4OLXH

Crystal structure of antibody vrc07-g54l in complex with clade a/e 93th057 hiv-1 gp120 core
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
QVRLSQSGGQMKKPGDSMRISCRASGYEFINCPINWIRLAPGKRPEWMGWMKPRLGAVSYARQLQGRVTMTRDMYSETAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 41
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH01
1JNHA 2CDEB 3KYOA 5JUEH 4NQSB 2CO7B 4BK5A 4YHLL 4UB0L 3GKZA 2IJ0C 5B8CC 15C8H 5F1NB 1WISA 5CFHA 5EORH 2CXKA 4YFLF 2PW2A 4DTGH 3OWEA 1IM9D 1QSEE 3TBSA 3PQYE 4R3SB 5BW7A 2YD8A 5JHDB 5C09D 3EIFA 4OAWB 5GS0D 4NWUH 1MFCH 4RMSA 4D3CH 4J23A 3ECBB 4WCYH 3DTXA 1GZQB 3PP4L 1KSRA 1OOAA 4HULB 1CTNA 3TO4B 5T33L 2YBRB 2NZIA 1K3IA 1BAFH 3V5DA 5EPMA 3C60C 4F9PA 5I1JH 1EMTL 1PGRB 3NCMA 5CGTA 4CNIB 4TRPH 1RURL 3GI8L 4A2MA 1PLGL 4P0DA 1ZLWK 5EBLB 4KQ4H 2UZXB 3KR3L 4M6MH 3RU8H 1SVCP 3QFJB 2XN9D 3E3QC 4R97B 5ETUA 5L9DL 3U0WL 4J3OC 3CSBA 4J4PC 1XAUA 2P5ED 3UAJD 4HUVB 3GM8A 1HQRB 1N64H 4MAYA 1G7JA 1SY6A 4Q2ZA 2NY2D 5HI3C 5ESVB 5I8CA 2H8PA 3O4OC 3SE8H 4KRLB 4PRID 1N0XL 3LKQA 1U3HB 3TWCL 1F5WA 1VHPA 4PJDA 5FDYA 2YN3A 5IKCA 1H8OA 4OZGF 3QDGA 1IEAA 3HNSH 4OKVA 4U1NB 4WGVB 3RKDC 3DO7B 3HLAA 4K7PL 2ED8A 2F54D 1MHHB 3QISA 4YE4L 1OGAA 5ITBH 3FO9B 3MNZB 4M6AA 5I66A 1WWCA 4RZCA 4Y5VC 3IVKB 2H3NB 4NQED 4U6HA 1OLLA 5F7FA 1BZQK 2IMMA 1OF2B 1XGUA 4P2QB 3QYCA 3GSUB 1NL0H 1KCRH 5CMAB 1JWUA 4AZ8A 2DLFH 5JW4R 2NXYD 4P23C 5EO1B 4OBRA 4OGXH 5CD5D 2W60A 5IB4B 3CFCH 3RA7H 4NNPH 1EEZA 4HPYL 4EOWL 3C09C 1JGLL 4XH2B 4UV4H 2DQEH 4XNMB 4U1LB 3VFVB 1M6OA 2ZUTA 3CK0H 2AJVH 4L4TA 4P2YA 4HJGB 3D0VB 3FRUA 1RZFL 2V2TA 2B0SL 2FLBT 4FS0A 3DX6B 2PXYA 1CVSC 2BY1A 3NCYP 5JXEC 3E2HC 4I0CC 2OL3H 3K2MC 3HE7B 1HYSC 2H32H 1NLDH 3AREC 2V17L 5DJZA 3O6FB 4I18A 4JN1L 1XIWD 3OR7A 3PWLA 3P11H 5TFSL 2V2WA 1NANH 3P40A 5FYJU 2PO6D 3FN3A 3STZA 3IF1B 1CXFA 1QLFA 2H2SD 3HZMA 2F53B 43C9A 4D0CA 4Z7WF 4KK9D 3ARRA 1KTDB 4IM8A 1IRAY 1OCWL 1YECL 2XZZA 3HE6D 4Z7QF 2CH8A 1BD2B 3UX9B 3CJJA 4HIHA 2EE6A 4GRLC 3DHJA 5CJQH 3SE3C 1DUYB 4PJ5E 1AKJA 4IMKC 3H0TA 5ICZA 1LDSA 2QHLA 4OZ4B 2PR4L 3RRQA 1RUQL 3ZKMD 4N90E 4GAJL 1NCCH 1U2HA 2Q7YB 4WU5A 1U95A 4JGUA 2AK4B 1INDH 1PEZA 1RJZB 4FQXC 2QQLL 3W5NA 1JIBA 1F4YL 3ELAT 4L4VD 5IFAH 1A14H 3SGJC 5KS9A 3G6JF 5D1XC 1MFDH 2BCKA 2VDRL 3QIWC 1A6AB 3NVQA 3L7EB 1BGXH 4R4BB 4QWWD 3HAEG 4BZ2L 5HTSA 1U8NA 4X99A 4U3XA 3MLTA 3BEVA 4JVWA 3MV9A 4J3WA 2J5LB 5C0DA 2VXQH 2BVUA 3P4MA 5GZNC 5CAYB 4NNXB 5J6GA 2IQAA 5BV7L 1HHHA 4KKNA 4AK1A 3RGVD 2YPKB 3B9KD 1T0MB 4PREB 2Z92A 5E2UH 2HT3C 4NKMB 4JRYD 1UACH 3QDJB 1Q9KB 3L3KA 5DA4A 4NQCE 4UT6L 4JFDA 3K0WA 2JELL 4RFOL 1LE5B 1F42A 5IJKC 3FQUA 2JJVA 3KPLA 5EIVA 1PY4A 2DLHA 1MI5D 4Y5YC 3V6OE 2FR4B 3I9GH 1GYAA 4UQ2B 4N8VB 1A6UL 4YPJA 5F70A 1S78C 4JQXC 4PPTA 5D2LE 1MCQA 5D2NC 5I18H 2V6HA 3IFNH 4KDTC 1R3KB 2CSPA 2WP3T 5ESAB 5ACLA 4HUKB 5IQ9A 4HKBB 4M6NL 3QIUA 2Y5EA 4K71B 5FYKE 3ZE2E 4WV1B 4YHML 2P8MB 5IM7B 1OPGL 2NY7H 1UQSA 4IOFD 1UT9A 4F7EB 4L9LC 1FO0B 4DZBB 2B4CC 4DKEL 2BVTA 1KELH 4A6YH 5HPOA 4YO0A 5TE7L 1E28A 5JUEL 3VFNA 5CJ8A 4ZAKA 4LSSL 4UDTB 2VKWA 2ZSWB 3F7PC 3HRZB 1CLYH 4L8BA 2VITA 3U36B 15C8L 2FL5B 5IB3A 5EORL 1JZ3A 2YPLE 3PL6A 5H37H 1XF5B 4DTGL 1KPRB 4XPFH 3JUZA 1VGEH 3S98A 4KFZC 5I30L 4I3RH 4L9DA 3VFOB 4PJIB 4CVZA 5B3JE 4JZJA 3KJ6L 4LSUH 1YEDB 2X1QA 4ZMAT 2HT2D 3WHE0 4NWUL 3JV5A 1MFCL 4TQEL 3TYFB 2ZSVB 4D3CL 1JHKL 3I50H 1CTOA 3UTSB 4WCYL 4XI5D 3NFPB 4I0PA 4M61A 2VLJB 4NZRL 4WTZA 4ZUUB 4U0RB 5HHOA 4UNVA 1R24B 4QXUH 1T1ZA 2CDGB 5I1LB 1G7IA 3S35X 1ROWA 1BAFL 1MOEA 5I1JL 4P3WA 3ARFD 2DMCA 2OJEA 3L95A 5DJ2A 2WQRA 4LCUB 4AG4H 5FA4A 5D7SH 3QO1B 5ADPH 3MV11 1YMMD 3ARGA 5LWYH 3QG7H 3LRSB 5TDNA 4MB5A 4X5LA 3IXTB 4WUUA 4KQ4L 4RAUA 3TJEH 4M6ML 3RU8L 1JCKA 1FZJA 3RZCB 2BVPB 2DOCA 5FDWA 4E0RB 1CICC 4IJ3C 2P42B 1R3IH 1VESA 1ZHBA 4XXCA 1N64L 1EDQA 4FTVA 1XGRB 4ZO7A 4ETQB 4LPCA 3O9WA 4JFOB 3HG1A 2CIKA 4MCZA 3DURA 3HNSL 4GKZB 3X17A 1SJXA 1IGMH 4QRPB 1KJ2B 4JN2A 4MXVE 5ICXA 4LVOC 2IANE 4HWZA 1T22A 1EV2E 3LQAC 4KKAD 1WGOA 4YEFA 4X80H 3QUXD 3GJFA 2Z8WC 3IJSA 5CSZB 1B0RA 4QHKI 5DJYA 2UY6A 4OJFH 4BQCA 5ITBL 1FJ1A 1U3YA 1CD1A 4YPGB 3QUYC 5KSUA 3SGKC 2R56H 2HFEA 1JFQH 4KXZI 5JHLH 3L5WA 4S11A 2NY6D 1TQBC 1NL0L 2WLZA 4D9QD 5C09A 4NRYB 1KCRL 4HLZG 2DLFL 3EFFA 1FCCA 4RQQB 1H0DA 4KU1A 2P7TA 3CFCL 3RA7L 4NNPL 1NFDE 3WO4B 12E8H 2VUYA 4UV4L 1X4YA 2DQEL 2FECL 1T5WB 4PTUB 1I7UA 4AL8H 3CK0L 1I9RH 2AJVL 1UJ3C 2XKUA 5C07B 4F33A 1ZGLM 2MHAB 4OF7A 3ARWA 3CFBA 1KV3A 2RR3A 5E6ID 5D1ZA 1SVZA 4NJAH 3ZDXE 1QQDA 1VADA 1OSPH 1YA5A 1DANT 1GGIH 3MQIA 3STLA 2OL3L 5KSAC 2Z31A 1NLDL 2G5BA 3LDBC 2Y6SC 1IAOA 3GHEH 1FFPA 1U8MB 4OF0A 1KGCE 3MUZ1 3P11L 4ODHH 3QXAA 1ZWIA 5KANG 1D5MB 3GSVB 3F65A 3TH3T 2CIIA 3G5YA 4JRXE 5EO9A 1TPXC 4PRIA 5CWSA 5ENWB 2VZ3A 4MX7A 1GIGH 4R0LB 3ARBC 1OP5K 3INUH 2G75B 2VZ1A 1UCBH 3MBEB 4LP5A 2FECI 1CE1H 4KC3B 3OBAA 3IT8D 2H9GB 3BD4A 8FABB 1W8OA 1INQA 4NO5B 3DV4A 3FQRA 4NPYA 5I74C 2YEZA 2B7DT 1T7YA 2FHFA 4RISH 1UA6H 3DX7A 2DI8A 2X1XR 1FORH 5IVXB 5F96H 3FHAA 1INDL 1S7VA 4XRCA 5I2IA 4R4NC 5IFAL 1A14L 5BVJB 1FIGH 3MC0A 5IR1A 1NC4B 2W9EH 3PWNA 1MFDL 3E6HA 2DYPB 2VWEE 2WBJD 3QDAA 3LKPB 5DD6A 1LEIB 1BGXL 3UTTE 1S7XA 3ZE0E 5B4MD 3VXMB 4LGPB 3HS0A 3HI6L 1NANI 1CQYA 4U7KA 1AXTH 1CFNB 4ORGA 2P1YA 2IC2A 2O61B 2DDQH 2JJTC 3U4EB 4JO1H 3L3JB 2NW2B 3BKMH 4LCIL 3RP1A 5KJRH 1U8OA 5E2UL 5GRZA 3RUGA 1BQSA 5I9QB 4NBXB 1UACL 4M8VA 4WWKB 3BDBA 5LBSH 4G80A 3QPQD 2EDQA 4HKXB 2BNRD 4PJGB 5MERA 4BK4A 2X7LB 2X4SA 3H42H 4YZFE 1TVHB 3G04B 1JPGA 1XGPB 3NAAL 4LASL 3P30H 4M7JH 1AGEA 3I9GL 3ALPA 4MJ6B 1RI8A 4RNRA 5DHXB 3BMVA 4OD1H 2IADA 1XFPA 3RWJB 3C60D 4E41A 2PO6A 5I18L 3IFNL 2WWKO 3WHXA 5TH2B 3P4NB 3HE6A 1HCFX 5E24E 1QO3B 2BSED 2LVEA 4PRHB 2Z93A 2NY7L 3D3VB 3L3DB 3MRRB 2XWJA 4HK0A 4J4PD 5HHMD 4H1LA 4H5SA 1DLHB 1NCBH 2ID5A 3I6KB 4ZS7H 1KELL 3TPUB 2YMXH 4A6YL 1S5HA 1RMFH 3KS0H 5HI3D 1PKQB 4L4VA 4RGMB 1BX2A 1CLYL 2ZCHL 1HEZA 5GSVB 3H2WA 5MP6H 3CZJA 4XCYB 2EEAA 3RKDD 5INCA 1V7NH 1T20B 4XPFL 4OFYD 1VGEL 2P4AB 1U6AH 3WFHB 3IAPA 4I3RL 5JZ7C 3ARZA 3C8KA 1MCOH 1UZ8A 1A7RH 4QOKB 3UTOA 4LSUL 1OAUH 4HS6B 1P7QD 4HSQA 1ONQB 3ZDZF 4K8RL 3I50L 3S97C 5GIRA 2WINB 4NO0D 5D1QC 5I71C 1IGJB 4JDZA 3FT3B 3B9KA 5BO1H 4QXUL 1T66C 1JPTH 3RKPA 4OCSH 3FTGA 3EOBA 1AGFB 1ZAGA 1F4WH 1RZKH 4ZFFA 2PETA 2VWEC 4P23D 4YDVB 4V1DB 2WK2A 4AG4L 5C0JB 4DQOH 1MI5A 5D7SL 3KLAB 3OJMB 1QHPA 4G9FA 4FQCH 5ADPL 3OV6A 4G8EA 4JQIH 3QG7L 3NCEB 4HHAB 3FO2B 3NIGE 4G43B 3RWCA 1EO5A 3SCMB 5JW4M 4UAOC 1J12A 3CFEB 3TJEL 5HGBA 3O3AA 1UH4A 3N1PC 1TVBB 5FGCE 4E5XB 2IQ9L 1R3IL 2X4TB 3EUUA 3I6GA 2XQYK 5IHUH 2BSTB 1P6AB 1HYSD 1QUNA 4TNWK 5JW4N 1QSED 3HPJB 5AUMA 1ZT1A 3RWDA 3VU2A 3VXUB 3R06A 1NDGA 5T1MA 3O8XB 5JW3H 4GW4B 4CN4A 5FCSH 4JANB 4PJHE 4Y2OA 1EBAA 5LAXB 1ITCA 1MWAB 1ADQH 5ANMA 1T4KB 1DTUA 1FH5H 1JPSL 3MRQB 4X80L 1JL8A 1XZ0A 3WD5H 2R2BB 4OJFL 1EA9C 1AQDA 3QSKB 3D69A 5I1AB 4KKBC 3FT4A 4LDEB 2R56L 4LVHC 2D7OA 3IU4H 1JFQL 1FG2B 3JSSA 4M9OA 1I9EA 4P4RA 1F45A 3MTRA 2F8XC 5JHLL 1OAQH 4GFTB 1AI1H 3QEHA 4CMHC 2KUTA 4OLZH 4FQXD 4HFWA 1AR2A 3AM8C 2QV2A 3MRGB 2F8OA 5SWZB 1B0GA 5D1XD 3ZSTA 5ID0B 3GMMB 3GSNB 4QT5B 3QIWD 3DGGA 5A43C 12E8L 1B88A 1MIMH 4MA3A 5E8NA 4JQVA 1WAAA 3KLSA 4AL8L 3VFPB 3W81A 1QEWA 1I9RL 3P0VH 1FAKT 2C5DC 4JM2F 5J6HB 3MRKA 1OAZH 4RDQG 5GPRA 2P47B 4NJAL 5DO2C 5GZND 3RIFF 1OSPL 1GGIL 3HZKA 1YPZB 3U46A 4GMSL 4DN4H 4R90L 1Q0XL 4B53A 5K9JH 3GHEL 2HT3D 1S7RA 1G0YR 4ZSOE 3CH1B 4Z7NE 1Y6KR 1NMBH 4ODHL 4H1LG 5C3TA 4ZUSB 4E9LA 1U58B 1VCAA 2ZCKH 4ZNEA 2A73A 3D85D 5F1OB 1NAMB 1GIGL 4WHTB 3INUL 4F8TA 3KYOB 1S78D 2Y06H 1UCBL 1UGNA 1CE1L 4FQQA 4EVNB 3LKNB 1JF5A 3O3DA 2Q3AA 4YDIH 4JPKH 1EX0A 1UA6L 4ZUWA 4Q6IA 2X40A 5ISZB 2JJUA 5E7BA 1FORL 1NUDA 5F96L 5JW5A 3RQ3A 4JVUA 4Q97A 3BPOB 4JFYA 4PJBF 3S5LG 4WI9A 1I9IH 2OL3A 1FIGL 3DI2B 2H32A 2W9EL 3GBNH 2GITA 2BXZA 3F62A 5T5FH 5FGBC 2J6EH 3GSRA 3RDTC 3Q3GA 3DTXB 3E8UH 3HPLA 3BQUA 5F7WC 1XF3A 2G5RA 4JVPA 5DD3H 5LKNA 1ZGLB 2OZ4H 3HAEB 2VB5A 4K3JH 3UTZA 5D93C 1AXTL 4PJXF 2OTUA 2XKSA 3QR2A 4PJAA 2E7BA 3V5DB 5CJXC 5EPMB 3QCTH 5D8JH 4BFGA 1HKLH 1YEGH 1CT8A 2DDQL 2YSSB 3REVB 2HRPH 4EQ2A 3WJJA 4JO1L 3W39B 4DOHE 5KSVB 1WC7A 3BKML 5KJRL 5DSCA 1C12B 4K94C 3VD5A 4CL7A 4C59B 5LBSL 5AG9A 2V9TA 3T0VA 3JV6A 3SDCA 1X7QA 3PXHA 4N90D 3H42L 3UJTH 1DEEA 2DWDB 3DUSB 2HFFA 3P30L 4M7JL 2DI7A 1A4KB 5JA9A 3H3KA 4XPTH 1G7JB 4Q2ZB 5I8CB 2H8PB 5DRZB 3OG6B 4OD1L 3LKQB 1TQCC 5EU3B 1S9XB 4QCIA 3GUTB 4GW1A 1P4LA 4XBPA 1A6TA 2VTFA 2HTKC 1M7XA 1XEDA 3TP4A 1UM5H 5MHSE 3N1GC 5F9OH 2VZVA 4PLKC 5TGBA 5KG9A 4POZD 4ZQKA 4CVXA 5I76B 4OBSA 4IIQC 1UYWH 3IKKA 4EXKA 3KPNA 1NJ9A 3OKLA 1NKRA 4R9HA 3VRIA 1AD9A 3SDAB 4POYA 1CICD 1NCBL 2X41A 5I66B 4ZS7L 2YMXL 3TNMA 4M00A 5CEYA 1FYTB 1RMFL 2IAMD 5EA0H 1F58H 4Y4KB 1XGUB 3RTQD 4W6YB 5IT2H 3TYGH 5MP6L 3VI4E 3ZYIA 4WJ5A 3SE9L 1DDHB 2VAAA 1V7NL 2C3VB 3CDFA 3ARDC 2EDKA 5HPMA 1U6AL 1WLHA 3WLWD 5EU4A 1U0QA 1MCOL 1A7RL 1DQDH 4TULH 1RUKH 4HGKC 1J5OH 4PBWD 1OAUL 3QNXA 4BQ6A 1T89C 1R5VB 4PG9A 1LO0H 5TPWH 1XF1A 3Q6FA 3QUYD 2FBJH 4QGTA 5FYKD 5BO1L 1JPTL 2R1XA 2IBBA 3X14A 4HJ0C 4OCSL 1MCFA 2PYFB 4A6YA 1F4WL 1RZKL 2BNRA 3DXAD 4LHUA 5DJZB 5F9AC 4I18B 4O2CA 3OR7B 3UPRA 5E8OB 5F9WC 1G9NC 4DVBA 2UUDK 4P46C 4FQCL 3STZB 1QLFB 43C9B 2GJJA 1TZIA 4ELMA 3P73A 5E2WL 1LVEA 4H0IA 3QG6A 4HIHB 3DIFA 1T0PB 5BQ7A 4RBPH 2YPLD 5IBUG 4MD4A 4M8QA 1LEKA 5IHUL 1EEYA 5DEZA 5KSAD 4BM7A 2NY0B 3ES6B 5H94A 4UOW1 3T2PA 1EUTA 1CLZH 2Y6SD 1F6AB 2NMSA 4WU5B 2F5BL 1H3XA 4YZFF 5JW3L 2O5XL 3DUUB 3WNPA 4J4PA 5DK3A 3K4DA 3S3JA 5FO8B 2FATH 2BCKB 1ADQL 5ILTH 3EAKA 4HBCH 4WEBH 3S37H 5BS0B 3ARBD 3WD5L 2DBJA 2WBWB 3BRDA 2V2XB 1UB6A 1U8NB 3ZHLA 5E6YA 3KHOA 2FJHB 1NC2D 1KJVB 3O11A 2W0PA 3IU4L 3P4MB 3STBA 4CADB 2GIYA 1K8DA 2Q76A 4H0GA 4YBLC 5IMKA 2PCPA 5FAAA 1OAQL 2ICWJ 1AC6A 2ZUQC 3TO2A 4OLZL 1HDMA 2VL5A 1P7QA 1DUZB 5JHDE 2Z92B 4R4ND 2AV7A 4B0MM 4Y5VA 3G5XA 1FP5A 3OX8A 2NW3B 1CG9B 3QRFM 1A22B 3DX8A 3DLQR 1HHKA 3W2DL 4JFDB 4Q9BA 1MIML 5IEKA 1BLNA 3EYFB 1QLRA 3D6GA 5ADOH 2IBZX 4LRIA 3OAUH 3P0VL 4NQVB 1ZLVK 2V5RA 3GMQB 1OAZL 2MQ0A 3PDDA 1T04A 2EDDA 5CEZD 2IAND 3BP7B 4DN4L 4JGJA 4O51A 5IQ9B 2IH1B 5K9JL 1B90A 3QIUB 5FOJA 3I3DA 5F8RC 3SDDC 1U42A 2VQTA 3MLVH 3QFJE 1UQSB 1NMBL 2QHRH 4F7MB 5CZXC 3QBTB 2X89A 3QXDA 5LQBH 4GMTH 3V5HA 2ZCKL 4LNVA 1MFBH 3PQYA 1L9MA 1TXKA 4YO0B 4ZYKB 1IC4H 1VERA 1E28B 3FOLA 3VFNB 2Y06L 3VXTA 1J1XH 3N85H 4QHMB 2XG4A 3W9DA 3SEPA 3BESR 4L8BB 1F3JA 2VITB 2EDNA 5CBEA 5IB3B 4JKKA 3PWUA 2GSIA 3PL6B 3MJ7A 4WIQA 4APQD 1I9IL 4CVZB 4IMKA 4JZJB 1T0NB 2DJ4A 4QXGH 3GBNL 4ZOAA 1FNLA 1D6VL 4ZTPH 5T5FL 4NDMA 2J6EL 1TNNA 4J3UA 1KNOA 3K46A 1KLUA 3T3MF 4I0PB 3E8UL 4P2QE 5DD3L 1YDPB 2OZ4L 4MJIB 5GSRA 1T1ZB 4PRBA 4LHUG 1G7IB 1SMOA 4DFIA 3QIWA 1X5ZA 3SKMA 4EI5C 4UDUA 3QCTL 2EICA 5CP7B 1HKLL 3MLWH 1YEGL 5D8JL 2HRPL 4PJ9B 2OJEB 4JRXD 5AYQA 5L0QC 4GLRH 5JZ7D 3DVGA 3ARGB 3F7YA 5TDNB 1M1SA 2OR7A 3MCLH 4WUUB 5E9DB 3DMMB 1L0YA 3C6LD 3AVEA 5DGRA 5DURD 4P4KA 5CEXA 1RD6A 3QQ4A 5D1QD 3T0EE 5F7HA 1X5FA 3UJTL 3EJYC 4LLYB 1T66D 1DN0A 1E4KC 4XPTL 5GISH 5IW1A 1J18A 4FTVB 4C58B 2GTZA 4U1JB 2EO1A 2N7AA 2JIXD 3P0GB 4KJYA 4PGCA 1U91A 5KZCD 3HG1B 1CD9B 2GQHA 5FB8A 3DURB 3SHSA 3UTTD 3DNKA 1G9MC 1UM5L 5F9OL 4LVNB 1T22B 1BD2E 2EH7H 4O58H 3RVXD 1UYWL 1WJ3A 3GJFB 4KDTA 3O3BA 5I19H 4DJMA 1HWHB 1JTTA 5KAQF 4U0QB 5C71A 3NIDF 3Q5YA 2HVKA 4BSJA 1CVRA 2AP2A 2DIAA 2DQTH 2Q7NA 5EA0L 1D9KB 4BZYA 3GMPB 5INDA 4JDVA 1F58L 9CGTA 2AK4E 2JCCB 1LD9A 1X9QA 2ZOLA 5TQ2L 3FCTB 4O4YH 5IT2L 3TYGL 5FXCH 4MSWB 1A9BA 3EFFB 4GSDH 1KJMA 3S4SG 1O0VA 5K33A 5KN5A 3PHOB 1G9NH 4TULL 1RUKL 1PX4A 1U3HC 3N0PB 2VLRD 4HXAH 3EJJX 3RJDA 3OGCA 3NCJH 1LO0L 4F33B 5TPWL 1QFWM 5EOCJ 4KKBD 5D1ZB 4OZHF 5T1LB 1GGBH 3B9EA 2FBJL 2A83A 2V5TA 3U0PB 4TSAL 2X09A 2Z31B 1I3GH 2IG2L 4PJ5A 3QDJE 1IAOB 3GO1L 3ZMRA 4GAFB 4JFHE 4LAQH 2HP4A 4J8RA 1ZWIB 4WU7B 2VXTH 3QIBA 2CIIB 3BPLB 4TNVF 4LCCB 5EO9B 5JR1H 3M45A 1R3LA 5DO2D 2IPKA 3L3OA 3LY6A 1A3QA 1INQB 3DV4B 4AEEA 4BUGA 1CLZL 2YEZB 4X7FC 4FFWC 1QFHA 3DX7B 2HJFA 1S7VB 3O4LD 1FVDA 1VKXA 4MQ7B 1CICA 1GJIA 1Z2KA 1UJTA 3LOWA 1QBML 3PWNB 2FATL 3OKNA 4X6EA 2IAMA 3HE7C 5ILTL 3G5ZB 5CJOH 2V5YA 4HBCL 4WEBL 4J6RL 3S37L 3RTQA 1PAMA 1S7XB 5SX5H 4JHZA 4P5MB 2VR5A 3RPKA 3OR6A 4ONFH 4NQCA 4U3CA 4NKOA 1OTSC 2YD3A 2BNUA 4DKAA 3MJ6A 4LSQH 4HT1H 5JORA 5E4EB 3V6OA 1P69B 1ZHNA 2I26N 3VGBA 4M62H 3B3IA 5E99H 2ICEB 4PJIE 4PJ7F 2ICES 1WBYB 1PEWA 1U8OB 4LLAA 5D5MB 5J57B 3L9RB 4UOW0 1FYHB 1CGYA 3TGXA 4S10A 5FEBA 4WW2A 4G80B 3CZFA 2VLJE 3UC0H 1N2RB 5ADOL 4P57A 1BJ1H 3OAUL 5EZIH 3ILPA 2X4SB 1ZE3C 4ETYA 1ADQA 1AGEB 1SJHA 2ADGB 1MPAH 1A4JB 1SYVA 1ZS8B 1R5WA 3SKUD 3VJ6B 4OQTL 4E41B 3V0VB 4FZEL 4I5BA 1S7SA 2VDOH 1IC7H 3WHXB 1QR4A 1UJ3A 4OFVA 1PY9A 3CVHH 32C2A 2DQCH 5CGMA 2Z93B 3MLVL 3LKOB 3F7QA 2J5LC 2QHRL 3HNTH 2P5WB 5J13B 4XHQA 2MKLC 5BV7B 3NFSH 2PN5A 1TITA 5LQBL 4GMTL 2XWJB 4KJWC 4HK0B 4H1LB 4DGVH 1MFBL 1KYOJ 4U1GB 1C7SA 5C0GB 1IC4L 3SGEH 4Y4FD 2J3SA 1X5HA 1J1XL 3N85L 4ZNCD 2APXA 4NN6B 2XQBL 2OTWB 3MO1A 4S1SH 2UZYB 4QRPE 1A9EA 3G5VA 4CVWA 4I3SH 2HTKD 1I8MA 4PRPB 3TBWA 3O41B 3KYAA 4PLKD 4HCRH 2NXZB 3C8KB 1UZ8B 2J4WH 3BP6B 3GSOB 4FNLH 4GW5A 1JV5A 4QXGL 3S5LB 2L0DA 4ZTPL 4JPWH 5JPNA 1SM3H 4WHYH 5GIRB 4DCQB 4JDZB 4NCC1 1VENA 4DEPB 1FVCB 3IXAB 4UUJA 2AI0H 5EBMA 3DYMA 4WO4A 4EUPG 4V2BA 4P5TA 1AY1H 2JLLA 3NABH 5EC1B 3UTPD 1TENA 2C26A 3MRIA 3T2NH 1RU9L 3MLWL 2XT1B 4XNYL 5E4IA 3ARDD 1CZ8H 5B3NA 2J12B 2WWMC 4X6BB 4G9FB 3GIZH 4G8EB 3QP3A 5E8EB 2ZOKB 4MA1B 2E27H 1J9CT 1Z9MA 1M7DA 1G9MH 1RVFH 4G5ZH 3MCLL 4F80A 2XACC 3WDHA 3WS3B 4RMRA 3O3AB 2JJTA 1RZIA 2W65A 2IANA 5F6HI 1RIVH 2W9LA 4YFLI 3GK8H 3LEXB 3U6RA 4HJ0D 2J6EA 3PGCB 4GBXB 1ZT1B 1O7SA 3C9NB 3O45B 3QEGL 5AEAA 1SJEA 4RIRB 3R06B 3BISA 3KXFD 4TTDC 1TJGH 2OZ4A 4L8SA 1YEHH 4U0RC 5C0EA 4MAUH 4P46D 3LN4A 5KW9H 2H41A 4CN6A 2BMKA 1Q1JH 5ANMB 2EH7L 1MJ7H 4O58L 1IGFH 5D96B 5I19L 3WDIA 4GLRI 1NFDA 4W6XB 1F3DJ 2ZUSA 3ZE1F 3RWHB 4BSWA 2DQTL 3N06B 1WCBA 3MLPA 4NHCH 1NDMA 2UVFA 4APQA 4P4RB 1TZHB 5IVXE 4O2FA 1RSFA 3QEHB 3RZCC 5DYOA 4JO3L 5HXMA 1S5IH 3FQNA 5KSBB 4LARH 5BRZD 3TNNB 4Q9RH 1JTOA 4GSDL 3VXME 2ENSA 5DVMA 4F57H 3DGGB 5DRNA 3FONB 4S2SA 1LGVA 4LDOB 3U48A 3QWQB 4HXAL 5HYSA 3SO3B 1ZVSB 1QEWB 5D6DA 4HK3N 3NCJL 5EFIB 2AERT 3RWEB 3ARYA 3MRKB 3HC3H 4P59H 2HKHH 1IQDA 1NBVH 4U1HA 3QNYB 5B38G 2YZ8A 1UVQA 1G7LA 1VFAB 1EZVX 4U1SA 5MHSD 5LGJB 3RIFK 3HZKB 4QRUA 1I3GL 1V8HA 3QHFH 3C6LA 1S7RB 3LZFH 3J8F7 3BP4A 4LAQL 1IAKA 2AV1A 5DI8B 2VXTL 2HLFD 4YGVB 1NBYB 4I4WA 5GRVK 2VQUA 1T3FB 5GGSA 2DQHH 5JR1L 4Y88A 3VXSD 2ZG1A 4MMXC 5AYUH 5F21B 5FYLE 4Z95H 2Z4QB 5GHWH 4X9HA 2JF1A 1KCUH 4LLDA 5DJXB 3RAJH 3WO4C 5EU6B 2JK5A 1U8HB 2NY3B 4FQQB 2B5IC 5MEPB 5T3XL 3RPIB 5IBUB 1B4RA 2VJXA 4PRHE 3HMXH 1EHNA 1QFPA 4Q6IB 3SDDD 2E6PA 4JFYB 3PABB 4U49A 2D4DA 3KPTA 4YDLC 1JI1A 2H32B 3V7MA 4PG2C 2GITB 4J3SA 5CS7A 5E08H 5CJOL 4OFPA 4Y16B 5J0BA 3GSRB 1PKQE 4IDJL 4BSVA 4GXVH 1MNUH 4PGZA 2G60H 4K7PY 1WT5A 4A2LA 2HN7A 3HPLB 4ONFL 3FT2A 3BQUB 3T04D 1MRCH 1XF3B 1B3JA 1MCWW 4XAKE 4FXGA 5C9JB 5D71H 1I7TA 5TJWK 1HCVA 4LSQL 4HT1L 1SEQH 2H26B 3KWWA 2P45B 4LKXB 3PP3K 3S96A 4BA8A 5E99L 4Y0GA 4QOKE 4R0LC 1YY8A 2A6IA 1WC7B 3MCKA 5DUMH 1OAKH 4X0KA 3TT3H 3H8NA 4L8CA 3MBEC 5ERWA 5JLZA 5E1HB 2VR4A 4AQ1B 1WQVT 1ZTXH 3UC0L 3QWOA 1MVUA 4KROB 3SDXF 3SDCB 1JF1A 5EZIL 5F3HA 4LSDA 4NUJA 1DEEB 4JG0H 2J8UF 3GBMH 5IW6B 1MPAL 1WBZA 2A74A 1U8LB 2XV6B 4OD3H 2IBZY 4F15B 4V1DE 4QRRA 4X9IA 4M5YH 3OXRB 1HH9A 2XFXB 5HY9A 2BVYA 3NIFF 1DSFH 1KCSH 4JY6B 2VDOL 1IC7L 4MQTB 1P4LB 3CPLB 4JPIA 1A6TB 1ND0A 5EUKA 3CVHL 2N56A 4ZFOB 2DQCL 2QJDA 3C5SA 5DDHB 1FGNL 5DRWB 5I75B 3HNTL 4ZQKB 4CVXB 4XNQB 1U8IA 4QY8B 1YC7A 1H9VA 4C56E 5J1TC 1NJ9B 3OKLB 3V52H 3VMOA 3VRIB 3O3EA 4PD4J 4O2EA 4DGVL 4NN5B 3HI1A 4KUCF 2W0LA 3TNMB 4WFEE 5CEYB 1DQQB 4N68A 3VXUE 1IFHH 2B2XH 2BXYA 1BBDL 5JHDD 2R0KH 1BQUA 2RB8A 1H8NA 2IPUK 1JVKA 3LKRA 3FB5A 3BZFB 4XCNA 3BDYH 5HD8C 4S1SL 3MUGA 2AJXL 4PR5A 4OLVH 1FO0H 4IOIA 1RUMH 1H3GA 4N5UA 4I3SL 4PFEA 1AHWB 2JJSC 4N0FB 3IFOA 4P9MH 4HX1A 3RBGA 3BH9A 5HYSG 1XCTA 3T4YA 2J4WL 4FNLL 3WJLC 4QRSA 1I7RA 3MRMB 4JPWL 1SM3L 2VN4A 3QFDA 1CU4H 4GG6F 2ADFH 1BEYL 4LIQE 4ZUVB 3MR9A 5HJ3A 2IBGA 3U9UA 2GAZA 4MJ4A 2CLRA 2AI0L 4ODUB 3X11A 3QFJD 3X14B 5SWZE 2CKNA 1AY1L 2ATPA 1V3LA 3NABL 4NM8H 3BJLA 2OI9B 5D7IB 4LHUB 3VXOB 3SGEI 4YAQA 3VDAA 3CNKA 4MGXA 4O2CB 1CZ8L 3UPRB 4U7MA 3QULA 1DBJH 3L3IA 2D0HA 3GIZL 2DQFA 1QSFA 1U3HD 2E27L 2UWEB 4IHOB 5C6PB 1G9ML 5AAMA 4G5ZL 4ELMB 3P73B 1JGDB 4PJHA 4JFQA 5DD0H 3QNZB 4JKMA 2I07A 3QG6B 3DIFB 2A6JA 5FA3A 1RIVL 5BQ7B 5IOPA 4MD4B 1X5AA 4PRDA 3S88H 1T7WA 1LEKB 1K4DB 3SBWC 4D9LL 4IMLA 2EIEA 1BM3H 3OJDA 4FXLA 3FAXA 3OAZK 2CDFA 1J11A 3BT2L 5CHNA 3GB7A 4ORZC 2YC1A 1TJGL 1YEHL 1IM3A 4MAUL 5KW9L 4P2QD 1DBMH 1H15B 1FGVL 1I9JH 2Z8SA 4RGNB 5HGHA 4Y4FA 4Z7UB 1D6EA 3RVWC 1IGFL 3B4NA 4Z7OE 4JFZH 1NGZB 4ZO8A 4UOJA 5IQ7H 5ISZE 1KJ2H 3SCMC 1ORQB 5IMKB 2PCPB 1EGJL 4FFWD 3WLBB 2H6PB 3WUWG 1HDMB 3O3UN 3SN6N 1S5IL 4LARL 4Q9RL 4J12A 3FRPA 5GRJH 2XQYG 3HE7D 2C9AA 3DX8B 1HHKB 1HILB 5I6XB 4ZSOA 1G9EA 1BLNB 2QSVA 2I5YL 4OKDA 2W9DH 3L5XH 1K3ZA 2XXCB 3O6FD 1C5DB 5DMKA 3S4SB 1E27A 4U6YA 5DA0B 1OTSD 3KYKL 1QP1A 4JKLA 4P59L 3HC3L 2HKHL 1FQ9C 1NBVL 2F53D 4MQSB 3ARDA 4HUUA 1T7ZA 4X8JA 1J8HB 1QPXA 4RSVA 2R39A 1BD2D 3QHFL 4O51B 4F7PA 3RVUC 3V6ZB 4HIEA 1MCJA 4NOBA 3LZFL 1PSKH 3PUCA 4LQ1A 1V3MA 1H8SA 4PB9H 2GT9A 3QXDB 3BAEL 5IF0B 2AK4D 3ZKSD 3PQYB 4DWHA 1DBKH 2DQHL 2PYEB 5JMRA 5AYUL 4Z95L 2BVQA 5GHWL 2YD2A 1KCUL 3RAJL 1YN7A 4MDJB 1ETZB 1F3JB 2WWKT 1CFTB 1U8PA 3T65A 3PWUB 3HMXL 3MJ7B 1SEBA 4OFKA 3HRPA 5DMYA 4KJWD 5E08L 1FYTE 4RMQA 1FLRH 4GXVL 1MNUL 2GI7A 2G60L 3DVFA 2DN7A 5HGAB 3NZ8A 4F58L 1MRCL 3QDJD 2BVOB 4OI8A 1MCLA 5D71L 2A6KB 3TZVC 4JFHD 5GSRB 1SEQL 5MEOA 1JPST 5IK3A 3SKMB 4UDUB 1V3KA 4P9HH 3UXFA 4LLMA 5C0CB 1AH1A 3GNMH 1WFOA 4ZUTA 1OAKL 4LLUB 3PGFH 3TT3L 3TN0A 3DV6A 3DVGB 4XP1H 3F7YB 5IVXF 4Z0BH 3KNBA 4C4KO 4PY8J 3BGAA 2M8XA 1ZTXL 4MJ5A 1DE4B 5DHYA 4YXKH 5HGDB 3V2AR 3C2SA 4OV5A 4P4KB 4NQXA 1Q9WA 3LIZH 3EYQC 3BPOC 3C87A 5FM5M 5DEFB 1CD0A 4KKLC 4JG0L 4X7CC 3GBML 4NKIH 1DN0B 4I0KA 4E42A 5BW7C 3B9AA 3JWOC 4OD3L 2AEWA 1B6UA 4OD2A 4EDWH 4M5YL 3MRLB 1DSFL 1KCSL 5FB8B 3G6JA 4OFIA 2Y9RT 2VE6A 3MRPA 4MYWB 2AQ3A 1CS6A 2VMFA 5DFWH 2FHCA 3ZKQD 5FO7A 2ZZUT 3I84A 2UZIH 3CSGA 4F9PC 4EI6A 5E5RB 2OQJA 3RIAF 2GFBB 5FYLH 4JHWH 3IJYA 3LN5B 1C5CH 4PJGF 3UBXI 2R2HB 4OZIE 1VACA 3SDDA 5DGQA 3QA3A 1IFHL 2B2XL 2HA1A 5INDB 3KPPA 4L3AA 3BDYL 3UTSD 3FRPG 2YUXA 1EFXB 3T0AA 1IGTA 4TTDD 1QKZL 4OLVL 2VLJD 1FO0L 3QJHA 5FK9A 1RUML 3S35H 4DZ8A 1MCNA 1S3KH 1HSBA 1A9BB 3DO3A 4HWNA 1RZJH 4FN0A 5BS0E 4P9ML 2F58H 2YUZA 4MAYC 4XBEH 4Z77B 2NX5B 4K3GA 2EIZA 5E8PA 4JZNA 5HYQA 1DFBH 2VXUL 5DWUH 3S3SA 2GJZA 3O0RH 4Z78A 5T3ZE 3CVHA 1CU4L 3CDCA 5D9SA 5DFTA 2ADFL 4D8PA 2AKRA 4QRTA 2NY5H 2C4FU 3K1KC 2KPNA 5CZVH 3U2SB 3TCLA 3KPSA 3CMOH 4PRAA 2C3GA 1X5YA 3N9GL 3P9WB 4X4XA 3RZCD 4PJ5B 3DBXA 1NCTA 4NM8L 2UYLA 3SDAC 2Y5TB 3ZT7A 3WCYA 4FQHA 3AXLA 4UNUA 3UZEA 4JFDE 1F02I 3VRLF 4EUPB 4J3TA 2HFGH 3EGSA 1UKTA 2P8LA 3HTLX 1TFHA 1DBJL 1MRFH 4MVBD 5BZDB 1DCLA 1S7UA 4RA3A 3QIBB 4GRWF 5LCVH 1UM6H 4XXDA 4OZFG 1FL6A 1G7PB 1R5IB 5DD0L 1TJHH 3D39B 4QRPD 5I16A 1R3LB 3VFGH 5SV3A 1C7TA 4CAGA 1J10A 3S88L 3G9VA 4FP8H 3D2UA 2VDNH 1BM3L 3OJVC 3ESUF 2QQQA 4X6DB 5C0BB 2HJFB 3GKWH 4NYLB 2RFXB 2C1OB 5HVWA 2PXYC 1FVDB 4HGWB 5L8KB 4M7KL 2HRLA 1DBML 3OKNB 4R3SA 1E4KA 5JDSA 5JHDA 4OAWA 4X7DC 5C7XH 1N7MH 1XT5A 2NLJA 4WY7H 4Q7DA 4I18C 1GZQA 1ZVYA 2FJFA 4NKOB 3BHBB 4JFZL 5J1AA 4O9HL 4TUJB 5CD3B 1KTLB 1GGUA 3TO4A 1MWAH 5IQ7L 1KJ2L 1JNJA 2AXHA 1ZHNB 1AO7B 1OB1B 2OJZH 5C07D 2EDHA 3B3IB 5F44A 5KVDH 5EU5A 2IGFH 4HJJH 4CVUA 3TPKA 4JY4A 4CNIA 3ULSA 5GRJL 5DJAA 4WW2B 2NY0C 4BFBD 2ARJQ 4JG1L 5EBLA 5JOPE 1KIPA 4OLYH 2EXYC 2W9DL 3KLHC 4MJIE 3QFJA 4JFEE 4LIQH 3ILPB 5B22A 3BP5B 1HQRA 3VXRB 1R5WB 1CE6A 4XVTH 5ESVA 5EG6C 3QCUH 3LSOB 3GSNH 4NQDA 1E4XH 1U3HA 3MRBA 4P48A 4RFNB 5B38B 1OWRM 4I5BB 1S7SB 4KUZH 4HEPG 1OTTC 3MBED 4WUUE 5E9DE 32C2B 2DLEA 4XTRC 3QXTA 1EGJA 4KK6C 2VXVH 4ZO6A 5F1KC 2PUQT 4P3CL 1FNEB 3FO9A 2BK8A 4GKSA 1CFQB 1DQJB 3IVKA 3WXVH 2YHGA 1NC4D 3HG1E 2VKXA 2DYPD 1A7NH 2EKJA 1OF2A 2Y36L 4F8QA 4C83B 5I15H 3VXMD 3MO1B 4P2QA 5JW4Q 1BF8A 3EO9H 3A6CH 3G5VB 1I8MB 1YPZF 3ALWA 3T77A 3WEXA 4QHNB 4HUMB 1JK8B 5IB4A 2NR6C 3QXWA 5DUPH 2ZUXA 4XMKL 4KRNA 1GC1C 5HI5D 1B4JH 1JV5B 2R23B 4QEGA 4XNMA 4U1LA 4ELKA 3QIUC 4FMKA 1CFVH 2JCCE 2DMKA 5F88B 3DX6A 4WWKD 1ORSA 1KPVA 2WIIA 4TSCH 4UV7H 4UUJB 1QFUH 1IKFH 4FZ8H 3IB4A 5EBMB 5CJBA 3T0EA 5HD8D 4WO4B 4P5TB 4EJ1C 1C1EH 2FCBA 2ORBH 1RULH 4P9HL 4RX4D 4X5XA 3EJZD 1IVLA 3MA7A 3DETC 1F13A 3O6FA 2WSKA 2AQ1A 3GNML 3U0TA 2D4FA 4KRPB 3PGFL 4ZAKC 1YEFH 3THMH 4XP1L 1A6WH 4PV9A 5E56A 4Z0BL 3HAEH 2EDEA 1M7DB 2QQKH 2AJ3A 4OLWH 1CDHA 1ERNA 3HMXA 1KTDA 3LRHA 3PL6C 3C8DA 4F7TA 3KAAA 4J7RA 3ULUE 2EIBA 3D3VD 1NGXB 3QDMB 2OXHA 5EUOA 2F74B 3IFPB 4JZJC 4NKIL 1T6VN 2SEBA 1BHGA 3QEQB 5C9KA 2Q7YA 1SJEB 4EDWL 1DQML 3VD4A 4I0PC 4Z7VB 4J3XA 5DK2B 3MJGX 2AK4A 4L8DB 4DGIL 4PGBB 2P43B 1N59A 4MNQB 3T1FA 4Z8FH 4YBHA 5D7LB 3PHSA 4XAKD 2DS4A 1IC5L 2YKLH 1A6AA 2MTPA 3L7EA 4R4BA 4PJ9C 4OF5A 3CH8A 1NFDB 1FIEA 5CINH 2R9HC 2UVEA 5FYLL 1C5CL 3UBXA 5DLML 4AH2B 3MLZH 1HOCA 4MA7H 4QOKD 4BSWB 3ARGC 2IPTH 3BKJH 4Q0XL 3GMRA 2AJZB 3G6AB 3DMMC 4O2FB 1BP3B 1UEMA 1LNUA 1NPUA 1SHMA 2ERJB 5F71A 4U6TA 2VDQH 2BSRA 1S3KL 1T0MA 4PJDF 5ALBH 1RZJL 3FZUC 1K8IA 2F58L 4XBEL 4U6VH 1Q9KA 2ED9A 4Z0XB 5SWSE 3O9WC 4EN3B 1DFBL 1LE5A 5DWUL 5HYSB 4JB9H 1D5BB 1MLBB 3FFCE 3O0RL 4V1DD 5F1SA 4YFEA 5IEHB 1GPOH 4U1HB 2NY5L 4LVNC 5CZVL 3MX0A 1IM9B 4N8VA 3FQXB 1UVQB 3DECA 4WFFD 1LILA 1EHAA 4ZOCA 3SCMD 3IGAB 3CMOL 5JTWA 2EYTB 4M1GH 3BN3B 4QRUB 5D5ME 1R3KA 1U3JA 4YHNB 2O5ZH 4HKBA 2G9HA 4WDIB 3I3EA 2HFGL 5FECA 4WV1A 5DVKA 1UB5B 2P8MA 1D9KC 2AV1B 1MRFL 4FQJH 5EIIB 4F7EA 2MPAH 3VXUD 3F58H 3BDXA 1KYOK 5LCVL 2KDGA 4I4WB 3O8XD 1FO0A 1UM6L 1TJHL 5GGSB 3VD7A 4CMMA 2CO6B 4GAGH 4E41E 2FH8A 1GCFA 3PE9A 2VC2H 3VFGL 2R0LH 4MJ2A 3ULVE 2JK5B 4FP8L 3H7LA 3NBNA 5AG8A 3HRZA 1T21A 4P2OA 1T1WA 2VDNL 3RVUD 2FL5A 1UXWB 2CLZA 2P5WE 3GKWL 1ZLUK 3T3PF 3V0WH 5D1ZC 2P5EB 1KPRA 4I2XA 4PJEB 3MUJA 3WNMA 3VFOA 2VLKE 4PJIA 5E03A 4XCFH 3L3HB 2HLAA 2Z31C 1YEDA 4MMZC 3A67H 5C7XL 1N7ML 2FRGP 4U31A 4BSVB 3TYFA 2BOCB 2ZSVA 5SWZD 4WY7L 3NFPA 3LH2H 1KUMA 1OAXH 2VLJA 4ZUUA 1BQLH 2ZCLH 5GJTL 2E5EA 3MRJA 4PRPE 1SBSH 1MWAL 3KWWB 5I1LA 4Y2DB 2OK0H 4LCCC 5F89A 2F54B 1KN4L 4PTTB 3P77B 2OJZL 4MNGB 5KVDL 3QRGH 1YY8B 2IGFL 4HJJL 3EYVB 4LCUA 4U6XA 4G6MH 4L8CB 1U36A 2K9UA 4U2ZA 5ERWB 5JLZB 3TBYB 2AAVA 5C0RH 3WUWB 3N50A 3LRSA 2FEEL 3AGVA 2DJSA 2K3TA 5T3ZH 5KS9F 3QWOB 1MVUB 2OMBA 4OLYL 1OAYH 3BPNB 1FHGA 1HHJA 4KRMB 4LIQL 2A1WH 2BVPA 3KPOB 4NUJB 1A1NA 5I8OH 4FFZH 5HHNB 2BERA 4LSTH 4UMGA 2VISA 1IZKA 1WBZB 2A74B 2N4IA 4XVTL 1NEZG 4LPVA 4QRRB 3QCUL 4ETQA 4NUGH 2QBWA 3GSNL 1CGSH 1E4XL 5CILH 4G9FE 4JFOA 2D2OA 4WENB 4KUZL 4GKZA 1ND0B 1B2WH 5EUKB 1K6QH 1QFOA 2NXYC 1KJ2A 3C5SB 2X4RB 4QRPA 5E4EC 2J1KA 4XVUC 3MV8B 2HKFH 2VXVL 5HYIA 1PZUB 3UBXG 3V7AG 3DI3B 3VXPB 5CSZA 5ISZD 1EJOL 4NP4H 4PBXA 3O3EB 3EYQD 4O2EB 4C55A 3U9PH 4KKLD 2FEEI 1XIWB 4YPGA 3WXVL 1IE5A 5GRWA 3FB5B 2WMPA 4XCNB 1HINH 2D03H 1LO4H 4PJCB 3NN8B 2GHWB 3EO9L 1CL7H 2N7BA 3A6CL 4ODVH 4XMPH 1N6VA 4EKXA 4HX1B 3BH9B 4X6CF 2L4OA 1WBXA 3RL2B 1E4XI 1XCTB 1KFAH 2QR0A 3T4YB 3LKSB 1B4JL 4QRSB 4RMUA 1IAMA 4Y19B 1CFVL 4KH2A 3QUZA 1IGCH 1A2YA 1OHQA 2MHAA 5GRYA 5GXBB 4EDXB 3MR9B 5HJ3B 3U9UB 1EVUA 4TSCL 2GAZB 3EO0A 4M7ZB 1QFUL 1IKFL 2CLRB 5J13C 3PV6A 3X11B 5KSBE 5BV7C 5EZLA 4PG2A 2HJLB 1REIA 1C1EL 4OUOA 4XZUA 2ORBL 3PIQB 4GXUM 3MUHL 1RULL 1NCWH 4BZ1H 4YAQB 3MACH 4U1GC 3MRCB 4N1CA 3CFDB 2XWBB 5DJCB 3C5ZA 1KIRA 1OP9A 1YEFL 1JPFA 3L3IB 1FN4B 2NZ9C 3FQWB 4HKZA 3THML 1A6WL 2DQFB 4NN6C 1QSFB 3GSVA 3R1GH 2RCSL 1LP9E 25C8H 2QQKL 4GXUN 4OLWL 4PJHB 4YXHH 4L29B 2Q6WB 5ENWA 4I3GA 3QJFB 4R0LA 2A6JB 5FA3B 3MXWL 2CLVB 4PRDB 2NXZC 1MHEA 3Q5OA 3L5HA 2DLIA 2A0LD 5DRXB 2H9GA 4YHLH 4IMLB 1JE6A 8FABA 2CDFB 4NO5A 3SDAD 3MFGB 4HMEA 4Q9CA 5CHNB 1ZT7B 2YC1B 1FYTD 2XZCH 3MCG1 1LK2B 3V6BR 3B9KC 5IVZA 4Y4KD 4DEPC 4Z8FL 1DANU 2GKIA 2X4NA 3MOQA 2YKLL 3LKPA 4Y8DC 1OARH 2QL1A 5ECJE 4LAJH 5EU6E 3HR6A 2IH3A 5CINL 3T0BA 2ZP0T 4BH7A 4JR9H 2XWTA 1BOGB 3WN5A 3MLZL 4MA7L 4MA1C 3BKJL 3RNQB 1CGWA 1CFNA 2FDBP 2YXMA 3AMKA 2F5AL 2H45A 3ZTJG 5A3IC 1AJ7H 3L3JA 2PXYD 2NW2A 3CXHJ 1QRNE 5ALBL 2RJMA 4UT7H 4U6VL 2ESVB 4WWKA 2BY0A 4P2RB 4JM4H 4K2UH 5FKAB 4HS3B 1JYWA 3RI5F 4BFIB 3FB8A 4JB9L 4U6YB 3WNLA 2HWZH 2R1WA 5JOEA 1TVHA 1YZZA 4RX4A 1AGBA 3G04A 1XGPA 1GPOL 3DJ9A 5JQHC 1BFOB 1KB5H 4B7LA 4HUUB 4QO1A 3GBLA 4F7CB 4QNPF 1T5XA 4CKVX 4ZD3H 4M1GL 3RWJA 1A3RH 5D96C 2ZNXA 4F7PB 3IRZA 2OR9H 3U83A 2O5ZL 4F3FA 3BUYA 5TH2A 5FUOH 1CDBA 1BZ7A 4ODBD 1QO3A 5EZJB 3S36L 1QBBA 2NY0D 4PRHA 1SBBA 4QTHA 3L3DA 4FQJL 4PD4K 2XRAL 3MRRA 4WFHE 4D0BB 1TDQA 2MPAL 3H7BB 2GT9B 4NO3A 2EXYD 2Y25A 3ULUH 5GRUH 4Q74A 2HT2C 2BDNH 5FGRA 1FPTH 2Y1VA 4GAGL 2I27N 4OZFB 2VC2L 3NH7L 3ZKXB 1YN7B 5GS1A 2G2RB 5BS0D 4P2CG 2VABB 4JQVC 1J0YA 3SO3C 1U8PB 3B9VA 5DXWA 1OTTD 4XCYA 3MLSH 4X4YA 1M71B 4M3JA 4XTRD 1T20A 2LE9A 5T3ZD 3WFHA 1Z0MA 4EOWH 1X5JA 4QOKA 3AY4A 3REWB 4GG8A 4HS6A 1YYLH 3TESA 1ONQA 4X4ZA 5TE6L 4XPGH 2X4UA 5K59F 3D87B 2WINA 3ARUA 2FZ3B 3F12B 3MLRH 5ESQA 1OAXL 5K9QG 4M6OH 1BQLL 2ZCLL 3GSQA 4KV5F 4JFDD 2JE8A 3GGWA 5I17B 1SBSL 2OK0L 2DQGH 3B8YA 5IK3B 2BZDA 3QUXB 5IHLB 4LLMB 3A6OA 3QRGL 1MFEH 3HUJE 3UYOD 4ZUTB 2MOVA 4Z7WB 4V1DA 2NR6D 4G6ML 2E9IA 5TFSH 5FCUH 3TN0B 3KLAA 3KNBB 5C0RL 2NY3C 4OCLC 2PNDA 1S9YB 3IDIA 4KGJA 5GGSY 3FO2A 4G43A 5T3ZL 2FIKA 4KKAC 1OCWH 3QIUD 4NQXB 4Q6IC 1OAYL 3Q1SH 2A1WL 5D7JA 1W0WB 2R29H 4U1KB 1TVBA 3SKNB 3UYRH 4MXQD 5I8OL 3JXAA 4U4BA 3KJ4B 2X4TA 2W0KA 4FFZL 4C56A 4IOSD 5D7IE 4E42B 4LSTL 5AAWA 4M1CC 2PR4H 1I4FB 5KOMC 3HPJA 1CGSL 2FB4H 4QHKJ 5CILL 1AC0A 2UWEE 3G6JB 3O8XA 3BQUC 3RL1B 3IDNA 4JANA 1B2WL 4IRSB 3MUY1 1K6QL 1MWAA 3VI3E 3RFZC 5CIPB 2HFTA 5J1SC 4ZXBB 3RUGF 2HKFL 2UY7A 2JJWA 3PL6D 4TUOA 3MRQA 3HC4H 3WJJC 1BVLA 4NP4L 4U05A 1VGKA 2R2BA 3IJYB 3RIAK 1DEDA 4CU8A 1BIHA 3U9PL 3ULVH 4WUKH 1F3DH 4U2YA 1U92A 5I1AA 4NC2B 3KPPB 1GZPA 5FV2A 1HINL 2K1MA 2D03L 4KROC 2JB6B 1LO4L 1PDKA 3VH8A 4I0PD 3SDCC 5BV7H 1IGTB 5FK9B 1CL7L 4RGNE 1DVFB 4BFEA 4XMPL 4Z7UE 4MJID 4JKWA 4HV8B 4JREB 2EE9A 4F15C 3GSNA 5F97E 4QLRA 4NHUA 3TIEB 3H9SB 4UT6H 2WBKA 4PJ9D 2GJZB 2R9HD 2FGWH 4Z78B 3VFPA 3LHPH 3CVHB 1U8JA 5D9SB 3ARGD 4G3YH 4D8PB 1YJDH 5EOQH 3QO0B 4AIZB 4YQXH 1JI2A 5I75C 4WUUD 5E9DD 3DMMD 4YC2C 3KPSB 2VDMH 4PRAB 3PWPB 5T5NF 3BX7C 4TSBH 4X4XB 4NWTH 2EDBA 5CCKH 3TBVA 4NN5C 1NCWL 4BZ1L 5F7KC 3MACL 4FQHB 3FZUD 2P8LB 4YHMH 1JWSA 4AENA 4FTVD 4YHKH 5DR5L 1QSZA 1IAIM 1HN1A 3R1GL 1CL7I 3HG1D 25C8L 1U58A 3ARXA 1CI5A 4OSUH 4YXHL 2HT4C 4JHBA 1HQ4B 5KANI 2R4RH 5CP3H 1AHWC 1YUHB 1P1ZA 1J8HE 4WTWA 5I16B 2BSSB 5TE7H 4MLSA 3BIKB 4LSSH 4FQLH 4OIBA 5KVMC 3QEUA 3D2UB 2VQ1A 4EVNA 3ZDYE 3RWIA 3OGOE 2DJUA 3LKNA 3AS0A 3AAZA 5ISZA 2XZCL 2V5SA 1OWWA 1D9KD 4LSVL 4PP1C 5I30H 2R69H 4DAGL 5C92A 2PYEE 3KJ6H 5JDSB 2KQNA 5CGYC 5F9DC 2V7NA 4CJ0A 3QPQC 4HGMA 4TQEH 5K9OA 1OARL 2NLJB 1JHKH 1P2CA 3EYSH 3WFZA 5E2TH 2FJFB 1P7KA 4JR9L 4NZRH 5J1AB 1K5NA 1ZGLA 3HAEA 1QBAA 4YEEA 4AQOA 4NC1E 1MCBA 4M48L 3OHXA 3ABZA 1A7OH 2YSSA 3REVA 1X4XA 5EU5B 5D1ZD 1AJ7L 2EC9U 3W39A 1X6NA 4JY4B 4HWBH 4LCYB 5KSVA 4G42A 1PZ5B 3FB6B 3ULSB 5DK0B 5DJAB 4LLQB 1C12A 2OYPA 2Z31D 5HSFA 4UT7L 4K8RC 3UCRA 4JM4L 1QR1A 1KIPB 3LCYA 4K2UL 3KVQA 4FQ1H 4KJPD 4KXZH 2HWZL 5GGQH 2ZKHH 1CGUA 2DWDA 3DUSA 1KB5L 1A4KA 4RGNC 3LAFA 1RY7B 1CE6B 5C0CE 5DRZA 4ZD3L 2D7MA 4NQDB 4YDKH 1A3RL 3LRGA 3MRBB 5EU3A 3BFOA 4F37F 2OR9L 3P2TA 1S9XA 5JIIA 3GUTA 3GIVB 3K3QA 5FUOL 1LO5B 1NCAL 1S9KC 5FYJE 1IMHC 5I76A 1UKQA 4G7YH 2MKWA 3K7UA 4C54A 1ZA6B 5DD5H 3ULUL 5FO9A 5GRUL 5DC4B 2BDNL 1H5BA 3IDYC 3SDAA 1FPTL 4GKSB 4KAQL 4P23B 1WAAF 4U1MA 1FYTA 2GY5A 3VH8G 1T03L 5ABDE 5I6XC 4Y4KA 3WDJA 4MA8H 1GGYA 1ED3B 5J89A 4LRIC 1C5BH 2EE3A 1BECA 2QSQA 3MLSL 3NMEA 1DDHA 2WUCL 3T77B 3WEXB 4CJ1A 2C3VA 1RFDH 4LRNH 1JBJA 4XVUD 3VWKA 5CSBA 3BKYH 3K2UH 2ED7A 4NSKA 2XIDA 3AREB 5IBLC 4ELKB 5J9PB 1YYLL 4HXBH 4HF5H 3EKCA 2AS5M 3NACH 1R5VA 1CD8A 4XPGL 5IB1B 1MCHA 3ILQC 3MLRL 1ORSB 1KPVB 2WIIB 4M6OL 3OB8A 3T0EB 4JFXA 2DQGL 2NX5E 2V5MA 2PYFA 4X5XB 3MA7B 2QEJA 3BGFC 5HYJB 4GRLB 1MFEL 4LNRA 3U0TB 4H25A 5E8OA 5FCUL 4RGOH 4PV9B 1J1OH 4E41D 1QFWH 4I9WE 1EH9A 2AJ3B 2APVA 1QHOA 4TVSa 3ULVD 4I48A 4F7TB 1JYXA 3UJJH 2CUHA 3Q1SL 1UC6A 3HNVH 4NC1C 2GUOB 2R29L 1W72L 5ID1A 4FQIH 2W91A 3UYRL 5EUOB 2P5WD 2VAJA 1I7ZA 2AEPH 3CSPA 2SEBB 3ES6A 1KB9K 4OZIA 1F6AA 1OW0A 2FB4L 5J56B 2ARJA 1OQOA 4PJAF 5ITFA 1NEZB 3DUUA 2X44D 1N59B 2EDLA 3T1FB 2NZ9D 1JF6A 4DVRH 2EYSB 5FO8A 3D39E 43CAB 4RA0C 4FXKA 3OAYH 5BS0A 4PRPD 3HC4L 4IRZH 1T7VA 2V2XA 3HI6H 3UBXB 3BZ4A 4NO2A 3WL9B 1L7TH 2NXZD 3ULVL 1HOCB 4WUKL 2VZTA 1M05B 2Q20A 2FJHA 2R0ZH 4X6DE 5C0BE 3GMRB 1KJVA 4N5EC 4UI2A 4X98B 4RWHA 4CADA 2OTPA 1LNUB 4P4KC 2FBOJ 5DHVA 3UROR 3I85A 2BSRB 1DUZA 4LCIH 5F7UA 1WK0A 1L4IA 1K8IB 2P48B 4KI5E 1FL5A 1X44A 2MCPH 5A2LH 3DROB 2NW3A 1CG9A 2OXGA 4ALAH 4I77H 3EYFA 4XNUL 2FGWL 4NKDA 3LHPL 1MLCB 4G9FD 1AO7E 5HHPB 4NQVA 4G3YL 3NAAH 3GMQA 4LASH 1YJDL 2EDRA 5EOQL 1FC1A 4YQXL 1VFOA 2VDML 3B2UC 5EULV 3WIHH 2ATKA 5A3ID 4TSBL 4NWTL 3BP7A 1BFVH 2HVJB 2UV3A 5CCKL 2A6DA 2G9HB 1MJUH 2IH1A 5KAQG 1G7QB 4HLJA 1V5JA 4K9EH 3IDGB 5FECB 2RIKA 4YHKL 4H20H 4GBXD 3BZDA 4F7MA 1WF5A 3X12A 1C8PA 1RJLB 3VXRE 4OSUL 2R4RL 4YUEL 1A6PA 2FO4B 1UWXK 4CMMB 4G9DA 4ZYKA 3CU7A 4FQLL 3DARA 4QHMA 2DQUH 3AS1A 1T21B 2ZCHH 1T1WB 4P2OB 3WUZA 4UINL 2CUMA 5M7QA 5C0FB 1MQKH 3JWNC 2CLZB 2HH0H 2VZOA 3FMGL 2O93L 3K8MA 4I2XB 2KQMA 4YXLH 2GJ6E 2R69L 2AW2A 1MHPH 4PLNC 1FDLH 1RK1B 1T0NA 2EDFA 2HLAB 2Z8RA 1TNMA 1FNAA 3QDHA 1HXYB 3CMGA 4BJLA 4K8RH 1ZLSH 3EYSL 2CKBB 4N0UE 4ELMF 3V95A 2LAGB 4RMVA 5E2TL 3X13B 4NZJA 3WS6A 3BKCH 2P49B 1YDPA 1PG7X 4LKCA 4K3EH 4MJIA 3QIBC 4JFEA 4BKLB 3MRJB 1SJVA 5F89B 3PDOB 3TH4T 5HDLA 2QADB 5CP7A 1A7OL 4PJ9A 2R4SH 3VFWA 2VH5H 4U6XB 4IJ3B 4NZTL 1R3JB 4HWBL 1II4E 2NY1B 3I2CH 4UU9B 3V8CA 3AC0A 1J86A 4POZC 5E9DA 3DMMA 3TFKC 1NBZA 4PS4H 1HHJB 2VLMD 5F93C 5C2UB 4FQ1L 1LK3H 5GGQL 2XYCA 1FZMA 2R0WH 2ZKHL 1ZLWH 1A1NB 2IQ9H 3K1DA 3PDGA 4PYGA 2X9XA 4LLYA 1OT1A 1ES0A 2IAMC 2VISB 1RZKC 4U1JA 1YC8A 3RTQC 3ZZ1A 4YDKL 3MRNB 4NCC2 4ZPVA 2AVGA 3MOBH 4FRWA 4K3DH 1TJIH 4ERSH 5EU6D 2NY3D 3HKFA 5K9KA 4HUNB 1Q9LB 2DIJA 3WLWC 3V6OC 4C4KT 1JPSH 1E4WH 2X70B 3QT2A 4G7YL 4YWGH 3QDME 5DD5L 5H8DA 1AXSB 4OCRL 1WTGT 3T0XA 3QEQE 1I1AA 1BFSA 4WW2C 4M1CD 4Z7VE 1D9KA 3GMPA 4Y16D 1MREH 2JCCA 4MA8L 2E7HA 4MNQE 3FCTA 1U41A 2AXJA 1C5BL 1J7VR 3BQUD 5D7LE 1BBJA 4MSWA 3VD3A 1KB5A 2E6QA 4O00A 3SGDI 1RFDL 4LRNL 2J8HA 1WBXB 5DF0A 4Y4HA 3PHOA 1N3NB 2QR0B 3BKYL 1Z3GH 4JM2B 3TIDB 3K2UL 3ZDYF 5F7MC 4RFNC 1JZ6A 3JBG7 4HXBL 4HF5L 4HH9A 3NACL 3KS0J 2AXFA 3QUZB 1A2YB 4N0YL 3SY0A 1KPUB 5T1LA 3EO0B 5SV4A 1FSKB 1NCDH 3PV6B 3Q5TA 4KROD 2YA2A 5EZLB 3U0PA 4OF8A 4JEGB 3SDCD 4GMSH 2C1PA 4R90H 4XZUB 1Q0XH 3VFUA 4WFHD 1JN6A 2DRUA 3L3GA 4YFDB 3VGFA 2X10A 3ARSA 3C5ZB 1KIRB 1JPFB 1L0QA 4RGOL 4HKZB 1KULA 4WU7A 1J1OL 1QFWL 5F9JA 5TDPB 1WFTA 1EEQA 3MNVB 3R8BB 2AXGA 3N1MC 4NT6B 4LCCA 1WFNA 2EDWA 1FZOA 5C6TH 5KTEH 3UJJL 1UZ6E 3HNVL 4BQ9A 4M43H 2R1YA 5JNYA 4FQIL 2DICA 1DBBH 4KY1H 1GOGA 1MHEB 2E7CA 2AEPL 2WQ8A 3LPWA 1OP3K 3L5IA 5C0AB 5EZOH 4B5EA 3H3PL 4ONOA 4ODWB 2ITCA 1XR9A 3WFEL 5IVZB 5FYJH 4MQ7A 4DVRL 4NCDA 2Z8VC 2M1KA 4WO4C 5SWQA 2X4NB 3WXWH 2CGRH 3DSNA 4P5TC 2E9BA 2HT4D 3G5ZA 1KEGH 4FQ2H 4IRZL 4P5MA 2IH3B 4PJXB 4BH7B 2XWTB 5SWSA 3WN5B 1QFWI 1L7TL 4PJFA 3RBSA 3PGDA 2R0ZL 4OGZA 2O26U 4ZFOL 3FFCA 3WMSA 1KT2B 1CDYA 3CVIH 4DN3H 2P5EE 1OTUD 3P4OB 4PJEE 3T1WA 4DW2H 3U7YH 4OLEA 2ICEA 1W72A 4KVNL 4FG6C 2EO9A 1WBYA 4PP1D 3Q6GL 5D5MA 3L9RA 2MCPL 5CGYD 3VGGA 4ALAL 2MWCA 4I77L 4LHUD 4CW1B 5BVPH 5IWLA 1N2RA 3FB8B 2R1WB 3RI5K 3SDYH 4L8SC 2VR9A 1AGBB 2F54E 3GJFK 5T1DH 4MNGE 3VGAB 4XX1G 2ADGA 5C70A 1A4JA 1CN4A 1ZS8A 3DX9B 1T5XB 2F9BT 1A02N 6FABH 3WIHL 3VJ6A 4NQEE 3V0VA 3K80A 1BFVL 4KTEL 4F3FB 1MJUL 3BUYB 4YHYB 1BZ7B 1CCZA 4K9EL 4QTHB 3LKOA 4H20L 4APQC 4H8WH 4K8RD 5HDBE 4Q9QH 2P5WA 1YN6B 3UP1A 4NO3B 3SPVB 4NFDA 1B0WA 3E1F1 2VLKA 4L3EA 3LPFA 5EC2B 5ACZA 4QRRE 5C0GA 5L7XH 4RGND 4EUPH 3MZGB 1SMAA 1PVHA 5GS1B 5DEGA 2DQUL 3TT1L 4EN3C 3I02B 2OTWA 5LJYH 3JWDH 2N1KA 5DMIH 5D6DC 5I1GL 4M3KB 1MQKL 4X4YB 3MV8E 3SE9H 2HH0L 4MLIA 2EH8L 4PRPA 5I71B 1MCSA 3RWFB 3O41A 5IHZB 4YXLL 1MHPL 3AFLA 1FDLL 1Z9LA 3BP6A 3SQBA 3GSOA 4GG6A 2FNBA 3S5LA 4ODTH 2XKNB 4GG8B 4XVSH 1FNGB 4JJ5A 3C6LC 1ZLSL 1MUJB 1Y18B 2X4UB 3BZEB 3PWVA 4ESKA 4DCQA 5ESQB 4JLRB 5IIEB 4PJCE 3BKCL 3BI9X 3GSQB 1F90H 3EDDA 1FVCA 3IXAA 4K3EL 1EAPA 3GGWB 4W4NA 4G6JH 2Q8BL 3OQ3B 5CP3A 5C2BH 1GSMA 5EC1A 4WI2A 2R4SL 3S34H 2VH5L 4QRQB 4XVJH 3FQTB 1N4XH 2LV4A 4Y19E 4X6BA 3I2CL 1J8HD 5E8EA 1NLBH 3ROLA 2ZOKA 4RMWA 3IDIB 5IBLD 3ARVA 2BFVL 2FIKB 3GJEA 4PS4L 3RVXC 5E2WH 3WS3A 3S9DB 3ILQD 1LK3L 5D7JB 3DRTA 2R0WL 5C08B 4C56B 3LEXA 1QBLH 1URLA 2X89D 5F1IA 1XGQB 3PGCA 1OVZA 4GBXA 3C9NA 3PQYD 3O45A 4PGEB 1WT5C 4RIRA 2F5BH 1QSFE 3MOBL 3S36X 3OJ2C 2O5XH 5DVNA 4K3DL 5C0IB 1TJIL 3IDNB 4ERSL 3UYPA 4YK4C 2DLTA 4LMQE 4LVHB 5D2LF 1L0XA 4Y2DC 1E4WL 4TUOB 4YWGL 4WW2F 3SJVB 1BVLB 3K81A 4JRYE 4R7DA 1VGKB 4HWBA 5E94A 3ZE2F 2X4OA 1U92B 3RWHA 4R6UA 1GZPB 4XGZB 1MREL 5FKPA 1TZHA 3R8QA 2LU3A 2PF6A 2WW8A 2EXWC 3CXHK 5DQJB 2XA3A 3VH8B 3BPNC 4CDHA 2NYYC 1VB9A 5KSBA 3TNNA 5KVFH 1Y0LA 3AB0C 2W92A 1L7IH 4NHUB 1BJ8A 3W2DH 2DM3A 4AEFA 3FONA 1Z3GL 2Q3ZA 5C0CD 1XH3A 1ZVSA 1A6VH 5EFIA 1U8JB 2EDTA 3RWEA 3BD5A 4W4OA 5A40E 3BD3A 1LP9A 3GHBL 3HC0B 3RX7A 5MI0B 2L7UA 4N5ED 5I1EH 3QNYA 5B3JF 1NCDL 1VFAA 4B7IA 4P4KD 5LGJA 3BW9B 4YX2H 4OV6F 5FYJD 3TBVB 2AJYH 3MGTA 2ESVE 1ULVA 4R2GB 2DB8A 4P2RE 4NZUH 1JWSB 4AENB 5IBTL 5DVLA 3V5KB 5DI8A 1CYGA 1JHTB 1DR9A 1S7TB 2QTEA 4QYOA 4XPBH 4YGVA 2EYRA 1NBYA 3OB0K 5C6TL 1T3FA 5KTEL 1P1ZB 2EDOA 4M43L 1DBBL 3OKDA 2Z4QA 4AEHH 1AR1C 3B2UD 1U9KA 4KY1L 5DJXA 5EU6A 3QEUB 1ZK9A 1U8HA 2GK0A 2VQ1B 1Q94A 1OP5H 3RPIA 3PHQB 5MEPA 3RWIB 5EZOL 3RDTB 4D94A 1T83A 3AAZB 3CDGA 4HH8A 5M94B 3PABA 5FYJL 1AGDA 1CFSA 4M7ZC 1CXLA 4M03A 3GM0A 5TF1H 5IGXH 4Y8AA 3WXWL 2CGRL 1WFUA 1QRNA 2V7NB 3MV7A 1D6VH 4HDIA 4Y16A 1KEGL 5K9OB 4FQ2L 1P2CB 4KK5C 1GXEA 1YMME 4HIJB 1R3HA 4JCLA 1HI6B 1P7KB 4CBPA 4ONHA 2NX5D 4MWFA 1K5NB 1KLFA 4MXVF 5C9JA 4Y1AB 2H26A 1MCEA 1C08B 3CVIL 4DN3L 4LKXA 3OHXB 4I9WD 3CFJA 4DW2L 3U7YL 3S7GA 4NRZB 4TVPH 3TVMA 1FFOA 1FG9C 3QAZC 1ACYH 4G42B 1EIBA 2CK2A 3ARTA 4L5FH 5L8LB 3SQOH 5TE4H 4PJ5D 5IHBA 1QR1B 1OD7A 5BVPL 1BQHA 2C3HA 2W59A 3SDYL 4EXPX 2FHBA 1NBQA 5T1DL 1NFDF 1EUUA 3MREA 3QIBD 5IW6A 4Y4FC 4XHJD 4OM1H 1U8LA 2VZSA 4Z7WE 5A2FA 4IIQB 6FABL 1MJJB 3D39D 4EEEA 3OXRA 2XFXA 4NGHH 2XXMB 5T3XE 4JY6A 4Z7QE 3CPLA 4F37K 3L1OL 1J0HA 3ZDXF 4ZFOA 2KZWA 2AK1H 4OCNC 2EC8A 5DDHA 3WIFA 4H8WL 5ALCH 5DRWA 3TFKD 3BH8B 4Q9QL 4XNQA 4N8CH 4NZDA 4GUPB 5C0BD 2FX8H 4L1DA 4MXWL 4QY8A 5FO9B 1H5BB 2B1HH 5GS0H 4LEOA 3IS0X 1IKNA 3ZL4H 4U1MB 3D9AH 5L7XL 1DQQA 4LF3B 3TA3A 2LABA 3G6JE 3KDMB 5GGRB 5D4QA 5TQ2H 3BZFA 4KI5D 1B6DA 3ZKNC 4YGAB 1CDUA 1HSAB 3JWDL 5DMIL 4NQCD 5DC9B 1J05A 4LCWB 1AHWA 7FABH 4N0FA 2ADIA 3CFKB 4KHXH 1JHLH 1XGYH 3VWKB 1BIIB 1AO7D 3WIHA 4HAFA 4HIIA 3NZHH 4NSKB 1N5AA 3VGDA 3HUJA 1Q9OB 4ODTL 1RZ8B 4MCYA 4XVSL 4NN7B 3MRMA 5HYFA 4O02H 3OKOB 3KXFB 4BH8A 1UWGH 5F6IB 2D9QB 4ZUVA 1L6ZA 1F90L 4H26B 3U30B 4ODUA 4TSAH 4LPYA 2IG2H 4JFXB 3ZE0F 4HS8H 2LQRA 4G6JL 5C2BL 4XPAH 3GO1H 5D7IA 3VXOA 3H9SE 5J3HC 2OSLB 3VXRD 3S34L 4LNRB 4NC0B 2V7HB 4H25B 4XVJL 1N4XL 3ZKXC 3A0OA 3ZLQC 3RZWA 3OPZH 2FX9H 1JZ7A 1NLBL 3EOAB 2UWEA 4IHOA 4XMLH 3WSQH 1KF9B 1JGDA 3IDMB 4M5ZH 4XNZB 4IDLA 4I48B 3EDEA 3QNZA 3KPSE 1EAJA 3PWPE 3IAGC 1SYSB 5ID1B 4W70A 1J0IA 1OLZA 3VCLA 1I7ZB 1QBLL 4KMQA 2MSPA 1K4DA 3FL7A 4OZIB 3OKKB 1EPFA 3AROA 3F6IA 4LFHG 2ARJB 5I8KH 4GQ9H 4IS6B 5ITFB 1A1OA 1UADC 2NPLX 2YRZA 3O2WH 1GHFH 1XF4B 3BXNB 1QBMH 2XY1A 1H15A 5E0QA 3HB3C 1P4BH 2BNQB 4FXKB 2W0FA 4J6RH 4Z7UA 1T2QH 4M1DH 1WEJH 3E6FB 3QCVH 1Z5LA 2WANA 2O5YH 3IDUA 2FYYB 5BMFH 8CGTA 3BZ4B 4NO2B 3QQ9C 3TN0C 4R96A 1NGZA 5AZEH 3V4UH 4PJ7B 5J11B 3VG9B 1IGIH 3B2VH 1N26A 1ORQA 4XC3H 2DI9A 5DHVB 3VFTB 3RX8A 1IL1B 2YUWA 3WLBA 2H6PA 5MENB 2VDLL 3GEWB 4UIMB 5KVFL 2C4FT 3D1MC 1BQHG 1FL5B 4WO4D 3D0LA 4P5TD 4YJZL 2ZNWA 1L7IL 1WZKA 1HILA 1KLGB 1I8KB 2HLFC 2XOTA 2AJUH 2D31B 3S4SA 1XCQB 1C5DA 5IMOA 3DSFL 3FN9A 4NKDB 3AMLA 4KRPD 1A6VL 1NGQH 1G6RH 1RHHA 1YEEH 3E3QE 3S6CA 5I1EL 2EEDA 1QLEH 4ZXBC 3ZYZA 1J8HA 2ATKB 4OQTH 4FZEH 4YX2L 4FG6D 2A6DB 2AJYL 3V6ZA 4NZUL 4NOFA 3P4LA 5DD1L 3P9LA 1HK6A 4X9FA 5C0NC 2D9CA 5DQ9B 4PV8A 3QEQD 2VDPL 3X12B 4YHPB 4XPBL 1JGVH 2PTTA 5IF0A 3FN0H 4FFVD 1DVFC 2CUIA 4MNQD 2PYEA 2E9WA 4NQDE 4G9DB 5D7LD 5E6ZA 4JREC 4AEHL 3F8UB 3NIGF 2XQBH 4MDJA 5E5MA 1ETZA 5FM5O 2D7TH 1CFTA 2X4QA 5L2KB 4UQ3B 1TLKA 1LO2H 4LEXL 4S0SD 3VWJB 3H9HB 5IG7B 3CUPB 3EYUH 4LQFH 5TF1L 5CJ5A 5IGXL 1RK0A 4EI5B 3BVNB 1FFQA 1KCVH 5L0QB 4PJHF 5HGAA 5CBAB 4GAYB 3BN9C 2BVOA 4LKCB 2K7QA 2A6KA 1KGCD 1CR9H 3V4VH 4JFEB 4EN3D 1GOFA 1TTGA 4PY7A 3ZYOA 1RU9H 4YNYA 5E2JA 3VFWB 4TVPL 4XNYH 3WE6B 3GMOB 5C0CA 3L7FB 3UTQA 1MQ8A 2WAHA 1ACYL 4LLUA 1YEKH 4L5FL 4RRPG 2IALB 3BOVA 4S1RH 3ZO0A 5KVGH 3SQOL 2Z91A 5TE4L 1DE4A 1NBZB 5DS8B 5HGDA 3T8XB 1I8LC 3RJQB 1FZMB 2OS7A 5C86A 3F5WA 5GRXG 3KPRB 5DEFA 4P49A 1ES0B 1EO8H 3VDCA 5HYJE 5A16B 1MFNA 4OM1L 1ACZA 1BVKB 5FUCE 4N0CC 4ZPVB 1H3PL 3QEGH 4NGHL 3MRLA 4OCMC 2I9TB 5EBWA 2XPGB 2DBLH 3BE1H 1LMKA 2AK1L 5K9KB 3TO4C 3QQ3A 5EBGA 5EWIH 5ALCL 4M7LL 5L8JB 1BJ1J 4FHBD 3NGBB 1U2CA 4N8CL 4PGDA 5I1IH 5EUOE 2FX8L 1T1YA 2GFBA 2VRAA 3LS4H 1FFNB 2B1HL 1MCDA 3LN5A 5GS0L 3D18B 4Z7NF 2R2HA 3ZL4L 1I1AB 3D9AL 1IEBA 1DLFH 4PBVC 3JTSB 2K7PA 3FOMB 2EDXA 4TUKH 2LU4A 1EFXA 4R97C 4D2NA 3QWRD 4JO3H 1BBJB 1KB5B 7FABL 4Z77A 4KHXL 1JHLL 1XGYL 2NX5A 3NPZB 1A7QH 4OZFH 4Y2DD 4Y4HB 4AT6A 35C8H 3V7AE 3NZHL 3WO3B 3EFDH 3FB7B 3QXUA 4HH9B 4O02L 2AXFB 1JWMB 2ICCA 4WW1A 5F7DA 3SY0B 1BPVA 1UWGL 2WIMA 1T80A 3BGMB 3F7VB 3U2SA 4O5LH 2EXWD 2ZUVA 3A6BL 3BWAA 2NYYD 2C1PB 3ET9F 4HS8L 3VFMB 3VFUB 2W38A 1JN6B 4XPAL 3L3GB 2Y5TA 5IMLA 1MVFA 5D2NE 3VFSB 4ZTOH 4EUPA 3OPZL 4QRRD 2FX9L 5IJVB 5BZDA 5F9JB 3NCCB 4XMLL 2AXGB 4FFYL 3WSQL 5E00B 4M5ZL 1R5IA 1FZOB 1G7PA 3EZ8A 2UUDH 2XNAA 3D39A 1QD0A 2EKSA 2R1YB 5JNYB 5GGRY 5E70A 4DK3A 1GRWA 1NKOA 3MV8D 1IBGL 3GSWB 3MLXH 2LFGA 2YA1A 4RFEB 1A3LH 5T3XH 2YN5A 3SE4A 5FV1L 1ZHLB 1OL0A 4GKNA 4X6DA 5CUSH 5I8KL 4GQ9L 5C0BA 2ITCB 4X9BA 4Z9KB 1WZ1L 2RFXA 4NYLA 1XR9B 2C1OA 4OT1H 3O2WL 2DD8H 1GHFL 4HGWA 4U7SA 5IUSA 1MIEH 3T0EC 2B20A 5SWQB 5C8JB 5AD0A 1P4BL 2YRLA 1T2QL 4IDJH 4M1DL 1WEJL 4X9GA 3QCVL 4ZG1A 3O6FC 3O81A 3KYNA 4EQ3A 2O5YL 2VOTA 5FUCC 5SWSB 5BMFL 3BHBA 2IFFH 1AR1D 4PJFB 1FVEB 3PGDB 4TUJA 5CD3A 5AZEL 1KTLA 3V4UL 3FFCB 3OG4B 1Q8MA 4Y19D 1IGIL 1UG9A 3B2VL 3TM6A 1AO7A 5CIPH 5E7FA 4I2XE 1OB1A 4XC3L 2GW5A 3ZDZE 1W72B 4KPHH 2CK0H 4QXTA 4PLJD 5IB5B 2IEPA 5BOZG 1KTKE 3SDXB 3QI9A 1P5VA 5HYEA 4KK5D 3EYOB 4ZO9A 2X9YA 2AJUL 2J8UB 3VI4F 2GTWB 2ILLA 5FIEA 3W0WB 2BRQA 3BP5A 1WICA 4KWUA 3CU1A 1OY3B 2Y7QA 1NGQL 1QSFD 1G6RL 2RGSA 1YEEL 3VXRA 1S9VA 1QLEL 5BXFB 1JGUH 2AEQH 3LSOA 4X7EC 4RAHA 1ZLVH 4G6AD 2ITDB 5B38A 3T4AB 3W9EA 2X1PA 5I0ZA 1XR8B 2ZUYA 2X05A 1P5UA 1FGNH 4ZODA 2R8SH 1FL3A 3RY6A 1JGVL 2GJ6A 2XTJB 3QH3B 1FNEA 3FN0L 2VLKB 4L3EB 5F7LB 5ACZB 2DQIL 3M17B 1CFQA 1DQJA 3I75A 4OGAC 1RUPH 1BBDH 5T1KB 3C5JB 4M4PA 4N0UA 5DEGB 3CX5J 4C83A 4JCMA 2DAVA 2NTFB 2AJXH 5DVOA 4AMKH 2DQJH 2D7TL 4X6CA 3U79A 3D25B 1U8KA 5KOVC 1LO2L 4GH7B 3TLRA 4QHNA 1JK8A 4IRJB 1X4ZA 2HMIC 3EYUL 3DXAE 4LQFL 1LEGB 5I1KH 4GG6B 4OFDA 2R23A 1FAIH 4JJ5B 4NQUA 4WNQB 2BRRH 3W11D 2B1AL 3RVTD 3EO1A 1KCVL 5F88A 4K71C 3PWVB 1BEYH 3OMZA 4WV1C 2Y23A 2B8OT 3V4PH 2ESVD 5SX4I 4P2RD 1PQZA 3TJHC 3ROOB 1CR9L 3V4VL 1EAPB 3ZKND 3QQNA 5D70H 5FFLA 3IFLH 1D5IH 5DMGD 4YDJB 1ZANH 4UT9H 1GGCH 2FSEA 4LLWB 3DRQA 3CAFA 4WI8A 4ZFZB 1YEKL 4F2MB 3ROLB 1I3VA 4S1RL 5KVGL 5JPMA 3CD4A 4GRMB 4P2OC 3C2AH 1OSZB 1JUFB 3GJEB 3U4BH 3AU1B 4LMQI 1IC1A 3HCVB 1HNFA 3DRTB 2D0GA 2GEEA 1KC5H 4OUUB 3PJSB 1NGXA 3QDMA 2F74A 3IFPA 5F1IB 3TC9A 1EO8L 4PJ8A 4D9LH 4MQXD 2YWYA 3HZYA 4AYFA 1LE9A 5JA8B 3QEQA 4KVCH 3GMLA 3BT2H 5J3HD 4UTAH 5FYKU 1CDCA 3IDJA 4Z7VA 5DK2A 2XA8H 2P8PB 4L8DA 3ISWA 4HC1H 4L3CA 4PGBA 4TRPL 2XZQH 2DBLL 4MNQA 3BE1L 1XF2A 5TDOB 5D7LA 4GS7B 1FGVH 5EWIL 5GGVH 5I1IL 2QADC 4QF1A 4R7DB 3VDBA 3LS4L 4CRPA 5E94B 4AJ0A 1K9TA 1AGCB 2X4OB 4PJBE 5C0AE 2NY1C 4AH2A 5FOBB 1DLFL 3LEYH 1KG0B 2AJZA 3SE8L 3G6AA 5FKPB 5FHBH 1EGJH 4TUKL 4TOYH 1KEMH 4J1UB 1I3UA 5IFJB 5CEZE 1Y0LB 2EEBA 5I73B 3HB3D 4PJXE 1A7QL 2MCG1 4MVBC 4DFHA 2DKMA 4Z0XA 2NNAA 35C8L 1VEPA 2I5YH 4EN3A 3EFDL 2D0FA