1XAUA

Structure of the btla ectodomain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
CEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords B- and T-lymphocyte attenuator
publication title Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator.
pubmed rcsb
source organism Mus musculus
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xauA00
5FYKE 3B5GA 4OLWL 2D7TH 2YKLL 4FMFA 5D7KD 3DI3B 4HFWB 1A64A 1HNGA 5TJWK 5GQBA 2F54E 3QULB 3W11C 1EJ6A 1X6NA 4DW2H 4HS3B 5FO8B 5IV2B 4P23D 4HGKC 4OLZL 4G9FE 1HH9A 1K4DB 4OFDA 1KB5A 1DBBL 1CICB 4NOFA 5L2JB 1EEZA 3MGAA 5M94B 4F2MB 2VITB 1G7PA 4LVNC 4RZCA 3O3UN 2CRZA 3KGRA 3V5KB 43CAB 3UYPA 1OWWA 5F72S 2DQIL 3BW9B 3NCYP 1IGYA 5GZOC 5ETUB 4PGCB 3W0WB 1NLDL 4G9DA 1D6EB 2MOVA 2DKSA 2PYEA 1F3RB 3ZKQD 1DBMH 2H26B 4YBQC 5DD3H 2V2XA 4Z9KB 4ZUVB 4M8QA 1KNOA 1S7VA 1UC6A 2ZNWA 1CU4L 1QD0A 5BQ7A 1CFVH 5HI5D 3QEQD 4QRUA 3WFDH 1EK3A 5SWZD 1UZ6F 5HHVL 5ANMB 5BW7C 1DQTA 5BJTA 4GG6A 1SJXA 5IB4A 4BQ9A 2K9UA 3FN9A 5EIQA 4DFHA 1A21A 3BX7C 5I75B 3C5ZC 2WWMD 3LQZA 2VLRE 3NPSC 2YUVA 4BH8A 5I15L 2OTPA 1X5AA 3C09B 3QJHB 2DQCH 1S7QA 1J1PL 4V1DE 4G5ZL 3BRDA 1DUZA 1IZKA 1QFWI 1Z9LA 1CDGA 4FMKA 5DD1H 1D9KC 2DDQL 3JV4A 2R2BA 3O8XC 4PGBA 4TVPE 1A6TA 3IFPB 1EA9C 2H1PH 3NFPB 4R96B 5TH2A 3TJHC 1C7TA 3EOAB 4LL9A 1JNJA 2B7DT 2F74B 4K7FB 1QR1B 4PRPE 4NNXA 3HG1E 4GSDH 2O5YL 3LD8C 5K9JH 1I3RB 3KPQB 3HZKB 3MRKA 2I9TA 4FQXA 2OL3L 3BKCH 4AENA 1Q9LB 4FXKB 2P1YA 4L8SB 3K2UH 5DJ0B 3CH1A 2AKRB 4NM8H 3RVVD 1EEYB 3QQ4B 3EAKA 2FEEL 2R2CA 3MLRL 4ETYA 4R3SA 2M1KA 3H9SB 5EWIH 1QFWM 4LHJB 1I7RA 2QV2A 4L4TD 5DJDA 3LB6D 4P57B 5FKAB 1J8HA 5EPMA 1F6FB 3OKNA 2UZIL 3OJDB 3PXJA 3STZB 1MHEB 4OIAA 1FRGL 3TV3L 2NXYC 1YEEL 4B5EA 4KJYB 5HI3C 3T65B 5IP4A 5D1ZD 1YYLL 4WWID 4BZ2H 5BS0A 2BSRA 3L9RA 4PIRF 4KRLB 1IEAA 2A77L 1ZVSB 2VABA 4UQ3A 2OR7A 3ROLA 4OLXH 4PRIA 3U6RB 1P9MA 3WNKA 1DLFL 1IM9B 3NFNB 2AQ3A 2VB5A 2MWCA 5I1IL 7FABL 5HGBA 4LFHD 1IAMA 4ZNCD 4U1GC 1HCFX 1U9KA 2J4WL 3EGSB 3S35X 5C2UB 1FL6A 2NR6C 2NY2B 1E4WH 3MGTB 4DJMA 5I8CB 2FJHA 5GRUH 3GUTB 2G60L 2XWJB 4KHXH 4P99A 4AK1A 3MJ8A 2NY4B 3DURA 4XTRD 2Z8SA 3FT2A 3DBXA 3TN0D 4DGYL 1RMFL 1M7XA 5T1DL 3OTTA 3NGBC 1BAFL 5E56A 3IB4A 3ZDZE 1G9MH 3L1OH 4M7LH 4PS4H 4U1LA 4KVCH 1TXKA 3VXMD 3DO7B 1MRCL 5HHMD 5I74B 2EEDA 4WWKA 4YFLI 5T1MB 1F58H 4RGOH 4D0BA 2VMFA 1INEH 4G42B 4WW1A 3SDXA 3O3EA 4P23B 1DDHB 4FABL 3FRUB 3EBAA 3WLWD 5MP6L 3D0LB 1YQVH 5HI5C 2DWEB 5IWLC 1M4KA 3JWOC 3AXLB 4UZGA 1C5BL 3L5WB 4R4BA 1RZ7L 1DQDL 3EDKA 3PHQA 4KU1A 3AS3A 4NO3B 4N9GA 1QOKA 5DO2C 3U79A 5F3HB 4TQEH 3NGBB 3SBWA 1UADC 3DVGA 5C0JB 2LFGA 2PXYD 5J8OA 3OX8A 1ZGLP 5HGDB 5C7XH 1KV3A 2YD4A 4JVWA 1QLFB 1QO3B 4HZAA 4O51B 1LO3H 4MGXA 4UV4L 1JHTA 1KIRA 1E28B 3ULUE 1AXSB 1U3HD 1YEJH 1B0RA 1YJDH 3MA7A 3QEQB 3TCXA 5SWZB 3QUZC 4XZUA 3QG7L 5I9QB 4ETQB 3LS5L 4LRIC 4PG2A 4YDVB 1YMMA 3BH8B 5A40E 1JJUA 5DFVD 1FL5A 1G7LA 2GJZA 1Y18A 4K3EH 2HMIC 2DBJA 3QUYD 1MQKL 2VSDA 3P9WB 1C16A 2NTFB 4LGSB 1CGXA 2D03H 1MUJA 1A22B 4KI5C 3HAEA 3HCVA 4XP1H 4K7PY 2XN9A 3L3GB 4EI6A 4RGMC 2VC2H 5DRNA 3X12B 3B5HA 3TFKC 1QBLH 4ELMF 1KB5H 3L3KB 3PIQA 1H5BB 5CCKH 4Y4KC 4YIQB 1B4JL 1WVZA 3REVB 4I4WA 4TVSa 4ZS6D 2X09A 4KROC 1NCCL 4AMKL 3BP5A 1KIPA 3VFSB 4Y5YA 4JRXA 3VXRE 4G8GA 5HPOA 2EYTA 4ZFZB 2GCYA 4HCRL 4NCC1 4JDVB 2A6KB 2NLJB 1T0NA 3SE4C 4DEPC 1S5IH 4IHOB 4EBQL 3FQXB 5JPMA 4LASL 4XVSL 1KYOJ 4MLIA 5ITBL 3L7EA 5I1DB 3BD4A 2ADIA 2MNUA 4ZSOB 1YEFL 2VO5A 5JTWA 3B3IB 5CJQH 3SDCC 1T83A 1FNAA 4L4TB 4MNGB 3OPZH 2EDBA 5JHDE 1BGXL 3VXQB 5C07D 3H8NA 4LAQH 4OD3H 2WP3T 1G7IA 4FQHA 2EH7L 5J1AB 2DBLL 3O2VH 1NSNL 2DI7A 4FXGA 4WCYL 3N50A 1TZGH 3DXAE 3DX7B 3WLBB 4FFYL 5IESL 4P4RA 1KCRH 4X9BA 3ZE1F 5IJKC 5D1ZB 2I25N 4I8DA 2NZ9C 1E6OH 1BJ1H 4KQ4H 4NC1E 1M7DA 1R5VA 3V5DB 4KTEL 3ARED 3TLRA 3WJLC 1XF2B 4KV5E 4X8JB 1HILB 3GKWH 4N8CL 4MCZB 4NRXA 3Q6FB 1OQOA 1MJUH 5E2TH 2VL5A 2PYEE 4NKMA 3RBGA 4O4YH 5DVOA 1T5WA 1VGKA 5ALCL 3UP1A 1WWWX 2P5EA 3BE1L 1CD1B 3IXAA 1U0QA 4KK5D 4NHCL 2CDGB 2NY7L 5D9SA 3SJVA 1F4WH 1HIMH 2DJSA 2K3TA 4TUKH 5C3TA 1DUYB 3TN0B 5CFHA 4NKOB 2D0HA 2X4TB 3IKKA 1LDPH 1CGSL 5IK3A 5DEFB 3MLTA 2PXYC 1TIUA 3DGGB 3MFFB 3VXMB 2CMRH 4PV8B 2HRPL 5HHMB 5BW7A 4UAOB 3GKZA 3CSGA 1JPST 2C3HA 3C5ZA 5C9KA 5GSRA 3H7BA 5IROC 5C09A 5CEYB 3OSKA 1YN6A 5I66B 2R69H 5C0BA 4ACPA 4WFGE 3C87A 1D9KA 3SGEI 2C1PB 3O8XA 4YO0B 5IW1B 5C2BL 4JN1L 2EC8A 4LSVL 3MJ7A 4ZFOB 5HPMB 5H37G 2BJML 2PXYB 4OBRA 4WTZG 4NC0B 4ZS7H 2NW3B 4P2QA 3VXSD 4LRNH 1NCAH 4WI4A 3DETD 4MQTB 4W6XB 3UBXB 5CLTA 4JREC 3BKYL 1PX3A 4KJYA 2CIIB 2BVOB 2W9DH 5GGQL 3D69B 1MIEH 1U3HB 1XT5A 2UWEA 3HFML 3MV01 3VI3F 4MAUH 1A7RH 3O2DL 4MS8C 1QEWA 1IGTA 4QRPE 4ZFFA 1FPTH 3D9AH 1CD8A 1YDPB 1K2DB 3EZJB 1GGBL 3S37L 3NA9H 4BFIB 2OK0H 3VG0L 1ZGLA 2WBJC 3WO4B 1NANH 3QHFL 3QUYB 4XCNA 2EKSA 4CGTA 5DMYA 3KPOB 1YNTA 3SN6N 3GM0A 4PRIE 4FZEL 2CUHA 1NDGA 5GPRA 5T5FL 4DQOL 2B8OT 4DTGH 3GZKA 4YAQB 5T1LD 3VXPB 1JGVH 5DVKA 3V7AE 1OP5K 1EUTA 4LQFL 3P9MB 4MJIE 4ZQKA 1OTSC 1T2JA 3QYCA 1OW0C 3VXTB 2X4OA 4NQEE 1S9XA 1TVHB 3REWA 1HINL 2XZAH 3HNTL 4JLRA 5HBBA 1JYNA 4ELMB 2D2OA 1A3LL 1EXUB 4ODWA 4P5TC 1NGWB 5CZKA 3HI5H 1KT2A 3BUTA 4U6HA 3CLFL 5DRZB 3VRIA 2VR9A 4QF1A 3SDAD 1IC7L 2Q76B 3ARQA 4MD5B 3SGKC 3CCHA 1U41A 1QSZA 5DD0H 3U4AA 3EDEA 4LPWA 2ZJSL 1VPOL 5CKAA 1D5BB 5IGXH 5KVMC 3PP3H 5EBGA 3ZSTA 5C07B 5DEGB 4EOWH 4M62L 3DNKA 2DQJH 2Z91A 5C8JB 3GSOA 3I84A 3PWVB 2X9YA 2ED7A 4OB5L 4Z7QF 3F7RA 5CEZD 4Z95H 4YHZL 2OJEB 1U36A 1NFDA 4RWYL 5F96L 2E8ZA 3HAEH 5GGSY 1BFTA 3RGHA 2NY5C 4YHKH 2EXWD 3AREB 3OAYH 5HDQL 1H8NA 2OZ4A 3RWDB 1NBYB 4H1LB 5IWLA 4U6YA 5JR1H 3CC5A 1CXIA 3GMMB 1I3GL 5I0ZA 1IC4H 2UVFA 4NPYB 1TETL 5FGBC 4PJIA 3GIVA 3P0VH 4Y19A 1DVFD 4FQ1H 1FQ9C 1T1YB 5MERA 2XA8L 4Y1AA 1DBJH 4ZXBD 1IGFH 3X17A 3I3BA 1P7HL 1QLRB 5C92A 1Z9OA 5LGHH 3F5WA 5K9OA 1FO0B 1A1NB 4JFFD 4JO4H 4GKZA 3QJFA 4YK4B 4BFGA 3EJZC 4QRQA 1JP5A 3QUZA 1O5DT 5EOQL 1T21B 1R3IL 3HNSL 4LRIA 4OLYH 1AGDB 3IU3A 1S7XB 1B3JA 1MCOL 3HS0B 4PJHF 1R3KB 5GS2D 3RNKA 3U0TB 1EBAA 3BP7A 1ZHLB 3ECBA 2LTQC 3EDDA 4I3RL 2R4SH 3W39A 3IYLW 1A6PA 1E27B 1V3JA 1EHAA 1TMCB 4GMSH 4XXDA 5HGAB 2Y36H 1FZJA 5HXMA 1Q9OA 3MRPB 2W1NA 2RQ8A 1OM3H 3RHWK 2FL5B 4XP5H 4BZYA 1WBYB 3HR5B 2VDQH 3P30L 1MIML 1AGBB 4XH2B 1F11A 3UDWC 4XB8A 3HPLB 4NFDA 4Y4KA 3IRZA 5GJTH 1L0XA 2AJXL 3EO0A 4JVPA 4BQCA 4X6DA 2FGWL 3BIAX 3RVUD 5KSAD 3VD7A 1AGEB 2AGJH 4IOFC 4NZUL 3PWUB 3VXSB 5IVZB 1KLGB 4F7PA 1EFXD 4XCYA 2DMCA 5E1HB 3S36L 1R5WA 1X7QA 1C08A 4M4PA 5GJSL 2W0FA 4NP4H 1MFAL 2BFVH 4O02H 3SE4A 3SO5A 5FECA 1LO2L 1CL7I 1KENH 1S9VA 2JIXA 4MJ2A 1UG9A 4KH2A 4YNYB 5ISZD 5FYKL 4ZYKB 2O5XH 3W0WE 3SDCA 1ZMYA 1KC5L 1PG7W 4D8PA 2IPTH 3MUJA 4TSCL 3FO1A 3D87B 3EFDL 3EO1B 2AXHA 2QQLH 3ARXA 5DJXB 4G6KH 1KEMH 3DPBA 3BEVB 1S9WB 4X8XA 1XGUA 3MBXH 4JFEA 4OGAD 3SKNB 2MKWA 2FX8H 4HIIB 5IJKA 5ANME 5TFSH 5MEQA 2OMBA 3MRBB 5GSVB 3EYOA 3D0VB 2IPUK 4R4ND 5T1LB 2ORBL 6FABL 2WIIB 2V2WA 4JO1H 1X3DA 4U1HB 4UT9L 5CGYC 3WJLA 1QKZL 5JO5A 2XG5A 4JEGB 2ICEA 4JHZA 5ITFB 4MWFA 5ENWB 4H26A 1HHKB 3ZKMC 1NGYA 1FV1B 3CMOL 3O41A 4M6OH 4QOKD 4P9HC 2Q86B 2P45B 2DB8A 4GQ9H 3X3GH 1CLCA 1V7ML 3DV4B 1HK6A 1FNGA 2VERN 5L8JB 5FV2A 2C7UA 4QTIL 3SDAB 5GS0D 3CDCA 3ZYIA 4CMHB 4LCUB 2DI8A 2HG5B 4F33B 1EHXA 2VLKA 4Z7UA 4KRNA 4DW2L 1DVFC 3B83A 4LGPB 5E0QA 1KJ2B 1H3GA 5INDA 4MXQD 1MCCA 4HJGB 5LWYL 3BYYA 1Q8MA 4F58L 4POZD 2CO6B 2FYYB 2GY7B 3RTQC 3WFBL 5F7EH 4BQ6A 1DR9A 3U2SB 3H9SE 4PJ7F 1MAKA 4O58L 2BC4B 3NIGF 4ZDHA 3MV8D 4DCQB 3SKMA 5IROA 4L4VA 3VE0A 1RUPL 4QXGH 2XXCB 1A02N 2JJSC 4F57L 2VDNL 4Z7OF 1T7WA 1V05A 4TVPL 5L0QB 4ZUSA 2VQUA 4HT1H 1CZ8H 1JRHL 3LZFH 5GGSB 2VXUH 3GMQB 2CUMA 2A9NL 2DS4A 4PTTB 2DQTH 4QT5B 1G7JA 2UWEE 4WEBL 4Y4HC 1TNMA 4JZJC 3NBNA 3EYVB 4HH9B 5EUOA 5FHBL 4ZXBB 4NHUB 3NOIA 4PJ9C 2ICWI 1EZVY 2DWDB 3CJJA 4LSDA 2E7BA 1RY7B 4Q9RH 3NZHL 3MGOB 1ZT7B 3RKDC 3K80A 4JFFB 4G6FD 2O5ZH 4K71B 3WD5H 2F53D 2H8PA 3L5XH 3P9MA 5KN5B 2GTZB 2Y4SA 5KSAC 2VYRE 2YPKB 5F8QC 2I07A 3TNMB 1ZK9A 4BH7B 2BCKA 3O3BB 1OPGH 3QNYB 3QHZH 2WBJA 2D0FA 1DL7H 1I9IH 3FHQA 3OF6D 1HH6B 1BJ1J 3FB8B 4OAWB 3PDDA 3F58H 1MAMH 1L0YA 1I1CA 1T1WB 4KQ3H 4XNMB 5JQHC 1PVHA 1E0OB 5D7KE 4NN5C 2OP4L 4MD5A 2DJ4A 3PGFL 4PJHB 4JY6A 5DZNA 4YHOL 4JPWH 3SDDC 2OZ4H 4LHUD 3G5VB 3GBLA 3JWOH 5GS3A 2JB6A 2G5BB 5KSAB 3MRFB 3RL1A 3TYGL 3KPPA 4P5MB 1VFBA 4TN9A 2PR4L 5FA4A 1OW0A 3E0GA 1AD9A 1EFXB 2M2DA 1QYGL 5TDPB 3UJTH 5BOZG 4JFHD 4P5TA 2H2SC 4FQIH 4NCC2 4OLVH 1MREH 4GOSA 3SGKA 1EJOH 3O3DA 5ISZB 1AQDB 3UYOD 3Q6GL 1U92A 4OD2B 1UYWH 3IDGA 4EDWH 2GITA 4GRWF 1NGZA 4OI9A 3VMPA 3BUYA 5FKPB 3TCLB 5ID1B 1KEGH 2PF6A 3QEQE 3U7WL 1NAKH 1Q38A 1RUQH 4P3CL 5SWZE 4IRSD 4XMPH 2HWZL 5FUZH 5HHNB 1ZHKA 4K23H 2G9HA 1FFQA 2BXYA 2ZCHL 3MTRA 5J12C 1WF5A 3GMLB 3KPTA 4HWBA 1TTGA 3K4AA 3UPRB 3IDUA 1AI1H 4NO5B 3UZQA 2XNAA 1PYWA 4GRLC 5J11C 4KZEH 3QO0B 3X14A 4L29B 1UZ6E 5FGBA 2WV3A 1YA5A 1IKFH 2MTPA 2SEBB 4PJ8C 1YEKH 4UB0L 3G5XB 4QOKB 2Q20A 4HUWA 3BPOC 1G9ML 3MOBH 2VLLA 1DE4B 3ULUL 4OLUL 4KY1H 4PY7A 3QIUD 5FYJL 3U4EB 5E00B 2Y07H 5JPNA 2Y5TB 4UILH 5ACMA 3FCTA 4JN2B 1RFDH 2CDEB 2A74A 3LSOB 5J6HB 1YQVL 2H45A 1ADQL 1H0DA 4KDWA 3RL2A 1HXMB 3HZMB 4UU9A 4ZSOE 5DJ6B 3HE7C 3EDFA 5GIRA 4OCRL 4L4TE 4MNGE 3MV8B 5ICXB 1ZT1A 2XFXA 4YX2H 5SWSA 1EHLL 1A8JH 5IQ7L 4RA0C 3WIIL 3TESA 3L3JA 5C7XL 1W0WB 4WY7H 5EN2A 1VGEH 3N1QC 1FFNB 3C8DA 5IB3B 5EBMB 3UDWA 4J4PC 3ZL4L 3B9AA 4PJ7B 4MNQA 2FBOJ 2DLFL 4UNVA 4G6AC 2P47B 1ZA3A 1AP2A 4JJ5B 4ELKA 4KXZI 3ILPB 2HLAA 3ZSSA 3HTLX 4LVOC 2VQTA 3KJ6L 5ESQA 3OZ9H 1J8KA 1FBIL 5D70L 2YWZA 3QG6A 2DQDL 5E03A 4G6FB 3SHSA 2F53B 1G9NC 4KPHH 1U8MA 4G7VL 1N64H 2VAJA 4NQXA 5ITFA 1ES0B 2V7NB 2E9BA 4GQPH 2KBGA 1OB1A 1OAKH 3GI9H 2E6QA 1KPRB 1XF5B 2VJXA 3IDNB 4FFWC 1DQQB 4YR6B 4QYOA 4X6CB 5F9OL 1LDSA 3VXME 5DHYA 1I8IA 3RDTC 5HHME 4G80B 4LHUB 1GOGA 3FB5B 1TENA 4OCNC 1WIUA 5DSCB 3LEYH 4G6ML 3GSRB 5JHLL 2R1WB 1FL3B 3MUGA 5FGCB 1YY9C 3EO9H 1BQLL 3IJSA 3W9DB 3OXSA 1EPFA 2HP4A 5F1NA 1AD0A 4GJTB 1HZHL 1T7VA 5D2NB 1MHHA 3B4NA 3S37X 1P4IH 1T0MA 4MA1B 5JUEH 2AXGA 1N26A 4LFHG 4LNRA 3QWRA 4LAQL 1X5IA 1F5WA 3H3KA 1IQDA 4XNUH 1TZGL 3K81A 4BSVB 3TBSA 2X5PA 3I75B 3U9UA 2ZUXA 4NQUA 1UWEL 5AAWA 2BOCA 4XCEA 5C08A 1DVFA 2AK4D 3LKNA 1CF8H 2ZOLA 4X0KB 4GW4A 3THML 2XWBA 4QLRA 4U6VL 3RTQA 5JZ7D 1NAMB 4IRSB 4JQXC 4NZRL 3V4VL 2WAHA 2IH1A 3QXDB 4KDVA 4MJ6B 5J0BA 4WHDA 2BSTB 5MEOB 1FYHB 4NQVA 4PBWD 2JJSA 3H9ZA 4NJ9L 3FMGH 1RUAL 4WI9A 4F15C 2PO6C 4LKXA 4GRWB 3BYTA 5BVJB 4Z76B 3TBVB 4QHMB 4X4YA 4A2LA 2GYSA 5I8KH 1NGQL 2PUQT 2Z35A 3LPWA 3DUHA 3KPLB 2FZ3B 4IIQB 4NN7B 1ZHBB 1FYTD 5EU4A 3CLEL 3KS0H 5JOFB 1ZA6A 4Y4HA 4JZJA 4A6YB 4G8IB 5DRXB 1MLCB 3HC3L 3NCBB 3B8SA 2V5TA 5I1EH 4PJ9A 3KHQA 2VAAB 5LCVL 4H8WL 3MXWH 3QIUB 3UBXG 1PY4A 4P3WA 4CW1B 4HXAL 5SWQA 5F7HA 3CFBB 4ELME 3WUWB 3ZHKA 4F15B 2GTWB 4AM0A 4CL7A 3JUYA 1AKJA 4XPHL 3I6KB 4JKLA 1ZHNA 2R69L 4PRDA 1BMGA 5C0NC 2EO9A 2AABH 1MFCL 4UDUA 2AS5M 1T80A 3V2AR 4LCWA 2FEEI 1EGJL 4KUZH 4HJJH 4DAGH 1J10A 1PSKH 4ODSH 3OV6A 4WHYG 5C07E 4U1IB 1FG2B 1N59A 3V5HA 4LRNL 2LU7A 3D3VA 2YBRB 3LKSB 3MJ9L 2NY5H 1NKRA 3QB7C 1P5VA 4HWBH 3SDDA 1AHWC 4YBLC 1AFVH 4JDZA 4MD4A 5DJCA 5JIPA 2OQJB 3QEGH 1HKLL 2YEZA 3BIKB 1ND0A 3IFOA 4WHCA 1OARH 1G7MB 1Z0NA 2Y25A 1JF6A 5DUML 4PYGA 5KW9H 2HFFA 1MI5A 1G1YA 5CD5C 2AAVA 5LQBL 2XQBH 2KKQA 5IJVA 2ATKA 5T3ZH 1DQLL 4OKVB 5ACZA 4PREA 4PJAA 1N7ML 3GSQB 3IFLL 3UPRA 1F02I 2BVTA 5T1KA 3TJEH 3WS3B 3HUJF 2R1YA 3P4NB 4P5KB 2BNRD 2CKBA 5CP7A 3RJDA 2CJUH 1JGLL 1RK1A 4Z8FH 1MFEL 5E8DH 1C1EL 3QEHA 3V0WL 1T22B 4AEFA 1I1AD 4Y2DC 2I26N 1OL0A 4JY4B 1MCPH 5BO1L 3PWLA 3MYJA 1A1MA 1HSBB 5IF0A 2OS7A 2QR0A 1L7IL 2HFGH 3GSVA 3FQTA 4L3CB 1GC1L 3FTGB 4Z7VA 3S36X 1JMZA 2ZOKA 3SE8H 5IFHH 4OFPA 1CGYA 4H1LG 4N1HB 4P59H 5L7XH 1KG0B 1U3ZA 4GRLA 5A3ID 2XOTA 5DJAA 4W4NA 5JZ7C 5E08L 2A9ML 4PRNB 4PJ8A 2ZSVA 2J6EA 2AJUH 5IGXL 2AEPL 4N0CD 4JQVA 1DFBH 3DMMC 3RBSA 5E8PA 2XRAH 1YUHB 5D72L 3F7VB 5BXFA 3CXDH 2O26U 2F5BL 5TDOA 4NO2A 3KNBA 3VXSE 5BV7H 4U3HA 5CLWA 1NC4A 4HV8A 1INQA 3ARUA 1QPXA 1C5DA 1KCVH 4PJDA 3KLAB 4PLJD 1ZANH 1T4KB 3I9GH 4Q97A 5HDBF 5FM4A 2YC1B 1TJIL 2AK4B 4NYLA 3VA6A 5I1LA 4M43H 1IBGH 3U0PB 1LO0L 5FGSA 2HT2D 1SEQL 1RULL 4DVBA 2A73A 4LVHC 3ULVC 5JR1L 5GS1B 1KCUL 5EU3B 3MLVH 4XPAL 3HE7A 1FP5A 2VRAA 4G43B 4AIXA 4D0DB 3T2PA 3CSBA 4UIKH 1JZ7A 2G2RB 5DDHA 1MWAB 1XIWD 2VQ1A 4KKCC 2DIAA 5KJRH 3TT3L 1LE5A 1LK2A 3FQNB 4UT7L 3DTXA 5E2WH 4LLWA 3VI3E 1DBJL 2BMKB 1S7WB 4Z77A 3BI9X 2ID5A 4J4PA 4PGEA 4OZFA 2VXVH 1U8PB 1P53A 4G8EA 1FYTB 1X5XA 5J9PA 4U31A 2YPVL 4WI5A 2WNGA 2XWTB 1G7HB 5E4EB 3IAGC 2BNUB 4X6CA 4D9LH 4P9HH 4KVNH 4UNTA 1BZ7A 1D5IL 5FB8A 1J5OH 4LHUA 2R4SL 4WNQB 2B1HH 3X13B 4CUCA 1KFAH 4H0GA 3IDYC 3MLZH 3INUL 1LK3H 4HFUL 1RJZA 1PLGL 1F8TL 2DMBA 5D1QC 3VFTA 5ERWB 3AVEA 3FFDB 4NM4L 4GKOA 3CUPA 4J1UB 5DZOA 4GKSB 5TQ0H 5EUKB 4GLRI 3JWDL 1E6JL 3V0VB 4ZD3L 3CIQA 4X6BB 4YPJA 4HIHA 3RVXC 3VFPB 3RDTA 4ESKA 4LLMB 5CEZE 3MRHA 3T0WA 1JZ8A 1RUMH 3NTCH 4R7NB 3SCMD 2NNAB 1PZUB 3IDIB 4CAGA 5DUBB 4B7IA 2H32A 5I2IB 5C9JA 4YE4H 4TPRH 3NZ8A 1TCRA 1GAFL 3GMPA 4WHTA 5D8JL 1UJ3B 1CDUA 4PJCF 4APQD 1XGYH 3VDCA 5DVMA 3DRTB 4TTDD 3QNZB 4HZLB 2P49B 2JTDA 1ZEAH 2GI7A 1AR1D 4BUHA 3SEPA 3U83A 4MAYD 3MZTA 1BBJB 4H88H 2NYYD 3IETA 3L7FA 4WI3A 4KAQH 4PP2A 2X05A 2BNRB 2I60H 2VUOA 4PRHD 1IC5L 3ZDXF 1LMKA 4P4KD 3PGDB 2ERJC 4NJAH 3QUMB 3QISA 4X5XA 3BH9B 2DQGL 4JFFE 5T3XH 2Q8BH 4Z5RB 3C6LD 1I1AB 1CLOH 3RY5A 1K6QL 2EIZB 1VADA 3E3QC 4XC3L 4JQXA 2PW1B 3DIFA 3HUJB 1FFOA 2HKFH 1A6AB 3EYFB 4HJ0D 1SJHA 3UZVB 3QDJA 4KJQD 2XTJD 3OXRB 3FRPG 3WHXB 2EDKA 2GTWA 1P1ZB 3X3GL 2PO6A 4WO4C 3BSZL 1KELL 4ZPVB 1GGTA 1YEGL 3L3IA 4CADA 4HBQA 1JGEB 5T33H 2OM5A 1UM6L 3HB3D 3NCYS 3O4LA 1RVFH 3ES6A 3LQAL 2E7HA 4OM0H 1NCWL 4PJHE 1JTOA 1QBMH 4H25A 5F7DA 5LBSH 1X5GA 2R2EA 4WW2F 3TZVC 2P8PA 4DGVH 2WUCL 32C2A 3OB0H 2QQQA 3AS0A 5HHQB 1WFOA 4XAWL 3CZFB 8CGTA 3QAZB 1OP9A 2FIKB 3KHOA 1RIHH 1SY6L 2RAMA 3GSWB 1HSAB 4JPKL 1RK0A 1IQWH 4JM4L 3U1SL 4S1SH 3WIFB 2CKBH 2R0KH 2X89A 4FZ8L 2WW8A 3E8UL 4K8RC 1I8MB 5ISZE 4LSPH 4FN0A 1PG7L 3MR9B 1G6RB 5FYLD 3LZFL 2BNQA 2VXUL 1XIWB 1PZ5B 4N5UA 2VE6A 2Q8AL 1FHGA 4KK8D 5EORL 1LWRA 4NKIL 1CGWA 2MFNA 4M5YH 1ONQA 1S9YB 1VERA 1QSFD 1L7TH 2JE8A 4OGYL 2YPLA 1OF2A 3A6CL 3NH7L 4JO2L 1AHWA 4N9OB 5GISH 1CT8A 3N0PB 2X9WA 3GHBH 5FOBA 1CGVA 4ERSL 5JLZB 4LCYB 4KGLA 5LAXB 5DXWA 4XNZC 2C3WA 2ADGA 2HTKC 3BZFB 1CXFA 1TZHB 4DKDC 2J6EH 1KN2L 5IHBA 5J56B 2VWEC 4GAFB 3U9PH 4BK4A 3QHZL 3ESVF 1J12A 4MA7H 4NOBA 5IG7A 4QOKE 5FHAH 4MVBC 1ACYL 4EI5C 5GGTA 1WEJH 4NO0D 3PABB 1MLBB 5TF1L 3MLYL 4PJEA 4YBHA 4YUEL 3FZUC 2DM2A 1A14H 5JW3H 3GGWA 2LV4A 3H9HA 4GT7A 5DFTA 3DYOA 3JWOL 4GFTB 4Y2DA 3MRRA 2Z31C 3IJHB 4C54A 1WAAF 3PV7A 1ZLWK 4GRMA 4TULL 3QIBC 3G6DH 1NJ9A 3BWAA 2VLJD 4NQDA 2X4PB 4IMKC 5DQDL 3SCMB 1YNKH 3TT1H 2R1XB 3FQWA 4J3WA 3KS0J 3LKOA 3BMVA 3MV8E 2F8OA 3P77B 4WUKL 2PN5A 1MJJA 4HGWA 5D6DC 3DX9B 4OZFH 2VNCA 5GXBB 5F7FA 4NZTH 3FB6A 3SGJC 4APQB 1OGTB 2RB8A 4LEXH 1IVLA 1FVCB 3HE6D 4XP6L 4PJ7E 3DMMA 4HD9A 5C3LD 4OZGF 2X70B 3NIGE 4MAYB 2YK1L 1DQJA 1HNFA 5ESVB 3QCTL 2LU4A 1WBZA 4XGZA 3PJSB 4Z7OE 1WIOA 2B0SH 1H3XA 5J3HD 1S7UB 4PJCB 2ARJB 4PRHB 5I1GH 5E2UH 4P4KB 5BZDB 1G9NH 3BHBA 4EN3D 3RZCD 4X9IA 1ZLSH 3PP4L 3L3OA 3C6LB 1F2XK 2X4SA 2F53E 3FB7A 3H6JA 3OAZH 1K4CA 3EOTH 4Z78A 1TCMA 2FX9L 4X5WB 2AEQH 5C0RH 3MRMB 3VFWB 1E4XH 3WN5C 5DMKB 1TNNA 1XF4B 4OSUH 2XTJB 2ADJA 2J2ZA 3C5JA 3VG9B 5JQ6L 1JTPA 3RWEA 3MOAH 1T20B 4JFXB 2A6JA 5TQ2H 3K8KA 1K3IA 1QHPA 5DUPL 3TIEA 4X6CE 3Q1SH 2R0ZL 3WMSA 4HKXB 4X6EB 4KRPD 2H32H 4UILL 3WFHA 1HDMB 2QSTA 4OGXL 1RURH 3KPNA 2DN7A 2YXFA 5MEPB 4RRPA 4YHYC 3O4OB 2NY6D 5FGCE 1WBXB 4UOJA 3CK0L 3SE3A 4FQ2L 1J11A 1OGAA 2V17H 5L8KB 1OT2A 5D2NE 4PLKD 5DTFB 3CVHB 4JFHE 1XGPB 3OHXA 3WHE1 3FOLA 4WW2B 1WISA 5D1QA 2D3VA 3LRSA 1WCQA 1TJGL 3IS1X 3SY0A 1H3VA 1LEKA 1O0VA 1R3JA 4QO1A 3G5YA 1R0AL 3KLHD 3RVWC 1N5YL 3X11B 1QSFB 1MJ7H 2D7MA 3RWIA 5CJ8A 4IMLA 1OSPL 2FD6H 5MENA 3FT4B 4F37K 2IQAA 1DANU 4U1MA 5HHOA 2E9IA 3G08B 5FXCH 4XPGL 3OBAA 4EIZC 4JFDA 4GRWE 2FLBT 1HHIA 1OAUL 4ALAH 5IHZB 3V6ZA 5IVXA 1DSFL 5KS9F 3V79C 1L0QA 1MH5B 1CFQA 4M3KB 1Z5LA 3MROB 4JAMA 4JRYA 1HYSC 1OAXH 2NX5D 4R0LB 5IMLA 3MCG1 4NO0B 4OV5B 2WMPA 2X41A 5KVFL 5L6YL 5JOPD 3TM6A 3KG5A 2E8YA 4KZDH 4TNWK 5EBLB 1HQ4A 4NWTH 5F88A 4DKFH 2R4RH 1BFVH 1I7UA 1J1OL 1FGNL 1EVTC 3D5OF 5IMKB 3PL6C 3CDGA 1OP3K 1EO8L 5DD5H 2VLJB 2ZUVA 1LO5B 4EN3C 3RZCC 4JPIB 3UYRH 5INCB 4WO4A 2VIRA 1QLEH 3ROOB 1BD2A 3KYMB 1Z3GH 3D1MC 4ONHB 2DAVA 2RHEA 5SX4H 5D7JD 4R90H 2ZUQC 3HE6B 1OTUD 3D18B 1JRHI 4RGND 1VEMA 3TZVA 2Y23A 5TE7H 1KF9B 4ZAKD 1OTTC 4ZODA 1FSKC 1HQRB 3N85H 1AGFA 3CU1A 1SM3H 4EN3B 2R8SH 2GSIB 3RZCB 2CIKA 4BELD 4P2RD 5TGBB 2BNQE 4PRBA 5GGTH 4DFIA 1CLZL 1W72A 2C26A 2X4QB 4P46D 3BP6A 1XR8A 4X7TA 3BPLB 4YDJB 3UO1H 4OZGB 3TO2B 1F3JA 3D39A 1WT5A 4G3YH 4U33A 2GK2A 2R56L 2W9EH 4I18C 1U93A 1NH6A 4JDTH 4RMWA 3P4MA 3NCJL 4ORZC 4CVZA 9CGTA 3B43A 2YN5A 3D6GA 3GI8H 1X5YA 4NNYB 4MQ7A 4WEUD 5K33A 5BMFL 2VDKH 5C6WH 4Y16D 5I71B 4PLOB 4JM2F 5H35A 3MLWH 4K94L 3SKJL 5I1HL 5IM7B 4KRPB 5DWUL 2C3GA 5E70A 4PUBH 5DQJB 5HYIA 1IE5A 5I30H 2EYRB 3MLSL 3ARZA 3CFKB 4MXWL 1F00I 4ZUTB 4I0KA 5DJ2B 1V3MA 3PWNB 2F19L 3GDBA 4FS0A 2NY6B 1U6AH 4JM2D 2EDDA 4FQCL 4O2CA 3PHOB 2EDYA 1KTLA 4EI5A 1FZKB 1LP9F 2VZ1A 3O6MH 3QCUL 4U1KA 1JHKH 1VACA 3VDBA 1QFPA 2GAZB 2ICES 1YPZA 4I0PD 3PV6A 1FO0L 1G7QB 3KR3L 3T3PF 4HWBL 3FQUA 1QVOA 1LILA 5IT2L 5B39A 3QEGL 4JY5L 1M7IB 3ULVH 3MJGX 1SEBB 3RA7L 4PLNC 2AK4E 2Z31A 1BFOA 1OAYL 5KSVA 1KTDB 4N1CA 3QIBA 4G6JL 4XCFH 3ZKXB 5SX5K 3EHBC 3GB7A 3VFOA 1JWSB 4RNRB 1BBDH 4IMKA 2LE9A 2W59A 4WGWB 4E5XB 4O2EA 4POYA 3HI1B 1UWXH 3MRJA 4WRLA 5K93A 2ED9A 3MCLL 2HAZA 5D6DA 4PJ5A 2HT4C 2BHUA 3BZEA 1ORQA 4KKAD 2AJVL 4JG1H 3ARWA 5D2LA 4HF5H 1JNLL 4UOW1 4P3DA 4BZ1L 2APVA 1I1YB 1FNEB 1FYTE 3VWJD 2ESVD 1FVDA 2IG2H 3VGBA 5IKCB 2NX5B 1YY8B 1A6VH 4GMTL 4LCIL 2PTUA 3VFMB 3OKKB 3S5LB 2C4FT 4RMSA 4CU8A 3MZGB 2WUBL 1GL4B 1WZKA 5KS9B 3ZTNL 3R8QA 3GIZL 5EZIL 1MF2L 3MRCB 1BZ9A 4YQXL 1NGPL 5E7BA 3K8LA 5DT1H 2J88L 4P59L 4RDQF 4ZAKC 1LE9A 4JFQA 3SKOA 3QIWD 3WN5A 2DTML 4IOIB 3S6CA 1VEOA 3FQRA 2AJUL 3I50L 2FATL 4X4XB 4ZUUB 3VRLF 5HYJD 3ALWA 2FNBA 4HG4K 3TA3C 1QFUL 2AJZA 5IB1B 1PDKA 4QHLB 3VJ6A 4U1JA 5B38G 2JELH 5JXAH 4TSAH 5DJZB 5D7JB 5DMJB 5F9WC 1P4BH 4F7EA 3MODH 3QH3A 3MV9D 3MREA 5LXGH 3RX8A 5I1AA 5FUOH 4H5SB 4OD1L 4RGNB 1I4FB 2QADD 1JI1A 4ZAKB 1UXWA 4CNIB 5HSFA 3BGFB 2ADFH 3MLVL 2IBZY 4LLYA 2I5YL 2Q7YB 2IPUG 4P2RB 4TUJA 5LVEA 1VESA 1LO4H 3RU8H 2NY0C 4HWZA 2WM0A 3UJIH 5IFAH 4P46B 1A6ZB 3O0RH 2HJFA 3HC0B 4QEGA 5IBTL 4L1HA 5AZ2H 2FHBA 3FOMB 1WCBA 3V6OE 2NY3D 3BKML 2DYPA 2HVKA 4XPBH 3NAAL 5A16B 3OL2A 1KJ2L 2BNRE 3IDXH 4PFEA 4KK6C 3MLUH 3T3MF 3QRGL 3F7QA 3MRDA 4U1NA 5CEZL 4Y16B 1SYVB 2AJYH 5C0DA 1Y6NR 3E6FA 5HVWA 4OV5A 2VDMH 4JKPH 5CIPA 2IFFL 1HEZB 2ATPB 2HN7B 3TBTB 4P9HL 1FZMB 43C9B 1MHCA 1S8DA 2JF1A 4EEEA 3HUJE 5EFIB 3L95B 1J5OL 4D0CB 3ARBD 1XEDA 2R23B 1F6AB 2CGRL 5D6CA 4ZO6A 3ULSA 2FSEA 4CJ1A 3TC9A 5HY9B 1HHGB 3QPXH 5C6PB 3DVNB 5D93B 1CK0H 4JM2B 3TH2T 2IAND 4NKQB 4NSKB 2GUOB 2IADA 3WXVL 1FNSH 4XX1E 3BPNC 4JANB 3UTSD 1PG7X 5SV3A 3K8MA 5KTEH 1NCUA 3F6IA 4N0FA 2QQNH 2VLRD 3KPSD 4I0PB 4YWGL 3L6FB 1C12B 1W72H 1A0QL 5C0CD 1KJ3H 2DL9A 4I9WD 3BISA 5F1IB 5IHUL 4HHAB 4AEHH 3NABH 2VOTA 2HVJB 4K8RH 1LP9B 5C0AD 3PL6A 5I18L 1BPVA 2DQFA 5EU6A 4XVJL 1J1XL 1QSEA 4PY8J 1H15A 4LPCA 2OMNA 1FDLH 3BPNB 1D5XB 2J8UA 2CDFA 4EN3A 4ONOA 4QRSA 2LVCA 2AV7A 4KWUA 3LHPL 3RZWA 3QWQB 4ONGL 1KJMA 3T0DA 3OKEA 2ENYA 5EO1B 4RMTA 3UTQB 4M5ZL 2K1MA 2GK0B 3MRQB 3QZWB 4XI5D 5KVDL 1EERB 4XPFH 3SPVB 4XX1G 4F37F 1V8HA 1MCIA 1NEZG 5EU7E 3VWJB 2ESVB 2Q8BL 1UA6H 2M26A 4YEFA 1S7TA 1RZJL 1DEEA 1TVBB 3DHMA 1WZLA 3SOBH 3O6KL 2YSSA 3IF1A 2VKWA 5ADOL 1MHPH 4HK0A 3TBWA 1CR9L 1WWCA 5ADPH 1Q1JH 3VGAB 5CKGA 1BQHA 2Y6SC 4HIJA 5JIKA 4U0QB 4KMTL 4NUGH 4F7CB 1BOGA 3WFCL 4I18A 4L4JA 5IW6B 2JB5L 1XGQB 2YRLA 1U8NA 2GIYA 3QIWB 3V4UH 5D96B 5BRZD 4OM0L 5L2KD 1S7RA 2RFXB 3MXVH 5KZCD 3LOWA 3OAYK 3M1BB 1FLRH 2RJMA 2A1WH 5HYJB 4D94A 5E8OA 1UCBH 3DX6B 3ZDZF 4X7CC 1FCCA 1RHHB 3WXWL 2AJSH 4KJWC 4LCCB 4GXVL 1CE1L 1UVQB 1DLHB 3MRIB 4K7PH 1IAOA 3F7YB 3MV9B 4ODHH 2QADB 2B4CL 1IARB 3RUGF 4LLAA 2I9LA 4ODXB 1T66D 3OKYA 1OSZA 2ZKHL 1XF3B 4DZBB 4LSPL 3RJQB 5ICYA 4JPVH 2YR3A 2AK1H 3T8XA 1YEHL 4OCYL 3FFCA 3UTTD 4P9ML 3PNWA 5F89B 3FONA 5GS0L 1VSCA 3FAWA 2NPLX 1NANI 2YMXL 3BWUC 1YMHB 4NGHH 5ICZA 2NY3B 4WFED 2DOCA 1AJ7L 4RX4D 5BCAA 4L3ED 3KYNB 3WNOA 5E8EA 1KPVA 1CXLA 2V9RA 2E5EA 4NWUH 35C8L 3SO3B 1XCTB 4IDJH 4J3XA 5EOCL 1NBZA 3O11A 3IVKB 3L5HA 3ARBB 4P2CG 3ZDXE 3CVIH 1TJHL 2XTJE 2BOBA 4UINL 3ORJA 4I5BB 3CXHK 1D5ZA 1IGIL 1KJVA 4QHUB 1AGCB 2IANB 5TE6H 1AXIB 4PJBF 5CJBA 2R9HD 3UTSB 1A14L 3B2VL 1REIA 4X7EC 1JGDA 1SHMA 1X44A 3I02A 4JFPB 4E42A 2AVGA 2P42B 4O00A 1B9ZA 1QFWH 1A1OA 4M7ZC 4W70A 2VLRB 5C71A 3KPSB 3CX5J 1SMAA 1G1CA 4X6FB 1ZVYA 4HKJB 5C0CB 1HI6A 3O3AB 5C0FB 3QFDB 3VXUA 1CXEA 3KPRD 5CUSH 3UJJH 4BSWA 3UC0H 2IPKA 1QQDB 1I4FA 5C0AB 4QRTB 3DUUA 2HT3D 1AXTH 3T1WA 1KOAA 2MPAH 1FNHA 4MX7A 5D7IA 3HHRB 4N0UA 3BKJH 2A0LC 4E0RA 2W60A 4HKBB 1UENA 4R9HA 4LEXL 1IFHL 4NDMA 4XVUC 3U46A 3VXRD 4LPTA 1ZTXL 3BMWA 4OFYA 1I9RL 4M7ZB 5CIPH 3SKUD 2VDRH 4L8BB 1LEIA 3RNQB 3TA3A 3BD5A 4Q6IB 1BVLB 3UMTA 4AG4L 3U36B 1ZS8A 4L8DB 1QSFE 2FH8A 4RSVA 3QUXC 4LEOB 4WV1C 2H2PD 2HYMA 3IS0X 3BZ4A 1NKOA 2EIBA 3C6SA 5CAYB 5IVOA 2BVQA 4XBGA 1IEBB 3B9KC 3D2UA 1AY1L 2FECL 2R0LL 3VFVA 2O61A 1RJLB 5DMIH 3EYSL 3T4AB 2XT1B 3ARDC 1NFIA 3B2UD 4K55A 5DA0B 1XCQA 1QNZL 5AUMA 3RWGA 1M71B 1TQBB 1CDIA 3MOAL 1Q94B 1YECL 3FO0H 4JCMA 5ID0A 4LOUC 4YGAB 5E2VH 4F7MB 4TOYH 4KHTH 3EOYG 1RIUL 5L2KB 5KZCB 4R7DB 4GG6F 1CG9B 1LD9B 3FO9B 2PYED 5GHWL 1OCWH 1CQKA 5DI8A 1N2RA 3DSFL 3H3BC 1NAML 4XC1H 1XR9A 1P69B 2ZSWB 4JFOB 4NRZB 5IIEB 5CJOH 1A7PH 5E99H 3BP4B 3QFJA 1JPFB 2EEBA 2OJZL 4GAGH 2VLJE 1KIQB 5KSUB 4HIEB 1IMHC 2F8VA 1MJ8L 3T2NL 1N4XH 1HHJB 4KKBC 4M6NH 4GAJH 1FCGA 1I1FA 3TEUA 4L9LC 4YDIL 5D1XC 3RWCA 1WAAE 2VR5A 3U30C 5EZOL 4LSRL 3M8OH 1WTGT 4A6YL 3C08L 2ZG2A 3GRWL 5C0IB 4LKCA 4ISVA 3IAPA 2CLVB 1QBBA 3QDMA 4QXTB 3WFEL 4F3FA 2KPNA 3S3JA 5C1MB 4X80H 4I77L 3RUGB 3JTTA 3S7GA 1TPXC 3UTQA 1EH9A 4MMZC 1ZSDA 1RJCA 3GSNA 1CTOA 3MMEA 2DQUL 2B39A 4L3EB 3BO8A 4DZ8B 4TUOA 5AZEH 1F90H 2R15A 5B22A 2CK0H 1XGTB 4OZGE 4K9EC 2L0DA 3JSSA 3MV11 4ZTOL 2X6MA 4LIQE 5DHVB 1U8LB 3CFIC 2VDPH 1KIUA 2ZPKL 1U8KA 5IBLC 3KVQA 3LKQA 1HHHB 4HKZA 4XP9H 3BQUC 4URTB 1J8HD 3EFFB 5FIEA 3CFDB 3GBMH 5J4MA 2X7LA 2HJKA 1BLNA 1MRFL 4HUXB 3BPCA 4XMKL 1FVEA 1U8OB 5JNYB 2F8XC 1TQCB 2R4RL 4S2SB 3Q5TA 3H3PH 4KKLD 2QSCH 4U3CA 5H2BB 5BS0D 1J0ZA 4XNYL 3CFEB 4PJBB 3BN9D 2ITCB 3CPLB 3KPRB 5KSBA 5DZLA 1Q9WB 3Q3GA 4YPGB 1X5LA 4RIRA 2WQ8A 4X99B 1V5JA 5EA0H 4FA8A 3PGCA 4OM1H 1P84K 2NXZD 4HX1B 1MRDL 4L8CA 4MNHB 1UWGL 2WP3O 1WZ1H 4OUUB 4Y88A 3VXRB 3RAJH 1AE6L 4GXUN 4GBXC 4XMLL 4OZIA 3OAUH 3SDXF 2FR4A 4FQLH 3BAEH 1MQ8A 3U7YH 2E6PA 1IAIL 4HLJA 4X98A 3N85L 1HWHB 4PGJA 4XBPA 1SM3L 3LIZH 3A67L 1R24A 3ILQD 2AQ2A 4WWKD 1ZGLM 1MCEA 5CD3A 3J7HA 4H20L 3ZTJG 5E8NA 1HH9B 3AMLA 4R4FH 1KB5B 5GRWA 1D3CA 2EDLA 1EEZB 2H3NA 1N6QL 5I1CH 4AL8H 4DUWA 1JWMA 4K2UH 1G7PB 2FX7H 5FUCE 4RZCB 5DR5L 2NX5E 3IFNH 2X4RA 1RU9H 1A4JA 3P0YH 4IS6A 5JOPE 1IGYB 4JHAL 4G9DB 1WITA 3OMZA 5KS9E 2PYEB 3UPCA 1B6DA 1FFRA 4QXUH 4B50A 3QR2A 1G0XA 2V2XB 4YZFF 4M8QB 1KNOB 1S7VB 3HRZB 1AQKH 1SVZA 5BQ7B 1BEYH 4N5ED 1MFDH 1MWAL 3QPQD 4QRUB 3TPKA 5F6IC 1YMMD 4EUPA 4CU7A 5BJTB 4GG6B 5IB4B 1PBYA 3N1GC 2DRUA 4JO3L 3TO4C 2J8HA 3IRPX 2YS4A 4PB0L 2WQRA 3CNKA 5DFWH 2W91A 3LQZB 4PJFA 3MA9L 3S4SA 1UACL 1B2WL 1GPOL 4BH8B 1BQSA 3UTPD 1S7QB 1SBBA 4NC2B 3NFSL 4UV7L 3WSQH 1DUZB 1RPQA 1Q9KA 2P7TA 3QSKB 4S1DC 4NNPH 2WK2A 2XN9D 1A3QA 3AROA 3JV4B 1KCSL 2AV1A 1JNNL 4PGBB 1A6TB 1CFBA 4W6WB 3D25A 5TH2B 3SGEH 4IJ3C 1FGVL 1RUKL 1ITBB 4Q58C 3S5LG 4NNXB 3DV6A 4Y0GA 2PTTA 3LDBB 4JRXD 3T0EC 4P2RE 3R8BB 3MRKB 4G8GD 4O5LL 1ZVHA 3KJ4B 4FQXB 1JUFA 4AENB 2YRPA 1QZ1A 2C9AA 4JR9L 5E24E 4ODTH 3CH1B 4XP4H 1P9MC 4R3SB 5KOVC 4I48B 5DLMH 4LLVA 4GG8A 1GHFL 1I7RB 2VXQH 5DJDB 2IG2L 3HZVA 1BM3H 1GIGL 1W0VA 4FFZL 1U8JA 1JHLH 3C8HA 4S0TD 1J8HB 5EPMB 3OKNB 3OKOA 2NXZC 3WFZA 5CZVH 1MFBH 1OAQH 5CGTA 4QCIA 4YDKH 3QUXA 1FIGL 4DVRH 4WV1A 5BRZA 2EDWA 3HNVL 2VISA 3L3HA 5J7CC 5ABDE 4WU5A 3W11D 2EC9U 5EU5A 5BS0B 2BSRB 3B9KA 3L9RB 4UTAL 4Z7WA 3C2AL 1IEAB 5IIEA 1I7ZA 2VABB 4UQ3B 1A7NH 3BP4A 4Z0BH 4DKEH 3ROLB 2AI0L 4PRIB 3VWKA 5HHPA 4ONFH 4NQSA 3ARDA 1DQMH 2CR3A 3WE6A 4M03A 4FNLH 5HGBB 2WWKO 4UT6H 2NXZB 3M17A 2P5ED 3GSNH 1FL6B 5GZOD 2ICWA 2GKIA 4I0CC 3QUML 1HYRC 2EYSA 2KL6A 3NCMA 2FJHB 5D7LA 4LHQB 3MJ8B 3UTTA 1KCLA 3MV7A 3DURB 4LDEB 3SJVD 1X5HA 4YBQD 5B38A 3S88H 3FT2B 2Y06H 3DBXB 4LLUA 2BXZA 1B6UA 1LP9E 3G6AA 3SBWC 1BWMA 2WANA 5KBNC 4U1LB 3O6LL 3MACH 4RAHA 2CLRA 1DJSA 5CINL 2Z92A 3T3PE 4WWKB 2OTWA 3BIBX 3T4YA 4OCSL 4D0BB 3O0RL 2GJ6A 4L9LA 5D1XA 4WW1B 3C5ZD 3SDXB 3O3EB 2CQVA 4M6MH 3MC0A 1MFNA 5C09D 1R3HA 4O9HH 5C0BD 4LK4A 5DRWA 2VDLH 5KVEH 5IMOA 1A3RH 2BZDA 1T2QL 1D9KD 4R4BB 3GBNL 4XXCC 3O8XD 3PHQB 3ZKNC 4N9GB 2ESVE 2UWEF 3S34L 1UM4L 4HIXL 4XHJC 3TJHD 2HFEA 1OLZA 3DVGB 5HVHC 3B8YA 2QKIA 2WIMA 3UBXI 5GGRA 3CX2A 1XMWA 1DEDA 4P2QD 4PJGA 4ODUA 2BDNH 3C60C 1MNUL 2GT9A 2PCPA 1JHTB 1KIRB 3DRQA 4D9RD 5H2BA 4CMMA 1RZIA 5TPWH 5CZXC 5FO7A 5B3NA 3G6JA 1G6RL 1B0RB 4PB9H 5E4IA 3CFEA 3W9EA 5L88L 1I9JH 1YQ2A 3NCEB 3MA7B 1OVZA 5JDJA 4DN3H 4XZUB 2OR9H 4M1GH 3SGDI 1NMAL 2A6DA 2R2HA 1YMMB 3L3DA 2VZOA 1FL5B 1G7LB 5KG9A 2GJZB 1Y18B 3P11L 4LU5H 3BQUA 5HYJE 1C16B 3QNXA 5JA8B 25C8H 3DSNA 1MUJB 3HAEB 3QZWG 5J1TC 1FFPA 4GS7B 3HCVB 2NXYD 3PDGA 1KJ3L 4OQTA 2XN9B 4EI6B 3S35H 1RZFH 5DRNB 3MV9E 3Q48A 3NABL 1FAIL 1T83C 1UM5H 4OZHA 2ZCLL 3RGVC 3M07A 3VRLE 3PIQB 4YDLB 1OP5H 5EO9A 1T1XA 3LKRA 4QRRA 4WGVB 4I4WB 5FCUL 5I73B 3IXTA 2VXSL 3TBYA 3P4OA 1YNLL 3BP5B 1KIPB 4HPOH 4JVUA 4Y5YB 3DHJA 3WYRA 1H3UA 2MQCA 4JRXB 4DUVA 3OR7A 4G8GB 4U7MA 4FP8L 3GMRA 3ARYA 2EYTB 3QXTA 2GCYB 1L6XA 4ZTPH 3LY6A 4DGIL 1T0NB 3IJYA 3RWFA 1HXYA 5C0EA 2NR6D 2FO1A 5I8OL 1EUUA 5JPMB 2J1KA 3L7EB 3DGCR 1YC7A 1NFDF 4Z7NF 2ADIB 1CL7H 3QDGA 4GBXA 3VXOA 4M4RA 1Q0XH 3NN8A 1H3PL 3MLXL 4OF5A 1IAKA 1G7IB 4EVNA 4FQHB 1NEZA 4FFVC 1RQ5A 4FXGB 4EUPH 4EQ3A 5IOPA 3NMEA 2BRRH 4P4RB 2Z8VC 1GJIA 1Q1JL 4MXVF 5IMMA 4PJIF 2GJJA 3T3ME 2A83A 2HKHL 1FC1A 1ED3B 1KBGL 4I3SH 1EZVX 1M7DB 1R5VB 4YHNA 1JGUL 3HRZA 4FG6C 4TNVF 1GGCL 2IANE 5CHNA 3VH8A 3PWPD 4S10A 4ZNEA 3UTSE 4LVNB 4JKKA 4NRXB 2VLMD 1WUNT 3B5TA 4Y5XC 1PGRB 2VL5B 5DO2D 2MCPH 2QLVB 4NKMB 4Y19D 1T5WB 2L7UA 1VGKB 2XZCH 3QEUA 2P5EB 4RFEA 3G04A 2H41A 1FH5H 3KPSE 2R0WH 3IXAB 4Y1AD 1DBAH 3WEXA 4DUXA 3HPJA 2QHRL 4AH2A 5C0CE 4I9WE 1F4XL 1CLYH 5D9SB 4HMCA 2LVEA 3QT2A 3SJVB 5LGKA 3ARSA 2FWOA 4UDTA 1U58A 3GK8H 5C0AE 4KI5F 1MCNA 5IK3B 3JBG7 3MLTB 3ZT6A 5EC1A 4M00A 1FORL 1CD9B 3QI9C 3QUZD 4WTXA 3I6GA 1YEIH 2D9QB 4HXBH 2DQHL 4JPVL 4M93C 3TIDA 4ZFGL 2P43B 4NZDA 1HN1A 5DK2A 4RFOL 3TO4A 4UI2A 3ARGC 4WDIA 3C5ZB 4FTVA 2HMID 3K2MC 4YXKL 3NPSB 4M61A 5GSRB 4X6DF 3H7BB 4AZ8A 4KI5D 3R1GL 4QHNA 1A6UH 5C09B 1YN6B 4FQJH 5C0BB 2EE9A 3TWCL 1D9KB 4M1DH 2HH0H 3GNMH 3O8XB 3JV0A 4I48A 3AB0C 3TFKD 2IGFH 4M02A 1A9EA 1XAUA 3MJ7B 4Y4KD 4P2OC 4Q0XL 2E9JA 1S7SA 5F9JA 3CVHL 4KROD 4P2QB 3LD8B 1V7NL 3C8KA 2AP2A 2ILLA 1AR2A 3T0EA 1BVKA 5IB5A 5ESAA 1U95B 4K3DH 3STLA 4CKVX 4HUVA 4D3CH 2XI9A 2I24N 2UWEB 4YXLH 5FYLL 2HTLC 2KH2B 5D7SL 1OLLA 5F9DC 4X5LA 5ALBL 4NFCA 3UZEA 3LEVH 1G0DA 1IGTB 1QEWB 2JIXD 4ZFFB 2XY2A 4ORGA 1CDCA 1T5XA 1URLA 3AB0B 3GJEA 2R39A 1R5IA 5BRZE 5L2KE 3SDCD 4MB3A 1ZGLB 2QQKH 4QWWC 5HYSA 4J8RA 4XCNB 1A7QL 2EKSB 5DF0A 3HKFA 3HMWH 4YXHH 2NXYB 1YNTB 4JFED 5I1KH 1FIEA 2AXFA 1NDGB 3EYUH 4BQBA 4N0YH 4CU6A 2ZUSA 4X7SH 2NZ9D 2F5AH 1MOEA 1JPGA 1NUNB 1AXTL 1P6AB 5DHVH 4ZQKB 1C5CH 1YEDA 1IT9L 3U4BH 1GSMA 1FE8H 1U3JA 3HMXL 2X4OB 4XNXH 1JPSH 1S9XB 3REWB 3UTTE 2F15A 3QA3A 4Z7UF 4JLRB 5E9DA 1Q0YH 5CBAA 4ODWB 4U1GB 1IGML 2OSLA 2RCSH 1KT2B 1F4YL 3RUGE 4U6HB 3VRIB 4WFFD 5GGVL 4WFEE 1DN0A 2Y1VA 4QF1B 3DVIA 2EO1A 1SYSA 1JK8A 3R06A 4PP1C 3CCHB 5TE4L 4K9EH 2HLFC 4W81A 1CBVL 4MA8H 4IM8A 4L3EE 2AXJA 2VLKD 1RIVL 3CFJA 1FN4A 4LLQA 1F6LL 4XCCH 2APTA 2OL3A 3I2CH 4PTUB 5TDNB 5K9KA 4R8WL 1K5NA 2P8MA 3AC0A 2Z91B 3GSOB 4JFYA 5GRZA 1IM3A 1NBQA 3KXFA 2NQCA 4YHLL 1NFDB 3SE9H 3RVTC 1Y6MR 3AS2A 4MDIA 3BT2H 2R29H 5CWSA 3CAFA 5DS8A 3A6BL 4OQTH 5D71L 2MCG1 4L4VD 5EUOF 4C83A 3PWPB 1SBSL 4U6YB 1MCRA 3CC5B 4XXCA 4PJGE 4R26H 3VD4A 3QQ9C 2QSQA 3V9FA 3DOSA 3MRNA 1JFQH 5FFLA 4HW6A 4PJIB 1YYML 3GIVB 4Y19B 3E6HA 3SQOH 1JN6A 4C57C 3BRFA 5MERB 2V7HA 2AJ3A 4Y1AB 4Y4FC 4OIIH 8FABA 2WINA 4GAGL 5HHXH 3C60A 4PJBE 1JPTH 1J05A 1ITCA 1N4XL 3SDYL 4TTGA 3KPRE 1R6VA 5A2FA 3F5WB 5K9OB 1XF1A 4LIQL 4GKZB 5C6TL 3QJFB 4MS8D 4QRQB 2YD9A 3QUZB 4Q2ZA 1QRNA 1NL0H 3IU3B 3RNKB 4E41A 5J57B 1T89C 3BP7B 2WBJD 3ECBB 3W39B 2KDGA 4HPYH 4XXDB 1U42A 1FZJB 1Q9OB 2IQ9H 1CIUA 3ARFC 3OWEA 4EDXA 4K3JH 2OXGA 3UXFA 4RGMB 5EOTA 1F11B 1NCBH 1WC7A 1Q72H 3RGVA 4Y4KB 4NUJA 2FB4H 3Q0HA 2CD0A 3EO0B 3LPFA 3U0WL 1WIPA 4X6DB 1BQUA 1OTSD 4KROB 5B21A 3LN5A 4F7PB 1BFSA 3K1KC 4XCYB 1OAZL 4UQ2A 4JFZL 1R5WB 2DF3A 1X7QB 4KXZH 1C08B 2DD8H 4P5TD 2W0FB 1DBKH 1ED3A 4DEPB 5FECB 4NQCA 1QR4A 4R97C 4PV9A 5BZWA 1MVUA 3KYKL 1PY9A 1MEXH 1EMTH 1S9VB 2B2XL 2JIXB 4Y8AA 3VFNA 1KXTB 1INDL 4N8VA 4AIOA 3OGCA 3SDCB 1MCQA 1NC2A 2IJ0C 4D8PB 3HC4H 2XG4A 1GGIL 3FO1B 5I8EA 2B1AL 5CSBA 3BDYH 4DOHE 3LH2L 2VXTH 4LSTH 1VENA 1B0GA 2C5DC 5AWNL 1XGUB 4JFEB 5T5NG 4B53A 4RISL 5MEQB 3EYOB 4GG6E 1FG9C 4OLWH 4G7YL 4IRJC 2MHAA 4M9PA 2V2WB 2XACC 2DJUA 2BY2A 1NCDL 2ZG1A 4LSSL 4RMQA 5JO5B 2NMSA 2ICEB 4Y5XA 4MCYA 4MWFB 4OLZH 4H26B 4S11A 3V4PL 1NGYB 3K7UA 3OAZK 1DBBH 2YOCA 4HBCH 3O41B 2GHWB 5T3ZD 1FNGB 4KTDH 2C7UB 1U8QA 5E5RB 3JTSA 2GSGA 2WLZA 4EJ1C 5L9DH 1R3LB 2VLKB 3PWJA 3ZLQC 2KQNA 4Z7UB 2DQIH 1KTRL 4WI2A 5KVGH 4G8FA 1PQZA 4HCRA 4JHWH 5F1SA 1NLDH 5INDB 3GMNA 3EJZD 2V2TA 1KN4L 3QI9A 2BSSA 1JZ2A 4DN4L 3VGDA 3OKMA 1AIFA 1J0JA 3ARGA 1U95A 4OIBA 4IDLA 1CU4H 15C8L 4ZDHB 4IRZL 3SKMB 4L4VB 1F45A 2BVPA 2EZ0C 4JG0L 4JQIL 4ODVL 5HHVH 5SWSD 3VE0B 1J8HE 3GJFA 5I17A 1FZOA 5F44A 4J6RL 1A4KA 4ZUSB 2EDFA 1WFTA 2ARJQ 5B8CC 1NCTA 2IH3A 4P2OA 3AMKA 5I15H 4MNQD 4F8QA 4LSQL 5BS0E 1J1PH 1G7JB 1ZV5A 2A2QT 4G5ZH 1X4ZA 2JK5B 2APWA 1EEUA 4IOFD 1MFDL 5EUOB 5GRJL 4M8VA 4XNQA 2JCCB 4JREB 3JXAA 5CSZA 1Z2KA 12E8L 3ARVA 1U8IA 2XZQL 1NMCC 2O5YH 3IGAA 2H8PB 2VDOL 1KB9J 4OGZA 2J8OA 5IB2A 4KKNA 5AD0A 1MCWM 4X7FC 4TRPL 2I07B 2OL3H 2BCKB 1L6ZA 1K8DA 2WBJB 4RFNC 1KGCD 1T03L 1GVIA 5DD6A 3CDYA 1S5HA 3MLRH 3T77A 4OTXL 2XIDA 3IKCA 2P5WA 1MVFA 3O9WC 5FA3A 4WJ5A 2OR8A 2WWKT 3GSUA 4JY6B 3O2WL 2UZIH 4GUPA 4F9PC 5E9DE 4PTUA 5TDNA 2VSCA 3SDXE 2JB6B 5DK0A 5CGYD 5JDSA 5HD8C 3RL1B 1YEEH 3KPPB 3X3FH 1VFBB 3QXAA 2FECI 5FA4B 1AD9B 1YYLH 3LS4L 4OCLC 1T3FA 3JV6A 4JZOA 5D5MB 3DJ9A 1D6VL 3ZKMD 2EH8L 2FEDC 2VXQL 4P5TB 1GCFA 3LV3A 2IF7A 2W92A 4JB9L 2BK8A 4U0RC 3QWRD 3V7AG 1N0XL 1DLFH 5GRXG 2LAAA 3LEXA 3PWPA 3O3DB 4ZOAA 7FABH 4YHIA 4JKMA 1U92B 4M1CC 2J4WH 5F6HI 3VD3A 1RV6X 3MUY1 1NMBL 3IDGB 5C08D 2GITB 2YWYA 5I76A 3WNLA 2FO4A 3DUSA 3KPMA 1CYGA 1RZKL 3W2DL 2G60H 1NGZB 3O2DA 4QY8A 3BUYB 5EZJA 1NEUA 5FK9A 3RTQD 2FHCA 4DGYH 1RMFH 1YMME 5T1DH 1ZHKB 1A5FL 4GW5A 1BAFH 2G9HB 4FNLL 4AT6A 2NY1C 1AC0A 3MBEC 3BXNA 1MRCH 2IALA 1MCHA 4YZFE 2X1PA 3UTPE 4RQQA 1UCTA 5FO9A 1K9TA 2XNAB 1PYWB 4CDGC 4OI7A 3X14B 2XN9E 4FABH 3N9GL 2ICWJ 5MP6H 2YD8A 4HUWB 4Y4HD 2ITDA 1C5BH 3V52L 4Y4FA 2Q1EA 4WI6A 1RZ7H 1DQDH 3G9AB 4PG9A 2D4FA 5FF6A 2VLLB 3QCVL 4PJ9D 3HI6L 1VA9A 1XH3A 4HC1L 4PY7B 4JRXE 5JPNB 1K8IA 1U8HA 3RKDD 3FCTB 4G8GE 2A74B 2XY1A 1TZIA 4UMGA 1VFAA 3PDOA 1AKJD 2VDLL 3T09A 1H0DB 5CILL 5T3XD 3RL2B 4RBPK 4HAFA 4UU9B 1T89A 3N1MC 2LTQB 4LCWD 5GIRB 1IRAY 1TDQA 4I2XA 2H6PA 5BV7C 4UTBH 1ZT1B 2XFXB 5SWSB 1TFHA 3ARFA 3QG7H 4M3JA 4HULB 3LS5H 3NACH 5F3BA 2J5LC 3RWHA 3HAEG 1ZLUH 3L3JB 5EN2B 5EZLA 3D3VD 4MZ2A 5DGQA 1LHZA 4YGVA 5HI4C 3DYPA 2F58L 5E5UB 3SDDD 4NQTA 4MNQB 5I1JL 4PJAF 4ZUWA 2QL1A 2Q87A 4K3GA 5C70A 4XWGL 4J3VA 1A9BA 1ZA3B 1AP2B 2FJGA 2UUDH 2PW2A 4ENEC 4DN3L 4ELKB 2HLAB 3MOQA 1MI5D 5E1AA 5ESQB 1P4LA 5BV7B 2Z0BA 2H2SD 3QG6B 4LBEA 3ZZ1A 1NCCH 3MNVA 3GO1L 2P5EE 4NFBA 3S96A 2K7QA 1U8MB 5HGHA 4NZJA 5T1KD 5IEKA 4LARL 3PE9A 5EO0A 3HLAA 4HCRH 3ULUC 4NQXB 4BQ8A 5MI0C 5H94A 2H9GA 4Z7VF 1OB1B 3SJVE 3BGAA 4HWEL 4LASH 4XVSH 1II4E 1UT9A 1CDYA 4OF3A 2RGSA 4ODBD 2OI9C 3VRJA 4QYOB 1IAII 2VKXA 1YEFH 3ZE2F 4GLRH 2D7TL 5DA4A 5DHYB 5DC4B 1I8IB 1ROWA 1AO7A 1BGXH 5JMRA 1R3LA 3OG6B 1WK0A 4IRJA 2EH7H 1T6VN 3S9DB 2DBLH 3GJFH 4WCYH 1NSNH 3T2QA 1XGRA 4FFYH 3IDMA 5IESH 3MUGB 3H42H 3IJSB 5C09E 5F1KC 5C0BE 3OXSB 4GRLD 5F1NB 1AD0B 4YHMH 1MHHB 4PJDF 5DVLA 3P9LA 3DLQR 4KTEH 4PJ8D 1T0MB 2Z93A 1ZE3C 1CFNA 1EEQA 2AXGB 4LNRB 2DQEH 3KYOA 3TVMC 4PR5A 1CQYA 1IQDB 4N8CH 4NRYA 1QA9A 3OKDA 3TBSB 1IAIM 4P2QE 3ZE0E 5DHXB 1NC4D 3U9UB 5FEBA 3O6FA 1YC8A 5ALCH 1IL1A 3BE1H 1DBML 2BOCB 4XCEB 5C08B 1DVFB 5CBEA 4D9RE 5JOEA 4NHCH 5DD3L 5LGJA 3LKNB 1KLUA 2ZOLB 2JK5A 2NY7H 1OWRM 1TTFA 4MQXC 1CFVL 4GW4B 4M9OA 2FBJH 5CMAA 2IMMA 3WFDL 2XWBB 3RTQB 1NUGA 2OTUA 4LP5A 2JCCA 1UB6B 2MQ0A 4JZNA 3HE7D 2IH1B 3MLPA 1CGSH 3KLDA 4NQVB 2EIEA 2HRPH 5I16A 4LKXB 2F54A 4X6CF 1LVEA 2DQCL 4X4YB 4HMEA 2YA2A 2OYPA 5EIIA 2FDBP 4J4PD 2Z35B 5DD1L 4NC1C 4G9FA 3AU1A 5B8CA 5LKNA 3FT3A 2H1PL 5EU4B 4BKLA 1S78C 1ZA6B 4G6AD 4Y4HB 4JZJB 1F13A 5A2KH 2IAMC 4PJ9B 5C2BH 4GSDL 4X7DC 2PYFA 5K9JL 4LSVH 2BJMH 1EV2E 5SWQB 3MRLA 3BKCL 3O45A 4AM0B 1M1SA 5HJ3A 1A47A 1AKJB 3K2UL 1ZHNB 3BKYH 4NM8L 4MJ5A 4PRDB 5GGQH 4UDUB 2DLIA 2HH0L 1VEPA 3HFMH 3TYFA 5IVNA 4LCWB 5D5MA 5F7NC 5EWIL 1MPAH 1TLKA 2PETA 3O2DH 3QO1A 4QHKI 4FFWD 5DJ8A 5FM5M 3WKNA 2P24A 4NN6C 1GGBH 3S37H 3O9WA 3VXNA 1N59B 3V5HB 4NN5B 3VG0H 3V95A 3D3VB 3RDTD 3QHFH 1N8ZA 4OZ4A 4M48H 1NFDE 3SDDB 1O7SA 4Z7NE 4HDIA 4F9PA 4JDZB 4AIZA 4MD4B 4U6XA 5DJCB 4BZ2L 4V1DA 2YEZB 5J1SC 2ZUWA 1ND0B 3IFOB 4FZEH 1YY9D 2W65A 5T5FH 1J87A 4DQOH 3PHSA 4OLXL 2HFFB 1MI5B 2QTEA 3PWPE 1T0PB 3QXUA 1FNLA 4RWHA 2X4UA 5IJVB 2VLME 2ATKB 4QTHA 4MDJA 1GH7A 4LNVA 4LQFH 4MXVE 4PRPA 5ACZB 4PJIE 3HG1A 4PREB 1HKFA 4Y19E 5IHLB 4PJAB 1DTUA 1UKTA 2OBGA 2M8XA 1E4WL 5T1KB 1HINH 3HNTH 4YXHL 2X1OA 2Y7QA 4Y1AE 1A3LH 5GRUL 4KHXL 2R1YB 2D31A 1Z9SA 1RZ8B 2CKBB 4H8WC 4GAYA 3EOBA 5IFJA 5CP7B 3CLFH 1B0WA 3UTZA 3QWOA 1RK1B 4JQVC 1IC7H 2XKUA 3QEHB 3VCLA 4PGZA 1C5CL 3B6SA 3L1OL 4M7LL 4PS4L 4KVCL 2ZJSH 3PWLB 3MYJB 1VPOH 1FE8L 5IW3A 3MRGA 3QUKA 1A1MB 5IF0B 2QR0B 4M62H 1NDMA 3GSVB 3FQTB 1F58L 4RGOL 3KDMA 5J12B 3FO2A 1Q0YL 4Z7VB 1INEL 2ZOKB 3MBEA 3QDJD 2P8LA 4OB5H 1NLBH 5IQ9A 4HUMB 2PO6D 4YHZH 4KI5E 4LLDA 5DK3A 3TPUA 4WFHD 4RWYH 3CDFA 5F96H 3RWJA 4GRLB 5FOJA 5E6IC 1LNUA 5DJAB 5J11B 5C0GA 4WU7A 3I3DA 1HCVA 3O4LD 4PJ8B 5HDQH 2D4DA 2ZSVB 3C9NA 4XCCL 3BPOB 1CGTA 2EDJA 4TQEL 3TNNA 1B4RA 4XPTH 5E8PB 4R6UA 5DYOA 5BXFB 1I3GH 4X6DE 5TDOB 4NO2B 3KNBB 4EQ2A 4KRMB 1TETH 1NC4B 3G5ZA 4HV8B 5I6XC 5JA9A 1INQB 1JZ5A 1UZ8A 3W5MA 1LO3L 1C5DB 4PJDB 3I6LD 2XA8H 3KAAA 4NYLB 5I1LB 1YEJL 3DYMA 2ED8A 3BZDA 1CDHA 1HE7A 2GQHA 1YJDL 4BJLA 5DJYA 5C0ND 4DVBB 2A73B 4MSWA 1RZGA 5IR1B 2X89D 1I8KA 3HE7B 4OCWH 1PD6A 1JFQL 4HEPG 4WI7A 1UB5A 1PKOA 2V5SA 2BVEA 2Z8WC 2BNQD 5DDHB 3HZYA 4K3EL 2VQ1B 1LE5B 5EOQH 1R3IH 3HNSH 3E2HC 5DC9B 3EJJX 2CH8A 1MCOH 2D03L 3MCKA 2DICA 1LK2B 3CFCH 3DTXB 3T2OA 4LLWB 2Q3AA 1CFTA 4Z77B 1PFCA 4IOSD 4XP1L 2E6JA 4I3RH 2Y9RT 4FQPA 4JFEE 2FCBA 2YPLD 4PGEB 4OZFB 2VC2L 4N90D 4F7TA 1QBLL 4G8EB 1GC1C 1KB5L 2XPGA 1KXVC 4MA3A 5HYQA 5J9PB 3UAJC 5CCKL 2G5RA 3GSXA 3P30H 1MIMH 1JI2A 1BREA 1VKXA 4PJEF 4CJ0A 5IEHA 1NL0L 4LVOB 5CD5D 1IC1A 3BGMA 4O2FA 2AJXH 1BZ7B 4F80A 5FB8B 2FGWH 4NZUH 2FJFA 4UIMA 1UQSA 1S5IL 4NKDA 1RJZB 3S36H 4WFFE 5GJSH 3VFTB 4Y5VC 4B41A 1LO2H 4L3AA 5CJQL 3DI2B 2VLKE 3CUPB 3MO1A 5CEXA 3OPZL 4Z7UE 4HUUA 2FIRT 4OD3L 3P4LA 5FYKH 4Y2DD 1KC5H 3O2VL 1IEHA 4ZPTA 1WICA 4HIHB 1RJYA 3RDTB 3S97C 1ADQA 3MRHB 1SJEA 4TSCH 4K07A 1KCRL 1T2XA 4NQDD 3EFDH 4Z0XA 4RAVA 2DD8L 1ETZA 1E6OL 4KQ4L 1JF1A 2H32B 5E5MA 5C9JB 5EC2A 4L4VE 1IM9D 3NZ8B 5K59F 1BF8A 1TCRB 3GMPB 4WHTB 3GKWL 2ORBH 1UB6A 4UNUA 5BVPH 6FABH 2VZVA 1MJUL 5E2TL 3WNMA 4UT9H 2Q6WA 1P7QA 4O4YL 3DMMD 1QKZH 3TVMA 1CICC 1Y0LA 2P46B 4LDOB 4MZ3A 3ULVF 3IETB 3L7FB 5EUOE 4PP2B 3CSPA 3QDHA 3WV0A 1BP3B 2JCCE 3LMJH 1F4WL 1HIML 1V7MH 3OR6A 4TUKL 4W68A 4EIGB 4X5XB 3VFRA 2WSKA 4QTIH 2AW2A 1LDPL 2C1OA 2Q7NA 3NVQA 3UROR 5FDYA 3S98A 1VADB 2CMRL 3ULVD 1JL8A 5JHDA 3DIFB 2RR3A 4Z6AT 1UXSA 1FFOB 1L4IA 4LDLB 5DVNA 4KKCD 1SJHB 3RRQA 3DXAA 4HBCL 3QDJB 5LWYH 4XWOC 4F58H 3FN3A 1XZ0A 2PO6B 1M05A 3T1FA 1PX4A 1LEGA 1MCBA 3JWDC 3WFBH 4KTDL 4HGMA 3L3IB 4CADB 4YEEA 4O58H 5L9DL 2V5RA 3O4LB 5I75C 3ES6B 5GGUA 1RUPH 3P73A 1EAPA 5KVGL 4F57H 1MCFA 2VDNH 4OF7A 3VFUA 4H25B 5AYUH 4FQQA 4TVPH 4JHWL 5F7DB 2R2EB 3C09C 1M6OA 3C5SA 4L5FH 2P8PB 2IAMA 4ZS7L 32C2B 3F8UB 4C4KT 1RSFA 1JRHH 4YH6A 1NCAL 3H7LA 2J3SA 1SMOA 2A9NH 1OGAD 3KWWA 4WEBH 4WTZA 5D5ME 2W9DL 3LRGA 4UUJA 3WHE0 1MIEL 1RK0B 2N4IA 5FHBH 3CH8A 2G75A 2WLYA 1A7RL 4MAUL 3RPIA 2XKSA 3NZHH 1FPTL 4UBDC 5D1QD 3D9AL 3DX8A 3LPGA 1S3KH 3NA9L 2OK0L 1D5MB 2BNQB 4OFVA 4GH7B 4L8SC 2HJLA 2VE6B 1JV5A 4ZOEA 4PJXA 4PRAA 2X9XA 3DVFA 3RVXD 1ONQB 2NW2A 1BX2A 5IVXF 2YPLB 1T04A 1OF2B 1AHWB 1RZ8A 4YBLB 1CT8B 4GW1A 5DGRA 4DTGL 5FOBB 3MSPA 5MEND 1KPUA 1JGVL 5HHOD 3ZT5A 2OP4H 3PGFH 4LF3A 2ADGB 4JFDD 1IGJA 4Y7MA 4YHOH 2Z9TA 3LN4A 2NCMA 4OFKA 2N56A 2CRMA 2XZAL 4MD0A 4Q9CA 3LQAC 3TYGH 1MCDA 5IG7B 1GZPA 2PR4H 4JRYD 3OGOE 3HI5L 2COQA 5T3ZE 5J6GA 3OKLA 1QYGH 2EDNA 4PJEB 1CE6A 2XKNA 5DD0L 3GGWB 3JVGC 3H9HB 3CD4A 1IGCH 3RP1A 4QRPA 2NY2C 4EOWL 4KFZC 2DQJL 4Y2DB 5EBWA 3MRRB 1OP3H 3X3FL 5GZND 5BOPA 3Q6GH 4GRMB 3JUZA 2NY4C 4Z95L 1ZLVK 1CFSA 1NJ9B 2EDTA 3BWAB 3T0BA 4NQDB 1EGJA 3Q5OA 1KACB 1CD0A 5E6ZA 3FQWB 3LKOB 3U7WH 4YHKL 2IBZX 4P3CH 5SWSE 4WO4D 1MJJB 1BD2D 4HGWB 2DM4A 2HWZH 1JNHA 4LSUH 5E6IA 5I74C 4X83A 2ZCHH 3FB6B 3MJ9A 2GFBA 5IR1A 2CPCA 3GMOA 4P23C 1NUDA 1IC4L 2EE3A 4HS6A 2ZG3A 4MJIA 3P0VL 3DMMB 4FQ1L 2L4OA 3LCYA 4MNQE 1GYAA 1MCLA 3TZVD 3VU2A 4NQEA 1DQJB 1I85C 1WBZB 4XGZB 1BIIA 1IGFL 4UB0H 1V3LA 1N3NA 3BHBB 4U1SA 2A6IA 3V6FA 5LGHL 1L9MA 1GZQA 3L3OB 4JO4L 2BX5A 2X4SB 3ULUH 1ZT4A 3FB7B 4OLUH 4LVHB 5FYJH 1K4CB 3D39D 4Z78B 2CRYA 4K8RD 4OLYL 3SE3C 1MAJA 4X9FA 4XRCA 1KGCE 2ADJB 4QGTA 4GMSL 4S1RH 3C5JB 5JORA 2Y36L 1ADQH 3RWEB 5I9QC 1ZXQA 1OM3L 2A6JB 4XP5L 4OCRH 2EICA 3TIEB 2VDQL 5DURD 2WWMC 5FDWA 1EHLH 1ORSA 3WFHB 2QSVA 2DLHA 5IQ7H 5FYKU 3WIIH 3KPNB 5GJTL 1YPZF 2HTKD 2AGJL 3ZL4H 3H0TA 4RAUA 2EEAA 4PD4J 4PGDA 1OGAB 2DLFH 3DROA 1H5BC 5FYJE 1U91A 4UTBL 2JJWA 3OHXB 2BFVL 4MVBD 4NP4L 4O02L 1JYWA 3IDYB 1ZWIA 1T1ZA 3HA0A 4EI5D 3FOLB 3NACL 1KENL 3KJ6H 3LKPA 2UYLA 5D1QB 1FBIH 5D70H 4Y5VA 4CVXA 2DQDH 3LRSB 3FZUD 2O5XL 1W2KT 3IAQA 3SY0B 1LEKB 3RQ3A 3WNPA 1R3JB 2IPTL 3AM8C 5C08E 3G5YB 4WUUD 3RVVC 2QQLL 2Z31D 4G7VH 4G6KL 1KEML 2YZ8A 5SX5H 3T0VA 3MBXL 3QIBD 3BEWA 3LB6C 2FX8L 5TFSL 1CWVA 3RWIB 4LVEA 5D2LF 4IMLB 3ZHLA 5MENB 1ZOXA 2IQAB 5F9OH 4U1MB 4JO1L 5HHOB 4HFWA 2D7QA 4JFDB 4PJ5D 4U05A 5GZNC 1HHIB 3QULA 4CVUA 5D1ZC 4HS3A 3V6ZB 5IVXB 5FO8A 2XZZA 5IV2A 4MB4A 4G6MH 4UOW0 1K4DA 5JHLH 4L1DA 3F62A 1EAJA 3FN0H 1CFQB 1CICA 1BQLH 1Z5LB 5ACLA 4JAMB 4M6OL 4ZO9A 4JRYB 5L2JA 1JYXA 4GQ9L 3UX9B 4F2MA 1HZHH 2VITA 5IMLB 5H37H 1GRWA 4XAKD 1MCWW 4HH8A 1CIDA 3V5KA 43CAA 2ERJB 1HQ4B 5F88B 4HK3J 3BW9A 5AEAA 3VMOA 1I7UB 5ETUA 4PGCA 3W0WA 1ACZA 1D6EA 1G84A 3H42L 5ELIA 1PW3A 3CDGB 1UWEH 2XQYK 5GRVK 2V9QA 2H26A 4XTRC 5T3XE 5F7EL 4YHML 2W0LA 3VGFA 2EE6A 4LPYA 3TN0C 4ZUVA 4LCWE 5F70A 2DQEL 3THMH 4U6VH 1UKSA 1KYOK 4WO4B 2VIRB 5ANMA 4QXGL 4LPXA 4XBEH 1BD2B 4NZRH 3V4VH 1OOAA 4UAOC 4OKDA 1WT5C 3D3VE 4HT1L 2VUYA 1CZ8L 4NJ9H 1D5MA 1RUAH 2APFA 4KGJA 2EDHA 3QJHA 3WLWC 3VGEA 2DQTL 3VFGH 4CN4A 3TZVB 2GY5A 3WO3B 1NGQH 4D2NA 2FBJL 2W38A 1AGFB 3IFPA 1MI5E 3NFPA 3CLEH 4R96A 1JVKA 3ALXA 4Q9RL 3EOAA 2CIKB 1AC6A 3HC3H 2F74A 4K7FA 4PRBB 1I3VA 1W72B 1QR1A 3W5NA 3RKPA 3BP6B 1XR8B 2O5ZL 4X7TB 4PJAE 4M7LT 3WD5L 5LCVH 1I3RA 4H8WH 4PJXE 3L5XL 1F3JB 3D39B 3KPQA 3HZKA 4HXAH 1U93B 4CVZB 3P4MB 2DYPD 1OPGL 1Q9LA 1U3HC 4FXKA 4GXUM 1DL7L 4L8SA 4XPHH 1I9IL 5DJ0A 2AKRA 1EEYA 5GGVY 4MQ7B 3QQ4A 3F58L 3RVWD 1MFCH 1MAML 3H9SA 4KQ3L 5DFVC 1EGJH 5KAQF 5H35B 4AQ1B 3RI5K 5DURB 4J12A 4P57A 2VN4A 3WO4C 3QUYC 4OQ1A 1UH2A 5FKAA 3VMNA 4JPWL 2OZ4L 3OJDA 3STZA 1UJTA 1GGUA 1MHEA 3E1F1 4Z7VE 1QFOA 4XNZB 1OY3B 3MJ9H 4H0HB 3T65A 3ZE2E 1HKLH 4O2CB 4ZMAT 1MPAL 3UJTL 1JE6A 1ZVSA 4ZS6C 4FQIL 5DUMH 1KTLB 4EI5B 3U6RA 1HYSD 4OLVL 3GHEH 4U1KB 5LQBH 1VACB 1IM9A 3NFNA 1MREL 5DMGD 1YPZB 1DQLH 1EJOL 3PV6B 2J8UF 3U82B 3JVGA 1N7MH 1E4JA 4M48L 3IFLH 3FQUB 1QVOB 1UYWL 3EGSA 1SY6A 4PJDE 5B39B 3MGTA 4EDWL 4WUUB 1BWWA 2Z31B 5I8CA 1BFOB 5KSVB 3GUTA 2XWJA 3BESR 1K85A 3PL6D 3CGTA 5EU6D 3QIBB 1KEGL 1QSED 1OHQA 3GB7B