4OLXH

Crystal structure of antibody vrc07-g54l in complex with clade a/e 93th057 hiv-1 gp120 core
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
228
structure length
228
Chain Sequence
QVRLSQSGGQMKKPGDSMRISCRASGYEFINCPINWIRLAPGKRPEWMGWMKPRLGAVSYARQLQGRVTMTRDMYSETAFLELRSLTSDDTAVYFCTRGKYCTARDYYNWDFEHWGQGTPVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Enhanced Potency of a Broadly Neutralizing HIV-1 Antibody In Vitro Improves Protection against Lentiviral Infection In Vivo.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2014-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4olxH01
4MCZB 4XHJD 3JV5A 1G7PA 1F6AB 1JYVA 3A6BL 1QSFE 4X7TB 3SE3A 1WZMA 3ARTA 3VI3E 1I8LC 1E27A 1I3UA 2HFGH 4XGZB 2Q8BL 2QHLA 1X5LA 1FLTX 3LN5A 3ROOA 5T3XE 1UZ6E 1MQKH 1T4KB 3R4DA 4JO2L 5BRZD 4LLQA 2EKSA 3GNML 4F3FA 5J7CC 5EIIA 1MAMH 2W65A 4G8GB 4UUJB 1OOAA 5KAQF 4L8DB 3CFCH 2KQNA 4CN4A 2AW2A 2DWDB 4EUPA 5I66A 4EDXB 5IW6A 2EYRB 5IVOA 5C2BH 4LCWA 5E8NA 3GM0A 4XCYB 3DRTB 4GQPH 4M3JA 1BFOB 4WI4A 1FVEA 4NPYA 2AGJL 2ZOLB 4ZS6D 1TQBB 4WEMB 5GGSB 4P5TC 3D3VB 2VDPL 4DZBB 4LFHG 2QSQA 4LLDB 1GJIA 4G6KL 3AS2A 4UU9A 1KNOB 4JFDB 2XFXB 4KJYA 3V6OE 5KBNC 3GSXB 3MRHB 5F7EL 4DKAA 1NEUA 3MZGB 3GBNH 2EH7H 1J18A 3VXSB 4P9HH 2FZ3A 5EZIL 2ERJB 1X3DA 4D0CB 4OZIE 4D8PB 2E7LA 1S7QB 2R1WA 5FF6A 3T4YA 2QQLL 4C55A 5LBSL 3SBWA 1X5FA 2H9GA 3D5OF 3EOAB 5D5ME 1IFHL 2QKIB 5IB4B 1AHWB 1QBML 1BZQK 1JGVH 5F8QC 5FGSA 1IAIL 3TWCL 2DLGA 2BVPA 1RZGA 5CILL 5CMAB 3K74B 4PJIA 5I8CB 3RP1A 2ZKHH 2P24B 5GGTA 1EUTA 3NPSB 5TE7L 4Z6AT 5EDXA 1JPTL 4Q9CA 3BAEL 1CQKA 1I7TA 5L2JB 4XNXL 3QIWA 2QADD 1KCVH 1KN4L 3LMJH 3AMKA 4W4OA 2F5AL 5LAXA 5EC1B 1CFTB 1UJ3A 4PJ8D 1NCTA 4GFTB 1ZLVH 5D93B 4HC1A 3LRSB 1NAMA 4GW5A 4X6DA 3C09C 3L6FA 3VJ6A 4XH2A 1MCBA 4Z95H 1QSFD 1HEZA 4H0HB 2F74B 3U4BH 3LS5L 3HLAB 2CKBB 4HIJA 4LKCB 2MHAB 2MFNA 5C9KA 3QDME 5I30L 4UNUA 4B7IA 4ISVB 3VGBA 3DRQA 2DLIA 4PPTA 5T3XD 1XGPA 2XA3A 4PTUB 3O4LD 4IHOB 3EFDL 1U8HB 4QEGA 5GRZA 4OV5B 3MLUL 4RCAA 2EECA 3RHWF 3C5ZC 3S88H 2HRLA 1DEEB 1TJIL 1INQA 1RZFL 3QUXA 3R0MA 1AD9A 1WFTA 1WBXB 1FIEA 4P2OC 4ZAKC 3TC9A 5GZOC 2BVOA 4JPKL 1BZ7A 1DSFL 4LFHD 5KS9F 4HIEB 5BQ7A 1A7OH 3KPSD 5HYSA 2GSGB 5IHLB 3VGFA 5K9OA 2FEEI 1MCOL 3V5KB 5IM7A 2BC4A 5HHXL 2BOBA 1DZBA 4F8TA 1QNZL 4ERSL 4F57L 1WQVT 1MIMH 3H3KA 1XZ0A 4KAQL 4Y5YA 3D2UD 3WXVH 3KAAA 4S1DC 3GK8L 5CEXB 4Y8AA 1J0IA 5I1KL 4O2FB 3GJEB 1CDGA 3EGSB 5JDJA 1QSEE 2JK5B 1XCQB 4LCYA 3KHOA 4BFGA 4NM8H 2NX5D 2VH5H 2W1NA 3SE9H 3ETBF 1ZHNA 1U8KB 3KPQB 1UJTA 4C59B 3VFSA 3ARXA 4OQTL 4X8JB 3QPQC 4F7MB 1CGXA 4ELKB 3RTQD 3FO0L 1BBDH 2JLLA 3TPUB 3HZVA 2D7NA 5IIEA 4WFFE 1HZHH 3WUWB 2BNQB 3OJDA 1JZ2A 2AEPH 3F5WB 1ZWIB 3DX8B 4YE4H 2GAZB 1IMHC 2FO4A 4HULB 1JVKA 2JKXA 3BE1L 1Z6JT 4UZGA 1T66C 5DEFA 1H0DA 4K8RL 2PO6A 5D1QC 4XHQA 4XT1C 4YH6A 1TITA 4X0KA 2EC8A 4AEIL 1NGZB 5JHLH 3L7FB 4UTBH 2Z8WC 2OBGA 7CGTA 2W0LA 1WT5A 4H0IA 1ZHBA 4MAUL 4QRRA 5KN5B 2YUVA 3F62A 3NA9H 2ICWA 3PABB 4M7KH 3PWPD 4LSUH 1HINH 1RVFH 4X9GA 2AV7B 1OD7A 1CXFA 4IS6A 5CKAA 4FQ1L 1DBBL 4Y5VB 1A3LH 4M93B 4Y16C 3TVMA 5HPMA 3SOBL 3FB7A 5D1ZD 3HZMB 4WEUD 2UZYB 5HHQB 4QY8A 5INDA 1I7RA 1I8MB 3JVGC 4OD2B 1A02N 4QNPE 1CU4H 1XH3A 4BUHA 1XAUA 1UXWA 4U1JA 2DIJA 5L7XH 3SDXE 1JF1A 4LQ1A 5I1HL 3NCJL 1R3IL 4NSKB 3CH8A 4RZCA 5DTFA 1JZ6A 5DJ0B 5D7JA 2HH0H 4R2GD 1OAKL 4PJ9C 3L5XH 2EYTB 3PUCA 5DHVA 4FFWD 1BVLA 3LD8B 1BQHA 4YHYC 4NNYA 4NO5A 1WICA 4KRNA 3DBXB 3QA3A 1MNUH 4P3WA 4PG9A 5AAWA 2ED7A 4PLKD 5H35B 3MNZB 3QFJB 2K7PA 1EHLH 3WMSA 3LKSA 2F53E 3NABL 4Z7QE 5F1NB 1ZT1B 1CK0L 2R2HB 3UTZA 3U7WL 5LGHH 5E6ZA 2APXA 4ODSH 1MJ7L 1ODAA 3CZFA 2OL3A 1ES0B 1D3CA 3IDXL 5JW5A 5BOZG 1NMCC 4KK6C 4M48H 4PGJA 1NGPH 3TM6A 4P3DB 4KHTL 4ALAL 2LE9A 1UYWL 2HFGL 3S5LG 15C8L 2F54D 1MQKL 1NFKA 2J3SA 4ELMB 2VL4A 4WHYG 2V5TA 5KVEH 4OI8A 3OKDB 2VYRE 5BV7C 4GAJL 2GTZA 5KANI 3HAEH 1OSPL 4Y4HD 3WJLC 2FB4H 1YEEL 1IKNA 5E00A 5IHZB 3MRIA 1HKFA 2UUDH 1HH6B 4JFYB 3AB0C 5F9WC 2DLEA 4HKZA 1AD0B 4GG8B 3EYVB 2BVQA 3Q3GA 4HUWA 4UTAH 4JJ5B 1A7BA 4O58H 4JN1H 1KYOK 4GKNA 4V2CB 2FBJH 1OLZA 2JIXD 3FO2A 3GHBH 5HYSG 3KS0H 1Q9WB 3GSUB 2BVTA 1C5CL 3C8KB 5DC9B 3EDFA 1KIPB 1NCUA 4QRPD 4X6BB 3QT2A 4P4KD 4OLWL 2EH7L 1A2YB 4ODXB 4P9HL 3AM8A 1PKQE 2DLTA 1T7WA 1BIIB 1G9NC 4QHMA 2ZPKH 5H8DA 1OGAD 5DRXB 3HCVA 4XRCA 3PXJA 2PTUA 3QI9A 5BRZB 4E42A 4OIAA 4PS4L 3QQ9D 1UM5H 1CD9B 1Q0YH 2KZ1B 3GMLA 4DUWA 7FABL 1N7MH 1TCRB 1WTLA 1YC7A 3N1MC 4IRSA 2ZKHL 5F8RC 4J3WA 4WTWA 1YEGH 3LKPB 2EH8H 3QUYD 5JQ6H 3I85A 4XPTH 4HPYL 3ARYA 4CNIA 1BP3B 4WIQA 3LMJL 3E2HC 3KLDA 3KHQA 4AYFA 4U1IB 1CGSH 3CX2A 4J8RB 2Z8VC 3JWDH 1MFCH 1YY8B 4MZ2A 1AGDA 4QRRE 6FABH 2AJYL 4GBXC 4NQSA 3AU1A 4GRLD 4UDTB 3ZDZE 5M94B 1S8DB 4XP1H 3A6OA 3VW3H 3VD9A 4LKXA 5H37H 3KPPA 4AY0A 3ZYOA 3GI9H 4FOMA 3X17A 3C60D 1G7MA 4JFPB 5CP7B 2ADIB 4KVNH 2YPKA 2R4RL 5B21A 3ALWA 4F9PC 5EO1B 5TE4H 5DA4A 4AMKH 4BFEA 1OT1A 3TH3T 2EICA 2X1OA 4WW2A 3S88L 5GSVA 2DBLH 5FGBC 4YFEA 4P59H 4E41E 1YMHB 3QDGB 1KJMB 4P46B 2NY1D 1U8LB 1HHIB 4ONOA 4TPRL 4RWYH 4XCCH 2AXGB 3IFPA 5BZDA 3VCLB 1PYWA 4NO0A 3DGGA 2OK0L 4XAKD 3OKKB 3QQ3B 4ETYA 1DLHB 4HXAH 1WAAF 3PL6D 4HGWA 1FFOB 2QADB 2UVEA 5EULV 1A7OL 3CC5A 3DUSA 2DQFB 3DPBA 3ARFD 1MIEH 4BH7A 5BVPH 3S6CA 3QEGH 1KGCD 1OAXH 5ERWA 3ARDD 3MRGA 2IAMB 4HKXB 3TFKD 3WXVL 3MOBH 1QSFB 3PWVA 5CIPA 2X4OA 1DQJB 5D7IB 1I1AC 4JPWL 3RA7H 2YD3A 4MDJB 2N56A 3MV9D 4C83B 5IFAH 1S7VA 4YBLB 5E2JA 1RQ5A 4HUVB 5HBBA 3MOAH 4AENB 3IJHB 1DLFH 2VH5L 3O6LH 3DNKA 4FMKA 5C7XH 1MHCB 1YEIH 1NGWB 3VFWB 1A6AB 5DFVC 4NRXA 3ARGC 3OKOA 5E2TH 1K4CB 5DHXB 1VGEH 3BSZL 2DQUL 3MJ7A 1HZHL 3EAKA 5JPMA 2XKSA 3W82A 1FFRA 5EBMB 5FGCE 2AEPL 4Z8FH 4OZHE 4YE4L 3K1DA 4JDVB 1KJ2H 1J05B 3MV11 3SDCA 5MEQB 2X70A 3X12A 1HHHA 2IPKA 3C8HA 5EIQA 3UTTD 2H3NA 1T0NA 1FAIH 3OAZH 1Y0LA 3MUJA 5JIKA 3VH8B 2EEDA 2ED9A 3TESA 2WMPA 4LVOB 4YHNA 4L8BB 1NDGA 1NBZA 1FV1B 5F1IA 5F7DB 5IB1A 2CLRA 1F3JB 2AJSH 1A6ZB 1WIPA 3ZDXF 2MMXA 1FLRH 3BOVA 4U0RB 3TT3L 2DTMH 5AD0B 4E0RB 2NX5B 3BPNB 4LSUL 1HINL 1JPST 4G8FA 4NNPH 2GITA 4KK9D 1IM3A 3G6JB 1HWHB 4HF5L 2H32A 2EDRA 1GZQB 2XZQH 3FQNA 5BZWB 1G7HB 1OLLA 2FLBT 2X4NB 4JFZL 3RTQB 4E41D 1A9BB 1A3LL 1C08A 1A1OA 4WHDA 4NO2B 2EXWD 3SCMB 4FQLH 4LLYB 1VA9A 4U49A 2BSRA 4PRNB 1CU4L 1MWAL 4WI7A 1MCKA 5LQBL 5C09D 1J1XH 5L7XL 4L8SB 2HKFH 4F15B 2OSLA 3OKEA 3D0VA 4I3SH 2I9TB 4QGTA 5HDQL 3L5XL 3U46B 4Y5XB 3Q6GL 3RWHA 4YUEH 3U4AA 2CLZB 4RIRA 3OX8B 3STZA 1TZGH 1V3MA 3BXNB 3FJTA 4LSPL 4XWGH 1EHNA 2ADGB 5I15H 4HX1A 3KPTA 3IDYC 4JY6B 5IP4A 2DQTH 1DANT 4YFLF 3PWPB 4Z0XA 1MCIA 1PW3A 1KXQE 1I3VA 2VITA 4ODSL 1REIA 2VIRA 1KF9B 2X4SB 3QP3A 4MSWA 4I18B 1QSVA 2B39A 1ETZB 1DQML 4JKWA 4K8RD 4M48L 1X5YA 1SEBB 4Y1AA 3WFHA 4UQ2A 5D1ZB 4JG0H 3G6DH 5EOQH 3BQUD 5CSBA 2VRAA 2X89D 1FVCA 1JPFB 1TCMA 4R97B 5I75B 5D96C 4LNRA 5D6DC 4XNYH 5GZNC 2AABH 5KSAD 1HI6B 5T3ZL 3RWIB 4R2GB 4PGBB 4X98A 4ODVL 1YECL 4OFIA 4PJEE 3OR6A 4ODUB 1J10A 1HNGA 5J11B 3KYAA 2KPNA 5EZJA 1NDMB 4UTAL 5LCVH 1ZMYA 3KYNB 3Q6FA 3FB5A 3TGXA 5J13B 3B2VH 3IF1B 1VFBA 2EDNA 4Q9QH 5MEND 2QBWA 5HYQA 4I5BA 4EXKA 3NCBB 4M3KB 2X4TA 2YWYA 3QULA 3JV4A 2PN5A 1HQRA 3PHOA 4A6YH 1V05A 4DW2H 1G0DA 4XVUC 3BP6B 2CKNA 4ZSOB 4JM2A 4MWFA 3BKMH 4K9EC 3IRZA 4X9FA 3FZUC 5CZKA 1XR8B 2ZPKL 4UINH 4FQQB 4ZFZA 3CFJA 1QFWH 2KZWA 4QOKA 3PJSB 3O6FD 3E8UH 4HK0B 1K5NB 1UM5L 2AS5M 3GJFA 2VL5A 2VDRH 1Q0YL 1WWWX 4Z7NF 2E9WA 5DA0B 4Y4HB 1WITA 3TIDA 3MV8A 4GUPA 4L1HA 1A6TB 5B8CC 5EZLA 1AO7E 2EH8L 2CDGA 4NC1C 5JQ6L 5KSVA 4XPTL 4OGYH 2IAND 3BUYA 2YD5A 5DZOA 2BSED 2C3VB 2HLFD 1Q94A 2JIXB 4TRPH 1ZV5A 5KTEH 1D6VH 1CGSL 3BP7A 3JWDL 1MFCL 2W59A 3FRPG 5A2KH 5JPNB 3FO9A 1VEPA 3QHZH 1T3FA 4QRPB 5HI5D 5GS1A 3U0PA 4P4KB 3VXTA 4PJ7A 1BX2A 2FD6H 2QLVB 4HH9B 3FQXA 4YHOL 3SQBA 2JJWA 4MNHB 3GSRA 1HQ4A 2H9GB 3TO4C 3VWKC 1A4JB 2VDMH 1GHFH 3BT2H 2GJ6D 4R90H 1P6AB 1VCAA 3VG0H 3ALXA 4TNVK 1GPOH 3I50H 1UCTA 3RWJA 5FM5O 3DOSA 3SDXB 4AMKL 1X6NA 3VD7A 1U8IB 2UUDK 3VE0B 1X9QA 4N9GB 3M8OH 3IXTA 5F96L 3MO1A 3DTXB 4RWYL 5FUCC 1FNFA 3HE6D 5AEAA 5T5FH 4N1HB 5MEPA 3BPLC 4JPVH 4MXWH 1C8PA 4N0UB 2F53B 3L3OA 1RZKH 4IDJH 3QEGL 5LVEA 4HK3N 5A1AA 5SWZE 4TSCL 3D85A 5ID0A 3S5LB 3VDBA 4GRLB 3MOBL 5A2IH 4GMTH 2Y23A 1I8KA 2ZUQC 4DFHA 5I73B 3QUZA 4OF5A 3RA7L 4PRHE 4FXKB 3GRWL 1AQDA 1G7LB 5GGRB 3MRDA 4KJPD 1JYWA 1L0XA 5FCUH 3C60B 3MOAL 3C6LD 3QCVH 5F88A 1DLFL 4HW6A 4WO4D 3RDTC 1CD8A 3M1BB 5CJBA 5C7XL 4Z78B 3QXVA 4JFQB 5HHNA 5HHOA 1EAPA 3WL9B 2P42B 4CKVX 4FQXD 1J88A 1LILA 1D5IL 2K7QA 2NY1B 5I16B 1PSKH 1BZ7B 4ZTPH 1EFXD 2DQEH 5B4MD 4PGEB 4XNZB 3LSOB 1S7TB 5F1SA 4OBRA 1VESA 1KJ2L 3MRQA 3DUUA 2ADJA 4JRWA 4Z7WA 2D4DA 3ARFB 1MFBH 2J5LC 3FOMB 1FAIL 4C56E 4OM1H 4PY7B 5C07E 3ARDB 5DK0B 4G8EA 5FCSH 2B8OT 2P8MB 4I3GA 1OF2B 3FQRB 4JN2A 4KJWD 2A6JB 1IAKA 4PJ8A 2FL5B 4QXTB 4L4TD 1PKQB 3RKPA 1CN4A 1X5KA 4PJFA 1VFAA 3O3DA 1FLRL 3MREA 3ZKMC 1G7IA 1T20B 3H3BC 5DJ2B 3DROA 2VO5A 2XZCH 1AR1D 3V95A 2D7PA 1CDIA 1P9MC 1WCQA 3K4AA 4CN6A 4NQTA 4LARH 2CIIA 3SY0A 4ZS7H 1T7YA 3O4LA 3S37H 3PP3H 4I0PC 4X7CC 3ZKXC 1JZ4A 2J4WH 5JORA 1JNNL 1R3HB 1YUHB 1YEFL 1NCCH 3P77B 3B2UC 4ODTH 4FQLL 2XKUA 1RUMH 4MA7H 1J1XL 4X0KB 3PQYD 5DI8B 3MV8E 2HLAB 5ANME 2HKFL 1N5YH 2RFXB 4X6FB 3HNSH 2F8XC 2EDJA 3OKYA 4X4XA 3ABZA 2EDQA 5ACLA 4I3SL 4ZTOH 4R26H 1F4HA 2WV3A 4JZJC 3ZKND 2FRGP 4ODBD 5JTWA 3S4SA 3ZTJG 4N5EC 3NIGF 1E4XI 4YUEL 5TF1L 4DK3A 3KPSA 2IH3B 1AKJB 4X5WA 2RIKA 1XIWA 3JZ7A 4PRHD 1DBJH 4YGVB 2WBJC 4R8WL 1FZKA 4ELMF 1LDSA 3D2UA 1BHGA 4PJ7E 2YD1A 5E08H 2XZAL 1T1ZA 2IBZX 1BPVA 3QQ4B 5HPMB 2A6DA 5BJTA 1AGEA 4GAGH 4GRWB 1F3DH 1WWAX 1H5BA 4WUKH 4KV5E 4QY8B 3C2AH 2LV4A 2CGRH 3V7AE 3GMMA 4F7PA 4E41B 4NRZA 1BGXH 4W6WB 5B38G 1RU9H 1E28B 3EYSL 4ORZC 4JG0L 5EOQL 1XGYH 1UXWB 4G8IA 3QIUC 3NN8A 2BFVH 1RUPH 4KJQC 4B41A 3ZHDA 3HAEG 1V5JA 2XOTA 1YN6A 1EXUB 2ZWLT 3D0LB 1Y6KR 1RSFA 4TULH 3BP5B 2AABL 4LLWB 4WW1B 3OAZK 3R8QA 1BREA 4NO5B 5F6IB 4GJTB 1BLNB 4LCIH 1UB6A 4C56D 1QA9A 1EFQA 1QTYT 1O5DT 3CX5J 1W72B 3HB3D 4G6JH 2BERA 3GKWH 4LDLB 2EDYA 4D2NA 5IOPA 5CZVL 1JBJA 3B2VL 2KH2B 4Q9QL 1NBQA 5IK3A 1TPXC 4UOJA 4NDMA 3EYUH 3NOIA 5DUPH 3TV3H 4BSJA 4LSSH 1MCNA 4K07A 1C1EH 1LP9A 2JTDA 4G9DA 4A6YL 4I9WE 4LP4A 5IV2B 1AHWC 2P49B 3BQUB 3BKML 3H9SE 4UINL 4OZHB 3EO9H 1QFWL 1L9NA 3MFFB 5HHOE 4DAGL 5ACZA 2G5BA 3E8UL 4UI2A 4P57A 3K8KA 5F7WC 5BV7H 4QGYA 5GRWA 5C86A 5KSAB 3LEXA 1NL0H 1CFNA 4AIZB 2CSPA 4Q6IC 2HFEB 1P4IH 3RY6C 5CSZA 4ENED 5ADPL 1W0WA 1FO0H 2COQA 4JCLA 5IHBA 5J4MA 1CXEA 3M17B 1JWSA 1RI8A 3JV6A 3NFPB 1QVOA 4PV9B 5I71B 4JFXB 3MLZL 5IEKB 3ULVE 3S9DB 3KPOB 4O02H 4BSVB 5KTEL 1HYSD 4HUUB 5IBLD 1D6VL 3TBSB 1R5VB 3CPLB 4DGYH 4FFYL 2P8LA 1NCDH 4NO3B 3QHZL 4R4FH 5H37G 3TN0A 3FMGH 4LCCA 1U3HA 2FD6L 5C0CA 3CSBA 4PP1C 4N0FA 1G9NH 3HCVB 1F4YH 2DM2A 1ROWA 4KKBC 3KYMA 3U7YH 1T1XA 4JZOA 3MRBA 2E5EA 1S9WB 2EDFA 2VDML 5E2UH 3O6FB 4M7ZC 1N4XH 1GPOL 1SMOA 3P4MB 4YXHH 3EFFB 5IQ9A 4ZG1A 4YXKL 1M7XA 2IQ9L 4X9IA 4AT6B 2DWEA 3SGDH 4DKEL 1JPSL 4PBXA 2F54A 1HH9A 4EZMA 1JGUL 5DSCB 1SEQH 5I1GL 2CO6B 5CEYB 3VI3F 3UPAA 3HG1E 1G6RA 4R3SA 1YJDC 4GKOA 3FKUS 4Z7VA 4O2CA 2FYYA 3C9NA 5DQJA 2VR5A 3WS6A 2N4IA 4MXWL 1AGDB 3O2DH 4WCYL 4IDJL 3RWEB 2VLKD 4Y19A 3AREA 4H5SB 4RBPH 3LKNB 4QHUB 3HC0B 4UILH 4Q9RL 3KPPB 2QQKL 3PGDB 1JNJA 4GMTL 2R8SH 5C6PB 1P84J 2IBBA 4RGND 1B0GA 3QB7C 3SDDB 1S7XA 3V5HB 3W81A 3H9SD 2GJ6B 4R6UA 3RWCB 1S7RB 3BKJL 3IFOA 3QCVL 3KR3L 2VAAB 1PFCA 5J1AA 3OMZA 3KLHC 1OB1A 5H2BA 5BZDB 3VGGA 2ZUUA 3K8MA 3WLBA 4ZTPL 1SJEB 3O6MH 2P1YA 1I9RH 1T1WB 2DQEL 4PJEB 1CXHA 4LPYA 5JMRA 5I1LA 2YEZB 2NY6B 4J3UA 2XWBA 2YA1A 3BEVB 3HE6B 5GJTL 4BH7B 1D5MA 5E5MB 3QNZA 1MFBL 3G6JF 2VISB 5MERA 3QUYA 4OM1L 4G43B 2X1PA 2AXFA 1U8OA 4NZUL 4EDWH 3V0AC 5F3BA 5TDNA 3V6BR 3CDFA 4TTDC 4CW1B 4NOBA 5FYJU 5C0IB 1GGBH 3DXAD 4WWKA 1BIHA 1ADQH 4ESKA 2JELH 2X4UA 1INEH 5DMKA 4EI5D 5D1XB 3C6LB 2KKQA 5E1AB 3W11C 2Z35A 1TZHB 2XZCL 5FDYA 5IB3B 3ZSSA 4FQXB 3V5DA 3AC0A 3VMNA 1OY3B 2EXYC 2B5IB 4U1LB 4IRJD 4PB9H 2XA8H 2J4WL 3RPIA 1KPUA 1MJJB 3G04A 3OXSA 1EO7A 1AO7B 3BKYH 4OLUH 1NCCL 5EO9A 1J8KA 2V2WA 4ODTL 4TSAH 3HG1D 2B7DT 3LD8C 1RUML 2FBOJ 3EJYC 1FNEA 3MPCA 2FHFA 3LKQB 5CS7A 1CCZA 2C1OA 4QXUL 1UACH 1FVDB 3GUTA 1N5YL 4X80H 4U3XA 1FL5B 2VXQH 3HNSL 5D70H 8FABA 1TTFA 4ZTOL 5F1IB 4WHCA 5DJZA 3O8XA 3PL6A 4HFWA 4UDUB 1MOEA 2F15A 1NMAH 4MD5B 3L3DB 2AJUL 4HWEH 1JIBA 4G8FB 2GITB 5FYKU 1OPGL 2YA0A 4N5UA 5E5UB 3HE7A 4PR5A 1MRCH 3BUTA 1K8IA 3TPKA 1YPZA 4D0DA 2Q8AH 4LSQL 4JREB 3QDJD 2RCSH 4OLVL 3UAJD 5DK2B 3HPLB 3MV9A 4F58H 2H2PC 5F44A 3T77A 3C2AL 3V0WH 2FGZA 2CGRL 3D18A 1CGYA 1IC5H 2BSRB 3EYOA 2MNUA 1VB9A 1DVFC 4FRWA 5D9SB 2H6PA 1NFDA 4MD0B 1OWWA 3FONA 1RUPL 3IXAA 4WV1A 5E6IA 5SX4I 3DO3A 2CUIA 4YBQD 3PQYB 3IAQA 4TULL 4PUBH 4X8XA 3DSFL 3RVUD 4L5FH 1CFVH 3MUGB 5DS8A 4F37K 2NTSP 2NZ9D 3KNBA 4LCIL 5DD1H 2HYMA 1A14L 1JFQH 5CZXC 5SWZB 4BFIA 4Z7VE 4LLVA 4OKVA 3NAAH 5DMIH 3TH4T 4G6JL 4HIHA 3GKWL 3UTTA 2OR9H 3VRJA 4QRSB 3NFNB 5I1DA 4Y19E 2C4FT 4PRHB 4WFHD 2I60L 3MGTA 3QG6B 4NN6C 2WANA 3RUGA 4LGPB 2Z92A 4KY1H 3QUMA 4PJXA 4MJ5A 2Z93B 4YDJB 3P4NB 5DZLA 3EYUL 3NMEA 4YX2H 4JKMA 5HYEA 1YY9C 3EHBD 5DUPL 1V7NL 3BKCL 3TV3L 1DANU 1BJ8A 4LSSL 4U2ZA 4NP4L 3T65A 1H3TA 1FVCB 2PXYC 5FHAH 4PJAA 4FXGB 4FQPA 4HKJA 2YWZA 4V2BA 3D25A 4M02A 1R3JB 3MQIA 2GCYB 1U93A 4LNRB 4WHTB 4TVSa 4Y2DA 1WC7B 3EO9L 2DLFH 2DDQH 4MS8D 1WWCA 2OTWA 4OGAC 4LSRL 4MXQC 1S7SB 4LBEB 5IMLA 3NIDE 3L9RA 1R0AH 1AC0A 3QJHB 4E5XA 2FJHA 4HPOH 4C56B 4LPVA 2Q7YA 3WNMA 1F8TH 5C07B 3G6AA 3PWLA 1KLGA 1B3JA 1FO0L 2R0KH 5C09A 2QL1A 1X5IA 1VSCA 5LGKA 4Q9BA 3TA3D 1QP1A 3MRRB 4LNVA 1YNKH 1JNHA 5E56A 3V52L 3E0GA 5KSBE 2P5EE 4QNPF 4O02L 5DD6A 2I25N 3SDXF 1MHHB 1EA9C 3CCHB 1NCDL 4N0CD 2ZOKB 1CFQA 4OCYL 4NKIH 3BIBX 3CVHH 3D69B 4KDTA 3WE6A 3PGFH 1IC4H 3B3IA 5FO9A 5ADOH 5I6XB 4K9EH 1LE9B 4C57C 1A7PL 5DMGC 2VJXA 2YPLA 4QLRA 3QG7L 3SKMA 3VWJA 1JF6A 5GRUH 4DN3H 4JY4B 1CGWA 4U1GC 2YPVH 1LWRA 4XNQA 2ZNWA 1JCKA 1SY6H 2YXMA 5I18L 5CCKL 4Z7QF 4DEPB 5ANMB 3DMMA 4GUPB 2Y72A 5DD0H 5GRYA 5MP6H 1GC1C 4H8WC 5TFSH 4LRIC 3STLA 5A2FA 1HCFX 4L3CA 3D39A 3O9WB 1SEQL 4JHZA 1RULL 3EYQC 1CR9L 2YOCA 1E6OH 1KTDA 2IAMC 3B6SB 4LEOB 1B6DA 2EEBA 3BW9A 2YN5A 5SWQB 1HOCB 1T03L 3U0PB 4Y89A 1NANH 1XGRB 3HNTH 1P1ZA 3GEWB 4YBLC 5B38B 4CN1A 3S34H 3TO2B 4MJ6A 3B9KA 1CXLA 2BOCB 3VRIB 4QHLA 5GHWH 4UILL 3T0VA 4XPAH 4IMKC 5EPMB 5MEOA 3HAEB 5C0RH 4LVNC 1A0QH 4EJ1C 3O6KH 3E1F1 5D7SH 4POYA 2AJZB 2NY7L 2J6EH 4J6RH 2ZJSH 3LN9A 4MDIB 1N2RB 3UYOD 3OPZH 3X3GL 4P5TD 4AEFA 3JTSA 1HCVA 1YEKH 3S98A 4H88H 2CDFB 1WK0A 2OI9C 1JWUB 3O6ML 5I8KH 4JRXA 5JOPD 1T7VA 4PJHB 5E8PB 3V6OC 1RURL 2Z4QA 3L3OB 2EYSB 5KJRH 1XEDA 1A8JH 1JN6A 1CGVA 5E7FA 5FHBL 3MRKA 1HXMB 3P0VL 4RWHA 1CTNA 4KU1A 5SWSA 5F1OB 5HVHB 1S7WA 4FQJL 2HAZA 2P5ED 3RZCA 2VE6A 1KCUH 4OGXL 5DHYB 2FWOA 5TGBB 3BD4A 4NKDB 4HG4J 2VLKB 5HVFB 4OJFH 5AYUL 3MRJB 3KYOA 2YRZA 3MRLA 5HYIA 1KJ3L 3VFRA 3BPNC 4Q7DA 1AQDB 5I2IA 2C1PA 3G5ZB 4MJIA 1RZ7H 4RGNB 5MHSD 1QLFB 1GGBL 2FX8H 3RJQB 1FYTE 4PJXE 2A74B 4OCRL 5CFHA 5EZOH 1F4AA 3P9WB 3H9SB 2JELL 3BZEB 1INEL 2GTWA 4IM8A 3SCMC 1E4WH 2R9HD 1JK8A 3QO0A 4PJAE 5JW4M 1FL3B 3T3PE 2WM0A 4J4PA 1NBYA 1DN2A 1A1NA 3GMPB 1RV6X 5ITFA 1MQ8A 3LRHA 3VFPA 3R8BB 3BKYL 4UT9H 4OLUL 1BD2D 4ZDHB 3MFGB 3KWWA 3LEYH 4TSAL 4JCMA 2AK4D 3HS0B 5JW4N 1KLUA 3SKOB 4CVZA 4RRPA 3BMWA 3G5VA 2VDLH 1S78C 1IKFL 5IW1A 3JTTA 3FT3B 4RBPK 5D6CA 4X80L 3T0EC 2VABB 2VXQL 4E9LA 1TNMA 5INCB 3DV4B 3CU7A 1CL7H 2G60L 3OR7B 2LAGB 2A6IB 4OM0H 2YSSB 3VFOA 5DJ6B 4U31A 3OGOE 4NNXB 1NMAL 5T5NG 3KXFA 4CAGA 4NCDA 1L6XA 3V8CA 1FFPA 3DXAB 4YDVA 5CJ5A 3LOWA 3MNVA 4P2OD 4JKPH 4PBVC 5J1TC 1KIRA 3MJ9A 4ZAKD 1H8OA 1U8PA 3VFMA 4EI5B 5GZOD 1GZPA 1GGYA 3IDMA 4O9HH 1N26A 4PFEA 4JGMA 3CMGA 4NRYB 2RCSL 2YPLE 3TBVA 3MBXH 3U9UA 1JHTA 4DKFH 3V0WL 2V6HA 2DJSA 1ACYH 1IC5L 2MSPA 2KBGA 4WO4A 1J87A 4Z7UA 5EC2B 4S1DD 1B2WL 5GSRB 3HG1B 1VACA 2X05A 5DEZA 2UWEE 5FXCH 3F58H 4PTTB 3QFDB 4RNRA 2ZCLL 3C08L 5D7KD 1UCBH 1Z5LB 4YHKH 3D39E 5IF0A 4L5FL 1CFVL 4XPFH 4X5WB 5CLWA 4PP2A 1A7NL 3QPQD 3SE3C 5EU5A 1HHKA 1JTOA 4U6VL 3ARVA 1QQDB 2OR9L 4OZHF 1FYTD 3L7EA 1UH4A 1YNLH 2VLLB 3SGDI 4V1DA 4XVSH 4OF6A 4KY1L 1RJLA 1KJ2B 1T66D 4L4TA 4XBPB 4NGHH 4L4VA 4CVXA 4D9RE 5D1QD 4G8IB 1VHPA 2OS7A 3KJ4C 4OLEA 5FHAL 1M7IB 1KV3A 1YN7A 5DJ8A 4GXVH 1AGBB 1EJOH 4M62H 5F70A 3E6HB 3VGDA 2DDQL 5A43C 4HXBL 3QZWG 3U4EB 2XN9A 5IMKB 2UYLA 5F3HB 4P49A 3W39B 3MYJB 2E27H 3UYPA 4KHXL 1R0AL 2EIEA 4JRXE 4EI6A 5JMOC 2W9DH 1SYVA 3TEUA 1M71B 5D2NA 3QNXA 1FHGA 1KXVC 3MUHL 5TDOB 5LWYH 3FRUB 4HS8H 1IAOA 2Q3ZA 1IEAB 2R0KL 5SWSE 5JDSA 2CQVA 2BSTB 4LHJB 2ILLA 4Y16D 1YNKL 4TYUA 2E7LC 5FDWA 5C08E 4NWUH 5TF0A 5ICYA 2VWEC 4PRID 5JR1H 3DX7A 1OP3K 5HI4C 5KSUA 4MA8L 5IFHL 4MLSA 3SBWC 4CVUA 5L88L 2GT9A 3KLSA 4MJIE 1N6QH 5IQ7H 2R2EB 4ODWA 4P23B 3UTQA 3BZDA 5GRVL 4TUJB 1MH5A 2OTUA 1EEQA 1U91B 2FIKB 3WIFA 1KFAH 4NKIL 2V2XA 3CVHL 5DLML 5HYJE 4PJ9D 1R5WA 3PGFL 1IC4L 4H1LA 5C0AE 1KPVA 4K9EL 5D2LB 4P57B 2D2OA 3MNWA 4HHAA 2YD2A 4KTDH 3BJ91 4WFED 5GRUL 1Z9MA 2E7BA 3NZHL 1SY6L 3QIWC 2XXCB 5F9JA 5CSZB 2A1WH 3ILPA 3EYFB 1UJ3C 4N8VA 1DQQB 4ZFOB 5I17B 3JV6B 1QVOB 1AFVL 4R0LA 4X6CB 1CD0A 1F90H 4U6TA 4KK6D 1PG7W 43C9B 1UXSA 2OMNA 2DJ4A 3TA3B 3H7BA 5DJYB 2DQIH 2CKBH 4IOFC 5LGJB 4LCUB 4X99A 2W0FB 1MLBA 5FA4B 2CLVA 1EAJA 2V5YA 3TN0B 1JI2A 4LCCB 3LY6A 3WFBL 3KXFE 4PJBE 1JGLL 1T2QH 1CLCA 3S34L 1C7TA 1V8HA 3SO5A 3X13B 3QUXC 3MRBB 4TNWK 2ZG2A 1NCWH 5BXFB 4CJ1A 4PJEF 5C0RL 5C0EA 3QHTC 5KVDL 5FYJH 3WYRA 1MWAA 3O6KL 3K1KC 1IGTB 1PZ5B 5KVFL 1IT9H 1IGJB 2DWEB 4HZLA 2J6EL 5GIRB 1JF5A 4WRLA 2XY2A 2GHWB 3PIQB 4OZFA 3OPZL 5C0GA 4Z76B 4Z7UE 2ICEB 2XQBH 3RJDA 4RFEB 1QHOA 1ZEAH 1D5BA 1CXKA 5IMOB 3IU4L 1KENH 4GW1B 4KKLC 4RA0C 4Z7VB 4ZUTA 4Y5YC 1J8HE 5I8KL 43CAB 2FYYB 1YJDH 2XQYK 3F12B 2Z91B 4TUKL 3MBEA 2OXHA 4A6YB 5ELIA 2MCPH 5KJRL 2V7HA 1FL6A 5C08D 3AREB 1U6AH 4P2QD 4LLUA 1KCUL 4TN9A 4K7FA 3QWOA 3MRPB 5FIEA 4OJFL 2GSIA 2VLME 3SKUD 4RDQG 4X6EA 3ZE0E 5EUKA 4MCYA 1I1YA 3ROLA 2DLHA 4QTIH 1SYSA 4YHPA 2EDKA 5DJXA 4OAWB 2CXKA 3V6ZA 1RZ7L 5C0AD 3V6FA 4V1DE 3CX5K 4TSBH 1MCLA 3IFOB 5IMMB 3D9AH 3CUPB 5EZOL 3T4AA 1Q8MA 2A9NH 4KDWA 1CE6A 4QO1A 4JFFE 5FYKH 2A6KA 5FUOL 3SGEH 1PGRB 4JQVA 1FC2D 1CGTA 1JUFB 2X7LB 2PW1B 4MA3A 2PO6C 3LHPL 4YHZL 3CK0H 1I7ZA 4P5TB 5IVXA 1F02I 4Y4KA 1YQVL 3TZVA 2IADB 4EVNB 2DN7A 2A0LC 3ZSTA 3I6KB 1HHGB 2P43B 3I6GA 4S2SA 5L6YH 3LN4A 4L9LB 5JOFB 2MTPA 1WWBX 4GBXD 3CNKA 5JIHA 1QBLL 4RAVA 4UT9L 1WT5C 3K7UA 3T2OA 2IALA 3C5JB 3LEYL 2GY5A 1QBAA 5D2NE 3BPCB 5KSBB 2XWJA 2YKLH 2VDLL 2MQCA 2P5EB 3BDBA 3WFCH 4UV4L 1D7FA 3MXWH 3UTSA 5EU3B 5F21B 3L5WB 2X44D 1K6QH 4MMZC 3MRCA 1CL7L 2NY2B 4XCNA 4HLJA 3V79C 4HCRH 4LDEB 3TVMC 3U2SA 3SDAA 4APQA 4BSWA 5L0QC 4TTGA 2AJ3A 2G2RA 6CGTA 3FB8A 4KKAC 3WD5L 3DX6A 2RAMA 1L0YA 4GKZB 4O9HL 2FNBA 2IQAB 2BY1A 1ORSA 1CD1B 2NXZC 3KDMB 4FS0A 4RMTA 4YPGB 3ULUE 5D7JC 1U41A 4X7DC 1DBMH 4DKFL 3EDKA 3H3PL 4H1LG 1UZ8B 2I5YL 3C09B 1NH6A 3HMWH 1PX4A 5HGDA 3CAFA 4RAHA 3WSQH 1DBKH 1BD2B 4DJMA 4OSUL 2AK4B 5A16B 2VUYA 5H94B 4G6MH 2KUTA 5DC0A 1OAZL 4LL9A 1J5OH 4PB0H 3CFKB 3MJ8B 1ZA6A 1MCFA 4YHKL 8CGTA 4EQ2A 3DJ9A 2BRRL 4XPFL 4R7DB 2VLMD 4GO6B 1NCBH 4PD4J 3C5ZB 4PJDA 4DVBA 3FFCA 5DR5H 3RNQB 5FECA 4I77H 5DFVD 3ARGD 3RL1B 2PCPB 3DVGB 4PR5B 1K8IB 3G08A 1O7SA 5FA3A 3SJVA 4P2OB 4ZAKB 1F3RB 2ZZUT 4WI6A 2R0WH 1LO2H 3RNKB 2J8UA 1FSKC 4KFZC 1ORQA 1KULA 4HEME 3BIKA 5DVNA 1IKNC 3IKKA 1F42A 1I9EA 5C0BA 4LGRB 4RAUB 2ORBH 3VXME 2W91A 3CLEH 1EJOL 3MCG1 2NXYB 1W0VA 4M61A 4FZEH 5DS8B 4IRJA 3VI4E 2G75A 5E0QA 5I71C 1CVRA 4JANB 3GBMH 3HRPA 3VFTA 3P4OA 2W9DL 3U0TA 3N1QC 4F33B 3PWNB 2XQYG 2BNRA 1GGCH 1RIHL 5LWYL 2L7JA 1QLEL 4XAWH 4HS8L 4N8PA 3BWAB 2P46B 5DQDH 3AM8C 5F7UA 3KPRE 1RUAL 1FYTB 3KPLB 4DTGH 4U1NB 1ZGLB 2R4SL 4RQQA 2NW3A 4LOUC 5F89B 2C26A 1CFSA 3T2QA 1RHFA 3N1PC 2Y7QB 3QI9C 4IRZH 1JHKH 1PVHA 4NQDE 1BFVH 3ARWA 4CMMA 1DN0B 5ID1B 5D1QB 2YK1H 1FRGH 2L0DA 1KFAL 4MA1C 5K33A 1D5ZA 1TMCB 1P5VA 4AEHH 4QT5A 3KPNB 1KJVA 4IRSC 3WFEH 4BQ9A 2W60B 3I3DA 3FB6A 1FN4B 4JQIH 4BQBA 2OP4H 4NC1E 5J9PB 1QO3B 2ITCB 1JZ7A 5IVXE 1QEWA 4Y7MA 3MTRA 1FFNB 3IU3A 2A1WL 2EE2A 3GDBA 3IKCA 1X4ZA 3CSYA 2HN7A 1WBYA 1ZLSH 1NGXA 3ET9F 2SEBB 3FCTA 4IMLA 4YWGH 1F90L 4KV5F 5E8EB 3MMEB 4TNVF 4KZDH 3FT2A 1TDQA 5EU4B 2IFFL 4XZUB 1KLFA 3DHMA 1XGUB 1HILB 5GJSL 2DQIL 4I0KA 2CKBL 1MCHA 3AXLB 3RWFB 3UTSE 4PRIB 1B0WA 1G7JA 3PDOB 5CBAA 4RGMB 1J11A 1A22B 4KI1A 5EOCL 4MNGE 5DO2C 1I75A 3SDDC 1L7TH 2EDLA 4U2YA 4K94C 4KI5C 3B3IB 5GZND 3RY5A 1I8IB 1T2QL 2YPLB 4JDZA 4WW2C 5D7LA 3RVVC 5HDOA 1ZHKB 3RPKA 3SKMB 3WN5A 1IEBB 3IETA 4PJ9B 5IW3A 1K3ZA 1NCWL 2EIZA 4YHYB 4K71C 1NBVH 3IJSA 5FYJL 2Y36L 4NQEA 4NCC1 3DMMB 3GIVA 1CZ8H 2UWEB 1IT9L 5E99H 1GC1H 2R0LH 2NY6C 4H8WH 5IB2A 1K9TA 4L3CB 4ZQKA 1KCKA 3MA9H 4OFDA 5I8EA 4ZO6A 1JGEA 4N0YL 1NFIB 2G5RA 3SPVA 2XQBL 4FN0A 3ZTNL 3RFZC 1VERA 4JRYE 1ZEAL 1MLCB 4XP9H 4LMQE 2VQ1B 1NMCB 1HN1A 1KENL 4GMSL 4NJAH 4OUOA 1URLA 2EDBA 1YJDL 4P2RD 2B2XH 4ZUWA 3T2NH 3F7VA 3LB6C 3OGCA 4JGUA 4XVUD 4LDOB 5K59F 3KPRD 4IOIA 3OB0H 4KRPC 3IRPX 3FZUD 5A3IC 1U6AL 5CINH 4QYOA 1LE5B 2MQ0A 4ZPTA 2QSCH 2PTVA 3UPRA 1T5XB 4LIQH 3EZJB 2NW2B 2XXMB 4NQDD 2HJFA 4POZC 4PGDA 4UAOC 4J12A 5BV7B 4QTIL 3F7PC 1QZ1A 1SM3L 2Q76A 4MAYA 3Q5YA 2ICWJ 2PYED 1S5HA 1VEMA 4ZUUA 3QZWB 4TSBL 1BAFL 4YHML 5DQ9B 3AB0B 5F9WB 1FO0B 1K8DA 2X4RA 32C2A 5IFJB 1EK3A 3I3EA 4PJ5A 4Q2ZB 3SDCC 3BDYH 3UEZA 1N59A 5CUSH 5F7MC 1SBSH 4XPHL 2ZSVA 4DN4H 3I75B 3CK0L 4CADB 1K4DA 4JRXB 4XMLH 2B4CC 4LRNH 3RU8H 4K3GA 4BFBD 4POUB 3V4VL 1P7QD 1RZIA 4GH7B 5I76A 4OFYD 1BBJA 3MR9B 1NEZA 4JO3L 1S7WB 3RZCB 2VE6B 1H3PH 3MRNA 2CR6A 2VSDA 1EGJA 4YFLI 5C08B 3PV6B 4P2QB 3CFDA 2BNRE 1H3VA 2O5XH 3TO4D 3VWKD 1BVKA 4PGZA 3VFRB 1G1CA 1FBIH 5GPRA 5HD8C 5ALBH 1U8NB 1U8JA 1FNSL 3MXWL 3NZ8A 4U1SB 3ZT7A 3FFDB 1WTGT 3IGAA 5SX5H 2PETA 4J1UB 3S96A 1H3GA 5FO7B 4JREC 2ARJB 5HYJB 5C0AB 2O5ZH 2P8PA 4NQCD 3H0TB 4P5MB 2EEAA 1JK8B 5FM4A 1IGML 5I1JL 2CIKA 2JJVA 1T89A 2VXTH 1IGIH 3SKNA 4HUMB 1X44A 3BRGC 4D9QD 1X5JA 2RJMA 1OCWH 2LVEA 3CFBB 5BS0A 3QXDA 3B8SA 1DBML 4JRYD 3NFSH 4YHIA 4M8VA 3RVXC 1IGFL 3E3QC 1DBKL 4Y0GA 1KUMA 1VADA 4G6ML 1XCTB 3DHJA 2B1AH 5E9DA 3ESVF 4PB0L 2EIDA 4WUUA 3QEQA 4AIXA 5I1IL 5TDPA 3HZKB 2QR0A 3L3JA 4HIIB 3RDTD 3KXFB 1S9VB 4PJBB 4XBEH 1FFPB 1U8MB 1INDH 3QJFA 4YDVB 2P5WD 4I2XB 1ITCA 4I77L 5LJYH 2WP3T 1RAMA 3UJIH 4MMXC 1ZVSA 5J0BA 1BOGB 3EOBB 4JZNB 2FECL 5E70A 1MPAH 2XKNA 1AY1H 1W8NA 4NJ9H 3TBVB 1C16B 3U0WH 3C5SB 3UDWA 5JA8B 2R0WL 1JHTB 4O2EB 1J7VR 4PGCB 3U79A 4JVWA 4ZMAT 4NQVB 1KB5H 5EN2A 3LPWA 1QG3A 2YC1A 4R4BA 1J1PH 2AV1B 1MCEA 2APVA 1FDLH 3MZTA 1J8HB 4WTXA 3WNPA 4OF7A 4GKSB 1YEHL 3CLEL 1EVTC 4L8CA 1J0ZA 1FE8L 1I1AB 1JGDA 2EC9U 4BQ6A 3O41A 4KGLA 3LH2H 4ZUVB 3U9PH 3ZKMD 4NUJA 2OZ4A 1EMTH 5ESVB 5D72H 2NCMA 5DJCB 3V0VB 1SJHB 5F6HI 1DCLA 2DQCL 3GBML 4IJ3C 5JHDE 5ILTH 5EOTB 5E8OA 4LGSB 2DL2A 4XAWL 3L3GA 3ZLQC 3CLFH 5EWIL 4QRUB 3ARGB 2VLJE 1JMXA 1N8ZA 4I0PD 4JM2C 4DTGL 1G7QB 3QRGH 4FQIH 3B2UD 2WIIB 1CYGA 1FG2B 2BRQA 4TOYL 5ESAB 5T1MA 2HTKC 4JB9H 2XIDA 4JFFB 4NZRH 5J6GB 5EBLA 4IRZL 1QACA 2HMIC 1IQWH 1BFVL 5DDHB 2AKRB 5T1LD 4EUPH 2X10A 5FAAA 4LAQH 4PREB 1UM6L 1FRGL 4NZDA 4AEHL 4PJ5E 2ZCHH 1Q9OB 4N5ED 2GQHA 2MPAH 3LKRA 4HEPG 3K4DA 3WFEL 4LPTA 3GSOA 2GK0A 2ARJQ 1OL0A 3W9EA 1FCCA 2BSSA 3QIBA 4JQIL 2OP4L 1DFBH 5EO0A 3UBXG 3UZVB 3P0YL 2ZUVA 3DIFB 3QNXB 4FA8A 4FQCH 3U83A 5D71H 3WEXB 3X11B 4P9MH 4L29B 3QWRA 1Y6MR 1YA5A 1RZJL 1ZLSL 3G5XA 5FO8B 5JXEA 2CDEA 4XXCA 1PX3A 4YWGL 1MVUA 5GS1C 3SDYH 3EZ8A 4KZDL 2IFGA 2XNAA 1NEZG 3P9MB 5F7HA 4G8GD 2NLJB 1KEGL 4HS6A 5GGVY 1F45A 3QIUD 3AFLA 1WIOA 4KJQD 4XHJC 1YYMH 4QTHB 1DUYB 1I9JH 4FG6C 3U30C 2WLZA 4G9FA 1HXYB 4M6OH 2HVJB 2YHGA 1T2JA 1KBGL 4U6YB 3GSWA 1VGKB 1U8QA 5IBTH 3W9DB 3VGEA 2Y4SA 4Z7VF 5GGTH 1J12A 1L6ZA 2R29L 3AAZA 1OTTC 2DKMA 3HZYA 3VXOB 3N85H 1NBVL 3P3YA 4GOSA 4JHWH 2JCCA 3BHBA 3DI2B 1RK0B 2VR9A 3CVIH 4XC3H 3PDGA 3V9FA 1KACB 5BS0E 1CZ8L 4WEBH 3LPGA 3IDYB 4I48A 3VXSD 4S1SH 1NC4D 4HC1H 3RL2A 2R0LL 2XTLA 1BZ9B 1CT8B 1NAMH 1OGTA 1EPFA 5IJVB 2OJZH 5DRNB 1LDPL 4ORGB 4HS3A 3WHE0 5ICXA 4BH8B 2Q20A 4M5ZL 5HDLA 4NJAL 5E9DE 5TE6H 3QUZC 1LNUA 2VLJD 2I24N 2XWTA 3QEQE 4DWHA 3QH3A 4GG6A 3WXWH 4WHYH 2A38A 4Y4FA 5ICZB 12E8H 3ARPA 1U95A 2OM5A 3BN9C 1BWWA 2QSCL 5C9JB 5D96B 4Y16A 1S9XA 5FYKE 4P2CG 1OSZA 2PTTA 3VXUA 5F7YC 1CICA 3K0WA 5TQ0H 3LZFH 1AXTH 5AWNH 3RGHA 1A7QH 3KPMB 1XGTB 2HFFB 4LK4A 2NR6C 2ATKA 3VXMB 3MRMA 1HKLH 2AK1L 2I9LB 5DMYA 1CS6A 2O5YH 4M6MH 5KSBF 1NSNH 5HGBA 3BDYL 1NUGA 5CUSL 1FIGH 5EUOE 1SBSL 1AIFA 3QCUH 4HDIB 4IIQA 4XNMA 3QISA 1FAKT 2IC2A 1FZMA 3ULVC 1JV5A 3VXNB 3D87B 4XMLL 3TNNA 4LRNL 1N5AA 3RU8L 1RUKH 2GIYA 3VXRE 1CDYA 1R3LB 1KT2B 3VRLE 2FECI 3UJJH 3S3PA 2DQGH 5J06A 5BVJA 1P4LB 4P2RB 4CDGC 2J1KA 3J8F7 4PJ8C 4OUUA 4PP1D 1DQDH 4FQ2H 1JPGA 3CVHB 4KKBD 4OLYH 2JJTA 3KPRB 4X7EC 4OZGA 4ZUSA 4U7SA 1LGVA 2BCKB 3O45B 1JZ8A 2IWGA 2O5XL 2XRAH 2IPTH 4HFUH 5C0JA 5FYJD 4UNVA 5ALBL 4HWBA 4XMKL 2JB6B 1QRNE 1RJYA 4NQDB 2ESVD 3GMNA 4WU7B 5IGXH 3OKNA 5ENWA 2M26A 3TBYA 2YRLA 3ARBA 5EFIB 3VXPA 3VXQB 2FEDC 2DF3A 4RFNB 2V9QA 3T08A 1FJ1A 3QPXL 3BEWA 1MI5E 4DZ8A 5B8CB 2O5ZL 4ZPVA 1LD9A 3RI5K 1EZVY 4J3TA 4G80B 4UIMA 1CDHA 3UJTH 5IVXB 4KDVA 2LTQC 2VXTL 4JFHE 2NYYC 1IGIL 3IJYB 5EU6D 2BHYA 3W0WE 4WJ5B 3OXRA 3I6GB 1RMFH 2WK2A 3L95B 3ORJA 4I0CC 4K7PX 2AERT 3WFDH 2HG5B 1D6EB 1FPTH 3FT4A 3DETC 1P7QB 2XG4A 4C58B 3NFSL 4J3OC 3MV7A 5FKPB 2XWJB 5JXAL 2HTLC 2NY3B 3OB0K 3RBGA 1D9KA 2HJKB 1PZUB 4ZFFA 2YXFA 4LF3B 1XIWC 4J7RA 3NTCH 1U3JA 1MF2H 3BH9A 4YNYB 5HVWA 4FABH 4FFZH 4AM0A 5JIIA 3VWKB 3P9LB 3UX9B 2K3TA 4ZOAA 4MNGB 3OKMB 3QEUA 4PYGA 4JY5H 4N8CH 3W2DH 5K9KB 2OJEA 3FQWB 1LQSR 5FYKD 4OCXH 3TJEH 1HSAB 4YAQB 5GGVH 1H5BC 1TVHB 2HA1A 3KLHD 4ZOEA 2AJVH 2G2RB 4M6NH 1DEDA 2FLRT 3UJIL 4F37F 1RJZB 2R1XB 3DX6B 3MA7A 2N1KA 4WGWB 3P30H 4R7NB 3U0WL 2GFBB 3BPLB 1J0JA 3MCKB 3L3HB 1RFDH 5DHVH 2GJJA 3O0RH 2JCCE 1KB5L 1AXSA 1UQSA 4IBLT 1ZHLA 2HT3C 4JRYB 1ZTXH 3VXRD 3TYGL 1FDLL 4JLRA 1XF4B 5ISZE 4KZEL 4WENB 2NTFA 4TTDD 3K46A 3WHXB 3MROA 4NKQB 5FYLE 2VMFA 1UWXK 2X4PB 2R23B 2DM3A 1KPRB 5FOBA 5F9AC 3GB7A 4OLXH 1MJ8H 5B39B 3WO4C 2OL3H 4FMFA 1KC5H 3W11D 5SX5K 4LHQB 2Q87A 1I1FA 1QRND 3RDTB 3T3PF 4B0MM 2P5WB 1A64A 3TBTA 3H42H 3M45A 2EXYD 4P23C 3GMQB 5AG8A 3AS3A 3TBWA 4PJGE 1V7MH 5IVZA 4XBGB 4JFOA 4FQIL 3QRGL 1FP5A 1PKOA 2DYPB 3GMOA 5FGBA 4Z18A 1Y18B 1RUQH 3EJYD 4JB9L 4NYLB 4NZRL 1ZT4B 1KN2H 4JFHD 1ORQB 2ATPA 3W0WD 1IQWL 1P4BH 3EO0A 4BK4A 2BVUA 5DYOA 1S5IH 5T5NF 3IFLH 2J5LB 3VG9B 4JFEE 3FN0L 3QFJD 2WINB 3T3MF 3MLRL 1R5IB 3TYFA 3T8XB 2ZCHL 3SGJA 2HRPH 3QUKB 1T22A 3F6LA 4TUOB 3MYZA 4K3HA 4JPIB 1DFBL 3CZJA 5KS9A 3BVNA 1AP2B 4NQXB 3LQAC 1IQDB 3GSQB 5D71L 1A1MA 2WUCL 4P9ML 2WQRA 3AUVA 4HBCL 5L2KA 2CXGA 1UWEH 1LEIB 3LVEA 2DQJL 1TZIA 1F11B 1UKSA 3TN0C 3IDNB 2X42A 3LKOB 4LCCC 1U3HC 4OZGE 3SDYL 2H2PD 4WNQB 5IB5B 2NW3B 4F7TA 3HHRB 4I0PB 1CFSB 4LHUG 3UZEA 3CH1B 1DVFD 2Y06H 5K9QG 2BNUA 2UWEF 3GGWB 5DK3A 1UGNA 3VFUA 3ZL4L 4DQOL 3PDDA 1YYML 4OIBA 1FNAA 3R06B 2Y5EA 1Q9LA 5EORH 1MY5A 3QXUA 1YEDB 5EBWB 3MODL 4EOWL 5DGRA 4O00A 1QLRB 5IBTL 1F13A 5GGTL 4JZJB 2NY0C 1S9YA 1ZT7B 1VFUA 5CZXD 1B4JL 5CJQL 5A2JH 4EN3B 2FJGA 4Y2OA 4JHWL 1FCGA 4Z5RB 2APBA 3EDJA 4GAYA 3CVIL 4XC3L 4Q6YA 4OCMC 2HWZH 2WBJB 1U36A 3WS6C 4S1SL 3QEHA 4HC1L 2GK2A 4GXUN 1BQSA 1XGQB 4K23H 3AREC 2OJZL 2VB5A 4ZFGL 5KAQG 2R1YB 2A77H 4O4YH 1YY9D 1HDMB 4LIQE 2Q6WA 3MXVH 3REVB 2PXYD 4KPHL 5JLZA 1G7JB 2FSEB 3DURA 4CMHB 5F72S 4NKMA 3WXWL 3QIUB 4KH2A 5F97E 12E8L 4K94H 4OGAD 1CLOL 2D0GA 4MXQD 25C8L 2IH1A 1QPPA 4MX7B 1A4KA 1F6FB 3BFOA 3BN3B 4F7EB 2O61A 1ZA3A 4U6HA 2YUZA 3U7AA 3LZFL 1D5XB 4JFED 4P3CH 4PBWD 5C0DB 5AWNL 4PD4K 2A9MH 5TH2B 2DKSA 1ND0A 4ONFH 1A9EA 3NPZB 5D4QA 4L9LC 5A2LH 4M6ML 3MLTB 2X6MA 4LLMB 2HT2C 4JDTH 3VFNA 2H26A 3H9YA 1LEKA 1OARL 3LIZH 1FIGL 1NC4B 3QCUL 2NY5C 1AI1H 1MCPL 1TPXB 1QPXA 5JHDB 1U58A 2ZSWA 1FORH 4HD9A 3TIEB 3OGCB 1R3KA 4LHUD 5CIPH 3UJJL 4W4NA 1MVFA 2DQGL 4QHNB 4F2MB 3KYKH 1TTGA 1YNTB 4QCIB 2C7UA 2ITDA 5ETUA 2VLJB 1DQDL 2NY2C 4FQ2L 4WWKC 5DMGD 3CFEA 3CXDL 5DRWB 4ZPTB 4OLYL 5DVKA 3QDGD 3HI1B 4P46D 3OF6A 2IPTL 3OKLB 4HFUL 2VLRA 3ECBB 2AXJA 1QR1B 5KW9H 1AH1A 4MQ7A 4I4WA 4Q6IB 3U36B 1M05B 4NWTH 5ALCL 5IEHA 32C2B 4LPUA 4L4JA 3UBXB 3QNYA 3I2CL 4NKOA 1NC2A 1RZKC 3EYQD 5I19H 3RY4A 1CTOA 3UJTL 2IAMD 2GJZB 1WEJL 4YIQB 1MHEB 4PRPE 5J6HA 1RMFL 2B4CH 5IJKA 4M1GH 4NM4H 2C3WA 3T0EE 4PJBF 3WFDL 3O11B 2B0SL 5I8OH 2B20A 3BP4B 3V4UL 1MUJA 2Z31A 3O8XC 3PWUA 1UFUA 1RPQA 5T1KD 3CFIC 2D9QB 1IBGH 1U92B 3EO1B 1M4KA 3SGKA 5CJXA 1RZ8A 4ETQA 5TJWK 3NTCL 4FABL 1I3RB 3C6SA 2BVEA 3HE7C 3TFKC 4M7ZB 4HV8A 3UC0L 2H32H 4G7VH 4JY5L 1MEXH 4N8CL 2ESVB 1T0MB 4JGJA 2YN3A 5T33L 4AEEA 1ED3A 4AH2A 4DGIH 4MNQE 2AJVL 3WNKA 4M6NL 2B1HL 1WSST 4H26A 2FJFB 1YDPB 2J12B 1NGQL 3P30L 3PHQA 4P5KA 4PJCE 4WV1C 4RDQF 5HY9A 5CWSB 1DUZB 5E6IC 2A83B 5BS0B 5EU6B 5FKAA 2NXYC 2PYEA 1IL1A 4RFOH 1UM4H 4WU5A 1RFDL 2F19H 2NNAB 1X7QB 2LFGA 2J2ZA 3CDGB 3ZE0F 3O0RL 1UADC 3MGOA 4K7PL 4HKBB 4PRBB 2HVKA 1GGUA 1AE6H 5CBEA 1X5GA 3BH8A 5E9DB 4U1MB 4KQ4H 3IVKA 1W72L 5IROC 3IDGA 3PWJB 4X5LA 1AGCB 3S36H 1MJ8L 1TVDA 2OL3L 3SCMD 1XF3B 2G9HB 4TQEH 3MLWL 3IFNH 4R96B 3B4NA 2Y5TA 1NLDH 4OD1H 3H42L 1YMMA 5ESQB 1BJ1J 1IGYA 1GAFH 1QBBA 3N9GH 4P4RA 3PHSA 1IM9A 4LCWE 4KK9C 2HJLB 2GUOA 3PGCA 4QRQA 1OW0A 3IB4A 4Y2DC 4EUPG 4YR6A 1PQZB 1FH5H 1RUQL 4FTVA 4AJ0A 1AGFB 1KN2L 3GI8L 4DVRL 5EUOB 4PRPD 4Z77B 1S78D 3BO8B 1A3RL 1RY7B 4M1DH 1M6OB 2F9BT 1OHQA 4DUXA 3IFLL 5JNYA 3QDMD 1HHJB 3HI6L 5DUBB 1TFHA 2BMKB 5HI3C 3HR5A 5CD3B 3VXRB 5FM5M 3O3BA 5HJ3A 1AJ7L 2PR4L 1XF2B 2CMRH 4XXDA 3K2MC 2V2TB 4NUJB 3I9GH 3FO1B 2VWEE 1BEYL 1WAAA 4OD3H 4NBXB 1RIUH 4UT6H 1UA6L 1QRNB 3SE4A 3ULUF 4UQ3A 4QRTB 4RGMC 3F7YB 1B6UA 4OZ4A 4LEXH 1ZE3C 1KTLB 3A6CL 4BM7A 4KDTC 5DRZA 3GSNA 4MNQD 1IC1A 3HKFA 2V5RA 1Z9OA 1A7RH 4PJIE 3TCLB 1MI5B 4ONHB 5FFLA 1DL7H 4FNLH 3VWJC 1H3UA 4YXLH 4O51B 1IE5A 3GJFH 3RGVA 4HGMA 3W0WB 4ZYKA 3DMMC 4U1HB 5EORL 1C5DB 3DO7B 3ZTJH 2GK0B 1B90A 1QSED 4X6DE 4HJGB 2AP2A 1IAII 4XP4H 1KIQB 3LQZA 4XCEB 1PLGH 3VFVA 4TNWF 1I4FB 3HFMH 1I7UA 1T21A 2H1PH 4WFFD 4W6XB 5HSFA 3AY4C 5BMFH 1FNGB 4HS6B 5IKCB 4NT6B 4NBZB 2I07A 3B9KC 4ZXBB 2Q86A 2VZUA 3MXVL 1DQTA 2OLDA 4OKDA 1MAML 3IDJB 4LCWD 1DVFB 1VPOH 4KUCD 1QYGH 3CFCL 4KXZI 1NGYA 1P53A 3UO1H 1VEOA 2CUHA 3CIQA 4K94L 2Y6SD 5C2BL 5CP3A 1B88A 2VXUH 3FTGA 5GISH 2H8PB 5FM8A 1MFDH 4XWOC 2ZP0T 5J3HD 4L3EA 4YHLH 4DFIA 3KLAB 5ISZB 4LSDA 1ZSDA 2CJUH 1ZLUH 2E9BA 1UVQA 1TJHH 2R2BA 4JDTL 5IR1B 3GBNL 5GGQH 3O3AA 1LEGB 5GRJH 3RWGA 3RWDB 4NN6B 5KG9B 2DI7A 3RZCC 4DKDC 3DVNA 5ICXB 4OQ1A 1AI1L 5HI4D 3UZQA 5DJAA 1RK1B 1H15A 3BI9X 4GLRH 3DI3B 5DD5H 3D1MC 3DX9B 4G42A 4U1LA 2MCG1 2FIRT 1CIDA 3BZ4B 4MCZA 4X4YB 1T5WB 3VDCA 1F6AA 4X7TA 2IG2H 4U6XA 3MRFB 3KYKL 2PXYB 3ISWA 2OTPA 1ZVYA 4XGZA 1JGVL 4PJGB 5IVXF 1T4KA 3B5HA 3DVFA 1DE4B 5AUMB 4MXVE 3REWB 3QIWD 5B3JF 2YBRB 3GIZH 5DEGB 4G8GA 2FGWH 4L8DA 2BY3A 4J4PC 3TLRA 4EXPX 3H7LA 4JFEB 1S7UB 2DWDA 1KCVL 3WIHA 4NFDA 4EDXA 2F53D 2EYRA 4FTVE 4XCYA 3PNWB 3DRTA 5CLTA 1BFOA 1KG0B 5I9QC 2ZOLA 3IDUA 4LASH 5C92A 4IOFD 3H9HB 4Z95L 2ENSA 3ULVH 5GGSA 4QF1B 3D3VA 3U4BL 4DZBA 4LLDA 2B4CL 4M1GL 3MACH 1KNOA 4JFDA 2XFXA 4RA3A 3GSXA 3MRHA 2V7NB 4LHUB 2PYFB 1J1OH 1WZLA 4OZGB 1WAAE 3QUXD 1JRHH 4D0CA 4D8PA 3CJJA 3GBLA 4HUKB 1S7QA 4PRAB 4F7CB 2R69H 2IJ0C 1X6LA 2EDDA 4U1GB 4U1KB 5I74B 3EOAA 1KB9J 1EIBA 2QKIA 4G7VL 5IB4A 1MEXL 1SHMA 1AHWA 4NCC2 3WLWC 4DZ8B 1M7DB 1EH9A 2P45B 5CMAA 5HHPB 5TQ2H 5I8CA 3OV6A 2P24A 4WO4C 4S1QH 2YMXH 3LV3B 1XF5B 4NUGH 2JE8A 5L2JA 1MIML 1BQHG 4ODHH 5DWUH 2KL6A 4L1DA 4LP5A 5HHVH 1CFTA 2F19L 1B0RB 3LRSA 5A40E 3BISA 4NM8L 3VD3A 5T1KB 1AE6L 3SE9L 3HLAA 2AEIT 4LKCA 2MHAA 4URTB 3T1FB 4LVNB 3SO3C 4YQXH 4G5ZH 3KVQA 1VKXB 3N50A 4PTUA 4IHOA 1BBDL 1U8HA 4OV5A 1JP5A 4TQEL 3ES6B 1DEEA 2PO6D 4OD1L 2FATH 3MLYH 3S97C 2A0LD 2X1WL 1WBXA 5E4EB 2C3XA 4PV8B 2OI9B 3N9GL 3OHXA 5D8JH 3ULSB 4YGAB 2VDOH 3RX8A 1LK3H 3OJVC 4HIEA 4WDIB 4OLZH 5JHLL 4QRRD 4GRMB 2APTA 1IJ9A 3K4ZA 4UTBL 1CG9B 4M7LH 5IT2H 1AKJD 2GSGA 4L3EE 4D0BB 3V5KA 4OZIB 1A6UH 5D2NC 3NA9L 4GW4B 4M7KL 4NQUA 4XC1H 4R9HA 5F9OH 4JAMB 1Z2KA 1RVFL 4S0TD 4KKCC 2CMRL 5F9DC 5CEXA 2DM4A 3TVMD 4O2FA 3U6RB 5D5MB 3GJEA 3EGSA 3I9GL 2D31B 5C70A 2JK5A 1XCQA 3BZFB 4KKAD 2PW2B 4OD3L 4HMDA 3O3UN 1RIUL 5E94B 1U8KA 3KPQA 5KVMC 2XI9A 3OQ3B 1T1YB 5JO5B 4F7MA 4X8JA 3NCFB 4OTXH 4ELKA 5D7JD 4LEXL 3TPUA 3HI5H 2WLYA 1DDHB 5CEZE 3WUWA 2BNQA 3ULUC 3F5WA 4HUXA 1ZWIA 3DX8A 4HSQA 2GAZA 2HH0L 4FNLL 2ATPB 4M6AA 1Y6NR 4XP5H 5JUEH 1U2HA 1SVCP 1Q72H 1LK2B 2AAVA 4PRPB 1N0XH 1IC7H 4M8QB 1MNUL 2YD8A 3L1OH 3T0EB 3QDMB 1SJXA 1NGZA 4R0LC 4RMWA 1EHLL 4CBPA 3L7FA 5EA0H 4AG4H 3BGFC 2XPGB 5LGHL 1E4KA 3D3VE 5KN5A 1PLGL 2VQUA 3LQAH 1KIUA 2Z8RA 1BJ1H 2MKLC 3AROA 3PE9A 5HGAB 3PABA 3HFML 3INUH 4K3JH 1NGPL 2Y07H 2VC2H 3HRZB 2AV7A 2H1PL 4IOSD 3QXAB 4LQFH 4KI5E 3GSVB 3RZWA 5BMFL 1RHHB 2JJSA 4Y5VA 5KVEL 4MNQB 3ZMRA 1EEYB 3HZMA 1KB5B 1Z9SA 5HHQA 4Q0XH 2BZDA 1I8MA 1W0YT 2FB4L 4WFGE 4PJCB 4OT1H 4H25B 4NSKA 3ESUF 3QSKB 3QCTH 5DT1H 3NBNA 4FP8H 1WCBB 5DJ0A 2BY2A 1DBAH 2EDWA 2EYTA 4WTZA 1MFDL 4O58L 1L9MA 3GMRB 4JN1L 3O3EB 1QSEB 1TIUA 1LHZA 2FBJL 3GHBL 1UKQA 1G6RH 4YHLL 1G7PB 3S7GA 1JL8A 3L5HA 5DXWA 2CJUL 2Z0BA 3IS0X 3MBEC 4JJHA 3DBXA 4LPWA 4ZO7A 5HGHA 1QFOA 3EDDA 1IEHA 1OAYH 5H35A 1E27B 1OTSC 2J8OA 3MNZA 3QFJA 5ACMA 5GGQL 5GRJL 3MUY1 3ROOB 3LN5B 1ZT1A 2R2HA 4LOUD 1ERNA 3QI9D 5MI0C 4LLQB 2EKSB 4F3FB 1ES0A 2JB5H 5EIIB 3OZ9H 2W65B 2HKHH 3RIFK 3KJ4B 4EUPB 5I66B 4P3DA 5IW6B 4IRSD 4LCWB 1N7ML 1WZKA 3GJFK 5E8NB 4RFNC 4ELMA 1FVEB 4XNUH 4NPYB 5E7BA 2NY4C 2QJDA 2D03H 4JQVC 1YEGL 3OKDA 3S35X 2FGWL 4Y4KC 3TZVC 3MLXH 1ND0B 4UU9B 4KJYB 5IHZA 5E4IA 2N7BA 1WBZA 4WI2A 1HH6A 4JFYA 1QKZH 1AD0A 2GKIA 2RHEA 3EYVA 2FZ3B 4QXGH 3THMH 4JJ5A 5CHNA 4WY7H 6FABL 2NY5H 4LASL 2R1WB 4UNTA 1U58B 1Q9WA 2NY3C 3ULVL 4RMQA 4XP1L 5FF6B 3GSUA 3T4YB 3DWTA 3A6BH 3C8KA 5DO2D 4G6FB 3SDDD 3VW3L 4KI5D 5ETUB 4HQQH 3GI9L 4X6BA 1J1OL 4KVNL 3VGHA 1A2YA 3RVVD 4ODXA 2UZXB 4LVEA 5TE4L 2BVPB 2VN7A 1JRHL 1RZGB 3SDAC 4APQC 4PJIB 1BIIA 4MHHG 2DBLL 4P59L 5DRXA 2R69L 2BK8A 4NO0D 3TF7C 1I7TB 4KK8C 5BRZA 1F58H 4MQ7B 3QIWB 4XCCL 4KVCH 2NY6D 4XVJH 5LAXB 5CGMA 1UJ3B 1NQBA 3S35H 4MB3A 1BOYA 4HXAL 2GEEA 1NAMB 4GW5B 2K9UA 4X6DB 1OT2A 5TQ2L 1ZLUK 3L6FB 3WUWG 1MIEL 5BVPL 3VJ6B 3LKPA 4XH2B 3EW3B 3SKJH 3E3QE 1HEZB 4NUGL 1OAXL 4HIJB 2DIAA 2CRZA 3DRQB 2LU4A 4KRPD 5A3ID 5HGGS 1XGPB 2FH8A 2OR8A 3ILQC 5HHVL 2ZG3A 4U1IA 4J8RA 4OV6F 2D7TH 5EZIH 1YY8A 5IFAL 2J88H 5D1XD 4POZD 4UDTA 1T80A 1INQB 1S8DA 3O6LL 3QUXB 1J86A 4J2XA 1AD9B 4NN7C 5E1HB 4Y1AE 1YEIL 5LBSH 3S37X 5LKNA 4Z9KB 5E2TL 1X5ZA 2BVOB 1UEYA 4JFPA 5CP7A 2ADIA 1VGEL 5EUOF 3MLPA 5EO1A 3TWCH 5BQ7B 1AO7D 4Z8FL 4WI9A 5CILH 4HBQA 5HYSB 1OM3H 5K9OB 5TE7H 5IM7B 4JVUA 1JI1A 2BC4B 1YMHA 3QDGA 5FB8A 1KJMA 2BOBB 2FATL 4P46A 3BAEH 3VRLF 4HMCA 1U8LA 1HHIA 1Q9KA 2E8YA 5EIVA 1XZ0B 3VG9C 2AXGA 4Y5YB 3VCLA 2F5AH 3OKKA 3QQ3A 1T0PB 2VTFA 1DLHA 4N9OB 4OLZL 3P11H 3ZE1E 2Y1VA 2YD7A 2DQFA 4LCYB 4KWUA 2V17H 3HMXA 3ZO0A 5HD8D 1A6UL 2AJSL 4WTZG 1ZHNB 3T09A 1F00I 2DTML 2IAMA 1N0LA 5I30H 4HKXA 3VFSB 5F9OL 1QSFA 1DQJA 4NNPL 1QUNA 5D7IA 3HZVB 4MDJA 5IIEB 4EKXA 5JZ7C 4C83A 2XZQL 3OJDB 3EIFA 3MLUH 2VKWA 3QUMH 4HUVA 4QOKE 3SE8H 4AENA 3IJHA 1WUNT 3P40A 2FO4B 1RZFH 2MKWA 5F71A 3NIGE 4YLQT 1TJGH 1MHCA 5J89A 5DEFB 1H0DB 1NGWA 1E0OB 3VFWA 1VFMA 2PO6B 3Q1SH 4MVBC 5C0NC 1A6AA 1K4CA 4QRQB 4JG1H 4DCQA 4M9PA 5EBMA 1ITBB 3RVXD 4JDVA 1J05A 1MCOH 2Y9RT 5SWZD 5HHXH 1ZHBB 4RX4D 5MEQA 5DVOA 4QRRB 1OWRM 5JUEL 4EN3C 1QNZH 4ERSH 2ICWB 2W0KA 3WNOA 1TZGL 4KAQH 4XWGL 1N0XL 1IC7L 1HSBA 5I15L 4NHCH 3GK8H 2WQ8A 2M2DA 4XXDB 5I1KH 2DQTL 2W9LA 3R1GH 4XP6H 4ZFOL 3VH8A 4K3DH 4IS6B 4AG4L 4L8BA 1FV1A 1RIVH 5F7DA 3TVMB 4ZO9A 4Y1AD 4BKLA 1F3JA 3FB7B 1A6ZA 5L0QB 3JV0A 4K55A 5KOMC 5INDB 1BFSA 1I7RB 4OB5H 3OWEA 5AD0A 4E0RA 2NX5A 3INUL 4CMHC 4OQTH 1J0KA 3G9AB 4B5EA 1XH3B 2VC2L 3G6DL 3G6JA 4U1JB 2BY0A 1JF1B 4KQ3H 4BUGA 1GZQA 2NXZB 4RZCB 5BZWA 1G7HA 5DTFB 3OAYH 5D7JB 3WN5C 2X4NA 3RTQA 1A9BA 5DHVB 4XNYL 1BVLB 4NO2A 5BRZE 1BQHB 3NCYS 4NNYB 1MCSA 4Q0XL 4LLYA 4PRNA 4RISH 5C07D 2ICCA 3QA3B 4PG9B 1QHPA 4JHBA 4AEIH 4L8SA 3LKSB 3QCTL 4WWID 3ARSA 5I1EH 3UTZB 2I9TA 3QAZC 5LCVL 1DBAL 4CU8A 3U46A 4Y5XA 2VUOA 2Z8SA 3CZFB 2OL3B 5JW5B 2CLZA 2CRMA 3F7QA 3OX8A 3CU1A 1CDUA 4YZFE 5F7NC 2MJWA 4XPGH 3BXNA 5AYQA 1U0QA 2H2SC 4PJGF 2NZIA 2E7CA 4JM2D 2LQRA 4JY6A 3CXHJ 4YJZL 3WJJA 3PWPA 2HT4C 4QOKD 4DW2L 4FQ1H 1NMBH 4W81A 4FZ8H 2HTKD 4FQHA 4I3RH 3B9VA 2X4SA 5FGCB 3SOBH 2JB5L 1FSKB 4I18A 4B50A 2HMID 1ETZA 3UYRH 2GTZB 4MAYC 2HKHL 1SEBA 1XFPA 2EZ0C 2APFA 3MV8D 5D1ZA 5E00B 2UZIH 3MRIB 2VDRL 1EBPA 5GXBB 3MCLH 1R3IH 3NCJH 4HKZB 4N1CA 1JPFA 3SQOH 1UH2A 2BVQB 3Q3GB 4HUWB 3NGBC 3C2SA 3O9WD 2E8ZA 2D03L 4GKNB 4Z7WE 1HI6A 3RIAK 3FO2B 1IZKA 4OGYL 3RWIA 4I1NB 3L3KA 2WNGA 3MLXL 4XI5C 4TRPL 4OZGF 4ZOCA 4ODUA 1OVZA 3NABH 4AQOA 4ZODA 1NDMA 3THML 3IF1A 1H15B 4KGJA 4PJFE 4QHMB 4N68A 4ZO8A 4DUVA 4HLZG 3S3SA 4XRCB 4FG6D 3QI9B 4RMRA 4E42B 2W07A 4U6XB 5D7IE 3RI5F 4KHTH 4HQQL 1IZJA 4ALAH 1L7IH 1EERB 1GHFL 1UYWH 3BT2L 1P2CA 3GMLB 4R90L 2CK2A 3VG0L 15C8H 3I50L 2M8XA 4YFDB 3VFGH 4MA1B 3O4LE 1A5FH 3BP6A 4ZSOA 2DD8H 4IRSB 1OTTD 5IWLA 1XR8A 4U7MA 4FQQA 4YEEA 3PJSA 4GAJH 1PG7H 3M8OL 1OSPH 1T89C 2ZUSA 4CNIB 4HK0A 1K5NA 1F58L 1YEEH 3MUZ1 4GAFB 1FZOA 4KVCL 4XVJL 2J7LA 3RVWC 4Y4HA 3S35L 1F2XK 2EE9A 5T5FL 1UZ6F 4JPVL 4HH8A 1A6TA 3AVEA 1RZKL 3D85D 4NQSB 3KPSE 3AU1B 5LG1A 3SKJL 5AG9A 3QUZD 1C5CH 3S4SG 4YC2C 1JYXA 2C3VA 1L4IA 2JIXA 4LKXB 2DL9A 4I9WD 4KMQA 2W38A 2E9IA 1G7MB 3PXHA 2YPKB 3BN9D 3MLVH 4OLWH 1K85A 2D7TL 5JPNA 3WIIH 4QRPA 3VH8G 2J88L 5FCUL 4P4KA 1S3KH 4WW2B 5HHOD 5GSVB 4HH9A 2NX5E 3SEPA 3MJ9H 1BECA 3FQTA 4MNHA 4PS4H 4K71B 3G6JE 3A67H 3IFPB 1A4JA 1OGAA 2NR6D 3WCYA 1PYWB 4GS7C 4NO0B 3DGGB 1PSKL 7FABH 1GSMA 3UDWC 3T0AA 4HGWB 3RAJH 3SDXA 1G0YR 4OZIF 3CC5B 3DUSB 1OM3L 2RQ8A 5DC4B 1TQCC 1U8IA 3VE0A 3ULVD 3O2VH 4MQXC 1UWGH 4N9GA 5ABDE 4HPYH 3U82B 3F65A 5ERWB 3NA4A 3MRGB 3DTXA 2R9HC 5D5MF 2XT1B 3PWVB 5CIPB 2X4OB 3X3FH 3P11L 5E03A 1F4WH 1C5BH 4KRPB 1S7VB 4N0UA 1QR4A 2F53A 2AJYH 2V17L 3Q2CA 2QTEA 3H2WA 1QFUH 3UCRA 4UAOB 1JMZA 3S5LA 1LP9E 3BD3A 4GRLA 4NRXB 2FEDD 2RBLA 3OKOB 3PWPE 4FXKA 2R4RH 2RB8A 1G7LA 3MJ7B 5GGRA 5JPMB 3HUJA 4LARL 4ZS7L 3QUML 3C60A 3SE8L 3S37L 1P69B 1XT5A 3SDCB 2X70B 3M1BA 2NYYD 4CDHA 1TJGL 3X12B 4Z78A 1HHHB 2IPKB 4JFQA 4BQCA 4X9HA 4TPRH 3WL9A 2H3NB 3OHXB 3Q1SL 4R4NC 3TJHC 1T0NB 4M5YH 5I16A 2OK0H 4MA7L 4Z7OE 1Y0LB 3DETD 4JG1L 5J12C 4PGEA 4YHNB 3LSOA 1NDGB 1S7TA 3K3QA 3QIBC 4R26L 1NBZB 2P7TA 2HTLD 5CJOH 4CVWA 5IB1B 2CLRB 1XIWD 1QFWI 2WAHA 3ARFA 1FGVH 3FOMA 4NHCL 1DBJL 5HXMA 4PY7A 5JXEC 1IM3B 1TNNA 4JPWH 1MSPA 3ARDA 5DK0A 4XXCC 3R1GL 4XP6L 2P8MA 5GS0C 2H32B 4K3DL 1OF2A 3FQRA 3FQNB 2WIMA 3P4LA 4OBSA 1OP3H 5E08L 2A6JA 5C0CE 1RIVL 4LPXA 2FL5A 4QXTA 1PKQA 1C08B 1A1OB 4GAGL 5FGRA 4ZXBC 4WUKL 4PJCF 4OB5L 1NKOA 1BGXL 1T20A 2ZCKH 4PLJD 5DJ2A 1RU9L 4HJ0C 4Z0BH 1XGYL 2D7OA 2BFVL 2QQNH 2AQ1A 4ZSOE 3BSZH 2DQUH 2OSLB 4G6AC 2EKJA 4KQ3L 5L8LB 3OKEB 4H1LH 4HUXB 3D0VB 5DURD 5I1AA 2F54E 3ULUH 2FX9H 2HT3D 1AXIB 3RWHB 1R3HA 1YUHA 3D48R 3P77A 4RIRB 3STZB 1GRWA 1BJMA 1Q1JH 4RISL 4HX1B 2AEWA 5DI8A 2WWMC 2C4XA 2HLAA 4S10A 2RFXA 4X6FA 4Z0XB 1WV7T 5I1EL 1KB9K 3PP4H 2VITB 1DR9A 2VIRB 4MSWB 3EJZC 3FN3A 2ADFH 3TT3H 2IH3A 1AKJA 1QRKA 4XPGL 1OP5H 4Y1AB 4P23D 3WFHB 4UQ2B 5SV3A 4KUCF 4YGVA 5CGYC 1C1EL 4HF5H 4Y4FC 4QRPE 1K2DA 4DGVH 5C8JA 1NMBL 4FZ8L 3B9DA 1MHPH 3H8NA 4JFZH 4I3RL 3WHE1 3QQ4A 1GGTA 2AVGA 1CICC 3UYRL 4E41A 1OGAE 5BV7L 3BGMA 4X98B 1E28A 4OI7A 1NL0L 2UZIL 1MWAH 4HWZA 1EHAA 5LQBH 1P4IL 3OR6B 3MCLL 1JWMA 3SQOL 1EXUA 2P44B 2V9RA 3D0LA 5EZJB 3Q6FB 3FB5B 4OZFH 5HDQH 2Q3AA 4N1EA 2APWA 1JNLH 1VFBB 3BP5A 3Q6GH 3NCMA 4IIQC 1Q0XH 4LLWA 4WW1A 5HYQB 4I5BB 3TCXA 1BLNA 1UG9A 2EDOA 4IJ3B 2X4TB 4LSPH 5HGHB 3QULB 5I0ZA 3JV4B 1EHXA 1W72A 3JBG7 1MCRA 1HQRB 1YC8A 3PHOB 3TN0D 1U3HD 3W5MA 4PJIF 4DGYL 4N0UE 4OQTA 5J56B 5C0CD 2VR4A 1JJUA 3PF2A 2BXYA 4JM2B 2JJTC 4MWFB 2BHZA 4R4FL 3FMGL 4ZFZB 1CGUA 3CFJB 4QOKB 1V3JA 1G9NL 2CK0H 1F4YL 1DQMH 1TVBA 3U7YL 3FL7A 3OAYK 3GJFB 5FK9A 3LDBB 2VL5B 5JW4Q 5E2UL 1L7IL 2ID5A 3ARBC 4P2YA 5I74C 3HUJE 1N4XL 4X6DF 3DLQR 3VFGL 5IV2A 1PEZA 1X4XA 4YXHL 3TIDB 3MV8B 1A5FL 2NY0D 3B43A 3BQUA 3JUYA 4WGVB 5EZLB 2DD8L 1XF1A 2X89A 3A0OA 4OZHA 5T3ZH 3MFFA 2CDGB 5KSVB 1CDCA 1PG7L 2GI7A 4KK5C 1OTUC 3BUYB 1OAQH 4A2MA 4ODVH 4YK4B 5KSAA 1Q94B 1YECH 1HK6A 2R56H 4AIZA 1VENA 1XR9A 4B7LA 4OF8A 1WBZB 2HFEA 1EO5A 1C7SA 4Y19D 3ARED 3BP7B 4XAKE 3WBDA 5DGQA 5CHNB 3FO9B 1T3FB 5GS1B 3O2DL 3M17A 3VXTB 2FDBP 4NZTH 2AI0H 1BX2B 3NFPA 2VXVH 4PJ7B 3FQXB 4PV9A 4JFXA 1D9KC 3T0WA 3WNNA 5IEKA 2ARWA 4JM4H 4KMLB 1KGCE 1WVZA 3GSRB 2DKUA 5MENA 3KPOA 1HQ4B 4BSVA 3ARRA 4HUUA 2R8SL 1YPZE 3TBSA 1R5VA 3U30B 3CPLA 3MLVL 4NO3A 3RWJB 3BRDA 1MAJA 3WIIL 3MV9E 2XTJC 1S3KL 1E4XH 4PRDA 5DFWH 4W70A 3I3BA 3MJ9L 3IXTB 4FHBD 4XVTH 3MO1B 1NFDE 1GYAA 1S9WA 3A67L 3AGVA 3GZKA 5E4EC 3O6FA 2HT2D 3P4MA 1I9RL 1FQ9C 5MEPB