4OLXH

Crystal structure of antibody vrc07-g54l in complex with clade a/e 93th057 hiv-1 gp120 core
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
QVRLSQSGGQMKKPGDSMRISCRASGYEFINCPINWIRLAPGKRPEWMGWMKPRLGAVSYARQLQGRVTMTRDMYSETAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 41
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH01
2VZSA 4YWGH 5D1XB 3V6ZA 3VXME 1CWVA 3W39B 4UOW0 4HGMA 1UYWL 4Y2DA 1JF1B 5C0BD 2YPKB 4NO0D 2VH5L 2PCPB 1RZ8A 1UQSA 1IGFH 2Y5TA 4KQ4H 4YXLH 4WI5A 3TLRA 3E3QC 4MD5A 2OP4H 2VXUL 4K55A 1VFBA 2VZVA 4NRYA 3SE3A 2ZSVB 4KQ3L 1KC5L 3U36B 3RL2A 5E2VL 2AEIT 1NEZG 3GJEB 3T65B 4G9DA 4JZJC 4BSJA 4QY8B 3ROOA 2EEAA 2I9LB 3CXDH 1RFDL 1DBKH 1TVBA 3QBTB 1EHLH 1AD9A 3PGFH 4QNPE 4X98B 1S9XA 2XZAL 1JWSA 2NQCA 5FCSH 3D69B 1FZKB 1LO2H 4RMWA 1I7UB 3BVNB 1XGPB 1FAIH 3VXTA 3S88H 5EU6B 4GKNA 5JOFA 1NFIB 1QLEH 1N3NA 2IEPA 4PLOB 1GZPA 5B21A 3WYRA 3QUMH 4G8IA 3QQNA 4GKZA 1W0WB 3MA7B 1MI5B 4JVUA 2CK0L 4Y5XC 5JMRA 5I6XC 5SWSD 1N7MH 1N64L 2Q7YA 1GCFA 3BDYH 4P9ML 1YN6B 4JZJA 4LSTH 3FFDB 4XNYH 2L7UA 2W1NA 3O45A 1IZJA 2WV3A 4P59H 5IHZB 1BFSA 2Z91B 3DIFA 2E27H 1K4DA 1S7QA 4JANB 1FPTH 1C8PA 3A6CH 1YN7B 3BKJH 4R0LC 3CSGA 1K8DA 2BVQB 2WUCL 1GAFH 4HIEA 1YMMA 1BD2E 5KS9A 5MERB 1P2CA 4Y5XA 4JRYD 3GIZH 3P4NA 3QUXD 3V2AR 5I1AA 3PP3K 4ORGA 5FK9A 5E99H 1AR1C 4MS8D 4ZFZA 3QUKB 3I2CL 3SKNA 4P2RE 3VWKB 2HKHL 4OBSA 1WFOA 4HUMB 4X0KB 4N8VA 4U49A 8CGTA 2CUHA 2YD5A 4GAJL 1QFHA 5H37H 3MXVL 4P2QB 4CN4A 2ARJB 3ABZA 4TVPE 3JV4A 5F9OL 4PLJC 2ADIB 2LTQC 3ILQD 1NMAL 4HIXH 3UTPD 3QJHA 4R0LA 3RGHA 5C07E 3SJVB 1RZGA 3NTCH 2F53D 1UA6L 2EYRA 1A3QA 3FHQA 2EE3A 1TVDA 5F7EL 5IFAL 3HS0A 3ULVE 4DQOL 15C8L 4TN9A 4JQXC 5FO9A 4YDJA 3OZ9H 3IYLW 5FYLD 1S7TB 4PJ5A 5GSRB 1RSFA 5E00A 4PV8A 1KLUA 3MX0A 4O4YH 1VESA 1OD7A 4NN7C 4X6FB 2BFVH 4HGWB 3BPNC 4PJ7F 1C5CH 5HPMA 3H9SB 1NGQH 1OPGL 5IUSA 4BQ8A 3L5WB 5DRXA 3L3GA 4BH7B 4ONFH 4RGNB 4XZUA 2VE6B 5GGTA 4D0DA 4LPVA 3K3QA 4L4TD 4Y4KB 5T5NG 3WNOA 4S1RH 5EC1A 2NY5C 4HZLA 3ARZA 5E56A 3WS3B 1L0QA 5EBMA 3LRHA 2IG2H 3DX6A 4JQXA 3FQNA 4DKEH 3P9WB 4PJCA 4OKDA 1EEQA 3TN0A 2MHAB 1ZHBA 2NY2C 3DPBA 1A6WH 2P8LA 2X4RB 5GGRA 3UAJD 1P1ZB 4PD4K 2XACC 3GHBH 4M6OL 1QRNA 3QYCA 1ZWIA 2C1OB 5HGDB 3CH1A 1QHOA 3KYKL 1JI1A 4JG0H 5T1LD 4TNVF 2D0HA 5F1IB 5GGSB 5TQ0L 1I1RA 3O3BA 5D1ZD 5FO8B 1XFPA 3MMEB 1ONQA 1VHPA 4WI2A 4H8WC 3RVUD 4U33A 1E27B 3A6BH 4NIKB 1NGXB 4JM2C 5D70H 2PXYD 1BQUA 3L1OL 1J87A 3DMMD 1HH9A 5I1JH 2O5XL 3M17A 4LCCC 1PKOA 3BZFA 4JY5H 5CJOL 2OJZL 3LN4A 2IPUG 1ND0A 3PF2A 3CLEL 4JHWH 1A2YB 3RJQB 4XMPL 2J8OA 5SV3A 5DEGA 5E4IA 1NEZB 1DQMH 2APVA 2D7PA 2QSCL 4F8TA 3NA9L 4PY8J 2OSLA 1NBYA 5D1XD 4X6CB 2VDRL 1FG2A 4OZGF 2YUXA 1IAKB 2J6EH 3MV9B 4LLYA 4ETQB 3OKMA 4H8WL 1MFCH 2AQ1A 5IMKB 4JM2A 1ITCA 2VLKE 1YEEL 3WE6B 5DF0A 4V1DA 1PG7H 5GISL 4U05A 4UDTA 1SEBB 2R0ZH 5HYQA 2R1WB 1WWAX 2H2SC 2Q86B 2P42B 3DBXA 4XCYA 4LLUB 1MJUL 1Y6NR 3P9MB 5H35A 4AEHH 3CZFB 5E9DB 1MOEA 3H42H 1RIVL 2VLJD 3LRGA 3QULB 4L9DA 5DJCA 1CFQA 2EXYC 3AS1A 3RA7H 4YR6A 4TVPH 1CGYA 3FONB 4W81A 3VCLB 2DTMH 4U7SA 4NZDA 2DYPA 5FUCC 1AXIB 5LWYH 1L0XA 5KSBA 1K6QH 5BXFA 3BP4A 4PBWD 2NNAB 1IM3B 4KK9D 3BX7C 3EUUA 5T1MB 3ULVH 4I48A 3KPSB 35C8L 4BK5A 2H8PA 4U1LB 3LKNA 4PR5B 5TDNA 4HLJA 1MI5D 4PJEE 4FP8H 4GXVH 3X3GH 3D9AL 4LOUC 5J11C 4LLQB 3E0GA 2WWKO 2V5SA 1ACZA 3B9VA 4KVNL 4EQ2A 3CVHB 4JVWA 4BFGA 1YMME 5DRWB 5EZIH 3OAUH 5KS9E 5ALBL 3RWEB 5E5RB 2VQ1A 3WIIH 4EIGB 3MGOB 5AG9A 4E5XA 4O9HH 2WP3T 2Y4SA 1JNHA 2LVEA 4MNHA 2BJMH 4HIJA 4EXPX 5BV7L 1DLFL 5HHOE 1A6UL 2IFGA 4WEUD 4YNYB 4XB7A 5IMLA 2F58H 1VADA 1ZLUK 4XCCL 4DN3L 2L7JA 1D5MA 25C8H 3UYRL 3OKEA 5IR1B 2BY3A 1KCUL 5TE6H 4JDZB 4LSUL 5E2JA 2VIRA 2Z8VC 3O4LA 1I1YA 2AEPH 5I8CB 4OLXL 3VWKD 4LVOB 3MUJA 4M5ZL 4YIQA 1ZT7B 3C6LC 2ILLA 1CF8H 4YHNA 2ED8A 4K8RH 1CLYL 3MV8B 4HF5L 1BPVA 5J8OA 2DQDL 4AMKH 2VDML 4JO2H 5LBSH 1L7IL 3IJHB 5MI0B 1G7MA 2R8SH 3SJVD 2I5YL 5H37G 5GZNC 4PJ5E 3JWNC 4IOFC 5ERWB 4QF1B 1UYWH 5EOTB 2AVGA 3ARFD 4JY4A 5DGRA 5FDYA 3CFDB 3UDWC 1UB5B 3D3VB 1INEL 4M9PA 1S7SB 2VH5H 3LDBB 2NR6C 3C5JB 4NZTL 1JZ5A 3B5GA 3RNQB 2VXUH 3TBSB 4XB8A 2GFBB 3C6LA 4KQ3H 5D7JB 1ZGLP 1KC5H 3VRJA 5B8CC 1ORSB 2EIEA 3BEVA 32C2B 2M2DA 2CGRL 1TNNA 5E2VH 4HS3A 4RGND 4PJCE 1Q9OB 2YD9A 2UZYB 2P24A 3I75B 1RFDH 1N8ZB 3O6FB 4QGYA 3UTSB 5T1DL 2HLAB 2R2BA 3BZEA 3TPUB 1MIEL 3VJ6B 4FTVA 2XZAH 3UDWA 4HK3J 2XZCL 2J8UB 3SCMC 5DJ8A 1MCFA 4AIXA 7FABL 1CD0A 2E7HA 3OR6A 4FFVC 5DJ0A 1BQLH 3TIDA 3S37X 5C2UB 5B8CA 3FZUD 2A83A 1KN2L 2CK0H 2Z92A 5CJQL 2APXA 3ILPB 1N64H 4X7DC 3QFDA 2DQUL 4P9MH 2IJ0C 2JB5H 1AXTL 4U6HB 1T1XB 3VXNB 1OTTC 1WITA 3EGSA 3H7LA 4P2OD 3VFTA 2EDHA 1EVTC 2EEBA 3SCMA 3GI9H 3KPRD 3DO7B 4ZG1A 2RAMA 3UZEA 4HUNB 1PKQA 4JFHD 3U4EB 5ICYB 1EFQA 2ICWJ 2PO6D 1R3KA 3THML 4S1QL 3K2UL 4V1DE 3QDHA 5FYKU 3P4LA 4HUWA 3OTTA 5D93B 1DP0A 3OJDB 3MV9D 3ZSSA 1CICA 3KPPB 4WWID 1YY9D 2E7MA 4LGPB 3KYNA 3AM8C 3I2CH 5JZ7D 2XQBH 4ZNCD 3TBWA 2HKHH 3MNVB 4FG6C 4PP2A 4Y1AA 5LGJB 1ZHNA 4GJTB 4GAJH 4U4BA 3MXVH 3JBG7 2XTLA 3GSWB 4X6CF 2FGZA 4FQHB 5F9OH 4HH8A 1NFKA 1NMAH 4HMCA 4HH9A 4UUJB 5DEFA 5EZLA 3QUMB 2HTLC 5KSBE 3RVWD 1UA6H 4PRAA 3NFSL 4X6DB 5CJXC 5F7EH 4CUCA 5IFAH 3TZVC 5K9KB 4DQOH 15C8H 4WTWA 4PUBL 4DJMA 1A64A 5CBEA 3VI4E 5EH1A 5I1HL 1P4BL 4QXWA 1KJ2L 3MJ6A 3GSOA 3EYSL 3F62A 4PJHB 1PQZB 1QSZA 2UVEA 2NY6C 4NQDA 4AYFA 3AM8A 3BSZH 2ITCA 4Z7WA 5D6DC 4DOHB 1F4AA 4NRXB 4B7IA 3JTSB 3ZLQC 1S7WA 2BX5A 3QNXB 4L1DA 2OJEB 3UJTL 5EUKB 5EBWA 1EBAA 1W8NA 3O4OB 4H0HB 1OPGH 3HHRB 1CFTB 1GIGL 2WWKT 4O5LL 1WBZB 4LNRA 4TTDC 1SJVA 1U8JA 3MUY1 1FO0A 1FO0L 4I4WA 3NIDF 2QBWA 1S5HB 4NPYA 5ACZA 5CJXA 1GH7A 1QLFA 1KYOJ 3TZVA 1GGIL 2DQGL 3BPCA 4NZRL 3RIAK 3T0BA 4LLVA 2R23A 4JPWL 4WHTB 4L1HA 2VNCA 4FNLL 4ZUTA 3ALPA 2VWEC 2D7NA 2YUVA 4OLVL 5I1CH 5D6DA 5E5MB 3QP3A 2ZUWA 4M6OH 1TZHB 1AO7A 3PXHA 4MDIA 3BRGC 3KYKH 3ARGC 3V79C 2XG4A 4ZPTB 2XA3A 1NL0L 4HX1A 3RIFF 5TQ0H 4G6FD 1RJLA 5C3LD 5LVEA 5HHMB 1EDQA 2G75A 1OP5K 3ARRA 3TWCL 2MSPA 4MD0A 3U6RA 2V17H 3TCLB 5ESAA 4KHXL 4G8EB 3UJIL 2NY5H 5T3XD 3L1OH 3BMVA 5I0ZA 5J1AA 3WO4B 5ENWA 4BSWA 3DRQA 2O5XH 4GW5A 2VAAB 3OX8A 4WO4B 4F7MA 2OJZH 3MV8D 3GFUA 5DMGD 4NO5A 3CLEH 3VXMB 3FQXB 4XMPH 3MOBL 4LCWD 4CMHC 1ZA3B 2QSCH 2W0PA 3NA9H 1IARB 5FGBC 3M1BA 3ARGA 4MDJB 5C09A 2VDRH 2VN4A 3CXHJ 2V5RA 2V7NA 4TSAL 5DDHA 3D2UD 2XOTA 5TFSL 4M8VA 2E8YA 3BN9D 4ODBD 4H8WH 2EH8L 5FKAB 1MCWM 4HMDA 1DZBA 1YEEH 3W2DL 3FMGL 1G0XA 1HHIB 3I6LD 5GISH 5T5NF 4J3SA 1EAPA 3PV6B 4WTZA 1S5IL 2AV7B 4UNTA 1SJEA 2H9GB 5D7JD 2OCFD 2V7HA 4NBZB 3QQ3A 3O41B 4KRPD 4C4KO 2YOCA 1ZV5A 1G7JB 1MJUH 2IH1B 4Z7NF 1RIVH 4K7PY 1FVCA 5FGBA 1WWCA 4YEEA 3BT2L 1U8HA 1EO8H 1ZVSA 3WJJC 1WUNT 5L2KA 4IHOA 3UZQA 3SKMB 2XKNA 3IDIA 3PHQB 4UV4L 1MCBA 3QNZA 4M4PA 4LPCA 1A6AA 5JW4N 2R9HC 3IAQA 5TDPB 4ZNEE 3P9LB 4XH2A 2EDLA 4PFEA 2OBGA 1HKLL 4PGZA 5DJAB 2Q3ZA 1BLNA 1NDMA 4XTRC 3CFKA 3PDDA 35C8H 4L4VA 3MRRB 4IRJB 4MXVF 4Y4HB 4DEPB 4QT5A 3HZVA 1LWRA 4RWYL 1OWRM 1ZANL 2J8UF 4ZO6A 3D9AH 4F57L 5IGXL 1LILA 4HUVA 3WJJA 3X11A 4KVNH 3RQ3A 3D85A 4HBCL 3ARUA 3HI5L 4NCC2 2NZIA 1KLGB 2DWDA 3C2SA 4QHNB 5ALBH 4DZBB 1OL0A 1U8MA 2CQVA 1QFWI 1NSNH 1W0VA 3V6OC 1Q0YL 4O02L 3QIBA 3RX5A 5BV7H 1UH2A 5DVMA 2O5YL 1A6UH 2ADGA 4KI5D 5CILH 4P2RB 4Y1AE 3L3JA 1A1OA 4GG8A 4XCCH 4DN3H 2A1WL 3UYRH 1JHTA 3IJYA 1KCUH 3ZDYE 4LSUH 1R5IB 3U0PB 5EOCJ 3B9KD 1WQVT 4OLXH 1MFAH 3QPXL 4M5ZH 2P5EA 5C07B 1Z9MA 3E6FA 4HKZA 3PL6A 1CLYH 4UV7L 3ZMRA 2M1KA 1U3JA 2FBOJ 4HF5H 4KI5F 1KXQE 2G2RA 2DQDH 5GRVL 4OKVB 3VFGL 2VDMH 3CUPB 1GSMA 1L7IH 4MXQD 5F7FA 3WLWD 1GZQA 4JFPB 3TH2T 2HFTA 4N8VG 2JF1A 5DK2B 5KVFL 1RHHB 1S9YA 2I5YH 3JZ7A 3TEUA 4NQDE 5F7MC 4J4PC 3BIAX 3AXLA 4G5ZL 3V6OA 4Z7WE 1T6WA 3I02B 4PJ9C 4JLRB 1HHHA 2EC9U 1DN0A 5CZKA 1INEH 1B0RA 1EMTL 3PDOB 4K2UL 5C9JB 1L7TL 5IM7B 3S35X 1M71A 1MCOL 4NZTH 3TVMD 1MNUL 2YRZA 3DGGA 3AREB 1U95B 5L2JB 4X6DF 4FMFA 5CHNA 2EC8A 1UZ8B 5K59E 4UILL 3DUSB 1T20A 2CGRH 2ZUSA 4PJHF 3ME0A 3RDTD 5F9AC 3S96B 3G5VA 1M7XA 4E0RA 4J4PA 5TDOB 3H8NA 1EHXA 5T1DH 4PJ9A 3DROA 4RX4A 4KZDL 1AO7E 5I9QC 1MIEH 1LE5A 2EIDA 3L6FB 2XZCH 3ZL4L 1UZ6E 1ZHKB 1OD9A 4GBXB 3QFJA 4D0CA 2B8OT 3O6LL 4YPJA 7FABH 4DGVL 3LQMA 3U9UB 5DJYA 2Y1VA 5F7NC 1QPPA 1EHAA 1I1FA 2HT4D 3DX9A 3JWOL 1G7IA 3QIUB 2BHYA 3IETA 2R2EA 1HSAB 4KPHL 2AI0L 1KN4L 1KN2H 3BZ4A 3I6GA 2FB4H 5CJQH 2W9LA 3DTXB 5HHMD 4JZOA 2DQUH 4G6AC 2IAMD 1KCRL 2NXZC 5A2FA 1HK6A 4HXAH 1AXTH 1A5FL 4LPTA 1OAKL 5C0CB 3TA3B 5D7SL 1RZ8B 4PJBA 4WO4D 1UQSB 3VMOA 2WLYA 4P5TB 2Y5TB 2GITB 3RJDA 1HILB 2KBGA 2D7MA 3KPTA 2ICEA 1VFBB 3O2WL 5MEND 3OXSA 5AZ2H 2CD0A 1MJ8L 4NKDA 1JL8A 2VLKB 4S1QH 3RL2B 3THMH 3K2UH 3QG7L 5FUZL 1C08A 3LMJL 2E6QA 3LEVL 3UTTA 2CDGA 4PGEA 4G9DB 5INCB 1CGTA 1SQ2N 5DS8B 3ROOB 3S36L 1T66D 4PGCA 3M07A 2XKSA 3D0VB 2PR4L 4LSQL 2RGSA 4XI5C 4C4KT 1AD9B 3PGDA 1R3JA 1S9XB 1JWSB 5C0GA 4W6XB 4L3EB 3G5YA 3VXTB 2BSSA 5L2KE 4GKNB 5JOFB 3NCMA 1CQKA 5L8JB 3FN0L 4Z18A 3PQYA 1Y6MR 2VJXA 4ODTL 3NFSH 4GKZB 4ORZC 4RCAA 4EN3D 5BO1H 1MAKA 2YZ1A 5IJVB 1IE5A 2YN5A 4Z77A 4PUBH 4XVJL 3REWA 3OJ2C 4LLWA 4JZJB 5J12C 1P4BH 3PXJA 4X8JB 1KJ2H 3EYSH 3O6MH 1Q9KB 4L4VE 4JN1L 2QR0A 4WW1A 3O45B 2BC4A 4QNPF 4PJEB 3WFDH 3D18B 1PZ5A 4JCLA 4JJ5A 3DIFB 3UJTH 1K4DB 1FLRL 1MIML 2PETA 2CRZA 1G6RA 1G6RL 1GIGH 4LPWA 1A9BA 1UCBL 3BE1L 5J13C 3VFWA 5IW1A 1FO0H 1YMMB 5EB9A 4QOKA 3ZT6A 1WBXA 3T0AA 5KS9B 4OF7A 2XFXA 1P2CB 3ALXA 5I6XB 1GGIH 1QSFA 3C09C 4ORGB 2DQGH 4NZRH 1OVZA 3STZA 2B2XL 1JI2A 4JPWH 1KT2A 4LAJH 4TUOB 4ZFZB 4JFYA 2X4UA 3TC9A 1BOGA 4FNLH 5HHOB 3SKNB 1BD2D 4K9EC 4PV9A 4OLVH 4N8VB 3QNYA 4YAQA 1JP5A 3FO1A 4LMQI 3JV4B 1NL0H 3HE6C 1KNOA 4LEXL 5AZEL 1L0YA 1QFWM 3QJHB 2P5EE 4P2RD 5CP3A 1RZGB 2YRLA 2DF3A 3TWCH 3WUWA 3DUHA 4X7FC 4KHXH 5JNYA 4WUKH 4TVPD 3UJIH 3WNLA 3SDXA 5E8PA 4QRPB 1CDBA 3I50H 1KCLA 1YNTA 4YDJB 5C07D 3HUJA 3V6OE 1K3ZA 5E00B 4TUKL 4PV8B 1KLUB 3MOBH 3RNKB 3TV3L 3ULVD 3HR6A 4H1LH 3TIEB 3IKCB 1RZKC 2NY7L 1FN4B 3FO9A 4KV5E 4BZ2L 1YECL 3DV6A 3EFFA 3CFEB 3HE6A 4Z7VE 2LTQB 3L3GB 1AGBB 2IBBA 4XZUB 2B7DT 4GRWE 5CJBA 4KAQL 4JKLA 4D0DB 5HYJD 1B6UA 2E5EA 4XBPA 5TFSH 1XF2A 3VWJC 1T1YB 5FV1L 4HZLB 2EH8H 4YH6A 3ULVF 1IAII 5EBMB 2I9TB 3DX6B 3W2DH 4RAHA 3FMGH 1BAFL 3FQNB 1S5IH 4PJCB 3ARED 3QG6A 4U2YA 2P5WD 3TN0B 3UMTA 1P7HL 1ZHBB 3T1WA 1WCQA 4JFZL 2VLRA 1ZWIB 3CH1B 1WAAA 3BPNB 3KPLA 2B1AH 3BT2H 2BNUA 3C2AL 3CPLB 3KHQA 3QFJE 1P84J 1RK0A 1T04A 2AJZA 2Q1EA 4HJ0C 2FIKA 3VWJA 4UV4H 4IS6B 3OAZK 5IESH 3MACL 4GBXD 5A3ID 4OFKA 3EDEA 4KU1A 3ZYIA 4MQTB 5EZJA 3BOVA 1G1YA 3LN4B 1ND0B 3RWFA 3FOMA 3QIUD 5E4EC 3MSPA 1CFSB 1YEDA 3ETBF 3S5LB 2XY1A 3ZKMD 2LU4A 1WISA 4RWYH 4Q6YA 5FGRA 1ZANH 2A9ML 4PJBE 2ORBL 2OSLB 2WW8A 4F57H 1NBYB 3MYZA 5I76A 5CZXC 3OAYH 1FG2B 2M26A 1QHPA 4Y2DD 4KK6C 5E6IA 2CKBL 5IROC 5EWIL 2HFFA 3SDCC 5F1KC 4HBCH 4Z9KB 3HI5H 2ARWA 4JM2B 5A16A 3IAGC 4V1DB 4OM1L 3UTTE 5HD8C 3MJGX 4UDTB 3U30C 3RUGA 5D72L 5HYQB 2R29L 3V0VA 4Z7OE 2BNRA 3N1QC 4U1JB 1Q0YH 4O02H 1C7TA 4XCYB 2O5YH 5D2LA 1IAMA 5CSZA 2E9IA 4KKAD 4OCMC 2A1WH 4EUPA 1CFQB 4F15C 1J1OL 7CGTA 4HHAA 4YR6B 3BYYA 5EOQH 2W60A 2P8PA 4JGMA 3QPXH 1IL1A 4G6ML 3PQYE 3SDCA 3DLQR 3EHBC 5HI4C 5KSBB 3MRKA 1ADQL 3VFGH 3BP4B 5DLML 2X1WL 3D0LA 1FFOA 2LU3A 4EJ1C 4WFEE 2R4RL 4I48B 5KVFH 1A6ZA 5E70A 5FOJA 2H8PB 4G5ZH 3LKNB 5C6TH 5F88A 5TDNB 3Q48A 1GRWA 3PNWB 3MGTB 4OD1H 5B22A 1A7RL 1EMTH 4GAFB 4K2UH 1L7TH 3CVIL 1MCOH 3QDJA 3KYAA 2CDFA 5FGSA 1MNUH 5ADOL 1YYML 4ZYKA 1M6OA 5DFWH 4GRWH 3MLXL 4QOKE 4U6TA 2BVTA 2K3TA 5CFHA 2VQ1B 4YHYC 4UILH 1QSFE 1X5IA 4E5XB 3FJTA 2FWOA 4MNHB 4HIJB 3VG0L 5BV7B 3IGAA 1YMMD 2MPAH 4PJEF 5IMLB 4L29A 3RFZC 1VADB 3DSFL 1D5MB 1DANT 1F90H 5EU4A 4KZDH 4OLWL 3OKEB 3EYVB 4X5XA 5J11B 2VIRB 1LNUA 3KXFA 3SKOA 1JV5A 5DI8B 1I1YB 4N0FB 3O6LH 4YIQB 1Z9SA 4DGVH 5DXWA 3NCEB 3BP7A 1GJIA 3JWOH 1N6QL 5KS9F 3L5HA 3NABL 4WU5A 4M1DL 3S6CA 3SDXE 2Y9RT 4KPHH 4LEOA 2AI0H 1KN4H 5DEZA 4BSVA 2BMKA 3WFHA 5HVHC 1KCRH 2FO4B 4F7CA 3FCTB 1A5FH 1KJVA 4JY4B 1QR1B 2X9WA 1OAKH 1NLDL 5D7SH 3IRZA 4GAYA 4PJ5D 5I30L 1AR1D 3BHBA 4XBEL 1MHCA 3T2QA 3QHFL 4WI6A 3C6LB 1TCMA 1UWGL 4YDLC 2IBZY 2X70A 4Z0XA 1MJ8H 1TJIL 3BEVB 3QG7H 5FUZH 4PLJD 3QB7C 3RTQC 4GG6A 4W4OC 4HS3B 4P5MA 3RPIA 4H1LG 4LPYA 2Q7NA 4PRNA 3OR7A 5SWQA 1JPST 3S36H 2W07A 2P24B 4PS4L 1KCVL 1EHNA 1YA5A 2PR4H 4LSQH 1WTLA 3B8YA 1HEZA 2R2BB 3BZEB 3EOBA 1GC1C 1WAAE 4G7VL 4L8CB 3DSNA 1JZ6A 2YN3A 2MTPA 2HFEA 1IAIM 5DJ8B 5JOEA 1O7SA 2P46B 9CGTA 3VG9C 3G6JA 1CT8B 1QRND 5DJ0B 4WTZG 3L9RA 4UBDC 4ODTH 1OT1A 3BH8B 4RAUB 1MLBB 2A83B 3MROB 2Z92B 3RTQA 3GMOA 3QFDB 4PJCF 4W4OA 4XVJH 3CX2A 3P77B 2IGFL 1NUFA 4AIOA 2IC2A 1QR4A 1FNFA 4JN1H 4X5LA 2OR8A 1JE6A 3FT4B 3VFTB 1GC1L 2WIIB 4AENA 4KTDL 3V0WL 3SCMB 5HDOA 1FLRH 3S3JA 4R7DA 4J3XA 5ID0A 2FEEL 5E1AA 2NY2D 3RPKA 1OAZL 1G6RH 4JKPL 3BFOA 4QRSA 4O2FA 3BE1H 3MV01 4EBQL 1MCQA 3HC3L 3HC4L 3PP3H 4FQQB 4HUWB 5F6IB 4JKKA 2FECI 4OI9A 4CVZA 4H25B 5F7HA 2BNRE 1G0YR 1CICB 2B2XH 5I8OL 3MA9L 3KYNB 4NCC1 4YHPA 3NZHH 4JM2D 1F4HA 5D2LE 3VD3A 5IV2A 3TBWB 4PB0L 1JYXA 4PP2B 1RK1A 3U2SA 3WHE1 5FA4A 2WINB 2AJVL 4R96B 4RWHA 3UYOD 2R56H 6FABL 4W6WB 3NN8A 4LEXH 1FV1A 5AZEH 4MB5A 4HH9B 5DEFB 5EZLB 3IFLL 3O3AB 5CP3H 4JM2F 5AYQA 4PRAB 1U8KA 2EE9A 3RBGA 5GGVL 3P0GB 3IDUA 1U91A 5ESQA 5D5MA 1KJ2B 4AEFA 4L4JA 2DYPD 1FL5A 1FRGL 4JFDA 3OB0K 1ES0A 4NQDB 1A6PA 4TUKH 1VFOA 3WL9A 2ITCB 3AS0A 4X4XA 3QDMB 3TV3H 1IMHC 2RBLA 1NCBL 1S7WB 5I17B 2NY7H 2YA0A 5EBWB 3QHZL 2OLDA 2VDKL 4BZ2H 4QXTB 3QDJE 5DO2C 1HE7A 1YECH 2H2SD 5IOPB 2YBRB 2Q87A 4IRSC 4U7KA 4LNRB 1U8JB 5KSBF 1B2WL 1FO0B 4AQ1B 2V9QA 1AGCA 2X4OB 4NPYB 4FABL 1QLFB 2EXYD 3UPRA 1NCAH 2CDEA 2JJWA 3TZVB 3QQ4B 4RISL 3VI4F 1BAFH 4LLVB 2LFGA 4XXDB 3V5HB 4EI5C 1A4JA 1QQDA 4JHAL 4ZUTB 1UWEL 1K2DB 4RFNC 4XRCB 3W5MA 4LCIL 4JFZH 4K3EL 1AO7B 3QT2A 4S0SD 4YK4C 1RZKH 3KXFE 2HVKB 4HX1B 3DO3A 4X9HA 2K7PA 3C2AH 5FO7A 2G75B 4PRDA 3UTZA 4PRID 4RGMC 3MOAL 4MD0B 2R0WL 3U6RB 3GMLA 4LOUD 3IDGA 5ESAB 2YPVL 1H8SA 4DGYL 1A9EA 5J1AB 5TQ2L 3O4LD 5ENWB 3AAZA 4BSWB 3MACH 3O8XC 2D03H 3RI5K 4GW5B 5IB1A 3OX8B 4WW2B 2ZCLL 4D3CL 5BRZE 4L8SC 3KDMB 4O2CA 4EI5A 1NJ9B 4NO5B 5JW5A 3VGGA 3SDAC 5HSFA 3CK0L 4YLQT 4H1LB 3RVXC 3S7GA 4LSSL 4M7LT 4XVTL 1WZ1H 2A9MH 2ORBH 1I3UA 4U1SB 3ZYJA 4OFDA 2EKSA 5JUEL 3SOBL 4M1CC 4QYOA 4N9OB 2V7NB 2ZUYA 4N0UA 4LDLB 4UIMA 2MCPL 3G5ZA 5F96L 4X4YA 1RZJC 5EWIH 5EFIB 4JREC 5HHVL 4YFLI 2WANA 2A6KB 4U1GC 2BCKA 2ESVA 1MCEA 5IFHL 1MCRA 3OG4B 4TQEL 3AB0C 1KTLB 2NX5A 4GG6E 4JPIA 5ICZA 1EAPB 3O8XA 1MY5A 1SJEB 3C6LD 5D72H 2R29H 1PFCA 2V7HB 3QQ3B 3VI3E 4CU8A 3L3IA 3SDAA 3NCFB 1CGWA 5CJ5A 5CGTA 1K4CA 3WXVL 1OLLA 2IFFH 4IJ3C 4M61A 1CGSL 3TCXA 4BH8B 3QO0A 2VSCA 5GZND 1ZLSH 1ZVSB 4IOFD 1J1OH 4EUPH 4LARL 1BMGA 5L2KB 4IHOB 4NQUA 4ZUWA 3IDIB 1JPFA 1FNGA 4FTVD 1RZJL 4N8CL 1A6AB 2NR6D 3DVNA 5C2BL 2QADC 4CJ0A 1INDL 1CK0L 1VA9A 5DLMH 4DN4L 4XH2B 3FRUA 2R4RH 3BQUC 1NDMB 3CFKB 3K8MA 4M1GL 4L4VB 1QBAA 4XP9H 3BISA 4QT5B 3HZVB 1FL6B 2DI7A 4R4BA 1IQDB 1A7RH 4DAGL 2C3XA 3CVIH 4F58L 2DMBA 4F9LC 5DD3H 2X1OA 2NPLX 3X13A 3D85B 5ADOH 1GOFA 4HS6A 2DWEB 4M48L 3KNBA 5CINH 3MLXH 5DJ2B 2DWDB 3L3KB 4WUUA 1U8LA 3SCMD 5HHNA 2LV4A 1G9ML 5IQ9A 1LGVA 3VFSA 4Q2ZB 1LDPH 1KIRB 3RRQA 4FFVD 3IFOA 1W0VB 3VG0H 3BQUA 5IMMA 3QIBB 4LIQL 3FT2B 5DUPL 1KPVB 3CSYA 3PE9A 3L3JB 1A1OB 3DSFH 4GG8B 3OXRA 2AW2A 1TMCB 2HYMA 1NGZB 4KJWC 5CEZL 4ESKA 4OLWH 3C9NB 1YEIL 1JHTB 3IJYB 2KZWA 3WJLC 1CICD 3FT3A 5BVJA 4HC1L 1RV6X 1OTTD 2HH0L 4F9LA 1EIBA 2P5EB 4WFFE 2VABA 4Y1AD 3CFIC 3E6FB 4HKZB 3PL6B 5HJ3B 4H0GA 5T33L 4ZUSA 4TNWK 4W6YB 1N6QH 5MEOA 2XPGA 2G2RB 3QWOA 3NABH 2FIRT 4M1DH 3BO8A 1JUFA 5D71L 1GZQB 5D5ME 2W91A 4F3FA 3UBXA 4JFDE 4N0CC 4UDUA 2DAVA 3MLPA 1TTFA 1WVZA 3AXLB 5F6HI 2AAVA 4LSVL 2C3VA 5K9JL 1HHHB 1DN0B 4FFYL 5CP7A 3VD5A 3V7AE 5I1DA 1NLDH 4D9QE 1XF5A 3ZDYF 3WUWG 3WJLA 3GMRA 2EO9A 1M71B 1ZHLA 3QA3B 5I30H 3FRPG 4XBEH 4Z7VB 2DBLL 1FCGA 3QHFH 4DW2L 1PD6A 4GRWB 3DGGB 4FG6D 3MRNA 4X9BA 4WHCA 1UWGH 2FEDC 2QEJA 4RAVA 1LP9A 1JPTL 1TJIH 3GMQB 3VFUA 1Q38A 1T20B 1JK8A 3IDNA 3UTQB 43CAA 1ZTXL 2KL6A 5EIQA 2W65B 1N0XL 3G5VB 1HHKA 2HTLD 4E0RB 1KCVH 4Z7WF 4ZUVA 3TH4T 1MVUB 1F00I 3BXNA 4PJ9B 3TZVD 1LE5B 4G7VH 3G08A 2ZOLB 1E28A 3IU3A 4GS7B 2NY6D 3QFJB 8FABA 1R3LA 3FQWA 2NMSA 5DJYB 3SGKA 3DX9B 1AO7D 1G7IB 3KYOA 1DCLA 3LKOA 3M8OL 5K59F 5DHYA 3I6GB 2EDKA 3DX8A 4JZOB 2FSEA 2LE9A 2YC1B 4TTDD 3T2NL 2ED7A 2IGFH 3B2UC 5BQ7A 1FYHB 5DQJA 4HEME 1D6EB 3VXOA 2EZ0C 1YEFL 4B50A 2APWA 5I9QB 1GC1H 4KTDH 4PJBB 4OAWA 5F9DC 3T77B 1UZ6F 4RSVA 3BDXA 5E8NA 4RFOL 1AI1L 3ZKXC 4N0UE 2ICEB 1OAZH 4KRNA 4JKPH 5EBLA 4EVNA 3N50A 4I5BB 5FHAL 1BVLA 2ESVE 4EBQH 3ARGD 4NKDB 4KMTL 4HKBA 3HC3H 5DRZA 2NX5E 4HFWB 3HC4H 3QSKB 4OFPA 5C09D 4LHUA 3UTTB 5JORA 2CDGB 2DKUA 4WW2F 1JNJA 4NM8H 4LPXA 5J7CC 1D5ZA 5I8OH 5EC2A 2R15A 4H26A 4PGCB 3MA9H 1I8IB 5I74C 4PB0H 5C0GB 4NQXA 1ZMYA 2OTPA 2B1HL 2B5IB 2V2WA 3G5YB 4RA0C 4OLZL 2AJVH 3LPFA 2BSSB 6FABH 2XWJA 3H3KA 3O3EB 3IFLH 3QQ9C 3PQYB 1QYGH 3WFZA 5GGVH 1VEPA 2APBA 1JZ8A 3DYMA 1PJ9A 5L2KD 4Z77B 5DA4A 3JV6B 1CLZL 4JFEA 3Q5YA 4GXUM 1RUPL 1Z0MA 1BREA 1QEWA 1FRGH 3H3PL 4EUPG 4WW1B 2QR0B 4R2GB 3S3PA 2BC4B 1OCWL 1JYWA 1WC7B 5T1KA 2AJUL 1NCBH 1PZ5B 3QEQA 4POUB 2SEBA 1TXKA 3QHZH 2VDKH 4KDWA 1LK3L 1G6RB 4E41A 4X4ZA 1XCTA 3MO1B 3QWRA 3K2MC 2JJVA 1A9BB 4BA8A 1B2WH 3QIWC 5IW1B 3VFWB 4WUUE 1II4E 1CQYA 2C3GA 4QOKB 4FA8A 4K3HA 1WBXB 4X6EB 4FABH 1JPSL 5GPRA 2BOBA 5TH2A 4RISH 3WNKA 3WS6C 3D85D 4OGZA 1X5LA 1KT2B 4LIQE 2BP3A 2IPKA 3MLTA 2RJMA 3MRIA 2X4UB 4JFYB 4D0BB 4JHAH 4XPHL 1UWEH 4PV9B 4LCIH 2R9HD 3QNYB 4WRLA 5CEZE 3P73A 4K3EH 4MVBC 3HR5A 4M5YL 5LAXB 3MV7E 2OM5A 4PG2C 5EIVA 3FO1B 5EPMA 5DD6A 3C8DA 4XTRD 1JHKL 1V3JA 1UKSA 5K9OB 3WUWB 2CK2A 3MRFA 2R0WH 2AERT 3IS0X 3QIWA 3CCHA 2YPVH 2NY0C 5JNYB 1F58L 3O9WC 4LQFL 4DGYH 5E8PB 4FQLL 2J5LB 5TQ2H 3C09B 1BZ9A 1QSEA 1YNTB 1I9IL 2DKMA 3WS6A 2ZCLH 4D3CH 4LSRL 2KDGA 1J1PL 3CK0H 1LHZA 5DC9B 5IK3A 4LSSH 4XVTH 4PG2A 3WSQH 1WFUA 3D1MC 3KR3L 1Z5LA 3DV6B 4HLZH 5JUEH 3HE6B 3SOBH 1R3HA 1UM4L 2MCPH 3HI6L 4PGDA 1XF2B 5F96H 4NYLA 2E6PA 3SHSA 1LP9E 1M05A 5HHVH 5GSVB 1ACYL 2MQCA 5IFHH 3O9WA 2AJ3B 5EO1B 5D7LE 4TQEH 3JVGC 3C60B 3HRZA 4AH2B 1WZKA 1OM3L 1DTUA 3U1SL 3DXAA 1VACA 3U48A 5ETUB 1VFAB 4N9GA 3MRCB 1IGIH 1NFDE 1F02I 2OR7A 3WXVH 1B9ZA 4EDWL 4JO1L 1CGSH 1JF1A 4WI8A 4Z7VF 2H26B 1OTSC 4J4PD 4ALAH 4LARH 2LABA 1RK0B 1T04B 2YPKA 4GRWF 1MCWW 4PJ9D 5IB5A 4RX4D 4LKCB 4MA8L 2FIKB 3VWJB 1EPFA 1RZJH 4N8CH 3LCYA 5F1SA 5C2BH 4MA1B 2Q76A 2GY5A 1CK0H 1J12A 2ZSVA 4X4MA 3QFJD 4DN4H 2XZZA 2DB8A 3JVGA 4G80B 1I7TA 4WFHE 5GRUL 3GHEH 1ZXQA 3FOMB 2DLFL 4JPKL 3AY4C 4M1GH 1YEDB 4QY8A 2I9LA 3CZJA 4OD2A 2YSSB 3K81A 4ISVA 3OKNB 3ARPA 5I76B 4DAGH 2Y6SC 4R3SA 3V4VL 4F58H 1CDHA 2CKBB 1FZKA 5E6IB 2WUBL 2B4CC 4MQ7A 2HFFB 1JBJA 2P1YA 4M48H 2CRIA 5EU6A 2EDNA 1MH5A 4Q9BA 4XC1L 5A16B 1RAMA 1WK0A 1G9MH 4PLKC 1QSVA 5FHBL 3WFCL 5CEXA 3V0VB 4MLSA 1W0WA 2BNRB 2ARJQ 4Z78B 4HS8L 4LIQH 1KPRA 3AY4A 5DUPH 5D2LB 5BOZG 1YN6A 4OFYA 5CSZB 1U36A 3UTTD 4D2NA 4PJBF 1TNMA 1FZMA 1F3DJ 3FFDA 5CEZH 5F71A 2ID5A 1NC2A 1GPOL 4G6AD 1YEIH 4EUPB 4FQXA 1PLGL 4HHAB 2P8PB 5IHZA 3T2OA 4JGJA 3OB8A 3VRLF 2B4CL 5F1NA 5T33H 2MWCA 3MRKB 4ODUA 4XNMA 4M3JA 1L9NA 3D0LB 3TESA 1FFOB 5D71H 1QVOB 4JFEE 4Q74A 1G6VK 5SX4I 3U30B 4Z7OF 1A6ZB 5MERA 3PQYD 1I8MA 5I15L 3H6JA 2VR9A 3F65A 4M7LL 1IEHA 1A14L 2XIDA 5F88B 1BWMA 5DYOB 5CAYB 4LSVH 1T0NB 5K9JH 4P46C 5AUMA 1B3JA 4WFED 3QUKA 4PRPA 3QEQE 5L6YL 1ZT4B 1GYAA 1F4YL 3P11L 5HVGB 4BQBA 5EG6C 4F15B 3QDJB 4E41E 4DKFL 3MOQA 4DKAA 4XI5D 4WEMB 4XNUL 2GEEA 2DBLH 4P2QA 4DW2H 3SE8L 4ZYKB 1QKZL 4ODHL 2AJSL 2UY6A 4DTGH 1OSPL 4Y4KC 2FWOB 4XNZC 3OG6B 1ZTXH 5IBLC 3GGWA 4KZEL 4NUGL 4ZFFB 4HAFA 1N0XH 3IGAB 3V7AG 4QOKD 4LRNL 4TRPL 5J6GA 2V6HA 4L29B 2HJFB 1PYWA 2OTWB 1QSFD 4P46A 1S7TA 5GSRA 1UT9A 3P2TA 4X5XB 5JXEC 1LNUB 3KXFB 1JV5B 2DJUA 2H3NA 4X6FA 1IC5H 1IC4L 4PD4J 1ZK9A 4HGWA 1E4XL 1KLFA 2W0KA 1LDSA 3SGJC 1BFVL 4I3SH 1SM3L 3L5WA 2YA2A 3I3DA 4BH7A 3M8OH 4HW6A 1EEZA 2XT1B 4TNVK 4LEOB 4YHYB 5KN5B 4LU5L 1QSEE 4BSVB 2BMKB 5SX5H 4A2LA 2BSRA 3WS3A 5BRZB 1VFUA 3T2NH 3K8LA 4F7CB 3MLWL 3VMNA 4PJIB 1KJVB 3GDBA 1YEFH 5JLZB 3MRDB 4HCRA 2FJHA 1CYGA 4HCRL 3BJ91 5GIRB 1E0OB 5JXEA 4GAYB 3GSVA 5F7UA 3BHBB 3E6HB 4RFOH 2C1OA 4QHKI 1AI1H 5CD5C 2AJXL 4XP4L 2YEZB 2RFXA 4D9LL 5F1IA 5GGSA 3SGJA 5FHAH 5T5FH 5C0EB 2PW2A 2WWMC 2X70B 4Z0XB 4XAKD 2WMPA 3C5SA 1QO3A 5KSVA 3HE6D 3RPIB 1I3VA 3DXAE 5JTWA 3OR7B 5DTFA 2OXHA 3F7PC 1EEUA 5HVHB 3TJEL 4HLZG 1HEZB 4RFEA 4J3VA 3EOBB 4BJLA 4XC3L 1HWGB 5CGMA 2B1HH 1A2YA 1RVFL 2HFEB 3S4SA 1NEZA 1BQSA 4OLZH 1WTGT 1MCCA 3KYMA 3LSOB 1MEXL 2VLRD 1X44A 3L9RB 5I73B 1KF9B 1JTTA 3LS5H 5E8EA 4HGKC 4ZSOA 4X4ME 4QHLA 3MPCA 1OQOA 4OTXL 1JGVL 1CLZH 5I18L 1RUPH 3VWJD 3H3PH 5GJSL 4LFHG 1AQDB 3QI9B 4NJAL 3VFOB 3NCBB 1OCWH 5F3HA 1JGUL 1WAAF 2AJUH 5A2LH 4AENB 4X5WA 2ZG2A 4K3DL 3GSQA 3P9MA 4R7DB 3CZFA 5E9DA 5ID0B 1LK3H 3DVIA 2EE6A 4LHQB 3DI2B 4BKLA 5EU6E 3B5TA 4FZEL 5B4MC 2CIIB 3ZO0A 1YEGL 2RIKA 1JPSH 4I2XB 3U7AA 5F7KC 4FQIL 4HJ0D 4NM4L 4YHPB 5IV2B 4YGVA 2E8ZA 3HMXL 4XPHH 4Y4FA 2NW2B 5I1GL 3QEHA 3KPSA 5GJTL 2YWZA 4M5YH 1RK1B 3U2SB 4U1LA 2BNRD 4NFDA 2IBGA 3NN8B 2ICWA 1FV1B 1JHKH 1NC4B 2Z8RA 3VU2A 4LVOC 1BFTA 1Q9WB 3LOWA 4LQFH 4XPFL 4X99A 5CZXD 2CLZA 4FQLH 5ESQB 1GHFL 2X1PA 2BVUA 5D5MB 4CU7A 4PB9L 1T7WA 5DRWA 4KK6D 3WIHA 1I9IH 4L8BA 3RWEA 3WIHL 1FL5B 2QQLL 4JFDB 3C5ZB 5I1IL 1ES0B 3SDCD 4LSRH 5D2LF 3JUZA 1EO7A 4CGTA 5MI0C 3MGOA 4XCEA 4HULB 3WL9B 1J1PH 4MLIA 1IGTA 4PRPE 5HD8D 1TVHA 3GM8A 5CCKL 4YNYA 4YHKL 5FYJL 3KR3H 1VENA 4KKAC 3DWTA 4P48A 3LDBC 2AEWA 5IR1A 4NP4L 1T0MB 5DUML 1UM4H 2EIZA 3UBXG 5J56B 3V5KA 2CXKA 4K7PL 1ACYH 4QRUB 2VO5A 4RGOL 1ZT7A 5KVGL 3UPRB 4GLRH 3QDJD 2CDEB 1SJHB 2X42A 1AR2A 4ZFOL 5L0QB 4MAYC 1OM3H 4GRMB 2BRRL 3U1SH 5KVDL 3G6AA 4APQC 1A4JB 3EHBD 3FB6A 5HI4D 3QO1A 2BZDA 1HHJA 1UM6L 3MNWB 4YUEL 1XEDA 1QRKA 3O6FC 2BVYA 3WNPA 4MJ6B 4EDWH 2ZCKL 4JO1H 5EOTA 1UM5L 4I18B 3CFDA 1K5NB 3D3VA 1ZSDA 4J12A 1S7SA 5FO7B 4PRDB 5DJ6A 3C5JA 3UTZB 4MA8H 2BVOA 1EERB 3VXSB 4BZYA 5E7BA 3C87A 5KJRL 6CGTA 1F3RB 5C6PB 3KXFD 1HI6A 1A9EB 1FDLL 2GFBA 4XCNA 3HE7C 1WJ3A 3AAZB 3AS2A 5IB1B 2F9BT 4MAYA 5HYEA 5GRUH 4O2CB 4APQA 5CLWA 4EI5B 4JPKH 2DLFH 5M7QA 5JW5B 4RFNB 3RVTC 4NKQB 5IEKA 2PYEE 1Q9OA 3UZVB 3BI9X 5ITBL 3O6FA 3ZKND 3UTSA 2HLAA 2EKSB 4HKXA 3TPUA 4QYOB 3VJ6A 5TGBA 2UY7A 3LH2L 3V4VH 4N0UB 4UIMB 5F6HJ 1QFUL 4TSCL 2WUBH 3G5ZB 4X4YB 5MEPA 4RGMB 4NWTL 1U6AL 2QQNL 2ESVB 3B9AA 1E6JH 2NX5B 3HE7A 5FHBH 3WFCH 3O8XB 1DQTA 1U3HC 2BY2A 3JV0A 2XYCA 2EE2A 5D93C 4PJIF 4HS8H 3L3IB 1K3IA 1JGLL 3ARDC 3QHTC 1K4CB 5CEYB 3L5IA 3IDXL 1GPOH 4OF3A 1ED3A 3QO0B 2JIXA 1PLGH 3MLUL 4ZUWB 3WDHA 3INUL 2CKNA 4BUGA 1BBDL 4LHUG 1FNGB 4XPBL 4O51B 4C83B 4N0YL 1NGPL 2GIYA 3UYPA 1PEWA 2B4CH 1JZ3A 3MLRL 4ZSOE 4OUUA 4U1GB 3VXRD 3X12A 3VGAC 2FLRT 1KG0B 5ICYA 4Z7UA 2V2XA 1U3HA 3AS3A 5DK3A 3VI3F 5I15H 3DRTA 2D0FA 4H5SA 4M7LH 2XN9B 1KENL 4ZO9A 4PGBB 4Q0XL 3ARDA 1V7NL 1XCQA 3RTQD 1T7YA 5L6YH 1F4YH 3P11H 5LJYH 5J1SC 3T3ME 1T7ZA 2JE8A 4DKFH 4DGIL 5DJDB 4XNUH 3X13B 3GJFA 3O4OC 3SE8H 3LQZB 1CDCA 1QKZH 3HB3C 5HVWA 4K71C 4WUUB 3T3PE 1U8LB 5HHNB 4ODHH 2AJSH 1AGFB 5IQ9B 5I8KL 5EU7C 1OSPH 1EX0A 4MZ3A 5DGQA 1ZGLM 3X17A 4X6DA 5GGRY 4NUGH 3RKDC 5IMMB 1X7QA 5K9KA 4UBDD 4Z76A 2O61A 4LRNH 4TRPH 4MGXA 3CSYB 3KPSE 3ZT7A 3OXRB 1JJUA 1AXSB 3MV7B 2IADA 1MRDL 5C6WH 4X80L 3FT3B 5BVJB 4ACPA 4HAGA 4NRXA 4GKSB 1IC4H 3QNXA 3AGVA 3G6DL 1E4XH 2VABB 5D8JL 1BFVH 4ZXBC 4CU6A 1SM3H 3CU7A 5J1TC 5HTSA 2PTVA 5MEOB 3G04B 3NGBB 1MHEA 3BO8B 5C71A 2XRAL 1JUFB 2DRUA 3RIFK 4UI2A 4F3FB 4LU5H 4NFCA 3UBXB 4UDUB 1S5HA 4WFFD 5GS1B 3WO4C 3MLWH 3GO1L 1BF2A 2C3VB 1DQQA 2VXSL 3EJYD 1PY4A 2XQYK 5EOCL 5CP7B 4F33B 4JB9L 4HCRH 5FYJE 2X4QA 2AEQL 4JFDD 5DJZB 3MUHL 5ESVA 2VQTA 1P7KA 2AJXH 4XP4H 4ZPTA 4D9LH 3MRNB 1AHWC 2MCG1 3ARBB 4ZXBA 2DDQL 4RAVB 4D9QD 1LP9B 4CADB 3VFUB 3GMNB 1DVFB 1RUQL 5D5MF 1Z3GL 1JK8B 3IDNB 3NCCB 5D7LB 3BUYA 2A6IA 3TCLA 1TFHA 4HFUL 1HHKB 4NC2B 3TJEH 1UGNA 1JRHI 1CLOL 3BXNB 2VAAA 1G1CA 1NFDB 4L5FL 5FF6B 1DBML 1A6VL 4XC3H 1S9VA 3VXMA 2OK0L 1E28B 1RVFH 1JCKA 3IU3B 4YBLB 1SYSA 2JJSC 5H8DA 2VC2L 3BW9A 2HMIC 5HGBA 3D3VE 4BYHA 8FABB 1F8TL 3LEYH 4Z7NE 3FQWB 1NANH 1MEXH 3GMPB 1AHWA 3KYOB 3W82A 2EDJA 3LKOB 4IM8A 1CLCA 1A21A 2A73B 3LV3B 5DHYB 5DO2D 4OI7A 3DX8B 1PEZA 3DARA 1LEKA 4OTXH 1JGVH 4IRSD 5I18H 5E6ZA 1FSKC 5C0IA 3L3OB 2ICCA 2ZZUT 2F15A 2VITA 3MRPA 4X9GA 5DQJB 5GJSH 5BQ7B 4W70A 4QTHA 4NJAH 3VXOB 5ANMA 3R1GL 1JGUH 4UTAL 3O41A 1BP3B 4YBQC 4IRJC 5I75C 4Y4HC 4HUUB 2DN7A 4K3DH 4EI5D 3WHXA 2IH1A 5M95B 4QGTA 5E8NB 4EKXA 1B0GA 4EVNB 4ZUUA 1BQHA 1JTPA 1SEQL 5D7KE 3CDYA 3CMGA 3TBVA 2WBKA 4A6YA 1BVLB 4A6YL 1OWWA 3SKMA 1AE6L 1NBQA 2HRPL 4FZEH 4HKBB 4U0RB 5DRZB 1J8HE 4ONHA 1YEGH 2FJGB 4LHUB 5JORB 3LIZL 2VDNL 3IDMA 1D5ZB 4FQIH 5EC2B 2ZPKL 4H26B 4NM4H 4U1NA 3P9LA 3V52L 2ESVD 2CUMA 1F42A 3HMXH 1OB1A 2NX5D 3GSXA 1PVHA 5I1GH 4NQXB 5DJAA 1IBGH 3B8SA 3O8XD 5GJTH 1KGCE 1I1AC 2V2WB 4IRJA 4Y4HA 3BKCH 4GUPA 5IP4A 2MKLC 1IVLA 3SDAD 2HP4A 2XWJB 3ZKXB 5FUOL 3RVXD 4JR9L 4FXLA 4LFHD 5IVZB 3BIKA 4XPFH 2WLZA 4M1CD 4ERSL 1RUKL 1SHMA 4Z7UE 1GHFH 4JFEB 1B88A 3TM6A 2DBJA 4PB9H 4QHNA 3OB0H 2MJWA 3MZTA 1QEWB 3WIHH 1T89C 2QQLH 1KEML 3P3YA 1TJGL 2P7TB 5HPOA 2OQJA 5EO0A 2BHUA 1S7XB 2SEBB 5CCKH 1I1AA 4YHKH 5FYJH 4E41B 3CMOL 1XCTB 3I3EA 4NP4H 5DUMH 5CD3A 5J89A 1CGXA 4EDXB 1YPZA 2FBJL 4PYGA 4M62L 4O00A 1NAKH 2FCBA 5JW4Q 2Y23A 4K7PH 5DMIH 5KVGH 4JKMA 2BOBB 5TH2B 1HOCB 1MHPL 4MNQA 3TNNB 3KLHC 3DECA 2BRRH 5KVDH 2IPKB 3MLTB 4L3CB 1T89A 3GI8L 4WUUD 3FTGB 2W9EL 3EDKA 4JFPA 3FFCA 4UU9B 3VGFA 2QADD 1UM6H 3O2DA 5I1LB 4YUEH 3UTOA 3HR5B 1YEJH 3MC0A 4U1HA 4IRZL 5EPMB 5DD6B 4AL8L 4DOHE 2ZCKH 4JLRA 3BQUD 1VGEL 5C8JA 1UM5H 3ULUC 4P49A 2AXGB 4AIZA 2DICA 2UUDK 3PDOA 5CEZD 5IM7A 2F74A 3CCHB 2UYLA 5KJRH 4K8RC 3L5JA 1Z0NA 1FDLH 2BY0A 2NY3C 1U95A 2C3HA 5L2JA 2ATKA 4BFIA 1BZ9B 1QSEB 3MGAA 1QG3A 1X4YA 1IEBB 3KS0J 1NBVL 5L88L 1WIPA 3P4MA 5IK3B 1FCCA 3S96A 5ITBH 3JXAA 1T3FA 1U2CA 5EIIA 3S97C 1A1MB 5HYIA 3SGEH 1Z5LB 1X4ZA 3TA3C 1I4FB 2F19L 3ULUL 1R3HB 3L6FA 4UINL 1QFUH 3CC5A 4P5TC 4PGDB 4TSCH 3TFKC 2EDXA 4NYLB 4KJWD 4NWTH 1M05B 1U6AH 3QPQC 4NHUA 1OAQL 1B6DA 2QQNH 3U9UA 3O9WB 5IFJA 1V05A 1J0HA 2EC9T 4OV5A 1W0YT 3DXAB 1VACB 3W0WA 5C92A 4N9GB 1KB9K 2NY4B 3SDDC 1M1SA 3Q2CA 1OAUL 1JN6A 3QDAA 5E0QA 3H3BC 3EJJX 1JGLH 4PTUB 3IDXH 5HHQB 1OW0C 1UKTA 4N0CD 1WZLA 1E4KC 2ADFL 5C0CA 3MLUH 3TA3A 3INUH 5IB5B 1BBDH 5JXAL 1QPXA 4P5TA 4XPBH 2GITA 2A0LC 3PABB 1LP9F 4NC0B 5I1KL 5KTEL 1HILA 4FQCL 2C4FU 4PJXE 3VA6A 2Q76B 3S3SA 4QXUL 1CFVL 3FB8A 3EO0A 2WK2A 1I7TB 2VLKA 5FB8B 3SDDA 3T4YA 1VGKA 3S4SG 2FEDD 2BY1A 4QCIB 1NFDF 4NCDA 5INCA 5ANME 5K9QI 5DS8A 3EDDA 5JHLL 4OD2B 2QSVA 4Q0XH 1V7NH 3D0VA 4ISVB 1OW0A 4KMLB 4WFHD 3EKCA 1E4KA 4R3SB 3CNKA 4XVUC 1QUNA 5IG7B 3K4ZA 43C9A 4DGIH 3RHWK 2GQHA 4OSUL 4L3EA 3ZHDA 4MQ7B 3GJFH 1NH6A 2LAAA 5JW3H 3ARWA 1MH5B 5DSCB 1NCCL 1YDPB 5CSGA 4G7YL 5CEXB 4UAOC 3IRPX 4QHKJ 4JJHA 2EDYA 3VXQA 1PZUB 1MFEL 1X5HA 5IJVA 4I0KA 1KPRB 3SGDI 2EEDA 1X5JA 3QAZC 1QFPA 3KPMA 4X8JA 4ZPVA 3RWJA 4LHUD 4RMQA 1FZMB 1Q9KA 3KWWA 2QHRL 1NC2B 3FN3A 4E9LA 1MRDH 4FQXB 1XIWC 4X80H 2PUQT 4PJEA 3D18A 3VGHA 1Y18B 3B2UD 3N0PB 2Q6WA 3WNNA 3LAFA 3CDGB 4B7LA 2EZ0D 3MCG1 2VZ1A 1X6LA 3G6DH 5D8JH 5JR1L 5F1NB 1F6FB 2CO7B 1MELA 5ILTL 4ODUB 4XNMB 4GW1A 4P0DA 2XRAH 1BJMA 4ZQKB 1EEYB 3KLSA 1X3DA 1MRCL 1YQ2A 5C1MB 4WGVB 5HGAB 5I71C 5JOPE 5DT1L 1J0YA 1I8MB 4Q7DA 1LEGA 5FXCH 5GHWH 4BFEA 1JGEA 4QHUA 1FFQA 1R0AL 1WWBX 4LL9A 5AUMB 2VXSH 4TUOA 4JFED 4PRPB 5EOCH 3FHAA 4JB9H 5HHOA 1FP5A 5KOMC 2AEQH 2X7LA 1XIWA 5DRNA 2P45B 3RWDA 2FNBA 4JN2A 5T1KD 1YPZE 1F11A 4ZTOL 1OGTB 3QEQD 2VRAA 2DDQH 4HK3N 5F7YC 3DYOA 1LO3L 1RUQH 4E41D 4MNQE 1OTUC 1Z3GH 5C0DA 5FYLL 4X83A 2FR4B 3GGWB 1XH3A 3HN3A 3PWJA 3BRFA 4HFUH 2R0KL 3QQ9D 1HIMH 4KMQA 4QRPA 3RAJL 1EZVY 3FFCE 3GZKA 5J6GB 1CLOH 1GGYA 3GSRB 1PYWB 1CZ8L 4P46B 4L5FH 3TN0C 3OPZL 1DBMH 1A6VH 2OK0H 2VZTA 4Y8DC 3EO1A 5FECA 5IWLA 3RNKA 2H3NB 1VEOA 4M7JL 3TIEA 1T6VN 3IKCA 1F8TH 2P4AB 1FN4A 2WBWB 2D4DA 3QXUA 4M7KL 5IW6A 4HWUA 3RKPA 2N56A 3CFEA 1AGBA 1HYRC 1EEZB 1BJ1J 1ZOXA 4OLUL 1RZ7L 4KKBC 1T1YA 1U58B 4XNZB 2XTJE 2BSRB 1J5OL 5IVNA 3QIWD 2I9TA 1Y6KR 4NZUL 1CDIA 2BVPA 5DURD 2PKDA 3AC0A 2PYEB 3R1GH 4YDKL 2FJHB 1QSED 4UTAH 3KPOB 3V0AC 3MRGB 2GW5A 3GSVB 3KVQA 3O11A 3S36X 3ULUE 3U46A 2Z4QA 1LD9A 2RFXB 5ITFB 1GL4B 4MVBD 1N59A 3CPLA 3MZGB 2PW2B 1IGCL 4A6YH 3C5SB 1AE6H 2HRPH 2XWBA 1QO3B 5KSVB 2YD1A 3NZ8A 2I24N 3GSNA 3P0VL 4KK5C 3GSNL 3W0WE 3LIZH 2VDNH 4IS6A 4M6NL 3U7YH 5DTFB 1T22A 2ZPKH 5FM4A 2D31A 5C0BE 3V52H 3KLAA 2NY0D 4RFEB 3O9WD 1QA9A 3DXAD 5FYKL 1CFSA 3S5LA 5GXBB 3S4SB 4Y19A 3IDJA 2E3VA 1CIUA 3QRFM 5C0CE 4LF3A 3QUZC 3KYMB 1EJOL 3V8CA 5FUOH 1IKFL 4S1DC 3LPWA 4IIQC 4P4RB 4YDIL 4JR9H 4NN5B 2DM3A 5E8EB 5FGCE 3RL1A 4TULH 4ZSOB 4LDEB 4QHLB 3I84A 1DQDL 5I16B 3RZCC 4KK8C 5H94A 1RUKH 4C56A 4JHZA 2Y7QA 1RJZA 3VXUA 1KEMH 1N2RB 2J2ZA 1TJGH 3WFEL 5JHDA 4R8WL 4HG4K 1MAML 3GBNL 5F3HB 4I9WD 2GHWB 2JCCB 4BFBD 4U1JA 1IJ9A 1J10A 4X5WB 5IVXE 2FO1A 4IOIA 3ZTJH 3GSQB 2CRYA 1A3LL 3QUZA 4L3EE 3LEXA 3WEXA 3ARTA 2MOVA 4IIQA 4BKLB 2DLTA 2FBJH 1ERNA 4M62H 4XWOC 1PW3A 5J3HC 4UOJA 4IBLT 1OTSD 4U1IB 3RZCA 1MHPH 4MNGB 1AJ7L 2EDWA 2DI9A 4KJQC 4EIZC 5EU6D 3GI8H 3D48R 5CIPH 4YGVB 4Y4FB 5BW7C 4OD3L 3QEHB 3O2DH 5BV7C 5J4MA 3KHOA 3I6KA 4YXKL 3OGCB 1Z9LA 5C08B 2H1PL 4IRZH 3IKKA 2AK4A 4AL8H 1VGEH 4P3DA 3PNWA 2ICWB 2ZSWB 1XGUB 1LEIA 4K3JL 4OFYD 3MGTA 2D0GA 1T5WB 1QOKA 4NC1E 1NC2D 2CR3A 3C6SA 4WI9A 5ICXA 4X99B 2CLZB 3RWIA 2Y6SD 2R69L 5ALCL 3CD4A 5I19L 4L8BB 3ARSA 1EUTA 4PTTA 5ABDE 1NBVH 4XCEB 1G7HA 5L88H 5HI5C 3ARXA 3IXTB 5D96C 5BW7A 1IGTB 4PLKD 1ETZA 1TVHB 5AWNL 1KXTB 4XHJC 3WNMA 2HFGL 3HPJA 4OGYL 5DZLA 3EOAA 2NW3A 1QLRA 2F19H 3ULUH 1H3WM 3EYVA 5IHBA 2JELH 4UINH 2EIZB 4PRPD 5DI8A 3T1FA 2BK8A 3V5KB 2X1XR 5BZWB 3TBYA 1OAQH 4N0FA 4FQ2L 2C7UA 4DZ8A 2C4XA 1J1XL 4F37K 5JA9A 3OF6D 4ZFOB 4P2QD 3WKML 3G6AB 4QRPE 1OAUH 3FB6B 3HZYA 1V3MA 3QO1B 3ARFA 3KJ6H 1HHJB 3V4UL 5KW9L 3DUUA 4QRRA 1F5WA 2FO4A 2VLMD 5KANG 3FCTA 2GCYA 2I25N 3KPQB 1FZOB 2ADFH 2E6JA 1QR1A 1ZSDB 4LVEA 4J8RA 4GMTL 5DJ6B 4P46D 5GS3A 2BVOB 1AIFA 4PRBA 5SWZA 5JIIA 3IVKB 5JA8B 5I1KH 3NACL 5KTEH 1HI6B 4FQCH 2EXWC 4XCNB 2P49B 3WIFA 3OKLA 4QXUH 3UCRA 1L6ZA 1CFVH 2KUTA 3TNMA 4MAYB 1OAXL 3H9SD 5JIKA 4APQB 3EJZC 2UZIL 1YMHB 1TZIA 1U8QB 5IEKB 3P30L 1QFWL 4Y4KD 3BH9A 5JHLH 5DFVC 3NCYP 1BFOA 3VFNA 5IBLD 2W9DL 4HKXB 5TGBB 2BNQA 4L8CA 5E5UB 5IIEA 3IS1X 4OSUH 5MEPB 4XPTL 2O93L 2MNUA 2VLLA 3KJ4C 4HIIA 5JXED 4GAGL 1CT8A 1NCCH 1J8HB 1C5DB 3HE7B 3GMMB 4G7YH 3BH8A 1NAMA 1MLBA 4RAUA 3WBDA 1NAML 3MROA 2IMNA 1MFEH 4MJIA 4ZNEA 5F6IC 2MQ3A 4P2OA 5ISZA 1CICC 3P77A 1AQKL 4I77L 5FYKE 1IM9A 1BQHG 1FGVL 2DQCL 4Y19E 4HPOL 2QHRH 2Q8BL 1ED3B 1TJHL 2JIXB 4J6RL 3FT4A 1LO5A 2WIIA 3HG1A 2FATL 5KSAC 2GUOA 4MHHG 5JR1H 4D9RD 4OUUB 3X12B 4JE4B 2WUCH 1MRCH 4Z7UB 5CD5D 4C56E 2YMXL 2V2XB 4UQ2B 1U3HB 1CE1L 1WFTA 5DT1H 3SQOL 3VXUE 3BP5A 3DRTB 3EAKA 4FQQA 1NCUA 1R5VB 4H5SB 5JHDE 4G42A 4UB0L 2WWMD 5JPNA 1KBGL 2VLJE 1PDKA 1R0AH 4JRXB 4H25A 1FNAA 4MAUL 1KB5A 3ARDB 4PIRF 1KB5L 1XCQB 4WTXA 4KDVA 4LP5A 2AXJA 4NO2B 3HTLX 4NOFA 3GJFB 3TO4B 5KSAA 2WINA 4R96A 1MRFL 4ZTOH 4X7TA 4GLRI 1LO3H 5E9DD 3VGAB 3B3IA 3O3AA 2V9RA 1TTUA 1HNGA 1MJJB 1XT5A 3DETC 4UOW1 5FYLH 3ZTJG 1X7QB 2R0KH 4Z76B 2O61B 5EUOA 4HWZB 1KJ2A 4KKCC 1ZS8B 1DUZA 4KKLC 3BPLB 3OPZH 2IADB 2AK4E 2DKSA 3T3MF 4V2BA 3MLYL 3QDMA 4M7JH 5INDA 5I17A 2UV3A 1SMAA 3KPSD 4M7KH 4RRPG 5GRXG 4QXTA 5IOPA 3T3PF 2YBRA 2AXFB 4K71B 1MHEB 3MUZ1 1RJCA 5HYFA 4OLUH 3BZDA 4PJDA 4QWWC 2BSTA 1FORL 2X4OA 1J5OH 2J3SA 1EGJL 3QQ4A 5DFTA 4KHTL 4NZUH 4OCRL 5B4MD 4WW2C 1DQQB 2JLLA 4PREB 2DMKA 4XXDA 3V5HA 5E2TL 4YDKH 1BF8A 3QDGA 5GS0C 1K2DA 5E8OB 2X4QB 4XRCA 1F4XL 3FB7A 1IZKA 5ESVB 4LSDA 2QQQA 5E94A 1P7KB 3GBLA 1KIPA 4FN0A 2EDFA 2Z35B 4RZCB 3RWCB 2BSED 2PTTA 2HVKA 4PJAA 3ET9F 3GK8L 4ZXBB 4XPGL 2IQ9L 1YEKL 5T3XL 1CD1B 2ZG1A 4EI6B 4MB3A 1I3GL 2KH2B 3T08A 3P0VH 3GSNH 3BUYB 2A6IB 2DD8L 4S0TD 4M6NH 5BZDA 3EOYG 5F3BB 2OZ4A 2OZ4L 2R2HA 5TF1L 4PY8I 3R06A 3V5DA 4FS0A 4QRRE 4WW2A 5DMYA 4PPTA 5D4QA 5CJOH 3KDMA 5LCVL 3MFFA 1NJ9A 1S9VB 3MBEC 2AK1L 5FYKH 5GS0L 5IB3A 4M93C 1SYSB 1OGAA 3BW9B 4H1LA 5HGBB 4IDJL 1SVZA 4Q9CA 5B39G 1EJOH 4U1SA 2DQFA 2R0LL 5E1HB 1IKFH 2XZQL 1ZAGA 1AHWB 2YD7A 5SWZE 4YDIH 1U8PB 4U6VL 1DDHA 4AY0A 4PJXB 1DQDH 3NCYS 3D3VD 1HN1A 1LEKB 3L3DB 3UO1L 5EFIA 1A47A 2A6KA 2BXYA 4WV1C 5C0IB 2YUZA 5HDLA 1KTLA 2VITB 2DLEA 3MRPB 2AGJL 3WFEH 4QTHB 2VKWA 4R8WH 3GBNH 5ANMB 4P57B 1Q1JL 5DVOA 1JHLL 1ZLVH 4MAYD 2QKIA 3MBEA 4FQJL 1NCDL 4OFVA 4APQD 3D87B 4NDMB 3WHXB 2BNQE 1A3LH 4FZ8L 1B0GB 4ZUUB 1BQHB 3C8KB 4BH8A 3TBVB 5C0NC 2VOTA 4A6YB 3O6FD 3UTSD 2ITDB 1D6VL 4ONHB 1BIHA 1FZJA 2DTSA 3W11C 2B0SL 3IDMB 1AJ7H 2DLHA 2A74B 4WV1A 1FSKB 5D7KD 4MJIE 2ZUTA 4U1NB 1Q72L 4EEEA 3R8QA 1I8LC 1G7QA 5ISZE 1OB1B 1WEJL 3GSXB 4QRQB 3Q0HA 4OD3H 1QD0A 3HE7D 4AM0B 3QIBC 3KPRE 3VDAA 5I75B 2H1PH 4GUPB 4G43B 3Q6FA 1OF2B 1FL6A 3HG1E 1IQDA 4JFHE 2ICES 4K3JH 3OJMB 4NNPL 3RVTD 1E4XI 4LGRB 5IT2L 5HHPA 2KQNA 2E7BA 1KGCD 3X14A 3BIKB 1J11A 2BHZA 2JIXD 4NKOB 3PL6C 2R69H 1YJDL 2DWEA 5ALCH 5DJ2A 5I19H 3L3KA 1ZLWH 4U3CA 4OGXL 1IAIL 4AK1A 4LCYA 5F21B 1I8LA 2OQJB 1SYVA 1JTOA 2AS5M 5EO0B 2O5ZL 4Q2ZA 1KIRA 2VZ3A 3FT2A 5AWNH 3W81A 1DLFH 1KPVA 1U3HD 2DL9A 2HKFL 1I1AB 1DBKL 2HFGH 3U4AA 4KXZI 4OGYH 1NGZA 3VA2C 4KWUA 3C9NA 3TT1L 5CD3B 4Q97A 2NXYC 1YPZB 3ARDD 4R97C 1RY7B 1MCLA 1FAIL 2W0LA 3VFRA 4O58L 4Z7UF 1J1XH 3ZE1E 3BEWA 5HJ3A 4MNQB 1KCKA 4ZFGL 3WKMH 5CIPB 1BIIA 5EUOE 1T03L 4U3HA 3FFCB 4KFZC 3V4UH 5IB4B 5KW9H 4FXKA 3WXWL 1ZT1B 2F54A 4U1HB 1TTGA 4MCYB 1I1CA 3EDFA 3QDME 5C8JB 4DKDC 4LASL 5B3JE 4P59L 4AIZB 1WGOA 4GS7C 1CDUA 5IJKA 4GMTH 2W38A 3HMWL 3QA3A 2F74B 1VB9A 1AFVL 1I7ZB 2UYLB 3NACH 3PWVB 4Z7VA 1H0DB 1NGWA 3JWOC 3RDTA 3D5OF 2ATKB 4BFIB 4PJDE 2FYYA 1ZVYA 2VL4A 4B0MM 1OAXH 2XTJB 3GMQA 3HB3D 2UZIH 3UTQA 1XGQA 3P4MB 1XGRB 1UFUA 3PWPA 3ZHLA 2W65A 1QFWH 3P30H 3QDGE 1T3FB 5KZCB 4GQ9L 5EIIB 4N5EC 2HLFC 1MVUA 2LVCA 2W9DH 3RKDD 5DVKA 1VKXA 4F7EB 3GB7A 3T8XA 2ZOLA 2F8XC 2IALA 3BYTA 3CC5B 4PJAE 3WN5B 4K94C 2GT9A 3ESVF 4XPTH 4NHUB 1HHGB 3B6SA 4GAGH 5IFJB 4YPGB 4LCUB 5B39B 2NY3B 4HK0A 4OV5B 4X6BB 1YQVL 4XHQA 3W0WB 2X6MA 4D94A 5FA3A 1A8JH 1NAMH 1JN6B 4ZXBD 2EH7L 4LCWE 4WI7A 5C0BB 1AKJA 4NO0B 1WBYB 2YC1A 1AQKH 3S98A 3AROA 4I77H 1OP3H 4JO3L 1FGVH 1OGAE 1D6EA 2GK2A 4HPOH 2Q8BH 1TJHH 4J6RH 5MENA 2B5IC 2BFVL 5T3ZL 3RGVC 2FATH 5F9WC 3T77A 2P48B 4K94L 3VXMD 3IFPB 5FGCB 2V9TA 4I5BA 4MA7L 3FB8B 3EO0B 2YMXH 2HWZL 1CE1H 1P5VA 3SDDB 3SQOH 3T4YB 1VGKB 4WU7A 4HFWA 3S5LG 4UB0H 4PGJA 1WF5A 1KBGH 4MAUH 2FL5A 1GVIA 1KB5H 1FFNB 4R2GC 5IVXB 2BVEA 1T21A 1I8IA 2B20A 2ATPB 43C9B 4LMQE 4LP4A 3RGVA 1G7PA 3CX5J 2FX9L 4S10A 4PJXF 3ALWA 3Q6GL 5IBTL 4PY7B 3O3EA 2HMID 5E08L 4LRIC 1A7QL 3VRIA 5D70L 2O26U 2X41A 3VXQB 4NO3A 4KUZL 4JPVL 3B5HA 1L4IA 1Q94B 4OCLC 3JV6A 3RWGA 5I1JL 5I1HH 1DUYA 3KPMB 4ZPVB 3RWJB 4JY5L 5DD1L 2EICA 3KWWB 1T5XB 5IHUL 4JHWL 4ELME 1DQJA 1K85A 1WC7A 3MLYH 1S7UB 2Q6WB 2GTWA 3QH3A 4P2YA 4YBQD 4IRJD 2XWTB 2FLBT 3OAYK 4Y4HD 3MO1A 4GW1B 4O5LH 3LS4L 4RIRA 1CL7I 1WWWX 2ZKHL 4LRIA 4XP1L 1FORH 4UAOB 2YD4A 4X6EA 4CN1A 1LEGB 2J5LC 1JGEB 1O5DT 3CFJB 1PG7L 4QHUB 1JZ7A 4YHOL 4KHTH 1GXEA 2HT2C 4OCRH 3QAZB 4KJYA 5E2TH 4D0BA 3U7WL 1YC7A 4KUCD 5JOPD 1FYTA 2X7LB 4YHML 1XIWB 1F4XH 3QXDB 3HI1A 5DRNB 3MV11 5ID1B 3CGTA 1CDYA 4ODSL 5LAXA 1TPXB 2DQTL 3RWDB 1XR8A 2F53B 4JN2B 1J9CT 3OHXA 1F11B 3GK8H 1FNLA 4XPGH 2IQ9H 1I1AD 1YEKH 1WT5C 3HKFA 1A7OL 1TCRA 5K9OA 2OI9C 1I3GH 3EYOA 4NQSA 3QXWA 4KUCF 5C0DB 5M94B 5E95B 1KIQA 2DD8H 1DE4A 5I71B 1XH3B 3FRPA 3PWJB 4Y5YC 4U31A 3K8KA 2OZ4H 5GRVK 3C60C 5TF1H 1J0KA 3I3BA 2ENYA 2X89D 2MFNA 1H5BB 3F5WB 2F54E 1Q0XL 3BPOB 4MNQD 3WV0A 5LCVH 4CVWA 3Q1SL 3HCVB 4Z95L 1X5AA 1UWXH 2AK1H 3EO1B 5FECB 5GS0H 3EO9L 3HZKA 4IDJH 5HYJA 1A22B 3FFCD 1TENA 2NTFB 1J88A 1YPZF 5IW6B 1I3RA 2R0LH 2XZQH 4ENEC 5HYSA 4U6VH 2Z31C 3TT3L 1IC1A 1WT5A 4TSAH 5EA0L 4BQCA 5JO5A 3LKRA 4CMMB 3UO1H 5HGGS 4WCYL 2P5WA 5GSVA 1NPUA 4MA1C 3NH7L 4KI1A 2AJ3A 4Y5YA 5EO1A 4HUXB 2AGJH 3C60A 2BVPB 1HCFX 2DM2A 2X4NB 3MUGA 1A3RL 4AH2A 3PWPE 5ETUA 1VFAA 2FECL 3MRCA 1Q1JH 3RU8L 1JHLH 5D1ZB 3KLHD 5HI3C 3NIFE 3O11B 2VXVL 3U46B 2Z4QB 4FZ8H 3V95A 4MWFB 1FGNL 1LD9B 3TYFB 3QCUL 1N59B 2H26A 4QRTA 2PNDA 3DMMB 4NRZB 2XWBB 4JVPA 5E6IC 1D6VH 4BZ1L 1T7VA 2Z31A 1P9MC 4LKCA 3NZ8B 2Y36L 3GSNB 4CDHA 3ULUD 2HRLA 3VE0B 2B0SH 4AMKL 1T22B 1WIUA 2E9WA 2D31B 2XNAB 1Q72H 2ZG3A 3KLAB 3DV4B 2PN5A 4G80A 2EDRA 1WEJH 4K8RD 1QA9B 1HKLH 2NY3D 4NBYB 1X5KA 3W0WD 1NMBL 4Y19B 3IDJB 2WQ8A 3GUTB 1YZZA 4TOYL 3ULUF 3SN6N 2K1MA 1BZQK 2B39A 5MENE 4LF3B 3L3HB 5T3ZE 1UCTA 2YSSA 3UEZA 4OCWL 3P4OA 4NNPH 3OKNA 5IT2H 4M9OA 5IGXH 1I9JL 1U92A 3RL1B 3ES6A 2CKBA 3O3DB 3VFVB 1P9MA 1YUHB 1PGRB 2A2QT 5C0CD 1KACB 5H94B 3TA3D 3VRLE 1YJDH 4U1KA 1TZGL 4C56B 4P5TD 3TFKD 2Y7QB 2J4WL 4NWUL 1RJZB 3VXUB 4OGXH 1EO5A 1IAIH 5JHDB 3QPQD 2VLJB 1D5BA 2O5ZH 4UNVA 2IMMA 4Z78A 5FAAA 1A0QL 4IOIB 5J6HA 3G9VA 1RJYB 2HKFH 2VLKD 3N85L 4JFQA 3SDDD 4R7NA 1KV3A 1P4LA 2L0DA 1TQBC 3OKKB 1JWUA 3QUZB 3LEXB 3WEXB 3TT1H 5KANI 1HWHB 1DEEA 4IIQB 2X4SB 2CO6B 4N8PA 5TPWL 4O58H 3R0NA 3RZCB 3Q3GB 1BQLL 1U93A 2W0FA 4UV7H 4L3ED 1ADQA 4ZFGH 4N0RA 2GSIA 2A0LD 3LRSA 1CXKA 1QVOA 1T03H 4X7CC 2EECA 4WFGE 1Y0LA 2CH8A 1N0LA 3GSUA 3WXWH 2JB5L 4YX2L 3MYJA 3HZMA 5IVXF 3I6KB 3FN9A 4BQ9A 2AK4B 5DYOA 1T0NA 4P3DB 4LASH 1JPGA 4YFEA 4JZNA 1NBZB 1LEIB 1ZT4A 4RA3A 2UUDH 3KG5A 3GI9L 3HMWH 4AEIL 1RQ5A 1AFVH 3C6SB 5ICXB 4DFIA 1WZMA 4R90L 3RWIB 1Q9LA 2R1YA 4XVUD 2YXFA 1N6UA 3LKQA 1A7NL 4PTTB 3P40A 1JWMB 4POYA 1J86A 1G7HB 2LAGB 3ZKNC 2WP3O 4RMSA 5FM5O 5IF0B 1ETZB 4ZFFA 1CFBA 1V8HA 1FYTE 4GQ9H 1JF6A 2XQBL 2HJFA 3PGCB 3HPJB 2OTWA 4ZD3L 4KRLB 3EOAB 2NW3B 1QLRB 4RBPH 5C86A 1EXUA 2YKLL 2FH8A 3ZL4H 3T1FB 3SQBA 5HHOD 3TBYB 4NQCA 5C3TA 1XIWD 2C7UB 4DZ8B 4XT1C 3HLAA 2XQYG 4MHHI 3REVA 5CMAB 1YQVH 1LE9B 1CE6A 1CG9A 3PHSA 1HZHL 5KN5A 3HZYB 1LK2A 2EH7H 3ARFB 1MUJA 2ZNXA 2Y06L 3DUUB 4OLEA 4QRRB 5D96B 2VQUA 3DYPA 5BRZA 3QEUA 3AU1B 3I9GL 4JO3H 2J88L 5F1OB 4PJIA 2GCYB 3BSZL 4QRPD 5HYJE 3PWUA 5JLZA 3MRDA 1JNNL 4WGWB 4J8RB 5GIRA 5IVOA 4S11A 5T3ZH 1ZA6A 3ZYZA 1AIFB 2JJUA 4HKJB 3MR9A 4PRBB 5SWZB 4K94H 2CMRL 3E6HA 4YQXL 2IF7A 1XR9A 2YEZA 1V5JA 3WIFB 3O2WH 3BUTA 3OKLB 4HBQA 5GGTL 5I73C 4MA7H 4JFOA 2P5WE 4NZJA 1T1ZA 3TNMB 5C0EA 4XXCC 2HWZH 1BVKB 2IPTL 1MLCA 4MSWB 1S7VA 4OF0A 3V8OA 3LMJH 3LEVH 1TZIB 5EN2B 3ZZ1A 1CD8A 1FJ1B 3V7MA 3BH9B 1N5YL 1OTUD 3QI9C 3VFNB 1BFOB 3OWEA 3FQUA 1IQWL 5GRWA 2H41A 5I1CL 4CL7A 2BNQB 4P3CL 3W9DA 3PHOA 5E2WL 5IIEB 5MEQB 2DQHL 5FEBA 5GZOC 4G8FA 3TN0D 1RIHL 2H6PA 3BKML 2VLLB 4HIIB 2FX9H 4OI8A 5DZOA 3LSOA 3Q6GH 5DJXA 3GIVA 5IBTH 2QHLA 3FN0H 5E08H 4OZIA 1A7QH 2V17L 1NAMB 4XXCA 2NY5L 2FJFA 1JFQL 3MTRA 3QZWA 4JPVH 4KUZH 4MJIB 3MRHA 2HJKB 5L9DL 4P2OB 5ISZB 4BUHA 5DD1H 4KKBD 1IM9B 1U0QA 5IHUH 3KPRB 1AQDA 3QI9A 4YZFE 1JZ2A 3VFOA 2A9NL 3GRWA 1MVFA 3GRWL 1LO5B 1A6TA 4M6ML 3HG1B 2GUOB 1KEGL 2PO6B 1MIMH 5C7XL 5DVNA 5FYKD 1MJ7L 1NGYA 1T4KA 4Y19D 3KJ4B 3LS4H 1UCBH 1CIDA 4U6YB 2NY1C 2YZ8A 2ZKHH 4F80A 4XP1H 4UTBL 4HJGA 2CIIA 3BP5B 3EJYC 1G0DA 4G42B 4I2XA 1F3DH 2ZUUA 5DMKA 5JPNB 1IC7L 1WLHA 2IH3B 3K80A 2DQJL 4YHOH 5AG8A 4WVRA 3C5ZC 4LCCA 1KB5B 4KK5D 4U1MB 3U7WH 1S7RA 4C56D 4XNQA 4V1DD 2NW2A 4NNYA 4YHMH 3VXUD 2H45A 5JHDD 4ZDHA 4ODSH 2DQTH 3WO3B 4UT6L 4GFTB 3VXPA 5DUBB 5KSAB 1UJ3C 2OMBA 3QXTA 1EO8L 4X7TB 3E3QE 4C57C 1NC4A 4LVHC 3B3IB 1A7OH 3GNML 4PRHA 2JKXA 4N90E 3QUZD 3SDYL 2G9HB 1MCNA 1ZEAL 4OZHB 4PJFA 4S1DD 4QLRA 1Q9WA 1RZIB 4Q9QL 5EUOB 5L0QC 3MODL 1DUZB 3C5ZA 3RZCD 1XAUA 4KK8D 1ZE3C 1Q0XH 3R0MA 3Q1SH 4Z95H 4HDIB 3EO9H 5INDB 2A6DA 2I07A 4I18C 1UJ3A 4J1UA 3BAEL 1S8DA 3U9PL 5AAMA 3H9HA 1ULVA 2AK4D 1T0MA 3TT3H 4KAQH 5EA0H 4U3XA 2QL1A 1CDJA 5DHXB 3D6GA 4PJDB 2BSTB 4WCYH 2APTA 3HRPA 4QRUA 3NH7H 4YC2C 2QSQA 5BS0A 1SJHA 5D7IB 4XWOD 5J3HD 3FO0L 3HNVL 1A3RH 4GRMA 1FE8L 3QDGB 1NSNL 3RU8H 4OGAC 4G6FB 5GGUA 2X44D 4KJQD 3FB7B 5CILL 3DURA 3MNWA 2C1PA 5E94B 2VXVH 4M6AA 1KIPB 5J06A 4PRIA 3CAFA 1FGNH 2PTTB 1JMXA 4DVBB 3QCUH 1B4JL 4MJ6A 4PJAB 4Z7QE 4I18A 4KROC 4N1HB 1K5NA 4NQCE 1CN4A 1MHHA 1MFAL 4BZ1H 1DLHA 2Y36H 3QUYC 3VXSA 5BZDB 4D8PB 4J3TA 2R2HB 3CSPA 4F2MA 2VISB 4LCWB 3R06B 3V5DB 5L8KB 3BWUC 4XGZA 1YEHL 1CCZA 1OT2A 3MFFB 4HQQL 5IB3B 4PJIE 4MQSB 1NMBH 1OGAB 4TOYH 3D2UB 1YNKL 4OBRA 1MCKA 2DQFB 5HI5D 4OCWH 4QRRD 4M00A 3LZFL 1I9JH 4XHJD 1DDHB 5AD0B 5DVLA 2CKBH 3N1MC 4ZS6C 3QUYA 1TZGH 4KRPB 5SWZD 2J4WH 4NWUH 2VZOA 4OM1H 3F12A 1TDQA 4GMSL 3EYFB 3RP1A 4JM4L 1A0QH 2QKIB 2J8HA 3MBEB 2X4TB 4M93B 2MKWA 3N85H 4L9LB 1C12A 1QRNE 3HAEA 5CEYA 1X5FA 3U79A 4LQ1A 2DM4A 1UVQA 2AXHA 1U42A 1NKRA 4GKOA 5TPWH 2EYTA 1HYSC 1FZJB 2DL2A 4FRWA 4O51A 2BNQD 4G6MH 4XWGL 4C83A 4OZIE