4KI1A

Primitive triclinic crystal form of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
208
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG EPSILON CHAIN C REGION
publication title A range of C3-C4 interdomain angles in IgE Fc accommodate binding to its receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 208
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A02
2X42A 1OLLA 1Z3GL 3DVGA 4F58H 3TA3B 4MA7H 4DN4H 1AGCB 3DO7A 4LKXA 3HC4L 3QCVL 1AD0B 4WEBH 2R2EA 3IJSB 2CRMA 4U6TA 5D1ZD 3UO1L 5ID0A 1U6AL 5I1EH 5F6IC 4Y2DD 2X1WL 3A6CH 3WSQH 5IEHB 1L7IL 4H1LB 3KLHD 4OD3H 4NSKA 1CDHA 5A2IH 1QBLL 3BO8B 2BOCB 4LGRB 3B9KB 2EDHA 3WO3B 1BZ9A 1MIEH 2FATH 1QFHA 4KJPC 4U1KA 3MJ9L 2H45A 4JFYB 3TVMA 3NCJH 3NA9H 5HYJB 2Q3ZA 2D0HA 3L9RB 3PJSB 5GGUB 1I8MB 3RWIB 5I8EA 4EI5A 1Q9LB 4R96B 3MLPA 3EJYD 1H3PL 5DRWA 4NCDA 3JV4A 4IRJB 2ZUVA 3GRWH 3LIZL 4FQHA 4PJIF 5ERWB 5B21A 1E6OL 4N0YH 2FD6H 3OHXA 1HQRA 4BSWB 1FNGB 5MEPA 4R4NC 4NUJA 1DN0B 1BQHB 3WO4B 2L7JA 5D2LB 4YGAB 1YDPB 3PQYB 3V2AR 5BMFL 2XKNB 5H37G 5IMOB 2FH6A 4DOHB 4LCIL 2E27L 2X70A 5E2UH 1AQKL 4MA3A 5D7IF 5E00B 4PUBL 4LIQL 5DVLA 4GQ9H 4YPGA 3MJ6A 5I1IH 4FQ1L 4O2FA 1SYSB 1JCKA 1DBJH 4YIQB 2C1OB 5D6DA 5GGRA 4HQQH 1U8PA 5IW6A 1QQDA 4U2YA 4XAKE 4NCC2 3RBSA 3TVMD 1WFNA 5EORL 2NY0D 3FRUA 3L5HA 3UTSA 4O2EA 4KAQL 3RX7A 3VXME 4DGVL 1MWAB 5SWQB 1N7ML 2OR9H 4EI5D 4Q6IC 4NPYB 4HUNB 4RNRB 5EC2B 1W0WB 3TH4T 2D7NA 3EHBD 2EIEA 1T6WA 3CU7A 1GHFL 3EYQD 5EZOL 4LRIC 3HNVH 1L0XA 3BX7C 4JKMA 5ESVB 1J88A 2UVEA 3FFCE 3HZVB 3MXWH 3EFFA 4AG4L 3IDGA 3VFVA 5L88L 3DWTA 3QXDB 3C8HA 3KPOB 2VQTA 3BD5A 4LSSL 1G7QA 5D1ZC 2XNAA 4GAFB 3FN0L 2VZ1A 4K7PX 4WDIA 1NMBH 4PJ8A 3UTQB 4Y2DC 3I6KB 3O6FD 4MNGB 3CMOL 3CUPB 3GNML 4RBPK 2AABH 4XRCA 4YZFE 5JW3L 1S7UA 3TBYA 1CFNB 1MVUB 4URTB 3V6ZB 1FORH 3MJ8A 2CIKA 4WY7L 5T33L 3D6GA 3KLHC 1ZVSB 1IEBB 2EDLA 4X5XB 3WJJC 3BRFA 4XP9H 4GRWE 3O0RH 4X0KB 3MLYL 1QFWH 1O7VA 2ID5A 4WUUE 1NBZB 1YEDB 4LEOA 4ONHB 1TXKA 4XP4L 3QG7H 3EYFA 1AH1A 4DKDC 1Y18B 2NX5B 2F53A 5C7XH 3DRQB 1HKFA 5CWSB 5D7SH 1KIPA 3FCTB 2G5RA 5C9JA 1DQLL 2PETA 4HIXH 3RTQC 3FRPG 3V6OA 3CZFB 3OJDB 4QHKJ 5IJVB 4PRHB 2JB6B 5HHOD 4WFFD 3QDJD 4OI8A 1UM4L 1CXIA 3WV0A 5EZIH 3K8KA 3EJYC 3FMGH 5F9DC 4NQCB 5BVPH 2UZIL 4NQUA 3MODH 3JWDL 1LILA 1JPSL 2EYTA 4PJ8D 2BVUA 4FFYL 5JMRA 4BFEA 1F6LL 5T5FH 3JWOC 1L6ZA 2CRYA 4CU6A 5E7FA 1BAFH 5FDYA 2B2XL 7FABH 1W0VB 3B5HA 3VA6A 4PV8B 1FGNH 2IADB 4HBCL 5CKAA 4HUXB 3QWQB 3BYYA 1UB6A 4GW1A 4Y4KD 3ROLB 3VI4E 4BZ1L 4OZIB 4FQCH 1NGYA 2F53D 5CCKL 2J6EH 4Z0XB 5DHVB 1E6JL 3JVGA 1KC5H 5HHVL 4XBPB 5I30L 4OKVA 2NY0C 1S7XA 2MJWA 1I85A 1X44A 2CD0A 4HFUL 3GO1H 3CFEB 2ZCLH 3SDYH 3B2VH 3VXSA 1DEDA 1YMMA 2Q86A 4QWWD 2FJGB 2GJJA 3O6LH 5JLZB 4M7KL 3MBEB 5IMKB 1XR9B 3VWJA 5ACZA 3EHBC 4KUCF 1EEZB 2YEZB 3BGMB 1ETZB 4WI9A 1G1YA 1UVQB 3MRBB 4EUPB 5FYKL 1OARL 3I6GB 2E9IA 2Q76B 3ESUF 1RUPL 5DMYA 1BFSA 1LO5A 3U9UA 4XPFL 5D5ME 2AEPH 5I74B 3Q1SL 3GSQB 3RRQA 3KPLA 5ICZA 1X5GA 1BD2A 5EWIH 3MA7A 3O6FC 4K2UH 3ZKSD 1V8HA 1NCUA 1GGCL 5DFVD 2HT3D 1KN4H 1CLZH 1U8OB 2YK1L 3TV3H 1IC4H 1FZKB 2DD8H 5JUEL 5I1KH 5CUSH 1S7WB 4IRZL 5IFAL 1BBDL 3HI5H 4LVHC 1MFEL 4FTVB 1A7PH 3MRJB 2NY5L 4ODWB 3ZZ1A 1RUAH 5B22A 3RU8L 1RZIA 1DFBH 4YXKH 2ESVA 4L5FL 5DLML 5LQBH 4HUMB 4P57B 5F3HA 5EPMB 3VXSD 1YMMD 2Q7NA 5LKNA 3ARBD 4F2MB 1E28B 5FM8A 1JWMA 1ZVHA 1IGMH 2YN5A 1IEHA 4UINL 2A0LD 4JFQB 3GJEB 5A2LH 1INDH 1FGVL 2LTQC 1NKRA 4XXCA 1KCLA 3OXSA 2COQA 3W39B 1MLCB 3ARDD 5DHYB 4PRDA 1YN6A 4PJ8C 4LPWA 2SEBB 1MI5E 3ZE0E 3O3AB 1A14L 1AQDA 1MCDA 4M93B 3LRSB 2EDNA 1Q0XH 3LDBB 4NRXB 1MRCH 3KPSB 1KIRB 4HKBB 1BPVA 3GSVA 2D3VA 2X4QA 1KPRA 4Y4KC 3QUKA 2BNQA 4HWZA 2YD2A 3UTPD 4YHYB 4M43H 3WHE1 4D9QD 3LN9A 3UJIL 4LARH 3BEVB 4E42B 1R0AL 2XKUA 1CVRA 1R3LB 3GSNH 3GBML 4TUOA 3FB6A 5E8NB 4DUWA 3V6OC 3MYJA 2DQIH 3GHEH 5C0FB 4F7MA 4LNRB 2Y5EA 4AMKH 2AJVH 4QWWC 3DSFL 1JI1A 4O4YL 1IGCH 1FE8H 1ROWA 3LQAH 1MJJA 1WEJL 4UIMB 4XMPL 4JZNA 1Z0NA 2HTLD 1BF2A 4ZXBD 2OR8A 3MXVH 2VQ1B 5D1QA 5FOBA 4OCSL 4GKOA 4FRWA 2ERJB 5FM5M 4I9WE 5IV2A 4YWGL 3KS0H 4Z76A 3IJHB 3NZ8B 1Y6MR 2FHCA 3VFSB 4XCEA 2UUDK 2ATPA 3QIUA 2OTPA 2Z4QB 3S96A 4U0RB 4Z7NE 2XXCB 3BIAX 5GZND 4Z7VA 4HJJH 3IFPB 4ZTPL 4ODHH 2X1XR 4G7YH 5HYJE 1ZHBB 2RCSL 4ZQKB 5IHZB 4HULB 1GGIH 1QUNA 2P8MB 3SCMA 3A0OA 5ANMA 1CR9L 3DX8B 4NBZB 1BEYH 2NPLX 4NZRL 5E94A 1DBKH 4HT1L 5TE6H 4JZOA 2JELL 2AP2A 2JE8A 3ZYJA 2WNGA 1NEZB 3EFDL 1J1XH 4APQB 3BESR 1H3TA 4JKLA 3ARBC 5GISL 2VDLH 2KQMA 4Z7WB 5IQ7L 4L4TD 5D4QA 5FOJA 3O8XB 5JXAH 3CC5A 1U8MA 5KZCB 4FXKB 1NUDA 5DUPH 5D2LE 4OGXH 5I1GH 5MEOA 3RPKA 2A0LC 3PQYE 3W5MA 1SJHB 4TPRL 4MNQA 4PJBA 3P2TA 3CFKA 1CDCA 4DOHE 2UY7A 4WTZG 1HQ4B 4LLDB 1KFAL 2NYYD 3DX6B 4NM8L 1RSFA 3V52L 4PGDB 1I8IB 3CMGA 3ARDC 4PGEA 4FFZL 4KK9D 4P5TA 2BOBA 1ZA3A 3QIUD 5DJZA 5TDOB 1F5WA 1A6UL 3SPVB 4NQXB 5K59E 3LN5B 5JOFA 1D9KB 1CXEA 4D0CB 3VGAC 2OJEB 4X7DC 3BP7A 4JFPB 1XCTA 1QSFD 2W59A 2VXVH 1TTFA 4PD4K 4LSRL 3F7VA 3N85L 1SEBB 5LGJA 3RPIA 3V5DB 1JYVA 5GS0C 2M2DA 2ZUXA 4NN7B 4AQOA 5IKCB 2YD6A 3NCYS 2CK0H 3FOLA 2RIKA 4JY6B 3O3DA 4NNPL 3PGFL 2HKFL 3GMPB 2YPKA 3L5WA 4AM0A 4NO0B 1I7TB 4JFFB 4C55A 3O6ML 4HUKB 3MUZ1 4MNGE 3IFNH 1YJDH 4JY5H 4K94L 4NOFA 1O7SA 4PP2B 5GS2D 4ZXBC 3TBSA 3MCG1 4HJGA 5T3XL 4CRPA 4DGIL 1JGVH 1OSZB 4P5TD 2EECA 2O5ZH 2VDKH 3HI1B 5C0AA 1PQZB 5DXWA 3EYSL 1A22B 2G75A 2X6MA 4XPGH 2YD4A 5LG1A 2C26A 1DQML 1KJMA 1OQXA 4PP1D 1EBAA 2NX5E 5GZNC 4ZMAT 1XR8B 3QEQA 4OUOA 2IBGA 1IFHL 3BP6B 2IALA 5IM7A 4N8VA 4X4XB 4OV6F 4PRHE 2XZAL 2YPVH 2VH5H 4XP5H 1T7ZA 3MJ9A 3OKOB 4JPKL 3TEUA 1A7QL 4E41D 3AVEA 1AC6A 3OBAA 4XPHH 5EO9B 5TQ0L 1WAAE 4LP4A 4PR5B 3B83A 2BSTB 4EN3C 4UDTA 4U1JB 2BNRA 1EAJA 3DV6A 3MROA 4H1LH 4XP6H 4NQVA 5C0BD 3V0WL 1K6QL 5H94A 3O4LA 1R5VA 4IS6B 4X83A 3U46A 4KUCD 1RZJC 1AP2B 1EA9C 3KLDA 5GS3A 5FGBC 1YNLL 2NYYC 5C0AD 3GJFA 1ZHNA 4Y19B 4K71B 4WV1C 5IVNA 3LRGA 4HS8H 3U7WL 3VH8G 4RMRA 4N1EA 4YHLH 3U36A 1WCQA 2Z0BA 3QIUC 1WFUA 4UOW1 1CDGA 3T0DA 4FQXD 4LCCB 5HGAA 2Q6WA 4NCC1 4LAQH 1KB5B 2VKWA 3MRKB 3TYFB 2LAGB 1DVFB 2ICCA 3P4LA 1D5XB 4OCXL 2EEDA 2HFGL 5EU6B 4X6FB 5HD8C 2DAVA 2F19H 4CU8A 1U93B 4N5UA 2V17H 3UJJH 2J8UA 4WFHE 1LO4L 3FN3A 2YKLL 3QIBA 4BSVA 5DZNA 3FT4B 2DWDA 3P4NA 4TYUA 2R0LH 3CJJA 3G9AB 2C3VA 1LK3L 1HIMH 5F96H 2Q20A 2LV4A 5I9QB 4XWGL 4M8QA 4N90E 4TN9A 3KYKH 3O4LD 4LLMB 3NH7L 5EOQL 2ED8A 4GG8B 4PJXA 2FR4A 1FO0B 1QSZA 2VLJA 3PP4L 3WXVL 5F7MC 4M5YL 1KCSL 1IJ9A 3MO1B 4RIRA 2LQRA 1ZVYA 3OX8A 4Y4FB 5F1SA 4P5TC 2AJSL 1MFAL 4HC1H 5LAXB 3L6FA 4FTVE 3NN8B 1HHGB 1K4CB 1P1ZA 1T89C 3CXDH 3EOBB 4LLYA 1OT2A 3L1OL 5EU7E 4Y1AB 4R7DA 3TT1L 4TNWF 5FB8B 4LDLB 2NY2D 3U2SB 5INDB 5HJ3B 1N6UA 5BRZA 1OF2A 2KL6A 1GSMA 5KVDH 1XF5A 1I9JL 1OW0C 5DT1H 3IXTB 4O9HH 3QIBD 4EDXB 2FJFA 3KYNB 3X14B 3BPLC 3M1BB 3LAFA 4NQEA 3S5LA 4JDVB 4LQFL 4I18C 3MLWL 2YN3A 4XX1G 2PW1A 3KXFB 3STZB 2PCPB 3V5KB 1EEUA 4JB9L 3RVUD 3QFJB 5CEYA 5TDPA 1UWGH 4KQ4H 5T1KA 2PW2B 4ERSH 3SEPA 5GSRA 4YPJA 5E2WL 1Q8MA 4KZEL 2VLJD 1CK0H 3RWHA 2VYRE 3H3KA 1CN4A 5ENWA 2F58L 1RVFL 2ZJSL 5FYKU 1T1ZA 1NAKL 3DBXA 3NIFF 5IEKA 3KPSE 3X3GH 1I8KB 1MHHA 3PL6B 1EV2E 3BW9B 2CDFA 2ENYA 3ES6A 4K9EL 3QUZA 4MMXC 3TBVA 4FQXC 1P7HL 2CO7B 1ZTXH 2A2QT 5LVEA 2BNUA 5E6YA 1MQKH 5EU4A 5BRZD 1HZHL 4FP8L 1OCWL 2J88H 4OLWH 2P5WE 3F12A 4FFWD 2XA8L 1OB1A 2EDKA 1JHKL 4LRNL 4BQBA 3JUYA 4XBEL 2LAAA 1MCSA 4PS4L 1IKFH 3RUGB 4YHPA 2VZ3A 5FF6B 2DIBA 4HPOH 4MA7L 3BH8A 5F1NA 3PV6A 4FQQA 4DN4L 4RFEB 1R3KA 1WJ3A 1JYXA 3ARQA 3SGJA 1CQYA 4WEBL 4GG6A 1HEZA 5TFSH 5EBLB 4OAWB 4IJ3C 5SV3A 5I1EL 5AZ2H 2HVKA 1IGIH 2AV7B 4ZO8A 1HKLH 3OAYK 5F6IB 3AREB 1ZLWK 1LP9A 3LQZB 3BIKA 2F74B 5IBUG 1T3FB 4AZ8A 4C56E 4F9PC 5IIEA 1JZ8A 1VFOA 3P77B 2CR3A 3MNWB 3RWJB 3S37H 3NZHH 5CBEB 3D2UB 4PJHF 4M61A 1HDMA 1MIEL 4R7NA 4N0RA 3MRRA 3QUZD 4GXUN 5IOPA 5IK3A 1E27A 1MCPH 4OZFA 5JHDB 1A6ZA 2NXZD 4HKJB 4G8IB 4RQQB 3NCJL 5DJ6A 3NA9L 2ZUQC 3LV3B 5JW5B 3OKMB 1ZLSH 4H5SA 2IF7A 3CX2A 3IYLW 4HLJA 4UNUA 4JCMA 2I60L 1MCCA 4RMWA 4Z7WE 3AFLA 4RAVA 2Z35A 3HPLB 4OCRH 4AT6A 4KC3B 4ZUVB 3OR7A 5C07B 3GRWL 1MREH 1UZ8A 2AXHA 2R39A 4N0YL 2FD6L 3OF6A 4WHYG 4HXAH 3WJLC 4LHJB 3Q2CA 1FL5B 1VHPA 3P4OA 4ZFZA 1ACZA 3RVUC 4OZ4A 3JTTA 4PG9A 2ARJA 4GAJH 5J0BA 4PLKD 4QNPE 5FYKD 5I1IL 1MH5A 3NFSL 4JKWA 4XC3H 5I76A 2YUWA 1DBJL 3QIWA 2E8YA 2XWBA 4HQQL 4MYWB 4H26A 6FABH 5IHLB 1RFDL 4G9DA 1BZ7A 3VFTA 1CTOA 3WFDH 4NQSA 3BD4A 5J06A 4HK3J 5IBTH 2XFXB 4O5LH 4MZ2A 4TSAL 4G9FB 2IH3A 1K8IB 1NPUA 1OTSD 2OR9L 4LHUB 3BT2L 3PABA 1C7SA 1NDGA 3SKMA 1CF8H 3PWUA 4Q6IB 5C08D 1MHPH 1T04A 3CVHH 3BKMH 3HNVL 1QRNA 3IRZA 4JFFE 3DMMD 1T66D 4JFOB 4WU5B 1FVDA 3DVIA 4N0UA 5IR1B 2W0PA 5D70H 4PGZA 3RL1A 4QHMB 2UWEB 5HGDA 1UQSA 1NMBL 5GGSA 5D1ZB 2A6KB 4D9RD 2AABL 3PWPD 4Y2DB 5DK2B 3GI9H 3X17A 3WL9B 3NBNA 3RZCA 5CLWA 1FJ1B 1X4ZA 3WIFB 2HWZH 5ESAA 4XP9L 3JWDC 3HUJA 4M7JH 4HLZG 1MLBB 1QFWL 3I02A 2AXGB 4KZDH 1JRHI 3QG7L 5DC0A 5A16A 3QUZC 3AU1B 2OXGA 1AD9A 3CSBA 3PWNB 4EDWH 1CFSA 5D7SL 3FQUB 4PGBB 4FNLH 1BF8A 3VD4A 4EXPX 1MCKA 1RJZA 5BV7B 4HIXL 3S3PA 4MAYD 5JXEA 3RWCA 2K7QA 5JPNB 5CBAA 4WUKH 1QVOB 1DL7L 3BN3B 1QRND 3T2QA 4LF3A 1ZKAA 2VLRA 1CFQB 5EZIL 3FMGL 2FIKA 2FIRT 5FXCH 1BIIA 1JBJA 2ZKHH 5BVPL 1FH5L 1IMHC 3DVGB 4G80A 2EIBA 5HDLA 1DEEA 3DO7B 3PIQA 1OOAA 3IT8D 5BS0E 3GM8A 3GSUA 2R2EB 4G6KL 2B4CH 4Y19E 5ID0B 4YDVA 2ORBH 1U3ZA 4KKAC 2B20A 1BAFL 4X4YA 1FFPA 3FQRB 7FABL 3OKKA 4PLKC 3W5NA 1YPZA 3O45A 3LZFH 4DCQA 4ZS6D 1FZOA 2X5PA 3ZT5A 1CE1L 4X80L 4NC0B 4XC1H 1NC4A 1TENA 1BZ9B 4FQCL 5BO1L 4O2CA 1RAMA 3QUMH 1KC5L 4U1KB 3LEYH 3BXNA 1OP9A 3WUWA 3MFFA 3TVMB 5JXED 3SDYL 2JLLA 2F15A 1WTGT 3O6LL 5KSBB 3QHTC 15C8H 2VLRD 2DJ4A 5GJSH 4EI5B 4QTHA 1N6QH 3UPRA 1D6VH 4P2OD 2NY5C 3VE0A 3DMMC 5DRWB 2BVEA 3JV4B 1F4AA 3G5ZA 3D9AH 2J4WH 5H35A 2B1HL 3ZE2E 5K9JH 1NKOA 5I1DA 4EVNA 1IAOA 1PGRB 3ULUH 2AEPL 4XGZA 1HQRB 1KIUA 4CMMA 5MEPB 4NUJB 3DI3B 1KB9J 3MUHL 2VAJA 1N64H 5EWIL 3TT3H 4C57C 1RZ8A 3NFPA 5JW4M 5I18L 3RY6A 2X70B 4P23A 1A3RH 4MA3B 4Y1AE 1S9XA 4KMTH 3TV3L 1IC4L 4YPGB 3B6SA 5I1KL 4GBXD 4TSCH 2E9JA 5CUSL 2XPGA 3HI5L 4O2FB 5FECB 3ARYA 1A7PL 2ZPKH 2MPAH 4M4PA 3S98A 3RKPA 4ZUUA 5GGRB 1G6VK 3OKNA 4BFBD 4LBEA 1DFBL 1U8PB 4YXKL 2XQYG 5IW6B 1QQDB 3JV6A 1XGUA 3BDXA 4HIEA 1GCFA 3THMH 4F3FA 3QQNA 3FRUB 3UTSB 4O2EB 2APFA 3N50A 1IGML 4MAYC 3G5YA 3KXFE 2XG4A 3RX8A 3SE8H 5C3TA 1GVIA 2A9MH 2Q8AH 3NMEA 4L8SC 1K8DA 3QFJE 5SV4A 2V2XA 1INDL 2Y36L 2GAZA 5HHOB 5ITFA 4ZAKA 1N6VA 3EFFB 2OI9C 2B8OT 3IDGB 2OSLA 1EHAA 2AKRA 2G5BA 3VFVB 5KBNC 3D3VA 1RIHH 3IDIA 3T2OA 2X9YA 5DJXA 3FO9A 1G7QB 4IIQA 2H9GA 4BA8A 1YEEH 4WCYH 4WDIB 2YWZA 4PJ8B 4H20H 4LSTH 4P23D 1Q0XL 3QJFA 4JFXA 2ADFH 3TBYB 5ELIA 1MRCL 1N4XH 3MJ8B 2CIKB 4UV4L 1G7JA 5T3XD 5D96C 4ZS6C 3DURA 1OP5H 2WBWB 3VRJA 1KELL 1RIVH 4LEOB 4R97C 4DGYH 1MAKA 3EYFB 4E0RA 2ZUWA 2E6QA 3RUGE 2F53B 4LARL 3T3PF 5E8OA 2GYSA 4Q9RH 3GHEL 4FQLH 5E7BA 1KIPB 5C9JB 2AJVL 3E8UL 1FE8L 3LQAL 5CILH 2Y06H 4XHQA 4P2OC 3MXVL 5KAQG 3D3VD 1FAIH 1CGVA 3SO3C 1TQCC 3RA7H 4JZJA 1N3NA 2VLKA 2EYTB 1SM3H 4M6AA 4GMTH 1KJ2H 2Z93A 3PDGA 3U4EA 4P2QD 4Z18A 5CIPA 1AGBA 2VSCA 5JHDE 4HJJL 5E0QA 4POUB 5KANI 3NCBB 1QKZH 4ODHL 1YEIH 4G7YL 4CADB 4S1DD 2BVQA 1GGIL 1T7XA 4J12A 5FGCB 4GBXC 4GRLA 4YBLC 5SWSA 1BEYL 5HDOA 1UB6B 1DBKL 1BLNA 4N0FB 3EOYG 2BY2A 4N0CD 1PY9A 4XNYH 3I6LD 1W72H 2EC8A 3T4AA 4K3JH 2EDOA 3QI9D 1J1XL 1CDBA 4QRSA 4P4KA 4OKVB 5C07E 3C09C 2WWMD 3QJHA 3ZYZA 2VDLL 3TH3T 3R0MA 4KHXH 2Z8VC 3CXHJ 5FUCC 3VXSB 3GSOA 1L6XA 1YMMB 2Q86B 2E7HA 3ARBB 5JXAL 4NWTH 1J18A 5DUPL 4OGXL 5ACZB 2A6JA 2VITA 5I1GL 1OAQH 1YQ2A 3HR5B 1FO0H 5JMOC 4PB9H 1NJ9A 1N2RA 1JL8A 4Y5XC 1XT5A 2GK2A 5K93A 1S7QA 4HG4K 2VLKD 2R4RH 4XZUA 1X5FA 3U83A 1LO5B 3QDMA 4BJLA 3U9UB 3ARDB 5ICZB 1BD2B 2MQ3A 3O9WA 4JRXA 4XMKH 1IARB 1LK2A 3S34H 4WHYH 5T5NF 5DRZA 2VXVL 3CSPA 4GRLD 5SWSD 2IG2H 3BWUC 3QULA 2UUDH 3B4NA 3E3QE 3DLQR 1IZKA 3EYUH 1S7RA 2MNUA 3FOMB 3TN0C 2FBOJ 4RISH 4LGPB 4P4KD 1RZIB 2ESVB 3L3DA 2J1KA 5F3HB 1I7ZA 1CD1A 2CUHA 2CDEA 2Q1EA 5F7HA 3IDUA 1JWMB 3D85A 4BH7B 2RHEA 1QLEH 1FPTH 2W0LA 1H3VA 4EJ1C 3L95A 3IFNL 2YPLA 1YJDL 3QR2A 4JY5L 4M3JA 4XNZC 1KYOK 3IS0X 1JGVL 2IJ0C 4HK0A 4IRSA 4OCWL 4ZXBB 3QDMD 5EIVA 3BMVA 3OXSB 2O5ZL 5HHPA 1KJVA 4XVJH 4PRDB 3TM6A 1YN6B 2OTUA 4JRXD 5FDWA 4PJIB 1AQDB 1I3RA 1JP5A 2P44B 2R1WA 4PRAA 1WTLA 5FYJH 1T0MA 1PY4A 3GSVB 5D7IB 5D2NE 2ATKA 1KPRB 3QUKB 1FFQA 2N56A 2BNQB 4HWZB 1B0GA 2YPVL 4XP5L 4MSWA 3P3YA 2IAMD 3QI9C 5FUZL 4XPHL 2WWMC 2CDGA 3D85D 4TUOB 2A1WH 3MYJB 4OLVH 3VXUA 4F7MB 3T2NL 5K9KA 1U8IA 2H41A 1AY1L 3WS6C 1S7SA 2OMBA 4LSQH 5ETUA 1MJJB 4I5BA 4JZNB 2NTSP 3P30H 4IRSD 1GOGA 5DVOA 1NSNL 2O5XL 1QACA 1DANT 4DJMA 5FOBB 3D69A 4HS8L 3TH2T 3F6LA 2I9TB 3BJLA 4YHLL 5IV2B 2Z31A 4JG1L 4GRWF 4Z76B 1CBVH 4XCEB 3FT2A 2HYMA 5L0QB 2ATPB 3QIUB 5C0RH 2X4NA 4NT6B 5CEZH 2E7LC 1RZKH 1CDIA 4Z7VB 1CLYL 1K3IA 4KKCD 1FFNA 1QSFB 3U1SH 2F19L 3MGTA 5ANMB 2V17L 3OAZH 3TO4D 5FEBA 1U0QA 3ARRA 1Z2KA 4JZOB 4LCUA 4Y8DC 2RFXA 5ICXA 1Z5LA 5I1AB 4EZMA 3BUTA 2R0LL 2IH1B 3VXUD 1TNMA 1HIML 5F96L 1EGJH 3WFEH 2EKSA 1YECL 5FGSA 5C8JA 3KYKL 4U7MA 1A4JA 4NJ9H 3CC5B 3D5OF 1U8MB 4OLUH 4G6FB 1VGEH 2NW3A 1X7QA 3BH9A 4YR6A 5MEOB 4MNQB 3OGCA 4PJBB 3CFKB 3PXHA 4W6XB 2YD5A 5DJDA 1QBAA 2D0FA 3UZQA 4LVEA 4WI5A 4HMEA 2I9LA 2DICA 3NACH 4P5TB 2BOBB 5DJZB 3MOQA 3CXDL 1ZEAH 4IDJL 3VI4F 4ZYKA 3ZHDA 1E4WH 1IGJA 2J8HA 5JOFB 1U95A 5KOMC 3QXUA 3BP7B 3MJGX 1XCTB 3MLXH 5F9OH 3UTSE 3F7VB 3ZYOA 4G8FA 5KS9A 5LGJB 4LLQA 1NC2A 4O9HL 4QRRA 4MXQD 3ZDZF 1A4KA 3T8XA 2IQAA 4K9EC 1UACH 2VXSH 1EO8H 3FOLB 2IAMC 5CGYD 4DQOH 3O3DB 4LLUA 4NO3A 3GMRA 5DA0B 4D0BA 2PUQT 2YPKB 2Z9TA 3QPQD 2CMRL 3L5WB 4KQ4L 3LY6A 2X05A 4PJAF 4AM0B 5GJTH 1RMFH 2FEDD 3K80A 4EIGB 5J56B 2ICES 3B5TA 4LVNC 1C5CH 5C0BB 3S36X 1CK0L 1BQLL 1U2HA 1WQVT 4HFWA 3QRFM 1N0LA 2UYLA 3TBSB 5AG9A 2FEEL 4HJGB 4EXKA 4UZGA 3OG6B 3X3GL 5ISZA 3L5XH 5GSVA 1X3DA 4W4OC 5C0AB 5L7XH 1H3WM 3VFOB 1AXSA 1FFOA 3IFOB 5JTWA 4DFHA 3S88H 1ZTXL 2B0SL 1I1AA 1KJMB 2PN5A 4E5XA 2F53E 2J88L 4OLWL 1FNFA 5T1DH 5JW4Q 5K9OA 2WBJA 4AIZB 1NC2D 4QRRD 4KKCC 1OTUD 4FXLA 2ITCA 3SGDI 1QBBA 4QCIA 3V6OE 5IWLC 1IKFL 3BQUC 2IALB 4HZAA 4RRPG 3TO4C 5IM7B 4M48H 4N8VB 3GMNA 4WFED 4HPOL 4QOKD 4CDGC 2J6EA 4EUPG 1T2QL 3QNXA 3L3IA 1QPXA 4Q58C 4MD0A 3I3EA 2BMKA 3WBDA 5IVZA 5L8JB 5DMGD 5ALCH 1QFUH 5AZ2L 1IQWH 1CG9A 5E1HB 4UDTB 1HKLL 2BNRB 3DV6B 1EFQA 3MROB 2DI9A 4NQVB 3AAZA 3ZE0F 5H94B 2OBGA 4A6YH 2EIZA 3O4LB 1R5VB 1BBJA 2GK0A 4Y0GA 2R0WH 2V2WB 4XVTH 3S37L 5IGXH 1S7VA 3GJFB 1ZHNB 3T4YB 2PTUA 1E4JA 3RWDB 5FGCE 3U36B 1MCPL 4LPTA 1B3JA 1I1AD 5ICYA 2C3WA 5SX5H 2UVFA 5DJ8B 3QWOA 1ZLSL 1ODAA 2XA3A 3P11H 5HGAB 5B8CA 2WBJD 1TVHA 4KV5E 5D9SA 3WE6A 1BOGA 2NY2B 4UQ2A 3CAFA 5KSUA 2J8OA 4OCRL 2ZNWA 2FHBA 1MRFH 3VXSE 1YMME 4MXQC 1VKXA 2H2SD 2NCMA 1OPGH 1MREL 2J8UB 3CPLA 3QIBB 3C08H 4BSVB 2DWDB 2CKBH 4RGMB 4HXAL 5CGYC 4ZNEA 2C3VB 1BIHA 1QFPA 2WLYA 4M8QB 1LEIA 2NY7L 3MRLA 3C5ZA 4WO4A 2FEDC 1EXUA 1Q9WB 1RUQH 1BD2E 4ZPVA 1AGDA 4PJXB 2FR4B 4YXLH 1RUKL 3CFCH 3H9ZA 4XC3L 1UC6A 2VLJB 2OYPA 5F72S 1WWWX 3QH3A 4HV8B 4RIRB 3OX8B 6FABL 1IEAA 2AJ3A 1G9NC 3HA0A 2MSPA 2FH8A 4ZDHA 2IWGA 5C2BH 2VISA 1P1ZB 4KXZI 2I26N 2WM0A 4LLYB 2PKDA 5IBTL 3W9EA 4O5LL 2BERA 2EYRA 3VXRA 2H2PD 2ESVE 1VFMA 1GPOH 2FYYA 2PXYA 3QCTH 3UTPE 5EG6C 5AZEH 1A6WH 2EO9A 4D9QE 2D7TH 4XAKD 5BRZB 1OF2B 2Q87A 1OTUC 1CF8L 4LSPH 1MHPL 4ETQA 1EFXD 4QRUA 3HG1A 4JPIA 3BKML 2A6IA 5EFIA 2FJFB 2EC9U 2DYPD 4ORZC 4X99A 3S5LB 3NTCH 4FG6D 4MQ7A 4JGUA 5T3ZH 4HDIA 5FA4A 4G8GA 4MJIA 5D70L 3GSNA 2HLFD 1QYGH 2PW1B 3IXAA 3OL2A 2DLIA 1LDPH 5CJBA 3FFCD 4WO4D 5CEYB 1BOYA 5TDPB 43CAB 1PX4A 3GI9L 3ZTNH 3Q0HA 5K59F 3RWHB 2VDNH 5ENWB 3X11A 1JE6A 4M7JL 4G42A 4Z5RA 1PYWA 1T1ZB 3DBXB 5IEKB 4KZDL 1NGZA 2GY5A 5C0IA 2BHZA 1GH7A 1MHHB 4JN2A 2CDFB 2GCYA 3HC3H 4WRLA 4AIOA 4EDWL 1UADC 5IVXA 3QUZB 3TBVB 2BNQE 4FNLL 3VXRD 2PXYD 4WUUD 2BNUB 2NXZB 3OWEA 2ZUSA 4UILH 3MUY1 3FQWA 3F12B 1SVZA 3HG1D 1OB1B 4WUKL 2GKIA 4DZBA 5A1AA 5I19H 2W0FA 4J6RH 5C9KA 1SVCP 1WZLA 4POYA 5MP6H 4U6XA 4RMUA 1M4KA 2H2SC 1J1PL 4JDZA 3ZO0A 1KXVC 2ZKHL 4YHPB 1MJUL 1FAKT 4G8GD 5TDNA 3BH8B 3PV6B 4FQQB 2E6PA 5KG9A 4CJ0A 1R3KB 4M7LH 1HWGB 1BVLA 3SE9H 2R15A 4AYFA 4MB5A 4WVRA 1HEZB 4GG6B 2B4CL 3OKEB 4Z7OF 1SQ2N 5CJXA 3V0VA 3F65A 2ORBL 2VTFA 1FHGA 2HVKB 2EDBA 1S9VA 1CFBA 4PJ5D 4HX1A 1JK8A 1YEKH 2VOTA 1Y6KR 3IDMA 3E6FA 2YSSA 3BIKB 3LZFL 2HT2D 2V7NA 4PJAA 1HSBA 5IIEB 4BYHA 4ELKA 2ADIA 1U58A 3NCEB 4Z7VE 3UBXG 4XC1L 2MCPH 5GGVL 4M61B 1HDMB 3WFCH 2DQFA 4R7NB 3MRRB 4MLSA 1EK3A 5IOPB 5IK3B 1E27B 4OZFB 5ANME 5B8CC 4L8CA 1IKNC 2DIAA 5DJ6B 3OQ3B 2GQHA 1FBIH 2H2PC 5E2TH 5I75C 1JIBA 4H5SB 3FT3A 4W4NA 15C8L 1YN7A 3QQ3A 4M1GL 4XP1H 3QXTA 2X41A 5GJSL 4YBQD 4H0GA 1N6QL 1WAAF 2Z35B 3QQ9D 3GMLA 4AT6B 1D6VL 1N8ZA 3FHQA 3OR7B 2P45B 4YHZL 5C08B 5HVHC 4MQXD 5F7YC 3D9AL 1FLTX 1UZ8B 4FG6C 4YQXH 1F3RB 3DMMB 4MNQE 4PJBE 3WNOA 3PNWA 5K9JL 2I5YL 4NKMA 2QQLH 3KYOA 2HLFC 5KTEH 3FB8A 2NR6D 1DBBH 4OD2A 4NN5B 1N64L 4ZFZB 4QXWA 1SMOA 5BOPA 4OZ4B 5H2BA 3JTTB 2ARJB 1A3RL 4NYLA 2D4FA 1ZT1B 1MSPA 4DAGH 5E4EC 1MH5B 5HGHA 5I76B 3QIWB 2ZPKL 2MPAL 4RMTA 3BE1H 3RWEA 4XAWL 3GI8H 5DMIH 3CCHA 4G9DB 1BZ7B 1DSFL 3VFTB 2AEIT 1TITA 4X9HA 4OF5A 2VDPL 4MNHA 3THML 4MWFA 2PXYC 1WSST 4JO4H 1Z9LA 2YD7A 4FZEH 3P0VH 2A9ML 3PABB 1NDGB 4HXBL 2Q8AL 4MAYB 4OLEA 1OAUH 3SKMB 3KDMA 3PWUB 5GS1A 1T04B 1M6OA 4X98A 1QRNB 5E08H 4KDWA 1B0RA 4EI6A 4J2XA 5D72H 4KQ3H 5HDQL 1FVDB 4N0UB 1RIHL 2HH0H 3V4VH 3RL1B 1SJEA 5I2IA 2VDOH 5I8KH 3L3JA 5HGDB 1JTOA 5GGSB 3MLUH 4WWKA 2VXQH 5C0AE 3LQAC 3OKLA 4PIRF 4ODUB 5CZXC 2ADFL 4P2RA 5ESQA 3QT2A 1N4XL 3RWFA 1U8JA 5EBMA 2V9TA 3ARSA 3RZCB 1MI5D 2HT2C 3FRPA 5IROA 4PTUA 3LKSB 5FHBH 2C7UA 3HUJB 4KKBD 3V8OA 3QEQE 3I02B 1RIVL 4K8RC 4XB8A 4OD1H 1A21A 2JK5B 4NQDA 4DGYL 5I8OH 5A16B 1T83A 1A7NH 1NQBA 3VFWA 4I0PA 3VDBA 1AD9B 1CFSB 3O3BA 3SKUD 1RJZB 2IBZY 1DE4A 2UZXB 3CSGA 1GGTA 1JJUA 1DN2A 3W11D 3RWCB 3ARVA 1LO0H 3IF1A 4H8WH 3BDBA 4YBQC 1VACA 3DTXA 1NLDH 4Y4HD 5CILL 1GAFH 5DWUL 5J13C 3QQ9C 4LF3B 2Y06L 2VLRB 3TA3D 2BNRE 4X8JA 4X6CF 1BIIB 1CXKA 4YHIA 5L9DH 1IC1A 1FAIL 4P2OB 3O4LE 4G80B 5KJRL 3RA7L 1DEEB 3PIQB 1SM3L 32C2A 3SO3B 3GSUB 2CH8A 1KJ2L 3HR6A 4YDVB 4WHTA 1QLFB 4PB0H 4P2RD 1WUNT 2YUZA 4X4YB 1KB5L 4F37F 4B0MM 3OKKB 4PY8I 1YEIL 5DD1H 1YPZB 1BZQK 5DD3H 3O45B 3K46A 1VFAA 4DCQB 3MBXH 1FZOB 2EKJA 1B2WH 1IGYA 3GZKA 1UGNA 1NC4B 5M95B 2X10A 5EBGA 4XNYL 4FHBD 4I0PD 1W72L 2BSED 4K3JL 4HC1A 4O2CB 3TJEL 5HYJD 3NAAL 2IBZX 3BXNB 3WUWB 4GKNA 4JFHE 4WI2A 3H3BC 3IJYB 5MHSD 2J8UE 35C8H 3MFFB 4HH9A 4KHXL 1QOKA 2P43B 1UB5A 2OLDA 1ZLUK 4NWTL 3VXNA 1B4JH 2IGFH 4DTGH 1OAQL 3GBLA 4QTHB 1FO0L 4PB9L 4PRPA 4ODXA 3UPRB 1OGTB 5J11B 4R8WH 4JCLA 3VE0B 1AGEA 3TZVC 1XIWA 3C6LC 1BM3L 1I8LA 1QFWI 1WF5A 3G5ZB 1YY8A 2R4RL 4PJXE 3EW3B 1BVKB 1EHNA 4P46A 5H35B 1JWUA 3LEXA 3PQYD 1BJ1J 5I1DB 2VLJE 3PHOA 4P3DA 5DTFB 5JDSA 4EVNB 1A0QL 4OLYH 3X3FH 4CMMB 2MOVA 1UH3A 2QKIA 1MY5A 3RVTD 4XMKL 4LSUH 1F4WH 2A38A 3S34L 1RZ8B 5M94B 3NFPB 5FFLA 1YJDC 4GLRH 4ETYA 4P23B 5F9AC 5T1LA 3HMXH 1OWWA 2IG2L 4H0HB 3V7MA 4Q2ZA 1S9XB 3B6SB 1VGKA 3BEWA 4GQPH 4OFKA 3KG5A 3ZT6A 3DRTA 4KKBC 3WFHA 2XPGB 5BRZE 1NFIA 4NJAL 2R4SH 3CX5J 4RISL 4ZUUB 4M02A 4G6AD 5BJTA 3OKNB 2WIIA 1JZ6A 4LBEB 3WKML 3LEVH 4MVBD 1NMCC 1CICA 4PYHA 3JV6B 4PJHB 1QZ1A 3T77B 4HIEB 5A43C 4NQEE 4XPTH 3KHQA 2BJMH 4UBDD 1MEXH 3FQTB 4KH2A 3TBWA 3W11C 5IFJA 1F4YH 1FPTL 4PRPD 3FKUS 2EIDA 4WGVB 5HTSA 4Y4HC 2W9EH 4XCFH 1UENA 1DP0A 1K8DB 5D7LA 3TA3C 1TTUA 1MAMH 2V2XB 1CGYA 4BQCA 3RQ3A 2HJKA 5DSCA 2X4SA 1S78D 4ZAKB 1JGEA 1CGTA 4QNPF 2OSLB 5DQJA 2AKRB 2QHLA 3RBGA 4KJWC 3D3VB 4PG2C 5HHME 5BW7A 4XVJL 1A9BA 1F8TH 1UXSA 5DJXB 1MFBH 4LSDA 4IIQB 2H9GB 4M6NL 4Z9KB 4CNIB 1P9MC 3WN5A 1WZKA 4JFXB 1HCVA 2HRPH 2V5MA 3B9KC 1G7JB 2PO6A 4I48A 2NX5D 2I25N 1T83C 1MCQA 1FV1A 2IPTL 4I0PC 1BX2A 5HHXH 1GXEA 2IPUK 3WEXA 4HKXA 5E8OB 5E6IA 2CGRH 2A1WL 2ARJQ 3QI9B 3N1PC 4HSQA 1UKSA 1EO5A 5JZ7C 4GG6E 2HKHH 4L29A 5D7LD 4R0LA 4LSQL 3RGVA 4ZOEA 1ZS8A 1E4KA 5C2UB 3P30L 2DQHL 3VD5A 4UT6L 3R06A 1LP9E 1SJVA 1NFDF 1G7PA 3ZL4H 1JTTA 4JZJB 3BSZL 1N3NB 2VLKB 1T7YA 1CBVL 5FYKE 1LE9A 2Z93B 5C0RL 3H42H 3HCVA 4B53A 5CIPB 1AGBB 1RZKL 3Q5TA 2F54A 1RJYA 1KUMA 1OAXH 1NBYA 2BVQB 3U1SL 3T1WA 3LKNA 4GRLB 5SWSB 1K5NA 1BLNB 1RUMH 2L4OA 5IQ9A 4WTZA 5E6ID 3T4AB 4WJ5A 4QRSB 4P4KB 1EGJL 4D0DA 3MBED 3QJHB 4U3HA 4UBDC 3I75A 3TCLA 4NM4H 3GSOB 3RGVD 4OLUL 3S3JA 4DVRH 3JXAA 4IDLA 1VGEL 5CAYB 2A6JB 2VITB 4PFEA 3BWAA 2AK1H 3CVHA 2A74A 1NJ9B 1I9RH 1INEH 1D5IH 4N90D 1LEGA 2R2BA 5DEFA 1LEKA 3RKDD 2V9QA 3WLBA 4NZUL 5DD6A 3CK0H 4BKLA 3T2PA 4XZUB 5F9WB 4X6CA 3QDMB 3NACL 4HMDA 1ZEAL 4U1LA 3HLAA 2G2RA 1FZJA 1E4WL 3O9WB 1A64A 3GGWA 3KPTA 4JRXB 4U1GC 1LK2B 3NIGF 5FV1L 4P9HH 3VWKA 4KMLB 4UTAH 1EZVY 3MLXL 1RZ7H 2NY1B 4X9IA 5JA9A 3QULB 4KHTH 5HI4D 3KHOA 3ETBF 1X9QA 1DDHA 1UACL 4FFVC 2VXSL 1EO8L 5CZKA 3VGGA 1QRNE 1FC2D 4DQOL 1MCFA 3L3DB 4XNMA 1T1XB 2H1PH 1I7ZB 1CD1B 4XBGA 2CDEB 4N0UE 4C58B 3D85B 5IMMB 3ZE2F 1GC1C 3MLTB 1T2JA 2IQ9H 2YRZA 5I17B 4AK1A 5HVWA 1WITA 1SY6H 3L95B 4Y2OA 4F8QA 3AGVA 2YPLB 3EO1A 5GIRA 2D9CA 3P9MA 3RL2A 1G9EA 4FQJH 1MCWM 3NPZB 4HK0B 4IRSB 3L5XL 1KCRH 5HHPB 5L7XL 1KJVB 3HUJE 3S88L 2OTUB 4BZ2H 1EZVX 2C4XA 5FDWB 1ONQA 3MRFA 3UMTA 4UT7H 4U2ZA 1I3RB 4J4PA 1K2DB 5T1DL 1NGPL 4PRAB 2P4AB 5I66A 5BVJA 3HPJA 1J0YA 1T0MB 3V7AE 5HSFA 1NCWH 4LDOB 4M48L 2ATKB 2P5WD 3C2AH 1B0GB 3MRNA 3CFJA 3QUMA 5A3ID 2VLRE 4S1QH 4MSWB 3P0GB 1O0VA 4LLWA 2RBLA 3MBEC 2CDGB 5ALCL 1MUJA 3VH8A 1IQWL 4GMSH 3VXUB 3QAZB 2OMNA 4MD5A 3ZYIA 1E4KC 2X4PA 1S7SB 4A6YL 3VFRA 1A6PA 1MRDH 5ETUB 4I5BB 3LKPA 5SX4H 1DCLA 3ZKND 2R0WL 1I1YA 4XVTL 3W9DA 3RKDC 1YPZE 5I74C 4MB4A 4R4BA 3ARXA 2VL5A 2YZ8A 1GGYA 3QNZA 3UEZA 3W2DH 1J0JA 4KVNH 2WV3A 4C56D 4J4PD 1I1CA 5DYOA 2KKQA 3FT2B 1XF4B 2X4NB 3BN9D 3GIZH 3P11L 2BRQA 4FN0A 1JGDA 3U7YH 4Q0XH 3VFNA 4Q9QH 2DIJA 4LU5H 1T4KA 1MRFL 3K8LA 1U3YA 5EU7C 1WT5A 4GAYA 3MGTB 4MS8D 1OSPH 3V95A 1U8NA 1H3GA 3DPBA 4BUGA 1PG7X 2HJLA 3C08L 2RFXB 5ICXB 4YBHA 1Z5LB 2CKBL 12E8H 4TNVF 4YHNA 3P9WB 2D03H 2GFBA 4KRPD 3QUYA 3KYMA 4ZOAA 4ALAL 2X2YA 2MHAA 3BKCH 1A7OL 5KZCD 4JPVH 4K07A 2EKSB 5F8RC 3FB5A 4BFGA 1L7TH 5BCAA 5C8JB 5TF1H 1A4JB 5ABDE 2NW3B 2W38A 4YR6B 3BH9B 4QRTB 2CRZA 4X6EA 4YXLL 3SE4C 3CFCL 3OGCB 1P7QA 2HN7A 1ORQA 5DJDB 3OAUH 3ULUD 4TTGA 3TYGH 3IFLH 3WNMA 4M93C 4J3UA 2I9LB 3PE9A 4LPCA 1YNKH 5T3XE 3TF7C 1NFDA 3RHWK 2VKXA 3O3EB 1D9KD 5C2BL 3Q3GA 1FYTA 5I15L 4ZYKB 3LS5H 3LDBC 1DUYA 5DRXA 1NGWA 1GPOL 2NXYB 5AZEL 1ZHLA 2JJSC 4KVCH 2D7TL 2HA1A 2AXJA 3VFMA 4LSPL 2BRRH 2BSSA 2O5YL 4YE4H 2R8SH 3QO1A 1X4XA 5KS9B 1WISA 3MPCA 4LLQB 1NC2B 4JO3H 1FSKB 4QRRB 1R5WA 5IW3A 3WIHH 1YMHA 4UT9H 1A4KB 5E2VH 3T8XB 2IQAB 1PDKA 3QUYD 2G60H 2FX8H 5A3IC 5T3ZL 5DJ0A 2XI9A 5F6HJ 1QYGL 4LLUB 4NO3B 1OGAA 3GMRB 4G43A 3GEWB 2R56H 2XTJB 3D3VE 4LHQB 5J6GB 3LKQA 2D7OA 2NY6D 1IILE 3MV8A 4NFCA 3HS0A 3ZTNL 3EZJB 1GRWA 3RVWC 1P7QD 4K7PH 2ERJC 1UWXH 4HFWB 1INQA 2UYLB 1OP3K 2QSTA 5BZWA 1CE6A 4HUWB 5ISZB 2B4CC 5GSVB 3ZDYE 3WHE0 3HC3L 4U1IB 1AXSB 2XY1A 4YFEA 1LO3L 3O6KH 1S9KC 3BN9C 3E2HB 1I1AB 2BDNL 4UILL 4YC2B 4E5XB 1CD0A 3I6LE 4ZOCA 3QUXA 3EIFA 2ZOLA 4FS0A 5K9OB 2WBJB 2AJZB 4J6RL 1H9VA 4FA8A 5MP6L 2ITCB 3ARGA 4QCIB 4L9LA 3CDGA 4W6YB 1PSKH 3GMNB 4PGCA 1W72A 1DQJB 5JIPA 3W0WA 3QNXB 3L3IB 1S8DA 2ICEA 4M7LL 1OGAD 4MD0B 3SE9L 2BMKB 3O8XC 1F45A 3PDDA 1CG9B 3NPSC 2VLKE 2V2TA 5TE4H 3U4BH 5DVNA 5BS0D 3AAZB 1CTNA 4PRIA 2GK0B 4Y19D 5HVGB 1TTGA 4YHMH 3T04D 2DF3A 2MCPL 1S7VB 1JFQH 3D39A 3WFCL 4KWUA 4AEIL 4P2CG 3DECA 5J89A 3RFZC 5SWSE 1D9KC 5ICYB 1YC8A 2P7TA 1ZANH 1FBIL 3QWOB 4RSVA 5E2TL 5B8CB 1CDYA 1TVHB 3BVNA 3SDAA 5D9SB 1I75A 3WE6B 4XP1L 5FYJU 1BOGB 3L7FA 3ARGD 4UQ2B 1WT5C 3KAAA 5KSUB 4NN7C 3B3IA 3TIEA 1VKXB 1AHWA 1EFXB 3MRHA 3P73A 3W0WD 1RY7B 2FEEI 1VSCA 5C71A 3HI6H 5HVHB 4F57L 4TRPH 4XWOD 2DYPB 2QQLL 3QHFH 4BH8A 5LJYH 1DBBL 4FQPA 2GTZA 4L3EA 3QDME 1NCAH 1LEIB 3MRLB 4J1UA 3C5ZB 3E6HA 4WO4B 3WS3A 1EXUB 1KIQA 5F7NC 4JRXE 1AGDB 4LASH 4P0DA 4DAGL 2AV1A 4JGJA 1UCBH 3D39D 3H9HA 5KAQF 3QH3B 5E4EB 1IRAY 3BE1L 1EO7A 1D5BA 1IEAB 2AJ3B 4ZDHB 5EU3A 2F8OA 4Y1AD 4TVSa 5FV2A 4K7FA 4OSUH 3N9GH 4TOYH 1OWRM 2VISB 2AJYH 1A6VH 3FQXA 4F9LC 2OP4H 4JO4L 3W9EB 5GRUH 2EYRB 3VXRB 1TZHB 2PXYB 2FYYB 1A9EA 1HILA 3Q6FA 4DVBA 3S35X 4FZEL 3UC0H 2GT9A 3P0VL 2PTTA 1LNUA 1OAUL 3OB0K 1MCIA 4BFIA 2YXFA 4U6VH 4QRUB 4ETQB 3HG1B 5HYSB 4JPIB 1P2CA 4POZC 1QHPA 2A6IB 4OFPA 5E08L 1MHEA 4YDIH 2LFGA 4UTBH 1T0PB 4G6MH 5D72L 4KQ3L 4X99B 3H7BB 3V6BR 5E4IA 2YPLE 4Y88A 5J8OA 1TPXC 4HDIB 4C4KO 5FA4B 4G8GB 2AW2A 3V4VL 3GSNB 2VDOL 4L3ED 1BREA 4Z0BH 1FIEA 1RK1A 4KTEH 3MLUL 5DDHA 1F97A 1AXTH 2X40A 2AJUH 3BDYL 1RD6A 3MACH 2QR0A 3V0AC 3QEUA 3MUGB 5KVFH 1Z0MA 3K81A 4PJ5B 5CSGA 3KPPB 1DUZA 5FHBL 4HS3A 3X11B 4Z5RB 1PYWB 1EVUA 4OD1L 5C0IB 5A40E 4OT1H 3IDNA 1A7NL 4JN2B 4LCCC 2GCYB 5IVXB 4R3SA 2N7BA 4KDTC 3EYVA 5DMJB 5FYJD 1MFDH 1DVFC 1IBGH 3E0GA 1WGOA 3FQWB 4ELMA 2KBGA 4H8WL 3MUJA 1FVEA 4DZBB 3ARGC 2YD9A 2XXMB 2W0FB 3F5WA 4L9LC 3VXUE 1GAFL 5EC1A 1T20A 4U6XB 1Q72L 3KWWA 3RY5A 4JDZB 3STLA 5CJQH 5IBLD 5TDNB 4FQIH 5KG9B 4LEXH 5I9QC 1F02I 4XWOC 1B90A 1BVLB 2FHFA 4JO1H 3TWCH 5BQ7A 4UOW0 3DHMA 3MZGB 5IESH 3ARED 4JFZH 4YO0A 4MA8H 1IAMA 4IOFD 2IANA 1E0OB 1BGXH 5HI3D 1WWBX 1BJ1H 5DD1L 1JK8B 4P3WA 3KPQA 5EZJB 4LPYA 5DD3L 3IDMB 4QRPA 3E6FB 1Z9SA 2YSSB 2V7NB 5EUOA 4PJAB 3MBXL 4ELKB 5HYEA 2ADIB 1G9MH 1U58B 5JHDD 1Q9KA 5EUKA 1FDLH 1YEJH 4DZ8A 2DQFB 4QHKI 3KPMB 3T0WA 4HZLA 1GIGH 35C8L 4L8CB 1HNGA 1QSEA 3ZT7A 2XWTA 1W2KT 2YRLA 1KBGH 1T21A 1TIUA 1YN7B 1B4JL 1FCCA 3QQ3B 4JJ5A 2IGFL 4TNWK 2R69H 5DJAA 3MLRH 2ILLA 5C07D 2BVYA 4HHAA 4WU7A 3RGHA 5IF0A 4R8WL 4JQVC 1HE7A 4RGND 1N8ZB 5I1LA 5IB2A 1WZ1H 3QHZH 2A9NH 2KPNA 5GQBA 3DV4A 3V6FA 4JGMA 2EE3A 3PNWB 2C1PA 1KTDA 3MGOA 4NKMB 3KYOB 2AQ2A 3FB8B 4OD2B 2IAND 4LSUL 2QV2A 2DLHA 4DK3A 3KLAA 3MFGB 2VUYA 3BGFB 2XZQL 5H2BB 3WD5H 1RHHA 4NYLB 2AGJH 5HVFB 3B5GA 5HGHB 3RAJH 2QSVA 1MI5B 4XXDA 1NGXA 2R4SL 1J8HA 3RWEB 3DYOA 5KS9E 3P0YH 3LEVL 4QRRE 3QG6B 2GY7B 1NDMA 2DS4A 2GSGB 2EE2A 4MNHB 3MOBL 1V05A 4XPTL 1NMCB 2BJML 3SKJL 1M05A 5DJYA 4WFEE 1MEXL 1URLA 4Y5VA 4OFIA 1F4YL 1WFTA 4YAQA 2W9EL 3C5SA 4QGYA 2XTJE 5C6WH 2IFFL 5GS1B 1M6OB 4X98B 1MAML 4Y4HB 3VRIB 1AKJA 1B0RB 3MNZA 4EI6B 1ZLUH 4FXGA 5IBLC 3I50L 1JZ5A 1MFBL 1SJEB 4JLRA 3L3JB 4Y7MA 3AREC 5ISZE 3SE3A 4RDQF 4WWKB 1JPST 2R23A 4HGWB 3OKLB 4IOFC 5JO5B 3DVFA 4HS6A 5HI3C 5I1JH 4A6YA 2HRPL 4P2RB 5ESQB 3RWFB 5KN5A 2OL3A 3P4MA 1U8JB 5EBMB 1MHCA 4KY1H 4KK6D 5ADOL 1J8HD 2C7UB 3VFGH 4JO2L 1YC7A 4BZYA 4WW2A 2P48B 4H88H 4HUVB 3ME0A 4D3CL 2PR4H 3T0EA 4QTIH 1MIMH 4S1SH 1P84J 5CD5D 3VFWB 4I0PB 1GGBH 1Q9OA 1PBYA 4GKZB 1RZKC 1XF2A 1QLRA 4JN1H 3DGGA 3WFBH 1DE4B 3CGTA 1EERB 2HKHL 1QRKA 4I0KA 5KANG 4XCYA 3IF1B 1MCNA 4I2XA 5E5RB 1VACB 3DTXB 2EH8H 3AMKA 4G5ZL 1F00I 4X8JB 5FYLH 1KCVH 4UIKH 1CWVA 4JREB 3ULVE 2CKBA 2CIIA 3BOVA 3QEGH 32C2B 5F88A 3R8BB 4MLIA 3PGCB 4WHTB 3IRPX 2VABA 3U4AA 5F7WC 1J7VR 4K7PY 2P8LA 4M00A 1OAXL 1A5FH 3NCCB 3QB7C 2AERT 1VFAB 5HPMA 1IGYB 3SY0B 1RUML 5EOTB 2VJXA 4PYGA 4GXVH 3T0VA 2A6DB 3WKNA 2FGWL 3CFIC 4B7IA 3REWA 1BFOA 5I16A 3E3QC 1I7UA 3UDWA 4HH9B 3U30C 3UTTA 1AGFA 3UTZA 1UB5B 4MMZC 5GS0H 4XB7A 4ZNEE 1YNTA 2V5RA 3VXNB 4HUUB 4DVRL 2EH7H 1FYHB 3HZKA 1WBZA 4PRPB 4M62L 4ODXB 1I9RL 1YEFH 8FABA 1XIWB 1UWEH 3HZYA 1KEMH 2QQKL 3NVQA 4WEMB 1YY8B 3CK0L 2DQCH 4MDIA 4X4ZA 4ZD3H 3ZTJG 1JWUB 4P3DB 2RJMA 4Z7VF 1KPVB 3B43A 3RDTA 1IM3A 5I8CA 4L4JA 1AGCA 4P9HL 4UTAL 2XRAH 1RZ7L 5D6CB 4U1GB 5C70A 5T1LB 3S3SA 3D25A 4KHTL 4Q2ZB 2AXFA 3VXRE 1BWMA 3BEWB 1VGKB 4OTXH 5IEHA 3WFHB 3MTRA 5FCUH 2NTFA 3MNVA 1N5YH 4UDUA 1CCZA 4IMKA 3HG1E 1CS6A 3RWGA 1RZGA 3UTSD 5CD5C 5BV7C 1CICB 3NIDE 3PP3H 4HF5H 4CU7A 4MQSB 3K4ZA 1GZPB 2YA0A 2AAVA 3INUH 2AEQH 3MA9H 5D2NC 3GDBA 2JF1A 4PJBF 1F2QA 4G8GE 4MJIE 3TP4A 2Y07H 3TBWB 4X9GA 4RWHA 1CXLA 3FO0H 3VW3H 1OD9A 1SY6L 1RI8A 1YZZA 5D7LB 3PJSA 4YLQT 1I8MA 4FQJL 5T3ZD 3VJ6A 2VMFA 3KGRA 2HJKB 5DSCB 4PJ5E 1JGEB 1KCRL 5DQJB 4NC1E 1UXSB 5TJWK 4BZ2L 2BY0A 1XGYH 4QXUH 2GJZA 1JN6A 4UT7L 4S2SB 5JIKA 4RMQA 1P4LA 3WN5B 3BZEA 5IVXE 5EH1A 2PO6B 1MPAH 4I48B 1NCWL 2OJZL 5IMOA 2JB5L 4EBQH 3C2AL 4UB0L 1FV1B 4GKSA 1BX2B 4S1QL 3TVMC 2HFTA 1SYSA 2FJHA 4HKXB 1EPFA 4RGOH 5E6IB 2XT1B 1JNJA 2FLRT 2JJTA 2EDDA 4GMSL 1F58L 3ZDZE 4EI5C 4ZUWB 4HAFA 2D2OA 1T7VA 4R0LB 4OZGF 3ULVH 3GSXA 1MRDL 3EYQC 3RGVB 3RNQB 1ZS8B 3TO2B 5IHUH 3SOBH 3R06B 1A1MB 2VIRA 3TNMA 1G7PB 5EN2A 1MCRA 5GHWL 1J0ZA 2O61A 4PJAE 1TJGH 3RIFF 3W2DL 2H3NA 4KVNL 3B8SA 4V1DA 2XKSA 3EOTL 3BRDA 5F1IA 1A6TA 3HZVA 1LE9B 4X7CC 4K3GA 1C1EH 4AJ0A 3GIZL 3HCVB 4PBXA 2QHRH 2X7LA 1KTRL 2PYFA 3DX9B 2APWA 4UV7H 2N7AA 4Q9QL 4ODTH 4LU5L 3O2DA 1P7KA 1FG9C 5D6DC 3SQBA 3D87B 3L3OB 2FDBP 3LKNB 4Y5YA 4HGMA 3H0TB 1DANU 5CZVH 1JPTH 2VXTH 12E8L 5DK3A 3Q6GH 2BC4A 4X7TA 3LPWA 4LMQI 4D0DB 1FC1A 3BHBA 1YEDA 1L4IA 4JPVL 3VWJD 1L7TL 3I75B 3VXQA 5D71H 2V7HB 1XGTA 1P6AB 3BWAB 1KOAA 3CVHB 2A74B 4H25A 4U1MA 5CSZA 3DSNA 4IOSD 4U1NA 1LEGB 3RHWF 5DEFB 3OAUL 3WLBB 3IFLL 4V1DD 5DD6B 4BKLB 1BD2D 4X6CB 2DN7A 5E70A 3FQNA 2VZTA 5L2KA 2NZ9D 4NQCA 4U1LB 3LS5L 2G2RB 1J05A 1FZJB 3EAKA 3GGWB 3CFDA 2QLVB 4Z7QF 4PRNA 4KVCL 1OHQA 4NKDA 3DROA 5EB9A 2J8UF 4YE4L 2R8SL 3UO1H 1CFTA 5IJKA 4GJTB 1HNFA 5B3JE 5F89A 4JO3L 4RX4A 5E2JA 4TQEH 4KGLA 4UT9L 2ESVD 1DDHB 4NKQB 5EIIA 1RK0A 2IADA 2FX8L 1QP1A 1YQVL 2P5WB 5GGRY 1FRGH 4XNMB 25C8H 4OZIA 2JJUA 2PYEA 4XBGB 4CUCA 2R56L 4PJXF 3V8CA 4YNYA 1ULVA 4Y16A 5IP4A 4XBPA 3HC0A 2RGSA 1JPFA 1IGTA 3VU2A 1KEGH 3EO1B 5GIRB 4ZFFA 1FIGL 3P9MB 5IMKA 3RL2B 4P2RE 3C60A 1YYMH 1J1OL 4MXWH 2NY4D 4NO5A 4ODVL 5L2KD 3BGMA 1ETZA 4RRPA 2P1YA 3G5VB 2FO4B 3OR6A 4M7ZB 1ONQB 3MRFB 4EUPA 4NQDE 1R5IA 3C5JB 1EJOL 3LIZH 4QHUA 4C56B 1RURH 2FB4L 3O11A 2ARWA 4HCRH 2D7MA 1AXIB 2CUIA 5DFVC 2D31A 2HT3C 4AQ1B 4NHCH 5EDXA 5I66B 2GUOA 3F8UB 2BNQD 3HHRB 5MHSE 3BP4A 1G6RH 1PSKL 3JVGC 2BSRA 3C9NA 5DJ2A 2OX5A 3A6BL 3MRNB 3CFJB 3QUMB 4YFLF 5B39G 1I85C 5DI8A 4G8EA 2JJTC 1S7WA 2PYED 2UV3A 4LLWB 1KTKE 1H5BA 3HNTH 4KRPB 5KVGH 3VH8B 2AK4A 3VWJC 1LHZA 4MD5B 2WUBL 5TE4L 3U4BL 5EORH 3NPSB 5CSBA 5D1QD 3VFRB 2EDJA 1NUGA 2H32H 1BFTA 3LKPB 4K23L 4GS7B 3ZSTA 4YHML 1I1YB 1T03H 1JFQL 3W9DB 3F7RA 4QLRA 2J5LB 3VMNA 4R4BB 2H6PA 5GRVK 5M7QA 2VL5B 3HE6A 3QNZB 4X5WB 2NW2A 2YD8A 1FNAA 2J2ZA 5DYOB 5IB4A 1ZANL 1OP3H 3HN3A 3W39A 1TCMA 1P69B 2DLTA 1JGDB 1CL7H 2RB8A 3B2UD 3SCMD 3VFNB 3SDDA 2HP4A 3HMXA 3O3AA 3EO9L 1T4KB 5H37H 1HHJA 3HRZB 1ZLVH 3VMPA 4WHCA 4GAYB 4GG6F 4M5ZH 4R9HA 4CL7A 4NRXA 1U8NB 2QTEA 2HJLB 3HI6L 4PRPE 4YHNB 1IM9A 2GFBB 3QUYB 3KYMB 4JANA 5CD3A 3QHFL 3FJTA 3WIIH 2AK4D 2MHAB 1LP9F 1CD9B 3LSOA 4G6FD 3FB5B 4OB5H 4MNQD 4DEPC 2ZUUA 2HMID 5DD5H 3SJVA 1VADA 2NY6B 2HTLC 4LASL 1ED3A 4XXCC 3CSYA 1WLHA 1GL4B 1UCBL 3HAEG 4Z7OE 4X6DF 5DEGA 4ZTOH 1PZ5A 4OZGA 4DK6A 1P7QB 2HN7B 1ORQB 4XNQA 4PJEA 4FZ8H 2HT4D 2NY4C 2GTWB 3HE6D 1UT9A 1KLFA 5E03A 1ES0A 3N9GL 3D0LA 3MOAH 4JM2A 1NFDB 4TOYL 4YDKH 3Q3GB 2AJYL 1I3GH 1A6VL 2OP4L 3ILQD 1DUYB 3ZTJH 4OFYA 5GRUL 3JWDH 1Q94A 5DRXB 4BK4A 3SDDD 1NGWB 2DM7A 1TNNA 3MJ7B 1ZHLB 3UC0L 3IJHA 2AJXH 2I24N 2BSSB 2ICWJ 4JEGB 4U6VL 4NNXA 3QO1B 1R5WB 3C87A 4UNVA 4UU9A 1YMHB 4JY4A 4UTBL 4G6ML 1IM9D 4HBCH 5D7LE 4A2MA 5DJ0B 2VSDA 4RAUB 4JHZA 4WI6A 1OGAB 4Z0BL 1TPXB 2BVOA 4KTEL 2Z8WC 5GGTA 4Z7UA 4G43B 5AYQA 3EGSA 3SDCA 1AXTL 2AJUL 5CCKH 2DKSA 5CHNA 1E6JH 3MACL 3LKQB 3SJVD 3VGHA 5HHVH 2N4IA 3MV8B 5B38G 5KVFL 5D1QC 5C0GA 1XFPA 2JJWA 4HFUH 5BS0B 1INQB 4WW1B 4M7KH 1U3JA 3U7AA 4YDLC 2X44D 3S8WA 5BZWB 4OT1L 1CE6B 4JM2D 4F7TB 1SMAA 5L0QC 4KK9C 5DS8A 3RNKA 1CGXA 4LLDA 4OFYD 1KJ2B 1X5ZA 3CZJA 4PGDA 3QEQD 1MFDL 4I1NB 1IBGL 3B2UC 3SCMC 3QUXB 4PD4J 2ZOLB 3GB7A 5DO2D 2DM4A 1BHGA 2DLFH 2OK0H 4NO2A 4KGJA 3ARGB 3H9SA 1NANH 4L9LB 1G84A 3CDGB 4JFPA 3QQ4A 3OTTA 1AFVL 5CJQL 4PGCB 1W72B 4FQIL 2DQUH 4WI4A 3KJ4B 3W0WB 4LEXL 2YK1H 5DR5H 2ICEB 3UBXA 2GIYA 1KJ3H 4JO1L 3TWCL 3DGCR 1YUHA 2BNRD 1BBDH 3M45A 3SDCD 5E24E 5IESL 4JFZL 2B5IB 3BPOC 4NDMA 4NKOA 1ACYH 1BGXL 1G0XA 3SKOA 3HUJF 3AM8A 4IOIA 5DLMH 2HMIC 2V2TB 2O26U 4YFDB 2VC2H 3GMPA 1U3HA 4E9LA 2YBRA 3BUYA 1G9ML 2F54E 4NO0A 4KTYA 2HT4C 3D39B 4QF1B 1YEJL 4ISVA 1DJSA 2P42B 2R0KH 1FG2A 3S4SG 1FL3A 4O02H 3ILQC 1OSZA 4PP1C 2VE6A 2P7TB 4CMHB 1KBGL 2HAZA 3SDAB 3BVNB 3K74B 4FOMA 4I8DA 1XF1A 2R69L 3L7FB 4JFHD 3H9SD 4QO1A 2CLZA 2QSQA 1JPGA 5FUOH 3B3IB 3TIEB 1WZ1L 3QHZL 1AHWB 2A9NL 4G6JH 1V7NH 5I73B 3P73B 3MRHB 5FM5O 3WNKA 4PJFA 5IVOA 4J7RA 4P3CH 2X4TA 3BP6A 5EULV 4BH8B 4NHUB 2ZOKA 1YPZF 2GTZB 4GW4A 2VWEE 4L3EB 4X6CE 4F33A 2DWEA 3WD5L 1OD7A 2WW8A 1U3HD 3UJIH 4J1UB 3E6HB 3WS3B 1SY6A 4U05A 4ZO7A 2AGJL 1KIQB 1DLFH 2I07B 1MCLA 2XOTA 1H15A 3GMMB 3RAJL 3NFNA 1TDQA 5SWZA 3H9HB 4O4YH 3ELAT 1KULA 3FN9A 2RQ8A 5EU3B 2Q8BH 4K7FB 1X6NA 1EAPA 4KROD 2WUCH 4AEHH 3FQXB 4M6MH 1VFUA 1J87A 1R6VA 4YWGH 4U1HA 1A9EB 1HILB 3Q6FB 2PNDA 3K4AA 3RJQB 1FNHA 2GT9B 4DVBB 2PTTB 1H3UA 1LNUB 5DO2C 2DJUA 1V3KA 3ARFA 4NQED 3QZWG 1P2CB 1KACB 2DMCA 1MHEB 4F58L 1ERNA 1G7IA 1FQ9C 5DMKA 3G5XA 2FBJH 1JF1B 3QDHA 5EU6A 3ET9F 4YJZL 5HXMA 5T1KD 1S7TB 5LCVH 1RK1B 3A6CL 3WSQL 1KXQE 5DDHB 2QEJA 3BMWA 1CGSH 3CDFA 3K3QA 3L3GA 2QR0B 3QEUB 3OMZA 1F3JA 2KZWA 5HHMD 4OD3L 3MV9A 4ZUTB 5GISH 3L5IA 3LD8B 5SWZD 5IQ7H 3BZ4B 3VFGL 3LKRA 4HS3B 2FSEA 2MTPA 4HIJA 2FATL 4H88L 4WI3A 5FGRA 3R4DA 4X6DA 2OM5A 4TSBH 3IDNB 1OAYH 1GGBL 2PF6A 1FFRA 4NM8H 5F9JA 4BUHA 4R3SB 4JN1L 4Y4FA 4CVUA 2NY2C 3HB3D 2XN9A 3EYVB 4U6HA 5I6XB 1Y0LA 3SGEH 1H8NA 3NN8A 4ZPTA 4ELMB 3ARFD 1FVEB 3F5WB 4D8PB 1A6UH 4C4KT 4N8CH 3VGDA 1FCGA 1L9NA 3ALWA 3QIBC 1T20B 2GITA 4RGMC 1R3JA 3QXWA 1T1YA 5HGGS 3G6JA 3KWWB 5FYLL 1KCVL 4RGNB 4Q9BA 1F11A 1B4RA 2J12B 2D9QB 3IXTA 3QEGL 3EO0A 5BQ7B 3X14A 3B8YA 1R24A 3AM8C 4YO0B 2IBBA 3MV9D 3ZDYF 3ULUE 5E2UL 2IANB 3VFPA 4JHBA 4ORGA 3PGFH 1H8OA 1IAIM 4GQ9L 3KPQB 1A5FL 4QRPB 1IT9H 4RWYH 2DTMH 4KMQA 5EUOB 2VERN 3V5HB 2DOCA 4KJYA 1UJ3A 1II4E 4JFDA 4OGAD 3VXPB 3K4DA 1Q9KB 4JHWH 4DZ8B 5F7UA 2OQJA 4KROC 4OGYH 1MY7A 1N5AA 4P9HC 3WNNA 3QNYA 2ZSWA 2Y5TA 3PL6A 1QSEB 2XWTB 4FFWC 1T21B 5LGKA 1P6FA 1QHOA 2EH7L 1WC7A 3AROA 3OJ2C 4JJ5B 4LKCA 3U30B 1XGRA 1HYSD 5DJAB 5IHBA 4WU7B 1YEFL 5F70A 4JQXA 3WIHA 3UZEA 5I1LB 3MXWL 1DZBA 5IB2B 3CDYA 1M71A 3OF6D 1UWEL 2R29H 3DV4B 2DQCL 3V6FB 4ZD3L 5MEQA 1IFHH 1J86A 2C1PB 4JHAH 1GOFA 1KTDB 3MGOB 1VPOH 4WIQA 43C9A 5FF6A 4P5KA 1NUNB 4XHJD 4DFIA 1EHXA 5E99H 5JORA 1NFDE 3F7YA 1FORL 2XRAL 1FYTE 3QIWD 1RHHB 2X4RA 1MCBA 3UCRA 3O0RL 4JFDD 3QFDB 4XX1E 4OTXL 5D1XA 5T5NG 5FCUL 4XXDB 1NGXB 3V0WH 1PZUB 1J8HB 3MRPA 1N5YL 3LQZA 4CN1A 3DX7A 3ORJA 5C7XL 2YA1A 3HAEH 1TCRA 4ZUSB 2NXZC 3CVIH 3WXWH 1CYGA 3P77A 1NDMB 4B7LA 1RHFA 3WMSA 5CBEA 3INUL 2AEQL 3D2UA 5I1CH 3HB3C 1M05B 5DJYB 4Y5VB 1EX0A 3AS0A 2Y07L 5D2NB 3CLFH 5HI5D 3T3ME 3EJJX 1OGAE 3FO0L 3VW3L 2HG5A 4YAQB 3ALPA 3LV3A 3C5SB 3C8KA 1UH2A 1XZ0A 4KK8D 2W65A 1U8KA 1ZOXA 2NY3D 3TFKD 3MV8E 3KR3H 4LSVH 3MODL 3SGJC 1HHHA 1AKJB 3MNZB 4Q74A 4FXGB 3L3KA 4LKXB 3HPLA 5GRVL 4N1HB 3S36H 2HFGH 4OCNC 3GUTA 4QXUL 5T5FL 2VR4A 4JLRB 1LO4H 1NGQH 1HHKA 3RZCD 2R23B 4HS6B 1FGNL 4A6YB 3KYAA 4NSKB 5D1XD 5KN5B 3P4MB 3U48A 1FL5A 1MHCB 3I2CH 4RBPH 4PJCA 4I3RH 4OGAC 4EBQL 1DBMH 4NZDA 2J6EL 3NIGE 2AEWA 3GMOA 1CXHA 4QHLA 3T0EB 3WNPA 5F7LB 4KFZC 1QPPA 2F5BH 4N9OB 1FN4A 1Q9OB 4FQ2H 5FO7A 4RGOL 1UFUA 1XF2B 2EC9T 3GO1L 1QLRB 2ZCLL 3WXVH 3B2VL 3W0WE 1NBVH 5AUMA 1OTSC 2XG5A 2ZWLT 4KJPD 3N1QC 5I8EB 1MF2H 4XCYB 4GLRI 3ULVL 1HYSC 4I2XB 5LBSH 5I71C 3L1OH 5IHUL 1R3IH 4G9FA 1D5ZA 1F4HA 1T66C 3SOBL 4QYOA 1PVHA 4CDHA 3AMLA 1P5VA 4FQHB 1B6DA 4PRIE 2CKBB 4Q6IA 1I9JH 4Q97A 2CIIB 3OHXB 4NN5C 1TJGL 1U91A 5F88B 4CVZA 4KU1A 3D39E 3NA4A 1C1EL 1HHIA 4K2UL 1OLZA 4LRIA 4XHJC 2QHRL 2F8XC 1NMAH 5HBBA 5DGRA 4UV7L 2P8LB 4ODTL 1KN4L 2UWEA 1CLZL 2VLME 2EEBA 3QIWC 4R4ND 2DD8L 1I1FA 1NC4D 2K7PA 4OFDA 4R6UA 2CSPA 5HPMB 4CGTA 5HYSG 1V3LA 4Y2DA 2EO1A 1RUAL 1JPTL 2VXTL 5E2WH 1WBYA 3U0TA 3RP1A 4KZEH 1KENH 3S7GA 2VDRH 5LQBL 3Q6GL 4MHHG 2D7PA 2XYCA 3REWB 3WJJA 1BFOB 5I16B 1I7UB 2HLAA 2FRGP 5LXGH 3UTTB 5FK9A 5A2JH 5HI5C 2APVA 5CJOH 1YNTB 5D71L 1NCCH 4PREA 5MENA 3HZKB 4L3EE 1WBZB 4NWUH 1J10A 4KUZH 1ADQH 1HZHH 1C08A 3TFKC 2ZUTA 8FABB 3N0PB 1D7FA 3HZYB 2QQNH 3RTQA 4MDIB 2EDYA 4ZG1A 1P4IH 2XNAB 4PS4H 4QHNA 4CKVX 5IG7A 3LHPH 3RDTB 1IM3B 4C54A 4OBSA 5I8CB 1LE5A 2Y23A 4XRCB 3RZCC 1S7UB 2OR7A 4LMQE 1X5IA 4QXGH 3HTLX 5D1XC 4R2GD 3N06B 2HRLA 3D25B 2AXFB 4TQEL 3FQRA 3DETD 3RIAF 4PRBA 4MA1B 2NTFB 5FYJE 4M43L 5DK0A 3MNVB 4UDUB 4OM0H 3V79C 3RWGB 1RZGB 3GSNL 1FRGL 1FZMA 1TVDA 5F3BA 1T0NA 25C8L 2DQIL 2MKWA 2VR5A 1ZWIA 3C6SA 3EDFA 4OUUA 5JXEC 3OJVC 5J57B 1L0QA 4AMKL 1IGCL 4HAGA 4HIIA 4PJGF 5CMAA 4EIZC 5MEND 5DQ9A 4ZAKD 2F9BT 4QRQA 5AG8A 1KEGL 2P5EA 3RTQD 5KSBA 1YYML 1RIUH 3VJ6B 1P4BH 2G9HA 4MXWL 2I60H 5INCA 1UYWH 1DLHA 3CDCA 3AS2A 3UBXI 2GJZB 1JN6B 4TUKH 5KS9F 1RURL 2NLJA 1P4LB 4HCRL 3BZEB 5GGSY 2QL1A 5JOPE 4WFGD 5CEZE 1UXWA 4NHCL 5DC4B 2DI7A 4F37K 2DKUA 1BECA 4CN6A 1RJCA 4GW1B 1G6RL 5TE6L 4ELME 4AL8H 1NGYB 3O6FA 5C3LD 4GKSB 1QD0A 2BZDA 2C4FU 3NFSH 1JGLH 1S7XB 5FECA 2FJHB 4RGNE 3HNTL 5KVGL 3VG9C 4OQ1A 5J7CC 1RFDH 5J11C 4YHKH 2APBA 4RZCA 3DUHA 3VWJB 3MRDA 1TQBB 2P5ED 4KDVA 3GSXB 3OJMB 4LP5A 4TSAH 2IANE 1T03L 2VL4A 4A2LA 2MCG1 5CLTA 3BT2H 5DURB 2VIRB 3TNMB 4QRPE 5EN2B 5EUOE 2O61B 3O2WH 5JA8B 2H3NB 3KPLB 4V1DB 5HHOA 3QDJA 5F1IB 1A6TB 4RFNC 3RY6C 4P23C 3MA7B 4YFLI 5IT2H 2X7LB 1CL7L 4K94C 2WP3O 4TVPH 2PYFB 2YWYA 3M07A 1G9NH 4ODBD 4NC2B 4R2GC 1P7KB 1XGQA 1QSEE 4S0SD 5TF0A 3DETC 4EOWH 4Y5YB 1AR1D 4M5ZL 3IKKA 4LDEB 2I27N 2CK0L 4NRZA 3V4PH 2HFEA 4K3DH 4R90H 5FO9A 3WIIL 2BC4B 4X7TB 1SHMA 3BHBB 1WBXA 3ULVF 1RULH 4Y4KA 4YXHH 3PWLA 4OB5L 3P9LA 4UAOC 2OZ4H 1PKOA 3IU3A 1FNSH 3VXQB 4H1LG 3QPXH 5DD5L 5DVMA 1XGTB 3K1DA 3H2WA 4ZAKC 4DEPB 4H25B 4U1MB 5CSZB 4ZTOL 2XQBH 4U1NB 3MX0A 3JBG7 4FZ8L 2VDKL 1M1SA 4IIQC 2VZOA 1DL7H 4HIHA 2NY4B 3O9WD 3MOAL 3VD9A 3FQNB 2JCCA 4YDKL 5L2KB 1CIUA 1I3GL 4FMKA 4XPGL 5JQHC 1J8HE 1FH5H 1NAMH 2NY1D 1J05B 2N1KA 2R1XA 3CFDB 4FMFA 2M8XA 4S1DC 4PRNB 1YA5A 2AJXL 4NKDB 3DROB 3F6IA 4G6KH 2M1KA 2EDTA 1CFTB 4U3XA 5F89B 5SX4I 5E56A 2X4QB 2JJVA 1G7MA 1UH4A 4KKNA 3UYOD 1MCWW 4N0CC 1HXMA 3UYRH 2VH5L 2YOCA 4CADA 5EIIB 1A7BA 1IAKA 1RK0B 2YXMA 4P5MA 4HLZH 4X7SH 5IB1A 4UMGA 1CE1H 3FB6B 4X80H 4NZTH 5T1MA 4N0FA 2E9WA 1BQHG 4EEEA 2PYEB 3CU1A 4WI8A 4AEFA 5DQDH 5BO1H 4XP6L 4YNYB 4Y16B 2YPLD 3HC0B 1JPFB 5C6TH 3OGOE 1BP3B 1IGTB 3HNSH 1J11A 2R0ZH 1UKTA 2NNAA 2QSCH 5D1QB 4ZFFB 3ARBA 4JZJC 3CFBA 2BP3A 3C60B 4HG4J 5AEAA 3IVKA 4NO5B 3HR5A 3VRLE 3IKCA 1GZQA 4YDLB 2ZCHH 3WDJA 3OR6B 5CP7A 4L1HA 4ZFOA 2ZNXA 1R5IB 3T0EE 3S96B 3UAJD 4QHUB 4LAQL 3WDIA 5HPOA 1A1OA 2XWJA 2R1YA 3VD3A 4BQ6A 2B1HH 5AD0A 3O11B 3NIDF 1JUFA 3WYRA 4BQ9A 4GRLC 2D31B 3ARDA 1G9MC 2DLFL 1OP5K 3SCMB 4OKDA 2GUOB 2OK0L 3LPGA 4YGVA 1ZHKA 3BP4B 1T6VN 2GSIA 4JG0H 5E94B 3UJJL 3X13A 1AR1C 3F7QA 5I18H 2BSRB 5HYQA 3C9NB 4I2XE 4P4KC 2DQUL 5DJ2B 5F93C 5D7JA 1IQDA 4X6BA 5DR5L 5DI8B 4G8EB 3GSRA 1KJ3L 3F7PC 3VGEA 4YEEA 1H5BB 2ZP0T 3FOMA 5C0DA 1HH6A 2AK4B 4JPWH 1B0WA 1ACYL 2EE9A 3ZDXF 3BPOB 2VC2L 2QQQA 1P5UA 3QSKB 3X12A 3FO2A 5FYLD 1KYOJ 4PJGA 4BH7A 3N1GC 5LWYH 5F9WC 1U92A 2E3VA 2Z31D 5IVXF 4PGEB 2X1OA 4HC1L 1F13A 4C59B 2R0KL 2H6PB 3OZ9H 1ZA3B 4IM8A 3O9WC 3HE6B 3MREA 2YC1A 4L3AA 2NW2B 2Y36H 4WI7A 5HDBE 5HGBA 3SBWA 4O02L 5IB4B 2NY1C 5ILTH 4ZXBA 1GOHA 2DLGA 1WVZA 2DQGH 1D6EA 2CXKA 5KVDL 4PJIA 3SDDB 5DT1L 1D5MA 3RPIB 1CQKA 5GGQH 3UTTE 5FUOL 5ACLA 1HHJB 4PJ7F 4GRWH 3JSSA 4G6JL 1V7NL 3KNBA 5D7JD 5TGBA 2X4UA 2ADJA 2FX9H 4P3CL 4UV4H 5J12B 2OCFD 5HHNA 4PY7A 1IM9B 4JANB 5CD3B 4BK5A 5D7IA 5GS0D 1KELH 2YUVA 1QNZH 3LSOB 5T3ZE 4YX2H 1UWGL 4ERSL 4MCYA 2VLLA 5DGQA 3SJVB 1VADB 3EKCA 1DLFL 4LAJH 4IRSC 2JKXA 1ED3B 5AYUH 3CSYB 2Y4SA 5DEGB 1PZ5B 1T5XA 4OZGB 2DI8A 2V5TA 3E8UH 1JV5A 4KPHH 4L4TA 4EN3A 3WHXA 4XNQB 4PJEB 2JTDA 4UQ3A 4PBVC 3QBTB 1ES0B 2Q8BL 1YEHH 2DQJH 4JM2B 3D0LB 2WUCL 2NZIA 2G75B 4AEHL 2NXYD 1TETH 3BISA 3U6RA 1MQKL 4M6ML 1MNUH 5FGBA 3UAJC 3T65A 1Q94B 2I9TA 4WTXA 4LCYA 4K8RH 1CD8A 3QEQB 1VCAA 2EXWD 4WV1A 3LMJH 2IPKA 2WAHA 1ZA6A 1QA9A 3FB7A 4NT6A 4NNXB 1UA6H 1F90H 4CN4A 4UU9B 4JY4B 3D0VA 3F62A 2C9AA 1CGWA 2FBJL 2XV6B 1QSFA 5TFSL 1N26A 5F8QC 2XTJD 3QYCA 3MV7A 3QAZC 5FO8A 4U7KA 3EYOA 3NABH 5LCVL 1IGIL 2BVOB 4Z7UB 2F8VA 3EGSB 3M17A 5I1AA 3SDCB 4LLVA 1CGSL 5CHNB 1KF9B 2IH1A 2R2CA 3AB0B 1E4XH 4OV5A 2OL3H 3U46B 4U33A 4U1SA 3FL7A 3ROOA 5C0GB 3HMWH 4LFHD 4EN3D 5ISZD 3NZHL 3MR9A 1V3MA 1F4XH 3BPNB 2H26A 2Z31C 5FA3A 3ECBA 3O4OC 1W0YT 4TSBL 4XNXH 5DS8B 3RNKB 5B3JF 1OAYL 1XH3A 4RAHA 4DUXA 1XF3A 4P9MH 2Q6WB 5E1AA 3VFUA 1X6LA 4F7PA 5MI0C 3GB7B 3I3DA 4L1DA 4N8CL 1X5AA 1T89A 4NO2B 3H9SB 1IAIH 5BZDA 1JYWA 5D7JC 3QQ4B 1EMTH 1W8NA 2LABA 3P4NB 1I7RA 3MV7D 1U8HA 5C92A 3B9VA 1HYRC 3UBXB 5JQ6H 5HD8D 1YUHB 1C7TA 1OW0A 4TNVK 5FAAA 2DQDH 3QPQC