0A 5C08E 2EDXA 4LEXH 1U8OA 2PO6C 5HI4D 4OTXL 1CLCA 1HXMB 2FATH 2JELL 1NANH 1KULA 1HDMA 4B7LA 5DJXA 4KKLD 4N5EC 2X1XR 4HIJA 3IDJA 1OTTC 4V2BA 4XVTH 1CFNA 2MNUA 1BZ9B 3HRPA 4CAGA 1C5CL 4PRAB 3MGAA 1PBYA 4F7PA 1SEQH 3VD5A 1XR9A 4R26L 2HFFA 3VDCA 5J4MA 1PKQB 5D7IA 3UC0H 4X9GA 4ZPTA 4F33B 3S5LA 1OW0C 3K1KC 5CJBA 1WICA 1M71B 5J1TC 1PLGH 3L3GB 5D7JB 1M6OB 1O0VA 3U7AA 4RQQB 3HI5H 2V2WB 1CXHA 3GM0A 3DVFA 1FLTX 4WUKH 1UM4H 1CDCA 1XZ0B 1KIQB 5FOJA 3RWDA 2Y5TB 4HV8A 4M3JA 5DYOB 3QEGH 1Z2KA 3FCTA 3IDYB 1KENH 4BSJA 4Z0BL 2PF6A 3FB5B 3HZVA 3TH2T 2X4OB 2EE3A 1WZLA 4MD5A 3NMEA 4PLKD 4F15B 4YUEH 5E8PB 5DD5H 5IB4A 3LD8C 4NQDD 1KELL 3MRQA 2YN3A 3DVGA 4OCNC 5E95B 3S35X 1ZLUH 3RL1A 4JFDE 4Q6IA 1EAPB 3RUGE 3GKWL 4F3FB 5MEQA 1I7TA 1UGNA 1KFAH 3QDJD 1YQVL 3O6MH 1DBJH 3LS4H 3KXFE 2ESVA 4YLQT 5D72H 4FNLL 2BZDA 3N1QC 4DTGH 1WC7A 3NCBB 2N1KA 5CCKL 4DCQA 2F53A 4TVSa 5IK3B 1IJ9A 4XNQB 5BV7B 4L9LB 1JMXA 4KH2A 3C09C 5JQHC 1T7XA 4CRPA 4LCCC 4CU7A 1FH5L 5K9KB 3MOAH 2Y23A 2XXCB 3EJZC 4NCC1 1OAZH 4MDJA 3GSUA 4QWWC 1U6AL 5DJZA 5GGRY 3DX7A 4Z7QE 3EHBD 1UM6H 2WAHA 4O4YH 3E8UL 1H0DA 1JIBA 4G6KH 5DMKA 4ALAL 3S4SB 3ULUH 2BSED 3T3PF 5I75B 4F80A 3STZB 4HBCH 2UYLB 4LVNB 2EYTA 4UT6L 4KHXL 1U8NA 5BVPL 1FORH 1FBIH 5J56B 3NABH 3SKNA 2Z8RA 4M6MH 2GKIA 2EH7H 1IAIL 1RIHL 2Q76A 5IHLB 3SEPA 3O8XD 1XF4B 1VKXA 5HI5C 4XP5H 3V8OA 4APQD 4Y2DD 3T65A 2DAVA 2VXSL 1G1YA 4I3RH 5DS8A 3SDXB 3MRRB 4MQ7B 1B0GB 3NIFE 4NO5B 3KPPB 4DQOL 2JB5H 1YYLH 1Q9WB 1LEKA 1IM9D 1HYRC 1S9WA 2FX7L 1G6VK 4U6YA 3TO2B 1S9YA 3SO3B 3OB0H 4X6CE 2VLLB 2CUHA 4XNZB 3UJIL 4DK6A 1K85A 4XVTL 2DLGA 1XGYH 2P1YA 2GIYA 4WUUA 3N85H 1V7NL 1N64H 1IFHL 3UTTB 1MCDA 5B8CC 2Y07H 2XWTB 4L8SB 1EA9C 5E1AB 3ME0A 1OP5K 4RCAA 3PWPE 3RWHA 4OJFL 2LU4A 1I3RB 5DMJB 4JFQA 3ARFA 2FIRT 3D3VD 4YBHA 3BQUA 3G5VB 1IGYB 3OXRA 2EDNA 4LASL 1YEIL 5C09A 4JREB 3ZDXE 3VXSA 3QZWB 4FQXA 4QRPB 5DTFA 4EDWL 1QRND 1F97A 4Z95H 1TZGL 5HYSA 3FT3A 2F8VA 2X4PB 3BDYH 3C6LC 4PJ7A 1KENL 3DMMB 4QHUB 4JM2B 1XR8A 2JK5A 3V6ZB 4NZDA 2VUYA 5B38B 3RWJB 4K8RD 1XGUB 1AO7D 3R1GH 1FZOB 4JRXB 5KVGL 1YNKH 5FCUL 1AGFB 1DFBH 2EKSA 3SDAA 3VWJC 1JVKA 4X9BA 4JHAH 4H25A 3MLUH 1T21A 1NBVL 4ZNEE 1A7QL 5FM8A 3ZYOA 2EO1A 5SWSA 1A6VL 4CVXB 1M7IA 4HF5H 4DTGL 5IW6A 4WENB 1YZZA 5F7DA 3CFIC 1B3JA 1UM5H 4MA1C 2NY3B 3DUUB 4WNQB 1OOAA 4BSWA 1ZANH 1MJUH 1RZ8B 3L1OH 1CWVA 2EDEA 4N1CA 5EIQA 3H6JA 3VXNB 1IC7H 2QQQA 4QXGH 1G0XA 3ARBB 3TYFB 1BM3L 1EDQA 1L0XA 2DTSA 4P2RD 4JFHE 4RFOL 5BRZD 4DGVH 5CHNB 3KYNB 1OSPL 3DROA 5BCAA 2CGRH 4QEGA 1A6AA 1UWEH 2DQUL 3MSPA 1NJ9B 3QEUA 1TZIA 4X6BB 3STLB 4LEOA 4JM4H 1SJEA 4PTUB 4GSDL 2R29L 3QEHA 3AREB 4ZYKA 3U4EA 3VXMA 2CKBH 3IRZA 5C0FB 4DVRL 4YBLC 3J7HA 4MQXD 4GRWE 5HY9B 3NAAL 3QISA 2AJZA 3CVHH 3FRUA 2D2OA 4UQ2B 1ZGLM 4Y4FA 4E41B 5DDHA 4R90H 2VLMD 4L4VB 2ZUXA 2VLKE 2VR5A 2ATPB 1R0AH 1RZKH 1SEBA 2HP4A 5EO1A 2R0LL 1CDIA 4XXDB 2JB5L 3MZTA 4GW4B 4NFDA 1NEZB 4LLVA 4M4RA 5BZWB 1U93B 3QDGE 2VLJE 1A9EA 2BSTA 1OAQH 1K8DA 1RIUH 2XZZA 4ODXA 5EWIL 3HZYA 3TO4D 4OZHB 3NFSH 1DQQA 4R7NA 3AU1A 3MRFB 2YC1B 2ARJQ 2WINB 1HHGA 5DQ9A 5I17A 4KK5D 3KDMA 1MLBA 5T3ZE 4OIIL 1MH5A 1ZVSA 4WJ5B 4O2EB 2P45B 1Z5LA 4G43A 5HYEA 5EOQH 4G7YH 5C0RL 4OCYL 1INDL 2AEWA 1RZIB 1PSKH 4DEPB 3LV3A 5H2BB 4LHUA 1U3HD 4PJ5A 5DJXB 4NQXA 4EQ2A 3H9HA 1JPTL 3IDJB 4HIJB 1GCFA 4IDLA 1JYNA 1CFNB 2AV1A 5DMGD 5D7KD 4GRLA 2V2TA 1BQLL 1WZMA 3BD5A 4P4RA 3D9AL 4LRNL 1CDUA 1XR9B 2HFFB 4JO3L 5GS3A 3BDYL 2VDRH 2FCBA 3BX7C 5D7IB 5JPMA 1KYOJ 4ZPTB 3SKMA 1G7LA 4JGMA 3S5LB 1FVCB 1E4KC 5ISZA 4HIIA 2OMBA 3VA6A 4GXUM 4PS4H 1RJLA 1F11A 5IESL 3BEVA 1DFBL 4P23D 3CX2A 2P43B 1VCAA 3RWDB 4HV8B 1T2QL 4HF5L 3WXWL 3FCTB 4FTVD 1DSFH 3L3JA 3V0WH 3HZVB 5L8LB 2P7TA 5CSZA 3HUJF 3WUWG 5I6XB 4UTBH 4D8PA 4P48A 5IB4B 3LHPL 3G08A 5MI0B 1LO4L 3RL1B 4Q6IB 5MEQB 1NFDB 4MXWL 5E0QA 1UB6A 2ESVB 1NCCL 5IOPA 1N5AA 1UWEL 1WC7B 1EGJA 1YPZE 2FLBT 5HHVH 3LEYH 2F53B 5KAQG 1KOAA 3ZKMD 3FFCA 4J3OC 4Z7UF 1T4KA 4NYLA 1LO5B 1B88A 5GS1C 5SX5K 4ESKA 5FYLH 5EN2A 1EK3A 2NY2C 4XNYL 3CVHL 3WO3B 3GSUB 5EBMB 2EE6A 4KVCL 5DJZB 3DX7B 1YN6A 4QRRE 2R56H 5DMKB 1H0DB 4DGIH 3GIZH 5ALBH 3GI8H 5HGHB 2BXZA 4ZXBA 1ED3A 2XN9A 3UJTL 1RURL 3NACL 5D7JD 5K9JL 1U42A 1FAIH 3QUYC 2OR9L 3SKNB 3DSNA 4ELMF 3SO5A 2CK0H 4N8VA 1VKXB 4JZOB 1UACH 5C0IA 3HE6C 1U92A 3T65B 1EV2E 4U1JA 3GJFA 3P0VL 1J8HE 3HB3C 4N8CL 3B9KC 5IFJA 1YEJH 1JWSA 1LEKB 3BHBA 4U6YB 2EIBA 1S9YB 5D1ZA 1PSKL 3S3SA 5DK2A 1F2XK 2QR0B 4WU7A 2EDFA 2R1XA 4MJ2A 4KHTH 2AAVA 1CL7L 3GSXA 4QHKI 2FR4A 4WUUB 2P5WA 5CZXC 3GEWB 4FQIH 4U1IA 1UWXK 2MKWA 2EEAA 1BBJA 4PJGE 4GMTH 1AD0A 4JFQB 4YHYB 4EUPG 2IH1A 1I8LC 3G04A 2VLRA 3BN9D 2HLFC 3BQUB 3QQ3A 2WW8A 4OZIA 3NIGE 1VB9A 3H42L 3VXSB 3KR3L 3OL2A 3QUXC 2ZKHH 1FG9C 2W59A 4FQXB 2DWEA 1EFXA 5KW9L 5DTFB 4CU6A 3WKNA 4WY7L 3OAZK 4OB5L 5HYSB 1UH2A 1MVUA 3FT3B 1GYAA 5FB8A 2DQCH 3L3IA 1ZV5A 3SDYL 2B4CH 1XR8B 2JK5B 2V5SA 4N1EA 4ZO6A 5HHME 4KJQD 3UYPA 1LQSR 3V4VL 1JZ3A 1QQDA 4YX2L 2EKSB 3PGFL 3SDAB 1Q72H 3MBXH 4J23A 1IL1A 1T21B 2ENSA 4MJ5B 1TDQA 3GRWA 3K7UA 4I8DA 5SWSB 1G7PA 1M7IB 4OLZH 5JDJA 2X41A 3T4AA 4HK3J 1MCCA 4JN2A 2VDLH 3RTQC 3WXVL 5L88L 4BSWB 3NFNA 1EGJL 4WW2A 3NFPA 2UUDK 1MFBH 4J4PD 4R7DA 5DEGB 2H41A 3K2UH 4KDWA 1RU9H 5CP3A 3PDGA 4RWHA 3UTTD 3L3DA 1FNGA 4KY1H 3DROB 4JEGB 4JKPH 3CFCL 4DK3A 2E9IA 1A6AB 4J12A 3SDDA 3QEUB 1TZIB 4HGMA 4LEOB 4R97B 1SJEB 3RZWA 3QEHB 1NC2A 4ZYKB 3U4EB 3VXMB 4L3EE 4NKDA 1J0JA 2VDOL 4GKNA 5KANG 2YMXL 4CMMB 5J3HD 2AJZB 3I84A 3FRUB 4Y4FB 3QHTC 2BNQE 4QRPD 5DDHB 1R3JA 2F5AL 3W0WA 4FQLH 1Y6NR 2Y25A 1JTPA 1UXWA 3EJYC 1AJ7L 3DMMD 3U9PH 5EO1B 4JM2D 4GW1B 2BDNH 1T83C 2AI0H 4FFZL 5DC9B 4LLVB 3UBXG 1EERB 4WV1C 1A3LL 3TH4T 3MLRH 3ZLQC 2ZG3A 1A9EB 2YD2A 3Q5YA 4JRXD 2BSTB 3OG4B 4KKCC 1K8DB 4XVSL 2X9XA 3ARVA 3WFEH 3HZYB 1NLBH 1DQQB 1U3YA 5LQBH 4R7NB 1LK3H 3AU1B 3OF6D 1HHGB 5DQ9B 1A0QL 5I17B 1FGNL 1E27A 3EOYG 1MLBB 4RGOH 1MH5B 3GHEL 2NY3D 2VRAA 4NPYA 4XHQA 1Z5LB 4H8WH 4G43B 4EKXA 3VFRA 1H9VA 5TH2A 1RZJC 3LV3B 3SE9H 3ZE2E 4LHUB 1CLYH 1CGSH 2X89D 4PJ5B 4NQXB 5C0AE 2IEPA 2Y72A 3MRCA 5T1DH 1DE4A 3ARBD 3BWUC 4P5KA 4GRLB 3WN5A 2EZ0D 2V2TB 4F8QA 4B0MM 4P4RB 3QUMH 3MYJA 3QEQA 4P3CH 4R8WH 4RFEA 4PP1D 5JPMB 1FE8H 5INDA 3SKMB 1G7LB 1HSBA 3CSYA 5JXED 5GPRA 3ARED 4HIIB 5GJSL 5I74C 4PRIA 4JJ5A 2E6JA 2MTPA 3U83A 4O02L 5DI8A 1RJLB 5A2FA 4I13B 2Y7QB 1F11B 4NGHL 3BEVB 3O45A 4M7JH 3QR2A 4M1DH 4PLKC 4E41D 3KPOA 4KKBC 4G8IA 2B2XL 2X1PA 2YPKA 4L4VD 3U7YH 6FABH 3O4OC 3JWOL 3L3JB 4XMLL 4OZFA 2VDLL 2DN7A 1QFWH 2P7TB 3NIDF 5I30H 4OKDA 4HJGA 1MWAA 5D2NB 3G08B 1GH7A 4QRUA 3VRLF 2VDMH 4XPHL 4HSQA 2NZIA 2FEEL 3TT3L 1W0WB 3DRTA 4WEBH 5IOPB 3HMWH 3PIQB 2FEDD 4G5ZH 1N5AB 3N1MC 1EX0A 5AWNL 5TPWL 1D7FA 3FFCB 5F7HA 1T4KB 4NYLB 4OD3L 1KTRL 3C5JA 2C4XA 3FO9A 3NTCL 4ZOBA 2J88L 1FO0A 1WZ1L 1KLUA 5EN2B 2BSRA 4UIMB 1JZ4A 5F21B 2APVA 4U33A 1WEJH 2CMRH 4OGYL 1F4AA 1YN6B 1WT5C 4K3EL 5F9OH 4ZXBB 2DJSA 4X9FA 3EJJX 2XN9B 3P73A 3EDDA 4Y2DC 2FYYB 4NQSA 4DZBA 3SBWC 5KSBF 4GBXA 1G7IA 1QSEE 3I2CL 3DBXB 4WHYH 2WBJC 4N8VB 5I71C 2N7BA 2KZ1B 1DEEA 4LU5L 1ZAGA 5C0IB 1HK6A 3VXQA 1U92B 5GJTL 1GOGA 3JZ7A 1GPOH 2JCCF 3MV8E 4RGOL 4ZUWA 5IFJB 1K9TA 1OAYL 3CZJA 4FHBD 3BHBB 5B22A 5D1ZB 1K6QL 4DOHB 1PFCA 5T5NF 3OGCB 4OGAD 5DK2B 5C7XL 3BN3B 4WU7B 5IMLA 3MJ9H 2HFGL 3B4NA 3OJVC 3SGDI 2R1XB 1R24A 1XEDA 2ZSVA 3GSXB 2FR4B 1HQ4A 2P5WB 4E5XA 1W8NA 2DOCA 2GITA 3LRGA 4W4OC 5J6GB 4U1IB 2ESVD 4NQDE 3WJJC 5JZ7C 1X9QA 1XGPA 3BDBA 1JTTA 4GQ9H 1W72L 4W6XB 3GB7A 1PG7X 2XZCL 4NKQB 4Y7MA 1L6XA 2F53D 1AD0B 1WGOA 2E7HA 2F19L 2YRPA 2P5EA 2IH1B 5KVEH 2VLRB 3QQ3B 4Y5YC 4OZIB 4OFIA 4QXUH 2RGSA 1SM3L 4K8RC 2DWEB 2IFFH 1EFXB 1NBYB 4GO6B 3HC0A 3RL2B 1JI2A 1XIWA 1MVUB 5FB8B 3L3IB 4KUZL 4NUGL 2HVKA 4LCWA 1X5KA 1B2WL 5EU3B 3THMH 1CDGA 4AZ8A 2BVPB 5DQDL 1B4RA 5F9AC 2Z9TA 4U1HA 3AVEA 4PLOB 1RJYA 1ITCA 2GFBA 4F8TA 1IL1B 3HC3H 3Q6FA 4NM4L 3MUY1 2NY5L 2BSSA 4OCSH 1ZVYA 1G7PB 3LQAH 4G5ZL 2K7PA 5C6TH 1AIFA 2W65A 1BFTA 4X80H 4NC0B 1MFDH 5DWUL 3NFNB 4UDTA 4NZUL 3NFPB 2IAMA 4R4FL 1ZEAL 3MJ7A 1QKZL 4PJ9C 3AS3A 1FC1A 2ZP0T 4HFWA 5TFSH 2C1OA 2CLRB 4WUUD 1EEQA 5TQ2H 3VFTA 4B50A 1I9RL 2OJZL 4FN0A 4RISL 3L3DB 1IZJA 3RVUD 1FNGB 1YJDL 4PJBE 4MQXC 2D7OA 3WLWD 3SDDB 5K59E 4CVUA 1FLRH 2F54B 2ZOKA 2NPLX 1KTDA 3X11A 3ARFD 4DKEL 1NC2B 2W1NA 1INEL 1NL0L 4K9EH 2ZUUA 3BQUD 5CJ8A 3W2DL 4KZDH 4NKDB 4OD2A 3QCTH 1EZVX 4GKNB 1CLZL 3ZTNH 4TRPL 1UZ8A 4FQ2L 3VXSD 3BSZL 3LKRA 4FQXD 3D3VE 2Q3AA 1A7NL 1R3JB 1F6AA 3W0WB 3UO1H 4LCUA 3TM6A 4U6VL 5GS0H 3QWOA 1QRNE 1X5HA 3TBVB 2Y06L 3T0AA 5IGXL 1KCUH 4LLAA 3RHWK 2HRPL 4KK5C 5EOTB 3L3HA 3SDAD 1VADB 4B53A 2JB6A 1UFUA 3GI9H 1N3NA 1T2XA 4XNMA 1AO7E 5SWSD 2NMSA 1FRGH 2VXQL 4YE4L 3DNKA 1JPSH 1Z3GL 5F70A 4X7TA 5ADOH 4RNRA 5DMGC 2PYEB 2DLIA 2OTWB 3K4AA 5AZ2H 4OF3A 3VFRB 4XVUD 5TH2B 5DD3H 4YHPA 1OWWA 4UI2A 4D2NA 2C5DC 3ARXA 3MRCB 2HN7A 1H3PH 1W72B 2OI9B 4BFIA 3WN5B 4HZAA 3U4BL 4HJJL 1LGVA 3K1DA 3MV9A 5E2WH 4PJAA 3MYJB 3QEQB 3QQ4A 1JF6A 4P23C 2MQ0A 4LSRL 3MXWH 5L0QB 4NRXA 5INDB 5GRUL 4P2RE 5BRZE 3CSYB 4D9RE 2O5XL 3VXMD 4PRIB 4JJ5B 3TZVA 3RNQA 1I8MA 5CAYB 5DI8B 3O45B 1Y0LA 1OPGH 5KJRL 4Y4FD 3KPOB 2J5LB 5FYJH 3K8LA 2LTQC 4GFTB 3BWAA 4OZFB 1F4YL 4K3GA 1RFDL 5DR5L 1GGIH 3DGCR 3I02A 4YIQA 4HJGB 5FUCC 1MCPH 2W60A 4BQ6A 1MWAB 1SMAA 3O2DH 3QPQD 4QRUB 5LJYH 5KVFH 3SE8H 4OZGF 1J1OL 3QXVA 1JZ8A 3DRTB 2M26A 3IETA 3SY0A 5IP4A 1JV5A 1OP5H 1NGXA 3HAEA 2J7LA 4TNWK 5TE7L 4IJ3B 1JNHA 2B5IB 3MV11 5KTEL 2UZIH 2EDWA 5K9QI 3C5JB 3VMNA 3LB6D 4LHUD 4EI5C 4KZDL 3FO9B 4PJ5D 1FO0B 3OKMA 1KLUB 4QT5A 2BSRB 4YDLB 4IDJL 4J8RA 3DJ9A 4QO1A 5MEOA 3I6GA 2P8LB 4Y89A 3GIVA 4GRLD 2I9LA 5D7JC 3SE3A 4N0CC 1TQBB 3S3PA 3IFNH 4JFXA 4NQSB 4DZBB 4LQ1A 3ULVL 4GBXB 2IWGA 1L7TH 2IBBA 5FHAH 1TJGH 2VKXA 1CDBA 1QFHA 1T0MB 3S7GA 4F15C 3BXNA 4AIXA 5FEBA 1VPOL 3VXQB 3RKPA 5EA0H 5HHXL 3Q3GA 2GJ6A 3B9AA 4W6YB 1P5VA 3ULSA 3VXTB 4ZUWB 4X6DF 3BJLA 4NBXB 2A0LD 5AZ2L 4LPWA 2HT4D 3CSBA 5J1SC 4FTVE 5EU4A 1MCJA 5IMLB 5HGGS 1SHMA 5EZOL 4BH7A 3CFBA 4UMGA 1R24B 2IBZY 3ZE1E 2ZSVB 1HQ4B 4Q74A 4E5XB 1N4XH 5BV7C 5C86A 1ZSDA 2GITB 5AZEH 5JR1L 5E1HB 5TQ0H 1XGPB 1UJ3C 4XAWL 1YEKH 1BVZA 2DBLL 3M1BA 2NY0B 5CEZD 4TVPL 3FFCD 3V5HA 2D3VA 2P5EB 1RULH 1D6VL 2KQMA 5KS9E 4O51A 4HBQA 2D7MA 5I75C 4LPYA 2Z92A 3DARA 2BHUA 3GUTA 1RIVH 4FFYH 4LVNC 3F7PC 4NP4L 1Q1JH 3TT1H 3V0VA 4KJQC 4FXGB 4FQHA 1KBGH 1T80A 1IGML 1XIWB 2NZ9D 2ZJSH 1NCAH 4L3CB 1IAMA 3NPZB 1DLFL 4WTZA 4ZXBD 1LO2L 2HVKB 4LCWB 5EO9A 5GRWA 2XQBH 2XN9D 1JZ2A 5AAMA 4YDJA 1GGIL 1TETH 4G6ML 3QUZC 2OXHA 1S7XA 2E9WA 2OK0H 4TQEH 5K33A 5F1SA 2GFBB 4JANA 5E94A 2E6PA 3OQ3B 4EQ3A 3Q6FB 1DDHA 5KBNC 1E6JL 1RZFL 2BSSB 4J4PC 4XNZC 3VI4E 5GSVA 1RVFH 1MFCH 3KYKL 1W8OA 2ZUYA 2W65B 4Z7NF 1U8JA 4XNXL 3SPVA 4AY0A 5HDQL 1QBLL 4UT7H 1MFAL 4M7ZB 4UDTB 5D1ZD 4P59H 2IAMB 2JJSA 5DVOA 3MJ7B 4Z7WB 4JZJC 4OCRL 1MCIA 4GOSA 4HFWB 5IIEA 2C1OB 1ZA3A 2P5WD 3VFTB 3OJ2C 1E4XH 4KJYB 5EZIL 1UCBL 1JPFA 3B2VL 3TN0A 1QFPA 3QAZC 1IAIM 2VB5A 5J3HC 5D1QC 3X12A 4MB4A 4HAGA 4Z7QF 1GOHA 1G7QB 1DZBA 3P9LB 5D5MA 2E8YA 2VLRD 1Z0MA 5JW5A 1PYWA 4L4JA 4CVWA 4OD2B 3CXDL 4PJHA 1DQLL 2YRLA 4JM2C 4KPHL 4FABL 4WDIA 1SVCP 3HKFA 3LKRB 2HJKA 5GRZA 1EFXD 4NSKB 2IQ9H 3TCLB 1F6AB 2H3NA 5C0CA 2QQNL 3E2HC 4XPGH 1J88A 4YDIH 1F90H 4LCUB 5HHOA 4ZAKA 2X44D 1MCOH 3NBNA 3SKJH 3QNXA 3MRJA 1XMWA 1JRHL 5DJYA 3S36X 1O7VA 2CRMA 4NZJA 2AJYL 2GAZA 3L3HB 3GM8A 3NCEB 4LSSH 4M7LH 1N3NB 4X6CF 2J12B 4XNMB 5C70A 5F97E 1KN4H 3VG9B 3NA9H 4K7PX 1DBKH 3B5GA 3G6AA 3A67L 3ARBC 3MMEA 1JNNH 3P4NB 5ID1A 4X7TB 4RNRB 1GXEA 2XZAL 3WKMH 3MCLH 3TPKA 1FL6A 2D0GA 1T2JA 5SX5H 4GS7B 4L8BA 4YHPB 4ORGB 2XTJB 2O5YL 4F37K 1MEXL 2DI7A 4RDQG 2HN7B 3I6KA 4BFIB 3GO1L 5IJKA 2AEPL 1HQRA 4JDTL 1WCBA 2BC4A 5DK0B 3ZSSA 1EAJA 3OKOA 3CFDA 3MV9B 4MNHA 5LCVH 4EZMA 3CDYA 4PJAB 3QQ4B 5JMOC 3SDDD 2MQCA 3T1FA 5F93C 1YY8A 2Q87A 2F54D 4NRXB 4YC2B 4XGZA 3AMKA 3UTTE 4HJ0D 1NC2D 1CDYA 3TZVB 1ZLSH 3LDBC 1YMHB 3ILQC 4LCYA 2E6QA 1I3GL 1Y0LB 3NH7H 3X14A 1EHXA 4ZFFA 4HIEA 3ZZ1A 3W0WD 2P8MA 3B9EA 4FZ8L 1GGCH 1MNUH 3BWAB 3FT2B 1QBML 4O58L 5I8OH 4QRPE 1KCVL 1NQBA 3QXUA 3L95A 4KDTA 3OZ9H 2XG4A 1EJOH 2B7DT 4X4MA 4Y5VA 3V7AE 3I02B 2C4FU 4ONFH 4YIQB 1IBGH 2VH5H 3BYYA 4CJ1A 4LL9A 5E6IC 4OF0A 5CJQH 4YGAB 1C12A 4ZTPL 3QRGH 4MHHI 1CTOA 4JKKA 1UWXH 4JRXE 3SY0B 3IETB 3T3MF 4PYGA 2XZQH 1NGXB 1U2CA 4YEEA 1T1XA 1BBDL 2PYED 5EUOA 1JNHB 4LLQA 4PJIE 2BFVH 3SGJA 3LN5A 4U0QB 3CJJA 3OKMB 2CKBA 1PQZA 4QT5B 1A22B 4J8RB 4U1SA 5MEOB 3I6GB 1JCKA 3GIVB 2I9LB 3OXSA 5HVHB 4QTHA 2GSIA 4GRWF 3QEQD 1MHPH 2X5PA 3LPWA 3DO7A 4TSAH 3VFWB 1Z9OA 1ZLVK 1DLHA 5F6IB 3LZFL 4JO4H 1I1AA 3D1MC 3QIBB 1GHFH 4PRID 5KOMC 3CDFA 4WI8A 5DRZA 1E4JA 5I6XC 3T77A 5FXCH 1B0WA 3VWKA 4GH7B 2V17H 5MI0C 1E6OL 3Q3GB 2HT2D 4Q6IC 3O0RL 4UUJA 1JNNL 4E41E 5SX4I 2BOBA 4LCIH 4L4VE 1JPGA 1PVHA 2AK1L 3MCLL 3MBEA 2SEBA 1PDKA 2UUDH 5EU4B 3FN0L 1MAKA 1I3VA 3LVEA 3GGWA 1OGAA 4BH7B 4OKVA 2R4RH 2RHEA 3ZSTA 1HHKA 5I1CH 3WD5L 4HKZA 4M5YH 1ZSDB 2W9EL 1A7RH 3M1BB 3P9MB 1IQWL 3V8CA 5IVOA 2AXJA 3CGTA 2VZOA 5J57B 3V5HB 4CADA 3N9GL 5DJ0A 4O51B 2KZWA 1EUUA 4R3SA 2CD0A 4JB9H 2Z92B 1TITA 3GUTB 5TF1H 2RFXA 4FQHB 2E5EA 4OFYA 5HD8D 3MLSH 1OL0A 2VXVH 1BZQK 1MCHA 1LDPH 3DURA 5T3XH 5EO9B 1ZT7A 4P9ML 2PETA 7FABL 1QSFA 2CO7B 5EULV 2X09A 1RUAL 1S7XB 4GBXD 5D7IE 4Y1AA 3M07A 3OJDA 4LIQL 4TOYL 3GMQB 4JANB 5E94B 1AQDA 15C8L 4NCDA 2P44B 1DDHB 3KLSA 4M4PA 4MXQC 3ZKND 5GSVB 3ZKXB 1FL5A 1RJZA 2J8UF 4I77L 1U8JB 3SPVB 3I3EA 1GIGL 2R0KH 3RVUC 3O41B 3B2UD 1UENA 1F6LL 1CU4H 4RZCA 4GAFB 1K4CA 3HR5A 2DQIH 3RZCA 4HUMB 4PV8A 3ARFC 4YPGA 5IIEB 1JHLH 1ZA3B 1J1XL 1IILE 5F6HJ 3BQUC 4S1QL 3JV4A 1JGLH 3T0BA 1EEZA 5BJTA 3TYGH 3W9EA 3N06B 2NY0D 4HDIA 3RWIA 1RY7B 1NKOA 4FQXC 4L8DA 3RHWF 3LKNA 2ESVE 2P5ED 1UYWL 4U3HA 5D5MB 5DURB 5JW5B 1OAKH 2E27L 4PR5A 1PYWB 4MWFA 3WUWA 3V7AG 4IRZH 3RDTA 2CJUH 2F53E 4PJHB 3DXAA 1DBML 5I1HL 4WDIB 3QQ9C 2HJKB 1J5OL 4DGYL 2FHFA 3DV4A 2H3NB 2V17L 4MVBD 3U0WH 5C0CB 1XIWD 2WBWB 3ALXA 3R4DA 3SDAC 3WIHH 5HHOB 1I7UA 5L2KA 4ZAKB 4LCWD 2FBOJ 3QNXB 3MRJB 2HTLC 1BFVH 4PIRF 1U3ZA 1DQML 5DJYB 1NC4A 3DHJA 3U48A 4X9HA 1YYMH 3V5DA 4PTTA 4LGRB 4GXVL 3VFVA 4XBEH 4LCCA 3RBGA 5F89A 4X6EA 3AS2A 3L3KB 4NO0A 5CJOL 3G6AB 4NWTH 4YO0A 3MMEB 5ID1B 2EDYA 3CD4A 5EU6A 5FUZH 2IAMD 4L8BB 1GAFH 4U3XA 4R97C 5IFAH 5JPNB 3I6KB 3HMXH 1HQRB 4HMEA 1WCBB 3VGGA 1MJ7H 3OKOB 1CCZA 3NIGF 5AG9A 4MNHB 3RAJL 4YXHL 5F7MC 1RZ7H 1YY8B 4WUUE 4Y4FC 3HFMH 4XGZB 3RVXC 4HS8L 4TPRH 3MLVL 2VE6A 5JIHA 3F6LA 3BPNB 4W4NA 3ECBA 4KMTH 4GAJL 1QP1A 1MCLA 4XP4L 1B6DA 3NOIA 4JPVH 2FLRT 4LCYB 5FIEA 3MLYL 5JOPD 3X14B 4DN3L 4WI5A 5TDNA 1NEZG 1LE9A 4AG4H 4HIEB 2P8MB 2CRYA 5DFVC 4TNWF 2YPVH 3QO1B 5C09E 4A6YH 4OLWL 3VXSE 4GRWH 3ULVD 4NKIL 3BPOB 2ZCLH 5IT2H 4Y5VB 3WIFA 1WSST 3D48R 4PJ7E 5FM5M 1A6ZA 4HT1L 4U7MA 3FFDB 3AM8A 5F7FA 1JUFA 1TXKA 5MP6L 1CGYA 1DL7L 5EIVA 4BFEA 4A2MA 4AJ0A 4LAQL 2DQGL 3V52L 1RUMH 4UINL 3LRHA 2O5ZL 2EECA 1N2RA 5I1JH 1M05A 1T1XB 2AGJL 2YD8A 4GRLC 5EUOB 4KTEL 4LLQB 3QULA 5SWSE 2D31A 1V3MA 4LFHD 4PGJA 2J6EL 1FSKC 3LN5B 1LO3L 2XTJD 1ND0A 1RUKH 5DO2D 3SDCB 2CKBB 1PQZB 5IMMA 3H7LA 3O6FC 3IYLW 3A0OA 3S5LG 1FYHB 1ZTXH 3OXSB 4OT1L 3KWWA 1UKTA 3MV9D 4QTHB 3VWJA 2ARWA 2AJUH 3DO7B 2D4FA 2MCPH 1DLHB 4JHWL 2XA8L 5E8DL 3T04D 1MCEA 1I1AB 2NCMA 1FFNA 2ZUQB 5SWZA 3H3PL 3TZVD 4NUJA 2R39A 1YYML 1NCNA 5EU7C 1YA5A 4ZOAA 5DRZB 4QKXB 2A0LC 2XRAH 4TSCL 3T77B 3VXME 2HT4C 5H37G 1JNLH 3VWKB 2FGZA 1T03H 3LPFA 4NN5C 3U30B 8FABA 3UTZA 2JJVA 1WJ3A 1RK1A 2BOBB 5CS7A 2I27N 4Q0XL 3WFBH 1MFEL 2CPCA 3Q0HA 3SHSA 1JPGB 1U41A 5F7EL 3TVMA 3GMLA 3MBEB 4ISVA 1IC4L 2ICWI 2QSQA 1D5MA 4JJHA 3GGWB 1OGAB 4OKVB 1HHKB 3ZE2F 4HKZB 5IBTL 3VFGL 1KLFA 4HIHB 4UOW0 3WNPA 4JPKL 4LPXA 1ACYL 3QUMA 4JQIH 4HWBH 4XPBL 3MUHL 5GGRA 4CADB 3TJEL 5DJ0B 2NZ9C 3ZL4L 2AVGA 3LMJH 3RVVD 4R3SB 1BEYH 1D9KA 4ZXBC 4Z7UA 5C0GA 2ARJA 5HGDB 4XNUH 1OD7A 2RFXB 4LLWA 4JDZA 4PJ5E 1TJHH 5CLTA 1OSZA 3PQYA 4KWUA 1YEEH 4YQXL 2NX5A 4H0GA 3DURB 4NNPH 1ZT7B 1UA6L 2XA3A 1QSFB 3CFKA 5CEXA 3RJQB 2QSVA 1OP3K 3U82B 4Y1AB 4HHAB 3UYRH 3F5WA 3L3OA 3S37X 3OJDB 2MPAL 2DI9A 5ISZE 3UTQB 3SGEH 1AQDB 3HNVH 3IXAA 3RVWD 5JW4R 1I4FA 4CL7A 2BVEA 1FL5B 4OLYL 4C4KO 5IB5A 3VRIA 3EYUH 2DQJL 3WHE1 4H1LH 1ZHBA 2VDQL 5ESAA 4OFPA 1AXTL 1ES0B 1E4KA 4PRPA 4RZCB 1K4CB 3HR5B 3RZCB 4PV8B 5T3ZL 4YPGB 3PABA 1AI1L 1X5AA 3MNVA 4QHLA 4WO4A 3JV4B 1EEZB 5IQ7H 4ONHA 4WWKA 4YHMH 5FV2A 2ZPKH 3W9EB 4HDIB 3D0VA 5CZKA 1YNLL 3RWIB 3ELAT 2MCPL 2QQLH 2EYSA 4BQBA 4L8DB 3LKNB 4PR5B 1PGRB 1G9NC 2BVQA 2CK2A 2X7LA 4MWFB 3WUWB 3RDTB 1S3KL 4JY4A 4HULB 5HYSG 5CEZE 3G5XA 4JQXA 4Y19A 2OXGA 3DXAB 3FFCE 2W0KA 3BAEH 3EBAA 4LLYA 5GGTH 3LD8B 4J2XA 3DV4B 1T03L 3QFJA 1P5UA 5KN5B 3OPZH 2BVOA 1ZLWK 5L2KB 1I7UB 3HLAA 4JPWH 3JWOC 1EEYA 5FA4B 4F37F 1AR1D 3VXUA 1NC4B 3OBAA 3I85A 5FO9A 2BXYA 3V5DB 4F58L 4UB0L 4XCEA 1RHFA 4PTTB 4YHLL 3MJ9A 3DRQA 2XN9E 4LCCB 5CUSL 3VFOB 5EU5A 1FHGA 5GIRA 4WW2C 1X4YA 4U3CA 5F89B 4NZTL 4X6EB 4NO0B 1BAFL 5I66B 1N7ML 2UV3A 2NY4C 1ORSA 5EU6B 1HKFA 4J3SA 1G9MH 1JGUL 4HD9A 3T2NL 4K2UH 1HILA 1RMFH 3BZFA 5JQ6H 1KIRA 2R1YA 3I9GH 4JFOA 4JG1L 5DMIH 3SDDC 4BUGA 3FRPG 1BEYL 4G42A 2AJXL 4ORZC 2I5YH 4CMHB 3UXFA 1R6VA 4HJ0C 1DBBH 5LGHH 4DOHE 3QUYA 5B3JE 4RWYL 5ACZA 5DUML 3O3EA 1N6QH 1B90A 5JHLH 4NJAL 5A43C 2P5WE 1X5YA 1NSNL 4ZUTA 2VE6B 1AFVH 1HKLH 3FQUA 4UT9L 5DURD 1WWBX 3B9KA 4OLUL 4LSTH 3EYSL 2EIEA 3EFDH 2DQTH 2VLRE 1MY7A 5TE4H 5TDNB 1LE9B 1V7ML 2YSSA 2R0ZL 4KI5F 5C0CD 4OZIE 4P2YA 1DBAH 1Y6KR 4MNGA 1WUNT 1QSZA 1S7QB 5HHOD 4IOIB 4ZAKD 4L8CA 2A73A 3NCYP 4EDXA 2OL3H 3G9AB 4HGWB 3WIFB 3A6BH 1A6ZB 1OARH 5E9DA 3INUL 1TCRA 1FCGA 1JUFB 3MV7A 4U1KA 1T1WA 1LP9F 1OF2B 2H2SD 3V6BR 3ZDZE 4M61A 1J7VR 3QUXA 1NAKH 4U0RB 4LHUG 3NCJH 5FYKU 2HH0L 1N2RB 3MROA 4HC1H 2OI9C 1M05B 3P9WB 1GOFA 1F42A 1DUYA 3QULB 4PJBF 1EH9A 1T89A 5DJ6A 2X4UA 2NR6D 3ALWA 1ND0B 3IKCA 2AQ3A 5L0QC 4NO2A 1VEOA 5IMMB 2N4IA 3ES6B 4OV5A 3RX7A 1JZ6A 4M7KH 3QYCA 4AEHH 5T5FH 3KWWB 4HWUA 3UTPD 3V6FB 2UY7A 3P11L 2VZSA 1JFQH 2DI8A 3ESVF 4R2GB 3VWJB 1EHLL 1T6VN 1WFNA 2J5LC 4HMDA 5J9PA 5E99L 1FFNB 2DKUA 2X10A 1Q94A 3KAAA 2WIMA 4P9HC 4NUJB 3RTQA 2HT2C 1A7OH 5L7XH 2VDKH 3NPSC 1AD9B 1N8ZA 4UDUA 4EVNA 1FNEA 1HZHL 2CSPA 3OTTA 1KT2A 3KS0J 2NY7L 1BJ1J 2YKLL 5I73C 2BJMH 3VRJB 4MHHG 4MJIA 8FABB 3UTZB 1RK1B 3JUZA 3HZMA 5D8JL 3VE0A 4MS8D 1MELA 1JP5A 3W0WE 3TA3A 5KG9A 3TVMB 4ZNCD 3LRSA 3HNTH 4U4BA 1D5MB 4PJEF 4KC3B 2I5YL 2Y6SC 4X99A 4IJ3C 2B5IC 4YGVA 1Z0NA 4M6OH 5KZCB 1Y18B 3FZUD 3DYPA 4Z7VA 1NANI 1P4LA 1ZT1B 4YDLC 3EO1A 3RIAK 3SOBH 5C2BL 3MFFB 1A6UH 5GGRB 4OD1H 2BP3A 1FVEB 2QHRH 1T83A 3ARDA 4FMKA 4WV1A 1TQBC 3MRGA 4Z7UB 3PXJA 3RY5A 5C0GB 2ARJB 5ECJE 5KVDL 1F4HA 3MLXL 4LLWB 4JDZB 5F9JA 3UTOA 4OQTL 4POZD 1H3TA 4LAJH 1U8KA 5I8CA 1OSZB 4BH8A 2NX5B 3VFMA 1INQA 4S1RL 4QRRB 1BVKA 4N8VG 1I1AD 3CFKB 2VAAA 5CEXB 2K1MA 3QEQE 4ZFZA 2ADGA 2IANA 3P2TA 4Z78A 3ZKNC 4KROB 4YHOH 1CFQA 3L3OB 2IPTL 4CJ0A 3O2DA 4LSVH 1V3LA 5KSBA 3F62A 4PRIE 3PWJA 3B2UC 3VWKD 4UIKL 2WUBL 5C9JA 1I4FB 2VR9A 3C5ZA 3MRLA 5IB5B 3VRIB 5CZVL 1CVSC 5J0BA 2YZ8A 4V1DA 1ZHBB 5H8DA 3MBED 1QTYT 5ESAB 1LVEA 2VXTL 5DZLA 2WBKA 4HWZA 2NY0C 3CLFL 4PRPB 1OGAD 1QHPA 2OR7A 3HCVA 2OBGA 3PABB 5FYKE 5CLWA 5IHBA 1FZMA 4AEHL 4QHLB 4WO4B 4J3WA 4ONHB 4WWKB 4KFZC 2HJFA 2ED9A 4HXAL 3D0VB 2EYSB 1NAMH 1Q0XH 4AM0A 4TN9A 3OMZA 1SBSH 1OM3H 4ZFGL 5SX4H 1AH1A 4MVBC 4XTRD 4HCRH 1XIWC 4PJGB 2BVQB 2X7LB 5HGAB 3MODH 4LP4A 4JY4B 3WEXA 3PP4L 3G5XB 1KTKE 4AT6B 4LLYB 4PB0L 1ZGLB 3HPJA 5F7NC 1CS6A 3OX8B 1N5YL 4PJCF 3QFJB 2DJUA 5BZDA 5I2IA 4OFYD 2D7PA 3VGEA 4P57A 5DZNA 5LGJA 1I75A 2BVOB 1QYGH 1BHGA 4PD4K 3UMTA 3QHZL 4GMSL 3FO1A 3HLAB 3IGAA 1CFVL 1EEYB 2FRGP 1CFBA 1QSFD 4J3TA 4DAGH 3VXUB 1F4XH 1PY4A 2MFNA 4LDEB 1DN0A 2W0FA 1BMGA 5IVZA 5FO9B 4NNXA 4Y1AD 4PBWD 3EDKA 2FJHB 2VJXA 5E7FA 5HHMB 2ZCHL 4G3YH 5EOCJ 5CKGA 3MA9L 5EU5B 4E42A 5GIRB 2NY2B 2IAMC 1G7HA 2D03L 5DLML 3W39A 1I9JL 3ZE1F 2I07A 3EOTH 1ZHLB 2K9UA 3L7FB 4M48L 5JUEL 3H9YA 2UZXB 2X4SA 3O2WL 1JYVA 1GZPA 4M02A 3BZFB 4AENB 1NPUA 2R1YB 4JFOB 4G42B 1LWRA 2JKXA 2EXYC 5FYLD 3RZCD 2A77L 3O9WA 3QUYB 4ODWA 2HMID 2JJWA 1ZE3C 2XICA 1QACA 2GJJA 1L7IL 1RV6X 5ACZB 2WBJA 3O3EB 1G0YR 5I15L 4NNYA 5L6YL 4G80A 3EDJA 3HE6B 1ZLVH 5L2JB 3UROR 5DRNA 5DT1H 4ZUTB 3DUHA 3FQUB 1UADC 2GYSA 3B9KB 1AE6L 3S34L 3RDTD 1KB5L 2FD6H 1J1PL 2KPNA 3DXAD 1NUGA 3OR6A 3VJ6A 4HPYH 2P5EE 1LMKA 2P4AB 5LXGH 4XXCC 4N68A 1RZJL 4MNGB 4QRTB 4W4OA 4ODHL 2VL4A 3FO0L 5L2KD 3HN3A 4L8CB 2A73B 4KDVA 4FQ1L 3MOBL 3V9FA 1CGTA 2Y36H 2XKNA 5GHWL 1NC4D 1WISA 3KJ6L 1RJCA 2FB4L 2NTFA 5E9DB 2IG2L 2H45A 1TCRB 2MMXA 4LCWE 3MV7B 4U1KB 5DGRA 1T1WB 4NKMA 3VW3H 3IF1A 2P42B 4GS7C 4M61B 4UU9A 5AG8A 2APXA 3MGTA 1UVQB 2XTJC 3QUXB 4NO0D 5DO2C 4PRBA 5E6YA 4NM8L 5HJ3A 3MROB 2EDKA 3KPNA 5EU6D 2R8SH 3QDMA 3ZYJA 3S35L 1DUYB 4TSBH 3WFHA 3BKML 1A1NA 5IKCA 2X4UB 5E7BA 4CVZA 2HKFL 3IKCB 2R4SH 2ADFH 3VH8G 3M8OL 1WIOA 4M43H 4NO2B 4WEMB 4YC2C 4M6NH 3P4LA 3RP1A 4OV5B 4M1GL 3IJYA 4PG9A 5C0AB 3TZVC 2GT9A 4TUKL 5J8OA 3A6CH 1A3RH 2EE9A 2H2PC 5HI5D 1NFIA 4S1SL 1DVFA 3ORJA 1F3DH 5J9PB 5CJXC 5DEZA 1Q94B 1VEMA 3QB7C 4PREA 1F4XL 1A2YB 4NFBA 3RTQB 1HIMH 4WW1B 1N8ZB 5DD1H 2PR4H 4RRPA 4UDUB 4EVNB 1GC1H 1FNEB 4G9DA 1KN2L 1KT2B 4X8XA 2DTML 2NXYC 4X7SL 4Z7OE 2AJVH 5F96H 2E9BA 2HWZH 3CLEL 5JOPE 4YWGL 5JXAL 3AS0A 4RX4A 2DL9A 2C26A 3JWDH 3HZMB 4N8PA 1L6ZA 4CN4A 4FZEL 5HVWA 3CK0L 1ETZA 3TA3B 5KG9B 2R2EA 2XT1B 3LRSB 1BGXL 1A6WL 4JG0H 5MENA 4PJXF 5F7UA 4FQCH 1MCWM 3ULVE 5C0BA 4NWUH 5C71A 4X99B 3GSOA 4XVJL 1FIGH 4YGVB 3IDIA 4HFUL 1AQKH 3SDXF 2EIZA 2XQYK 4U2ZA 1IGFL 3HHRB 4ZTOH 3WFCL 4KZEH 4Z7VB 1P4LB 4LPUA 2NTSP 4HMCA 3EO1B 4OZGA 5D96B 1YECL 2IMNA 5JOFA 2DQEH 3REVA 2NY1C 4YZFE 2E3VA 3MPCA 4M00A 1FNFA 1FNAA 3SE3C 4ZD3L 1NGPL 1G6RH 1J0YA 3ARDB 2B0SH 5F6IC 4WV1B 3ZTJG 2QQKH 3MRGB 4FQQA 4OCWL 4AL8L 3QCUL 2Q8AL 5E8OA 1IGIH 1X6NA 3K8MA 5F9JB 5E2TH 2XTJE 3VWJD 4R2GD 4KQ4L 2Z93A 5I8CB 1U8KB 2M2DA 4BH8B 4FOMA 5F9WC 3FQRB 3VFMB 1INQB 1BVKB 3MA7B 4QYOB 2FBJH 3MV9E 2VAAB 4PJAE 2WLZA 2D7TL 4ZFZB 5SWZD 2ADGB 2IANB 4K3JH 2DLHA 5FGBC 4X5LA 3NN8B 1LK2A 5EIIA 2RQ8A 1K8IB 1W0VA 2HKHH 5LBSH 3UZQA 1U8MA 1A7PL 1X5ZA 1SJXA 3PWJB 1QSEB 2YOCA 3KPQA 2AK4A 3U6RA 5C9JB 4B41A 3C5ZB 3MRLB 35C8H 4V1DB 4QNPE 3MV8B 3MACL 2NNAA 4K8RL 3TVMD 2E8ZA 1UZ6F 1X3DA 3AXLA 3TH3T 1TPXC 2X70A 4HWZB 2R4SL 2C3VA 3RRQA 3P0YH 4X6DA 5I74B 4GAGH 1KEMH 2DWDA 3HCVB 4WVRA 2RB8A 1FZMB 2UWEF 5KZCD 4YHNA 2HJFB 3LKQB 3LCYA 5D1XC 4JRWA 2WWKT 4AM0B 3O4OB 4I0CC 3QDHA 1FVDA 4OLVL 4RGMB 5IB1A 5JTWA 1CR9H 3WEXB 5D71H 1Q9OA 2WUCL 3HPJB 5I1KL 1ERNA 1AR1C 2V7HA 1IC5L 3LKOA 4QF1A 4OUOA 5DC0A 2VXUH 4P57B 4M3KB 5LGJB 2I60H 3PQYD 3TIDA 3BH9B 3FO1B 4PRDA 2NX5D 4KK9C 1NMBL 4GAYA 4L1HA 4OZ4A 2PW2A 3IGAB 4LSUH 5FGCB 1A4JA 3C5SB 5CINL 3ISWA 3QWRA 4GG6A 5HYJA 3ZKXC 5IVZB 2W0FB 4KROD 4NNXB 4QLRA 3UTSA 1J87A 2G60H 2A6KA 2V5YA 3R0MA 4TUOA 1CLOL 2FECI 2VUOA 2B20A 3CU1A 4OM1L 2JJSC 1BJ1H 1G7HB 2APTA 3W39B 4M62L 5BMFH 4JO1H 5EPMB 5J89A 1CBVL 4KK8D 4JN1H 1IKFL 2X4SB 3C87A 1GZPB 4QRSA 3TN0C 4TULL 2GJ6E 4JFYA 4OZHF 1Q9LA 4PRPD 5C3LD 4HKBA 2EICA 4BKLA 3ULUC 1ZMYA 2L4OA 3S9DB 4ODWB 4ONGH 1IGIL 2OP4H 4WO4D 4HPOL 4PD4J 1KJ3L 2WBJB 4WWKD 1NGQH 4NNYB 2F58H 4G80B 4WCYH 4Y2OA 4JO2H 2B39A 3DTXB 1DQJB 1C16A 4MAYC 5DRNB 1AXIB 1S5IL 1FN4A 2Z0BA 3PL6C 4ZAKC 4LOUC 3VJ6B 5IEHB 1T22A 25C8H 4LF3A 3SKOA 4F7CA 3CPLA 2O26U 3O11A 3QFJD 5HDOA 5GRYA 3HI1A 3WSQH 4U49A 1U9KA 1CE1H 5IB3A 4Y4KA 1YQ2A 4FP8H 2EXWD 3B8YA 1X5FA 2GQHA 3DSFH 2LU7A 1WBZB 4ZO9A 3T2OA 2XKNB 3VXUD 4WRLA 1AGCA 1OWRM 2H8PA 3BE1L 3DI2B 2PUQT 4NZRL 1RD6A 2NTFB 1KJ2H 5HHMD 3MGOA 5F1KC 3MLWL 4ENED 4Y5YB 4NKMB 3IF1B 1I85A 4DJMA 2NY2D 4UU9B 3KLDA 3MGTB 4LFHG 3RA7L 2B1HH 1GGBL 4K94H 2P47B 4PRBB 2IJ0C 5HJ3B 4OAWA 5EO0B 5FFLA 4I9WD 3KPNB 3L7EA 5IJKC 1EEUA 5DJCA 3QDMB 4C56A 1AY1H 1MRDH 3WFHB 5IW1A 3ZDYE 5ACLA 1A1NB 3SJVA 3BIKA 4XMPH 3VGBA 5IKCB 4CVZB 4F9PC 3MLZH 2HFTA 1NFDF 4YPJA 3GMNA 2R69H 1T5XA 5IHUH 3QUYD 4PPTA 3IJYB 3O3BA 4PG9B 2XWJA 5D7SH 2V7NB 2GT9B 5ALCH 4P4KC 4EBQH 4XP6H 5TGBA 1NFIB 1ZHNA 1DVFB 4RMWA 2FGWH 4NRZA 4KV5E 32C2A 4TNVK 3B9KD 4PREB 3DX6A 3EYOA 1OP3H 3MC0A 1ZWIA 2Y1VA 4GKSA 3IJSA 3LKPA 4KDTC 5D5ME 4Y5VC 1FZJA 3RU8L 4PJ9B 1G7JA 1HINL 1OAUH 3RIAF 4PJHE 4PJDF 4OTXH 9CGTA 1QD0A 2XYCA 5ESQA 4FG6C 3T08A 5BVJA 5IFHL 4KRLB 2JELH 2HAZA 3IAQA 2R2HA 3FN9A 1OGTB 4IOSD 1K3ZA 1DR9A 1ETZB 5C0CE 2R2EB 2DLFH 3FZUC 3VXRA 5MENB 1C5CH 2BNRA 5E9DD 5HHOE 5C0BB 3MV7D 4O9HL 1KCRL 3HAEG 4R26H 4LSPL 3GSOB 2ICCA 4ZUUA 3IDIB 2EIZB 3SGJC 1WFTA 2F74A 3QUXD 3T0WA 4F57L 5DRXA 3IU4L 5JOFB 4EJ1C 3IFLL 2UVFA 4N9GA 3REVB 3TNMA 4POZC 1XFPA 4L9DA 4ZS7L 4ACPA 2AEQL 3FN3A 1REIA 2I25N 1RZKC 1MAJA 2GTZA 1I1AC 4XPTL 3KPLA 2ZUQC 3DECA 4XAKE 1BWMA 5AYUL 1Q0YL 4Z0BH 5C0AD 1G7MA 1M7XA 2OTUA 1F8TL 3F7VA 4AK1A 2Z93B 4JPIA 2CR6A 1ZLWH 1HH9A 4PV9A 4XC3L 1S9XA 2NW3A 1KELH 5GGSY 3B6SA 4A6YA 1TQCB 3VXOA 3UTPE 3U30C 5BV7L 2BX5A 3GKWH 3RTQD 3H3BC 1PZ5A 2YUXA 1YQVH 3TBTA 1LK2B 5EIIB 5M94B 3KJ4B 4XCYA 4FNLH 1W0VB 5CCKH 1U8MB 1UEMA 2WWMD 2PTTA 4MZ3A 2QKIB 5DJ8B 3FB7A 3D25A 3JV6A 4D9LH 4WI6A 5I18L 3KPQB 3GFUA 2AK4B 2B1HL 2CO6B 5CILL 2XFXA 4E0RB 1FH5H 2A1WL 3K0WA 3TESA 3GKZA 4AEIL 3TA3D 5IF0A 2BRRL 1FYTA 3BT2L 4KTDL 4YHIA 2X70B 1U6AH 4YK4C 2C3VB 3O3UN 3OKYA 1XF3B 3E8UH 4ALAH 4X4ME 2DWDB 2I9TA 3MJ8A 3WFDL 2E9JA 4IBLT 3FO2B 1X44A 4NCC2 1FL3A 3ETBF 5E08L 5BQ7B 4CU8A 5HYIA 4UT6H 4C83A 4NC1C 5GSRA 1VGKA 4KHXH 5ERWB 5ITFA 3C8DA 3VG0L 5BVPH 2LTQB 3BMVA 3EJYD 1QBAA 5IBLC 1BQHG 1IAIH 1BIIA 1FVDB 1RIHH 3OWEA 2I26N 1IGJA 4M6AA 3ARDD 4N0FA 2VXSH 5EUOE 1Q9OB 2PNDA 4ERSL 2V7HB 1OAXL 3LKOB 2Y5EA 5E6IA 4DQOH 4GJTB 5DHVH 5C0DA 2FX7H 1V5JA 3TIDB 4PRDB 3IDGA 4OZ4B 4GAYB 2PW2B 4U1NB 4M8QA 3UJIH 1D5ZA 1A4JB 2DLFL 2IAND 4GG6B 4ZFOA 2ATKA 5HYJB 1NMAL 1V7NH 1IFHH 3UTSB 4LHQB 4TUOB 5FUOL 4EI5B 1MCBA 3GMPA 4NOBA 5EOCL 1QSED 3O6KL 1NCWL 1R3IL 2GY7B 4OJFH 3P40A 3C5ZD 3RZCC 3BPLB 5ABDE 5ILTL 5A3ID 4Z8FL 2HMIC 4TYUA 4V1DD 3MV8D 4HWBA 4LASH 1YEIH 4PG2A 4QRSB 4NHCL 2J8UA 4JFYB 5F3HA 1P4IL 4EDWH 1Q9LB 2X05A 4HKBB 5DXWA 3U7WL 4BKLB 3ZE0F 12E8H 1TZGH 4I18C 4PGCA 3RDTC 5E8NA 2F9BT 1OGAE 1G84A 4KKBD 1V3KA 3PV6B 5KVGH 3WO4C 3RPKA 4ZMAT 1RUQL 5FCUH 1T3FA 1QHOA 4JFFA 1ZS8A 4WI2A 1NBVH 2HFEA 1A7QH 1FFPA 1YEHH 3N50A 1A6VH 1T22B 1B4JL 4HIXL 4DFIA 3BZEA 1S8DA 4XWGL 4LF3B 4XX1E 3DYMA 2GCYA 3SKOB 4D9LL 1FP5A 4MNQA 3WFZA 2BVUA 3VGHA 2IALA 5IB3B 4Y4KB 2ICES 5F72S 4WFHE 3LSOA 4OBRA 2W9DL 3JVGA 1UJ3B 2F5BL 1V3JA 4YDVA 1JK8B 3PE9A 1BM3H 2H8PB 4RFOH 1OSPH 3MGOB 2IC2A 2DQUH 1QSFE 1CXFA 2DDQL 4NQTA 3D69A 1W0YT 4Y1AE 3T3PE 3P3YA 4GSDH 1JNJA 2R29H 5T33L 3VDAA 3QXWA 1MCSA 3QHFL 4CMHC 4OAWB 3L7EB 3ZT6A 4DVRH 5JA8B 2BY1A 5DJCB 5LWYL 4C56B 3EZJB 3NAAH 2LE9A 5IW1B 3OKNA 3SJVB 3BIKB 2QADB 4NQCA 4G8FA 2LQRA 3D18B 5F1IA 3NZHL 4HWEL 1AR2A 4MJ6A 3GMNB 3QUZB 2B4CC 1T5XB 5FHBL 4EN3C 5I16A 3O3BB 3S3JA 5K9OB 2R0LH 2XWJB 3F58L 5GGTA 1HHHA 2OM5A 1BWWA 2WBJD 5TGBB 5FYLE 4PLJC 4O00A 1KGCD 1ZHNB 4LSDA 4NRZB 1T5WA 4OM0L 32C2B 2A83A 1VACA 5EWIH 3VGAB 3DX6B 3EYOB 4DN4L 4GKSB 3IJSB 4ODTL 3LKPB 4OLXH 1OVZA 1FZJB 4FXLA 4OIIH 1EMTL 5B4MD 1G7JB 4JZJB 1TENA 3VCLA 5C0RH 3AM8C 3DXAE 1INDH 4OCYH 3WCYA 5ESQB 1V05A 1QOKA 5BVJB 1EHNA 5JZ7D 4S0SD 3QAZB 4M03A 1JPTH 1MRFH 2CUIA 5D1QB 4U0RC 3VXRB 4AYFA 1BQLH 4I1NB 4MDIA 5L2KE 1ONQA 3D9AH 4LRNH 12E8L 4JO3H 4X7DC 1A5FL 1WVZA 3D85A 1QLRA 4ZUUB 4EEEA 4HXBL 3SN6N 1DQDL 1OTSC 2F74B 4YAQA 4WIQA 1CFTA 5DRXB 1A1MA 4ZQKA 1QFWM 3QCVL 3AY4A 5B3JF 4PB9L 3E2HB 3QDMD 3V95A 5IESH 3TNMB 5GGVL 3L5WB 4R2GC 3QPXL 4G6FB 3RGHA 2OZ4A 1YEHL 2ZUWA 4PJIB 4YFDB 3RIFK 1T2QH 5EU6E 3MZGB 3WXWH 4BYHA 1OLLA 2GTZB 5EDXA 3KPLB 1PG7L 4P5MA 3Q2CA 1G7MB 2VL5A 2OTUB 3F7VB 4FXKA 4H26A 4JPIB 2QHLA 1F58L 3TBYA 1DVFD 4PV9B 3KGRA 2NW3B 3B6SB 3LHPH 4Z0XA 1ITBB 1PKOA 1LO4H 3VXOB 4OZIF 4R4BA 4Z5RA 4BZ1L 4FRWA 4JFZL 2OL3A 1PZ5B 4MXWH 3TBTB 5I1GL 1NCCH 3O6LL 4D9RD 1UQSA 4XCYB 1BQUA 3FRPA 4G6AC 2PTTB 4LMQI 2L0DA 2VERN 4PJ9D 3TVMC 3FB7B 3D25B 3JV6B 5JNYA 4LLUB 5IB2B 5JHDA 1JWUA 4JR9L 4RX4D 2XFXB 2MHAB 3U79A 2DBJA 1NGZA 4P5TA 5I1EL 4HC1A 4D3CH 3K4ZA 4XNYH 5IF0B 1GL4B 5E5MA 2DKSA 1FYTB 4YHIB 1F4WL 5MEND 3FTGA 4KVCH 5C9KA 2DQHL 2EDJA 5C0BD 1NMCC 5A40E 4EXPX 3WDHA 3LDBB 3X3FL 1IQDA 2JF1A 2EH8L 3MJ8B