4KI1A

Primitive triclinic crystal form of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
208
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IG EPSILON CHAIN C REGION
publication title A range of C3-C4 interdomain angles in IgE Fc accommodate binding to its receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 208
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A02
5ALBH 4OLEA 4CRPA 1MQKL 1IGMH 2VXVL 1RZ7L 1F8TL 1U8PA 1QLFA 1JFQL 4Y1AB 5B22A 3WV0A 5BS0A 2AXGA 1KN2H 4D0CA 3QPQC 4PGZA 2HKFH 1KOAA 2X7LA 4FNLL 1IC4L 3VXRA 1E28B 3UC0L 2EH8H 4L4VB 3ZKMC 3WE6B 4NQDA 4RAUA 2H2SC 3K8LA 3BRFA 4Z7VF 5INCA 5DWUH 4QRRA 3KPMB 1INDL 4M7JH 3RBSA 1CZ8H 3O3AA 4NKIL 4OZGE 5IQ9B 1P2CA 4ZOAA 3MZGB 4RWHA 3CH8A 1CFBA 3RPKA 1NQBA 2NR6C 2GEEA 4LEOA 4KHTL 3MNZA 4RAVA 3REVA 1FP5A 1A6ZB 1OT2A 3OR7A 3FHAA 4OLYL 5BXFA 1DEEB 4JFFD 1DQQB 4P5TB 3DETC 1KG0B 1TJHL 4FABL 3HMWL 1WICA 4BQ6A 4KTDH 4PJXA 3VU2A 3VA2C 1N3NA 3HAEH 3P40A 4KAQH 1FYHB 5CZVL 3FQUA 2YD8A 1CVRA 5F7HA 3QDGD 2IH1A 3QBTB 3U0TA 3ZLQC 5EIVA 2VMFA 3I6GB 2V7NB 3RTQD 3FN0H 1PSKH 5AD0B 1KB5A 1LO0H 2NY6D 4NWTH 1MHPL 4BFBD 1M7DB 1BMGA 1GIGH 5CD5D 4Y16D 3V4VH 3WCYA 3UXFA 2Z8WC 1T2QL 1JK8B 1W0VA 1MI5D 4JRXA 4NRYA 3I6LD 5FOBB 5C6TL 1I85C 4LSTH 1XIWC 2AV7A 4QRQA 4RGMB 1G9NC 3FQRB 3QJHA 4QRSB 4QT5A 1DLHB 2ATKB 3QAZC 2C1PA 1FG2A 4A6YB 1S7QB 5E56A 3VH8B 43CAB 5BZWB 2NX5B 1IEBA 3VFNA 1E6OL 1LO4H 1TCRB 1RZKH 1S9KC 3IAQA 1DE4A 1C5DA 3BKML 2GI7A 4YHZL 4A2LA 5DMKA 3NOIA 3HFMH 2A1WL 4FQQA 4JHWH 4K9EH 1CFNA 1BQHA 1SEQH 3D3VE 4PJFB 2F58H 5C2BL 3LKSA 1JZ8A 1BGXL 2BXYA 2BX5A 4G5ZH 5TE6H 1HNFA 1CWVA 5J11B 3BE1L 3KYMB 3JV6A 5D71H 5JW5B 1X5JA 5DO2C 1ED3B 3UTSD 5K9KB 1A7RH 1KIRA 1FZJB 1XR8A 2AW2A 2DQEL 2PNDA 5DC0A 4B7LA 3QXUA 3QO1A 3MR9A 4MJID 5JOEA 1IVLA 1JTOA 1T5WA 4JAMB 1RV6X 4JRYD 1RMFH 4MSWA 1U3YA 2J88L 3NZ8B 1MWAL 2R0KH 3QIUB 3SDXF 1JE6A 3QDMB 3H2WA 4IRZL 3S88L 4UAOC 2NY7L 1H0DA 4AM0B 1K8DB 1NAMH 5HD8D 4UINH 1IZJA 3GHBL 2VXQL 4XI5C 1UADC 2ZSWB 4PJHE 1ORSB 4HJGA 3DYMA 3WS3A 1PQZB 5KG9B 1QFUL 1IM9D 5C0JB 4MA7H 2FL5B 35C8H 5T5NG 1HHJA 5D7JA 3V5DB 1BF2A 3MLUH 2ZOLB 3TH3T 4JZNA 5CSGA 2VISB 2VDLH 2FGWL 4JQIL 3WNLA 2B2XL 3SEPA 5L0QB 1FNAA 2IPTH 3FQWA 4OJFH 5AWNH 1UWXH 1CXHA 3T0EA 4XAWH 2BJMH 5I1KL 2VDQL 3ULUF 5TPWH 5DJ0A 3TZVB 3X3FH 1VHPA 3BGAA 1CICD 1NGZB 3GGWB 3PXHA 4GW4A 2R2CA 3JWOH 1ZSDA 1ODAA 4WU7A 5D6DC 3HC0A 4QRTA 1BZ9A 4GBXB 4OZFA 4EN3C 4G3YL 2XTJC 3VRIA 5GRUH 4DW2L 4TRPL 1XF2B 3CX5J 3O2DH 3R1GH 2X4PA 1ZT7B 4KI1A 1VACA 4G6AD 1JNLL 5D5MF 2HJKB 2R2EA 3BSZL 4O2CA 3KPOB 4ONHA 1GH7A 5IMLA 4GUPA 5ABDE 5JNYB 3WS6A 5DJAA 1R3KB 1YEEH 5D2LE 5T1LD 4W6XB 3P73B 1UJ3A 5K9QG 3TT3L 3MC0A 3VXSE 3KYKH 1CFSB 3WDIA 1JYNA 4WUKL 1FFRA 2V2WA 5DK3A 1IZKA 1Q9OA 2K3TA 3FT3B 2FX8H 4DVRL 2IBZX 4GRLA 3NFNB 3VWKD 1DVFD 3K1KC 4UV4H 4MA8L 5T3XD 3SE8H 4WFHD 1KTDA 3VGDA 4JPKH 1BEYL 1IGFL 4HLZG 4ODSH 1KXQE 4Q9RH 5IR1A 3J8F7 4XVUD 4BH7A 3PL6C 4LGSB 4M8QB 2O5ZH 5DJXA 5CJQL 3AU1B 5E8NB 4QNPF 3TF7C 4MD5B 4YNYB 1N6VA 5J9PB 2QADB 3HMXA 2B8OT 3B83A 4LHJB 4JDTH 1HHKB 3H9SB 1C12A 2HFEB 4NWUH 3L3GA 3HG1E 3ARDB 5BRZD 2VDRL 1CDIA 2PXYD 1AHWA 3VI3E 5I18H 2NTFA 3IKKA 3WLBB 4ZUWB 4GRMA 5JHLL 5EWIL 1A6WL 3TFKD 4XXDA 5C09A 1G7QA 1XEDA 3IDGA 1N6QH 4KTEH 1FNSL 1S7UA 2NNAB 2AXJA 4TUJB 4N8CH 5GSVB 4CN4A 1Y6KR 2EC9T 1GGUA 4ZXBB 3MRLA 4TNWK 1U8MA 5HHMB 3R4DA 4U1JA 1F4HA 2IC2A 3QRGH 4IBLT 2QSCL 3RTQC 4DN4H 1QFOA 4JGMA 4LLWB 4OD3L 5J6HA 3C9NA 2QL1A 5CD5C 4MXWH 4R7DA 4QHUB 2V17H 2XOTA 4Y16C 4Y19B 3U6RB 4HXBL 1G9NL 4PJIB 5IVZB 4HCRH 2DM2A 4FTVB 1EK3A 3A67L 5JQ6H 1LNUB 4Q0XH 2E3VA 3HZVB 4FQ2H 1BD2E 2VC2L 2C3VA 3S3PA 5CJOL 5D7IE 1I1YA 3VXNB 4D8PA 1CLYH 5B3JE 1PZUB 1EHLL 3VA6A 3EIFA 1BIIA 3HAEG 3CGTA 4XB7A 4Y4FA 3MXWH 3VFMA 3VFRA 4QOKA 3TPUB 4NKOB 5D7SL 2LVCA 5JXEA 1QSFA 4L8BB 4WENB 1B4RA 5GGRB 1I7UB 4NQEA 4CJ0A 1XZ0B 5E95B 3SDAA 4AYFA 3TBTB 4XAKD 3VXMB 3RVUC 2A6KB 4P3DA 4U1KB 4PYGA 5CP7A 4HGMA 3KYOB 1Q1JL 3GSRB 4KU1A 2XZCL 4DQOH 4UDUA 1OSZA 3WD5L 1IT9L 4U7SA 5J12B 2Z91B 1I4FA 3FOMB 5D6CA 1FO0L 5DD0H 1DQTA 4PTUB 2BOCA 3D69A 5F7EH 3NMEA 3S9DB 5I1HH 3QDHA 4Z7UF 5D70H 2X89D 5FA3A 5JA8B 2LABA 5F3BB 5HYJD 4L29B 2XTLA 1FFQA 3TN0D 3PWNA 1KJVA 5HD8C 1D5IL 3HNSL 1HIMH 3OMZA 3SPVB 3BD5A 2GHWB 2EEBA 1J5OH 1A7NL 2F5AH 3MRRA 4MZ3A 3QCTL 3MV8D 3QH3A 1JGEB 5DA4A 4C83A 1T7YA 5CWSA 4PB9H 1KBGH 4U6YB 4U1MB 4MJ5B 3HS0A 5E9DA 3DRQB 2WBKA 2Y06L 4LCWB 3FL7A 5AG8A 4YWGH 4DKEL 1M71A 3HI1B 4PRHD 2QHRL 4PJCB 4YDKL 3HE6D 3ARBA 4HK3J 1SMAA 4L4TB 4FXGA 3WKNA 1CICC 1OAXH 2NY0B 1LE5B 1LEIA 3WNPA 5K59E 1WITA 4OD1L 3Q3GB 5I1IL 4JFEB 3SGDI 5A40E 1R5VA 4QHNB 1FFNA 2VDML 2QEJA 3IRZA 1G7JB 3GSNB 5F6IB 2Z8VC 4QCIA 3AREA 4E41E 1PZ5A 3ZTNL 4PRDB 3OG6B 3HHRB 4G6AC 5DQDL 3ALXA 4MNQD 3KXFD 1MJ8H 1YEJL 1QQDA 4H25B 1FNGA 2OR8A 5E8EB 1VEPA 3PABB 3QUZB 1MCPL 3ISWA 2J8UE 3WHXB 2VXVH 1RZ7H 4P2RE 1F8TH 3U4EB 3FZUD 2IEPA 2XV6B 4OZIA 2WV3A 5EC2B 1R6VA 1UGNA 4R96A 4FNLH 1C7SA 3UC0H 3VFSA 2F19L 5IKCB 4X7TA 5KW9L 2DLHA 1TTUA 4JKPL 1GGYA 4IOFD 4GKSB 3MRQB 1INDH 3VWKC 5EOQH 1DVFC 1TVDA 1ZVSA 4U1LB 3ROLA 4NZJA 4X6CF 1T03L 2Y5TA 3RDTD 3V79C 4KHTH 4CVWA 3OKKB 4OLYH 4XVUC 3VE0B 1F3RB 3TGXA 1CI5A 1BLNA 1TJHH 4FABH 3HMWH 3MV9D 1N26A 4PD4J 1WC7A 2NYYD 2FR4A 3MA7B 5C0BE 4I5BB 4JO3L 5FKAB 4LVNB 4MJ4A 3BKYL 3CK0L 1V3JA 3TC9A 4Y1AA 1DQLH 3ARZA 2YWYA 5ANMB 5TH2A 3QA3A 4MAYB 3ZKXB 3VG0L 4MQ7A 1MHPH 2PXYC 1E28A 2A9NL 2X1XR 1QFWL 4WGWB 4L4VA 3WE6A 5F44A 3T09A 3AVEA 3MFGB 4G8IB 1T2QH 5MHSE 5EB9A 4QWWD 1LGVA 4G9FE 5EO9B 1WLHA 5IQ9A 4MD4B 2EDNA 2ILLA 3BPNB 4QRPB 1T83C 4XC3L 1PVHA 1XF3B 1N8ZB 1YYLL 3GMMA 5MERA 4LHUB 3S98A 1A6ZA 1E6JL 3ZYJA 1NMBL 4OKDA 1DQQA 3S4SG 1KG0A 1AGEB 3FN9A 4FS0A 4I48B 3BKMH 1BJ1H 4YHZH 1WZLA 2APXA 4CL7A 5HHNB 1RY7B 1K2DB 4RMUA 1E4KC 2A1WH 3S96B 4HBCL 5C2BH 2YPLA 1BGXH 3G6JF 2L7JA 4XC1L 3I6GA 2V7NA 3V0VB 5AD0A 3SKMB 2BRQA 3BE1H 1WTGT 2DQIH 1NL0L 1A7BA 1AI1L 4IMKA 1M7DA 3T2PA 5LCVL 5F9AC 3D39D 2DQEH 2D3VA 1YPZE 1WSST 5AG9A 1U8NA 2E5EA 5FOBA 2JB5L 2EIDA 4L3AA 5FYJL 3NCJL 2J88H 1MWAH 3FQRA 1TDQA 3IFPB 1DLHA 2ATKA 3PQYE 4IRZH 1OD7A 4A6YA 4UOW0 2OBGA 3S88H 1S7QA 3VH8A 4PJAF 43CAA 2H32H 2NY7H 5BZWA 2NX5A 2R69L 2Q6WB 4EZMA 1TCRA 3WFDL 4S1DD 3B9AA 3GHBH 5IEHA 1AGFB 1L9MA 2VXQH 2X4SB 3OAZK 3O3DB 4CU6A 2K1MA 1T0NB 3LPWA 4GW1B 3D9AL 2Y1VA 4IIQC 3MLTA 4PJFA 1NCCL 3VD5A 4R2GB 2FGWH 4JQIH 3MLXL 2DQFB 3KYMA 3MCKA 4KXZH 5JW5A 4DK6A 2CXKA 1U6AL 3F58H 1ED3A 3QFJD 4ZS7L 3QDJB 2NXZB 5K9KA 5SV3A 5I1KH 2VDQH 4U6TA 4ZFGL 3U79A 3GIZH 4LSPL 4JG1L 4JAMA 4KQ4L 3B9EA 3BPOC 3TN0C 3W5NA 4WFFD 3NZ8A 1V8HA 3QIUA 2OZ4L 1KJ3L 4CAGA 1BVKB 3QDMA 1VCAA 3HA0A 4G3YH 2WBJA 4TRPH 3KPRB 1K8DA 3PHQB 1JNLH 3SDCD 1XGPB 2BHZA 4NQUA 1ORSA 3BSZH 3SKOA 3QUMB 3EW3B 1PQZA 3WIHA 5KG9A 1J12A 2FL5A 5GZOD 4M43L 3V5DA 2ZOLA 3T08A 2VISA 4NM8L 2P5WD 4HAGA 3HE6C 2X4TB 4C4KO 1K6QL 3TT3H 4MDJB 5DVOA 4PRPE 3O6FD 1NFIB 1OL0A 4WUKH 5TE4L 3TZVA 4DVRH 5JDSB 3MUHL 5C7XH 3H3KA 4GBXA 4PJXF 1XIWB 1BEYH 4L1HA 3QAZB 1XF2A 3QUXB 1B90A 1IGFH 3IETB 2XTJE 4NBYB 4PP2B 4XVTL 5KJRL 4LVEA 4N0UB 1ZT7A 3VGBA 4NC1C 5E6IB 2OMBA 4HBQA 2BVPB 2QQLL 2HJKA 1FC2D 2JIXD 5CJQH 1I8IA 3KPOA 1XFPA 5JNYA 1OTSD 5FV1L 1R3KA 2JJUA 4KROC 1A3RL 4LSRL 1FNEA 3KVQA 2MSPA 1XR9B 4K07A 1CFSA 1WFNA 2H8PA 4L3EE 4Q58C 5JHLH 5EWIH 1A6WH 2XT1B 3FT3A 5J8OA 4ZFZB 3MLVL 1LEKB 1FNSH 4XTRD 2NZ9C 3A0OA 4JPWL 5IVOA 2YK1H 3F7YB 3REWB 1JF6A 1P53A 2CO6B 2NYYC 2BSSB 4FFWD 5EZJA 5F1KC 4UAOB 3FB8B 1XT5A 1YDPA 3LEYL 5HBBA 1AQDB 4PV8A 3AU1A 3WO4B 2QSCH 5E8NA 3IGAB 1MY5A 3QDAA 5DJ8B 4OD3H 3NFSL 4MD5A 3R0MA 4C57C 2YD3A 4YNYA 5J9PA 1BFOB 1LD9A 1Q9WB 2L0DA 4PRID 2BFVL 4JFHE 3GBNL 3H9SA 4XPHL 3QIBD 4HXBH 2HFEA 4X9IA 1DTUA 2XRAL 3W39B 4QWWC 3ARDA 4F37K 2YWZA 3A67H 5BMFL 4R4FL 1JMXA 2HTLD 3QI9B 5AZEL 1IL1B 3WLBA 2VC2H 5SV4A 2LQRA 3GMQB 4UV7H 1MAML 4ZUWA 1KYOK 5JUEL 3RWFB 5CJOH 2MHAB 4HJJL 2CK2A 1EHLH 4FQXD 3VXUE 2YRZA 3VRJB 1F5WA 1NKRA 5EUKB 1RQ5A 2NNAA 2BOBB 5J3HC 4TUJA 5KN5B 1SBBA 5D7SH 5GSVA 1UJTA 5I73C 4EN3B 2VL5B 2HVKB 1A1NB 3KLHD 4UIMB 4ZXBA 4AJ0A 3X3GL 1I1AD 1HQRB 1S8DB 4LLWA 3NIDF 4NNPL 4YR6B 1Q1JH 1I1RA 4QXWA 2VXTL 2XZCH 3KPSE 4Z76B 4U7KA 4QHUA 5ALCL 3WD5H 3EO1B 4Y19A 3U6RA 3W81A 2FSEB 1RJZA 4OD2A 1U3HD 4ZUUB 5IVZA 4FTVA 4HWUA 4J8RB 5C86A 3WFCL 1LNUA 3HZVA 5DVKA 1CTNA 2I60L 1LO2L 1NUFA 3VXNA 4C4KT 4KRLB 4Z0BL 1NC4D 1JUFB 2NLJB 4X7EC 3WJLC 3PDGA 4TTDD 3GSVB 1RZGB 1D5IH 3HNSH 1RIUH 4NKOA 4R7NB 3BHBA 4KJQC 1J0YA 4X80L 1A7NH 4NCDA 2GFBB 2EE6A 3LRGA 5C0CE 4L8BA 2NY5C 5FYJE 5GGRA 3QCTH 4IRJC 1I7UA 2PR4L 2ADJB 5KAQG 1XZ0A 1G1YA 5KSAC 3TBTA 2Z35B 3VXMA 3BMVA 5I75C 1DBKH 2Y06H 1D3CA 2VLKE 4U1KA 3B8YA 4DKEH 2UWEE 1KELL 2BNQD 3MSPA 4CU7A 1KCVL 2J1KA 2V9RA 2QHRH 4P57A 3SE9L 3UDWC 4YDKH 2Z91A 2P1YA 1JGDB 3W5MA 2Y4SA 3AFLA 4OD1H 3N50A 3VDCA 5I1IH 4EIZC 1IMHC 2VDMH 2JJSA 5F7YC 1KV3A 2MCPL 4L29A 3K2MC 3EJYC 4C59B 2XG4A 8FABB 2D31A 3ZTNH 1YJDH 1IKNA 5D1XD 5DQDH 3SPVA 4Y88A 5I16B 5GRJL 1N0LA 1T3FB 4JFFB 1YEJH 3IJHA 1NJ9B 4B41A 1MCPH 2Z4QB 1G1CA 1MJUL 3HTLX 1JGEA 2D0FA 5GZOC 2F53D 4U6YA 4JGJA 4MJ5A 3KGRA 4TSCL 3QDGB 1DN2A 1JZ5A 3TH2T 1J1XL 4LCWA 4UOW1 2GTWB 1KPUB 4CNIB 3RTQB 4AEFA 2NY6B 1B9ZA 4PJCA 2AJSL 1OGAA 3LQAH 2F19H 3RZCD 2Y07L 1OTTC 2X05A 5GGQH 4L4TA 4WI6A 4Y16B 5KW9H 4UBDD 1LE5A 4JKPH 3K7UA 3RAJL 3E2HC 4HC1L 3Q3GA 1MI5B 1UKSA 3CLEL 3WUWG 5ISZE 1MPAL 1G7JA 3GSNA 4ZUTB 2QLVB 4LPXA 1AD0A 5J0BA 4PRDA 4UQ3B 1K4DB 3UJTL 2Z31D 5HHOE 2X70B 5E8EA 2EO9A 1ZS8B 3PABA 5IVXE 4JO3H 4D9QD 1Q0YL 3WHXA 4WW1B 3U4EA 3CK0H 4HWBL 1ZT4B 1JJUA 1G7PA 1OWWA 5DVLA 1AH1A 3O9WD 3S8WA 5EC2A 3O2WH 3H6JA 2J6EL 2JJWA 2IPKA 3VG0H 3JWDL 4Y5XB 1QFWH 3LPFA 5IKCA 4I2XE 2VZUA 1OPGH 4IS6B 3DARA 1U41A 4GKSA 3MRQA 3B9KB 4MJIB 5FOJA 3ME0A 5TQ2L 4JRYB 1YQ2A 4U1LA 4E42A 2PYEE 4GRWE 1NFDE 3K3QA 4QYOB 4OM1L 4XC3H 1YYLH 1WFTA 2WNGA 1E6JH 4FFWC 1GGCH 4HT1L 1NMBH 3ZT7A 2A74B 4KK9C 3VE0A 3WJJA 2X42A 5JZ7C 1NGQL 4NN6B 2WAHA 3I3DA 4OIAA 4I5BA 4PREB 3BDXA 5CBEA 5FKAA 4NFBA 4HBCH 2XKUA 3MO1B 1IM9B 1OLLA 4XC1H 1WIPA 4OGXL 2WM0A 5CP3H 2DIJA 3QIBC 5ANMA 4CMHC 1NL0H 4M00A 1AI1H 2I25N 4MAYA 1Z9OA 4MNHB 2O61B 2VLJA 4IOIB 5DUPL 2HTLC 3GNMH 5LCVH 1JGLL 3KLAB 4LASH 4WI2A 5IB2B 4G8IA 1AR1C 1BZ7B 1UM4H 4FQXC 3TA3D 4HQQL 3OAYH 3MOBL 5FGRA 5IG7B 5FYJH 3BVNB 2CKBB 1CT8A 5EO9A 5FUOL 5EOCL 4MD4A 3CAFA 5GIRB 1KJ2L 3OKNB 1XF3A 1N8ZA 4L9LC 3BYTA 4LHUA 1WFUA 3CH1B 2R69H 1MIEL 1K3IA 4M6ML 3WFDH 1J0ZA 2FLBT 3VWJD 1AGEA 3TJHC 4I48A 4Z95L 5HHNA 5IBTL 1K2DA 1I1AC 4N90D 5DJCB 1UA6L 3OZ9H 3B9DA 1MHHB 1NCCH 5KBNC 3ARGC 4YFDB 4JFQA 4R97B 3V0VA 4HULB 3LH2L 3SKMA 5I2IB 4OB5L 1KN4L 4POZD 5BJTB 1U3HC 5GGSA 5T1LB 4W4OA 1KCLA 4X6EB 1VFMA 4S1SL 4ZS7H 3JTSB 4E0RB 4OCXL 4ZFGH 4LLYA 4BQCA 3KYAA 4JG1H 1FYTE 4P5KB 3OKEB 5DEFA 5L88L 2FLRT 4KQ4H 4D2NA 2IG2L 4OZHB 2OZ4H 1KJ3H 3IFPA 5IJKC 3VWKB 5I30L 1DVFB 4G8GB 1HK6A 5I71B 3IAPA 2Q6WA 1F3JB 4O9HL 1MRFL 4RBPH 1NBZB 5D1QC 1AGFA 4K7PL 2Y6SC 2X4SA 3O3DA 4XNZB 4QHKJ 1ZGLB 1MHCB 3OKDA 5I1AA 3OKOB 4NQCB 1T0NA 4GW1A 4PYHA 3P0GB 4BUGA 1WISA 2OR9H 4M43H 4NM8H 2ZG3A 5LQBL 2DQFA 2VAAB 4MAUL 1EBPA 3RVXD 3EYQD 5DVNA 1K6QH 5CS7A 5DD6B 3MV7E 2BVTA 3L3DB 5BRZB 4LCUA 1I9JH 5TE4H 2PXYB 3CU1A 4NO5B 3SBWC 4NJ9L 2FX9L 2UV3A 3MBXL 4PJEB 1BVKA 3LRHA 3MRFB 1W72A 1ZEAL 1C8PA 1KIPB 1T1XB 3KPRA 4WEUD 2YMXH 1CE6B 5KJRH 4XVTH 1PG7L 1IAOA 4F2MB 3PHQA 3QPXL 3WBDA 3ILPA 4XNXL 5CUSL 4AH2A 3IDJB 5E8OB 1NBYB 2YEZB 1Y6MR 3QUMA 3VI4F 2YA1A 4AY0A 4K7PX 3QHFH 1Z0NA 4OKVB 2BSED 1A3RH 2DQHL 2HFFA 4G7YL 3RZCC 3TV3L 4LSRH 2X4TA 5EUOB 2HP4A 4MDJA 4LCCC 4HIEA 2X10A 4UU9A 5E4IA 5J13B 2R4SL 1CE1L 4KRPD 2DBLL 1ROWA 3MODL 2GQHA 4GXVL 3CDFA 2CRYA 5JDSA 1FE8L 1JWSB 3MLVH 3L3KB 4ZD3L 1WBXA 1FDLL 5CD3B 1FZKB 3RWEB 5EZIL 4JPWH 1UVQB 2Z31C 3MLRL 3MRIB 4N68A 5A2KH 1XIWA 4HFUL 4M3KB 4LSSL 3V5HB 2ZCKH 3QUXA 3IETA 4PP2A 1GZQB 1N7ML 3BWUC 4PBVC 3P2TA 5JQHC 4L8DB 4M93C 5E6IA 4G43B 3LEYH 4NC1E 3JUYA 4CGTA 3RUGF 1PG7X 2AXFB 2FH6A 1RUPL 3ZYZA 3NFSH 5DR5L 2LAGB 4OLWL 5KSBA 4NOBA 4Y2DD 4IIQB 5CHNA 3IXTB 2BFVH 4HF5L 3GBNH 4XPHH 1F4XH 4XPTL 3VGAC 2XRAH 1XR9A 5BMFH 4R4FH 2YPKA 3OQ3B 4FQHB 5AZEH 1EEUA 2O5XL 1MAMH 1MH5B 5JUEH 1NCAL 2WINB 3QXDB 4HJJH 5DRNA 4ZFZA 3IFNL 3T3PE 5L8JB 4ISVB 1LEKA 4M7ZC 2WMPA 5HYJB 3U4BL 3BPOB 4RGOH 3TN0B 3F7YA 3HUJE 3K74B 3G5VA 4ZUVA 2BSSA 3QQNA 4PJFF 3FB8A 4P4KB 1CGVA 3CFDB 4YK4B 3MRCB 3ZSTA 3EJZC 1AQDA 3X3GH 4KK5D 2VQ1A 3WNKA 3IGAA 5DJ8A 1F6LL 2E8YA 4NNPH 3WN5C 4EEEA 2VXTH 2YKLL 1BFOA 5KVEH 5ALCH 1J9CT 4FQLL 4PRHB 4OGAC 5JDJA 1DL7L 2V6HA 3TA3C 4QTHB 4UI2A 1CD8A 3WFCH 4OQTL 3QI9A 3K8MA 4K71C 3VXQB 1IL1A 3GMQA 2I60H 4H88L 1LO2H 3RWFA 5DYOB 2MHAA 4Z0BH 1EAPB 5GGTA 4KRNA 3EDKA 4QGYA 1DQML 4YC2C 5DK2B 4HHAB 4PJIE 4U0RC 5EUKA 3E6FB 2BOBA 3UPAA 4PJ9D 3VWJC 4ENED 5KN5A 4HUMB 5D6DA 2DBJA 2Q3ZA 2RBLA 4X6FB 2BSTA 2EXWD 5C70A 5EA0L 4EN3A 2M26A 2VL5A 3E8UL 2PR4H 4OFYD 4ETYA 4UIMA 4KJYB 4UZGA 3ZE0E 5SX4I 1U8HB 4PJDA 4AMKL 2WZPD 1ZTXL 1X6LA 1HQRA 2Y23A 1S8DA 3OJ2C 1A6VL 4YR6A 2BC4B 3GRWL 2YUWA 1KCVH 4NKMB 1JWUB 4Z76A 2DDQL 1OP9A 4TOYL 3EO1A 3SJVD 1K3ZA 3SE9H 3IVKB 4ZUUA 1S7RA 4GH7B 4EUPH 4J8RA 5C08B 2YD4A 3CMGA 4X6DB 1JUFA 2NLJA 1JPSL 3FONB 5LGJB 2MCPH 4NNXB 5J6GB 1DBJH 1RZGA 4R7NA 3RDTB 3MRJA 12E8H 4Y4KD 2GSIB 4LOUD 5GRJH 4OF7A 4PIRF 2GFBA 3JV4B 1K85A 4OLZL 3CDGB 1TLKA 3PP4L 4LLQB 2HN7B 5EU6D 2ADJA 4WTZG 3MV9B 2X4NB 1MJUH 4PTTB 3LHPL 1WEJL 1V7ML 1EDQA 2Z35A 3L6FA 4IJ3B 4TSCH 3T2NH 5BO1L 3IT8D 3PL6A 3RVXC 4UTAL 3BDYL 3HLAB 3L5HA 1HHGA 5CINL 3GSXB 5CILL 2AJSH 2Y07H 4X4XB 5A2IH 1JGDA 4YFLI 3RAJH 4BSVB 3DXAE 3U48A 4HC1H 3CLEH 5K93A 1JRHI 3RVTD 1MPAH 5F1IB 5B21A 2EIEA 3ABZA 2AEPL 3WLWD 4RCAA 8FABA 4JY5L 2EE3A 3UJTH 5I16A 2E6PA 2P5EE 3KNBB 3L1OL 4PJHF 5ADOL 1A1MB 1T3FA 4JFEE 4JFFA 4JKMA 3T0BA 2AJ3A 3MMEB 2ITCB 2B20A 1NJ9A 4GXUN 4ERSL 5H37H 4BKLB 4TVPH 4S0SD 1Q0YH 2NQCA 1KCSH 2FATL 1RIVL 4HWBH 3QDGA 3A6OA 5FFLA 2GTWA 3K46A 1KPUA 4CNIA 2CK0H 5C92A 2OX5A 4RX4D 3RTQA 3ORJA 3Q5OA 3JWDH 3V95A 3FFDB 4KRPC 4MQTB 4Y16A 5D7LE 2Q7YB 3L5WA 2IH3B 1MI5A 4JREC 1CS6A 3HB3C 5KS9B 3Q5YA 5IF0A 5TQ2H 4OT1H 3NIFE 1XGRB 3U36B 5ECJE 4ZUTA 4OM1H 3D2UD 4HT1H 5L6YL 4UQ3A 1K4DA 1NGQH 4MNGB 2X70A 4I0PD 2YSSB 1ZS8A 4MCZA 1U92B 4JLRB 1QFWM 1W2KT 3G6AB 5IHBA 2YA0A 1UB6B 2HKHL 1ZT4A 3ESUF 1PW3A 5JOPD 4WU5B 4OGXH 4MDIA 5HGAB 5LKNA 3L3JA 4G8FB 2C3HA 4LVOB 5DUPH 3AY4C 4YHKL 4P4RB 1JGLH 3LN5B 3QFJB 3UTSA 2VQTA 5ESVA 3IJYB 1EFXD 2HMID 4HQQH 3MOBH 4B0MM 5FUOH 1M7XA 2GAZB 2R0LL 4JRYA 1FL6B 5IROC 2XXMB 4OIIL 4QYOA 2IQAB 4PJGE 3GBML 1KJ2H 4WI4A 3CSBA 3PNWB 3MROB 2MKLC 1MIEH 4M6MH 2A74A 4B5EA 3MNWB 4Z95H 5E94B 3DTXB 5IBTH 3KWWB 4KK5C 3SDCB 4OF6A 1UA6H 4QRPE 2X44D 4EXPX 4PREA 3VRLF 2ZCLL 3RFZC 3VXTB 5HY9B 3ULVF 2OK0L 3AM8A 4QGTA 1IM9A 1D9KC 4O4YL 3TVMD 3BDBA 1YMHA 4OB5H 1KN4H 3R0NA 1CGUA 2P5WB 4DKDC 4MNHA 4IOIA 4PJ8D 1KNOA 3VI3F 1H3GA 2VZTA 4S1SH 3RHWK 3KLAA 4DOHE 4R6UA 5IB2A 4OCXH 3O6FB 1QTYT 2RGSA 1BZ7A 5L88H 1KLFA 3IDNA 4BSWB 3BVNA 2CKBA 2IG2H 1CICA 3OR6B 2VLMD 4ENEC 5MENE 2DL2A 5I30H 3OKNA 3NIGE 1UZ6F 4HFWB 5HDBF 2AK4D 3CSYA 4O9HH 1MRFH 4L3CB 3GMPB 5LVEA 3JUZA 4K7PH 4NN5C 3H7BA 15C8L 3D0LB 3EYSL 3GHEL 5DJCA 2I27N 4X99B 1MHHA 2JIXB 5DMYA 4GT7A 5FGBC 1EEQA 2JF1A 3DNKA 5I2IA 5LQBH 1TENA 2F54E 4Z7QE 4MAUH 5BJTA 4H1LH 4LGPB 5T1LA 4YGVB 3C60C 4X6EA 3OJDB 3ULSB 5GRXG 5DHVA 3JTSA 5C07E 4OCYH 5EOTB 1TVHA 4JM2F 4F33B 5B3JF 1ZANL 4TUOA 3C2SA 5EZLA 2WQRA 3EYVB 4P5KA 1KT2B 3OKEA 4NJ9H 4OZHA 3K4AA 1L7TL 2FX9H 3DRTB 3VWKA 1DVFA 3QDJE 3STLB 1ZEAH 2VLLB 1FGVL 1UC6A 5SWQB 1PG7H 3VFVB 2JK5A 1F3JA 3QPXH 3VCLA 1FZOB 4XNXH 1NBZA 1W8NA 5CUSH 4ELME 3QRFM 4LRNL 5GGRY 3QO0B 1C1EL 4OF0A 1MHCA 4XHJC 4BQBA 3OKOA 3MUGB 4Z7VB 1DDHA 4EUPG 1TXKA 3VD3A 3S36L 3IJSB 1L0XA 3HCVA 4G7VL 1IAMA 5ETUB 3DVFA 2DQHH 4G7YH 1R3LB 2VAAA 1UCTA 5F7FA 5CEYB 5DD6A 1CD1B 3QIBB 3NPZB 3L3DA 2F5BL 1IILE 5BRZA 2VNCA 2PXYA 2R4SH 5E8DL 1CE1H 4X5WB 2DBLH 5FYKL 4NO5A 4PGDB 4GXVH 2ZUXA 5F21B 5FK9B 1FE8H 4ZD3H 1FDLH 4FQXB 3DGCR 5DRWA 5EZIH 4PJEA 3MLRH 3MRFA 2BVYA 4HFUH 1KIPA 1T1XA 1OAUL 3D48R 2VLRE 1TETL 4OCRL 3WXWL 1CE6A 1N7MH 4F2MA 1T83A 2I5YL 2W9LA 4L9LB 5C09D 3IDJA 5D93C 4R90L 1NBYA 1AJ7L 1S78C 2YEZA 5EPMB 1RUPH 1I1AB 2BMKB 1E4KA 3MV01 4OLWH 3PE9A 4M4PA 4N0UE 4N8VG 4N0CD 4HF5H 1IARB 3SQOL 5EUOA 4XPTH 3FB7A 1KUMA 1G7MA 4F7TA 5K59F 3S36X 4APQD 1U3HB 3ZE2F 2A0LD 1JL8A 2O5XH 1NCAH 5F7WC 4K8RD 1EV2E 1JWSA 2CUIA 3C8KB 3N9GL 5H37G 1T7ZA 1ADQA 1FZKA 3WIFB 3RWEA 1RVFL 4G6ML 1UVQA 3W0WE 3U4BH 2NY4D 3V5HA 1URLA 3VG9B 3BGMB 3QJFB 4ESKA 2EXYD 2QR0B 4HXAL 3AAZB 4JEGB 2PETA 1JN6B 1GZQA 2W9DL 4HKXB 3QUKB 3EJJX 2X09A 4L8DA 3IU4L 4M1GL 4KMLB 3AS0A 5JHDD 4G43A 4MLIA 3W11D 4H0HB 2XA8L 3O3EB 2W0LA 3MRHB 5GPRA 2AXFA 4N1HB 4HWZB 2ZOKB 4OFDA 3MGTB 5DDHB 4P3WA 2HT2D 1EGJL 5F9WC 4BZ2L 4IIQA 3SDXB 2YKLH 4NBXB 4YBLB 2XWJB 3IXTA 1CR9H 1CVSC 1PEZA 2BNQB 4FQLH 4OGZA 3WMSA 2E6QA 1X5XA 3PHOA 1DL7H 3BH8B 1MCEA 1PYWB 1ZT1B 3V6BR 1KLGB 3FQNB 3PP3H 4OQTH 2RIKA 2NXYD 1BECA 5DFVC 3UX9B 4XH2B 2JKXA 4H88H 5GISL 1NEZB 3QXDA 1S5IL 2C1OA 2X89A 5DMIL 1EX0A 4ISVA 5HGHB 3B5GA 2R15A 4LDLB 1M7IA 5K33A 5HYJA 2FBJL 3TN0A 3VW3H 4NKQB 3FT2B 5D1XB 3ET9F 1QNZH 5CGMA 3U46B 5EA0H 3LS4L 3E8UH 2CUMA 4LPUA 3CFDA 4M61B 1ZK9A 3MV8A 2YXFA 3MRCA 4JDVB 1LDSA 4AMKH 3NCYS 5CEZL 3TVMC 1ZTXH 1JZ4A 1J0HA 2F53B 4BZ1L 3MRGB 1A6VH 1YN7B 3GRWH 5CCKL 4BFIB 1CL7L 1U3ZA 2DN7A 2DDQH 4TOYH 3MNVB 1BX2B 4QO1A 4PRHA 5E5UB 4P2OD 4GAYB 2CR6A 2UUDK 1D5XB 3ECBB 3HE6A 4DUWA 4M6AA 3VXQA 5D5MB 2XYCA 3S37L 5DYOA 1JI1A 1EAPA 3HPLA 2J3SA 1KTLA 3QEGL 1JPSH 5EU7C 5B4MD 4JN2B 1DR9A 4LLAA 5DK2A 4HHAA 3ARBD 4X98B 3CVHL 3E6FA 1F90L 1ZLWK 2ADFL 3QZWB 4OF8A 4MXQD 4X6FA 1JHTB 2Z31B 4MNQA 1MCKA 3KXFA 3PP4H 3BP5B 5JMOC 3QUYC 1OAZL 2H3NA 4KJYA 2R0ZL 3PXJA 3QUMH 4JZOB 1U8HA 3FO2B 1WEJH 1V7MH 4RMTA 2VITB 3FT4B 4HDIB 5MEQB 1JGVL 4NGHL 4O58L 4UTAH 4YIQB 2BC4A 1DBBL 5CINH 3O9WB 4NKMA 5GGSY 1JWUA 3CFEB 5CILH 3IVKA 2KKQA 1G6RL 5HHPB 2YA2A 2J7LA 9CGTA 3LMJL 1JIBA 2IPUK 4KFZC 5D4QA 3WFEH 4X6DA 5D9SB 2RJMA 4Z5RB 1PFCA 4ZOEA 3KJ4C 3QQ3B 4LSDA 5KZCD 3FONA 2AEPH 3RNQB 5LGJA 3CSPA 5HI3C 2Y25A 3S37X 3RDTA 2OS7A 2GSIA 3L1OH 4RGNC 5ADOH 3OAZH 2O93L 2GW5A 2C9AA 4H1LG 3CDGA 3CZFB 4ERSH 4LLQA 2HN7A 3MV9A 3L9RA 4H8WC 2X4NA 1NEUA 4L8SC 5KSBF 4PTTA 4XBGB 4YDLB 5SWSB 2Q8AL 2FATH 1RIVH 1L4IA 3BD4A 3BP4B 1HH6B 5C0AD 3MRPB 2ED7A 3HLAA 1XF4B 2D7MA 2NY3D 3WN5B 1A4KB 1C08B 4U1SB 4X4XA 3ZE1E 1PX3A 1SJXA 5GRYA 1AGCB 5E00B 4BSVA 1KXTB 4JCLA 4I3GA 3TA3B 2WWKT 3QWQB 4K71B 2BVEA 3QIWD 4WTWA 5F1IA 4FOMA 2JJTC 3FHQA 2A6IB 3LEVL 5L6YH 4MGXA 2F74B 2P46B 5IB1B 3TCLB 4U0RB 3D0VA 1A1MA 5FYKE 4R0LC 3MMEA 5FO7A 1BPVA 1B0RA 1KGCE 2GJJA 2ITCA 2DI7A 3VWJB 4BKLA 4X4ME 4GKZB 1ZHLB 4F7CB 3C08L 2HKHH 4F80A 1VFBB 4N0CC 2H2PD 4BSJA 3NA9L 4JQVA 1O0VA 4PJ5E 2EZ0D 1X3DA 3L3HB 1MCWW 4WUUD 1MCOL 2D7QA 3B8SA 4K8RC 2YPLD 3RWCB 3D39A 2UZXB 2IBGA 2C4XA 2Q7YA 3B2UD 1LP9B 1X4XA 2IH3A 4D3CL 4ZSOB 3CFCL 5C0NC 2R0LH 3VFPB 4UB0L 2EEDA 4N1CA 5F8QC 3U36A 2ICWB 3GBMH 2EXYC 1EZVX 1MFEL 3AB0C 1VADB 4HUWB 3T3ME 3P4LA 3PV7A 4MJIE 4PJDF 1YEHL 2IMNA 4MNGA 1U8IB 2YSSA 3RWIB 1U92A 4OBRA 1IEAB 5IWLC 4FQCL 4JLRA 1KYOJ 1UCBL 2EO1A 5SX5K 2JLLA 2ZCLH 2JELL 2EDLA 2HT2C 3G6AA 3U9UB 2OK0H 4Z7UB 1IQDB 1UB6A 3O2VL 4WU5A 5HGAA 4YUEL 4G8FA 4FFYL 4Q2ZA 4P4RA 1QHOA 2NXYC 3WFHB 4U49A 5CFHA 3BZDA 3LN5A 3QFJA 2VN7A 1F13A 2BRRH 3VJ6B 3UDWA 1BWWA 4R26L 2OQJB 4KGJA 1HXMB 4BUHA 4LMQE 4KMQA 2GAZA 1CD9B 1FL6A 4ODHL 3ZHDA 4YPJA 2OJZL 4RQQB 4HK3N 1FIEA 4LVHB 3MNWA 4M7LL 4NYLB 5E94A 4ZMAT 3SDYH 15C8H 3CFJB 3DTXA 4PLJD 3KWWA 4L1DA 1INEL 3SDCA 4NDMB 3R8BB 1F4YL 3SDDB 1IRAY 5HY9A 2ID5A 4Z8FL 2EC8A 1EO8L 3V2AR 3RY5A 2ZKHL 4F37F 4YBQC 2CRMA 3TH4T 1Q94B 2P5WA 1J1OL 1EERB 1VDGA 4EI5D 1BBJA 1Q38A 5CEZE 1WTLA 3ZT5A 1ZANH 3DIFB 1YEGL 4MLSA 3NTCL 5B4MC 2KDGA 4KRPB 4BSWA 3OR6A 1EBAA 4PUBL 1L7TH 5DLML 2V2XB 4P3CL 4JREB 3KPNB 1GHFL 3BIAX 2GYSA 4Y4HC 4HFWA 1FGVH 3PF2A 2XWBB 1FV1B 4L3CA 1FHGA 3GMPA 5EU4B 2IBBA 3MZTA 2LU4A 2Z8RA 2BY3A 1HXYB 1C1EH 3PWPE 2ZUSA 4X99A 1M05B 1PEWA 1G9ML 3S5LB 3KHQA 4G8GE 2VABB 4FHBD 2JIXA 3BQUC 4XBEL 3S36H 1NUDA 4UT9L 4G7VH 2DMKA 4X6CB 4Y2DB 4XP9H 3MACL 4YGVA 4K23L 4ZNEE 3ULSA 1CTOA 1I7ZB 3GIVA 4WV1B 4NQCE 1Q0XL 2APVA 4ODWB 6FABL 5EOTA 3D3VD 5E8DH 4F33A 3S34L 2XN9E 1QBLL 1M6OA 5FYKH 5J56B 1KT2A 1P7HL 3VFOB 2ICCA 2YZ8A 3HE7C 3DRTA 5H94B 2ADGB 2CXGA 3OBAA 1OAUH 1TETH 3WXWH 2D2OA 2AEQL 2HJFA 5T3ZL 1GZPB 2I5YH 1FZOA 4HEME 4O5LL 2OL3B 1C5CH 2IGFL 3GO1L 1QPPA 1KPVB 1J8HA 3QO0A 4R90H 1AJ7H 3MUGA 4Z7VA 4NC0B 5F6HI 3I75B 1QLEL 1A6TB 1OD9A 2P43B 1MLCA 4AT6B 2BNRB 3IJSA 3DX6A 1MFBL 2NY3C 3CDYA 5ETUA 1YNKL 3QG6B 1UEMA 1NUNB 3SQOH 5CEYA 1FLTX 4PRIA 1CD1A 1AIFB 3QIBA 5B38G 5HYQB 3B3IA 1WT5A 4Y5VB 2GTZB 1RZKC 3L5XL 4X5WA 5DRZB 3Q6GL 3QIWC 4OUOA 4M48H 4PGDA 1CXKA 5FK9A 3TIEB 2E7LA 1UB5B 3N9GH 1WIOA 3TNNB 4WY7L 4EOWL 4FQXA 1TZGL 4K9EC 1LVEA 1RVFH 4G6MH 4DTGL 2CGRL 5GGVY 4PJ9B 5H35B 5I8OL 4HXAH 1CXLA 2XZQL 2W9DH 1TNNA 3TWCL 4L9LA 1R3JB 3IU4H 2P47B 1MSPA 1J11A 1DQJB 5EH1A 3O0RL 2H2PC 2XA8H 5EPMA 2VWEC 1NC2D 4NN5B 4Z7WE 5C0DB 3QG7H 1I1AA 2BMKA 2WIMA 5ITFB 3O8XD 4MD0B 2DAVA 3MJ9L 4KUCD 4BZ2H 5EBLB 4ZS6D 1NPUA 3MLSL 1PKQE 4MZ2A 4M6NL 2R8SL 3VFWB 4MXVE 4HPYH 4GKNB 3QNZB 5BZDA 3SJVB 2GJ6B 2VUOA 3BX7C 3DO7B 4HKBB 1FIGL 1U3HA 2A77L 1LWRA 3UROR 5GISH 3CVIL 1LE9A 1S5IH 1RIHL 5CIPH 1HKLL 3ZTJH 3C8KA 5DMIH 3UBXB 4WWKC 1NC4A 1QSEE 3WIFA 2FBJH 2IADB 3LSOB 3QJFA 3VXSD 4Y4KB 2QR0A 5IJKA 3AAZA 1JN6A 4HKXA 3LS4H 3QUKA 4KDTA 2AQ2A 5EU6B 3U30C 3G5XB 5A2JH 3O3EA 5DK0B 3P9MB 3MRHA 4BZ1H 3DI3B 3MGTA 3BGFC 1H3TA 5TGBA 3F8UB 1CL7H 3EUUA 2XWJA 3JWOC 2BNQA 3BH8A 1PYWA 1KLGA 2PTTB 1I9RL 3GDBA 4OZHF 1XF5B 4XH2A 3S37H 1NEZA 2AXGB 4GRWF 1NFDF 5ERWB 4YFLF 1U93A 3QEGH 2X7LB 4OCSH 1X7QA 5HGHA 1ZHNA 3KJ6H 3O11B 2EIBA 3CVHH 3SBWA 4UT6L 3HG1D 1E4XI 2ADFH 3CPLA 4P2QE 3FT2A 5D1XA 2J2ZA 2C7UA 3U46A 4G42B 5CJXC 1PJ9A 1OAZH 3OX8B 1EJOL 1SY6L 4XCFL 1S7TB 2R0ZH 1U58B 4ODUA 1GGBL 4JDVA 1II4E 1YZZA 1S9XB 3EYOB 5DJZA 2F53A 3BIBX 3RNKA 3EYUL 1JGVH 1I1CA 4RAVB 4NGHH 4O58H 4KZDL 3MRGA 2YC1B 1YN7A 1F45A 1DBBH 3SO3B 4BFIA 2VXSL 4LEXL 1WIUA 4HS8L 1H8SA 3TPKA 4HS6B 1BX2A 5ALBL 1C7TA 1G6RH 4GAYA 5JIPA 3FQUB 3ECBA 4HUUB 3RZCA 5D5MA 3LMJH 1F6FB 4LCCA 1KN2L 4WW2C 4MJ6B 3C6LD 2VRAA 4X98A 4AL8L 5C08E 1G0DA 4MVBD 3D2UB 3QZWA 3RGVD 4NRYB 1BD2D 2Z31A 2CR3A 5DWUL 3IDIB 3BP5A 1PDKA 1U8LB 2IFGA 2Q3AA 3CJJA 4JM2D 4QRQB 4RDQF 4I0PB 2VZ1A 4JZOA 3FO2A 2XXCB 1CIUA 4WI5A 3UTTE 5EIIA 2VITA 2Q8AH 3FT4A 1GAFL 5EUOF 3MRBB 4HDIA 5MEQA 4AIOA 4GS7C 1IBGL 2MCG1 4O02L 3O9WA 4MA1B 4XCYA 4ZAKD 4JFDE 5IMOB 4X0KA 2E7BA 1CFNB 4HSQA 1OP3K 1S9YB 2QKIA 5HHPA 4FP8L 3JVGC 3LKSB 4U4BA 3ARFD 1R24B 3C87A 1EFXB 5D9SA 3FN0L 3CFBB 3ARSA 4L5FH 4Z5RA 4QXTB 1UQSA 3QQ3A 5ADPH 4KJWC 3RNQA 2QTEA 1GIGL 1T7XA 3UJJH 1XF1A 2B5IC 3LEVH 2FO1A 3TCXA 1HHIB 1ITBB 1DQDH 5HXMA 2DLFH 1ZKAA 1JGUH 2GK0B 1JNHB 5HVGB 1N5AB 4GAFB 4KKAC 1T5WB 4RGNE 3CZFA 4DCQB 3QR2A 4XBGA 1G84A 2MNUA 3MBED 4QHLA 3C08H 1R3IL 1HEZB 2H9GB 3BP4A 5MEOB 3MRPA 1YY9D 3NA9H 1RZKL 5T3ZE 2ZG1A 5CZXD 4ZPTB 1J88A 3WN5A 1A4KA 4PJ8B 1MCOH 1C08A 3T65B 3T0XA 2YZ1A 4U1SA 1FVCB 2D0HA 2P7TA 1AGCA 5E00A 1PKOA 5EFIB 4D3CH 3TA3A 1DUYB 1ONQB 3CFCH 1FAKT 5I1CH 4LGRB 4UB0H 5D71L 3QISA 1G6VK 3G5YB 3EOTH 2DD8H 3FQWB 4DGYH 3EDFA 4J2XA 1YMME 3WDJA 4NP4L 4ONGL 5DJ0B 3TCLA 1YEHH 1EUUA 3VWJA 1RMFL 4FQCH 5CAYB 1OW0C 4GKZA 4WU7B 2JELH 5I19L 3O8XC 4QRTB 1ZHLA 4UQ2B 4ZS6C 1T20A 4F7CA 4E41D 3O2VH 5TJWK 4HIIB 5ICXA 1YY8B 4YUEH 4FFYH 1NAML 4YHYB 1VPOL 4BJLA 5FGCE 4FQIH 1N0XL 1DP0A 3MREA 4O2CB 4YQXH 4ACPA 4PBWD 4GUPB 3RWCA 4P2RD 3GUTB 3CZJA 1LP9A 3MLYL 4ZSOA 4U2ZA 5IP4A 3VFPA 4ODHH 4PY7B 5T1MB 4RAHA 2OJZH 5AWNL 4I8DA 2XKNB 3FB5A 1VADA 4ZTOL 5HI4D 4PFEA 4HUWA 1ETZB 5BW7C 5C9KA 3X3FL 4M7LH 1U8IA 1INEH 3RWIA 3ULUL 1F4YH 3HPJB 3JWOL 1PAMA 2C3XA 3G9VA 3U9UA 4Z7UA 1EO8H 1IQDA 3GZKA 4RMSA 2EDRA 1FFOA 2DJUA 1QLRB 5GRUL 5HHVL 4ZYKB 5IVNA 1ZOXA 4NO0D 3ZTJG 2VAJA 4FXKB 1J1OH 3WFHA 3SGEH 5CLWA 5HYFA 4C55A 5MEPB 5C0BD 3VJ6A 1YEGH 3NTCH 2AKRB 2OQJA 3CU7A 1HXMA 4PUBH 4PB0L 5DLMH 3D6GA 1NANH 3U82B 3MTRA 1GHFH 3L3GB 1QUNA 1GJIA 1BQSA 3I50H 4RQQA 4YBHA 1TPXB 1F97A 1U8KB 4PJ7B 3ZKMD 5MHSD 1YQVL 4DZBB 5CLTA 4G9FD 4M5ZL 3SY0B 5F9DC 3SOBH 1N2RA 2H2SD 5C09B 1JBJA 4NDMA 1G7QB 1G9MH 3FO0L 4XBEH 4J23A 2APWA 1VFAB 4WCYL 3LD8C 4EBQL 3KR3L 3MACH 5JA9A 4ODSL 2HH0H 1Q94A 1FH5L 4K23H 2AAVA 3DETD 1Q0XH 1Y0LB 2HRPL 3MRLB 1U8MB 4APQB 2OTUA 5I0ZA 3WHE0 3DIFA 4GJTB 3S34H 1QBLH 3C6LC 1DN0B 1EEYB 3DURB 3H9HB 3GJFH 2D9QB 2V2XA 2AJVL 2HLAB 4D0DB 2AQ1A 2RFXB 4MVBC 4NWUL 3EDEA 3KPNA 4JY6A 4JO1L 1NBQA 1YA5A 4I18C 2YD9A 4J3TA 2NY4B 5FYLL 1BVLB 2XWBA 5T3ZH 2C3VB 2WUBL 4IRSC 4O5LH 1B88A 2OCFD 5FM8A 2IGFH 3GO1H 5EORL 1VEMA 1UH2A 1M05A 3S5LA 1N6QL 4KKCD 5FUCE 3PQYD 3VFMB 3VFRB 4QOKB 1QR1B 1MFBH 3IKCB 1OF2B 1EFQA 1Q8MA 1YNKH 4X6CA 3ARQA 4FQPA 5DMGD 4Y2DA 3NVQA 1KACB 1I7ZA 5ESAB 5FHAL 4ODWA 5FO8B 3AY4A 4Z7NF 3L5XH 4P3DB 2NXYB 3Q6GH 4JHBA 3UPRB 2DJ4A 4MXWL 4WY7H 4EOWH 1W0YT 1TZGH 2I24N 2ADGA 2LU3A 4HWEL 4ETQB 4C56E 1NMAL 1I4FB 4DTGH 2CGRH 5IROA 5I8OH 3D69B 2XZQH 4F8TA 5DO2D 1OCWL 4U1GB 1AO7E 1QHPA 1GZPA 3TWCH 1QBMH 3HR5B 4G6KL 4J6RL 2OL3A 5J4MA 3O0RH 3F12B 1ZLVH 2FEEI 4X8JA 1B0WA 4PV9B 3I75A 2IAMC 1A6TA 3MXWL 3PWNB 1QP1A 4M9PA 2EKJA 3MJ9H 3GK8H 5CZXC 3O4OC 5JIHA 3MLSH 1A6UL 3QG6A 4NRZB 4M6NH 2R8SH 3CLFL 5GJSL 4K3EH 3F6IA 1MUJA 1IQWL 1AIFA 1FIGH 1NMCC 4P2OB 3MOQA 1NFKA 3BI9X 4WGVB 2AXHA 5CWSB 2GTZA 4MS8D 5E2WL 4S2SB 1RIHH 1BOYA 3TIEA 1HKLH 2G5BA 1UB5A 2FB4L 5CMAB 3TNNA 2VZOA 3ZSSA 5C3LD 3VGHA 1CF8L 4OTXL 2G60L 3ARBB 5DD0L 3MCG1 4FXGB 4PJ9A 4PRPD 5H35A 4CW1B 5IBUG 3BD3A 1R3JA 3TO4D 1ZGLP 1FFNB 2NMSA 1DQJA 4ONOA 4OFYA 3DVGB 2ARWA 5MP6L 4KWUA 5C0DA 5AZ2L 4QCIB 2VWEE 4U6XB 4QKXB 1Q72L 5JTWA 1HIML 4MD0A 2Q8BH 5EBLA 5L2JA 1NGXB 2XTJD 1RFDL 4DFHA 2YRLA 1AE6H 4GKNA 4KV5F 3QNZA 2A73A 3SJVA 3DO7A 1I9RH 3UMTA 1IM3B 1H3VA 3C60A 4RRPG 4HGKC 3SGEI 1H8OA 2J5LC 3SDXE 2J12B 1TZHA 3UBXA 5HDLA 3RBGA 1R3HA 5KZCB 5HI4C 5EDXA 2IQ9L 4IMLB 4UT6H 1QR4A 2IADA 3HAEB 3LSOA 4GQ9L 1IEHA 4Y4KA 3QEQE 4L3ED 3HRPA 2HRLA 1OHQA 5E2UL 1EJOH 1SY6H 1YEIL 4XX1E 1X9QA 3QB7C 2DQDL 4KPHL 5EU6A 1GGBH 2EEAA 3G5XA 1CDGA 5DK0A 4DK3A 3EYUH 4KZDH 5DRXA 5C0AB 2VXSH 4LEXH 1BLNB 4HS8H 1YUHB 3PWJB 3O6KL 2WQ8A 3ULUE 1WC7B 2NY3B 5D2NE 1SYSB 2FR4B 2PTTA 3UTPE 1UXSA 1XMWA 4JB9L 1MQ8A 3NCFB 3PL6D 1XF5A 2D7NA 5E70A 3HZMB 4LIQL 1MCDA 3IDYB 5ERWA 2VKWA 4PJGF 5TH2B 3QA3B 2EDKA 4MQ7B 1JZ7A 3QIWB 2XQBH 4LP4A 4JFHD 3O11A 4AL8H 5DHXB 3Q0HA 1V7NL 2EDQA 2EKSB 4G42A 1CK0L 2VTFA 5EOQL 1WAAA 3OX8A 1S7TA 3AMLA 3G9AB 1U58A 3VXUD 3KAAA 3EYOA 1S9XA 5I8CA 5MERB 1GAFH 3GMMB 3JZ7A 2YC1A 3RHWF 1P84K 3D5OF 3GBLA 4P9HL 1IBGH 2ENSA 4O02H 3CC5A 4RX4A 4GG6B 5D8JH 4HS6A 5F8RC 1XAUA 5EC1A 4F9LA 5DMJB 5EULV 4BA8A 4HUUA 4FP8H 5HHXL 2YPLB 4M6OL 3RQ3A 1G7HA 1DQLL 3R06B 4V1DE 5C0EB 2KBGA 4AG4L 3RUGB 1JMZA 2OI9C 4MJ6A 1IAIL 3KPSD 5E4EC 4RFNC 5DFTA 3NIGF 5E1AB 4Z0XB 5C9JB 4HZLB 5L9DL 1A47A 1WWWX 4QRUB 3D2UA 5SWZE 5DEZA 1U8NB 4QTIL 3G5ZB 1GL4B 3IDIA 1U8LA 2VZSA 2Y36L 4KKCC 1B2WL 3SKNB 4GQPH 3VD9A 43C9B 1J10A 4I0PA 4QNPE 2X41A 4HMEA 5TDNB 5I6XB 1R3IH 3CX5K 1P69B 3MRBA 5DMGC 4HD9A 3U30B 2E8ZA 5FYLE 4PJBE 4AEIL 3RY6C 3H7LA 1RUAH 3LEXB 1I3RB 5IEHB 5C0CD 1L6ZA 5IMOA 3EFDL 5FYJD 1T1YA 1S3KL 4MMZC 5SWSE 4OFKA 1S9YA 3MLTB 1A7PH 2D7PA 3ILQD 4XWOD 3I2CL 1R24A 2VLKD 1EFXA 3CFBA 3RVUD 3LDBC 2DIAA 2APBA 4QXTA 2DQIL 3MCKB 5FM5M 4ZQKB 1F3DJ 1H15B 1HHIA 2XNAB 3P3YA 4ZDHB 1PGRB 2GK0A 3NGBC 1JNHA 4NP4H 4ELMF 4DVBB 4ONGH 2A38A 1N5AA 4WTXA 4K3JL 3EAKA 3WHE1 3JV0A 4TVSa 1IFHL 4DCQA 5I19H 3F7PC 2XIDA 4OZGB 5HYSG 2R39A 5IFHL 4NUGL 3RL1B 4UILL 5L2KE 2WBJB 1HEZA 1MREL 2H9GA 5K9QI 5MEOA 1QRNE 4XP5L 1SQ2N 1RUKH 3TVMA 1VPOH 1CQKA 5AYQA 4P5MB 2IANE 4DWHA 5J1TC 1N0XH 4ZPTA 4PJ8A 4MS8C 3SKOB 3T65A 4EI5B 3O4LE 1FVCA 2E7MA 2PYFA 2RHEA 5FO9B 2PO6D 5EFIA 4J3VA 1JYVA 2WK2A 3DMMD 4JCMA 3MLYH 4WNQB 1DUYA 1ONQA 4L9DA 3L95B 1UH4A 4ZG1A 3G5YA 2ZUTA 4WW2B 4YX2H 3F58L 4NN7B 4ZTOH 3TO4C 2AK4A 3GIZL 3NPSB 4JPVL 5C0IB 1UJ3C 3ZDZF 3HRZB 3ULUH 1EUTA 3JBG7 5ISZD 3NACL 4GKOA 3S4SB 1SHMA 4UQ2A 3DUHA 5HHVH 5DD3L 2CIIB 4HIIA 1BM3L 1YY8A 4GRLC 2BY1A 2A83B 5I66B 5HHOD 1NCNA 1MVUB 4KK6C 4GS7B 2X5PA 4X6BB 4RFOL 1I8IB 4LQFL 1YJDC 1AY1L 1ZAGA 3FRUB 3D3VB 3GUTA 5INDB 3DUUB 1J0JA 4PB0H 2KQNA 2VDPL 2V5TA 2GSGA 4PY7A 1FNEB 5T1MA 4F9PC 2BHUA 2XKNA 2H8PB 4DEPC 4LKCB 1ETZA 1YQVH 1E27A 4M5ZH 4OLXH 5CEXA 4XMPL 3LQAC 2X6MA 3HPJA 5C7XL 3NH7H 2V2TB 1AHWC 2PYED 4DUVA 3FO0H 4TN9A 2N7BA 3ZYOA 4WCYH 4L8SA 4U05A 1QLRA 4ZYKA 1OQOA 4EBQH 3KR3H 2F8VA 3PIQB 5BVJB 5EZJB 4FXKA 4YAQA 1FH5H 4J1UB 5K9JH 1LK3L 1YDPB 2GIYA 2HRPH 2R1WB 3M07A 4PJHB 4PV8B 1T5XB 5MEPA 2YR3A 4KRMB 3V4PH 3RJQB 5DD5L 2H1PL 1I3VA 4Q9QL 3MJ7B 4N0FB 4PY8I 2AKRA 5GS0L 1EMTL 1KB5L 5I17B 1LD9B 4BH8A 3EOAB 2AJVH 1JV5B 3WKMH 5BV7B 4FFZL 4NZTL 5IBLC 4JO1H 2P44B 3BAEL 1P9MA 3BP6B 2VOTA 5FYLH 1U8KA 4PJ7A 1IGJB 2WUBH 4ZPVA 4LIQE 4DZBA 3SY0A 1ZLSL 2G9HB 5EORH 4N9OB 2LTQC 3CUPB 1UM6L 2E6JA 4F7EB 1T1ZB 1KENH 2YK1L 1VFAA 4CJ1A 3P11L 3T0AA 2ICWJ 1H5BB 4R8WL 4M1DL 4R4BB 3ZDXF 2EDEA 4YHNB 2UUDH 5JR1L 3PGDB 3RX7A 2HWZL 1Y0LA 5FHAH 1QPXA 4APQA 1PBYA 3QNXA 2VDKL 2X4OB 2EDHA 4NO3B 5JXEC 3FTGB 1DN0A 3DROB 1YC8A 3LB6C 3QWOB 1EEYA 3DURA 1HH9A 3H9HA 4LLVB 4LPWA 1RZJH 2HLAA 4D0DA 2RFXA 1RJZB 4OD2B 4HWEH 5I74B 5C0GB 1P1ZA 1NMAH 1WBYB 4P99A 1BVLA 3VXSB 1OCWH 5B39G 4UV7L 1J05A 1FYTD 4G6KH 4J6RH 3GSOA 5JHDA 1BBDL 4RFEB 5D1ZD 1ORQB 3PWLB 5DUML 5FKPB 4WJ5A 3BHBB 5IWLA 1QR1A 3IKCA 1MAKA 1OF2A 1U42A 1WGOA 1JYXA 1A6UH 2ERJC 4LDOB 5EO1A 3CLFH 5GJSH 1P4IH 2Z92B 1IQWH 1CU4L 4OQ1A 1UZ8A 5I8EB 1LP9F 2FJFB 3ILQC 3V6OA 5ESAA 4JZJB 3MCLL 4XWOC 4O00A 5FO8A 3C09C 4XCEB 3ZKSD 2LE9A 2QSQA 2BNRE 2W65A 4GMTL 5LAXB 5E2WH 2VKXA 3UPRA 1MVFA 4NC2B 2FB4H 2D4DA 2ED9A 1U2CA 2W60A 4H5SA 1YNLL 4P57B 4ETQA 1CF8H 4OTXH 2G60H 4ZO7A 3MV7D 1VGKA 4F7PA 4ZOCA 2Y5EA 5DJ6B 4JANB 4DGVL 1Z9MA 3HR5A 4AEEA 1BWMA 4GXUM 3DV6B 3F12A 5MP6H 3G6JE 2KPNA 4PV9A 1WWAX 1FGNH 5AZ2H 4PRAB 2P8PB 1RIUL 1Q72H 2D31B 5C6WH 4NRZA 1RFDH 3IJHB 4XVSH 5D7KE 3LD8B 1OARL 2JE8A 1YEFL 2PO6C 1U95B 4YLQT 4P2OA 2FECL 2B1AL 3DMMC 4F15B 5F7LB 1K8IB 1DBKL 4XP6H 1KJMB 1K4CB 4LARL 4S2SA 1KTRL 1L6XA 5CMAA 3QT2A 4PJAE 5A16A 3C6LB 2EDDA 2XY1A 2GJ6E 2IQ9H 1OGAB 3BISA 4ZO9A 3DSFL 1HOCB 4GQ9H 5MI0C 4JVUA 4NKDA 3RGVB 4CW1A 4F3FB 2ZWLT 1OSPL 5E2UH 1BD2B 1YEIH 5D7IB 4JM2B 2DQDH 4KPHH 3IXAB 3DVGA 2ZUQB 3N85L 5F9JB 3ZT6A 1AD0B 4U6XA 1YN6B 4DZ8A 3VMOA 1YJDL 1TMCB 4X5LA 4LAQL 3WXVL 5BQ7B 3V6ZB 3RA7L 1NGXA 4KVNL 4XX1G 2DYPD 3FFCE 5ESQB 3O6KH 1MHEB 4ZAKB 2LVEA 2JCCA 4N5EC 5CKGA 3L7FB 4URTB 4LRIA 1IM3A 4JB9H 1A7QL 1KIQB 1G7PB 2ESVE 2CIKB 4LIQH 2HT3D 4Y8AA 3ARFB 1G9EA 4HS3B 4I3SL 1LMKA 3HMXL 1X5AA 3OKMB 1EIBA 1WK0A 2IPKB 3NCBB 3H3PL 1S7WB 4KKBD 2JB6A 1TNMA 4KROD 1QSVA 3T3MF 2BY0A 3LQAL 32C2B 4IMLA 3T0DA 4OI9A 2DLTA 3HAEA 1V7NH 5GGQL 4MMXC 2E9JA 5BS0E 1HHHA 1CK0H 4MB5A 2OR7A 4ZO8A 5SX5H 3VXRE 3JTTB 4E42B 2DTML 4XVJL 4NQDE 5D96B 2RQ8A 3MBEB 3QYCA 2NZ9D 1MCFA 4P9HH 3IFOB 1UG9A 4QRRE 5C0AA 5T1KD 1YUHA 3PWJA 3U4AA 3OB0H 1SYSA 5CBEB 1MWAB 4LKXB 5HHXH 4P5TC 2B1HL 4M6OH 3VFTB 3HZMA 2H32B 4AG4H 2FIKB 4EI6B 1IAIH 3O2WL 4PJXE 4M7KL 2VLJB 3QIWA 3TBSB 1I8MB 5HGGS 4CVUA 4E5XB 4ZFOA 1H3PL 5L9DH 2CLRB 3P77B 4LFHG 5ID1A 1CN4A 1OPGL 1D5ZB 4QTIH 2EKSA 5JO5A 3O6LL 3RVWD 4IMKC 2Y36H 3DYPA 3ELAT 1B2WH 1CT8B 3BH9B 2XQYG 1CFVL 5CGYC 1QOKA 3QFDA 4K94L 5CKAA 4AEIH 1GGCL 2R1XB 4ZTPL 4LPTA 4JRXE 4E41B 4CDHA 5J3HD 1PY9A 2UVFA 4RGMC 1EEZB 1N59A 4GG6A 3EFDH 1VEOA 1S3KH 4Y5YB 4WUUA 2XA3A 2J8UB 5DTFB 2X1QA 4Z18A 4P2RB 2W91A 3I2CH 3R06A 3UAJD 4JFQB 5C0EA 2DKSA 3RUGA 4QXUL 5GGSB 5HI5D 5E1AA 4Z0XA 5HDQL 2HJLB 5C9JA 3GNML 4HZLA 4KK8C 5D72L 3WUWB 4B50A 3TIDB 4LASL 4QRUA 4WRLA 3OHXB 4LLYB 4NHUB 5J11C 1UM4L 3G5ZA 4K3JH 3RKPA 1SVCP 2X1WL 4HG4K 5DEFB 3SKNA 1IFHH 5D1ZC 43C9A 4PGEB 1GYAA 1J86A 5TDNA 1LO5A 5IFHH 1VSCA 4NUGH 4UILH 5HVWA 1MREH 3T8XB 3F6LA 3GKWL 1KEGH 4XP5H 2VR5A 3LEXA 4MQXD 1I3RA 4HEPG 4JHZA 1MCHA 4KJQD 1UKTA 4NO0B 4FQJL 3MRKA 3OKDB 3QWRD 4EXKA 4LSVH 5I1AB 3OZ9L 5FDYA 4IRJD 4QLRA 4RISL 5C0BB 5KSAD 4KHXL 4HIHA 4CVZB 1Z9SA 3O2DA 4ZQKA 4Z9KB 1H15A 1E4WL 1JF1A 2EC9U 2YN3A 4U3XA 2GCYA 2XNAA 2N1KA 3MUY1 1LQSR 4GAJL 4ZDHA 4LCUB 4NSKA 4ODXA 3V7AE 4DVBA 5I1JH 2ITDA 4OBSA 3DXAD 4JPVH 3ROOB 4G9FB 4PP1C 1RULL 3NACH 3NIDE 4G6FD 4OZGA 5CZKA 5F88B 3L5IA 2IPUG 1W72B 3QCVL 3RL1A 5DQ9B 3T0EE 5DD3H 5FGSA 1CDJA 1BM3H 2AJXL 3EJYD 1IAOB 3TO2B 2P5ED 4U6VL 5CSBA 3ILPB 1IJ9A 4JFED 4P5MA 3P30L 4GLRH 5HSFA 4D0BA 4LU5H 1HE7A 4AH2B 1EPFA 5TDOA 5IESL 4RFOH 5DD1H 4EI5A 3O3BB 1G7IB 2JJVA 2ZJSL 4LQFH 4JKKA 5LGKA 1AY1H 5FO9A 1Z5LB 4FXLA 2OR9L 3PUCA 5IFAL 4WNQA 2XACC 1AGBB 1ZLUH 2VDPH 2HFFB 3L95A 4KI5C 1TQBC 2N4IA 1CQYA 3QUZD 4FQ1L 4WW2A 3GFUA 4HIEB 1BJMA 4UU9B 1WAAF 1I9JL 5D7LD 2V5RA 1JPTL 1OTTD 5C0IA 2D0GA 2K7PA 1AKJA 3HRZA 4XMPH 1WBXB 3X17A 3S4SA 2V9QA 3BZ4B 4I13B 4NRXB 5EO0B 2HVJB 3PQYB 1XH3B 4Z78B 2CPCA 2CIIA 3ETBF 2YMXL 5I66A 2A83A 2FJGB 1I7RB 4OF3A 1MVUA 4X5XB 2RCSL 5ICZA 4H20L 1LK3H 4X6BA 5ENWB 4WFGE 2HT3C 2AI0L 5IB4B 5HJ3A 5DD5H 3FRUA 2H1PH 1LILA 3D3VA 5FV2A 4Q9QH 5INDA 3QHFL 5GS0H 3DUUA 1EMTH 1KB5H 4KKBC 5KSBB 1J8KA 5M95B 2CJUL 5CHNB 1IGTB 3JVGA 1G0YR 4FFZH 5F70A 5HGDB 4NZTH 1NCUA 3BAEH 4KVCL 4XWGL 2YPKB 4LKCA 5F7UA 4X7FC 1ND0B 1ZLSH 1JYWA 4J3WA 4YPGB 4MA3A 3JWDC 5DRNB 2D7TL 4JY4A 2APFA 2V2TA 1UM6H 3HNVL 4X7CC 1SEBB 1FFPB 2AJZB 3ZDYE 1WUNT 3TYGL 7CGTA 3P11H 2ZCKL 1FO0B 3G5VB 4HCRA 3BN9C 4R8WH 4M1DH 4ZUVB 3PIQA 5BVJA 1F2XK 3MJ8B 5C09E 5JR1H 1J8HD 4J1UA 3Q6FA 3BESR 2H45A 3M8OL 4KK9D 5JZ7D 1AXSB 1I1FB 2HWZH 2R1WA 4PJHA 1T5XA 3D85D 1F11B 4JRWA 2VDKH 3P4MB 5IM7B 2VQ1B 4Z7OE 5F72S 3MJ7A 4N0FA 2WANA 5AEAA 5I17A 4ZXBC 5DEGA 3EOAA 3S5LG 1JV5A 1F4XL 4E9LA 2NTSP 3BP6A 4MQSB 2C26A 4ZFFA 1AXTL 3RVWC 1IGJA 3WFBL 2KZ1B 2G9HA 5FECB 1AR1D 4MWFB 4AIZB 1UT9A 3TO4B 2A6JB 2RR3A 3CUPA 3DX8A 3OAUL 5MEND 1BBDH 4A6YL 5DUMH 2H26B 1NC2A 4F7EA 1T1ZA 4BELD 4RGOL 1A7OL 2WLYA 1BJ8A 3KDMB 3O8XA 1H5BA 2BSTB 4R4BA 2R2BB 3T4YB 2XTJB 4YHNA 1CU4H 3PGDA 1OP5K 1FBIH 2ZG2A 1P5UA 3UCRA 4KKNA 3TJHD 3MCLH 4HWNA 4PJDB 3UAJC 4QOKE 4JJHA 1JHKL 2X4OA 2ZUYA 4NO3A 4GMTH 3FTGA 3VD4A 5HI5C 3DROA 3QWOA 2UYLB 2E27L 1QSFE 3ARGD 2F54D 1T2XA 4LLVA 5KVEL 1CXIA 5D2LA 1YNLH 4NQEE 5DGQA 4WI3A 4XHQA 5IMKA 5DSCB 5C0GA 2MWCA 1S7RB 1D5BA 4KXZI 1WBYA 5C07D 3ZYIA 1TJGL 2X40A 1J0IA 3VXSA 4DGVH 2I07B 4DKAA 3V5KB 3KPQB 4BQ8A 5J12C 4KMTL 1U8OB 2XWTB 4RFEA 4OZFH 3PGCB 1ORQA 3PWLA 3OGOE 4MQXC 5FKPA 3J7HA 3MRJB 2PF6A 2FRGP 3SE3A 5IMMA 4F57H 5IHUH 4X9GA 3QXAA 2Z92A 5E2JA 1OARH 1OP3H 3G08B 5I8EA 1YEFH 2FJFA 5D1QD 2Y6SD 4JZJA 4DN3L 2V9TA 2B1AH 3WIHL 3GI9L 3JWNC 2YS4A 3L6FB 4XCEA 4RWYL 5E6YA 5LAXA 3PL6B 4LARH 1Y6NR 1HHGB 1HZHL 3BKJL 3FRPG 4A2MA 3CX2A 5F1NB 1BHGA 3DSFH 3TBWB 3OPZL 3L3IB 3BPCB 4XNQA 3HG1A 5E9DE 5FXCH 5GS2H 2HLFD 5DJ6A 4JANA 5J7CC 1OSPH 1U0QA 1A6AB 2ZNWA 3DV6A 3N85H 2NY0C 3VXUB 1DBJL 3B2VL 4PRAA 2P8PA 12E8L 3RRQA 2VLRD 1JTPA 1DBML 4LAQH 4OLUH 5EU5B 1RUMH 3WXVH 3RA7H 4U2YA 1TZIA 4KVNH 2AJ3B 5HVHC 4WI8A 4WO4D 2CSPA 3P0YH 1U95A 2FH8A 2I9LB 3KHOA 1A7QH 3MXVH 4FZ8H 3ZO0A 3T2NL 1K8IA 1KJMA 1K4CA 4JVPA 4I3SH 3HMXH 3QUZC 3H3PH 4PJ7F 3KPSB 3C6LA 3PDDA 4RBPK 2KQMA 5A3IC 1HOCA 3L5WB 3RGVA 4OZIE 1TJIL 4F3FA 5KVMC 1YNTB 3VFGL 1BD2A 1WF5A 2NY2D 3QQ9C 5IF0B 5D7IA 4JM2A 2DTMH 2ZUVA 3IXAA 5I8KL 5F9JA 3GJEA 4XVJH 2ADIB 2AK1H 3W0WD 2Y7QB 1FVEB 5T5NF 1YN6A 2DTSA 1JP5A 1YEKL 2PTUA 5CSZB 5BQ7A 4XPBL 3V6ZA 1X5GA 4LHQB 4HMDA 2BHYA 4NO2B 2IWGA 1MFNA 5ESQA 1MHEA 4ZAKA 4MCZB 4CN1A 3SKUD 4TVPL 1A0QH 3L7FA 4PRBA 4L8CB 3LKQB 1KCSL 3OXRB 5E5MB 4XZUB 2B1HH 1KIQA 1XGQB 2CIKA 3P4OB 4MDIB 3BW9B 3ARFA 2CK0L 2VLKB 3L3JB 4HS3A 4M7KH 3OKMA 5BV7L 1XCTB 1S7WA 2R9HD 4LVNC 4XGZB 1H3PH 32C2A 3X12B 1IKFL 3UTSB 4Y1AE 5ESVB 1LK2B 3O6LH 4MAYC 3PHSA 4JGUA 5E8PB 3ZKXC 1W0WB 3HZYB 1AC6A 3VI4E 4OT1L 3JTTA 1CFVH 4L4VE 4K94H 4D9LH 5EBMA 3MBEA 2GT9B 3PV6B 4ZTPH 3SKJL 3IFOA 2DWDB 4Q9BA 4LNVA 3FO1B 1MWAA 2UZIL 5IK3B 4LKXA 4XT1C 3EJZD 3VFTA 1YMHB 2H32A 3DMMB 1OWRM 2FIKA 4QXUH 4EI6A 5HDQH 4FFVD 1CLOL 1I8MA 3KS0J 1KNOB 3TBSA 4E5XA 5D72H 2CLRA 3P77A 3EO0B 3N1MC 5FUZL 4OGAD 2A6DB 1D5ZA 2YPLE 4W4OC 3IDNB 3U7AA 3LS5L 2PW2A 4ZO6A 3BH9A 1CICB 3C6SB 5FF6A 1BQHG 2YRPA 5B8CC 3I9GL 3SE4A 1CDCA 1UACL 4YZFF 4M4RA 3GKWH 3CSYB 2R1XA 2BSRB 4E41A 2IFFL 2XZAH 1OT1A 3ES6B 1EEZA 2O26U 4XXCA 1X4YA 5HHOB 3H7BB 5EG6C 4FQJH 4Y5YA 3DWTA 2B0SL 2WP3T 1S9VB 4RISH 3GB7B 3RKDD 5IVXB 1RU9H 2J8UA 1U91A 2NX5E 5DTFA 4KHXH 4P2RA 4G9DB 2FECI 4NIKB 4O2EB 2C5DC 3KLSA 3ULVL 2BNUA 4OCWL 1F2QA 2P48B 5IOPB 2HJLA 2AGJL 1E4WH 1KXVC 5E1HB 3WUWA 4GAJH 2G5RA 5DHVB 3STZB 4R2GC 3TIDA 4PJFE 1TVHB 3OHXA 4NHUA 4I2XB 4TUOB 4YE4L 5EZLB 4IOSD 2D03L 1O5DT 3E3QC 2VZ3A 2CDFB 2GITB 1RULH 1QYGL 3TT1H 4PGEA 1XGTB 2NXZC 4OI7A 4LSQL 2PYEB 3QCVH 4GRWB 1NFDB 3V7AG 3KS0H 3T8XA 1QG3A 1JZ3A 3UJIL 2JCCF 1RURL 3HKFA 1GC1C 2HG5B 2AJXH 2BVQB 2VN4A 4CUCA 2JK5B 4NFDA 4U6VH 3VCLB 4NO0A 3P30H 4X7DC 4JFZL 2A2QT 2WWMD 5IESH 4YGAB 3QDME 1DDHB 2ZJSH 2FO4B 5C0BA 3LY6A 3GSWA 3PDOB 1T6WA 4YO0B 3W9DB 5IFAH 3HCVB 4DAGL 4CVZA 1P6AB 4GOSA 1CLZL 3UPCA 2OXGA 4FQ1H 4OZFG 2HLFC 4OM0L 4M62L 4OCYL 1ITCA 1JPTH 3AS3A 5JOFB 3ROOA 4G9FA 1QRKA 1T7WA 1DJSA 3GSNL 3DLQR 5DRWB 4WFEE 3U9PL 5F88A 1F58L 4J3XA 4WHTB 3IAGC 5DQ9A 1CGTA 4YJZL 3TO2A 4WO4C 2BXZA 2FYYB 5FYKD 4Z6AT 2RCSH 1KGCD 5IFJB 4H20H 3EO9L 3N1FC 4F8QA 3O3BA 1WV7T 1G7IA 2AI0H 3QUXC 4M8VA 5T1DL 3TM6A 1Z5LA 3X14B 5E6IC 4KQ3L 1AGBA 2CJUH 3KPTA 2VZVA 1I8LC 3FO9B 2P24A 5I1EH 4CBPA 2GKIA 1N4XL 4PJ5D 5IB5B 3FB7B 2VIRB 4F7TB 1G7MB 4KI5E 1A9BB 2W0FB 1HYSD 4KVCH 4XWGH 4P48A 2WIIB 2NY2C 4M5YL 1QFWI 4I9WE 1YPZA 1HSBB 3INUL 2D7TH 2DQCL 1FYTB 4ZNCD 3HNVH 3V4UL 3C5ZD 3HB3D 3BZ4A 4NRXA 4UIKL 5EO0A 4GG6F 1I85A 2HVJA 3TYGH 5D1ZB 3PQYA 1XH3A 4Z78A 1N5YL 1F02I 2FJGA 3B9KD 4WHDA 1I7RA 4K3DL 3M8OH 4X5XA 1NGYA 1OB1B 3RY6A 5ENWA 4S11A 5DZNA 4U1NB 1IC7L 5DUBA 3WEXB 5IB4A 2COQA 4P9ML 2R9HC 4X8XA 1IGTA 5GJTH 2J4WL 5HYIA 1P84J 3WO4C 3PHOB 5HGDA 4HPOL 4TVPE 4TYUA 3MV11 3FQTB 1RJYA 1AXTH 1FQ9C 3MV7B 4C54A 1ES0A 4AEHL 3WFBH 1ND0A 4YPGA 2XICA 2C1OB 1AR2A 2AQ3A 3H9SE 1NLDL 3K2UL 3OAUH 3BP7B 2MOVA 2DLEA 1IAKB 3QI9C 4A6YH 1M7IB 1HN1A 1SEBA 3MRNB 1FFPA 2AJZA 4D94A 1KLUA 1A7OH 1FO0A 3WFZA 4EUPB 4XP1L 4N9GB 3MJ8A 1AXSA 1I1FA 2PW1B 1CGSL 3MV8B 3PGFL 1F11A 2EDOA 1JHKH 4UUJB 3P4MA 5IM7A 4AK1A 5KANI 1WWBX 4FFVC 4WEMB 2E27H 3X13B 5L8KB 1D9KD 1CR9L 4NQSB 1ZWIA 1DSFL 5HHME 4Y2OA 1EHNA 3HE6B 5CEZD 1OQXA 1YC7A 1TJGH 4PRPA 1TQBB 1CDUA 4OZGF 1I3GH 2DKUA 2E7CA 3B5HA 3RJDA 2NY1D 5FECA 4MWFA 3HPLB 4AIZA 3TO4A 2A6JA 1KTLB 4Y19E 4KMTH 4KKLD 3OB8A 4FTVE 2H26A 4R4ND 5H2BB 1MCLA 3VW3L 5TF1H 2D4FA 2VDNH 3SGDH 3KDMA 1QNZL 2E7HA 4MNQB 1WQVT 3KXFB 2R2BA 3LZFL 3T4YA 2DYPB 3RKDC 1CLCA 4EVNB 2H3NB 4N1EA 3PWPD 4DN3H 5HYEA 3TESA 4N8VB 3WIHH 3U0PA 1P4BH 3GI9H 3M1BA 3B9VA 4G8GD 4RWYH 1ZVHA 4WW2F 4K55A 2UYLA 1HZHH 4D9RE 3BKJH 4U1HB 1R0AH 2ATPB 5DSCA 4KROB 1TVBB 3OPZH 2P49B 1KCRL 4NQCD 3C60D 3VXME 5HDOA 4F9PA 1OLZA 2I07A 4L3EA 2XN9D 3VRLE 1GC1L 3V5KA 3KPQA 3ULVE 1VA9A 5FCUL 3V52L 4PR5B 5TDPA 2ICEB 5KANG 1FPTL 1OAQL 1U8OA 2XWTA 4PJBF 1CBVL 1W72L 3PGCA 3B2VH 2PN5A 1A6PA 1DBMH 3HUJB 2WWMC 4QF1B 1T89C 1EVTC 5T1KB 1S7XB 3G08A 3L9RB 4BK5A 3QUML 3MGAA 3U1SL 4XHJD 4WVRA 1UZ6E 4IHOB 5HDBE 1MF2H 1QA9A 2MQCA 3R8QA 1Z0MA 3VGGA 5F1NA 1INQB 3TBWA 3L3IA 3BPCA 5F7NC 1J87A 4LCWE 1TJIH 3I3EA 2NY6C 4QHKI 3VFGH 3WFEL 1WZMA 5GRZA 1A6AA 5I8KH 4PJCE 3LVEA 4YXLL 1OGAE 3VXUA 5IHZB 1P7QD 1A1OB 1M4KA 4L4TE 4UNTA 1YEKH 5AYUL 3NAAL 3U0WH 2FJHB 5EU5A 3D0VB 4XPBH 3GEWB 5FO7B 1B0RB 4KUZL 5ACLA 2HA1A 4S10A 1IE5A 5I73B 3MJGX 2I9LA 2LAAA 3PJSB 4L4JA 4PG9A 4BFGA 4EJ1C 1BZQK 1KJ2B 1S78D 2X4RB 3QULB 5BV7H 1UXWB 1HYSC 3WNOA 3D25B 3KPSA 5T33L 3FAXA 2VE6B 1A9EA 4K7FB 3RY4A 1IKFH 3AS2A 3D39B 2VSCA 4OGYL 1YNTA 3C5ZC 4Y5XC 4V2CB 3DHJA 5CP3A 3W9EA 4EQ3A 1ZXQA 4KUCF 1QSED 1ZVYA 1SM3L 2ADIA 2Y7QA 1FVEA 3B9KC 3MA9L 3SKJH 1H8NA 3K80A 1WCQA 5CSZA 5JORB 1OAKL 1NCTA 4NO2A 1JF5A 2X9WA 5C0CA 1I9IL 3K81A 4L8CA 2R29L 2UZIH 3LKQA 3OXRA 4PGJA 5E5MA 4IRJB 4XZUA 5D2LF 4NN6C 1XGQA 4N0YL 3P4OA 5KSAB 3BW9A 3G6DL 2VLKA 3UZVB 2VO5A 5I75B 1CLOH 3GMOB 4Q2ZB 1XCTA 2UWEA 4P4KD 1T0PB 4XGZA 5DURD 3AM8C 3X12A 5FUZH 3F5WB 1T7VA 4DJMA 5EBWB 1LK2A 5E8PA 2YXMA 3DXAB 3LS5H 1W0WA 4JR9L 5ANME 1TITA 3HZYA 5DFVD 5GGTL 2YPVH 3SN6N 3QEHB 5JW4M 5HPOA 2VLJE 2VDOL 3DUSB 4BYHA 3I9GH 3PWUB 4G6FB 1JPFB 1UACH 4H1LB 5BOPA 4WTZA 5IW1B 2GT9A 3PV6A 2IFFH 3BEVB 2DWDA 4P2QD 3SGKC 1B4JL 2FIRT 1NDGB 2P5EB 3GSUB 3EGSB 3K8KA 5JIIA 4OAWB 4U6HB 3ZE2E 3FO1A 2B0SH 5IK3A 2OZ4A 5HVHB 2DI9A 1EH9A 2M1KA 2PO6A 5C6PB 2CDGA 3DMMA 4OFPA 3S7GA 3ULVH 4OCWH 2AGJH 1GGIL 1BBJB 3VH8G 3CXDL 5AUMB 3TYFB 5I9QC 3EO0A 3ARPA 1MQKH 4OUUA 2NY1C 4R97C 2A6DA 1GCFA