4P57A

Mhc tcr peptide complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
178
structure length
178
Chain Sequence
KADHVSTYAAFVQTHRPTGEFMFEFDEDEMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEVTVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFHYLTFVPSAEDFYDCRVEHWGLDQPLLKHWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DP alpha 1 chain
publication title Structural basis of chronic beryllium disease: linking allergic hypersensitivity and autoimmunity.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 178
sequence length 178
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p57A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p57A01
2CSPA 2E9WA 4GW4A 3L9RB 2LAGB 1OP5K 1YUHB 2MKLC 4XC3H 3C60B 5D7IE 4NQEE 5JIPA 4C56B 5JO5A 4S1SH 3C87A 4HGKC 4FZEH 3BI9X 2O5ZH 3K8KA 3TA3B 4BZ2H 2BVOA 5CJ8A 4MNQE 3NIGF 3QXDA 5E95B 1LP9A 4TPRL 4YUEH 4WFHD 1IM3B 4ZS7H 2HKHH 5B8CB 1DL7L 5CS7A 3MLZL 1HINL 4GMSH 1JHTB 4PJ8C 3KPTA 1J05B 1P9MC 3UPCA 2Z4QA 1KIPB 3GBNH 4RAUA 3VXTA 4DEPB 4UDUA 5C9KA 5DVNA 2NTFB 4PJBB 3ZTNH 2NZ9D 1YUHA 3SKNA 4M93B 2K9UA 3ARDA 4X0KB 4C56A 1RJZA 4FHBD 4M62L 3QXUA 4XNUL 4DTGH 1TJIH 1DUYB 4G6FD 4P99A 2NX5D 5INDA 1QLRA 2MTPA 4UBDD 1B6UA 4XXCC 2J12B 5E8NB 5FYKU 1OHQA 2ESVD 1C12A 2L0DA 1J05A 3PWVA 3BGAA 4H88H 1FSKC 5LKNA 2W92A 3T2NH 5LGJA 4JG1H 1XF4A 4ZTOH 4ZUVB 4Y19B 4KFZC 2W0LA 1NBVH 2XPGA 2AJYL 4QRTA 5EORL 5E70A 1ORSB 2ENYA 1D6EA 5I8OH 1Z2KA 4Z7UE 4S1QL 4RMWA 5B3NA 2XNAB 4ZSOE 5BJTA 3QULA 3HC4L 2IPUG 3D3VD 4R96A 2YD5A 4F9LA 2UZIL 1BREA 4YEFA 4PB0H 1I3GH 3DVNA 4ZTPH 5C0CB 1Q9OA 1NC2D 4F58H 3H3BC 3G6DH 1NEZA 3FQXB 1XF1A 3AAZB 5BXFB 3X3FH 2DQJH 4MX7B 3P4OA 5J57B 3MBEA 3SO3C 1CBVL 5FUCE 2HA1A 4J3TA 1FBIH 2AV7A 3VD4A 4JM4H 4D9RD 1A7QL 4MB4A 3CCHA 4MXQC 3MUY1 2YD4A 5IVXE 4P4KC 4P2RE 1JHLL 3ZKNC 3WJJC 5GZOC 1U58A 5I76B 2WANA 3CFBA 4YX2H 4LDLB 1JNHA 1BIIB 4D0BB 4PTUB 1UADC 3PWPD 2EO9A 3E1F1 2BHUA 4PYGA 5IHUL 2P8PB 5HGHA 3BZFB 2GTWA 4DW2L 2LV4A 3FO0H 5TE6H 1G6RB 3AAZA 4NIKB 4M48L 1D5MA 4XCCL 4HQQL 4J8RB 4ZPTB 2WIIB 2OTWA 4HWBA 3BIAX 5FYJD 2VNCA 3STBA 3V52H 2CRMA 1WWBX 3AY4A 2OXGA 1ZHKB 1OGAE 2ZSWA 4HIHA 4HXAL 5ISZD 1LO5A 2VR5A 1MAJA 1PLGL 5E2TL 1KEGH 5H94B 4YDIL 5I76A 3UJIL 1NCBL 5T3ZD 3HUJF 3B9KB 3RUGB 3DO7A 1G84A 3QUKB 4YZFE 2WLZA 1BWWA 3P40A 3EOAB 2B5IC 4IMLA 5F96L 2A1WH 3LD8B 4XVUC 1CDBA 4LIQH 3LRGA 1CDYA 4K94L 3UTQB 2WIIA 2EDYA 5IVNA 4Y5VB 2K3TA 1MCCA 4U6XA 1MLBA 1F4YH 4UAOB 1BOGB 4GG6A 1QRNE 4KXZI 2P47B 1DFBH 5EU7C 2J8UB 4Y7MA 1XIWB 3VFOB 1RHHB 3DRTB 1J1XH 2I5YL 2IG2L 5IEHA 3EJZC 2NW3B 3OHXA 4OCRL 4LRNH 1D9KD 4M1GL 4ZOAA 3BYTA 3PQYE 3STLB 4YK4C 2JJSC 2DICA 2DI9A 2GSGB 1CLZL 1VSCA 5MEQA 4HC1L 1P4LB 1IFHL 1BOGA 3ME0A 2OSLB 1R0AH 2HJLB 3ARBB 3QUXA 3W5NA 1FORH 1FNEA 1I8IB 4L8CB 4QKXB 4RWYH 5A16B 3VFOA 1RHHA 2O5YL 1FYHB 4B50A 1A1NB 4Y16C 5IHLB 1RIUL 4W4NA 4HWZA 3DHJA 3U48A 4HKZA 3MCKA 2EXYC 5DMIL 5I2IB 3S37L 5INCB 1UH2A 3RTQD 4MAYA 1BVLB 3FRUB 4FQQB 5CP3A 4U1SA 4AYFA 2VZVA 1T04A 4HGMA 3NH7L 3NFNA 3UO1L 1P69B 2BDNL 4N1HB 4TUKH 4U2YA 4EUPH 1T0MB 2I9TB 4FFVD 2D0GA 3QWRA 3T0XA 1KN4L 2F5AL 5E00A 3L7FB 5C08A 5I2IA 4R7NA 4X6DF 3RX7A 5E6IB 3FTGA 2VKWA 3DSNA 5EOQH 3SDYH 5KN5B 1LK2B 1KTDB 1BVLA 2XZAH 1F2QA 4Q97A 4PB9L 1GZPB 2ATPA 3F6IA 1SVZA 3FRUA 2ZUYA 1QSFE 3GBMH 3HPLB 3QPQD 3QDGD 5TE4H 4NJ9H 5GS1A 1YEGH 1DUZA 1G7QB 1UKQA 1WFNA 3TN0D 3HAEG 5F9AC 1A7PH 2ERJB 2X4RB 5SWZD 2YC1A 2YA2A 4QTIL 4N8CH 4OFIA 1N0XL 3HMWH 3PGCA 4KMTL 4OFVA 4M7JH 5DMYA 2NR6D 2RB8A 3S36X 1JWUB 1NMCC 4L3EA 3SDAA 2D7PA 5J0BA 1ND0B 1T21B 1YMMA 4LGSB 3RBGA 1N59B 5AWNH 2OBGA 3BP6A 1TENA 4KC3B 1QBBA 2XN9D 1A9BA 3OF6A 4M7ZC 2XWBA 3VFSA 3HR5B 5JNYB 2DKUA 1OSPH 1X6NA 5D2NE 5C6TH 4E41D 1FGVH 4PJ5B 4PJDB 3BMWA 3DO3A 4WO4A 2BNQB 4GLRH 1A0QH 5LBSL 3QRGL 5I30L 3CFDA 1KCUH 3HG1B 1G9NL 3V7AE 3Q1SL 4R6UA 1ND0A 5BVPH 2XY2A 3TVMC 2FZ3B 3H7BA 3KLAB 1EO5A 1Z9SA 4M7KL 1CL7I 2P5WB 5DJ0B 4KK8D 3VWJC 5TE7H 1E4JA 1E6JL 5JNYA 1SJHA 4NWUL 1JWMB 3VG0H 1QACA 4H8WL 1BOYA 3H42H 4FXLA 4RGMC 3D48R 4G8IB 3LAFA 1I7UB 2YWZA 4IDLA 3O4OB 2VLRD 1BFVL 2PETA 1K8IB 3F7YA 5GS2H 5F44A 4UV4L 1DQDH 2R23A 4LVOB 1X5JA 3CNKA 4QRUA 1TCRA 4U1GB 3N9GL 3FRPG 3F7VB 4GKZB 5K9KB 3IXTB 3QXAA 1HHIB 4LLVB 4CUCA 1VEOA 3PGDB 4RFEB 3H9SD 1KB5H 7FABL 1NBZB 1QLEH 4G8IA 4QRRE 3OAZH 3HI1B 1RMFH 3L3KB 1YNLL 4HJ0D 5IGXL 3NCFB 1QYGH 1U2HA 1UWGH 4P23A 4QXUL 1Y6NR 3CH1B 4PD4K 4ZQKA 2DM4A 4UQ2B 3ZYJA 1RULH 1U93A 5T1KD 4MVBC 1M4KA 1I7TA 1F6AA 5C0RL 5HGBA 5HPMB 1IGTA 1VGEL 4JDTL 1R5WB 3HPJB 3IXTA 4XBGB 2FECI 1RIVL 2MNUA 5DJ6A 3RRQA 1QFOA 4YDLC 3Q6FA 4RCAA 4QYOA 5IBUG 1J1PL 4J2XA 4IMKA 1FNGB 5D7IA 4NQEA 2DLIA 3VDAA 4ETYA 1ITBB 4RGND 3QCUL 3EGSA 1U3HB 4IRJB 3H6JA 3BZEB 2BVUA 1MVUB 5CHNA 1A14H 3G5VB 4MNQA 1CU4H 4F7MB 4QRPD 3QEGL 1P6AB 4M02A 2WM0A 4PRNA 2ZOKB 4ZOEA 4WUKH 4DVRH 1DQJB 1CYGA 5HPMA 4PGEA 4ZAKC 3PHOB 1WITA 1KSRA 5EA0L 1G6RL 2RIKA 2UV3A 2FR4A 4KUZH 1EX0A 3MV01 3H8NA 4M7LT 4RZCA 3V6ZA 2VAAA 5JW5A 3MRFA 1NL0H 1PKQE 1MVUA 3VXME 3FQRA 4LAJH 3ARED 2OK0H 2BX5A 2A6KA 3KPRD 3J8F7 4JG0H 3BH9A 3T3PF 5EUOB 1DEDA 3O9WC 1JZ5A 5DUPH 4ONFL 2D31B 4EN3B 2C3VB 2H3NB 4HIXH 4WFHE 3TT3H 4NRYB 3VGDA 4Z7UA 2CLZB 5E56A 4BELD 3CZJA 5ITFA 4ZSOA 4CBPA 1JWSA 3IVKA 4BH8A 1X4ZA 3CSGA 1CICC 3PNWA 5GGUA 5D2LE 1RJYB 2PXYD 3DVGB 4IOIA 1UC6A 1L0YA 5FYLL 5HHQB 5F1IB 3WEXA 2V5RA 5EU5B 1AGCA 3DV4B 1KPVA 4G6JL 5IUSA 2WBJA 1BQHG 1I9RL 2PKDA 1DBBL 5M94B 5JR1H 4NC0B 2YBRA 1CLOH 4UQ3A 4RFOL 2QSQA 5IBLC 4DUWA 4M03A 2ESVE 4JHAL 4QLRA 4D9QD 4WI4A 3VFVB 5IVXA 3DETC 5L6YH 1XMWA 1BJ1J 4P2RA 2PW2B 1E28B 3ARGC 1RJYA 5FDWB 3GZKA 1OTTC 1QG3A 4BQCA 4DK6A 1NGXA 1UXWA 1QA9A 3DX6A 4JDZA 2AV1B 3SCMA 2YPLD 4NSKB 2C5DC 4XP5H 2B39A 1PG7X 3HI5L 3QCTL 4FQXA 1U92B 1Q1JL 4XXDA 3VXSD 2IBGA 4O9HL 3R06B 4UILH 3D3VE 3BQUD 5KAQG 4UOJA 4LNVA 1N3NB 1KC5H 2K1MA 4R26L 1OGAA 1WQVT 5HY9A 1ADQA 1U95B 3NFSL 5J6GA 1HILA 5L88H 5GJTH 1CE6B 5GS0L 4N0CD 1B0RA 1DJSA 3BYYA 3G6AB 4D9RE 3LS4H 2RCSH 2DTML 2X9WA 4ZUUB 2Q6WA 3R06A 1DN2A 4FNLL 4F57L 1FZOB 2BOCA 4G8GB 4MS8C 3CFKB 1NC4D 1XF5B 3PWPE 4KK6D 4KTEH 5FCUL 1E4WL 2VDLH 3WUZA 5DD6B 1MJ7L 5E2UH 1QRNA 3LV3B 4B41A 4R2GB 2YEZA 2JJWA 4YAQB 3GI8L 1BQHB 3EO1B 4X4ME 1A6WL 5FYJE 3IDJB 3ZE1E 1F6LL 5D72H 3BH8A 4BFIB 4LSQL 4OM0H 1WTGT 5ISZE 3IJYB 1OAQH 4Y4FA 3B9EA 3G5XA 3H3PH 3PQYA 2MQCA 1H3UA 5T3ZE 1UA6L 4BJLA 3V6OC 3CFKA 2CKNA 4NBXB 4YGAB 5L0QC 4LSSL 4PGJA 4I3SH 1D5XA 3ZKXB 1DN0B 4MD0B 3TO2B 4NQTA 1XCTA 3QHZH 1HN1A 5GPRA 4LLMA 4AK1A 1AQDA 5DJ2B 4HIIB 4R3SB 3C8HA 1MHEB 2Z31A 1NBYB 4HXBL 5ADOL 4NC1E 1ZSDA 1I1YB 4KJWD 4FA8A 1ES0A 3L5IA 5JQHC 1LK3L 2AJSL 3VXUB 1EEYB 2CUMA 5E8EB 7CGTA 4ZD3L 1TQBB 4G7VH 3WXVL 1JF1A 1I8KB 4I18C 3R1GH 4LCCB 4LEOB 5ENWB 5FKPA 3BD4A 3N1QC 1RJLA 5BS0B 3RJQB 4B0MM 4U3HA 1MHPL 4PLNC 1EHLL 3O4LD 4AIZA 3V5HA 4I0PD 4KHXL 1NGWA 3O45B 1MREL 4KDWA 5D1QD 3S35X 3WNPA 5DJ2A 2A9NH 2QL1A 1UWXK 2KZWA 5FKAB 2XIDA 5IQ7H 4K8RC 3LQAH 5E5RB 1T0NA 1I1YA 1F5WA 4CU7A 1MAKA 4LSVH 4XPGL 1R24B 4APQB 4Y5YB 4K2UL 5ENWA 4LCCA 1PAMA 2Z35B 1F11B 4HS8H 2B4CH 1JGVH 1UH3A 3ULUH 5T33H 3QIBC 1A3LH 4YR6A 3ZDZE 4J4PD 1QSFA 2D7TL 3BP5A 4R90L 3RVWD 2CKBA 1J10A 4WGVB 1MOEA 4XT1C 4AY0A 2VZOA 2AXGA 2NY0D 2I26N 4MYWB 3OL2A 4ODSH 4ISVB 3CDCA 4XVJH 4M6ML 3TNNA 3P77A 5ERWA 2D0HA 2Y5TB 3MRHA 3OAUH 5F7KC 5I1AA 4DKFH 4XI5C 1NGZB 4YO0A 5IB3B 4PJ9D 5DHVB 3QH3B 1BBJB 4ZFOB 3WFBH 2B4CC 4MCYA 1A6ZA 1KYOK 3ULUC 3FQWB 4OKVA 4W6XB 1YJDC 1MHCB 1XAUA 1PY9A 5GGRA 3UAJD 2W9EH 1L6XA 3PUCA 1EH9A 5F3HA 4XPAL 3UXFA 4F7PA 3ELAT 4AENB 1WISA 5I8EA 1FL6A 2AEQH 4AH2A 4JJ5B 3EUUA 3D85A 3DMMC 3QIWB 4ESKA 4G43B 3MRIA 4JAMB 2DS4A 2Y5TA 3IU3A 3MXVL 1C5BL 1OAUL 2OJZL 1T3FB 2HFFA 5D2NA 4YIQA 4OLWH 5DHVA 1G1YA 1OCWL 4Y4HB 4NRXA 4EI5B 3QDGE 2GCYB 1WAAE 3IAGC 5ILTH 2V2XA 3TIEB 4F15B 1CI5A 4ZFGL 4ZFFA 1L4IA 2XG5A 3K2UH 2F53B 3TO4C 3WIHL 3B8SA 1K5NB 4Z0BL 2NY6B 4S1DC 2R4RH 4WW1A 2VC2L 4PREA 5LCVL 5DZNA 1DLFH 1VGKA 4KI5F 5IW6A 1PZ5A 5K9OA 4OSUH 3LKPA 3QBTB 3DX7B 4POYA 5EU4B 5JDSA 3O6KH 5ELIA 5JORA 4Y1AD 2M1KA 4EI5A 4MJ6A 5DJ8B 3WD5L 5ITBL 1A3QA 3AU1A 2QHRL 3L3OB 3DYMA 3FT3A 4Q0XH 1UACL 5TQ2L 1AKJD 2B0SL 1EUTA 4JRXB 4E41E 3P4NA 4ORGB 5GRVL 3IDIB 3QQ9D 1RPQA 4JO4L 4I5BA 3KR3L 3EYSH 1SEQH 3VFPB 3O3AA 2XQBH 1PSKH 3JWDH 3FZUC 5D7SH 4RBPH 2I9LB 3ZKMC 4GW1B 1KB9K 4IRSB 3N1PC 5L2KB 2X1WL 2MHAA 3ULUF 2VABB 3V0VB 3GI9H 3T77A 4JFDD 1RHFA 2F54E 2HJKB 3H2WA 3W9EB 2W91A 3HLAB 1MI5B 2ADFH 1YEDA 5IQ9B 5GHWH 5MHSD 4ORGA 4PJGB 4MQXD 3EYOB 3BSZL 3RA7H 2FJFA 1GOHA 2DQCL 2NXZC 3ARRA 4H5SA 5F6HJ 1Q94B 3UZQA 5F88B 3UTSB 2VLRE 1T22A 3OZ9H 3QI9B 4YBHA 4IRSA 2X89D 1MWAA 5L2KA 2NZIA 3HZYA 4M6NH 4GFTB 2YK1L 5J3HC 1J0JA 4KZEL 3RJDA 3PE9A 5BV7H 3MZGB 5E7BA 4K07A 4MJID 2IMMA 1X7QB 3QQ4A 4NOBA 1BAFH 2JF1A 3CFCL 3H9SE 1XH3B 2GJ6D 3BOVA 1BX2B 4M1DH 3FQUB 5D7KD 4OLZL 5F1KC 1YY8B 5L7XL 1N5YL 1WTLA 1AR1D 3LKSB 1YEIL 2CGRH 3CLFH 2APBA 3O0RL 1NQBA 1Y0LB 1J0KA 1AJ7L 4WU5A 2ZCKL 1HH6B 1YC7A 3BGFB 1ZWIB 5T1DH 2A38A 3ARYA 1J7VR 4X6CB 2PYEB 4AMKL 1YN7B 3QCVH 3CAFA 1BVZA 5BV7C 3TYFB 3PP4H 1PKQA 4R4BB 3VXMA 1KN2L 4UB0H 4NKIH 2APTA 3QUZC 3QXTA 3IRPX 4JFQB 1AD9B 3BN9C 3KPSD 1BIHA 3WIFB 5C07B 1YN6A 4RGNC 2XI9A 5F89B 1OLLA 4WUUD 35C8H 3D39E 1H5BA 3RWJA 2PTTB 4QRPE 2I25N 3BKCH 1LO2L 2W60A 2EC9T 3GUTB 4KI1A 4KROD 3FFDA 3EYFB 5LAXB 4DUXA 5DRWB 1TCMA 2XZCH 3A6OA 3BPLC 4JQIH 4OFKA 5SWSD 1JI2A 2YZ8A 5F7WC 3RKDC 3Q2CA 1QR1B 1HH9A 5CWSA 5C07A 5D2LA 3VH8B 4JDVA 3VFTA 1ZLWK 3QQNA 4DN4L 15C8H 4NFDA 2H8PB 2IQ9L 1NGPL 5JOPD 1DLHA 2CMRH 4UTAL 4HUXA 1CGXA 1FL5A 2BOBB 4M9PA 5E2VH 4OZIB 2NY3C 3L5XH 3AB0C 2XWJB 4KKNA 3O2DH 3AXLA 3KPRE 1X6LA 2C4FU 4WEBH 1IC7L 3MRJA 4F2MA 1HKLL 1L6ZA 2ESVA 4YGVB 4F33B 4U1KA 1SBSH 3BDYL 4HFUL 3MJ8B 3LIZH 3BXNB 3WDJA 4L29A 1DE4A 5F97E 4GG8B 3TWCL 4OZGE 4PTTA 2NMSA 4TUJA 2DKMA 4Y5XB 3GSNB 3R8BB 1YDPA 1JHKL 1T20B 2HKFL 3REWB 5JDJA 1AE6L 2FX8L 2FWOB 5AD0B 3D3VA 4NGHL 2PXYC 4BFBD 1HHKA 4TPRH 4ELMF 1NC2A 1V3JA 5JPNA 4YGVA 3E2HB 2EYTA 3MGTA 4GXUM 4TSCL 5IMMB 5IB2B 3BW9A 1DVFD 5D1XC 1DL7H 3MLZH 1HINH 4JFEB 3HE6C 1A6PA 2FRGP 3IJHA 3V4VL 1CXIA 2X4PA 4D9QE 3FMGL 3ARPA 4M62H 4XNUH 3S8WA 2FWOA 4NO3B 4U1HB 4HH8A 3SDCD 3PWPA 5DQJA 3KVQA 2YOCA 1ZGLM 4ALAL 1YQVL 4JFXA 1CD1A 3ALXA 3VXSE 4EKXA 4XP6L 4JY4A 4WW2F 4JFEA 3QUYA 3SOBL 4ODTL 5JMOC 3IAPA 4O2FB 2VLKE 1HSBA 4X4MA 1H0DB 3FHAA 4Y2DB 4C59B 5KSAB 4XHJC 3NIGE 1E4KC 1K2DB 2AJYH 5EORH 1VCAA 5ISZA 2ICWI 1QVOB 5GS2D 4NO3A 4U1HA 3CXHJ 4S1QH 5IK3B 4ZFOL 2A6JB 4LLYA 3ZYZA 2GUOB 4OD2B 3HC4H 4JKWA 4NBZB 3G9AB 5CEYA 1PD6A 2YPVL 3RWHA 2UZIH 1BD2B 5FM5O 2QLVB 1KLUB 5ICXB 3P2TA 3O8XD 4PJIF 2FIRT 1CBVH 4WENB 3DJ9A 2I24N 4FS0A 1DBJL 3GJEA 4LLWB 3F7RA 4JFPA 3C5SA 1A7QH 1CD9B 4PJHF 2A6JA 1CQKA 4HUKB 1JHLH 3MRQB 2VDQL 1D9KA 5IHUH 1NFDF 1PKOA 3VGBA 4DW2H 3CU1A 4HK0B 4HZLA 4ORZC 5ACMA 3D2UD 4LL9A 5IB5B 2R2BB 3OJDB 4M48H 4XCCH 4HQQH 1C1EL 5CSZA 2V17L 4JZOB 4N9GB 1T5XA 5DD5L 4HXAH 1PLGH 5E2TH 4UT7L 5E08L 2VRAA 4YDIH 5BRZB 3UJIH 1NCBH 3GSVB 1SEBA 3MODL 1XCQB 1LO3H 3LKQB 3NTCL 5F96H 4CU8A 4Z77A 4N68A 4I9WD 1BFSA 1F3DJ 2BSTB 4EDWL 3QHTC 5ALBL 3RTQA 2R1YA 2OP4L 5B38G 4K94H 2AVGA 4FFWD 3EOBB 1UM5L 1S7QA 1S9XB 3O3DB 5EBGA 1NUDA 1Z5LA 4YFEA 4I0PC 4PJEB 4WWID 2A6DA 3RIAF 4FXGA 4EOWL 4OIBA 3B5HA 3IU4L 5JIHA 2EYSB 2NPLX 5E4EB 4MA7L 3LKQA 2VN7A 2IG2H 3L6FA 2A9ML 2RAMA 3REVB 4S2SB 4OCRH 5F9JA 4C58B 3NPZB 1Q38A 5H37H 5C2BL 4M1GH 1IAOB 3OXRA 4L4VD 3VRLF 2OXHA 1T7ZA 3HUJE 2FATH 3QFDA 1CLZH 4HC1H 1KIRA 2BHYA 5KS9F 1IFHH 5EN2A 2JIXD 3QDGA 5HHME 3OB0K 2CDGB 4D9LL 3TN0A 4OUUB 1ZVYA 5CJ5A 2O5YH 3FFCD 3PL6C 5I73B 1RIUH 3VCLB 2Q86A 3OKKB 1UB6A 3WLWD 5D7JB 4Z76A 2IAND 5DMIH 3MR9A 3S37H 2W07A 3TJHD 1JPST 3ARVA 4QWWD 5CGYD 3SO5A 3L3JB 4KDTC 3F6LA 3EJYC 2Q7NA 1MUJA 5J12B 3SGKC 2AEIT 4M61A 4Z7WB 1F3JA 5D1ZB 4HKXA 2PR4L 2ARJB 3OAYH 3IDYB 1ZT4B 3M17B 4BZYA 1LE5A 3NH7H 3UO1H 5I9QB 2BDNH 4CVZB 1OD7A 5B38B 4M8QA 2V5TA 4E41A 3OKKA 4NKOB 4NRZB 5E1HB 1KN4H 4IIQC 2F5AH 5CEXB 2IPTL 4L9LA 2FO1A 2NLJB 1RFDL 5ESQA 4PB9H 1GHFL 3BEWB 5FXCH 2C3WA 3FO2A 2VXSL 3MV8B 3P0VL 2IFFL 5E5UB 3GJFH 4N0UB 2F54A 5I15L 1FVEB 4D3CL 1S7TB 1FYTB 3C9NB 2X4NA 1WIPA 3TM6A 3U9PL 1N4XL 4Y1AE 5A2KH 1LDPL 4KRPD 4QTIH 2FSEB 4ZNEE 4C57C 1N0XH 4KAQL 4KMTH 2Y6SD 5DJXB 5HHVL 1JYNA 4GRLD 3UROR 3FB8B 2W65B 3PWJB 4DGVL 4YWGL 4Z7VB 3CPLA 4WWKA 3KPLA 1QP1A 1A6AB 2J6EL 4X6DE 2H32B 5E5MA 3EOTL 5I66A 3C9NA 3K1DA 5JHDD 4YFLI 4LRIC 5HGDA 3H9SA 3C6LC 2QKIB 3FQTB 4G5ZL 2PO6B 3E8UL 4HS6B 4X5XB 1B90A 2BCKB 1E4XL 4JR9L 3P4MA 1A21A 1FV1A 4UT6L 1GRWA 1NJ9B 1CGUA 5KG9A 1C8PA 4JFDE 3QR2A 5C0AB 3RY6A 4JM2C 4FQJL 1HXMB 5DA0B 5LBSH 3PWUB 2LTQC 1II4E 4LIQE 3QRGH 5MHSE 3MTRA 4FQ1L 5I30H 5T1KA 4MQXC 3LEXB 3GMRA 1G9NH 4Z7VA 4YBLB 1KIQB 3EAKA 1F58L 3Q1SH 4MZ3A 2HP4A 1IGCL 4NKMB 4U1NA 4F37K 1A6AA 3MROB 3K8MA 2CLVA 4M7KH 2X4QB 4DQOL 3QEHA 5J9PB 3D18B 5GGSY 4NHUA 1G9MC 4KI5D 1E6JH 3BIKB 5EU6B 5HYIA 4NWUH 2D2OA 5HYFA 1QQDB 2X1OA 4C54A 5L2JB 4TQEL 2CXGA 4H8WH 4ZUWB 3WV0A 1QEWA 1SQ2N 3D39A 1CFQA 1A3RL 4MJIE 3T0WA 4QRPA 1CFTA 5IM7B 1BFVH 1EO7A 4GT7A 1G9NC 2GJ6E 5EG6C 1LILA 1ZVSB 3W2DH 4UV4H 4HKBB 2AJVH 5D7KE 5CP7B 3S96A 3BP4B 1HQRB 1ZTXL 1AR1C 3N9GH 3MLYL 5D6CA 1I8LA 4DN3L 2H9GB 4XVTL 1FL3A 2Y7QB 3UDWC 1J1OL 4F3FA 4JFFD 5DMGD 2DLHA 7FABH 1MLCB 4G8EB 4ERSL 5F7UA 1AXSA 3PWLA 3NCCB 5HYSA 1F4AA 4F8TA 5IM7A 1YNLH 3AREA 1AGFB 4RMVA 5IGXH 1FNLA 3MLWL 4QXUH 3RPKA 5FV1L 1A6TA 1FZJB 3KPRA 3T65A 4NNYA 4QGTA 5FV2A 3ROOA 5IMKB 4IDJL 1CK0L 4WUUE 2YA0A 1B9ZA 5C0RH 1G0XA 1CZ8L 3FAXA 1VGEH 4JDTH 2YN3A 4YHIB 4MDIA 2YXMA 4OLXH 3ZO0A 1RIVH 4OZGA 4XWGL 1ITCA 1J1PH 4JM2F 2AKRB 2BVPA 1XGUB 1DEEA 2DWDA 3ILQD 1RZFL 3QCUH 5SWSE 2YD2A 4LF3B 1UKTA 4R4ND 3QEGH 1T1WA 3GKWL 4HWNA 1IC1A 4NO5A 3D25A 3PABA 1U8LA 3BX7C 1D5ZB 3OR6B 3HKFA 5JOPE 1FZMB 1U8IA 5I1DB 5EA0H 1G6RH 3FO1A 4G6ML 5CJBA 3TBTB 1WFUA 4LLQA 4POUB 3SKJL 5F9OL 4BYHA 1YYLL 4Q6YA 2VLJB 3DARA 1X44A 3MJ7A 5CLWA 3IDNB 4PLJD 3MRGA 2AXJA 1OWRM 4D8PB 43C9B 1TMCB 2Y25A 4OCSL 5DEGB 3WDIA 1R5VA 2YXFA 1D5ZA 2E8ZA 1X5HA 1TJGL 3VXSA 4P9HL 4PJBF 5D96C 5I1DA 2VLKA 2NY4C 4P46D 3WHE0 3BQUA 1CN4A 1KV3A 1OD9A 4BZ1L 5FDYA 2N56A 4ONFH 2X44D 4XTRC 4ACPA 5IFHL 4YNYA 1JPSL 5EFIA 5EIIA 4JZJA 1DQQA 3D6GA 4PRPD 3OQ3B 4X6BB 4P2YA 3IDNA 1S8DA 1V7ML 5DVKA 3KDMB 3RGVB 2LAAA 5I74C 2FJGA 3DXAB 4CKVX 4PBWD 4J3SA 5KVEL 5FYLH 5F7NC 4G6JH 3IGAB 4H1LB 1I9RH 2ICCA 5DI8A 5GGTA 1JPTL 3E3QE 3JTSA 1DBBH 1J9CT 3QISA 4ZDHA 1ORQB 1NC4A 4NQSA 3F7QA 1NUNB 5CD5D 4J3WA 3M8OL 4L8BA 1BECA 3WHXB 4RFOH 4XH2A 2LE9A 3VWKB 3T3PE 5ICYA 4JHAH 2A77L 5A3IC 4FQCL 3VFUB 2KQMA 4HUWB 3EDKA 3WFZA 3TZVD 1DQML 3VA6A 2CO7B 3KYMB 3MV7B 5FEBA 5CJXA 2EEAA 1RI8A 3TP4A 1C16B 2L4OA 3HI5H 3IFNL 3QCTH 2ZKHL 3KG5A 3LRSA 1UVQA 4RNRB 4O9HH 3VXOA 5F9WC 1GH7A 4ZOCA 2PTVA 3DROB 3BPCB 4R26H 4F7TA 3UZEA 4PJ8B 3OKDA 4MJ2A 4PRDB 3NFSH 5AG8A 3OKLB 3WLBA 4HWBL 5JXEA 5GS0H 1SYVA 3I02A 5ABDE 1KG0A 4F80A 1WC7A 2DTMH 4S1RL 2YN5A 4Z7NE 2V2TB 1WWWX 4FNLH 4F57H 4YXLL 4OQTL 3ALWA 4N8VA 2VDML 3VXQA 5IKCA 3H0TB 1P5VA 1E4WH 3SQBA 3KYKL 1MJ7H 1FSKB 3S3PA 5D1QA 5J4MA 4LVEA 2IAMC 4ODBD 1SJEB 3GI8H 2CRIA 1A6WH 5JA9A 1GC1C 4LSQH 1UQSA 1JGLL 1FH5L 4XNZC 5JW3L 3VFWB 2HMIC 4RMQA 4HUVA 4LARL 3BGMB 5CSGA 4WU7A 1UT9A 4MJ5B 1UA6H 2QQKH 3OKEA 4P3DB 1OAKL 3HUJA 4LSSH 3M45A 4J4PA 3AMLA 5IMLA 4Q9BA 4Z0XA 1KPRA 3RDTD 4XPTL 2J8UF 2QSCL 4I9WE 2F8OA 1JE6A 1WIUA 3EO9L 1EFXA 2P24A 5D71L 3SO3B 2VKXA 5BVJB 4PYHA 1HKFA 4PJCE 4Q6IA 5J89A 4O5LL 2VL5B 3VJ6B 5C1MB 2ZUWA 3PP3H 4LCWB 4PJ9A 1B2WL 2W9DH 1JK8A 4HXBH 5ADOH 5IWLC 3T1FA 4ODWB 4YXKL 3MGAA 4P4KB 3SGJC 3QO1A 5EPMA 3FOLB 4OT1L 1LK3H 2AJSH 2BSRA 4OLYL 3GM0A 4QRQB 3QUMB 2A6IB 4ZD3H 2EDJA 1HHHA 2IADA 3WXVH 4YFLF 1EV2E 3Q6GL 4XAKE 5DEFA 1MHPH 1UZ6F 1EHLH 4YC2B 2AK4B 3EW3B 3QPXL 4KDVA 1WBYB 4KHXH 4L4VE 1MREH 4RQQB 5FECA 5JW4Q 4O58L 4NYLB 3V7MA 1HE7A 3IDXL 5CIPB 5DXWA 1IRAY 1RK0B 2NY7L 4N0RA 5DK2B 4UOW1 1NPUA 3WJJA 5TFSL 3SJVB 4PRIB 4XPGH 4I48B 5HYJB 4K2UH 1C5CL 2AABL 1ULVA 3LQZA 2X70B 1JFQL 2B5IB 3FFCE 3SE3A 3WN5A 3MRPA 2D7TH 4R90H 3ARFC 3W82A 1RY7B 1QSVA 4RQQA 3I6GB 5CGYC 1M7XA 1WICA 3BWAB 4GOSA 1RUQL 4M6MH 3N0PB 1TETL 1RIHL 2BXZA 4EJ1C 3GSOB 1QFPA 5DWUL 1OGTA 5CINL 4ZNEA 1KTLB 3HZVB 2P44B 3KJ6L 3TBSB 3X13B 3ZLQC 1AKJA 2XYCA 4Q58C 2IPKA 3BZ4A 3OJVC 3AMKA 4LPTA 1XF3A 4XPAH 1HYSD 4X99A 1KNOA 3LB6C 4YK4B 3G6JE 4X6DA 2RBLA 5J1AA 5JW4N 3C8KB 5F7YC 1ZT7A 4JPWL 3GSOA 3ECBA 1C5BH 3MXVH 1OAUH 2OJZH 4LSPL 4O51A 3HC0A 2FEEI 4M5ZL 5F1OB 4PRAB 3MA7B 1X5ZA 1OCWH 4JFDA 4KJQD 5J8OA 1P2CB 3L7EB 3GGWB 4U1LA 4Y16B 1T7WA 1CLYL 1QRKA 3I6LD 3OKOB 4ZFGH 5C0FB 5I71C 2VQUA 1HCVA 3WIHH 2JJSA 4Z0BH 2VYRE 4O2EA 2VC2H 5HHNB 2IEPA 5LCVH 1QTYT 2DTSA 3ESUF 1MF2L 3OTTA 1WFTA 4YXHL 1JZ4A 1DANU 4PJDF 5F70A 3G08B 2DLGA 4G9DB 3DWTA 5DHYA 3DV6B 3WD5H 1M71A 3L7EA 2F74B 3GGWA 4MJIA 3V8OA 2GIYA 5ITBH 4JREC 3AS2A 2HT4C 5FOBB 2JK5B 2QHRH 5JHDE 4Q9QL 5ECJE 3KPMA 5EC2B 4AIOA 2NY5L 5DUBA 3I6KA 4WTXA 1K4CB 1UACH 5TQ2H 1P7KB 2B0SH 3IKCA 1TVHA 2ZUXA 4Z5RA 4S0TD 4UV7L 2B8OT 3GB7A 3QDJD 3ULVL 4N0FB 4NDMA 1MJJB 4JO4H 3KR3H 2DL9A 4L8SA 1JPGA 4NZTL 4NN6C 4JFHD 5I8CA 4P5TC 1K6QL 2HLAB 4FG6D 4L3CB 3GSUA 1ACYL 4OFYD 2CJUL 3HI6L 3S4SA 5KANG 3JWOH 4JHWH 4MDJA 3CDFA 4OGXL 2FL5A 4KI5E 3QDMD 2ICEB 2HTLC 5L9DL 2EICA 1WK0A 5TPWL 4WUUA 5HHOE 4NBYB 4N0FA 1L0QA 1TVBA 3BSZH 1DSFL 2DQCH 1NMCB 3STZA 4U6HA 1F97A 3O6FA 2IC2A 2ILLA 1PVHA 5DGQA 4EUPA 2YK1H 4JN2B 3JWOC 1Q8MA 2H6PB 2YWYA 4OLUL 5DQDL 4KZEH 4PJFF 5SWSA 4K3JL 3BRFA 3S35L 1P7HL 3BPNC 4KKAC 4M7ZB 5ICZB 4AZ8A 4JFFE 2FEDD 3MMEB 1P84K 1MH5A 2ZUUA 2HWZL 3FONA 4PRHD 3EDDA 3OKMA 4OF5A 4OLZH 1N5YH 5L7XH 1YEIH 5IG7B 3U46A 1HWHB 3LH2L 4HJJL 2DQFB 3QYCA 3O0RH 3MNWA 1TZIB 2HFEB 4XMLL 4G8FB 2ZCKH 3G04B 3TVMB 1IVLA 4AMKH 3CSYA 3UTTB 4XC1L 3VWJB 3SDDD 2XRAL 2Q8AL 1S78D 3DYOA 1NFIB 3MMEA 3MO1A 4Y88A 4RGMB 4S1SL 4GXUN 1BZ7A 3ABZA 2WP3O 3QIUD 1VKXB 2DM7A 3DIFB 3QJHB 1ZT1A 3CVHL 3MFFA 1PJ9A 2X4TA 4R9HA 4RAVB 1XF2B 4BUHA 1E27B 4NWTL 1EPFA 4QCIB 4HDIB 2Y72A 1H8SA 1DVFA 1JZ6A 3LSOA 1CTNA 4GBXC 1VADA 3UYPA 2WLYA 5AG9A 3G5YA 1FZKB 4LFHG 5DJAA 2EDBA 3RVUC 4DN4H 5DQ9A 5HD8D 2IQ9H 1NGPH 2BNRD 1ZA6A 1JTOA 4UTAH 4GAYB 2V2WA 2O61B 3SDCA 1U41A 1NGYB 2DBLL 1EIBA 1KLGA 1IC7H 1XR9B 1HKLH 3RWDA 1KJ3L 3BDYH 4HFUH 4LLDA 5F3BA 3Q3GB 4YDLB 2OQJA 4NFBA 1LEIB 2EIBA 3TCLA 3GMPA 3TWCH 4Y4KC 1FO0B 2DI8A 4PRPE 5IV2A 5HGAA 1IEBA 1H3XA 1MNUL 4NFCA 5TDOA 3SE8L 5EH1A 1JHKH 4X9FA 3I50L 2HKFH 2E27L 3ARZA 3GMLA 1AE6H 2FX8H 4RDQG 1RV6X 3L3IB 2Q76B 3QUML 4RRPA 1RK1B 2OJEA 2XA3A 2ZG1A 1I3GL 4NGHH 1CT8A 5IVZA 5CGMA 4YHPB 2UZXB 4JB9L 1U8JA 5F7DA 4ZAKB 2P5EB 1S7VB 1MEXL 4ODUB 1IQDA 4TSCH 1T1XA 4NZRL 3FCTA 1KB5A 5FK9A 2GI7A 3O8XA 3LVEA 3H3KA 2GFBB 3BD5A 3DUUB 3C60D 3ARDD 3TGXA 3NFPA 4C56D 3V4VH 2AJ3A 3MOBL 3DGGB 4BH7B 3FMGH 2N4IA 3TA3D 1NFKA 2FB4L 2C3HA 2DLEA 2Q76A 2A83B 3PDOB 5DJCB 3VFMA 3B6SB 5EZJA 4U1IA 1FNAA 1UFUA 4BQ9A 1LMKA 5ETUA 4OZ4A 2E7HA 2DIJA 4P9MH 3QEQB 4XNYL 4ALAH 1J8KA 3O9WB 2N7BA 1YQVH 2KH2B 3C8DA 2UY7A 1N0LA 3D2UA 4XP6H 2GFBA 4QGYA 3SOBH 4ODTH 2W0FA 1JVKA 1H9VA 2IMNA 3M07A 2E7LA 3X17A 4KKBD 2W1NA 2E5EA 5FGBC 4ELME 5FFLA 1RUAL 3U9UB 2P8LB 4OZFB 1FE8L 2DYPB 1UM6L 1CICB 3I9GL 2NNAB 4DUVA 3I2CL 5E1AA 1IEHA 2VDKL 3O2VL 2R2EB 2CDEA 5DZOA 3V5DA 2YPVH 4PGBA 4G6FB 1ZE3C 5F6IC 2NX5B 2W38A 4PJCA 4Y19D 3W0WB 1CDUA 4PGCB 2HT2C 1P7QA 4BKLA 1IGML 4D2NA 1DBJH 3V5KA 2DYPA 2NNAA 3F12A 4FQLL 3PHSA 3VGGA 3ARGB 1UYWL 5D6DC 1FAKT 3MRCA 2P7TB 3GSRB 3T8XA 4HS3B 4XB7A 2VDQH 1U8NB 1XGPB 5C0CD 1S7XA 4RISL 1HEZA 1RUML 4EIZC 4MD4A 4L4VA 3VFNA 2GK2A 3RVTD 3OAZK 3W0WA 4PGCA 4CVUA 3RZCC 1ZS8B 1KT2B 3WFCL 4A2MA 2V7HA 1C1EH 1YEJL 3RDTC 4B5EA 5IVOA 2V17H 2JIXA 5BCAA 5DD5H 3S98A 4R0LA 4N5ED 3ZKQD 2B1HL 1UEYA 4JFYB 2P7TA 1AO7B 2NXYD 4UT7H 4HS3A 5E08H 5EOCJ 1U8NA 3RWCB 1A64A 3SBWA 2QV2A 3FFCA 5CZXD 3MODH 2OTUA 4PJIE 2J5LC 3BVNB 4X7TA 3NTCH 4HV8B 3QSKB 1CFNA 1F4WL 2PYFB 1UB5A 4KV5F 3ULSA 4EDWH 5JZ7C 5ALBH 1KUMA 4JFZL 2OP4H 3Q0HA 5C0JA 1H15B 3CUPB 4KJPD 3IRZA 1R3KB 3OXSB 1UM5H 3RPIA 3ZE2F 5CJOL 5I17B 1IBGL 4X6FB 1U8QB 4EOWH 1NFDE 3IU4H 4EVNA 1I75A 5H2BA 3TLRA 4JHZA 5DTFA 3UTPD 4CW1A 4W70A 5CJQL 1H8NA 3C6SB 4MA7H 4K7FA 5DFVD 4HV8A 1HI6A 2NY2D 2PYFA 5EUKA 1I85C 1MIML 2QTEA 3LKNA 4LKCB 3TBVA 3T0EE 4HEME 3DUSB 5I1LA 3CZFA 5C2BH 5L0QB 1W0WB 2VITA 1ZAGA 3V9FA 5KVDL 4G6AD 4J1UB 5HBBA 3NN8B 1T89A 4N0YL 2H1PL 4LNRA 1EAPA 4NJ9L 1MFAL 4Z8FL 2WWMD 1U8KB 2AQ2A 2IALA 3TEUA 1XIWD 5C9JB 5GRXG 4D9LH 4PV9B 2FGWL 3F58L 4LKXB 1A5FL 5FA4B 1FFOB 5DRXB 3F62A 1SJXA 5GGSB 1GAFL 2BHZA 1G7MA 1OVZA 1AHWA 4I18B 4U6YB 3AS0A 4FTVB 3MRDB 4GRLA 2AJUL 2VSDA 4J1UA 3FQNB 3JTTB 4NN7C 3WUWA 5DK3A 4NNXA 4JPVL 5LGHL 3B9DA 1QD0A 4ZFZA 1I1AC 4MWFA 2X4SB 3PIQB 2E8YA 2PR4H 1O7SA 1RAMA 4XNMB 5IBTL 5JHDA 1I3RB 5LJYH 3GMQA 2OLDA 4LSDA 4AJ0A 5F93C 1WBXB 1CGTA 2DWEB 1G7JB 2ADIA 4PY8I 1OSZB 3N50A 2EKJA 5I6XC 3VE0A 2PUQT 4MNGB 3QEUB 1ZHLA 2IPTH 4FTVA 3MRDA 4EQ2A 1G7HA 5CUSL 3QIBB 3I6LE 1RFDH 3O81A 2Z92A 1TPXC 3GHEL 4KVCL 1GHFH 2X4OA 2Q7YB 3MUZ1 2ED8A 4LK4A 5IROC 3CC5B 1JGDA 2VXSH 4JZNB 1JGEA 5GQBA 3P0VH 1IKNA 2IFFH 4XNMA 5GS0D 4MHHI 1I3RA 2X7LA 5GGVY 5I15H 3N1GC 5EO1A 4D3CH 1A4KA 1OSZA 3DRQA 4U1JA 1MCPL 5E94A 4MNGA 3U9PH 5HHOA 1N4XH 5E8PB 4CMMA 4Y2OA 4OGZA 3Q5YA 1LDPH 5E6ID 3V79C 4X4YB 5JIKA 1N6VA 4JQXC 1KGCD 2CIKB 2ZWLT 4KAQH 3QIBA 2WNGA 5HHVH 1OWWA 5T3XD 1OLZA 3IS0X 3IB4A 1LGVA 1IGIL 2HVJB 2OI9C 4XNXL 4OJFL 4DGVH 4YWGH 4MLIA 3NCYS 4IRZL 3ZDXF 3DMMB 2VSCA 1FVDB 2HRLA 4PJGF 3HE7C 4JFHE 2J6EH 2VXQL 3LS5L 1FNHA 3EOTH 1Q9WA 4JFFA 1MWAL 3OF6D 2YRPA 2VXTL 3IYLW 4YJZL 3LY6A 4G5ZH 3E8UH 1OAYL 1FO0L 3GSWB 1E4XH 4UIMA 4JR9H 3BP7A 4NT6B 4UT6H 4X7SL 3LCYA 4FP8L 5JLZB 5L8JB 3MLTA 4KGLA 5D5ME 1SYSA 2QSTA 4FQJH 4XCNA 5F1NB 5SWZB 3D69B 3QDME 3SGDI 1FAIL 4NPYA 3TFKD 4FQ1H 3TO4B 25C8L 1C08B 4D0CB 1LVEA 1KCLA 1RUPL 1Q9LB 3TBWB 1U8PA 1F58H 2ARWA 2E7MA 3CLEL 1UCTA 4HUNB 1IGCH 2ICWJ 5F8QC 5FGCB 2IH3B 4NCC1 1VFAB 3EZJB 4ONHB 4DQOH 1AP2A 1MCRA 2Z93A 5A2LH 4AEEA 3CH8A 4QY8A 4PJ5D 2XKNA 2XTJC 4HWEL 4TQEH 5F7LB 2B20A 5IEKA 4AT6B 4MGXA 3GO1L 2HH0L 2XN9B 1FLTX 3OX8A 1A3RH 5TGBB 1TNMA 5HVFB 3OKNA 4ODHL 3HG1D 3WYRA 5I1EL 1KJMB 4LPVA 1AFVL 1S9YB 5A43C 4YHZL 4PRHE 1JPFA 2QJDA 4QRSA 1PDKA 1QLFB 1ZTXH 3PWNB 3MLYH 4ONHA 1LD9A 4DN3H 2P5WD 3VGAC 4XVTH 3U0PB 3C5JB 1H3WM 5DJDB 1J1OH 1Y6MR 2ADGA 1R3IL 4JLRA 2R0ZL 4ERSH 4V2BA 3UTZA 4AEIH 2MPAL 3B9VA 4OGYL 3MLWH 2D7QA 2UYLA 1BJ1H 4HX1A 3EFFB 2R1XB 4G80B 1F8TL 5ACZB 2NXZB 5A2IH 1NMBL 4IDJH 1CK0H 5EZOL 3T0AA 3MREB 4P46A 1N2RB 1CZ8H 1LO0L 5DJDA 5LVEA 1MCIA 1OAZL 4HIXL 3PJSB 5DURD 1S7RB 1NDMB 1FFPB 1XGQB 4P2OC 1IKFL 2I07A 2OTPA 5HYSG 3MRMA 4XWGH 3FO9B 4PRPA 4LBEA 1RZFH 1HHJB 5I1HL 4MNQD 2EIZA 2HTKC 1L7TL 3EFFA 4ETQB 1MFBL 1N7ML 3BE1L 4G80A 3BN3B 4L4TB 3GKWH 3RWEB 4LHJB 5DF0A 4UDTA 4GQ9L 5HD8C 2P46B 3B43A 5FA3A 4DOHE 4GKSB 3O3BB 1JV5A 3JXAA 1ZGLP 3CD4A 4G6MH 3UYRL 2YZ1A 2XFXB 5BV7B 3PXJA 3SKJH 5L6YL 5F9OH 5MEOA 4IRJD 5CEZL 1YYLH 1GIGL 4IS6A 2MMXA 3ARSA 3QUZB 2V6HA 2X2YA 3RNKA 1L9NA 5FHAL 4H25A 3TZVA 5SWQB 2HT3C 4UT9L 4OCSH 4WDIA 4RGNB 2I60L 1J8HB 4LHUB 5HVGB 4ZUSB 1TJGH 4P9HH 5HJ3A 1I9JL 2AK1L 3CMOL 4MXVF 3FB7A 2NY1C 1LP9E 4WHTA 1FCGA 5FO7A 3L3GB 4BZ1H 4QOKB 1FFNB 1CL7L 1JPSH 4IEFB 4V1DB 2SEBB 4ELMA 2X42A 3BPLB 3W39B 3MV9B 3QUZA 3MYZA 4V2CB 5HI4C 3KNBB 3CX2A 3B2UC 1V7MH 1NH6A 3V6FB 5FYJL 3WIIL 4PLKD 3JZ7A 2C3GA 4WI5A 3ARDC 4C56E 5J13C 5GJSL 5KVEH 4PG2C 4P9HC 1OTUD 4XCYA 1S7UB 3OGOE 2NY3B 3AB0B 4EN3D 1JPTH 3QG6A 2VUOA 2ZNXA 3NZ8B 3M8OH 1J18A 5DJZB 1CFSA 4E0RB 2B7DT 2PTUA 1QFWM 2WMPA 5C0BB 1CGSL 1XR8A 3EO0A 3CSPA 5JUEL 3ARTA 2G5BB 4WVRA 2A77H 5IW1B 4PJBE 4WW2A 4MQ7B 4F7EA 4FQCH 4WHYG 4TNVF 5J1SC 1M7IB 3VGHA 3ROLB 4KKBC 4RBPK 4TUOA 3RWFB 3BESR 1DQMH 3MLUL 2VO5A 1KFAL 1H8OA 4I3SL 1P1ZA 2PXYB 3IFNH 3QZWB 2ZKHH 4HMEA 3VXNA 5IESL 4PJHB 4F9LC 2XWTB 4R7DB 5I0DA 2FECL 1OGAD 1NLDL 1R3JB 5D1XB 3BKYL 5DJYB 2VDOL 3HE6B 3RWGB 4KKCD 4Y19E 2OR7A 3MBEC 4PGZA 4DZ8A 2ARJQ 3WE6A 4K8RL 4HWBH 3MNZB 5FF6A 5BQ7B 4OUOA 4PJIA 4EDXA 5I16B 3O2DA 5L8LB 3R1GL 3QZWA 4PJHA 4S1RH 4BSJA 1S5IL 2QADC 2W0PA 2YPLB 3CFEB 4LLUA 4KK5C 5GISL 1HYRC 4YXLH 5C0CE 4OQTH 4J23A 2VDMH 4RIRB 4QHUB 3HE6A 1T66D 1XGTB 3KYKH 1NFDA 2CUHA 4YBQD 1TQCC 5HDLA 2MQ3A 4QXTA 4JEGB 5BOPA 1FJ1B 3AY4C 3TIDA 4X4XA 4NKDB 4Y4FD 1UCBL 1JGLH 1FH5H 5JW3H 3T0EA 2GT9B 2NXYC 4GKNB 3KPOA 4LARH 2GK0A 1YJDL 4PJEF 2VDPH 3QNXA 5TDPB 3WS3A 2DM2A 5C86A 1OAKH 4D0DA 4TTDC 3MRKA 3MFGB 3KS0J 1XGTA 4R2GD 4XPTH 1I8MA 4LPYA 3EBAA 3NZHL 1BGXL 4KJPC 3EO9H 4Q9CA 4ONGL 5D71H 5IOPB 1A1OB 2ZOLB 2H32H 4K9EL 4O5LH 4UNUA 2WINA 2Z31D 2F8VA 5E8OB 4HHAB 2XT1B 3C2AL 1B2WH 5GSRB 2APFA 2BVQA 4JO2L 5KS9B 2P8MA 3T3MF 1MHHB 4YXKH 3T2OA 3RUGE 4OT1H 1VESA 4OLYH 3T2PA 2G75A 3PHQB 4U31A 3UTPE 1OOAA 4P5MB 5C0GB 4F9PA 1YEEL 2IBBA 3Q6GH 1JIBA 2ZG2A 1IC5L 2NY2C 3I75A 1QHOA 1GCFA 5SV3A 1X5XA 2P48B 3C5ZA 3OMZA 1W0VA 3QPXH 2YUXA 3FB5A 3L5WB 1QFUL 3DTXB 1DBAL 2LABA 1CLCA 4O58H 1T2XA 5E8OA 1HHGB 3KPNA 3IDXH 3P3YA 3QUXC 2NY7H 3QA3B 1U8OB 3VXUD 5KOVC 3VDCA 4LOUD 1ZLSL 2J8UE 3HCVA 5TFSH 2C7UA 3P73A 5BS0D 3K81A 2C1OB 3TBYB 5FYKL 1C5CH 2AABH 1IM9B 3WXWH 1CQYA 4OV5B 3T0VA 1JFQH 3BZDA 4E42B 4WTWA 1ONQB 4XGZB 4O2CA 2VIRB 1NANI 3ZE0E 3LN4B 2B1AL 4RMTA 4M3JA 5C0ND 3AS1A 4QHKI 4MAYC 5IR1A 2IH1A 3WJLA 2KZ1B 1LE9B 3OGCA 5TH2A 3O4LB 1RUQH 4FQIL 2VISA 4I0PB 4ODXB 1CS6A 1TETH 1RIHH 5DWUH 2J4WL 3IETA 4APQD 3E6FB 4MB5A 4CADA 5CINH 3ZKSD 3VRIB 4PP2A 5HHXL 1FVCB 3KJ6H 2VLLA 2H2SD 2YSSB 2QR0A 3RX5A 4NO2A 1K4DB 3BRDA 5DRZA 1LO4L 1MCBA 1I7RB 5JXAL 4HW6A 4NQDB 1DDHA 4MSWB 1IEAA 1K8DA 3D85D 5A1AA 1R3HB 5J7CC 5EU3A 4M43L 2FO4A 1ZANL 4JPWH 3HMXL 4YPGB 1A47A 4OFYA 1YNTB 4LSPH 3QFJB 1H3VA 1LNUA 4M5ZH 1WV7T 3VI4F 5GS1C 1FVCA 2D3VA 3QDMA 5EOTB 3PL6B 5FYJU 1CLYH 3GIVA 1UZ8B 3WL9B 3W11D 2VQ1A 1T1ZA 2EKSA 4LPUA 3CDGA 3SY0B 1KGCE 4YDVB 3QIWD 1R3HA 2JKXA 3B4NA 5I1KL 3JV0A 1F02I 3GKZA 1MF2H 3SDAC 4WJ5B 1LDSA 1B0GA 1M05B 4YXHH 1L0XA 2G5RA 3U30C 4Y4HD 4EI5D 3LN5B 1NCNA 3MGOB 4UIKL 5CBAB 3VRJB 3KWWA 1MPAL 4Q9QH 3TPUB 2NY5H 1C5DB 3ZDYF 1EHNA 4IIQB 4YE4L 4YHNB 2NY6D 4PRHA 4WO4C 1K3IA 2VWEE 3GMMA 4UV7H 3ULVH 4HC1A 2BSSB 4KDTA 5TDNA 1MFDL 5C0EA 3X11B 5CFHA 1I3VA 4NZTH 3ZSTA 4PLOB 4TVSa 1ZLUH 1MCOL 1EGJL 1K6QH 3DSFL 5K59F 1ED3B 2HLFD 5B39B 2XTLA 5CBAA 1ACYH 2CJUH 3HI6H 4WHCA 3SDDA 4EI6B 3O41A 4OGXH 6CGTA 4NUJA 2C1PB 2APWA 2COQA 2UUDH 4ZPVA 4JRXD 3RIFF 2R69L 4YHNA 4PJ5E 5L9DH 4PJDE 3QIUA 2K7PA 3TNMA 4MNHB 2BNQE 5TPWH 1JUFA 3KLDA 1JTPA 2BSSA 5JW4R 3UBXA 1DSFH 4QT5A 5CBEB 3MRLA 1RD6A 5E9DB 3HG1E 2FIKB 4IRSD 5IB4B 3LDBC 3S4SG 5J06A 4MB3A 1S7SB 5L2KD 5B39A 4GUPA 4X9HA 3UPRB 1R3LB 1AY1L 1JZ3A 1AGDB 4OLUH 5DQDH 2P5WE 4ZS6C 2ICWB 2EE9A 1MI5D 1TTFA 4K3JH 1OTSC 3C6LB 3S35H 4X8JB 1KJVB 3X14A 1JN6A 5SX4H 1WFOA 5DSCA 3MNVB 3S5LB 3UTSD 2EDRA 3MRNA 5JPMA 1M7DA 1EEZA 2HWZH 2ZUVA 3QI9D 4JM2B 4P23C 3RVXD 2LTQB 4MCZB 4EUPG 1CE1L 4E5XA 4HJJH 3LH2H 1S7SA 3GJFA 3VI3F 4XMLH 5DMKA 3HRZB 2GY5A 2FJHB 1INDL 4AEFA 2GKIA 5IFJB 3IXAA 4LRIA 2CDFB 4OCLC 4XC1H 4HZAA 4JQVC 3VXPA 2XRAH 3MYJB 4HSQA 2Q8AH 1KJVA 4IMKC 1GGTA 1OM3L 1JRHI 3S5LA 1FPTL 5T5FL 3UJJL 1GJIA 4YHYC 5HI5C 1NAKL 3AVEA 4UU9B 4NQVB 3CVHH 1LEKB 2X40A 3RWIA 3GIZL 3H7LA 2LU4A 2PYED 1VFBA 3OSKA 4NWTH 3MX0A 4WEMB 1OB1B 3MRRB 3MLSL 1YA5A 1D5BB 3AM8A 3V4UL 3L9RA 1HXYB 1U2CA 4MQTB 3ULVF 3C60A 5C07D 4ZXBC 4PR5B 3TA3A 4HFWB 5DYOB 4XBEL 3OR7B 1T0PB 3MUGB 4NQXB 4JKLA 5AYUL 3KPSB 4XWOC 2D0FA 3CXDL 3OAYK 1NDGB 2ED9A 1IM3A 3QNYB 5B8CA 2DBLH 1JHTA 1D5BA 3RY5A 1KIPA 4PY7B 1HXYA 2NTFA 4PJBA 1KJ3H 3F5WB 2YHGA 2GSIB 1VA9A 1ZHNB 4X0KA 2BC4B 2AP2A 1DUYA 5DFTA 4QEGA 4HUMB 1X5LA 1MNUH 3SE8H 1TZGL 4AQOA 4U6TA 3GJFK 4I2XB 5JOEA 3I50H 2E27H 3QNYA 2KUTA 2XQYK 4Y8AA 3QUMH 5E8NA 1BVKB 1X5KA 5EOCL 3K8LA 2MOVA 4JB9H 5EUOE 2CD0A 2WBJC 4HJGB 4PY7A 1MEXH 4TRPL 4ZUVA 4NZRH 1UEMA 4Y19A 1R5IB 3SDXB 4MZ2A 1ZHNA 1ORSA 1F3DH 1IAKB 4A6YB 5FUCC 5ID1B 4AEHL 1F42A 4FRWA 2XNAA 5CIPH 3MOBH 3OB8A 4P4RB 2J2ZA 2FB4H 2JCCB 1CF8L 2ZPKL 4BSWB 5C0CA 3SCMC 1T4KB 3FQXA 1DP0A 1UWXH 2F19L 5D96B 3ZT6A 5KANI 4XNYH 4FQXC 5BXFA 1NCCL 1YEFL 3QJFB 2NY4B 4MX7A 4ZUTB 1FC1A 3JV6B 4JFED 5MERB 3QUYD 2V5YA 4R4FL 1S3KL 1AGEB 3C08L 3X12B 4P59L 2DQTL 1KXVC 5F7MC 1CVSC 3L95B 1KCVL 1CIUA 3EYVB 4JANB 1RUAH 1HQ4B 5I74B 1FE8H 3CJJA 1UM6H 1BIIA 3I9GH 4D0BA 4LLAA 4PTUA 1T7YA 1LO3L 1T4KA 2P8PA 3I2CH 3BZFA 2VDKH 3O2VH 4B7LA 1G6RA 2EIDA 5E99L 2DD8L 3A0OA 3L3DB 4DWHA 5MERA 4J8RA 4ZPTA 2VE6B 4GRMB 2V9TA 3ZYIA 4Y2DD 3ILPB 4RMRA 5KSAD 1I1FB 2KL6A 3SKOB 3U0TB 1ZHKA 1SVCP 2M8XA 5MI0C 2NTSP 1UXSB 1YEKL 5C0DB 5H94A 1IGMH 4UUJB 3GDBA 3B9KA 3RUGA 4FQLH 3QUKA 5IP4A 2EDHA 1UYWH 3EOAA 1MCKA 1A2YB 3S37X 2DMBA 1BD2D 3EKCA 4Y4FC 1KF9B 4I4WB 4MMZC 3UTQA 4RISH 2AW2A 2EE3A 3K4AA 1RUMH 4G8GE 3GMNB 3ILPA 2YS4A 5F9WB 4Y5VA 2FATL 3U7YL 3WFCH 3WSQL 1YPZB 1YEJH 3T1WA 1RSFA 4OM1L 2J8UA 4HG4K 1DTUA 1XIWA 3DRTA 5B3JE 2VUYA 4IOFD 2B1HH 1QR4A 2NW3A 4KKLD 4KVNL 2Z31C 3ESVF 2XOTA 1PYWB 2MFNA 4I4WA 3STLA 2OCFD 1HSAB 2R9HD 1GGCL 1QFWI 1F4WH 2GSGA 1P4LA 4JFZH 3B5TA 1VFUA 2OSLA 2HJLA 3ARBA 4OLVL 4OV6F 5IT2L 1I8IA 1NLBL 4L8CA 4GRWB 3RZWA 5CJOH 4YZFF 5A16A 1IBGH 2IAMB 1XGRB 4HPYL 4LAQL 1A1NA 3RGHA 4G6KL 4PJAB 4NJAL 3S6CA 3BISA 1EXUB 5CJQH 4XBPB 3CFJB 4XNZB 5CMAB 3VXUE 5INCA 3G9VA 5K93A 1T5WB 1MIMH 1HOCB 1XGYL 5BS0E 5IIEB 4WFGD 2R15A 4FQQA 1VACB 2VR4A 5KVDH 3MSPA 4PJXB 4QHMB 3B9AA 3PV6B 4N0YH 1I4FB 4U33A 2H1PH 3CX5K 1T03L 2R2CA 1MFAH 4Z8FH 4KV5E 4M1CD 1T0MA 4MD5B 2I9TA 2XXMB 3L5JA 2EXWC 5GS3A 4C4KT 3KJ4C 2FGWH 3F58H 3L7FA 4JRYB 1HCFX 1A5FH 3MQIA 5E6IA 3ZE2E 1T2JA 1GAFH 5KN5A 1LK2A 1KTDA 3MACL 4KK9D 3T4YB 4ENEC 3A6CL 1GZPA 4XAWL 5K33A 4BFGA 3GMOB 4JY6B 1VACA 3ZTJH 2AJUH 3HPLA 1BQUA 3O11B 4POZD 1IAII 5HYQB 4HAGA 1WGOA 4JPVH 5LGHH 1RURL 3BMVA 1G7QA 1Z3GL 4FQHB 5IBTH 2X4RA 2R1WB 1G9ML 2CH8A 5KSBB 5D2NC 1HDMB 5D7JD 3BIBX 5GSVB 2HN7B 3SKMB 1N5AB 2FH8A 1JWUA 4DGIL 4JGUA 2H2PD 4O00A 5C09B 2BVTA 3TC9A 4KQ4L 5CUSH 2JJVA 3NIFF 5MP6L 1N26A 1T21A 1N59A 3GHEH 2MSPA 3ARFB 2E9IA 2IANB 4KVCH 4PJ7B 4TNWF 3JV4B 2IQAB 2F54D 1T1YB 5ESVB 1EMTL 4OZHB 2PW1B 3HR5A 3BPOC 3PDDA 3LPWA 5T1LB 5KVGL 4PJ5A 1QSEE 4PJDA 1MCPH 2BNQA 3VMNA 2K7QA 4WI3A 2A0LD 3FN9A 2X1PA 3VG9C 1WEJL 2Y5EA 2G9HB 2J8OA 1YZZA 3MOQA 3HG1A 3W2DL 3EHBD 3LEVL 4OF0A 5I1GL 2AJVL 2F53E 1D5IL 3HAEB 2AJZB 2YKLL 4K7PY 2X05A 3MV8D 4HIJB 3JSSA 3IJSB 1IGIH 2FZ3A 4XNXH 4OJFH 1VEPA 3KLAA 4K7PX 4IRZH 5FGSA 2P5WA 5DJ0A 3UJTL 4WWKD 4LSTL 1RU9L 1FYTD 1JWMA 4PBVC 5F21B 3IFPB 5T1LA 4KZDL 1BFOB 2DBJA 1F2XK 2VXQH 2X6MA 3LS5H 4L8DB 5GRUL 1MWAH 4KXZH 1AC6A 2UWEB 2VXTH 1FG9C 1I7UA 4KGJA 1OAYH 5DHXB 1FO0H 1K8IA 2AXFB 4FP8H 4X7SH 3G5ZB 1EERB 4DZBB 4WTZA 4PJFB 4JRXE 5I71B 2FLRT 5FM5M 1FAIH 3LKRB 3CSBA 25C8H 4P3WA 3UCRA 3LMJL 1RUPH 3F7VA 4GKZA 4CVXB 3KPQB 5K9KA 3CLEH 4OLXL 1HHIA 4LLVA 3PGDA 1J5OL 4RFEA 1BFOA 3HR6A 3DX9B 4QF1B 3VFRB 1NBZA 2GITB 4X98B 5L2KE 4A6YL 4UOW0 3HI1A 3L3KA 3AUVA 1JNLL 3N1FC 1A4JB 1RZKC 2C4FT 4EBQL 5C0AD 2D7NA 3D39D 4HWEH 5BZWB 2MJWA 2HG5B 4JREB 1MI5E 3CH1A 3ZDXE 1NAMB 3GO1H 2HH0H 4UQ2A 5DS8B 4QXWA 4PJGE 4ODHH 5I1EH 5CSBA 1UJ3B 1UH4A 4PGDB 5H8DA 1GSMA 5KSUB 3UTSE 1AFVH 1R5WA 4JGMA 3KPQA 3HPJA 3PP3K 5AUMB 4YHZH 4XBGA 4NN6B 1IT9L 3BJ91 4P5TB 3IFOB 5A2JH 4R97C 4KQ3L 1FNGA 5B4MC 5E6YA 1R3IH 1CCZA 1U3HA 4IRJA 3S3SA 3BZEA 4ZG1A 4NZDA 8FABB 3G5VA 4F7MA 2R0ZH 2Y9RT 3U6RB 3WIHA 4XZUB 4OZFH 1BQLL 2MPAH 4OGYH 2ZOKA 1QO3B 2R0LL 1DQJA 1UJ3A 4GQPH 1UKSA 2GW5A 3PHOA 1F8TH 1WBZB 1H5BC 2R0KL 1AH1A 1NMBH 5EZOH 3H9HB 1WT5A 43CAB 1LO0H 1MRCL 1OAZH 5D7LE 4X6CE 2HFGL 2PYEE 1IKFH 2DQIL 5J1TC 5KW9L 1MIEH 1JJUA 1S7WB 4ODVL 1JCKA 3U6RA 3BPNB 5IJKC 3HNTL 3RX8A 2NZ9C 5I1HH 2V7NB 1FGNL 2DKSA 5C07E 1SY6L 4XRCB 1L7TH 1X3DA 1MFBH 1N7MH 3BE1H 2ZNWA 1QUNA 5IBUB 5EUOA 1WBZA 1QKZL 4GQ9H 3H9HA 5C7XL 2D31A 4H20L 4EN3A 4TVPD 4X5WB 2C3VA 2H3NA 3RBSA 5ESAB 1IL1B 1JZ2A 4UBDC 3GSXB 5GZND 4NRYA 4BFEA 3UYRH 2CLZA 4K3DL 3QT2A 1PGRB 5CEZH 1GIGH 1W72B 1ZGLB 3DVGA 4NQCB 5HHQA 5FHAH 4GAJL 1G7IB 5F1IA 2N7AA 5EU5A 3DV4A 5GGVL 4UT9H 2ADJB 1W0YT 2I60H 3ES6B 3U7WL 1DQLL 2EDXA 3HA0A 5J6HB 4AQ1B 4OZIE 2VLKD 1I9JH 2AK1H 1QZ1A 2ITCB 3B2VL 2VB5A 3CMOH 5BZDB 1EDQA 5MEPB 3V4PL 1MCJA 3WNOA 3VFVA 5EWIL 1CL7H 2VLJD 1HIML 4NM4L 4GBXB 2PW2A 1E28A 1YY9D 5FDWA 1QBML 5HHPB 3CU7A 2FX9L 5IHZB 5FYJH 2AV1A 3WIIH 3SGEI 2Z8RA 3MJGX 5LXGL 2YUWA 4ZOBA 4NSKA 3KYOB 5D9SB 3ULVD 1GC1L 1IGYB 4RMUA 1U92A 5GJSH 4GMTL 2GYSA 3HZKB 2Z8SA 5JOFB 3KLHD 1N3NA 1BZ9B 1X5GA 2R4SL 2CQVA 4PRBB 4P2QB 1U95A 4PY8J 5D2LF 2GAZB 5I0ZA 1OAXL 4JFEE 3QUYC 1CGSH 5GRVK 1CE6A 3RGVD 5JUEH 3HC3L 2XZQL 3DXAD 5GIRB 3G6AA 4H26B 1VENA 4MXVE 4Y4KB 2RFXB 2BJML 3E6HB 1T80A 4ZUUA 1FZOA 3MLUH 1O7VA 3Q5OA 2QQKL 4G8GA 1KFAH 4RDQF 1XF5A 1A9EB 1ZHBB 3OWEA 5T5NG 5C6WH 1S9KC 3Q48A 3B3IB 5IESH 5DD6A 5KOMC 4HCRL 3LV3A 3VWKD 1NLDH 4YAQA 1BQHA 3EO1A 3IDJA 3BKYH 2CRZA 4Z95H 2VDOH 1YMHB 5EO0B 3FAWA 4BFIA 5JXED 5HVHC 2W9DL 4K8RH 3BT2L 3IJYA 4NC1C 3MV7D 4TOYL 4G42B 1BF8A 1X5IA 1JYVA 1DN0A 3O3EB 4MD0A 1WCBB 1S5IH 3TO2A 4OCXL 5GISH 1BD2E 2M2DA 1D9KC 3FT2B 4G9FB 4WI7A 5KBNC 1MFEL 3BKJL 1YYML 5FO8B 3KPPB 4HIIA 4R3SA 1MHEA 1NBYA 1PBYA 1OW0A 2X1XR 3VXUA 1EEYA 5E8EA 4MAUL 5IJVB 2V9RA 4WIQA 1I8KA 1ODAA 1UCBH 4IOFC 4LEOA 4UNVA 1J86A 5BS0A 4NCC2 1J88A 1WCBA 4KKLC 3WFHB 4YDJB 1YJDH 3P9MB 3KYNB 1YECH 5EZLB 3O45A 3ZE1F 5F6IB 2BY1A 3BHBB 5E6ZA 1PW3A 3BKML 5HHMD 3RTQC 5TJWK 5EDXA 5FKAA 1EFXD 3NZHH 2CLRB 1BGXH 5IFAL 5IB1B 4ONGH 5T1MB 1ZA3B 4K9EH 1V3MA 4HKJB 1R24A 4APQA 3QQ3B 4Y5YA 1X4XA 5IW3A 2WWKO 5SX5H 2YRZA 3C2AH 1T83A 2Z35A 1F11A 4JO2H 5BRZE 1O0VA 1OP3H 3P9MA 4FFVC 2X1QA 4PG9B 5HI3D 1ZMYA 3RHWF 1YEEH 4YHLL 1IC5H 1MCQA 2XV6B 4X6EB 4ISVA 1AGBB 3RZCB 4ZNCD 4HF5L 4N5UA 3HTLX 4WFGE 1G7PB 3RDTB 1QFUH 3DURB 1DBAH 1NGZA 4K9EC 5IB3A 4LCWD 4PJEE 3LOWA 3QH3A 4MXQD 3QPQC 1QSEB 1BBJA 4ZFOA 4P4KD 5GZOD 4HUUB 3FQWA 5I1CL 1BLNB 1ZLSH 3ZT7A 3TN0C 4YHOL 1WZLA 1MHCA 2BNUB 1NAML 5FYKH 4AENA 3VXRB 2J5LB 4DCQB 4JJ5A 3AGVA 5IF0B 1QNZL 2AK4D 2WUBH 3QIWA 1U36A 2NR6C 4XCEB 4G43A 4RFNC 4JAMA 2B1AH 3EZ8A 3T3ME 1T3FA 5BMFL 1CWVA 5KTEL 4HMCA 4POZC 1QSEA 3OV6A 2ORBL 4FZ8L 3HRPA 4FQIH 4Y4HA 2CR3A 2GCYA 1KIUA 3SJVD 2J88L 1BLNA 4PRID 2J4WH 3ZDZF 5HYJD 4P3CL 1JP5A 3LEYL 3TIEA 3WFDL 4AL8L 1PX4A 1I3UA 4B7IA 2HYMA 2F53A 2AGJL 2KPNA 4XVUD 5HHXH 1K5NA 4LCYB 1A6VL 5I1JL 3BO8B 1LO4H 1GYAA 5C8JB 5JXAH 4L9LC 1FN4B 3DX7A 5EU4A 5D70L 2R8SL 4Z7WE 5DJ8A 4M43H 1ZANH 5HDQL 1KCRL 3HMXH 3JWOL 4JHWL 2BRQA 4BK4A 3L3OA 3LKOB 4KK8C 2BY0A 3M1BB 1MRDL 1NCDL 1KBGL 2EDWA 5FUOL 1D7FA 4JRXA 1WZ1L 4WV1C 3IDIA 3TH4T 1AXTL 1L7IH 3VFPA 4QO1A 1GVIA 1QPPA 2GTZB 2I9LA 4OF6A 4GW1A 2OR9L 3EHBC 1G0YR 4P5KB 5I1KH 5BW7A 3R0NA 4NN7B 1WAAF 3U0WL 2VABA 3MV8E 3V0VA 5EB9A 1I1AB 2FX7L 4N0UE 5H35B 2HJKA 3W9EA 4WWKC 3HLAA 3OPZH 1MI5A 3D0VB 1FYTE 4UIKH 4HH9B 5IQ9A 4Q2ZB 4DVBB 1W72L 4PJGA 4JVPA 1MPAH 4GW5B 5HYEA 1NGQL 3EYOA 5I6XB 2EXYD 3KXFB 1VPOL 1Q94A 5F88A 2YUVA 4YE4H 1A6UL 3UTSA 4HJ0C 4LVNC 3QI9A 3RY6C 2HJFB 2GJZB 1GZQB 2P42B 4Y8DC 5ANMB 2ZUSA 4PD4J 3VI4E 1MFDH 2W0KA 2Q1EA 2D7OA 1IMHC 1TPXB 5D7LB 1KPUB 2G2RB 1KJ2L 4U1MB 4Z7VE 2MWCA 1MCOH 1EGJH 3BWUC 3DSFH 1P6FA 4IM8A 1BMGA 4UTBL 1TFHA 1X7QA 5EBWB 1XH3A 4KHTL 5K9JL 4GW5A 1RZ8B 1BX2A 3ZMRA 2ATKB 1KOAA 3FQUA 2DAVA 4XNQB 4JPIB 3QO0B 2R69H 2V5MA 1YY8A 3DBXB 3LKSA 5C0AE 2GJZA 5ANMA 1FLRL 1Y0LA 5GRWA 5MENB 1HH6A 1ZWIA 5D7LA 3O6FD 4X6CA 2PYEA 3L3HB 2OI9B 1YN7A 4WNQB 3TYFA 3QDJB 4TSBL 4R4BA 3ZDYE 4AM0B 2QHLA 1I8LC 3IKKA 3NACL 1AY1H 4JFQA 3HE7B 3U1SL 1RZ8A 4OCMC 1AD9A 4XMKL 3WIFA 5EU6E 3UZVB 2DJSA 3DBXA 2X10A 5F89A 3UBXG 1FIGL 5K59E 5I18L 4LGPB 2PTTA 1A22B 2DRUA 2Q3AA 2BVEA 3AREC 3RNQB 3GUTA 3EDEA 3EYFA 3JUYA 1CE1H 5LAXA 5DRWA 1YEHL 3FT4B 2FBJL 1INDH 4LCUB 4DKDC 2EYRB 1QR1A 3VH8A 2FEEL 2NW2B 2BFVL 3IDMB 2V9QA 4NP4L 4RX4A 2H8PA 4QHLB 2XTJB 1OM3H 1U8MB 1FPTH 1CD8A 5T5FH 2OMNA 3FOMB 2BOBA 5GGRY 1IGJB 3UJJH 4OZIA 1NBQA 5IMOB 1NAKH 2CIIB 2XWJA 2XQYG 3BFOA 4YDKL 4PPTA 3NPSC 2A73B 4F33A 1EAJA 3GIZH 4HULB 2J6EA 2OL3B 1MCSA 3MJ8A 3BXNA 4W4OA 4ELKB 4M8VA 3VGAB 3VWJD 3MLSH 4TVPE 1DBKL 3I84A 1KEML 4GG8A 2ZUQC 3IDMA 3V4UH 4GS7C 4U7SA 2BMKB 3VI3E 4Y5XA 3GSNA 1T20A 3REWA 2ZJSL 3QNZB 1T7VA 4KJYB 1FRGL 5AD0A 4XBEH 1C7SA 4W81A 3D87B 3O6ML 5AYUH 3W9DB 1FG2B 3CXDH 4HGWB 2LU7A 4P9ML 5CILL 5IMMA 3N1MC 5IB2A 2Z8VC 4WHYH 2WSKA 3BQUC 4P2OB 4ZODA 3S34L 3ETBF 1I9EA 5F7EL 3GRWL 4JZJC 2VLJE 3MRBB 3INUL 2PCPB 4MHHG 4N0CC 1TZGH 4MVBD 4JVWA 4QHKJ 1BFTA 3UYOD 4WRLA 3ULVE 5EOCH 3BUYB 2BNRB 3GSQB 4O2FA 4OZGF 4CNIB 4I1NB 1RZIB 1H0DA 2VZTA 3KLHC 4TRPH 4X4ZA 4Y2DA 5KSAA 1K2DA 4KK6C 2VXVL 1QVOA 4AEHH 4P57B 5DRNB 4O02L 3PGFL 5IK3A 2JB6B 1FFRA 5C2UB 3K46A 3I85A 4GW4B 2GUOA 4OD2A 5I8KL 3DXAE 1NEZG 1B3JA 2JLLA 1CF8H 1BD2A 2ZPKH 5JO5B 4ZAKD 2P5ED 1JBJA 5CJXC 1SMAA 2DLFL 2OZ4L 1KLUA 2F19H 5ICXA 2BVOB 2BZDA 3FKUS 1NCCH 1YEFH 3QXDB 2NY1B 3IDGB 4R4FH 1S3KH 1IILE 3C08H 4NUGL 2DQTH 1J0IA 4P59H 4L1DA 4P57A 4LLWA 2DN7A 3AROA 1OT2A 3VW3L 5KVMC 1IZJA 1KCVH 4RA0C 4JPKL 3CGTA 2Z4QB 4RAUB 1NUGA 3MRQA 3VXTB 4UDUB 3SKNB 2EDNA 5JXEC 1CDHA 5HTSA 3ARDB 1RJZB 3NCEB 4LFHD 5J13B 3AC0A 3MV7E 4KJWC 3QEQD 1MRFL 3O9WD 3RVVD 4HK0A 3SE9L 5E99H 5IB5A 4GXVL 2R2BA 2DD8H 3OJDA 4WFEE 5INDB 3IDGA 1QLRB 3TYGL 4JZOA 2D9QB 4N9GA 5JQ6L 1P7QD 3SE4A 1C12B 2VDNL 2DQHL 3PDGA 3PWVB 3C09C 1YEKH 4CMHC 1G6VK 5D1QC 5LGJB 2DYPD 1XF4B 5BRZA 1CICD 3GSVA 2XPGB 3VFGL 4QRTB 4URTB 3NMEA 3BEVB 1XCQA 1D6EB 4XAKD 4PG2A 5ADPL 1PX3A 5CZVL 2BSTA 2OYPA 2D7MA 5BJTB 4KPHL 3QULB 4FOMA 3EOBA 4R96B 1KXTB 3SEPA 3W0WD 4CDGC 5AEAA 1S9XA 2Y06L 3O3DA 4J4PC 5IBLD 3DVNB 3RVWC 1Q9OB 3U7YH 4PJEA 1NEZB 3WSQH 3GM8A 3DETD 2NY0C 3I3BA 1CXKA 2EYSA 4OM1H 3P4OB 3ARGD 3MBEB 3HNVL 3BEVA 5SV4A 1OTTD 4KWUA 4Q6IC 4KMLB 2D4FA 4OCYL 4TNVK 2AV7B 5DZLA 3TPKA 3REVA 3P9LB 4S2SA 3CCHB 4PJ9C 4KVNH 1IAOA 3HNSL 4LGRB 1U58B 3QXVA 1ZXQA 1A1MB 3CFBB 1KYOJ 3GEWB 1GGCH 1MCEA 1JNHB 2QADB 4LPXA 3SQOL 3UAJC 5HI3C 4UZGA 5HGHB 2GTWB 4RA3A 5CEZD 4OLVH 5IT2H 2CDGA 1NLBH 1D5MB 1TQCB 4OUUA 1F6FB 2OTWB 1AO7D 4LAQH 4HPYH 1IC4L 3P9LA 4G6KH 2C4XA 4NJAH 4HIHB 2ZSWB 4LCWE 3VCLA 1LO5B 2EDEA 1ZV5A 5D7JA 4DFIA 1A1MA 1DANT 1AI1L 2NXYB 4GLRI 4MS8D 3L3JA 1LWRA 3DO7B 4RMSA 1XGYH 1JNNL 4IMLB 2CXKA 3SE3C 3WN5C 4PS4L 4Z7WA 5D1ZA 4YC2C 2AK4E 2ARJA 1ZT4A 3M17A 3UX9B 5I75C 4CVZA 4W68A 1T03H 5B38A 3SKUD 3KHOA 4U6XB 1VFOA 1MLBB 4NKOA 4NRZA 4GG6B 5CEXA 3SJVE 4K3EL 4PRIE 5AZ2L 3U4AA 5HYJE 4OQTA 1Q0YL 2NLJA 3MACH 5IEHB 3A6CH 3BEWA 4XAWH 4S10A 4X7FC 1EZVY 3OHXB 5DD1L 3MV8A 2NY2B 2DMCA 3QQ9C 3QXWA 4N0UA 1EZVX 2ID5A 3LPFA 1FVEA 4I3GA 3NCYP 4N1CA 4P0DA 1RURH 1S7TA 1FYTA 5MEQB 1Z3GH 3WS6A 1KB9J 2CRYA 5GRZA 1G9MH 3QUXB 1FNEB 2FSEA 3ZL4L 5EU7E 5DJXA 4GKOA 1D3CA 1VDGA 3PF2A 3ARWA 4FTVD 4DGIH 3EYQD 3FB8A 2W65A 3KGRA 2ZG3A 2Y1VA 3PWJA 5HDBF 4HWZB 4KQ4H 1HK6A 4HKZB 5AAWA 3MCKB 1JMZA 5MP6H 2OL3L 5I1IL 2H32A 1MCLA 4MAYB 4K8RD 4J3VA 1GOGA 1EMTH 1N64L 2CK0L 2QKIA 3FQTA 2PO6A 4HS6A 4X5XA 4U1SB 2BCKA 1MAML 2DDQL 1NJ9A 3B8YA 5KVGH 2X41A 5HHOD 1T04B 3P11L 5C0AA 5E8DL 4CL7A 3NFNB 2L7UA 1HXMA 3WDHA 3PWUA 3K80A 4XVSH 4X7CC 3QIBD 1WEJH 3LEXA 2APVA 4K71C 5I1GH 3LEVH 2W59A 5E00B 1KIQA 5C08B 4R7NB 1D5IH 1VFMA 2YKLH 4NKMA 3MROA 1BWMA 3FTGB 4HMDA 4OD1L 4LMQE 4JN1L 2X4QA 1RUKL 4L8SC 5J9PA 3D18A 3UJTH 2ATPB 1NCAL 4LSTH 1RU9H 3BIKA 3JVGA 5EU6A 4XI5D 4KZDH 1QQDA 5L2JA 1U6AL 2JJTA 4ZUWA 4M6OL 2VQTA 4PV8B 5GRUH 3NIFE 2XA8L 3ULUD 5GS1B 3MJ9A 1DUZB 4AEIL 1ZVSA 2WWKT 2UVEA 2YC1B 4HKBA 5CP7A 3BP4A 1HQRA 3PGCB 4LQFL 2H9GA 3DMMD 5TQ0L 2J7LA 3LMJH 5DC9B 3VD3A 2Y7QA 4L3EB 4KROC 3SDAB 1UGNA 3O6FC 4Z9KB 5FM8A 1J5OH 3D9AL 1MLCA 2G60L 4PV8A 2GJJA 4G8EA 3LN9A 2ED7A 3U30B 1YMMB 4A6YH 4WTZG 1RZ7H 1JNLH 3BP6B 4L4JA 3U79A 1AGFA 4EBQH 3OJMB 3GFUA 1A9BB 1FZJA 1CIDA 2MKWA 2XWBB 3VFSB 2FD6L 3TO4D 5IMKA 3WO3B 4U4BA 3I3EA 4S1DD 4WO4B 5C3LD 4XP9L 4LPCA 3QP3A 4YHIA 3CFDB 1FIEA 3DX8B 1IT9H 4KQ3H 2AKRA 1XGUA 4WI9A 1B4JL 4WCYL 3H7BB 5AAMA 5FCSH 4LF3A 5FYKD 2DQDL 1SJHB 2APXA 1BQLH 5D93C 4BSVB 3OR6A 2R0LH 3FN0L 1FZMA 4TYUA 3IDUA 1B88A 3F7YB 1HZHL 4NNPL 3DX8A 2R0KH 3FZUD 3TT1L 3ZKMD 1KENL 3TBTA 2R23B 3S36L 3LDBB 1MRCH 4QRUB 1TCRB 2HFGH 2VLJA 2DQIH 2B2XL 1DVFC 3UTTE 4GSDH 4U3XA 5KW9H 2KKQA 3QXAB 4D8PA 4ODVH 43C9A 5DEGA 3DI3B 3HNTH 4BSVA 1FGNH 3RIFK 3V2AR 4YQXL 1SY6H 2NXZD 4NZJA 2VMFA 1OARL 4P23B 1QKZH 1YNKL 3E3QC 4CJ0A 1U9KA 4ZQKB 12E8L 5C7XH 3SDCC 1JMXA 4H20H 1U93B 5J3HD 1I7TB 1F6AB 5HGBB 4X6BA 1IGTB 1UWEH 4K3DH 3KDMA 3RGVA 5DURB 3BUTA 5DJ6B 3Q6FB 3DXAA 3V0AC 2WV3A 4QYOB 5DGRA 3QB7C 4L4TD 5D7IB 4NQEB 3VA2C 3J7HA 4GAJH 3EGSB 3IGAA 5GGVH 4YHYB 3SDXF 1GOFA 4H1LA 3BDBA 5CHNB 4MNQB 3U7WH 1DQLH 1ORQA 4OF8A 2JELH 4PRNB 4OTXL 3B2VH 4X8XA 3WHXA 4U2ZA 2EEBA 4YH6A 4PGEB 3V4PH 3VWKA 5EWIH 5KZCB 2JCCF 3QUZD 1HIMH 4JQVA 4NM4H 4K7PL 4GRWH 3VFUA 2FR4B 3BRGC 4HUWA 3O8XC 2EZ0D 5DD0L 3KS0H 3BN9D 1CXFA 1QBMH 4ZXBB 3K1KC 2FX9H 4RZCB 3O2WL 3KYMA 1CG9B 3MV7A 3V6ZB 1J8HD 2VAAB 5JW5B 5LXGH 3MRFB 4LHUD 1GC1H 1C16A 3CVHB 5FOJA 3FQRB 4J6RL 4GMTH 4RNRA 1Z6JT 2A6KB 3DROA 3BPCA 4QOKD 4XPHH 1GGBL 3BH9B 2R4SH 2P5EE 4V1DD 1LHZA 1IARB 4PJ8A 3MV9D 1P9MA 4PRDA 5TF0A 1MSPA 3OKLA 3RKDD 1TNNA 1OAXH 2X5PA 3RY4A