4KI1A

Primitive triclinic crystal form of the human ige-fc(epsilon)3-4 bound to its b cell receptor dercd23
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
208
Chain Sequence
VSAYLSRPSPFDLFIRKSPTITCLVVDPSKGTVQLTWSRASGKPVQHSTRKEEKQRNGTLTVTSTLPVGTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IG EPSILON CHAIN C REGION
publication title A range of C3-C4 interdomain angles in IgE Fc accommodate binding to its receptor CD23.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 208
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ki1A02
2VKXA 2FJFB 2OJZL 1FE8H 4Z77B 3BD4A 5CP3A 4FN0A 1NBZB 4GQPH 5J12B 5K9KB 4JQXC 5GS1B 5BRZA 3KPOA 2R0WL 1VKXA 4I18A 3LH2L 3IETA 5DRWB 5D1XC 4HV8A 5I1DA 3UJJL 4FXGA 2R39A 4LASH 4PYHA 3DTXA 3V4PH 3GBLA 4ERSH 3TO4C 3WNPA 5HVFB 1RHFA 4EXKA 1M6OB 2Z4QA 3E6FA 3O4LE 5IMOB 4YFLF 3MLTA 1EGJA 1XCTB 4NBXB 4P2QA 3NA9L 4JM2C 1FL3B 1YEDA 3GI8L 1I7UB 1R5VA 3QR2A 2PF6A 2HLAA 4U6VH 1U3HA 3VFMA 5GIRB 3FCTB 4H88H 1NBYA 3CDCA 3VCLB 1G6RL 4U1NB 2XXCB 2HKFH 1KN4L 1FE8L 4CU8A 2OMBA 2D7TL 1DEEB 1CXFA 3C8HA 3CFEB 4RMWA 4PJFB 1JFQL 4M9PA 4RAUB 4KV5E 4LASL 3BPOB 5HHME 3V4PL 1ZWIB 4K3EL 4ERSL 4R4NC 4F15C 3EYOB 3HE7D 1R3LA 2UWEE 2NY6B 4V2CB 2AJSL 2PO6C 1RJCA 3F62A 1D9KA 2YPLB 3JV4A 4AMKH 1NDGB 1KJ3H 4U6VL 3O4OB 1JZ2A 5D1ZB 4U7KA 5MI0C 5ICZB 1KELH 3T0ED 1R24A 3KDMB 3KR3H 1YMHB 1S7VA 4YGVA 4OZGB 4M5ZH 2CLVB 3U79A 1AO7D 1N26A 4LCYB 1J10A 2W38A 4JRYA 4LBEA 3S36L 4CDHA 2HJKB 4PRBB 1T0MB 1IAMA 5IQ9B 2X4RA 1TCRB 4GT7A 4LCWD 5E8NA 1HXMA 3FOLA 4TSBL 3IU3B 2DD8H 1XGPA 3SHSA 1ZT4B 4FFWD 3VXPA 4F7EB 4M7JH 4JFXB 5ESAA 1C5CH 5EBGA 3RVWC 5C0GA 1G7IA 4OUOA 4EIGB 3VRIB 4XCFL 2DB8A 5MHSD 3U2SB 2F54B 1KJ3L 5CHNA 2DWDB 5EORH 3QDJE 2H2PC 3H7BA 3LCYA 3CXHJ 3U46B 4PRHD 3V5KB 3NFPB 2QSCL 3RA7H 3VRLF 2VDRH 1H0DB 1T03H 4LCUA 5MENB 1DQML 1JWMB 4MNHB 4HKBA 1IM3B 3CVHL 1BEYH 4LLDA 5TFSH 5DWUH 2VLJD 5E5UB 2P8LB 1MFDL 2VLRB 4YHLL 3N0PB 1FVEA 3LQAH 4NQEB 4YE4L 4U7MA 3V7AG 2YPLE 5I76A 4U6XB 5IVXB 3I85A 4M7JL 1XT5A 1JV5A 3TBYB 2IH1B 1BD2D 3D48R 3HNSH 5D2LB 2HKHH 1YEGH 2ICES 4LF3B 5F96H 1JWSA 1KJMB 4U6HB 3PV6B 1R3IL 1X5LA 3MUGA 4F9LC 2ICCA 2ICWB 4QHKJ 1CIDA 2D0HA 4JR9H 5B38B 1X7QB 4YPGB 4OF6A 4TNWK 2YUZA 4KMQA 3RA7L 1T03L 1NC4D 1S9VA 4RGND 4UOJA 5ERWB 1OWRM 3VGBA 3ZTJG 1B4JL 1BEYL 1YUHA 4GUPB 5SX4H 3CFCL 2IWGA 2Z92A 4FQHB 3BZ4B 3FB7B 1AHWA 1OW0C 4N5UA 3ORJA 1CE6A 5HHMD 2EYRA 4D0BA 2H32H 2AJVL 3K0WA 2BSTB 2F54E 2LU3A 2HKHL 1YEGL 4R3SB 3SN6N 1J12A 2NTFB 3TN0B 2P8PA 4EJ1C 3K1KC 1YMMA 1R5IA 4RBPH 5DJ8B 4U1KB 3BZEB 2A74B 4JFHE 4JANA 3IB4A 3SDAB 4WI9A 2GITA 5I1LB 3MNVA 3BDXA 4JR9L 1ZANH 4LVNC 1FO0B 4P23D 3WN5B 1LHZA 5DYOA 4D0CB 1HI6B 2ZNXA 4LARH 2VLRE 3HZMA 4R2GC 3BP7B 3BYYA 3VXRB 3R06A 3O3BB 4K07A 3BIKB 3O3DB 4BQ6A 4Y4HD 3LKRA 3U0WL 1QG3A 5D2LE 1EVTC 1HH9A 3HS0B 3KYMA 4CJ1A 3QIBC 3PWJA 4EI6B 1UM4H 4FQXB 2FZ3A 5F3HB 5DD0H 4DQOH 5BQ7B 1D6EA 1G7LB 3MYJA 4AIXA 3BT2H 1GYAA 1LILA 3EGSB 1UB6A 2FRGP 1DQLH 3CVIL 1AKJD 1ZHLB 4XC1H 4Y5YC 3QDJD 3MJ8A 1FYTE 4W4NA 2VITA 4LARL 4JZOB 3KPNA 4ISVB 4L4TB 4RFNB 5CBAA 1B90A 3EO0A 3QUMA 3V9FA 3ROOA 5IB2A 2AP2A 3E6HA 5I75C 5CKAA 3FONB 3IDMB 4X7SH 3ARGC 1IC7H 2R0ZH 1UM4L 2VXUH 4M7ZC 3VG0H 1A14L 5DD0L 2R9HD 2Q8BH 3RZCB 4DQOL 5ABDE 5ITBH 2JB5H 3KVQA 2UZIH 3BT2L 4PB0H 4ELMA 3PWLB 5F9WC 1DQLL 2WANA 4X0KB 4XC1L 3VXUE 4AIZB 2X42A 2NZ9C 4ZPVA 1YZZA 1CFQA 1ED3A 3OKEB 4Y0GA 4JGJA 4MSWA 5GJSL 2P5EB 5DD3L 5DS8A 1CTNA 5AYUL 1IRAY 4OD3H 5A3ID 4PLKD 4OLUH 3AS2A 5FYJH 1XAUA 4X7SL 4ODTL 1IC7L 3JWDH 1T2JA 4WO4D 4NC0B 4FTVB 3S96A 3C87A 2Q8BL 5FUOH 2VE6A 4JLRA 2UZIL 3PDOB 4PB0L 2A6KA 4WHYH 3S34H 3C2SA 4D9QE 3HE6A 4L3CB 5HVGB 1UH3A 2MQ0A 3BP6B 1C5BH 1NFIA 2YSSA 3CX5J 5TQ0H 1I3UA 5B8CB 1OTSD 1V7ML 2X4SA 5HYJB 4DK3A 4WEUD 3WDHA 4PBWD 1G7QB 1HILA 2YMXH 1FNEA 1ZTXL 4HWZB 5KG9A 3UZQA 4OT1H 2CH8A 5J1AA 1U42A 1NAKL 2O61B 4OD3L 5D72H 2RJMA 5GRXG 1FIEA 4OLUL 3IJSA 5FYJL 4Z7VA 4M48H 3MXWH 2VH5H 1LP9A 4FZ8H 1T5WB 3STLA 1NEZA 1DBAH 1RJZA 5ACZB 3T0EA 3KNBB 4XVUC 3S34L 4L9LC 1K5NA 2OL3B 1AO7A 4ZFOA 1WZLA 3R1GH 4F33B 3QO0B 1VGEH 3FB5A 4WUUD 4KFZC 1C5BL 4ZSOE 5JPMA 3ET9F 1YPZF 2E6QA 3OX8A 4HDIB 5TQ0L 1BJ8A 3OKYA 1S7XB 2X4PB 1D6VH 2F58H 2LV4A 2P5EE 2VERN 4HZLA 3RGVC 2JCCB 4JPWH 2YMXL 1G9NL 3KAAA 1D3CA 3B3IB 3IAQA 1FYTD 4C59B 4TNVF 5D72L 2EDWA 1QD0A 4PJIB 3LQMA 4V1DD 2GTWA 3O8XB 3MXWL 1G84A 1G9EA 2GJZB 1D5ZA 1V5JA 4FZ8L 1MFAH 2ZUXA 1DBAL 3EOAA 4NKDB 12E8L 4HBCL 4PRHA 4F37F 4WI2A 5HDLA 4Z5RA 2L0DA 5ISZA 2IJ0C 1VERA 3R1GL 5DD6A 4GRLB 4I2XA 1VGEL 5A2FA 1UFUA 1FNGB 4QRSB 5JPNA 4LSPL 5FKPB 5K9JH 2M26A 5DR5H 3VXUD 4MMXC 1A7NH 1D6VL 2F58L 5DJZB 5FV1L 4ZUTB 3O9WC 1FORL 4YHNA 4ELKB 5DO2D 4QXTB 4P2OA 4Z7QF 2ADFH 2CDFB 1AGBB 3PP3H 1IKNA 4YXKH 4U0RC 2E9JA 2AJUH 4MA3A 3OAUL 3BSZH 3O4LA 4I5BA 2DQCH 3OAYK 3KXFA 4G7VH 1L4IA 3FHQA 3BKCL 3RWEB 3ZDXF 4A6YB 4M93C 4GW1B 4L8BA 5HY9A 1RVFH 5HPMA 2CKBH 2H2SD 5C0AD 2YPKA 1MF2H 3EIFA 1V3LA 1DQQA 2X4OA 5EO1B 3NGBB 1MJ8L 1A7PH 3CGTA 2XKUA 1HXYA 2NW2B 4L29A 4X6CA 1IAOA 1CGSH 1HYSC 2J12B 5DR5L 1A7NL 1EHAA 4OTXH 4DOHE 2VMFA 3O3EA 5EIIB 1KJVA 2ADFL 1FRGH 5F8QC 1INDH 1S7QA 1MJJA 4YXKL 2AJUL 3EJZD 2HFEA 1FFNB 1MEXL 1I7RB 1ZAGA 4AIOA 5F88B 2JIXA 2WIIA 2OXHA 3CX2A 3I6GB 1FL5A 2HN7B 1F8TH 1T89A 1RVFL 1L0XA 4JHZA 3TCLB 3HFMH 4P23A 2CK2A 2FJFA 1MF2L 1Y6KR 4JDVB 3CMGA 1AQDB 4Z77A 1A7PL 1FNAA 4YR6B 4FZEL 1BVLB 4ZXBD 5FDWB 4HZAA 5C2UB 4W6YB 1CGSL 5DRWA 3IFLL 3MBXH 3MJ9L 4OTXL 4M00A 3WJJA 5JW3H 3EYQD 4OGZA 5HVHB 5F7YC 1N2RB 1FRGL 2QTEA 2XRAH 3MV9D 1INDL 4LLUB 4YAQB 1XCTA 3VRLE 2DM4A 5JOPD 4JKWA 1RZJL 3B9EA 3VFWB 4PGCB 1P7HL 3L1OL 2YUVA 5GIRA 3FCTA 3VCLA 1AKJA 1U8LB 2EDXA 3DYPA 5JW5B 4U1NA 1MJ7H 3HFML 1C5DB 4X4ZA 4NJ9L 1YA5A 2XQYG 4XPTH 3KPPA 3PP4H 4Q9QH 3A67H 4HKJB 4HX1B 3V79C 3TIDB 4RAUA 2VLKE 3RDTC 5C0JA 3UJTL 3U82B 3FQWB 3EYOA 3BKYH 4U2ZA 4PG2A 2VDKL 2AABH 4LEXH 2YPLA 3O6LH 1NDGA 2VISB 1WIPA 3QB7C 4YHKH 1KGCE 3SKMB 1AR1C 2V2TA 3IYLW 1YN7B 6CGTA 3PE9A 1EDQA 4OGAC 5ICZA 1S9WB 1MFBH 2CO6B 1YMHA 3TO2B 1IGIH 5DC9B 2NX5B 2CLVA 1UJ3C 5DC4B 4BFEA 3SDXB 3N9GH 4YO0B 3A67L 4WEBH 2HJKA 4PRBA 1T0MA 2W65B 5FEBA 5IQ9A 1TCRA 4Y4FC 3L3OB 3QIUB 3IU3A 3BKYL 3QCUL 3VG9B 5ID0B 4XXDB 1YEIH 4JFXA 4L8DB 4LEXL 4WO4A 1MHCB 3V6BR 2XQBL 3C08H 2YUXA 2R69H 3HCVB 4YUEH 3O6LL 5EZIH 4BQCA 4BZ1H 3U2SA 4UNTA 4G5ZH 2F54A 4YHKL 4N8PA 2CR3A 2NY3C 4PR5B 4UQ2B 2J5LC 3U46A 3V5KA 1UWXH 2VO5A 3JTTB 1H0DA 4HPYH 3QUXC 2UZXB 5MENA 1OP5H 3UXFA 1JWMA 1IM3A 3KPQB 1NEUA 3JV0A 2VLRA 3MRBA 3ARRA 5EWIH 2EDYA 5C0DB 3C6LB 2V9RA 2BHUA 4X7FC 3ZKMC 1QSEE 1MELA 5K9QI 1YEIL 3ARZA 2V7HB 2BSSA 4L4VD 5DUMH 3TBYA 5I1KL 5L8JB 5D2LA 5LGJB 5EOTB 4YUEL 3JZ7A 3VD3A 5EZIL 3DARA 2VABB 4HUUB 3SGEH 4LF3A 3UAJC 4J3XA 1PY9A 4QWWC 3RPIA 4HK3N 4U6HA 3PV6A 1ZGLP 3IAPA 4HC1H 2CD0A 3AS1A 3QFDB 4OI8A 2ICWA 3VH8G 2NX5E 4NDMA 5B38A 1P7QB 1X7QA 1FGVL 5J13B 4HPYL 4OFYD 3DBXB 5ERWA 4X98B 1MHPH 4HT1L 4OZ4B 3P9WB 4GUPA 1FYTA 4M6MH 5JA8B 4HH9B 1I3RB 5EWIL 4FQHA 5FOBB 1S9YB 3BZ4A 3FB7A 3G5ZB 2VLKD 3WFCL 3ETBF 4NKQB 1KIRA 5DUML 2BSTA 2DQEL 3OJVC 3QCVH 2DQJH 2NTFA 5J89A 5F7DB 3L95A 2XPGB 1AP2A 4WW2A 5MEPB 1FDLH 35C8H 5DJ8A 4U1KA 1UWGL 1FVCB 2L4OA 5J1TC 3BZEA 2J8UF 1P4LB 2A74A 4HC1L 5GSRA 4GKNB 3SDAA 3TEUA 2OTWB 4N0UE 4PJGB 5I1LA 4BZ2H 3VXUA 3T77B 3UC0H 3WN5A 4JY4B 3MCKB 3EDFA 5GRZA 2C4FU 4D0CA 5EPMB 1HI6A 3PV7A 3WUWB 1J1PH 3I75B 3UTSB 4LLYA 2RBLA 3VXRA 3O3BA 5IMLB 1G0DA 1NCAL 3BIKA 3LRGA 4OUUA 3LV3B 1HNGA 5BVPH 3PL6B 4QOKB 4NFBA 1K8IA 4EI6A 3V5HB 4FQXA 3QCVL 5LKNA 2NY1B 3O3AB 2NLJB 4AY0A 1G7LA 3AREB 1FDLL 1I1AD 3QT2A 2DS4A 1SEBB 1NANH 3SOBL 5DJ6A 3QHZH 2MCG1 1ZLWH 1GGTA 4GG6B 5I18H 1FFRA 1NCTA 3N06B 3UC0L 4PY8I 3DGCR 3CH8A 5ITFA 3MODH 1J1PL 3JWOH 5D7JB 4JDZB 4ISVA 5E2UL 5C7XH 3I50H 3ALPA 1BIIB 2G9HB 3IDMA 2GQHA 3AM8C 4NQXB 4G6FB 4S11A 1E28B 5EOQL 2BP3A 2JJSA 3RZCA 1QSED 3MRGA 1A2YB 4MXQD 1WBXA 3NFNA 4DGIH 4ENED 3ZE2E 4BSVB 3SKOA 5GS0L 3LPWA 3HB3C 4HCRA 1MIML 2CRZA 2BY3A 2AV1B 4X4ME 4X0KA 3TNNA 4ZXBA 4AIZA 5I18L 5T1MB 2VYRE 1RZKL 4N9GA 3UTSE 3OKEA 2NX5D 4ZSOA 2EICA 2NYYD 1CVRA 5IMMB 1FPTL 2P5EA 3L5XH 5FB8A 2R1YB 5EG6C 3H9HB 3QIUD 3L7FB 4GAJH 3D5OF 4KKNA 1CLZH 3LZFH 3IRPX 3CSGA 3I6KA 3A6BH 2QADD 3KLHD 4HF5L 3PDOA 3RDTD 4Z7QE 4HWEL 4ZFGH 4MAYB 4CMMB 1S3KH 5JNYA 4FFVD 4NRXB 5FGCB 5J11B 1EA9C 2CDGB 3BD3A 2ZUQC 1OSPH 3LMJH 1FC2D 3V7AE 2FHFA 5LBSL 3ZDXE 5IGXH 1EEQA 4LMQI 1U8IB 2UV3A 1G7QA 1NUNB 1ZA3B 4HWZA 2H3NB 3BH9A 4BFIB 4GAYB 5L2JA 3L5XL 5CGYC 2O61A 3AFLA 4F57L 3TC9A 1MWAL 1KCUL 4LKCB 5C0BE 2EIDA 3SBWC 2CPCA 3P0VL 3C8DA 4UQ3B 2FO1A 2E6PA 1H15B 1KFAH 3FOMB 4DKDC 2W0LA 1GOHA 3A6BL 5B39G 1T5WA 3P40A 5BV7C 5ACZA 3ULVE 3VFVB 4WTZG 2Q87A 1C7TA 3JWNC 4K7PH 2OL3A 1WFNA 2XA3A 1PD6A 4ZFGL 3BO8A 3MLZL 4F33A 3QO0A 3RNQA 5EBWB 1C7SA 4M6AA 1P7QD 3TVMC 4NC2B 3WNLA 1S7XA 2X4PA 3U7AA 3LEVH 5L0QC 5HGAA 5DXWA 4IRJC 1QSFE 2YN3A 3B3IA 3C2AH 4HXBL 3RUGB 1BGXH 2FR4A 1A9BB 4LLMB 4XNQA 4WV1B 3O8XA 4OV5A 3VI3F 2ZSWB 3FN9A 1XIWD 1SYVB 2GJZA 1OGAE 3DVNA 4PY7B 4X6BB 1T20B 5IUSA 4LPXA 1OP3H 2A6DB 5HYEA 4K7PL 2ZUSA 3RVXC 1YEJH 2CJUH 4LSUH 1IAIM 4CN4A 2D31B 3RWDB 3ZT6A 1FNGA 4QRSA 5FKPA 2ERJC 4OLZH 4NO5B 5DJZA 4M62H 4H25A 4ZUTA 1IT9H 5J7CC 2CUIA 3RVTD 3S97C 4ELKA 3UAJD 4Z78A 1CDJA 2OTPA 2CDFA 3T2OA 2F53E 1JRHH 2IFFH 1BGXL 1YNKH 4F7PB 4U2YA 5C09B 4OD2B 1PFCA 1EO8H 4WWKD 1VDGA 4A6YA 2IG2H 2NY1D 1NSNH 1F11B 2CQVA 4MA8H 4F7CA 1K9TA 4G9DB 1YEJL 2CJUL 4LSUL 4OFYA 5EO1A 2QSTA 3W39A 3HAEH 2KQNA 2NW2A 4CMHB 3I3DA 4OLZL 3ZZ1A 1GIGL 4FMFA 2C3HA 5EIIA 2VLKA 4U1JA 5IVZA 4R8WH 3FZUD 2IFFL 1YNKL 4JDTH 3WBDA 4DWHA 1YC7A 4IIQB 1FFNA 1I7RA 1MFCH 5F88A 1QPPA 3GSWA 1UXSA 1UQSB 3K4DA 1DVFB 3I6GA 3U36B 1IAII 2V2XB 1PYWB 5C0BD 3QPQD 1IM9B 3CPLB 1V7NL 3GKWH 4MA1C 2IG2L 1BWMA 1CDCA 1G7PB 3FQRB 3RKPA 3KJ6L 4JDVA 2GAZB 1AQDA 3FT4B 4M3JA 4CAGA 3D85B 5H37H 3ULVD 4L3ED 5AZ2H 4YR6A 1BVLA 2LE9A 4DAGH 3DX8B 3RWIB 4QO1A 3AVEA 3MFGB 5KS9B 5AD0A 4HJ0C 2WWMC 4XP4H 5DJDB 3ARDD 1PGRB 4R8WL 5C09E 3KHQA 4LLUA 4YAQA 5FO7B 1WITA 4JDTL 1NGPH 4RFOH 5TDPB 4AEFA 4J6RH 3W9DB 1QSFD 2APXA 2B5IB 1MFCL 3T0BA 3VFWA 3A0OA 3DHMA 1DBBH 4JREB 1A1OB 4O5LL 3HI5L 4UDTB 2OJEB 1S7WB 1U8LA 5TF1H 5JW5A 4I4WB 3EW3B 4KK5C 4Q58C 4CW1B 1OGAD 1RUKH 1RJLA 5F7WC 4XT1C 1K3IA 5AZ2L 1RZFH 1PQZB 2ED9A 1F3JA 2DQHH 1KUMA 2LVCA 2NY2D 4HKJA 4HX1A 4JCMA 4YK4B 4LVHB 2GJ6B 5FUCC 4Z8FL 1BJ1J 3LQZB 4XGZB 4JFZL 5CJBA 5L6YL 1A7RL 3QUZC 4RFOL 1OOAA 1NGPL 2O5ZL 4DW2H 4J6RL 4Q6IA 5D1QC 2VZUA 3X11A 2VISA 2F53D 2F15A 2AI0H 4WI8A 3MLRL 4XHJC 1ACYH 4EQ3A 3S35X 3VXME 3WJLA 5FYLH 5TF1L 5IJKC 1S9WA 3IDXH 4JKPL 5EZOH 4XP9L 3SO3C 4RRPA 2EO9A 1PW3A 4Z9KB 4LAQL 2NX5A 3VMNA 5J0BA 1WF5A 1RZFL 1XZ0A 3G6DH 3BMVA 1ZLVK 1RZ8B 2DQHL 3U6RB 2DM3A 2W65A 5IB3A 4OQTA 3L3OA 3QIUA 5DMIL 1U2HA 2AV7A 5BZWA 3VJ6B 4BQ8A 3CSBA 2C1PB 4L8DA 1MHCA 1O7SA 3GSVA 1ZOXA 3HCVA 3MNZB 3GJFH 3NPSB 4JPVH 3MA9H 4UOW0 2AI0L 3IDIA 1Q0XL 3KYOB 3QHFL 2E7LA 1ACYL 1DCLA 5H2BB 4XCNB 4PR5A 4KRMB 4UQ2A 5FYLL 2QHRH 3MUHL 3ROLB 3IDXL 1Z3GL 5E6IC 1EMTH 5TQ2H 5ALBL 5MERB 5KZCD 3JTTA 3I9GH 1DTUA 3G6DL 3T2QA 4RAVB 5FO9A 2GJ6E 3OB8A 3KPQA 1WZ1L 3LVEA 3ZTNH 4M6NH 1IE5A 4MCZA 3QUYB 1MCFA 1U3JA 5CLTA 4WUKL 4PJXB 2J88H 1EIBA 2KH2B 1Q72L 2V7HA 5LGJA 4PS4H 1LK3H 4JO2L 1F45A 2WAHA 4GXUN 4J8RB 3HUJB 4JPVL 1JI2A 3MA9L 3RRQA 2N1KA 5F44A 3T04D 4EIZC 1JUFB 2QHRL 3QFDA 1MCPH 5F21B 1UCTA 4IRJD 2R56H 4E5XA 1EMTL 5TQ2L 1P7QA 3V0WH 5DC0A 1FYHB 3I9GL 1RAMA 4LKXB 2BJML 5DURB 4X98A 1QLEL 4OZ4A 4KHTH 3NIFE 2DKMA 4JRXE 4RFEB 1UM6H 4FQQB 3ZTNL 1OLZA 1I3RA 2BDNH 5D1XB 5FOBA 4F2MB 1S9YA 1KJ2B 7FABH 2DQDL 2X4TB 3V6ZB 1KNOA 3TO4B 4IOSD 3RVXD 1XIWA 3FQTB 1LK3L 4QT5A 3FJTA 1EGJH 2RFXA 5F7DA 2XPGA 3HZYA 1UB5B 5MEPA 5T3XH 2WBJC 1FVCA 4KK6D 1WFUA 1LVEA 1VPOH 1P4LA 1DQDH 2AXJA 1MCPL 4GKNA 5FYKL 2OTWA 4PJGA 3DMMC 4KMLB 3V0WL 4X4MA 3WS6A 3VXMD 5A2IH 1ONQB 3DGGB 4KJYB 3T77A 5C6TH 4JY4A 3D85D 3MRJB 3L5WA 5D5MB 3WUWA 5SWZB 4JB9L 2DTSA 1RJYB 1ADQA 3UTSA 3I75A 2Y36H 4KHTL 2HH0H 3L5IA 2BVTA 2I07B 5IMLA 1UM6L 1BLNB 4MS8D 4P5TC 4PJXE 3LV3A 7FABL 3PL6A 4PJCB 2JELH 1QACA 5MEQB 3V5HA 3E1F1 2E7BA 2W9DH 3HUJE 4V2BA 1EGJL 5D2NC 2CK0H 5INDB 3O3AA 1JNNH 2NLJA 2XA8H 5I19L 1MRFH 4ZS7H 5T3XL 3LRSA 3GSXA 4DJMA 4FQLH 4N8CL 4TN9A 3IFOB 3VWKC 4BFGA 1T21B 2FGZA 2NY5H 5MI0B 4RISH 4FNLH 3VI4F 5C6TL 1TPXC 4M9OA 1I85C 2P5WB 3LEYH 4XVJH 3BUYA 2YXMA 5IQ7H 3F65A 2Y36L 1JGUH 4JDZA 2HH0L 1D7FA 2GJ6D 3NZHL 1BIIA 2YD3A 4JEGB 4NO0B 1RV6X 1T2QH 3OAZH 4NQXA 5D7IB 5DRZB 3ZLQC 3UPRB 5T1KD 2CK0L 4K94C 1JNNL 3U30C 3WD5H 1A2YA 3L9RB 3U7WH 2YZ1A 2E6JA 4FQLL 3MV01 2AV1A 5KANG 5BS0E 4MXVE 3B83A 4F80A 3LIZH 1GH7A 3ULSB 1CGUA 1T7ZA 1JZ3A 2X10A 3LEYL 4XVJL 5D7LB 4NFCA 1FZJB 3VI3E 3RP1A 1CDHA 3GMMB 5IMMA 1JGUL 1ZT1B 1LO0L 5KJRH 3JVGC 1QSFA 3H9HA 3L7FA 4H1LB 4KK5D 4JRXD 5DT1H 1T2QL 1DBJH 1OB1B 4K7PY 3SE3C 1E27B 2IAMC 4YIQB 4OZIF 5E8PB 4PP1C 3HNTH 4FFYL 1P5VA 3U7WL 1OGAA 4XNYH 1Y6NR 4XB7A 4XWGH 4CMMA 2J1KA 1ZHBA 2P5WE 1JGEB 4NRXA 2R0LH 3DV6B 3PQYB 1H3WM 3RTQC 3MLWH 5C71A 1U8IA 1H8SA 1B3JA 5DEZA 3IGAB 1IVLA 2ZOLA 1ZA3A 4K8RH 4J3SA 4XHJD 4GAYA 4K7FA 4LOUD 2ZPKH 4YDVB 2B2XL 4LKCA 4PJDB 2HMIC 1HEZB 2F53A 5C1MB 1MQ8A 1OARL 2OM5A 1DBJL 4OGYH 1Z9MA 4UQ3A 2MPAH 1H15A 1L6ZA 1WFTA 2AERT 1P53A 3SGEI 1GAFH 4UBDC 1Y0LB 4IOFD 3HNTL 3SGJA 3VFVA 1YDPB 4UTAH 2M8XA 5F7MC 2IGFH 4XNYL 2X7LB 3MREA 4LMQE 5T5NG 5LCVH 4KROD 4XWGL 2XZCL 4G8IA 3V2AR 3LN5B 5EBWA 4RA0C 1I8KB 3KPMB 3L5HA 3MLWL 4LVNB 5GGVH 1II4E 3MRFA 4KK8C 4MJ5B 1I1YB 3ARBC 4Z0BH 3DRQB 1G6VK 5FFLA 2XTJC 3S4SG 2ZPKL 5GHWL 3RUGA 4R2GB 1A9BA 1G9MC 4WV1A 1A6TB 4I0PD 1F4XL 1TETH 4OGYL 5IV2A 2ZSWA 4E0RB 1OM3H 4LLQB 3QIBB 1GAFL 4PY7A 1T20A 2PW1B 1DBML 1PY4A 4C83B 4UTAL 2A6DA 1CR9H 1SVZA 2IGFL 5HI4D 4KI5E 3C6SB 3PQYE 4OB5H 1CL7H 4RGMC 2BRQA 3RWDA 1MSPA 4KTEL 3IXAB 4POZD 5BS0D 4DN4H 4Y5YB 1T1WA 2YN5A 3B9KC 4NO5A 1EJOH 5GGVL 4EDXB 1AJ7H 1T0PB 2DYPB 4IS6B 4JHBA 5CJXA 3ZHLA 4Z0BL 3MBEB 3V4VH 1NCUA 2SEBB 1S7UB 4DCQB 4F7PA 5DHXB 4X8XA 5GRJL 3T3PF 5C09A 1EBAA 1G9NC 4OD2A 1TETL 5E2WH 3ZE1F 1OM3L 4EN3D 2BXYA 4C54A 3ARGB 1VENA 1KCVL 4IHOB 4X6DB 5ILTH 3LKOB 3G5XB 4M7ZB 1N6UA 1QA9B 3VFTB 2EE6A 3EDEA 4OF7A 2DQIH 1INQA 3FT2B 3LEXB 3KG5A 5F1SA 2QQLH 2WW8A 3QXAB 3U7YH 2JJTA 4NUGH 4DN4L 3DVFA 1EJOL 1YY9D 4NBYB 1R5WB 1AJ7L 2P4AB 1IILE 1JCKA 2X41A 1KACB 1X44A 5A16B 1U58B 5DRXA 1LQSR 2AW2A 4ZUUB 2CO7B 4W68A 5EOCL 1XF2B 5HHOB 4IIQA 3QUML 5C6WH 4G42A 4OZFH 3ZO0A 5B4MC 3RKDC 5E2WL 1UQSA 2ESVE 1DVFA 3U36A 4S10A 2V2XA 1MCOH 1IBGH 2Z31D 1T7VA 5DVKA 1G7PA 1MJUH 3VXMA 4NSKB 3UTPE 4NOFA 2GAZA 4HSQA 2Y4SA 3DIFB 3D85A 1DBKH 3HAEG 4Y5VC 1MPAH 1OCWH 1A6VL 2QQLL 1FIGH 3DX8A 4NUGL 3GO1H 5CLWA 1KTRL 2EDDA 2KKQA 2IH3B 5KS9A 3MLYH 2UUDK 3GIVB 1NGYA 2HT4C 2BY0A 5DJDA 1T2XA 4OLXL 3FN0H 1IJ9A 1PKQB 2MOVA 1JGVH 3L3KB 4JZNA 3VFPB 4EVNB 2IPTH 1TXKA 5TDPA 4PPTA 3W9DA 5B3JF 4ZOAA 2QKIB 4HMEA 5C08E 1A1OA 1MCOL 1IBGL 4HPOH 2OJEA 4UDTA 1Z5LA 1S7WA 1U95B 4WFFE 1KSRA 5C0NC 3WKMH 4I4WA 1IGMH 1MJUL 1NMCC 3ES6B 2HT2D 4UNVA 5H37G 3MRKB 5DFVC 3VWJB 1MPAL 2VR5A 1OCWL 2WMPA 4L9LB 5K33A 1FIGL 4KI5D 4XPGH 3ZKXC 4P46D 2GJ6A 1AGCB 1I75A 3LQZA 4XGZA 4NM8H 1I3GL 3FN0L 3G6JF 3I84A 4PFEA 3RGVB 1JGVL 4UB0H 2IPTL 3QCTH 1J8KA 2H41A 2YD1A 3IU4L 1S9XB 4HPOL 1MRCH 4DKFH 1JK8B 1RZJC 4GS7B 1TENA 3MLXH 4KK9D 3CFIC 4XBGB 4ZFOL 4LCCC 4PRIE 3MRCB 5FECA 1QFOA 1RZ8A 1WEJH 4P57B 3U6RA 4XPGL 4ONOA 5DFTA 5C0CE 1KOAA 4YDIL 3MRLA 4NM8L 5IP4A 3U0PA 4JRXA 3VJ6A 3HR5A 5I8CB 1QBBA 1WC7B 3O9WB 4KVNH 2C1PA 1FNLA 4L8SC 4UB0L 3ARFC 2CKBB 2EXYC 2X40A 5JA9A 4NQDE 4QXUL 4U0RB 3SCMD 1KIPB 2YWYA 4OF5A 3C60B 4QNPF 1BX2B 4J4PC 1E6JH 1MRCL 5H2BA 4DKFL 2CIIA 1HHGB 5T5FH 4HLJA 3QNYB 2VDLH 2ESVD 1N8ZB 4Z95H 3FT3B 3ROLA 5C2BH 5CEZE 4KVCH 3HC4H 3MLXL 5MERA 1R3HA 1CBVH 3BJLA 4O58H 5CWSA 1UKQA 3F7VB 3EO9H 4RAVA 3UTPD 1UACH 1WEJL 2F8XC 1RURH 3TLRA 3MOAH 2ZNWA 1MCEA 3RNKB 4QKXB 4JQIH 1YEFH 2XZQH 4WGWB 4PGDB 2HVKB 5AAMA 1G1YA 3QUYA 3QFJE 4P4RB 4HUVB 4HUMB 4KVNL 4PJXA 3EFDH 3VI4E 1KLUB 3C5JB 3BUTA 2XWBB 4J8RA 5EC1B 4U1IA 1ZVYA 3HUJA 5HGDA 4CUCA 2IPKA 4P4KC 5T5FL 5DHVH 1JUFA 4WU7B 2IQ9L 3L5JA 2VQ1A 4ODXB 2VDLL 4F8TA 4CVUA 5C08D 3TZVD 4BH8B 4KVCL 3HC4L 1CBVL 4WFFD 3WLWC 1Q0YL 2PCPB 4O58L 4PIRF 5TE7H 1ZEAH 1I1FB 1T7YA 1UACL 4IJ3B 4H0IA 1RURL 3MOAL 2OS7A 4RFEA 1ZS8A 4FQQA 2VTFA 2AJYH 5D1XA 1A9EA 5DK0B 5JHDE 4F2MA 1KJ2A 2XZQL 1PJ9A 2JE8A 4FG6D 3MOBH 3W5MA 2X4TA 3CSYB 2QQNH 3J8F7 3EFDL 3FQTA 4WY7L 4BJLA 2NXZC 3RAJL 4L5FL 4FMKA 3UTQB 1FSKC 5TDNB 5AEAA 3MRHA 4WFEE 5F7LB 5BS0A 3BRGC 1OLLA 4KKCC 3DGGA 4GW4B 4KJYA 3LS5H 3MRQA 3D39B 5TE7L 1ZLUH 1ZEAL 3Q5YA 1PEWA 5GGRA 5SWZA 1RJYA 2P7TB 1LO3H 3T0WA 2DJSA 3W2DL 1YQVH 2I07A 2YUWA 5TE4H 4PRID 1J0IA 2AJYL 1MCBA 5C0CD 2EH7H 4YEEA 1EZVY 5DLMH 4EN3A 4ZD3H 4OCLC 3K46A 5JXAH 4KKAC 4P5KB 1PZUB 1KCSL 4NQDD 4D9LH 3C5ZC 5EUKB 1QFWM 5L9DL 1M7IB 1AC0A 3LPFA 2AGJH 4G6KH 2WP3T 3LS5L 5EBLB 1VCAA 2ZCKH 2P5WA 3D87B 5DQJB 5CEZD 1T1ZA 3VRJA 3SJVE 2CIKB 1HH6B 3DNKA 3DO7B 2WBKA 3EFFB 1YQVL 1ZLSH 3NPZB 4TVPH 3TA3C 4J2XA 4LSRL 4Y4FB 4XNMB 4NO0A 5DLML 1H9VA 4BH7A 5KAQG 2PXYD 1MVFA 3CU7A 5D7IA 4YNYB 5DRZA 2W60B 3CC5A 4ZD3L 4MQXD 3VH8A 3QFJD 1V3KA 2YA2A 1QUNA 1AD9A 3N1MC 4D9LL 4DVBB 4QHLA 3BHBA 1NBVL 1P4BH 2AGJL 2F19L 3D39E 2NY3B 3ULSA 1A64A 5DK2B 3CK0L 1NMBH 2J5LB 2DQUL 4IMKC 1NPUA 5JDSB 1FZJA 3QI9D 5M7QA 1MCIA 3O2WH 1U8QA 3RU8H 3QUXB 4KMTH 3GMMA 2P47B 2GK0B 1ZLSL 5KSUA 3OHXA 2BY1A 1SQ2N 4D9RE 3X13B 5GZNC 4F9PC 1D5BB 4HWUA 4S1RL 5JHDD 1QFWI 1OB1A 4OZHF 3S5LG 4HFUL 1E27A 4YIQA 5E8PA 5JZ7D 3Q1SH 3C60D 7CGTA 3GSUB 4GBXD 2Y6SC 3BWAB 5GGVY 3QNXB 3ZSSA 2R15A 4PP2B 4Y16B 3T3PE 1JGEA 3RWGA 5D71H 2FEDC 3DV6A 3PQYA 2BMKB 1NMBL 4Q0XH 5GS0C 3D2UB 3ZE1E 3UJIH 3MCG1 4WFED 5KOMC 3RU8L 3IGAA 3PHOB 1RZKC 4KMTL 5EU5B 4H20H 2BRRH 1CDGA 1CWVA 4YDVA 1HEZA 4LQ1A 1N59A 1Y0LA 4POYA 1YDPA 1BBJA 2APWA 3Q1SL 3FQNB 3CNKA 3QQNA 3SGDH 3G5VA 4NBZB 1CICC 3AUVA 3VXNA 5D8JH 4G43A 4EI5B 4G9FB 3LN5A 2Y5EA 4HIIA 4PTUB 5D71L 4Q0XL 1HN1A 1FO0H 2VZ1A 1MCKA 3UJIL 4CN6A 5GGSA 4XXCC 4YHMH 3VXSE 3HLAB 3KPRE 1OGTA 1NAMB 4AENB 4ORGB 2BRRL 2X4QB 3DRQA 3SJVD 1E4XH 2VL4A 2VDOH 3SCMA 3SQOH 1A6TA 4NJAH 4M8QA 2G5BB 2AKRB 3DETD 4NWTH 4E0RA 3EJYC 4LLQA 3KJ4C 3QIBA 2ESVA 4TNVK 5FGBA 4C83A 1J18A 1QO3B 4W4OC 3GSQB 2PTTB 3I2CH 4X6FB 1I8IA 1VESA 2F74B 3GHEH 4X7TB 1CXKA 1GOGA 5D8JL 5DMGD 4TSAH 1IGJB 4E41B 3IXAA 3O2DA 4Y5YA 4F37K 1KCKA 4PJBF 1NUFA 4YHML 3D39D 1P2CB 1VFBB 4EDXA 2DYPA 1HDMB 4IS6A 4PJHB 4R6UA 4DUXA 2OSLB 3MBEA 2Y07H 2SEBA 1S7UA 1CFBA 4TYUA 4DCQA 2JK5B 2VDOL 4TVSa 3RGHA 1F5WA 3SQOL 2XI9A 3P3YA 2CLRB 1FL6B 3JV6B 4D9RD 4DZ8B 1XGQB 2XN9B 3ARGA 4IHOA 5C08A 1H3XA 3LKOA 2W59A 3G5XA 4JJ5B 3VFTA 1QA9A 3W11C 3I2CL 3G6JE 3FT2A 1A7QL 2NNAB 5EC2B 4HCRH 5JIPA 4TQEL 3KHOA 1J86A 1U8JB 4TSAL 1U3YA 4NNPH 4Y19E 5DUPL 2EC9T 1BZ9B 3IKCB 3DECA 1LEIB 1R5WA 3JV5A 2EYSB 3FHAA 5A16A 1U58A 2EEDA 4JE4B 2PYEB 3TBVB 4PYGA 4NC1E 4HMCA 5E9DB 5IBUG 4GOSA 1T4KB 2ZG2A 4JFFD 1S7TB 3ESUF 1EH9A 3Q5TA 4WTZA 2YWZA 1IZJA 3P4MB 4HD9A 4ALAH 1RMFH 4NQSB 1A22B 3KLAB 5C70A 3DSNA 4JO1L 4AEHH 4NSKA 4P99A 1UH4A 1CFNA 3DIFA 4UILL 4YHOH 4ZAKC 4C4KO 2X09A 4HCRL 4OV6F 3GMRB 4XX1G 1A3RL 3R0NA 4NNPL 4PJHE 4QNPE 1P6FA 3RX7A 1LWRA 2IH3A 2V9TA 3GIVA 4W6XB 1FG2B 2ZUQB 2ZSVA 4XCCL 3ILQC 2FECI 1K4CB 1PKQA 4U33A 3D18B 1M7DA 2MJWA 2C5DC 3VXSD 3KPRD 3L3KA 4NN5C 3VFPA 2PNDA 5FV2A 4JVUA 1PG7W 4OZFG 2I9TB 5D70L 1CZ8H 1IKFH 4MNGB 4NQDA 4PJ8C 1U95A 2ZUYA 3MYZA 1CFSB 2IPUG 4W81A 2W0KA 5CUSH 1VFAB 4AEHL 5BW7C 5AZEH 3ES6A 2EZ0C 1IQWH 3QWQB 4CVXB 5BV7B 3VWJA 4L9LA 4Y16D 3MV8E 1BMGA 4XPHL 4P49A 3TVMB 3QIWD 3GB7B 4HH8A 4LSVH 1CI5A 3OF6D 5L0QB 2X6MA 3QFJA 4Q9RH 4I0KA 1S9XA 3WLBB 3CLFH 1I7TA 3K4AA 5KAQF 5I0DA 3MRDB 5AG9A 5SWSB 5CUSL 2VC2L 4K2UH 5AZEL 3KYKH 2A6JA 3QP3A 5HGBB 2EDBA 1TFHA 3SQBA 15C8H 4XBGA 1DDHB 2ICWJ 2OL3L 3TH2T 1DJSA 3MRCA 4HG4K 4P57A 4LP5A 4M5YH 4AL8H 4F3FB 1L7IH 5IVNA 3T65B 2ERJB 2EDOA 1GHFH 2LABA 4LEOB 4MJ6A 4Y19D 5I8CA 2ORBH 2F5AL 3M1BB 1WC7A 3O9WA 3Q6GH 4LSVL 4Z7UB 1CD0A 4H8WL 2CKBA 4WTWA 2FGWL 3EHBD 4Q9RL 2R2EB 2FEDD 1KIPA 3K8MA 1UYWH 3LHPH 4JVPA 3C60A 4HIJB 1Z9OA 1BX2A 5JQ6H 4O2FB 4GBXA 3HPJB 4A6YH 1HHGA 4G8GB 4Y7MA 3RWJA 2V9QA 2Y25A 3K2UH 3HNVL 3QNYA 1N8ZA 3FT3A 1KEMH 3N85H 1EV2E 2I26N 4K2UL 1T5XB 4O2CB 2DLTA 3BW9A 1CL7I 15C8L 4RX4D 4NHCL 4WIQA 5I71C 4M5YL 3VMPA 5TDOB 1L7IL 1U6AH 3INUH 3V0VA 1GHFL 2GFBA 2K3TA 3C5SB 5EBMB 2ORBL 1P84J 4PJ7B 2B0SH 2E9WA 1ZT7A 4P5MB 5F89B 4ONFH 1XGUA 3C5JA 5EC1A 1F02I 3QG7H 1CT8A 2N7BA 3LHPL 2V7NB 5FM5O 3BD5A 4EEEA 4FABL 4A6YL 1NLDL 3IDGB 3MACH 4MJ4A 4N0CC 4WU7A 4EUPB 3K2UL 3TIEB 1BFTA 1GGBH 2WINB 1KEML 3UZEA 4BH8A 1F42A 3B2VH 3Q0HA 5I1HL 3MV11 2OP4H 3ZE0E 1QSZA 2PCPA 4XMLH 2A77H 3P9LB 4Q9BA 3MJ7B 3EJYD 3LSOB 3SJVA 1U6AL 4LFHG 3INUL 2E7HA 1F90L 1J0JA 3MV8D 5DK0A 4YBLC 4Z7UE 5CSZA 1JZ4A 3MGOB 1T7WA 3D3VB 4ONFL 4ZUSB 3A6CL 5DFWH 3CDFA 3QG7L 3MRPB 4LPCA 2X1WL 5KVFH 1QP1A 5TDNA 2YC1B 5BXFB 1T3FB 3EJJX 1F4AA 2XT1B 2V5YA 2OI9C 1GGBL 5INCB 4F58L 1A4JB 2NY0D 3B2VL 5J3HC 5IFJA 2GJJA 3D39A 1IEBB 1LO4H 1TNNA 2EDTA 2A77L 2G2RB 3CFDA 2P7TA 2VRAA 3VD5A 3CXHK 2Q7NA 4PJ7E 3GSRB 4WW1B 1XEDA 2ATPA 5ADOL 2K7QA 3S3SA 3RQ3A 1N5YL 5FO8B 2YD5A 5GPRA 1F4WH 3QISA 3UO1L 3DRTB 2JB6A 2QQKH 3O0RH 2N56A 4P5KA 1UM5H 1JNHB 5KVFL 1A6WH 5D1QB 3VFGL 1YYMH 1X4ZA 3TPKA 4KJPC 1NBQA 5EA0H 1M7IA 3L3HB 1GGCH 4W70A 1PG7X 1C08B 3PABA 5EBLA 1RIVL 3BGFC 4GO6B 2LAAA 3SKJH 3SO3B 4NCC1 1ORSB 3MPCA 3DO7A 1NL0H 3BJ91 3DVGA 3P9MB 2KDGA 1BREA 4K3JH 4G6AD 4OQTH 1A1NB 3D3VE 1GC1C 4AM0B 1ROWA 5F6HI 4KRLB 4GFTB 4XNMA 4I18C 5E6ZA 1NKRA 4MVBD 1OT2A 4YNYA 2W60A 1PX3A 1F4WL 4XNUH 4WI7A 4NO2B 2QQKL 2GI7A 4YBQC 5L7XH 1A6WL 3G6AB 1YYML 4DVBA 4Y4KD 4I77H 5DK2A 4LHJB 1CLOL 3TFKC 3ZSTA 5E6IB 1U3HC 1EXUA 3K8KA 5JDSA 4ELMF 4IBLT 4PJ9C 2R8SH 2DQGH 3LDBB 3VXSA 2AK4B 4LVEA 5E94B 5HSFA 2GK0A 3KPRA 3QDGD 1HHJB 2ADGB 4OQTL 3F7YB 1XF4B 3GSNB 4JY5L 5FYLE 2HFFB 3MFFA 4K3GA 4NN7C 1D5BA 2G75A 2NR6D 5IW6B 4PJBE 1CQKA 5LG1A 3TM6A 5KVEL 4OI9A 5DVLA 3LRHA 1A7BA 5L7XL 5DJAB 1IZKA 3BIAX 4KKLC 5DHYB 3BWAA 5FCUL 1KPRB 2A0LC 3QNXA 3OR6A 1A0QH 4PP2A 4Y16A 1HSBA 1V3JA 4I77L 2RGSA 2MMXA 4HK3J 5CEYB 4GKSB 2BMKA 5F9AC 3WL9B 1BQLH 3C8KB 4HIEB 2FBOJ 3FQUA 1W0YT 3P77B 3PHOA 2R8SL 2DQGL 4JFDD 5EU5A 1EEYB 3SKNB 3OF6A 4U1GC 3DYOA 4LLWB 2XQYK 2BNQB 3B6SB 1D5XB 4PGBB 1C16A 2Q8AH 3TBSA 1VEMA 3CVHB 3VFRB 3RFZC 4XWOC 4Y1AE 1G7HA 4G6JL 3H0TB 1HQRB 1SJEB 4Z7VF 5CINH 3DSFL 4L3AA 2BSED 8FABA 1LP9F 3IDYC 2WBJB 3O6FD 4TPRL 4M1DH 4EI5A 4G9FA 2MCPL 4K71C 3O6MH 4PTUA 4CNIA 5B38G 5MP6H 1B2WH 1BQLL 5I1EH 2XNAB 3DMMB 2MNUA 3QQ4B 3HLAA 4Y19A 1I9EA 4N68A 4HS6B 3RL2B 2IMNA 1NAMA 4AENA 4ORGA 1ADQH 2X4QA 2BVEA 4K9EH 2BHYA 1IC4L 2XFXB 3RVVC 2B4CH 2EKSB 4I1NB 3MRMA 5I1IL 4K3DL 5E2TH 1DUZB 1U41A 2YD4A 2G5BA 4HWNA 4P5TB 2BC4A 3D3VD 3KS0H 4BSJA 1CFVH 1JVKA 3SDDC 4MXWH 3PUCA 1QO3A 5D2NB 3GSQA 3MA7B 2PTTA 1ZVSB 5FXCH 2R23B 4X6FA 5CINL 5C6PB 4X7TA 1TZHB 1UWEL 3LKPB 4RX4A 4M1DL 1FFPB 2QJDA 3VWKB 4E41A 3FFDB 1B2WL 4OKDA 5I1EL 3GEWB 2GYSA 1P2CA 1VFBA 4OJFH 3U9UA 1HDMA 4PJHA 3IFNL 4P2QE 1JIBA 3VXQB 1ADQL 2BVYA 2OSLA 3S5LB 4K9EL 2BNQE 5JORB 3CX5K 4IDJL 4KDWA 1CDYA 2APVA 1FL6A 2LTQB 5T1LB 4DZ8A 1XGQA 1KG0A 3O11B 2XN9A 5FYLD 1FV1B 4JKMA 1CFVL 1WT5A 3H3KA 3UBXI 3T0AA 3WNNA 2P43B 4LU5H 1AHWC 4JJ5A 1N4XH 5E70A 2WK2A 1AC6A 3BZDA 3U30B 2NNAA 3QYCA 5F7FA 3E2HC 3P0GB 1MVUB 1BZ9A 4NP4L 3MV8A 4N5EC 4OJFL 2EYSA 3HZVB 2HRPH 2WLYA 1NGWB 1OAQH 4X6CF 1EEUA 1YYLH 4NYLB 3TBVA 3CJJA 1T4KA 5I66B 5GS2H 4HLZH 1S7TA 3PNWB 1U9KA 4KY1H 5EU6E 1S7SA 4KV5F 5J3HD 2X89D 3MZTA 1JZ8A 3D69B 3P4MA 3LAFA 1OQOA 4NQSA 4X6EB 4LU5L 1N4XL 5KVGL 2IAMB 5IFHH 4AYFA 2HYMA 4M61B 3UDWA 5F1KC 3U4BH 4Y1AD 4XMPH 3ULVL 1S7RB 2JTDA 4PV8A 2I60H 4JM4H 3S4SA 5D93B 4OAWB 1UEMA 3V5DB 1WSST 3B5TA 3HG1B 5GRUH 2NQCA 1JN6B 3ZYZA 2IADA 1FG2A 2DI8A 2HRPL 4JQVA 3MNWA 3RTQB 4UIKH 1K4CA 1YYLL 5SWQB 3D18A 5DD1H 3OKNA 4KKBC 3TYFA 1AGEB 1M4KA 4KY1L 4U1HB 5F9JB 2I9TA 3GRWA 1MUJB 2ZG1A 4R9HA 1RUPL 4GAGH 1OT1A 4LNRB 3B9AA 4XNXH 1X3DA 5IFAH 1CFSA 4Y2DC 2BVQB 3LD8C 4U49A 1U92B 2Y1VA 5IFHL 4G6ML 4OBSA 3WS3B 4CVXA 4XMPL 1CIUA 1E4KA 2DDQL 4JM4L 3GNML 3ARWA 5GRUL 4RBPK 3VGDA 3KYNA 3TVMA 3D25A 5IB5B 4M1CD 2LU7A 3GB7A 5E7FA 3S36X 1EBPA 4J3VA 5DD1L 4PJFF 1MHEB 4P2QD 3ARBB 2J4WH 5HDQH 3X14B 2XTJB 5EZJA 5T3XD 1RFDL 4OCWH 3WLBA 4Z76B 4GAGL 1A3QA 1L0QA 5HHVH 1RI8A 1NCCL 5KW9H 4XNXL 3MRDA 5CMAA 5DQ9A 5SWSA 4RNRB 4H5SB 3SGDI 4OD1L 2VDPL 5HGBA 2W9EL 4KJQD 1DDHA 3HG1E 2VAJA 3VD4A 3WFBH 1FZOB 5BCAA 4F3FA 4QTHB 4RGMB 5I1AB 4OZGF 2Q86B 5C0EA 3T65A 5HYSB 5EO9B 2VLLB 4LEOA 5IROA 3SDCB 3NACH 3VGAC 1IGYB 1ZK9A 3S3JA 1GGIH 4K23L 4Z7UA 1W72B 1D9KD 1RUML 4HUXB 3UTZB 2QLVB 2R2EA 3MJGX 4OCWL 4HBQA 3HE7C 3L3GA 1KLGA 1A7OH 3MGTB 3FB6B 5HHVL 5EU6D 1Y18B 2MWCA 5KBNC 1PZ5B 4X4XA 1KF9B 1YY8A 1T5XA 3QH3B 4O2CA 1RY7B 4AT6B 4OCSL 1XF5A 5EFIB 3V4UH 1CD9B 5EUOB 1JHKH 1MLBB 2I27N 1T80A 3T0EC 43C9B 5TDOA 1NCWH 4A2MA 4AG4L 3C5SA 2VQTA 1GGIL 5EBMA 4PJ7A 4P5MA 4UTBL 5JW4M 5ACLA 5HHPB 1KEGL 4UT7H 1Y6MR 1C12B 3KS0J 4N90E 2V7NA 2WWKO 1A7OL 2X9YA 5IVXF 5C07B 3IDGA 5D2LF 4KPHL 4LHUB 4PRDA 3TIEA 2P45B 4FRWA 4CL7A 2XOTA 3QEQB 3NH7H 3N50A 4EZMA 3RVVD 3D0LB 1KN2H 5C3TA 1JPTH 3P9LA 3WXVL 3BFOA 4LP4A 2DM7A 4Y5VB 4X99A 3RY5A 2VXTH 1ZLVH 1FBIH 1NCWL 4C56B 5HDBF 5DZLA 3EYFB 5I8OH 1FZKA 3BKMH 3MGOA 3D3VA 4R7DA 4ZUSA 2HJFB 2HTKD 4XP5H 3OXSB 1QYGH 1CK0H 2X1QA 4ODUA 4YHIB 3SE8H 4YLQT 4YPJA 4BSWB 5L2KB 5D96C 4XX1E 1RQ5A 1KYOJ 1CXIA 4UT6H 4UU9B 2YC1A 1IKNC 5BXFA 1N7ML 5CZKA 2FNBA 5INCA 4M43H 2X4NB 3ZKND 1ETZB 1YJDH 1IEBA 1NMCB 1MHHA 2G2RA 4IMLA 4K8RD 2QHLA 4OF0A 3U0TB 1BFVH 2X9WA 2VXTL 1FBIL 3HG1D 4UOW1 3GSRA 4WW1A 3QWOA 4RGNC 5FUZL 4ZODA 3ZKXB 4WVRA 5FGSA 2X1OA 1QEWB 4DUWA 3DV4B 2HTLD 4JGMA 5FO8A 4XP5L 4P3CH 5D7KE 1QYGL 3SE8L 4ZMAT 1KC5L 3DRTA 2VZOA 4U1SB 1FCGA 1JNHA 3OKMB 4PJBA 5D1QA 2DOCA 4HKXB 3ZYOA 1QRNB 5CZXD 3PGFH 3L3HA 4J1UA 4DUVA 4M43L 1F2QA 4D8PA 4HS3A 1NQBA 3DROB 3N1QC 3HMXH 2PYFB 2J8HA 1X6LA 1T89C 3CFKB 2NXYD 3PGDB 4C56E 1ORSA 1FFOB 4AK1A 2MHAA 2ENSA 5E1AB 4LCCB 1HZHH 4P23C 4DKEH 3P9MA 4MD0B 5T33H 1SBBA 3GJFA 3T2PA 1A1NA 4FQJL 5EU7E 2UVEA 3KPTA 5J12C 4YX2H 5FA3B 2X89A 1J0HA 4I3RH 4I0CC 4KZDH 1LD9B 3BZFA 1R6VA 1QOKA 3REWB 2OZ4A 2DI7A 4NO2A 4L8SB 4Y4HC 1OSZA 2VWEE 5D9SA 5KSAB 4PREB 1BQHB 5E0QA 2AVGA 4DFIA 3MLVH 3P4NB 3V0AC 4Y1AA 2FJHB 4N90D 2LFGA 4KJWD 4FP8H 1P9MA 3T3MF 3T1FB 2EDJA 1R3JB 3HMXL 2D03H 4RRPG 5KVDH 5E6IA 5L88H 1TLKA 3KWWB 2DLGA 2N4IA 4XRCB 3H42H 1NCBL 1J1XL 1I4FB 2AK4A 5E94A 1HZHL 5BZDB 1GGUA 3W5NA 2ADGA 3RWFB 3LY6A 3F7YA 1XF4A 3GSNA 4KHXL 1RSFA 4YX2L 3VXOB 2FHCA 2HFFA 4G8FB 2AQ2A 2O5XL 4I3RL 3WV0A 2P46B 5M95B 1V8HA 4KU1A 1URLA 2BNRB 1N5AB 1MCRA 5JIHA 5DJAA 4I2XE 1P7KB 3M45A 3MLVL 2NY6C 1KPRA 2R0KH 1BVKB 5ICYB 4P4KB 2R9HC 4FP8L 5IR1B 3WFEL 3B4NA 1J1OL 4PJ5B 5J6HB 3EO1B 5CEYA 4GKSA 1I8MB 4JZJC 3WL9A 3C8KA 2D03L 5F7EH 4HIEA 3O4OC 3P77A 4RZCB 2PR4H 4OCNC 2C9AA 1ZSDA 4KQ3L 2H9GA 4XI5D 3H42L 1YNTB 1DSFH 1EEYA 3PF2A 3SKNA 3KXFE 5C0RH 6FABH 1GZPB 5D6CB 4LLVB 1RZGB 2RCSH 3VXTB 2DF3A 4LLWA 4BUGA 3WFZA 2BNQA 3B6SA 1D5XA 1VACB 1KJ2H 4YDKH 4PGBA 4NWUH 2EYTA 3VW3L 4OCYL 5F6IB 5A3IC 4PLKC 3VFRA 4L9DA 5D7KD 5A2JH 1CN4A 2NXZB 1HQRA 1IARB 1SJEA 4X6CE 3HE6D 4KTDH 1T1XB 4WO4C 4EDWH 1FSKB 3NCMA 4MJIB 1IQDB 5GGQH 3VDBA 5DGRA 4YXHH 1UH2A 5F7EL 1GZQA 2XNAA 3DMMA 3QQ4A 2PR4L 4MDIB 1TJIH 2FATH 4HS6A 1FN4B 1S78D 1A4KB 1OTSC 5C0RL 2A6IB 1BOGB 2Z9TA 4C56D 3P11H 1RHHB 2EKSA 4HQQH 3UBXB 1DUZA 1KJ2L 5LGKA 2JCCF 4YDKL 4QY8B 4P5TA 4NWUL 4R26H 2EIZA 4H88L 2GTZB 5EU6A 5DJCB 4PJIF 2HKFL 4DK6A 2W9LA 1ZVSA 1C1EH 1IEAB 4HJGB 2JJUA 3LKPA 1E4WH 4NN6C 3C5ZB 4M3KB 3MROB 3BISA 3VWKA 3FFDA 1DANT 3CZJA 5IB4B 2Z8VC 5B22A 4JAMB 3WUZA 1KTDB 1I85A 2FATL 3WUWG 1JL8A 2OR9H 3S5LA 1DN0B 1K4DB 3P11L 2EKJA 5JORA 5EZLB 2HJLB 4AMKL 1T22A 4HQQL 5IEKB 1UZ6E 3TA3B 4R26L 3GSOB 5T1LA 3O11A 1H5BC 4MMZC 1KELL 3KR3L 3EZJB 1C1EL 5ISZD 2BOCB 1T66D 3FAWA 1HCFX 4GKOA 1YNLH 4M5ZL 4NNXB 1YECH 4PJFE 1OTUD 3G08B 1E4WL 2YRZA 2ED8A 3B9VA 1D5IH 5J9PB 4JO4H 4WW2C 4I13B 1MVUA 1WIOA 2EDKA 2WLZA 3IDNA 3HZVA 4R97C 2DD8L 2ZKHH 1NGWA 3EYSH 3OGOE 4P2OD 3S7GA 2OR9L 1T04B 1XGTB 4NYLA 4LGSB 1C5CL 1MCHA 1UWXK 2HFGH 3GGWB 5I66A 3O4LD 1HCVA 2VOTA 3PNWA 2VDNH 3JVGA 3ARUA 3B5GA 3KXFD 4H1LH 1OP5K 4R0LB 5DO2C 3CXDH 3OR7B 5EORL 3D69A 1J05B 4OLWH 2AXFB 4X6EA 4OZGE 1X5ZA 3RWHB 5KSAD 2J3SA 2ZCHH 2VDRL 3PWNA 2VSCA 1YECL 1BJMA 5DJYB 4S0SD 1SJHB 1VADB 1TNMA 1S7RA 1NDMA 3K2MC 4HFWB 2AJZB 4TVPE 4ZS6D 2H2SC 3D9AH 4HUWA 1DUYB 4OAWA 5TFSL 5DWUL 3QDMB 3V5DA 3HG1A 4LFHD 3W81A 1JN6A 2FBJH 3LQAL 5F72S 3RTQA 1LMKA 4J3UA 1MCDA 3S37H 4F7MA 4M02A 3HNSL 4NKIH 5IIEB 2HFGL 4KRPD 1AGEA 4HLZG 3GFUA 4U1HA 5F9JA 5F96L 3WIHA 1CD1B 2JIXD 3CXDL 2OYPA 4LNRA 1L0YA 4RFNC 2KBGA 3EJZC 2BVQA 3TT3H 1WQVT 5GRWA 1YEKH 5MENE 1U92A 2ZCHL 4BK4A 1AD0B 3GM8A 1QLRB 1KIQB 3WS3A 1RZIA 3IAGC 5CIPB 2ZZUT 4DKAA 4X80H 1WWCA 2JJSC 3RZCC 1CICB 3BH8B 5CGMA 5GGUB 3D9AL 2RR3A 2HLFD 2R2BB 4NQEE 1MNUH 5IVXE 4JGUA 5F1IB 1TTGA 1UXWB 5IB5A 2DICA 4ZXBC 3QBTB 4ZPTB 3DI2B 5ESVB 5DUBA 3S37L 1A6AB 4NKIL 1MHEA 3ARBA 3EYQC 3X14A 3T1WA 3IS0X 5D7SH 4XPAH 2O5YH 4Z76A 3OQ3B 5CGTA 5KSBB 2OK0H 1WIUA 5HDBE 3TNMB 1JYWA 4H5SA 1ZANL 1YEKL 3KJ4B 2D0GA 1OVZA 1KPUB 4OGXH 4PLJC 5HHNA 2KUTA 2BVPA 1I1RA 3THMH 5DJ2B 1FZOA 4Y5XC 3GMLB 1X5AA 4OIIH 4I48A 4QTHA 5DDHA 3O2DH 1MNUL 5I1AA 2Q86A 1FQ9C 3QJHB 3TWCH 3CIQA 5EO9A 3SDCA 4JO3H 4HK0B 1ZLWK 3JXAA 1K8DB 2P24B 3SDXF 5H35B 2NY6D 3BN3B 3PGCA 4LSQH 3OPZH 1W72A 1IAIH 2YPLD 3ARTA 3UTZA 1JWUB 4DVRH 3AY4A 3DYMA 1CGTA 1CGYA 4YBHA 3UCRA 2BFVH 3MGTA 4WDIB 3FB6A 5D1ZD 2XKNB 2KZ1B 3WO4C 1PZ5A 1W2KT 5F71A 3QH3A 3HTLX 1BVZA 4PY8J 3TGXA 1WVZA 3VXRE 2VXQH 4OGXL 3THML 3WEXB 3FFCB 3SE9H 2E7CA 2Q3AA 2HP4A 3O2DL 4TVPD 3RPKA 2FLRT 5E24E 4OZFA 4N0YH 3N1GC 4LRIA 3V7MA 1SM3H 2WWKT 2R0ZL 4XAKE 2VXUL 3VG0L 1ZHKB 3SDYH 2W1NA 3OPZL 5HHPA 1IAIL 5ITBL 4OCRH 3L3DA 4EKXA 2JB5L 2F54D 3LKSB 1AY1H 3CFJB 3IJHA 2BVOA 4OI7A 2BFVL 4H8WC 5C07A 3WFHA 4ONHA 3CD4A 1QR4A 3O8XC 3LN9A 3QEQA 4JFHD 4LPUA 1BZQK 1LNUB 3T09A 2KZWA 3D0LA 4NIKB 5FGRA 5IF0B 4L4TE 4XNZB 4PD4J 4QF1A 2FLBT 3CU1A 5MEND 4NPYB 4YHYC 1SMAA 4Y5VA 4PLOB 3SE9L 3OB0H 4R4BB 5IK3B 4C56A 2VLRD 3ZMRA 4HMDA 1EUUA 2EDRA 4N0YL 2X4UA 4NQED 4H0HB 1SM3L 3T3ME 4PJEB 2HJFA 3JWDL 5HDOA 4YHIA 4MHHI 5FUOL 4OCRL 3RIAF 4NN5B 3MRIB 4MB5A 1LEGB 4CRPA 4PBXA 4UU9A 4NKOA 3FKUS 1HHKA 2A9NH 3HI1A 3H9SB 4PJ8B 1J8HB 5ENWB 2CSPA 4EOWH 1ETZA 3BQUB 5ECJE 3M8OH 3FFCE 2ZJSH 2VLME 5CEZH 5IWLA 3U0TA 3ZE2F 4OT1L 3BN9D 4PJGF 4OCXH 2NZIA 4JFOB 2FX9H 1QEWA 4KZEH 4FTVE 4M48L 2VH5L 2ZUTA 1REIA 3TN0D 4U1SA 1MI5B 3NCYP 1B9ZA 3OKMA 4J12A 4PGZA 2VZTA 3SDAD 2A9NL 5HYJE 4FQIH 2EXWD 4WNQA 1J7VR 2EE2A 4EOWL 3DROA 2PYFA 4JFQB 2FYYB 5E99H 3CFKA 4JPWL 5CEZL 3PGDA 1TZIB 4GG6F 1FFOA 3DXAB 5E1AA 4LCCA 1OP3K 2GCYB 3VXRD 1EFQA 4MD0A 5H94B 1NGZB 1JYXA 2Q3ZA 25C8H 3EDJA 3KPLA 4PJEE 4KZEL 1MY7A 5FA3A 1LD9A 3VFNB 3AS0A 3PJSB 3HRZB 3GMQA 4FQXD 4X8JB 1MFAL 4P9MH 3DHJA 4L8SA 3QXDB 5KSAA 3PWPB 3VD7A 3H9SE 3NMEA 3ULUE 2DLFH 5DSCA 3T8XA 5JMOC 2FJHA 4J4PA 2ZOKB 5T3ZE 4FQIL 4D9QD 1BECA 5K9JL 3L3IB 5TGBB 2JCCE 1I1AC 3T1FA 5CZVH 3IJYA 1R3JA 3STZB 4IRSB 1Z0MA 1ITBB 3KWWA 3ULVF 4KDVA 5E99L 4UV4H 3L3JB 4PJIE 1M71A 5IB1B 1I4FA 4L4TD 2Z0BA 2V5MA 3RWFA 1UZ8A 5I71B 4X5WB 3BSZL 4HWBH 5K9QG 3QG6B 2DQCL 2COQA 3VXOA 4G7VL 43CAA 4GMTH 1N6VA 5EDXA 1MLCB 5DHVA 4X9HA 1F6AB 3GIZH 1L7TH 1AGFA 4P9ML 2CKBL 3RZCD 2Z93B 1N5AA 2ATKB 1AXTH 2CKNA 4WU5B 1P7KA 3UPCA 4OLVH 1NBZA 5K9KA 5GS1A 3I6LE 5ICYA 4Q6IC 5IR1A 3R0MA 4HIHB 4GKZB 4MXQC 5J6HA 5GGRY 5LGHH 4PBVC 1Z9LA 3F58H 4ZDHB 4ENEC 4JY6B 3DXAE 4RZCA 4NNYB 5CJQH 4WI6A 1M6OA 5IMOA 2WZPD 2P5ED 3FFCD 2VLMD 5D6CA 2VR4A 1AQKH 4LLVA 5EO0B 3BEVB 3DX6B 1FL3A 4R7NB 5DA4A 4GMTL 1I7UA 2NYYC 4MQ7B 5I2IB 1HHIB 3NZ8B 4XHQA 1F8TL 1UT9A 4MQSB 4EBQH 2M2DA 3F5WB 3PWPE 1L7TL 4PLJD 3WXWH 4FTVD 2K9UA 3QIUC 2IANB 5ACMA 1TTFA 1AXTL 3TJEH 2HG5B 3VG9C 1T7XA 1V3MA 3HZKB 3AU1B 32C2B 2CGRH 1T1XA 1DEEA 2QADC 1IQDA 3CFEA 3KLHC 4B7LA 4X7DC 3MBXL 1FZMB 4PJFA 2AEPH 4B50A 2OI9B 3AAZB 3F58L 4NZTH 5HYJD 5JW3L 2E7LC 1ZWIA 1HWHB 5CJQL 4MDIA 3QUKB 5F9DC 4FFVC 2XRAL 1FN4A 3I3BA 3KGRA 5LQBH 3IVKB 1AQKL 1RHHA 1IGCH 4JG1H 5KVMC 1A5FH 3GMPB 3UBXA 1RK0B 4QY8A 4BKLB 4WI4A 2D3VA 5ANMB 4UUJB 5D1ZA 2RIKA 3WXWL 4NRYB 1RIUH 3RUGF 5DJCA 1MJ7L 2V17H 3KDMA 1ZA6B 4MB4A 5TE6H 3TJEL 1IEAA 1P1ZB 4HJGA 4OZGA 4XPTL 4XP6H 2CGRL 3QXTA 3PP4L 4LCYA 4Q9QL 3BAEH 3H9SD 1OPGH 3MROA 1TQCC 2AEPL 5DRNB 5F8RC 3BQUD 5IB4A 2ZP0T 1ES0B 2ZCLH 2Q6WB 4XMKH 1KTDA 1ZT4A 3BGFB 4F7EA 4TOYH 1DN0A 1K4DA 2AABL 3EZ8A 1KXTB 1CQYA 5LQBL 1BPVA 5EZLA 3VRIA 1A5FL 3O8XD 5BOZG 5IEKA 1YEEH 1T0NB 3MRRB 4GRWB 3TA3A 3GSOA 3SPVB 2DWDA 5BRZB 4HEME 1VKXB 4I18B 3MLPA 1TQBC 1XMWA 5I1DB 4HV8B 3GBMH 1X9QA 5TE6L 5E5RB 1MFBL 3NFPA 2BOCA 3NABH 1IGIL 4NNXA 4Z18A 1XIWC 4XP6L 3G08A 1ODAA 5K9OB 5DJ0B 4GRLD 3E6FB 1KIUA 4MNHA 3N9GL 3BAEL 1PKOA 2X1PA 4U05A 1MCJA 3MLTB 4U1MB 4WEBL 4YC2C 3GJFK 3X3FH 4GLRH 3I6LD 2P8LA 2VB5A 4TULH 4WWID 2ZCLL 2QR0B 4NQEA 3UTTB 4IMKA 1U3HB 2QBWA 4TOYL 4U6XA 1T04A 1XGTA 5IVXA 2IH1A 4QHNB 3C08L 4PJ9B 4ONGH 3IDUA 1AIFB 2R69L 2A38A 5ANME 3MOQA 2OR8A 4BZ1L 4G5ZL 3RVTC 4R0LA 4YGAB 1U8HB 1KJMA 3OR7A 5HYIA 3EAKA 1B4RA 3KPSB 3DJ9A 4NN7B 2AXFA 4U6YB 3GBML 1N6QH 4YPGA 1BAFH 3FL7A 3SDXE 4WWKC 3NCEB 3NABL 1HINH 4APQB 5LXGH 3JSSA 5DJYA 1RULH 1SJHA 5GGSY 1R3LB 2Q7YB 2NY1C 3BE1H 1N0LA 4UIMB 1DUYA 5GRVK 4TULL 2YK1H 3VFUB 3TF7C 2NMSA 4R3SA 4ONGL 3TN0A 5KS9F 1VB9A 1CFTB 1X5HA 4H1LG 2HA1A 1CD1A 4U1GB 1G7MB 2I5YH 1XGYH 1ZXQA 4JRYB 3FZUC 4RAHA 4B41A 1KGCD 2X4RB 1FO0A 1AD0A 2P1YA 1QLRA 1KIQA 1HINL 1HXMB 2A83B 5LXGL 1F58H 3QPQC 4JFEB 3QSKB 1XGPB 4RMVA 4RMTA 1MHPL 2R29H 3BDBA 4BQ9A 1CICA 3IDYB 3BP7A 5GGUA 4M6ML 3OKDB 2R2BA 4NCDA 3UTTE 1GSMA 1HIMH 2YK1L 3O3DA 2EE9A 4U7SA 3ULVC 4WRLA 5F1IA 5IHZB 2CRYA 3HS0A 4ZPTA 4XXCA 5CHNB 3H7BB 5I16B 1QNZH 1NAMH 2VDQH 5IBLD 2DQJL 1AE6H 5F3HA 3CDYA 5BQ7A 1Q94B 5C9JB 3KPSE 2D2OA 35C8L 3ARDC 3EGSA 1XGYL 5E4IA 3V6OE 1ZHLA 1A21A 3TNMA 4L8CB 4BZ2L 1CDBA 2QL1A 2D7MA 3IFPB 3QJFB 3RHWF 3SDDB 3B5HA 3FRPA 4JZOA 2R29L 2VIRB 5CBEB 5DJ2A 5GZOD 3BYTA 5J06A 4I9WE 4LGRB 5SX5H 3GMLA 4L4TA 5FA4B 1NFDB 1WISA 5HHXH 1F97A 1KXVC 4ZTPH 2R4SH 5BVPL 3HPLB 2XIDA 4HK0A 3FONA 1K8DA 2P24A 5A1AA 4U3HA 2NY2C 5H35A 1QNZL 1NAML 1PX4A 2YRLA 2VDQL 1UC6A 1AE6L 3BMWA 3QQ3B 2YPVH 1JWUA 3NIFF 3CCHB 4BUHA 5JXED 1MY5A 1S9VB 4PJGE 3MUZ1 3PWLA 2B1AH 3QHZL 5FM8A 5F7NC 2XKNA 1YUHB 1CGWA 2XACC 1WWWX 3G04B 3O6KH 2OTUB 1AHWB 3OAZK 3OG6B 1WCQA 3MODL 3GMNB 2EYRB 3JWOL 1NC2B 3SGJC 3WEXA 3FFCA 5HHXL 5C7XL 4QOKE 3E2HB 3I50L 1YMMB 4ZTPL 3RIFF 2AJ3B 1JPSH 2J6EA 2X5PA 5DQDH 1RZ7H 2BZDA 1JBJA 4FTVA 5EU3B 2BCKB 5HVWA 3G9AB 3LKSA 4DGIL 4GG6E 3CFJA 1MCWM 5IM7B 3P30H 3K4ZA 5I1GH 4OFIA 4L3CA 2DBJA 4PJXF 4G7YH 3HZMB 2E9IA 3R06B 3BP6A 2W0PA 3Q3GB 4WCYH 3O6KL 4WV1C 3QULB 3HUJF 5B8CA 4DN3H 5HYJA 3LKRB 3F6IA 1HH9B 4G8EB 3PWJB 4LLAA 2DMKA 4R4BA 1PDKA 1PG7H 3RX8A 3HI6H 3MYJB 2WSKA 2NY4B 4Z7WB 4GAJL 3C6LD 2VUYA 3MTRA 1CLZL 3LZFL 1UB6B 5IHUH 1RZ7L 4YDLC 4PJEA 3F6LA 4MLIA 3S88H 1XFPA 4GJTB 5CJXC 5HI3D 4KQ4H 1LEGA 3KNBA 3R4DA 4RMRA 3GRWH 1HSAB 2B39A 2XXMB 1A3LH 1JF6A 4M1GH 1XF1A 5BO1H 3KPSD 1F2XK 1S3KL 1MREH 2AEIT 2DTMH 3H9SA 4PJ8A 5CBAB 1J8HA 4WCYL 5ENWA 4HDIA 3GHBH 1OSPL 3LMJL 4Y2DB 2A9MH 4OF3A 3LD8B 3T4YB 3BQUA 5IGXL 4APQD 5BV7H 2JCCA 2WBWB 1NH6A 3LS4H 4AEEA 4S2SB 4MXVF 1PG7L 1FH5H 2BY2A 4PJIA 3RY6C 4JFOA 3AMLA 5D5MF 3G5YB 5IHUL 4CMHC 1KFAL 2JJTC 3DUHA 1MQKH 4ZPVB 4NKDA 2Y72A 4KQ4L 4NQUA 4PJCF 3GRWL 1A3LL 5FGCE 4M1GL 4FQ1H 4GRLA 4MSWB 2DTML 4AH2B 4G80B 2A9ML 1DVFC 4KK6C 3V6FB 3OBAA 4JFQA 2FYYA 4R4FH 3LEVL 1TZIA 3UTSD 4QXTA 3DXAA 3E3QE 3C2AL 1EHLH 3LS4L 1AGBA 1SBSH 2XWJB 2GCYA 2YS4A 1FH5L 1NGZA 2VE6B 1I7ZB 2IALB 3PL6D 1MIEH 2AQ1A 4QOKD 1Q9WB 5CKGA 2IBGA 3RWEA 1WFOA 2BHZA 3VFNA 4X8JA 3PJSA 3HRZA 1AI1H 4GW1A 4YHZH 1OY3B 3BDYH 3VGAB 1JZ5A 2YSSB 4MS8C 5HYFA 5JIKA 3ARED 3PWPA 5MEOB 1NCDH 4FQ1L 1FNEB 5D7IF 3HE7B 5KG9B 2ZUUA 2ZOKA 2B5IC 3WFDH 3L3IA 4JN1H 5TGBA 5C3LD 4M62L 1EZVX 4D0DB 2EE3A 3IJSB 4IRSA 4QLRA 1IT9L 3QXWA 2X2YA 3RUGE 5CD5D 4UT9H 3L3JA 4XBPB 5D7JD 2Y06H 5E4EC 5ETUB 5IB1A 1SBSL 1JRHL 4NO3B 1NEZB 4X5XB 4XAWH 1WAAF 4X5WA 3QG6A 2XTLA 1EO8L 5CJOH 1AO7B 4RQQB 1MLCA 2HN7A 4G6FD 2OXGA 4YHZL 1AI1L 1F6AA 4YK4C 4LVHC 3FB5B 2ED7A 5JPMB 4HIXH 3TCLA 2Z93A 2ATKA 1NSNL 4Q7DA 4LCWB 4WU5A 3MRNB 4MA8L 4HZLB 1N3NB 4YFLI 1EERB 2YD8A 5FDWA 4EUPH 1F6LL 4HIHA 4GKZA 1XR9B 1A47A 4ZDHA 4JY6A 3LB6D 2F8VA 3BPLC 5DMKB 1N2RA 4UT9L 2Y06L 2IPUK 1N64H 1NLBH 4KI5F 4ZO9A 4LSDA 2A2QT 4MQTB 5GS2D 5AYQA 1FNSH 4PRHB 4XAWL 3BEVA 3T08A 3DX6A 4R7NA 4PGCA 5CJOL 4MQ7A 5I2IA 1U91B 3NZ8A 1RPQA 3F7QA 3BEWB 3GKWL 5BJTB 4HIXL 3FRUB 4PJDF 2VLJB 1C5DA 3MC0A 2HG5A 4QGYA 2OR7A 3HZKA 1J5OH 2QEJA 4MAYD 4DAGL 1QTYT 1BD2B 1A6ZB 3NPSC 3TIDA 3AAZA 4ODBD 3FQWA 4XP4L 3QUKA 5JOFB 3BOVA 1IL1B 3PDDA 4DEPB 4L8BB 5HY9B 5HPMB 1FNSL 1QLFB 2YPKB 2NY4D 3GMPA 1NC4B 1RK0A 5JXEA 1DBBL 4RGNB 1JGLH 3SKMA 1HXYB 1WTGT 5ANMA 2IBZX 1F3RB 1YN7A 4LOUC 3VD9A 4KH2A 2IBBA 1ZA6A 3NTCH 1RUKL 3TO2A 1P1ZA 1J5OL 5HHMB 1KJVB 4TTDD 3SDXA 5KS9E 4YO0A 4IOFC 1S7QB 5ID1B 3TCXA 2HFEB 3ZHDA 2UWEB 3MXVH 1BP3B 4KROC 1ES0A 4TUOB 1HKFA 1DL7H 1CCZA 5ID0A 2ZUVA 4XXDA 5LVEA 2ITCB 4DW2L 2VUOA 4Y88A 4P23B 1QFWH 2DLHA 3NVQA 1KN4H 4YWGH 1S9KC 2D7TH 1T0NA 3M17B 1JGLL 3MRRA 5JO5B 1MRDH 3WKNA 2I25N 3SPVA 2VLJE 4CU6A 4NOBA 3T0XA 3P2TA 1B6UA 2APFA 2OZ4H 1JFQH 4I0PC 4NM4H 3NTCL 2NTSP 5EZOL 1IMHC 4K3EH 3Q48A 4Y4HB 1BD2E 3FB8B 5K9OA 4BZYA 5DJ0A 1WLHA 1GJIA 5I9QB 1HNFA 1NMAH 4X6DF 4U1MA 2AJSH 1WJ3A 5HI4C 4K55A 3MXVL 3TBWB 4ZO8A 4DFHA 1OTTD 1DL7L 2QR0A 5C0DA 3C6LA 2CDEB 3UTTA 1AKJB 4NKMB 4POZC 3PWVB 4J23A 4QHNA 4RGNE 4PJ9A 5EOTA 1AIFA 1EHXA 3QDJB 1QFWL 4PUBH 5C09D 2H45A 2VABA 3GSNH 1UEYA 3ECBB 4HUUA 4X9BA 4YWGL 1X5YA 1MRDL 5CFHA 1U8HA 3KPPB 4LAJH 3WHE0 3S36H 3KPSA 1JZ6A 4U6YA 2OZ4L 5C0JB 4NM4L 3V6OA 1PAMA 2APBA 4APQA 4TSBH 3DBXA 4EN3C 2Q7YA 1NMAL 3GDBA 5F1NB 4Z7NE 4UIMA 4HH9A 4XCFH 4M6NL 3VFUA 3CLEH 4KDTA 5AWNH 3G5ZA 3O45B 4JZJB 4NZDA 2VN4A 5E8DH 2V2TB 3MZGB 2J88L 4QRUB 4PS4L 4QXWA 1YY9C 3NIDE 3QPXH 1CFTA 4PUBL 3GSNL 1U8MB 5GRVL 2QSCH 3QQ9D 4FQ2H 1Q8MA 1G7MA 1DVFD 4JM2B 1DQMH 1IM9D 3WSQH 4U3CA 5HI5D 1DQTA 3CVHH 3O41B 2R56L 1PEZA 4XVSH 1UGNA 2IMMA 3L6FB 3W0WB 1MFDH 4YHLH 2A83A 3MCKA 1O5DT 4JFEA 2Z31C 4YE4H 2BNUB 5EPMA 3X12B 3QDAA 5FF6B 3AB0C 4DZBB 4MWFB 4WO4B 3OKDA 5FCSH 2BDNL 3CLEL 5IHZA 4JHAH 5AWNL 3BRFA 4QOKA 5E8DL 2ZWLT 4F15B 1R3IH 5I16A 4U0QB 2VDMH 3RVUD 2J8OA 4OSUH 3QPXL 1WICA 3LQAC 1X5JA 1Q94A 5C9JA 2PO6B 1ZLUK 2G60H 3AREA 3LN4B 4FQ2L 3VGFA 1SEBA 5ELIA 1VPOL 3WSQL 3HRPA 1DQDL 1IGTB 2DKSA 4GG6A 1B4JH 4L8CA 3CFCH 4XVSL 1F4YH 4NQCB 3IFPA 3MRBB 4JPIB 3WNOA 3QJFA 3SDDA 2DIBA 4XPFH 1AR2A 2VIRA 2AJVH 5D7JA 2BSSB 5CBEA 4NRZB 5TH2B 3W9EB 4NN6B 1VGKB 5FA4A 1NFDA 2HT2C 2CXKA 2G9HA 4JHAL 3HPLA 3RPIB 2DWEB 2DQTH 2JELL 4KI5C 4XZUB 4P46C 2W9DL 2VDML 1E28A 3ARSA 2E9BA 4WUUB 4OSUL 1KENH 4NDMB 3QQ3A 2XA8L 4A2LA 1MRFL 2G60L 3CCHA 4ZS7L 4DGVH 2P49B 4BSVA 4IM8A 3W0WE 1I8LC 1FYTB 1F4YL 2NY5L 5T1MA 1H5BB 3G04A 3QZWG 4RISL 4FNLL 5D5ME 5IKCB 5SWZE 4V1DB 3SE4A 4K94H 2OTUA 3U0WH 3MCLH 4XPFL 3GMNA 1KIRB 1A02N 5IQ7L 3FTGB 2Q76B 1NC2A 4HGMA 5HGHB 1BF8A 2WIMA 5DEFB 4B53A 4PJCE 4KK9C 2R1YA 3T4AB 3L95B 1AP2B 1EEZB 3MQIA 4WW2B 3TJHD 2AJ3A 2DQTL 5GSRB 3CVIH 4R97B 5EU3A 5AG8A 1KENL 2BCKA 1K6QH 3WD5L 1MFNA 3VXUB 4X9GA 4FQCH 4DGVL 2HT3D 4C57C 3JTSB 1TZGH 5IT2H 5IM7A 4QXGH 4NQCE 4MAYA 4LLYB 4WJ5B 3SCMC 4OCMC 3Q3GA 3LIZL 2CDGA 3QULA 2IEPA 4OUUB 5IOPB 4K94L 3OKLB 2Y7QB 3MCLL 4ACPA 5I0ZA 4G8EA 4GLRI 1K8IB 4HKZB 2H3NA 5FGBC 3CH1B 4BFIA 1X5KA 5JTWA 1A14H 5KJRL 1QVOB 4C55A 2FECL 4N1CA 5C0AB 5D7IE 4Z7WA 2IFGA 2PTVA 2W92A 3K74B 4WUUE 5DT1L 5DJ6B 3QUYD 4P3DB 1K2DB 1VHPA 3FOMA 4XCEB 1K6QL 1MCWW 3F7RA 4FQCL 1F3DH 5ITFB 1TZGL 3WIHH 5IT2L 4QXGL 1HSAA 3MBEC 1BBDH 5ADPH 5GJSH 1WAAE 4V1DE 4YHPB 5D7LE 5DD3H 2R0LL 5AYUH 2RQ8A 4Y2DA 3T4YA 4QCIB 5FIEA 3P4LA 5DURD 4ODTH 2VN7A 4K8RL 3TZVC 3GM0A 4S2SA 2WM0A 3MRGB 1UADC 4LLMA 5D1XD 3MGAA 1WBXB 1TITA 3NFNB 4PJAB 3SKOB 3G5YA 4ODWB 3TO4D 1JTOA 2MPAL 4ZXBB 3TNNB 1SYVA 4X6BA 1JGDB 4KGLA 4FG6C 4KTYA 1V7MH 4N9GB 2ARJB 3WIHL 2CR6A 4ZSOB 4JM2D 3JWDC 5LCVL 1G9MH 1BBDL 1ZTXH 2X1XR 1P84K 2D31A 5ADPL 1WK0A 3MV9B 3DX7B 4AH2A 5K93A 1NAKH 5FB8B 4G80A 3W0WD 3IF1B 1GL4B 4KXZI 2YBRB 3V6FA 4POUB 5SWZD 3I6KB 5C0AE 1VA9A 4PJDE 2XWJA 3RX5A 2VL5B 4Y5XB 3ARPA 1KV3A 1I7ZA 2FDBP 2IALA 3OSKA 1Q9WA 4R4ND 3BP4B 2WQRA 5I75B 5IW3A 3CZFB 5JNYB 4CBPA 3AMKA 1W72H 2PO6D 1CR9L 1F11A 5MEOA 4RWYH 4G9DA 5IW1B 1G9ML 4OB5L 2VQUA 5LJYH 3HE7A 1G9NH 3BH9B 1CL7L 3V52H 3GMOB 1JMZA 5F9WB 5L2JB 3AGVA 3WO4B 4NQCD 3EDKA 2P5WD 4D0DA 4X7CC 4IOIB 2C4FT 3T0VA 3PIQB 2D9QB 4XBPA 5ETUA 3V4VL 4PJAE 4NO3A 1U93B 3QO1B 4X5XA 12E8H 2FH8A 4HBCH 1OWWA 3TH4T 3VWJC 4JN2B 4NO0D 4OLYH 3BO8B 4RQQA 1PYWA 1IM9A 3CPLA 3RNQB 4RMQA 5ILTL 4LSPH 1W72L 5K59F 3RVWD 3FQRA 4LCWA 2DQIL 4O02H