1XAUA

Structure of the btla ectodomain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
CEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords B- and T-lymphocyte attenuator
publication title Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xauA00
1F6FB 3SDXA 1UWXK 3KLHC 2AJVL 3U2SA 1FZKA 5GS2H 3MCG1 3GSVB 2ZPKL 4W4NA 5I66B 2DLTA 4LNRB 1FAIL 3HPLA 1KJ2B 4GG8B 1NAMH 3T2NL 4MJ6B 3P4LA 1R5WA 4MCYA 2X4QA 5J12C 5CKAA 1RUQL 4NJAL 3D69B 4PREB 1DBKH 3IAPA 4WFHE 1JUFA 3V7AG 4JGUA 5C0BB 5EWIL 4Y5VA 2KUTA 3VI3E 5KSBF 3K1KC 2WNGA 2N56A 3IDYC 3OKOA 1U92B 4D8PA 1R6VA 3EYSL 4QTHB 3T3MF 4I0PD 5EU5B 5GSRB 2MKLC 1A14L 3V2AR 5IESL 4ELME 5D2NC 5T5FH 1D6VH 1FNEB 3VGBA 3DX8A 1DQMH 3G5VA 3GK8L 3MV8D 2PKDA 9CGTA 1L4IA 3WJJC 2F54D 2CH8A 3TO4D 3LKOB 2ESVE 3SEPA 2APWA 4L4VE 1OB1A 2Q7NA 4MNGA 2FX7H 4PRHE 4XNUH 1FVDA 4G43A 1Q38A 5DRZB 4QF1B 5E1HB 3O0RL 4K07A 2OS7A 4HS3A 4HD9A 4W6YB 4HGKC 1U95B 1WWAX 4R7DB 5HHPA 3FB6B 4NZTH 4YHYC 1G7MA 1QFOA 4Z7VA 3NZ8B 5DMKA 2DTMH 3DVGB 4FFZH 3FQTB 5E2WL 4KFZC 1UGNA 2AEQL 4G8EA 5AUMA 1RULL 1UCTA 4Q6IB 1A4KB 3HAEH 4JQXC 4M6OH 5DRNB 5EBWA 3T09A 5F7HA 5JIPA 5J11B 4S1RL 1QP1A 3VFGH 3ZE2E 5B3JE 5CHNA 5C0IB 4L1DA 4X80H 5IW1A 1BX2B 1ZSDB 1CFSB 5ID1A 1LQSR 4JKMA 5I18H 3BZ4B 2F5AL 1FYTD 5FYJE 3KS0H 5K9QI 4ZFOA 3BHBA 2ZUWA 3OJMB 1XFPA 4M61B 1OGTA 4O00A 5FAAA 5FYLL 5IEKA 2ID5A 3FQUA 3B2UD 4L8BA 3OXRB 4LKXB 5F96H 2R0LL 5D1ZC 3ZYIA 1T3FB 3L5XH 4NDMB 1WK0A 4WFGE 1JN6A 1NFDF 4GG6B 5KVFL 4Z7NF 1MWAL 4IOFD 1S9WA 1FL6A 4O4YL 4QHLB 1NBZA 2ZUXA 3FHAA 4LCIH 5DQDL 5HYEA 4XC1H 5DO2D 3VXMB 1K4CA 1NAMA 2DM4A 2E27L 1JZ8A 3STZB 1NC4A 4NO3A 3U6RB 5AAMA 2VC2L 1QR4A 4PRIB 4P2OB 1CYGA 3ARFC 1MREL 3MYJA 4YHPA 3W39A 4GAGH 5D2NE 1JGDA 1CD1A 5CBEA 1PSKH 1ORSB 4NZRL 5DI8A 4WUKL 4PJHA 5EFIB 4WO4C 2JLLA 2OL3H 3IDXL 5KANI 4XP5L 2P5EB 1PG7H 5IB4A 4KK6C 3QUYD 3DOSA 4M1GL 3QIUA 5TPWL 2QBWA 1A6UL 1XGRB 3SJVD 2FBJL 5HYJD 3FOMA 4PGCA 5I1EH 3ARGB 4TSCL 1A3LH 1ETZB 2BJMH 4XCEA 3S5LG 4JO1L 1J1OH 2BNUB 3W0WE 1DBBL 1QSFE 1EX0A 3D3VA 4RFEA 3QFJE 5E8EB 3T8XB 2ZKHH 4PIRF 4HK0A 4ZS6D 4JG1L 1Z0NA 3QH3B 3TNNB 4TVPH 4F7TB 2ITDA 4TPRL 5DRWA 3QDGB 4N0UE 5D2LF 3RIFF 5TH2B 4LAJH 5LWYH 3UTSE 1DL7H 3C5JB 5I1CH 3IXAB 3PP4L 1K8IB 1II4E 2BVOA 3NIGF 1X5LA 3HAEA 4TOYL 4UINL 4ZUTA 4QT5B 4I0PC 1EPFA 1YY8B 4JM2C 1K8DA 5IHZA 5DR5H 5T1DL 2VLRD 3IGAA 5HXMA 4I3GA 5SWZB 2AVGA 2G9HA 4NCDA 3T1FA 2XNAA 4M00A 4L3EB 5GGRB 5IKCB 5IMMB 4CNIB 2VDMH 4XP4L 5MENB 3FO1A 3TO4C 3EBAA 3WDHA 1CXKA 4NZDA 1RU9L 2ATPB 2EECA 2EYTB 5BRZB 1CXLA 1BZ9A 2J12B 4MHHI 1JTPA 2J1KA 1B4JH 4HT1L 5C0DB 3W82A 1JF1A 2ZJSL 2VXTH 3IFNH 5CIPB 3U83A 4ZPVA 1KB9J 2M2DA 4FP8H 4LHUB 3KNBB 4XCFH 1T2QH 1BVKA 5IVXF 1TPXC 1YYLL 3FMGH 1OAZL 1Z2KA 2N4IA 4EOWL 2W9EL 3AU1B 4YHNB 3TYFB 3I75B 4G8IB 2VXQL 4HIJB 1IEAB 5EBLB 3KJ6L 3T3PF 1JNNH 1F4YH 1BF2A 1IGYB 4YBLB 1NKOA 3CZFB 4IRZL 3TT1L 3MZTA 2N1KA 1KXTB 4K2UH 3C60D 5FYLD 1FE8H 5I74C 2OL3A 3H9ZA 3UMTA 5BV7B 1IGIH 3X17A 1OPGH 4FZEH 2KDGA 3SDXB 3TH4T 5DGQA 1TJIL 3U2SB 1SYVA 1HKLL 1YMMA 3QP3A 3C2AH 4PV9A 2DQTH 1AI1L 1NBQA 1INEH 1KFAL 2FYYA 4YX2H 3HPLB 3MOAL 3WS3A 3DV4A 5I1DA 2YN5A 1T7WA 3V0WH 1YEDA 5DO2C 1R5WB 3BIKA 4MCYB 4XT1C 1TJHH 3SGEH 1U3JA 4HPYH 4TUOA 2OR9L 2V7HA 3LQZA 4H5SA 3Q2CA 1JUFB 4L9DA 3S6CA 4Y5VB 3MOBL 3HRZA 4R4NC 3BKYH 2NY5L 3MV8E 1A7PH 1SJXA 1MCFA 4TRPL 3OKOB 4D8PB 2I9LA 3LPGA 2F54E 4WI8A 3QUYC 5H8DA 5DD5H 1GH7A 1OWWA 5KVGH 5IMOA 5GHWL 3SGKA 1MJUH 3DX8B 3G5VB 2VXUH 4JM4H 1CZ8L 2LTQB 1BEYL 3E6FB 3PABA 3S35X 5JDJA 1T03H 2CKBL 1OB1B 3MRQA 4HBCH 4MNGB 4ZS6C 4F8QA 1CU4H 1S9XA 5JMRA 1S9KC 1FVDB 4G43B 4WNQA 4WRLA 4HS3B 2F58L 3D25A 5HHPB 1IAIM 4Z7OE 1G7MB 4QGTA 4Z7VB 5DMKB 3GIZH 5AUMB 4G8EB 3MO1A 3RJQB 3WFBL 1K4DA 5EBWB 5E99H 1FYTE 1G9NH 1NSNL 1Q9LA 5IQ7L 4M7JH 4OSUH 1MCNA 5CHNB 1E6JL 1P5UA 2D31A 1Y6KR 5IW1B 4YJZL 1EO8H 1WZKA 1NUNB 3GSQA 5LBSL 4HIIA 2A6IA 3TYGL 5ID1B 2V5SA 4D0CA 4I18B 3QPXL 3GFUA 4ZFOB 3BHBB 1JTOA 2BHZA 3NABH 5FYKE 4HXAL 3QIWD 5DVNA 1OGTB 1T04A 5TQ2H 1ES0A 3I02A 3WJJA 4Q97A 5IEKB 3ZTJH 2HRPL 3FQUB 3OAZH 4L8BB 4I77H 5AG9A 1AGCA 4HK3J 4CVXB 1IQWL 5I1KL 3C2SA 5JHLL 1DTUA 2VDKL 4HKZA 1JN6B 4EJ1C 4ZTOH 8CGTA 1S9WB 1FL6B 2D4FA 3MLSH 1NBZB 1PKOA 2BY1A 3PXHA 4MX7A 4IHOA 1K4CB 1NAMB 3WEXA 1MFDL 4YWGL 4I48A 3RUGA 1NC4B 4NO3B 5I0ZA 3EFDH 3MXVH 1JHLH 1J12A 4K8RL 3MYJB 3SJVE 4YHPB 5MHSD 1JPTH 2B0SL 5HYJE 1JGDB 1CD1B 5EUOA 1PVHA 5DJCA 5CBEB 4NN6B 3VXNA 1N5AA 3P0GB 5DI8B 3GUTA 1CGYA 4PJHB 4JRWA 3C60C 4LQFL 5DDHA 4OUOA 4HWUA 5IB4B 3F12A 3QIUB 2CLZA 4OIAA 3H42L 4WW2A 2X1PA 3I9GH 3FOMB 1BJ8A 1G6VK 4PGCB 5JPMA 3HC3H 3GI8H 4KXZH 2VRAA 3O2WL 4X7TA 5E08L 2X9XA 2CK2A 1JGLL 1I9RH 4XCEB 4B0MM 1KIUA 1NCAL 4OZHA 3DECA 4LSQH 3FRUA 3D3VB 4RFEB 1MCWM 4MYWB 4HK0B 3QRGH 4JY5H 4LMQI 3FHQA 3CLEH 4MAYA 5EIVA 2Y5TA 1I7ZB 5GS3A 2ITDB 3GDBA 2AJXH 5DRWB 2VDOL 3HR6A 2EKSA 4Y4KC 3SO3B 2EXYD 3SDAA 4UILL 3MLWH 2CQVA 4KTEL 2VLRE 4U7KA 4XNZC 2CD0A 4JG0L 1LILA 2BVOB 4ODSL 2XTJB 4AL8H 5T1LD 4ZUTB 5F7DA 1BHGA 1K8DB 5IHZB 1HZHL 4NC0B 3RY4A 3IGAB 4MNHA 2FLRT 3EYFB 3H7LA 1DUZA 1LDPL 3H2WA 4I4WA 2HKFH 3PGCA 4NCC1 2G9HB 4XXCA 4HIXH 4W4OC 3T1FB 2XNAB 1ROWA 5I30L 3UJTL 5LQBL 4M5ZL 3FO1B 2NW3A 3TZVC 3CVHA 4OKVA 4F37K 2X4TA 4UT6L 1BZ9B 1VFUA 3OB8A 3IAQA 3U48A 5BJTA 3FFCD 3UPCA 4KI5F 2WAHA 5ID0A 4PTTB 4WVRA 4P3CH 4RCAA 5HDBE 3VH8A 1BFSA 3NIDE 4TQEL 3LQMA 1XGYH 4ZPVB 3ZDZE 2P1YA 4AK1A 2UZIH 3IRPX 4K7FA 4K7PL 1RUPH 1BVKB 3KYAA 3RVUD 5FYLE 2YUZA 2XV6B 2XT1B 4PG2A 1U8KA 1P7QD 1JNJA 1UWEL 1MJ7H 2XZZA 5DUPH 3WUWG 4KJPD 5TE4H 5KVDL 4AJ0A 2B7DT 2OL3B 3IFOA 3HE7A 3AUVA 1MFEL 2JB6A 3UJJL 4LKCA 1VERA 2GCYA 2VN7A 4X7SH 4EN3A 5CZVL 2FRGP 4MNQD 3ABZA 2D0FA 4RX4D 1YMMB 4WHYH 4Z7QE 4PV9B 3MRNA 4FQ1L 5BS0E 2FYYB 4UOJA 3UC0L 3VGAB 3DV4B 3WS3B 2YKLH 3M45A 5I1DB 3QDMD 1OSPH 1EUUA 1PKQA 3BIKB 5EZIL 4TUOB 4X5LA 2EDFA 4K8RD 2Y36H 2V7HB 4H5SB 3LQZB 1WITA 3P11H 1E4XH 5HD8D 5SV4A 4UIMA 5I19L 3E0GA 5JQHC 3HRZB 1RURL 4KRNA 4XVJL 5HPOA 3I84A 4Z77A 2I9LB 4LLUA 3QI9D 5FGSA 2VLJD 2BOBA 4WCYL 1LWRA 4PB0H 1J1PL 3CSGA 5IMOB 3MRBA 1U8JA 1IC4H 1UZ6E 1JZ4A 1ADQL 4YE4L 3PABB 4FFVC 1YEKH 2AJYL 2Z8VC 1NMBL 2GQHA 4U6TA 3V4VL 3MRQB 1KIPA 4CW1A 3C5SA 1UA6H 1S9XB 4KDTA 4TULL 4X4MA 4WNQB 5HHVL 3C08H 4M6MH 2HTKD 3D25B 3MLZL 5FV2A 1F4HA 1A4JA 2EXYC 3JWOL 2X4UA 3OAUH 3S3PA 1J7VR 3MO1B 4IDLA 4QXUL 3RX7A 4RA0C 3DX7A 2IAND 2NR6D 1QFUH 1ZVYA 1IAIH 1K4DB 1QHPA 2OZ4H 1JNLH 5IFAL 2BK8A 3G6JF 1Q9LB 3TBSA 2YR3A 3MNWA 2D31B 1YC7A 4JQVA 2D0GA 1L7IL 3GSQB 4HIIB 2A6IB 1BD2A 2CUIA 3MJ7A 4D0CB 3RWGA 2YZ1A 5GZOC 4U1GC 1RK1A 1G7LB 1CLZH 3MQIA 1IAMA 1T04B 1ES0B 3I02B 4DVRH 1AGCB 2XRAL 5FYJU 4PJXF 1DANU 4R8WH 1GAFL 1QSEE 5E8NA 1LGVA 4U05A 4HKZB 3U46B 1K3ZA 1UM4L 4JKPL 2VZ3A 1FBIH 4MJID 3QA3A 3ARYA 5MHSE 2BSSA 5DQ9B 2QQNH 4MX7B 5CSZA 4IHOB 3WEXB 3RUGB 4I48B 2ZOLA 2MCG1 3MJGX 3NIFF 4NFCA 2VH5L 1NANI 5J57B 3V52L 3RI5K 5EUOB 5DJCB 4EIZC 3ISWA 1AXIB 3VXNB 1N5AB 2DI8A 3LMJH 3N85H 3GUTB 4KQ4L 3ZE1E 5DDHB 3S88H 5I1GH 3F12B 1IVLA 1NUFA 2CLZB 3S36H 3DTXA 4WW2B 5GRJL 2HH0L 4N8VA 5JPMB 5I15H 1FNHA 3VCLA 5J1AA 4X7TB 3ARZA 1RZJH 4KKLD 4LVHC 3B8SA 3LKSB 4OZHB 4C56D 1H8NA 1A1MA 1W8NA 1EMTL 3C09B 3MV01 1QRNE 3FRUB 4BFGA 2V2TB 4XPAH 1U3ZA 4CGTA 3HI1A 1A7NL 2IAMC 4MAYB 2R8SH 2Y5TB 1SJEA 1FIGH 4ZO7A 1NLDH 3TGXA 4BQ6A 3A6CL 4I2XA 5FHAH 2EKSB 3SDAB 2VQ1A 3MV11 1FLRH 3DGCR 4LLYA 2NY4D 1NEZG 2IBZX 2D7QA 4MMXC 4Z7UF 2V5RA 5BOPA 1BGXL 4JKKA 1SEQH 1BAFL 2OZ4A 3LB6D 4LSTL 3B43A 5F7DB 5EOQL 5I1HH 4MNHB 3BQUA 1DUZB 4POZC 1WEJL 5ALBH 4I4WB 4PJEF 5FUZH 3PGCB 1LE9A 5TJWK 4H25A 3ET9F 3FFCE 4WI6A 4XP1H 3MA9H 1EJOH 1JZ3A 2NW3B 4LPVA 5SX4H 2P5WD 1DQDL 2AEWA 3DVFA 1WZMA 4OKVB 2WWKT 2X4TB 2F5BL 4E5XA 5BJTB 4I3RH 1YPZF 5ID0B 3HE6D 3IKCA 4QNPE 2HTKC 3VH8B 1CS6A 4M48H 2Q8BH 2DIJA 5F9AC 3RY6A 4Y4KA 3AS0A 2NR6C 4K7FB 5KBNC 4JPWH 4GSDH 5L9DL 4ZUVA 5CBAA 4RGOH 3X3GL 2J88L 2H9GA 2X05A 4PGEB 3BD3A 15C8H 1U8KB 3IJSA 4LAQL 5I71C 4FQIH 1T2XA 3EYQC 3IU3A 3UO1H 4B5EA 2H1PL 2O5YH 4U4BA 3D18A 1HN1A 4JR9L 4MNQE 4OZIE 4P23D 3RWJA 4X4XA 1B4RA 4OLWL 3BOVA 4KVNH 1S7RA 2DQGL 1ZA3A 3WIIL 3IFOB 3HE7B 2OLDA 1J88A 2GUOA 2JB6B 3QHTC 3MCKA 4LKCB 1Q72H 2ZCHH 5D96B 2GCYB 5KVEH 1XF3A 3MLUH 4EN3B 1KPRA 2P47B 4Z7WE 3PV7A 3MRNB 4DQOH 3MNVA 1GGYA 5TQ0L 3U36A 1Q9OA 4OCSL 4PJCA 3P77A 3V0AC 5J9PA 1PKQB 4OBRA 5JPNA 3IF1A 1KCSH 5JXAL 3ARDD 1I4FA 4LLQA 1CXIA 4PRPD 1B0GA 2VLJE 4K9EC 1TDQA 2GJZA 1A7OL 1LK2A 1MHPL 4OLZH 3T0EC 3NBNA 4MS8D 1XIWC 4Z77B 4OD3H 4XPHL 3AY4A 1J0YA 3S37H 2BOBB 4M62L 4YUEH 3S4SA 4ZD3H 1WBXA 4R90H 1CDCA 3MRBB 1RZKH 4KKLC 3O8XD 1VPOH 5D7JA 1AQKL 3IETA 3DVNA 4KQ3L 1WJ3A 1KIPB 3RWFA 5ALCH 4CW1B 4N0FA 3C5SB 4DAGH 5C2UB 1FV1B 3L95A 4S2SA 4QKXB 2IANE 5EPMB 5HHMB 1JCKA 3PQYE 2JCCA 4IIQC 1A4JB 3L5IA 3HI5H 2RCSH 2X4UB 4UTAH 5HYFA 2B39A 2VAAA 2IJ0C 2JB5H 3DX7B 2IQ9L 1KC5L 2D7OA 3TBSB 4JO3H 4KVCL 3R8BB 3MNWB 1J0ZA 5GGQH 3RPIA 5D7IF 4MA7H 1YNKL 1H8OA 5I9QC 2Z0BA 4PJAF 1BIIA 3ARUA 5DJ6A 1BD2B 5ILTH 3MJ7B 3WXWH 4Y19D 2ORBH 3RWGB 32C2A 4GAJH 3TVMA 3VWJD 5FKAA 1RK1B 4QXTA 1FP5A 35C8L 1OM3H 2Q20A 4MJIE 2YXMA 5DS8A 4HW6A 2QSTA 3CDGA 2YRZA 5E8NB 2E8ZA 5EOCL 2X7LA 5FYKU 4O58L 4KY1H 3DX6A 4C4KO 4J1UA 3B2VH 3QA3B 3ULVL 3WIHL 5C0ND 4YHLH 2BSSB 4U1NB 2EE9A 5CSZB 2B1AL 3UXFA 4HJJH 2APVA 5DT1L 5I75B 4F8TA 2ZOLB 5B38G 5ACLA 1F8TL 2UZXB 4U33A 3V6FA 4LVNC 2YUVA 1KCUH 1KCRL 1OTUC 5DVLA 5EOCJ 3G5ZA 4PJGF 4YHKH 2FECL 4OZFG 4NHUA 4C56E 2VLMD 4KKBD 4PJ5A 3MBXL 5F1KC 3DTXB 3SDDC 4Y4HA 4Y16A 4N8VB 2WUCL 2E7HA 5J3HD 1F97A 3VCLB 5J1AB 1A3RL 3PDGA 1ZLUH 2P49B 1A1MB 1JYWA 2EC9T 4MXVF 3BGAA 3RGVD 3D0LA 1JYXA 3FJTA 1X5YA 1OAQH 3M8OL 3MRLA 2QQQA 2COQA 2NY0D 4JGJA 3QQ4A 1W2KT 2QSQA 3LPFA 2VN4A 3W5NA 1SJEB 3MRHA 4WUUA 1IEHA 1W72A 4I2XB 3ARDC 1NGQH 1HILA 4JZNA 2VQ1B 3DXAD 2EDLA 4M7LL 2A9MH 2SEBA 1HHIB 4LLYB 3BZDA 4G7VL 2NCMA 1S5HA 3FRPG 1N64L 3LN9A 3MFGB 4MS8C 2CLRA 4N0YH 3TPKA 4OLEA 1SQ2N 2HT3D 4R26L 4HF5L 4YFEA 3VFVA 4JZOA 2HYMA 3BQUB 2P5WE 4HWZA 2AAVA 4LOUD 4H88H 4EZMA 4IDJH 2MCPL 2DQDH 2UUDK 1DQLL 5SWSD 3T0AA 1QFWI 2BNQE 3VXQA 1A6VH 1K6QL 4E5XB 4ESKA 5IFHH 2EC8A 3IKCB 4ALAH 3HZKA 3F5WA 5C08D 4Y1AD 1KJVA 1IC5H 4PJBF 4EUPG 3SKOA 3QR2A 3VMNA 4ERSH 4K9EH 1B0RA 4Y4KB 4P2RD 4MWFA 3P40A 5BS0B 3ZKMD 4ZUVB 2G75A 3ZKXC 5CBAB 2XYCA 2H9GB 4UAOB 3IJSB 5CD3A 1T1ZA 1CIDA 1I8MA 2A73A 2EEBA 1I7UA 2GY7B 5DLML 3EJZD 1A9EA 3D18B 3RWJB 1YMHB 4LHJB 4X6DF 3VWJC 1S7RB 1ZA3B 2B4CH 5GGUA 2ZUVA 2GUOB 5H35A 3MCKB 4L8DA 1DP0A 3VXUA 5KAQG 3TZVB 1XF3B 1PG7X 1KPRB 1HQRA 5E5MA 1IKFL 1EEQA 2QHRL 1A2YA 5C1MB 5HGBA 2FD6H 1ACYL 1BOGA 5DFWH 3ULVD 4PRPE 2OP4L 4AMKL 3MNVB 3U36B 1Q9OB 1IFHL 4PJCB 1C5BH 4S1SH 3P77B 3P3YA 5J9PB 3UCRA 4JVUA 3UDWC 5MP6H 5JPNB 3IF1B 5TF0A 3U0WH 1I4FB 3PWUA 4LLQB 1KELL 2J6EH 3RWDA 2FCBA 1B0GB 2VZUA 2GJZB 1LK2B 2HTLC 2YUXA 4EKXA 1S7QA 1QSVA 2FEDD 1CICA 2EC9U 5I1JL 1XZ0A 3GMRA 2J3SA 4KKBC 1VEMA 2EDDA 1N4XL 1I1FA 2R0ZH 3S4SB 4HZAA 2AW2A 3RHWF 1WBXB 4CKVX 3NN8A 4G6JL 4NQEA 5DEGA 4CUCA 4R2GD 5J3HC 3WFDL 5EOTA 4BK4A 4FQCL 3NPSB 1YEEH 4FQQA 5K9JL 1OP9A 2IFFL 5D7JB 3V4UL 5E2VL 3IETB 3DVNB 1J11A 3PP3H 3RWFB 1BJ1J 4N0FB 5D93C 4DKEL 1F4WH 1JGUL 3HI6H 2NY0C 3L95B 4GO6B 3F7QA 4S2SB 3VI4E 3GSUA 3UPAA 1RQ5A 2QSVA 3FO9A 4P2QA 4ZS7H 5HDOA 4FZ8L 4BZ1L 4GRWE 5D1XC 5A40E 5DK2A 4LGPB 2JCCB 1D5IL 3JTTA 2V17L 4NBZB 2VAAB 3QIBD 2YPLA 4P9HL 4RFOL 1OQXA 4YK4B 5DD1L 2AJUL 3ECBA 2R29H 4Y19E 3FZUC 4XB8A 3CCHA 5F9JA 2HT3C 3T0EA 5F7MC 1PEWA 3JWNC 2A0LD 3SOBH 3RPIB 3QDJD 1XIWA 2GJ6D 4GKZA 1MF2H 5JA8B 1BIIB 3O3DA 3FN3A 3T4YA 5DJ6B 4M7KL 1NKRA 4BQBA 2CRIA 4M8QA 32C2B 3OG4B 2XN9D 4I8DA 3TVMB 5FKAB 4QXTB 4CU6A 1PD6A 5DS8B 4BZ2L 4LCCC 1I1YB 3CDGB 2UVEA 1CQYA 4P9ML 2X7LB 1NCCL 1ZEAL 1NFDE 4CDHA 3DX6B 2QQKH 4J1UB 1E6OH 1N2RA 1T5WA 4JFED 5DD3H 3P0YL 4GQ9L 3VGDA 2A6JA 1BVLA 3OAYH 4X5WB 4OQ1A 1MCCA 1XGQB 4CN1A 4M4PA 5LAXA 1P6FA 2VLME 2J6EA 2QQLL 5KSAD 3V6FB 4JQIL 4ODVL 2ICWI 5EUKA 4PJIE 4I3SH 3G5ZB 3GMLA 3ZKQD 2O5XH 1UB5A 4NHUB 3BT2L 5CMAA 4PJ7E 4PJ5B 1X5FA 4NYLA 4WWKA 4OFIA 4Y4HB 4Y16B 2AJZA 4LSUH 4HKBA 3L5JA 2XZQL 3L3JA 3G6DH 3CSYA 4QWWD 1WCBA 2G5BA 2Z92A 3MUGA 3SGJA 3ULVC 4OF0A 4LEXL 3D0LB 3DXAE 1AHWC 1IT9L 3R1GL 3MRLB 2AV7A 3ZHKA 4U6VH 3QQ4B 1RV6X 3SCMC 1R0AL 4JPKL 3FONA 4HUKB 3MRHB 2XKNA 5KTEH 5CINL 2R4RL 3N06B 4JZNB 1HILB 1S7VA 2O26U 1GL4B 4XNYL 2SEBB 1S5HB 2APBA 5A2LH 2ATKA 2X4SA 4G80A 3MR9A 2CLRB 5E7BA 4KDWA 2XICA 1QLEL 3LS4H 3X3FL 3P9LA 4N1HB 5E9DA 4EDWH 1AR1D 2B5IC 5AZ2L 5SWSE 4JZOB 3VFVB 4FQHA 4HWZB 2O5ZH 2R2CA 3G5XA 1EO7A 4FFYH 5D70L 3LSOA 3HNVH 1A6ZA 4XCCL 3CH1A 1L0QA 1INDH 4ZO8A 5KJRH 5C08E 2YPVL 3QNZA 1WAAA 1R24A 3QPQD 4OGXH 4Q7DA 4F9LC 1WWBX 3VXQB 3ULUH 3MCLH 4HWBL 5ADPL 5FDWA 5HVFB 4OD1L 4P2RE 1LK3L 3UTZA 1XMWA 1OAKH 3HZKB 3F5WB 1AO7A 5HVWA 2GK2A 4OBSA 2WIIB 1KJVB 4CL7A 5F70A 3A67L 1WF5A 3WFEL 3SKOB 1C8PA 5J0BA 2DMCA 5DVKA 5T5NF 1B0RB 4Z7WB 3WXVL 3HUJE 4MWFB 4OB5H 2YK1H 5LXGH 2NTSP 1IARB 3U82B 4YXHH 1MCKA 4DGYH 4ETQA 5DHYA 4C57C 1ZANL 3RFZC 3BVNA 5CD3B 1MCOH 4BSVA 1NUDA 3L3HA 1JMXA 1T1ZB 3Q6FA 5DA0B 1I8MB 2A73B 1I7UB 5D72H 1GPOL 4HK3N 3QISA 1A9EB 4M1CC 4YXLL 5KSBA 2QSCH 1NFIA 3ULVE 5GGUB 1C5DA 1QG3A 4ZQKA 4LPWA 2D7PA 5H35B 3VXUB 4L8DB 4H1LG 4KTDL 2DL2A 4PGDA 4RAHA 4OLUL 5IHUL 5E5MB 1A2YB 1MFCH 4J3VA 1OY3B 1BOGB 1T66C 3GEWB 3MLYH 4K3JL 5DURB 3NFSL 4KHTL 1F42A 4M5YH 1PJ9A 3VD5A 1NH6A 3PGFH 1DVFD 4WI2A 4X6CE 4TSAL 1AIFA 3PWUB 3RWDB 3EUUA 3EYOA 3MLXH 3QULA 4N68A 3PQYB 5KSAC 1I3GL 4GRLA 1S7QB 3HN3A 3U9UA 1CICB 1CGXA 1XZ0B 4XWOC 1XGPA 5I8OL 4C83A 2BDNL 1W0VA 3GMRB 2OX5A 1RZ8A 5F44A 1I1FB 2RQ8A 4FQJH 3NN8B 4NQEB 4NC1C 3HNTH 5CJXC 5DEGB 1DQQA 3RDTA 5EOTB 1GIGL 4FQQB 2W9LA 3OSKA 5BZWA 1UWGL 2V7NA 1D5XA 2XA8H 3DRQB 1M7DA 5E1AA 4NM4L 3U1SL 4XBEH 3MTRA 1QPPA 2AJSH 4Y89A 1ZLVH 2ADJA 3GSUB 3FO9B 4P2QB 3V6BR 1Z9LA 4NZUL 2VKXA 3HMWL 4XMPH 3PL6D 5DK2B 5IROC 3JTTB 4UIKH 1UYWL 3UDWA 4GUPA 2J8HA 2Y6SD 2YPLB 2AGJL 5M7QA 3L5WA 5E0QA 4RMUA 4Z7VF 4WTZG 4MDIA 3ECBB 3CCHB 5F9JB 2XN9E 3T0EB 1AR1C 2YMXH 4YIQA 1XIWB 4DKAA 4ONFH 4GKZB 4MJ5A 4X8XA 3O3DB 1WFOA 3T4YB 1V7ML 5F6HI 1F3JA 4Y5XC 5FA4A 1NC2D 4M8QB 1KCVH 3OB0H 2HG5B 1OTSD 1BBDL 25C8H 5FA3B 1H3GA 2JIXA 4GKNA 4Y2DD 2C1PA 2CUMA 4P4KA 4BA8A 2XWJA 4HZLA 4KV5F 2VJXA 1G1CA 4IRSD 4JFEE 4WDIA 5HVGB 3SKMA 1MCQA 5DEFA 3F6IA 3UYRL 3SKJH 4L8CA 2R69H 1GZPA 1N2RB 3DBXA 1FNGA 1CDGA 2PTVA 4P9HC 4K23L 2Y06H 3RZCD 2PW1A 1T5WB 3AB0C 4NKMA 4YGVA 2A6JB 4YDJA 1BVLB 1FGVL 2EDNA 4KI5C 4PY8J 1RIHH 3B9KA 2Y1VA 1KV3A 3NH7H 3UTTD 3E2HB 2ED9A 2CJUH 2NY1D 2NYYC 3ILPA 5LAXB 5H37H 2YWYA 3DGGA 3CUPA 4P5TC 5I8KL 5D2LA 1FNLA 5EUKB 1U3HD 4R4BA 5E8DL 3TA3C 5F88A 4GJTB 2CK0H 4XGZA 1AKJD 3GMLB 2GJJA 3BKCH 5I9QB 4XMKH 2MPAH 4PJ8D 4OZGF 2MQCA 1LD9A 1IGJA 3NTCH 1UB5B 5CMAB 2YA0A 1I1AC 4R96A 3TPUA 3VRJA 4NYLB 4WWKB 5BW7A 1NCBL 2WBJC 5F93C 2NNAA 2AJZB 4PP2A 5CEYA 4HKBB 2PCPA 1P9MA 4XPGL 5K93A 3L3JB 4LCCA 1X5IA 4NIKB 3CSYB 3BIAX 1WCBB 4G6KL 2G5BB 3MUGB 3GHEH 3MRDA 4R3SA 4U7SA 4A2MA 2XG4A 1UEMA 2AV7B 2B2XH 3D39A 3G04A 4PLJD 1Q0YH 4ZSOA 5DC9B 4WU5A 3FONB 3RAJH 2XKNB 3S35L 3T2OA 5DC4B 1WZ1L 1MFAL 1S7VB 3U7WL 2WQRA 4RMQA 2OTUA 3QXWA 5FO8A 1WBZA 1D3CA 4JPIB 4UT7H 3G9VA 2LVCA 4K94L 1AJ7L 2ATKB 2X4SB 3KYKH 1QBLL 4G80B 5KN5A 3MR9B 4LVNB 2X70A 3BN9D 1EAPA 3P9LB 5E9DB 2XA3A 4OUUA 4GS7C 3GMNA 5IVXA 4FQHB 5C2BH 2FJGA 4DEPB 4FN0A 2ZUQC 5JQ6H 3QFDA 3G5XB 5EORL 4F7CA 3LSOB 3BXNA 1A6ZB 4LSVL 3O6FD 1U41A 4BYHA 5BOZG 3CH1B 3F7YA 5IK3A 2CIKA 1IC7L 5C6TH 2D7TL 3QNZB 2D9CA 3EO0A 1R24B 5ITBL 1DQTA 1G9EA 5HI4D 5IBLD 1CT8A 3UTZB 3BGMA 1TMCB 1IJ9A 2QKIA 4FQLL 1ZLSH 3PL6C 1AO7B 5KZCD 4OF6A 4XVSH 4OCLC 1JPSL 1IBGL 2ILLA 4GFTB 4Z5RA 1MRDH 2Y6SC 1AFVL 1FAIH 2C3HA 1E4KC 5L6YL 3ZDXF 1TQCB 2NY2D 5IBUG 1J5OH 2C3XA 2H2SD 4ETQB 2NQCA 5DHYB 2CO6B 4R9HA 1UM5L 1HOCA 3BVNB 4E9LA 1F3DH 4BSVB 3L3HB 3Q6FB 1GGUA 4MZ3A 5F89A 5KSBB 3TCLA 3U4BL 5IHBA 4GW1A 3INUH 3L3IA 4NKDA 5IGXL 3ROLB 1NFIB 4Y2DC 3MLRL 1C5DB 4GXUN 4ZQKB 2PXYC 1FZOA 3RVTD 4M43L 4IRSC 4N5ED 4PGDB 3G5YA 4KK5C 5D9SB 3S36X 2EDHA 5F3BA 4JRXD 5JA9A 4KC3B 4YHML 3WSQL 4NN5C 4EBQL 1SMAA 4KDVA 1AIFB 3EYOB 2NY1C 4JY4A 3QULB 3QUML 3EDKA 4GRLB 4RWYL 3ZLQC 1D5BA 3U9UB 3D2UD 3BE1H 4NBYB 5CGYD 1U3HC 2I24N 1XGPB 4V1DA 5ITFA 1WFNA 1Y6NR 3RZWA 4PJ8C 4C83B 1BQUA 2AP2A 4S1RH 1W0VB 1JYNA 4M1DH 4MQSB 5DTFA 5J6GA 1B6DA 4OT1H 1RZ8B 2PO6D 1TZGH 5GGVL 2D0HA 4UU9A 3I50L 3DUUA 1IQDA 3OKEA 2CGRH 3RDTB 1DQQB 1BBJA 1U91A 2FATL 5BZWB 4I0CC 5E2TL 2V7NB 1D5XB 1CWVA 1M7DB 1ZHKA 2EICA 5A2IH 2A38A 1U8IA 2E7BA 2Q1EA 1DUYA 1BQHG 3K3QA 3AS3A 2ADJB 4HLZH 4PLJC 4UQ2A 4M7ZB 5T3XL 1C08A 2GI7A 2FLBT 5CKGA 2G60H 1KN2H 5EZOH 1LDSA 1SEBA 4NM8L 4GUPB 2EXWC 1NFDB 2XOTA 1MVFA 3L5WB 1UZ8A 5AEAA 5E56A 2YD1A 1EUTA 2W07A 5CILH 4MDIB 2DL9A 5DQDH 2NXYD 4X4YA 4YIQB 3CVIH 2DQHL 4MJ5B 3ARVA 1F3JB 3O6FC 5FA4B 5AZEH 4JFFD 1TXKA 2JJSC 3IDUA 4HV8A 2JIXB 2Q8AL 3OR7A 4GKNB 3IDXH 1WWWX 3ARBC 2C1PB 1G9MH 4P4KB 4RIRA 3T0XA 3F65A 3ZKNC 1S7TA 2XWJB 4ODHL 3R0NA 5BMFH 4PJXE 5IBLC 4WDIB 3IFLL 3SKMB 1CG9A 3GBLA 5DEFB 4L8CB 1IZJA 3UTTE 5DUML 3TESA 1GZPB 4H20H 3KG5A 5C0JA 3DBXB 5ERWA 1FNGB 4ONGL 1DBMH 2PW1B 1YYML 4N0CD 5B39G 4NKMB 4YGVB 2NY6B 4YDJB 4G6FD 4QRTA 2NY2C 3CX5K 3B9KB 1PY4A 5EULV 1F45A 4PGBA 2UY6A 4WY7H 3ILPB 1F11A 4WI9A 2YXFA 4PY7A 5DZNA 1JZ2A 5EO1A 3RUGF 4K71C 1Z9MA 3DGGB 3CUPB 4YHZH 2UWEE 5D2LB 4ZAKA 4R4BB 1X5ZA 5F88B 1QLFA 4XGZB 2MMXA 3PP4H 4P4RA 2YN3A 1LD9B 1IGJB 1KJ2L 2Y4SA 3UAJC 1UKQA 4R96B 4H8WL 4M9PA 3TPUB 3VRJB 1CGSL 2LV4A 3AFLA 3PJSA 2NNAB 3RVTC 3S7GA 1LO3L 5F71A 4PP2B 4N5EC 2PCPB 3OF6A 2GSIA 3MUJA 1A0QH 4LCCB 4JZJA 4DOHE 2IQAA 3MRDB 2Z8SA 4R3SB 5IF0B 1S5IL 4DUWA 2OK0L 2ZCLL 1J8KA 1YNLH 5ECJE 3D39B 3G04B 4ZSOB 1NGXA 4WU5B 3TN0A 2Z31D 2OTUB 1KF9B 5FO8B 5JLZB 1WBZB 3S98A 3O41B 2GIYA 2VDPL 5KW9H 3UP1A 4LHQB 3VXSE 4JCLA 4AEFA 2X70B 5DD0L 1EAPB 3K80A 3LH2L 2BC4A 4PJDE 3TA3A 1K5NB 12E8L 3GMNB 5IVXB 4XP9H 2FJGB 1WT5C 1I9JL 3PHSA 1QYGH 5C07E 3QFDB 3UBXG 4PJEE 2DMKA 3CXDL 1H3XA 1I1AA 5TDPA 4F7CB 1S7SA 3BXNB 4AT6A 1HQ4A 1ND0A 5B21A 4MLIA 1PLGH 3F7YB 5IK3B 2CIKB 5DWUL 2P4AB 2HLFD 2VYRE 4TUKH 3WD5L 5C09D 3NCEB 5LCVH 3EO0B 3UROR 3L7EA 3WNMA 1ZV5A 1UQSA 5D7SL 2FIKA 2HT4C 3HMXH 5T3XD 3F8UB 1CT8B 3BGMB 1J8HA 2A74A 2BNRD 1TJIH 2QKIB 1EK3A 3QEQD 2PYEE 1C5CL 4S1DD 4JFDD 3VFRA 5A2FA 1WIUA 4J3OC 1HKLH 1AY1L 3BZFA 3IJHA 3O6LL 4Z5RB 4K94C 4HWNA 3WKNA 4DK3A 4O2EA 3AXLA 1KFAH 4LL9A 3MOAH 5F6IB 3FFDA 1VESA 4N8CL 2R1YA 4ZODA 2RIKA 4AENA 3S34L 2NXYC 1L7TH 3EJYC 1N5YL 4KMLB 1HOCB 1MEXH 1KG0A 3QG6A 2HWZL 2YC1A 4E41A 3MV7A 4UDUB 3KR3H 2OMNA 2W65A 5GS0L 1G7HA 4EI5A 3TCLB 1FIEA 4GW1B 4NKDB 3L3IB 1YECL 1DBAL 1OP5K 5DHXB 1G84A 4JRYE 1FZOB 3A6BL 2F8OA 3IU4H 2BSED 3G5YB 3P73A 3WO4B 2DQFA 4IRJC 4JGMA 4LGSB 3IKKA 5F3BB 1VADA 3M1BA 3RIAF 3P0VH 1J9CT 1BZQK 1VEPA 2CKBH 2CMRH 1LMKA 4GMTL 2R9HD 4N0CC 3QIWA 3DMMD 2ZSVA 4AIOA 3QCUH 2BY2A 2H41A 4MA1B 1N0XL 4WIQA 2F58H 2J4WH 2KQNA 4PJFE 3QEUA 4JY4B 4Q0XL 4A6YH 4YXKL 3VXRA 1BFOA 3WFBH 4V1DB 5ITFB 4LASH 4GXUM 4RISH 3OG6B 4L8SA 3L7FA 4DGIH 4FRWA 3T65A 3JV6A 3G6JA 1T21A 2WMPA 5J6GB 4BSJA 4E0RA 4UU9B 2QLVB 2JKXA 1IQDB 1OD9A 3DUUB 3K74B 4WEBL 3OKEB 5C0BD 1BBJB 1U91B 3C6SA 5GRWA 3KPMA 1NAKL 3HFML 2CO7B 3BWUC 1ZHKB 4PYHA 3FB8A 1U8IB 4FXGA 2AI0L 3BUTA 2I9TA 1A7RL 1DUYB 1FPTL 1DFBH 1V7NL 2PR4L 1FG9C 4UQ2B 3HMXA 4JO2L 1C08B 2Q3ZA 4UV4H 4BQCA 3LVEA 5DJAA 3HZVA 1NBYA 4PS4L 4WFED 4J8RA 3DHJA 2BP3A 2D3VA 1SEBB 3JWDL 1J1XL 2DDQL 2W0LA 5T1MB 3IVKB 5GJSH 2IG2H 2EE6A 1UZ8B 3FCTA 1JP5A 4JFFE 1CR9L 2J7LA 3B8YA 4LLAA 1FVCA 2G2RB 3EW3B 3O4LE 3OQ3B 1CLYL 3MREA 3Q1SL 3WNNA 3ORJA 3LY6A 4L3AA 1F2XK 4OF5A 1AC0A 2A1WL 2MSPA 4ZOAA 1I8LC 4HV8B 4LRIC 5ADOL 2HLFC 3OR7B 3B83A 3WUWA 4XC3L 3O2DL 1FORL 5EU6A 3QHZL 3U79A 4RIRB 3ZTNH 2E9IA 1HHKA 1S7TB 5TFSL 1YEJL 3MBED 1CG9B 3BSZL 3QHFL 3T77A 1BVZA 3LPWA 1MI5A 3NCYS 2XACC 4I9WE 5E08H 2YD8A 1JGLH 4S1DC 1NCAH 5C0JB 1CN4A 4N0RA 5E6IA 5ERWB 2CKBA 4HWEL 2KL6A 1TETH 2BRRL 4DTGH 4I0KA 4LDLB 4QRTB 5BV7L 4PGBB 4QO1A 5GRUL 1F11B 3QG7H 4PY7B 4Q9RL 5EO1B 1TQBC 3MPCA 3ILQD 4JDZA 5T3ZH 4G3YL 3KJ4C 5HDQL 4ZAKB 1XF4A 4A6YA 3X11A 1QBMH 1QLFB 4JG0H 5GS0D 1EFXA 4YQXL 4ODSH 4P4RB 4Z7UA 3VXMD 5GRXG 2X41A 4YC2B 2HKHL 2AABL 2HFTA 3PJSB 4I5BA 4C4KT 4P2OD 4P46C 2ERJC 1AC6A 2JK5A 2GSIB 3QNXA 3NGBC 4FQXA 1P7QA 1MCRA 1S7UA 3B5GA 2IQAB 5I1IL 4HUMB 1XF2A 5JXED 1T6WA 4KJQD 2X4NA 1DQJA 4XAWH 2ADFH 5D8JH 4UTBL 3ARWA 1FL5A 2O61A 4NRZA 1NGXB 4ODTL 2AKRA 1Z0MA 3OGCA 3O3BA 3AB0B 2L7UA 3ARGD 1YPZA 1DN0A 1LP9F 3TN0B 5IIEA 1HNGA 4CVUA 1SMOA 1VFBA 3BKJH 5C9KA 4NJ9L 2DQIH 1X3DA 2BHUA 3CU1A 4XI5D 3MRJA 4BUGA 1UJTA 5K59E 2JE8A 3CX5J 3KDMA 2BC4B 1WFUA 3QDMA 3TA3B 5C09E 4ZNEA 2X44D 4EIGB 4NQUA 3L1OH 4ODWA 3J8F7 3GSXA 1QQDA 2B1HH 1I1AB 5I73B 1S7SB 4XBPA 2KKQA 1CD8A 2FBOJ 1HQ4B 1ND0B 4AT6B 4JPVH 1N6VA 2WBJB 1SM3H 2QL1A 1I9IH 2BNRE 2IH3A 2VDQH 3K8KA 2QADB 3QEQE 3GBNL 4RNRA 4HMCA 4JFDE 2HMIC 1EEYB 1UG9A 1NANH 3NMEA 4JANA 4WHTB 5L2KE 1UQSB 3QI9A 4EQ3A 1J10A 2FIKB 5SWZD 3O3UN 3GKWL 1J8HB 2A74B 2BFVL 1CL7L 4YDKL 2XIDA 5ICXA 1XAUA 5CZVH 3VFWA 4L3ED 5CUSH 3VFRB 3BZFB 3IJHB 5DVOA 4O2EB 2B8OT 3AXLB 2JELH 5C0CE 3FFDB 1C1EH 5L88L 4NSKA 5BRZD 2R1YB 3SQOL 2PETA 4X83A 3B5TA 2ZG3A 3DETD 4AENB 1HHHA 4YDIH 1KG0B 5DZLA 5IB2A 1UH2A 2VLKA 2FH8A 2NXZD 2YC1B 3MV7B 4E41B 3THMH 1WT5A 1I85C 4LHUD 2W65B 1J0IA 2ICCA 1G7HB 4EI5B 3ZDYE 5JIHA 5J11C 3VD9A 1E4WH 2AV1B 5HBBA 3EFFB 3O6MH 1VA9A 5D5MF 4UBDD 2ZWLT 4CMMA 4WI4A 4HS6A 4P49A 1N59A 3P73B 4ZO6A 1DE4A 2DQFB 3V4PH 5MI0B 1UACH 1ADQH 1VADB 3TBVA 4OF8A 3ARRA 3BMWA 4WI7A 3FB7A 1JGVH 1MOEA 2EYSA 3QIWB 1QFWM 2HLAA 2ZSVB 3O3AA 5HI3D 5ABDE 3QWQB 5HHVH 3L3DA 2FX8L 1K2DA 3BPNB 3MLZH 3OJDA 1D6VL 3QEUB 2F15A 1DQML 4D0DA 4YDLC 4ZFZA 3JWOH 4ODBD 2I60H 3VXRB 3G9AB 1QFHA 1BFOB 3HA0A 4YZFF 4TSBH 5C0BE 2LAGB 2VXVL 4L8SB 5J4MA 3DIFA 2FX7L 3L7FB 1I7RA 4OCRH 4KZDH 4XNUL 3T65B 3JV6B 4XTRC 3G6JB 1T21B 4RAVA 4AIZA 4W70A 4E0RB 2RGSA 3KWWA 4PUBH 1U0QA 5F97E 3OAZK 5D7IA 3C6SB 1E27A 4NZTL 3KPMB 3C6LA 4PJAA 3KPNA 2DTML 4LHUG 4WFEE 5D6CA 1RSFA 1C7SA 4IRJA 4QHMA 4AY0A 4FXGB 4M6OL 4AEIH 4KJQC 2FO4A 2I9TB 3LIZH 1UH4A 4JFZH 2VR9A 1KENH 5DJAB 4L4JA 4X80L 3HZVB 2XZCH 4PJXB 1CF8H 4P2YA 4J8RB 3ARGC 4WHDA 3MGOB 5I18L 3FCTB 2CPCA 1RUMH 3OBAA 1O0VA 2PF6A 3ETBF 1RZIA 2VZ1A 2R1XA 1FVCB 1R3LA 1AGBA 7CGTA 3ZL4L 3L5XL 2XXMB 2WUBH 4Q9BA 3QEGH 4HJ0D 2OCFD 1TCRB 4JAMA 5GQBA 3RWEA 3WUWB 4PJGA 5EU6B 4LCIL 5MEOA 1HHKB 4XC1L 5DJXB 2GAZA 2HH0H 3T77B 3BX7C 1P6AB 3GSOA 1MI5B 3SQBA 3MRPA 5DJZA 4GAGL 4W6WB 1ADQA 1PSKL 1EMTH 5E6IB 3OKLA 1IGTA 4GG6E 2CKBB 1MNUH 3CAFA 1GOHA 1A7NH 1JIBA 4HEME 1PG7L 1SJHA 4MA8H 4XVTH 2ZUYA 4MXQD 1OCWH 4NQCA 3A6CH 1YEGH 3VXME 4EXKA 3HE6A 5I1EL 5C6WH 4JDZB 1A3LL 4NCC2 4PRIE 3NOIA 5GS2D 1XF4B 2BJML 3WN5A 4A6YB 1L9MA 1J1OL 3CIQA 1EFXB 1EZVY 4JHAH 1YJDH 1MQ8A 2ZKHL 4Z7UB 2GT9A 4LSTH 1NC4D 1I8LA 4LRIA 3PWPA 4LCUA 4I5BB 4UBDC 2P5EE 4LLMA 4TVPL 3PE9A 1WEJH 3BDBA 3HG1A 4N8PA 2FL5A 2JK5B 3QCTH 3QNXB 4PJEB 5ENWA 3O4OC 4JKWA 4FQXB 2X6MA 2ZUTA 4YBLC 5LWYL 1H8SA 1P7QB 1DL7L 1UM6L 3RBSA 1S7UB 2MQ3A 1XF2B 5I1CL 2Z9TA 1P5VA 4QRPA 2X4NB 4P23A 4NO5B 1DQJB 5BV7C 1FL5B 2F5BH 2O61B 4NRZB 2AKRB 3K0WA 1C16A 5DR5L 3OGCB 3O3BB 1YPZB 4NNXA 1DN0B 5IIEB 1VFBB 2V5MA 5GGSY 5E6YA 1MRCH 3QDGE 3T1WA 5FYJL 2VDML 4PJBA 3MRJB 3KDMB 2W1NA 5D6DA 1NBVH 3FO0H 4NUGL 1KLUA 1T83C 5I8EA 4ODWB 3GSXB 1QQDB 3IDMA 3EZ8A 4TNWF 2FHCA 5GGTH 4AG4H 1B4JL 2UY7A 4XBPB 2VXTL 4Y5VC 3IFNL 5SWZE 3KPPA 2IH3B 2XWTA 2J8UA 4P46A 1XF1A 4RNRB 2XTJD 4Y2OA 4L3EE 1PYWA 4XCFL 5MENE 4FNLH 4JANB 4X6DA 1VFMA 1T2QL 3QI9B 3FMGL 1D5ZA 2QV2A 2UZYB 5C0GA 4JRYB 5ICXB 5DMIH 3VFWB 4TTGA 1J86A 1JNNL 1F4YL 3VDAA 1DSFH 3TT3H 1U36A 1MHEA 1A22B 4K2UL 1FE8L 4NSKB 4X7DC 1LO0H 2VQUA 1KUMA 1EGJH 4TNVK 4KHXH 1ZK9A 2HVJA 1HHHB 5MEPA 4FZEL 1PAMA 5CJBA 3WNPA 4RSVA 4Z8FL 5IB2B 2VLKB 5KS9A 4IMLA 3WUZA 1X4XA 3WDIA 3C2AL 2F19H 3B9AA 3GMQA 4I13B 4YPGA 1INEL 2DYPD 4YX2L 1ERNA 2IF7A 3V7MA 2IPTH 3V0WL 1EHAA 4CMMB 1TJHL 4LVOB 5CP7A 4HPYL 4HS6B 3NA4A 1N59B 1PZ5A 2V5YA 1DE4B 4WFHD 3U9PH 3TBVB 4CN4A 3SDXE 4M93C 3DO3A 1ZGLP 1U93A 3FB7B 1T1YA 3BKYL 4KQ3H 3GSWA 4FMFA 1A7PL 2V6HA 3WS6A 3TEUA 3ROOB 4XNXL 2OQJB 2EYSB 1ZVSA 2HLAB 3O3AB 1G7QA 5GXBB 4R0LA 3L3DB 1K2DB 4MXQC 5E6ZA 4Y7MA 5DD5L 3OJDB 2WZPD 5B3NA 5KVGL 3MACH 1YN7A 4D0DB 1QFWH 2VXUL 4JM4L 4ZFZB 1GC1H 5JW4R 5JNYA 1XCTA 2IQ9H 3BDYH 3PHOB 1T03L 3FRPA 1U8PA 2YZ8A 4UZGA 3RP1A 5FV1L 3DIFB 5T1KA 3RU8H 1CU4L 1I7RB 2VTFA 3HNSH 4RAVB 4JDVA 4TVPD 4AIZB 1NCUA 4AEHH 4G6MH 3KWWB 1A47A 5GGTA 4DCQA 5D7IB 4YGAB 1E27B 1VFOA 3C6LB 1R3IH 4PJAB 3KPNB 1JV5A 3GIZL 4NN6C 5D6CB 4QHMB 1T5XA 4IRJB 3UPRA 35C8H 1EFQA 2NZIA 4HH8A 2FO4B 2JF1A 1A64A 3FAWA 5FM4A 3QIUC 1LEIA 4M7JL 4OSUL 3RJDA 4MNGE 4CJ1A 2EO9A 4DK6A 4X0KA 1EO8L 43CAB 4MXWH 1NGWA 5IEHB 4YDVA 5FYJD 4EVNA 2EIEA 3KLHD 1FH5H 4N9GA 1U9KA 4Z7VE 2BZDA 3NABL 4U1IA 3GJFK 1RJZA 1Z6JT 2B1AH 5JW5A 1RZIB 3DYMA 5DT1H 1GYAA 4I77L 2R1XB 1R3LB 1EGJA 1MCDA 1R3KA 1AGBB 2IBBA 3N1GC 5JDSA 5KSUA 2AXFA 2HT2C 1L9NA 3SO3C 3TF7C 1KCRH 2FNBA 2V9QA 4OGAD 4ZTOL 3MLSL 4U0RB 4JAMB 2ADIA 1P1ZA 3RWEB 2YA1A 4PJGB 5MEOB 4UOW0 5GSVA 2DWEA 2GAZB 2VISA 3EFDL 4U0QB 3MXVL 1JHLL 3GSOB 3MRPB 3I3BA 4F2MA 2DLEA 2JJVA 5DJZB 1JPTL 2K9UA 4XMLH 3OKLB 1QRKA 4MQXD 1IGTB 4PB9H 3CNKA 5F7KC 4JB9H 1F6LL 1SJHB 4HXBH 4NQCB 3I9GL 5DUBA 5AWNH 2Z8RA 3HC3L 3GI8L 3HE6B 7FABH 4MDJA 3WL9A 4Y1AA 1I9RL 4O9HH 3WN5B 3QXDA 4G7VH 4PLKD 4LSQL 3W0WD 2BSTA 1QSFD 2IWGA 5H2BA 2GT9B 3QRGL 4RDQG 1V3LA 4PJHE 4NUJA 3PWPB 2E3VA 4LCUB 4LLMB 3V95A 3QSKB 3HG1B 2AJXL 2FL5B 5A43C 4C55A 3MGAA 3MLWL 3R0MA 2XY1A 3VWKA 3EO1A 4KKCD 5EU3A 2BRQA 2APXA 2ENSA 2DN7A 1JPGA 3KPLA 4QRPB 4AL8L 2WANA 3BD4A 3D3VE 5HJ3A 1QA9A 2P8MA 4U1SA 5J1TC 1BJMA 5L2KB 2CRMA 1C16B 4AM0A 4D9RD 4NNXB 4GOSA 5HYSA 2HKFL 4HIXL 4ORGA 5D1ZD 2VSCA 2X89A 1F90H 4PJBB 1TQBB 4U6HA 3VGAC 3LCYA 3KJ4B 5E8OA 5FYKL 3V5DA 1XEDA 1REIA 1CFVH 4Z0BH 2XTJE 4R4FH 5J89A 1LO5A 5I8EB 3IDMB 3SDAD 2VR5A 3MYZA 4P3CL 1CGTA 2VIRA 3UZVB 3KPPB 3DYPA 4NOFA 2XWTB 3JTSA 2NY3B 4P46B 2ERJB 2UZIL 1PYWB 3NGBB 5FGBC 4X6DB 1RUPL 3ZYZA 3RTQA 1D5ZB 5DFVD 4BM7A 1OGAA 3T0BA 5C0GB 3I6GB 2ENYA 1CFQA 3SGKC 5JUEH 3Q0HA 5IUSA 1L0YA 4K3DH 1T4KA 5A2KH 1MHHA 5DA4A 1MJ7L 3VI3F 5HY9A 4ZOCA 2OP4H 1MHEB 5DUPL 1IKNA 1FRGH 1F13A 4L29A 1U6AH 3HC4H 4Y5YA 3L5HA 3BPCA 4EI6A 3Q6GH 5MEPB 4ELMF 1KELH 5EIQA 3CU7A 4X7SL 3WJLA 4LSDA 5KS9B 4IMLB 4XCYA 3F7VA 1T83A 1EEZA 4OGAC 5D7LA 1JHKH 1Q9WA 2LQRA 4X6FA 5IT2H 1JRHL 1FNSH 3GMQB 3D9AH 4YPGB 1A6AA 2YKLL 4QRRA 1OSPL 1X4YA 4MGXA 5CP7B 4RMTA 2HAZA 1MIMH 3HTLX 3VMPA 1R5VB 1PZ5B 2Y36L 3QDJA 4J3TA 4KUCF 3DSFH 1E4XL 3EIFA 3P11L 1M6OA 4JM2D 5CJOH 3CFEB 3FQXA 4GMSH 1N3NA 4HUUA 3V4UH 3X12A 1U93B 2EE2A 1T1YB 2DBLH 4LP5A 1WQVT 3GSWB 4MQXC 2WWMD 5GPRA 1YMME 4HC1L 4J12A 1ZVSB 3HE7D 2R15A 5TGBA 1G7QB 5JHDE 3ZE2F 4DGVH 4R0LB 2I25N 5CSBA 5B3JF 5IP4A 4ETYA 3GRWH 1FLTX 4EN3D 1YN7B 4RQQA 4TVPE 4L9LA 1IC4L 1JHTA 1KJ3H 1EXUA 1YEKL 2X9YA 5JNYB 1XCTB 4RFOH 4PLKC 2AJUH 4GH7B 5T1KB 1UA6L 1YQ2A 3ZTJG 4R7NA 1HSAA 4JDVB 4M6ML 4OCYH 3VH8G 4U1MA 4DCQB 4UNVA 4OCXH 1JV5B 4PRNA 3OAUL 4HAGA 4KKCC 1T5XB 1QFUL 3UPRB 1IAIL 1SVCP 2OZ4L 1KCKA 5ICYA 1JNLL 4PJ9A 1OVZA 4Z0XA 4GW5A 3K2MC 1KTKE 3HC0A 5LJYH 1LEIB 2XWBA 1FFNA 4WW2C 4LARL 2ICWA 1X9QA 4Z95H 4X0KB 1TJGL 3ULUF 2HFGH 4HSQA 3VU2A 1NGWB 3MOQA 4KKNA 2XQBH 4YDVB 3C09C 4EVNB 3V6OA 4N9GB 4YDLB 4BFBD 4GQ9H 4U1IB 5FYKD 1RJZB 1CLZL 5JW5B 5HHMD 3WLBA 4ZFGH 4MAYC 1T6VN 2YRPA 3ALPA 1R3KB 5JDSB 4CVZA 5KSUB 2AXFB 4HGWA 3SDAC 1T7XA 5L8KB 3TIEA 5CEZH 3NFNA 1Q1JH 1FBIL 1EJ6A 1WWCA 1RUAH 3BIBX 2ADIB 4JFQA 1P1ZB 1RUKH 4HCRH 2QQNL 4OZGA 3QZWA 4R4ND 1G9NC 2CDGA 1KB5H 1VGKA 5GSVB 2DWEB 5HGGS 2XKUA 5DFVC 2WBWB 2VISB 5E00A 2AK1L 2Q86A 1MFBL 4F57L 2WP3O 4XXCC 1BD2D 4F2MB 2DQCH 1N6QH 5KOVC 1IT9H 1S78C 4L1HA 3LMJL 3N85L 4DUXA 1WFTA 4PV8B 1CXHA 3S88L 5I1GL 4LRNL 3S36L 1JRHI 3L3KA 5DUBB 5CINH 4NC2B 3GRWA 4WV1A 3RUGE 4G6AD 4MDJB 2ITCA 3ARTA 3IDJA 1RZJL 4OFPA 4XNYH 3WL9B 5DF0A 3RVXC 4Y1AB 3QXDB 5EDXA 4M6NH 2BSTB 4XPAL 5EUOE 2OMBA 5H2BB 1NCWH 2KBGA 3BWAA 3X3FH 4K55A 2D03H 4U3HA 4NUJB 2DWDA 2R8SL 1EA9C 1FIGL 5FKPB 1NLDL 1OARH 4PG2C 5FHAL 2ZNXA 2JJTC 1FLRL 4W6XB 4D9RE 3VWKB 5A3ID 3EO1B 5EU3B 1HYRC 1JPGB 3PDOA 3KPLB 4ZDHA 4OZHE 2WWMC 1SEQL 3O6KH 4DZ8A 3HE7C 5HJ3B 5ADPH 1QA9B 3H3BC 2P8MB 4U1SB 2I27N 2I5YH 1NJ9A 2OM5A 1LK3H 5D96C 5I1HL 4QXGH 3L3OA 4EN3C 1HHJA 5HYSB 5ALBL 5FUZL 1ONQA 4ORGB 4XP1L 1VB9A 3MRCA 3MA9L 2AK4A 4TYUA 4U6HB 1CGUA 1RIVH 5E8OB 2R2BB 3V5DB 5FM8A 4CADA 5DHVH 5F7WC 4FG6C 4RAUA 1OT2A 4FABH 1DVFA 1LO5B 4I3RL 5HHOA 4M4RA 3WIFA 1OHQA 4WENB 3JBG7 4ZXBA 2Q87A 1B6UA 2DI9A 2VIRB 4G8FA 1EO5A 2MTPA 4WHYG 3JTSB 4YXLH 2Q8BL 4M48L 4D3CH 2L7JA 4PFEA 3O4OB 4JPWL 1M05A 4HCRA 4GSDL 3G6AA 1HWHB 3CFKA 3RTQB 2EEAA 1KB5A 4RGOL 3BQUD 1OGAB 4ZYKA 1CDBA 1CFQB 4NWTH 5IHUH 4D2NA 2IBGA 2CDEA 15C8L 2VB5A 2VXSH 1T4KB 4R2GB 4Q9QH 4FQIL 1MHHB 3UO1L 5HY9B 4UUJA 4FMKA 3TWCL 2O5YL 4LCWA 1UJ3A 2KQMA 5I16A 1FZKB 4U1HA 4L29B 4KVNL 4KDTC 4Y5YB 2XTLA 1GJIA 3BAEH 3BPCB 4EI6B 1FC1A 2OJZH 4WI3A 4N8VG 5JHDA 1Q72L 2ZCHL 3VXPA 1BP3B 2VDRH 5KVEL 3MLUL 2P48B 4LPCA 4XCYB 3F7VB 3VRLE 2FX9H 1I1CA 1EEZB 5D7LB 3V5HA 2X4QB 4X6FB 4Y4KD 2EO1A 4DQOL 5BS0D 5L0QB 2YHGA 1A6AB 4WJ5A 4QRRB 3H9SA 5HSFA 2A2QT 1U8MA 3STBA 3PP3K 1QVOA 4JQVC 4HFUH 5IOPA 3FTGA 3QDJB 1PDKA 5FGBA 2FEEL 1VSCA 1MH5A 1M6OB 1GIGH 3FQXB 4XPTH 4Z7OF 1GCFA 4OTXH 1N3NB 4HUUB 1UWGH 1T0PB 3X12B 1NC2A 4OLZL 3WCYA 4RGMB 1GOFA 3KHQA 4GBXA 3U1SH 2GEEA 1VFAA 4OD3L 3K1DA 2HJKA 1MELA 4NGHH 3VXOA 5TGBB 3S37L 3ZKSD 4ZOEA 2EZ0C 3TZVD 1U2HA 1YA5A 1CDHA 4YUEL 4ZD3L 2WQ8A 4RQQB 1PKQE 4R90L 3AVEA 4ISVA 1UYWH 4G6AC 4L9LB 1RZKL 1JHTB 1G7PA 1EXUB 1VPOL 4PGZA 4AQOA 2VSDA 3UTQA 4DN4H 3RZCA 5ALCL 3TNMA 5I1LA 5CZXD 2YD7A 1MAJA 4UDTA 3DNKA 4DAGL 1TNMA 4R7NB 2D7MA 5ISZA 4XPBH 1D9KC 1HSAB 5DHVA 5I75C 4K7PX 2DD8H 2NY7H 4U1MB 2CKNA 4BUHA 3TBWA 2RCSL 3JZ7A 1NDMA 4PRNB 4UTAL 3QUXC 1OL0A 2M1KA 2C4FT 5A3IC 2JB5L 1P4BL 1MY7A 6FABH 4QOKA 5ICYB 1TZIA 4PJ9B 4M93B 4Z0XB 4JO3L 4GW5B 3HC0B 3WKMH 2XWBB 1FFNB 3TIDA 1KIRA 1QUNA 2ICWB 3CVHH 5GGQL 3P30H 5SX4I 3OAYK 4X4ME 5HHME 4MA7L 4LDOB 1YY9C 4S11A 3HS0A 5EB9A 5D7JD 5ILTL 3WXWL 2ORBL 1CVSC 4Z18A 4RWHA 1OM3L 3L9RA 1ED3A 3WLBB 3WFCH 1CDYA 5DFTA 1AE6H 4KPHH 4NNPH 4KAQH 1Q0XH 2P7TA 4CVZB 3VJ6A 2YA2A 4HGWB 1QSED 2YBRA 1BECA 1KCLA 2J8OA 4KY1L 4M3KB 3TIEB 3NFNB 1BQLH 1AXTL 1BD2E 4JFQB 4YHLL 2AQ3A 3W39B 4OZGB 3QZWB 1FCCA 5HI5C 2CDGB 4WTWA 2DM2A 4HJJL 3BQUC 5E00B 1FDLH 5ANMA 2Q86B 2DLGA 3IAGC 2QEJA 1CGWA 4IJ3B 2K1MA 3VFOA 1CBVH 1F3RB 1KCUL 3DV6A 3HLAA 3TVMD 2FGWH 2EIDA 2ARJQ 2A77H 4FFVD 4YHKL 3T2QA 3L3KB 5HGAA 3S4SG 2DLFH 5LVEA 1UVQA 2ZCKH 2EDEA 1DEDA 2ITCB 3IDJB 3EDEA 1AJ7H 4Y0GA 1QRND 3GMMA 1RHHA 3RY6C 1OAQL 3BWAB 5DJ8A 1I7TA 1ZAGA 4UAOC 2DWDB 3TCXA 3QB7C 4YNYA 3HAEB 5HDBF 1NGQL 4LSVH 1CK0H 4P99A 3JUZA 2HP4A 4U31A 2A9ML 1LVEA 3ZDZF 3ESUF 1JTTA 3UTPE 1QTYT 3VD7A 3PDOB 4ZDHB 1E28A 4DZ8B 1HYSD 2HFFA 4N0YL 4PJ5D 5HGDA 5GZOD 1YEHH 4Y4HD 1QNZH 4Y16D 1NJ9B 1NMCB 4KTYA 3BJLA 3L3OB 1HHJB 3HHRB 1T20A 4H88L 1QPXA 1ONQB 1RZJC 4JO4H 2CIIA 4I2XE 4IDJL 2DQDL 2P43B 3MRCB 4HPOH 1AFVH 2AK4B 1JF1B 5L6YH 2Q6WA 4APQC 1JVKA 2EDXA 5CZXC 3SGDI 4J23A 2W59A 4CADB 1QBAA 3KPSA 1A6VL 4RAUB 1I8KA 2Z91A 5HHOB 1UM5H 1N0LA 3WIFB 1MRFH 1PZUB 5LGHH 1U58A 1CTOA 4ZXBB 5DJDA 4G8FB 1LO4H 5LG1A 1IC5L 3FO2A 4JFOA 1GGIH 4ZPTA 3REVA 2GFBA 4NKQB 4ERSL 4K9EL 1U8QA 2DM7A 3AY4C 2JJTA 1M05B 3G6AB 3CFKB 4ZTPH 1KB5B 4OLXH 2YD3A 5F9OH 4M43H 1IGMH 4ZYKB 4WI5A 2PO6A 4KGJA 2CDEB 2A6DA 3C5ZA 1K85A 3NPSC 4NPYA 4UUJB 2DTSA 5D7JC 4YHMH 1NQBA 4LCWB 1UJ3B 5I16B 4U1HB 1H0DA 5F9WC 3RIFK 3BESR 1SYVB 3PGDA 4ONHA 3GJEA 3P4OA 3ALWA 4JFHD 5JHDB 1J0KA 3VMOA 3VXPB 4NQDA 1DLFH 1YEDB 5J56B 2IAMD 2A6KA 2AXHA 2GKIA 5F1IA 2FD6L 1UZ6F 3OPZH 1S7WA 2NZ9C 4MJ2A 3MLVH 4JN1H 3V5HB 1U8OA 3I6LE 4YK4C 4P57A 3O11A 1C5BL 4S1SL 4WJ5B 2EH8H 3H9SB 1CLOH 4DKFH 1V3MA 1LNUA 1U8MB 5TE7H 5MP6L 1QVOB 3U0WL 5IOPB 3FTGB 3NZHH 5E70A 1MH5B 3HKFA 3VD4A 1TFHA 1PGRB 4POZD 5DQJA 1NC2B 2IADA 3TVMC 2DI7A 1F4XL 4GBXB 1VFAB 3ZHLA 2HJKB 3VXOB 3VFPA 3VXUD 4PJCE 4RRPG 3RWIA 5JTWA 5T3XH 5F7EH 3WDJA 4D94A 4U7MA 2R0ZL 5JR1L 4ISVB 2BVPA 4NHCH 4X9FA 5DURD 1G7PB 4FTVA 3VRIA 4RGNB 1YEEL 3FQRA 4UMGA 4X6BA 3WYRA 1T7YA 3E3QC 3UTQB 4KUZH 3RZCB 3RA7H 3TNMB 1N6UA 4UDTB 1F4WL 1Y6MR 3OB0K 1MIEH 2LE9A 3VA6A 5ISZB 5DHVB 3K4ZA 4HQQH 4QXWA 4ZS7L 2X1WL 4NOBA 3PQYD 2F74A 4LSPH 1CD0A 3TBWB 2X40A 1CICD 1NDMB 3BH8A 3CLFH 1ACZA 5FM5O 2Q8AH 3EYQD 1NPUA 4QOKB 1TZIB 1KPVA 1HYSC 2R29L 3U7YL 3CDCA 1VHPA 4ENED 3STLA 3TIDB 1KIRB 1I3UA 2GHWB 4Y4HC 4Y16C 3CC5A 4NQTA 3SOBL 4NQED 5DYOA 5IVNA 1MF2L 5FFLA 2X5PA 4M02A 1RZKC 3HS0B 2CXKA 4CRPA 3ELAT 2JCCE 4UV7H 3SO5A 5HYQA 3SDCC 4V2CB 1A6TA 4X7EC 3ZE1F 1PFCA 1VEOA 3L9RB 1ED3B 4PRBA 4F7EA 5C0AA 4P2QD 2P7TB 1Q94A 5JOEA 3VJ6B 2YBRB 3QUMA 2EDBA 1D9KA 3TBYA 2YPLD 5K9KA 1E6OL 1KEGH 4P59H 3T08A 4LSRH 2K7QA 4J3UA 4TUJA 5DD3L 2Y5EA 4IMKA 5DJ0A 3T0ED 4KI1A 3QUXA 1FN4A 3MV9A 3RWCA 1XIWD 4NKOA 5EBMA 3P2TA 5ANMB 1FQ9C 4NRXA 4XNMA 3VFOB 3DV6B 2P45B 3HLAB 3QEHA 3NAAL 3R06A 5D1QC 4I3SL 1KIQA 5M94B 3K8MA 1T1XA 3LRHA 1FSKB 2H32H 4G5ZH 2D7NA 2O5XL 4Y8DC 1TIUA 3E3QE 1IMHC 5ESAA 5HGAB 4OIIL 3S97C 1UVQB 4LSUL 1IM3A 2XPGA 4XRCA 1INQA 2Y23A 3EOTL 1LP9A 3G6DL 3PV6A 1PQZA 3GMMB 3R4DA 1RHHB 1RMFL 1RAMA 3AS2A 5DJ8B 4L4TA 3RNQA 1SJVA 5HVHB 4YNYB 1G6RH 1I9JH 3V5KA 3MRRA 4PJ5E 4QNPF 5JW3H 1UH3A 3KLSA 2Y07H 3WD5H 4AH2A 1JMZA 3KPQA 4YH6A 1E28B 1OT1A 3LS4L 5HGDB 4WWKD 5IBTH 4EDWL 2R0WH 1X6LA 3CVHB 1XH3A 4FFYL 4EEEA 3HNVL 3P9MA 4WUUE 2CIIB 4YHOH 1URLA 3CFBA 1INDL 5KJRL 2IMMA 4OZIF 4QHKJ 2UYLA 4J4PC 3MUZ1 2Q6WB 4N1CA 4OGXL 5J8OA 2BNQD 1MY5A 3GKZA 1GRWA 3B9DA 3DMMA 3QJHA 3KPSB 3MCLL 3TH3T 1H3PH 1I8KB 4EDXA 5AYUH 2Z91B 2HA1A 1OAKL 1U58B 2MNUA 5DJDB 2Z93A 3K81A 3FO2B 3DRTA 1CICC 4JFOB 4WHCA 3ZE0E 4ZPTB 3REVB 2GFBB 5GS0H 1U8QB 1OTUD 2X4OA 5E9DD 4OB5L 2YK1L 5LXGL 2PW2A 1YECH 2X42A 1KGCD 4MJ6A 4YXHL 1RZFH 1JPST 3GSNH 4ENEC 5D5MA 2R4SH 4QHNA 1IAOA 2PO6B 4X7CC 3CSBA 3H7BA 3N9GL 1A7BA 2A6DB 3C5ZB 1PX3A 4JFHE 3SDDD 3WO3B 4NPYB 2F9BT 5EA0H 5D72L 4ZOBA 1H0DB 5C0FA 4G42A 4M03A 2H32A 5GGVY 2QSCL 3PGDB 4ONHB 3GJEB 3P4OB 4Y88A 4K3EH 1N0XH 4MB4A 3LHPL 4WFFD 4F58H 4UT9H 4NQDB 1FNEA 2QR0A 4APQA 3QT2A 1AO7D 3W5MA 2A6KB 5F1IB 3U0TA 1JI2A 1MFCL 1NCDL 1S7WB 3DLQR 1T0NA 2HJFA 3MLYL 1DBJL 1U8OB 3TFKC 2MKWA 4U6XA 4P57B 3O11B 3DUSA 2C5DC 4UIMB 1GVIA 1PEZA 4DFIA 4M5YL 4F7PA 2DJUA 3PGFL 4HHAA 1LNUB 3CK0H 4KK8D 4QEGA 4LLUB 4HH9A 1G6RA 4WEBH 4CBPA 3MLXL 4PTUA 3HZMA 3VXUE 4OCWH 4MLSA 1DR9A 1ZE3C 5DQJB 3AREA 2IADB 5JO5A 3IYLW 1U8JB 1WICA 3LZFH 3O3EA 4J3SA 3VW3H 2NX5A 3VFPB 2B4CC 4LF3A 5DD6A 3RWIB 4JO2H 3JV4A 3JXAA 3MBEA 4JY6A 4FQJL 4KWUA 4CMHB 5GS1A 2W0PA 1CFSA 4UOW1 3HNTL 3JWDH 2BVPB 5F3HA 4FTVB 3VRIB 1W72H 1XR8A 3FQRB 4X6BB 3B5HA 5BVPH 2YD4A 2XA8L 4XHQA 3QUZA 3LQAC 1YEIH 3MJ8A 5CZKA 4XBEL 3EDJA 3LEXA 1ZXQA 1ZT1A 3E2HC 1BZ7A 3Q1SH 4XHJC 1FVEA 4XMPL 2F74B 3W9DA 4GRLD 4F3FA 4UIKL 3BH8B 4NQEE 5CJ8A 1JWSA 3AM8A 4QHLA 1NLBH 3GMOA 1FORH 3QHZH 1KPVB 2E7MA 1BPVA 2C9AA 2RB8A 3STLB 1T7ZA 4WWKC 3GSNA 3MJ6A 3CC5B 3RBGA 1MPAH 1IM9D 2GTZA 5DYOB 3RDTD 2XXCB 4ONFL 4PRAA 5CGTA 1N7ML 4JFYA 4P2QE 1CGVA 5IVZA 3WHE0 3SGJC 4MCZA 25C8L 4YHIA 1A6TB 5JXEA 2YPLE 1JYVA 3EYUL 2R23A 2VERN 1QD0A 4PRBB 4F7EB 5C0AB 2VLLA 3OHXA 1Q94B 3O2VH 3E8UH 3T0EE 4Y4FC 4G3YH 3SKJL 1KN4H 1D9KB 3CFJA 3TBYB 2DQJH 2R69L 1ZLWH 1IGFL 5K9KB 3QCVH 1RZ7H 5HYIA 4YQXH 4OQTH 4ZG1A 2Y06L 1AXSA 2HTLD 5E8EA 3T8XA 4TUJB 5DJ0B 1K3IA 3QUXB 1FN4B 3MV9B 3RWCB 3NH7L 4DEPC 4NKOB 5EBMB 5E94A 2CJUL 4NRXB 4XNMB 1OW0A 3QEHB 5FDYA 3R06B 2JIXD 1KIQB 4RMVA 2CK0L 1T1XB 2BY0A 3P4MA 3BKCL 4XMKL 2MPAL 3KXFA 2RHEA 3NTCL 3TV3H 2C7UA 4DVBA 3LEVH 3NCCB 3JVGA 5JZ7D 5ESAB 1A5FH 5F7UA 2QJDA 3SDCA 2E7LA 3HI1B 1IM3B 3EOBA 4XRCB 1INQB 1LP9B 1AGDA 2P8PA 5FUCC 1CFTA 5D1XD 5IKCA 3PV6B 1I8IA 1YN6A 3QXUA 3GHEL 2GK0A 2NY6D 1J05A 1TQCC 4QYOA 2B2XL 3B9KD 4L4TB 3RNQB 1Q0YL 4JHZA 3RAJL 3V5KB 4U2YA 3MRRB 4KK8C 3FZUD 5C0DA 3U4AA 4JHWH 5CCKH 1IAKA 5GJTH 4NO0A 4UT7L 1HWGB 2XZAH 5EZLA 4AH2B 4LHUA 2FSEA 3KPQB 1LE9B 1S8DA 3KYKL 4H25B 2VL5A 3U0PA 1A7QH 5D1QA 3WMSA 2FB4H 5CGMA 1OD7A 5C2BL 3GKWH 2NTFA 1IGCH 5JQ6L 1Y18A 1XH3B 5FK9A 3P9MB 1XT5A 5I8CA 3F7RA 4KROB 5BZDA 3CFBB 2EKJA 2ZNWA 4WU7A 5C6TL 2UYLB 4HIHA 3W11D 3CJJA 5IW6A 2E7CA 3DMMB 3QJHB 1DEEA 1TTGA 4LIQH 1KXVC 4EDXB 5EO9A 1JFQH 3B6SA 5CWSA 5E9DE 1KGCE 4S1QH 3K4AA 1ZLSL 4F7MA 1V05A 4GRLC 2IC2A 2Z93B 4XVSL 2F53A 3MRMA 3DRTB 3S3SA 1MRDL 4HGMA 5DJYA 4OQTA 3LV3A 2X4OB 3IU3B 2VR4A 1HH6A 2PW2B 2J8UF 3UJIL 1R5IA 5FGRA 4UB0H 1J5OL 1WAAE 3PWVA 5D5MB 4X4XB 4QHNB 1IAOB 3H7BB 3RDTC 4LNVA 1AR2A 3EO9L 3F58H 4WFFE 1D7FA 1F5WA 3CFCL 1SVZA 1AO7E 4XPFH 1HHGA 3BPLC 5FUCE 5C0FB 1ZKAA 5FHBH 4G42B 1HH9A 3INUL 1H5BA 2H32B 5I17A 4Q2ZA 3VDBA 2WINA 4AYFA 3KPRA 3ULUC 2IBZY 2FX8H 3LQAH 4M7ZC 4G7YL 1FJ1A 4J4PA 1NDGA 3VGFA 2QR0B 4APQB 1SHMA 3SCMD 4FQ2L 2EDQA 3QXAA 3SE3A 4J3XA 3U0TB 4NKIH 3E6FA 5HHQA 1T0NB 2HJFB 3DSNA 2FECI 1OP5H 5KS9F 1F3DJ 1CCZA 4U6XB 1UCBH 3DUSB 1YEFH 2VXVH 1FCGA 4F7PB 3VFSA 5A1AA 3GNML 5KSBE 4HHAB 1QO3A 3VI4F 4O5LH 1RJYA 4HH9B 5GGRY 1G6RB 3FQWA 4GRWF 3OJVC 3T3ME 4PTUB 3HZMB 5TE6H 4K3GA 4NBXB 2BCKA 5D71H 3BE1L 1UXWA 4U1LA 3AREB 5EG6C 3GB7A 1OOAA 5GRVK 5JO5B 3M17A 3O3EB 4P4KC 1H3VA 2NX5B 1MLBA 4LF3B 4M1DL 5DD6B 3JV4B 3MBEB 4JY6B 4OT1L 1KACB 5JZ7C 1TZGL 5L7XL 5F9WB 5GS1B 1X5JA 2CGRL 4HKJA 4J7RA 5F3HB 1QKZH 4OLVH 1ZVHA 5E4IA 1XR8B 4I18A 3TP4A 3WHXA 1F6AA 4WEMB 4HUNB 1MAMH 3QUZB 2JJWA 2IGFH 4HDIA 3MJ8B 1OAXH 2NY6C 4BH7A 3B9KC 3LEXB 4CVXA 1ZT1B 5K9OA 4KGLA 5BCAA 5FM5M 1BZ7B 2G60L 2X1XR 1FVEB 1KN2L 3W9DB 3ZL4H 4KKAC 5EZOL 4F3FB 4G9FA 1MCBA 3KGRA 2FDBP 4V1DD 3G08A 4B7LA 1EAJA 1JWSB 4LU5H 4DKDC 1RVFL 4CAGA 3GMOB 5CILL 1CD9B 2W0FA 3F62A 4F37F 5TF1L 4M1CD 3LDBB 5BW7C 3GSNB 4KZEH 1D6EA 3CVIL 2GTZB 5H37G 4PRAB 3ULUE 1P9MC 3S8WA 1JWUA 1BLNA 4JFYB 5IVZB 1HE7A 1NMAH 5AZEL 1NGZA 1Z5LA 3FOLA 4PJIF 4MCZB 1HEZA 2NLJA 4YHIB 1T66D 4Z7NE 2R23B 1G9ML 4PJ7F 3W11C 1MJ8H 2VUYA 4OM1H 2VLLB 3VFTA 5BMFL 3QWRA 5FGCB 3OHXB 1I3VA 4F15C 5DK0A 1A6PA 4P5MA 2ARJA 3CFJB 4H20L 4EXPX 5SX5H 1AXSB 4B50A 1DBML 1KJMA 2ZOKA 3FN0H 4XWOD 1F2QA 1I7ZA 5CJQH 5E94B 5K9QG 4WY7L 3O81A 4YHZL 2DQUH 5KAQF 2DMBA 4G8GE 1UM6H 3KLAA 3OZ9H 1T89C 2LU7A 3CMOH 1A1NA 3GI9H 3P4MB 1S3KH 3KXFB 2VDLH 2C7UB 4DVBB 1GGCL 5L2JA 2YD9A 3I2CH 4L5FH 3BPOC 3SDCB 3EYFA 1GOGA 1CIUA 4OLYH 4YR6A 3EOBB 3N1PC 5B8CA 1FGNH 2ADGA 4HEPG 1A0QL 1AGDB 1RHFA 2P8PB 4GQPH 5IJVA 1CFTB 3D48R 4WUUB 3VG0H 1B2WH 1I8IB 1MQKH 1W72B 1YN6B 5FYJH 3V7AE 4O51A 1RFDH 2Y72A 5I0DA 4Y4FA 5D2LE 2GK0B 5F6IC 1J05B 1B88A 4QYOB 1YNLL 3AS1A 2WP3T 3GBMH 1R3JA 4NUGH 4LEOA 1HK6A 3NIGE 4HS8H 1X5GA 1P4IH 4PTTA 1L0XA 2W38A 2FZ3A 5KANG 4DZBA 4G9DA 4ZAKD 2VO5A 1IAKB 4NO0B 2NXZB 5IJKA 5KW9L 1CDJA 4OM0H 1T80A 5EZLB 3X14A 2FSEB 1MHCA 2EYRA 1S8DB 3HUJF 1MCLA 5E4EB 2DYPA 2VL5B 3U0PB 5D1QB 4XP9L 3NACH 2NTFB 3D39E 4HG4K 1Y18B 3OF6D 4ZSOE 1QYGL 2BVTA 3WO4C 1EHLH 3EKCA 3N50A 5FK9B 2VKWA 5BO1H 3K2UH 5I8CB 1PLGL 1EV2E 5BZDB 4BFEA 2Q3AA 3LKRA 4TUKL 5FUOH 4WU7B 1X4ZA 4HIHB 5LCVL 5IW6B 5JW4Q 3ULVF 3OR6A 4YAQA 1DEEB 5FXCH 4JDTH 3B2UC 3HMXL 4MA1C 3I6KA 5EO9B 3B6SB 5CWSB 2R0KH 4KI5D 4Z8FH 3TN0D 5MEQA 5IVXE 4ELMA 1S9YA 2X2YA 2G75B 4F7MB 3SN6N 2NYYD 2F53B 3MRMB 3ZZ1A 2VDNH 4IOFC 5DJYB 3T3PE 1JPFA 3LV3B 4P5TD 3W81A 4XCNA 2ESVA 4UNTA 1HH6B 4L4VA 4HMDA 3TA3D 1R5IB 3VD3A 4D9LH 4PRHA 3AGVA 3PWVB 1L7TL 1UC6A 3B9VA 4X6CF 2DQEH 2J5LC 1I1AD 1ZHBA 3O9WA 3BW9A 1MEXL 5CD5D 2WBJD 3MODH 4BJLA 2QADD 1PY9A 3KR3L 4MHHG 3X13A 1EIBA 1HQRB 5C0RH 1HHGB 5HGBB 3N0PB 4XNXH 1QACA 1HH9B 5FO7A 1H5BB 4JN2A 1V3JA 5I17B 4Q2ZB 2WINB 3KPRB 1J8HD 3IU4L 1FJ1B 5HPMA 1NDGB 3WBDA 4NP4H 3HR5A 3QXAB 3RI5F 2VUOA 4KRMB 4PLNC 3NA9H 5E5UB 3P0VL 5HHQB 2CMRL 3VFSB 2V2XA 3H3KA 3LKQA 1QO3B 4NZJA 4HLZG 3QCUL 1RJYB 5KG9A 2J4WL 3FQWB 2A9NH 5JW4N 2Z8WC 4E41D 3MV7D 2BCKB 4A6YL 1FO0L 1UXWB 4U1LB 2V5TA 1GGTA 3GB7B 4EI5D 4LASL 3TC9A 3FQNA 3M17B 3JV0A 1KBGH 4RISL 1GHFH 1MLBB 1ZMYA 4X6EA 4DGIL 3D6GA 1FAKT 1P2CA 4QHUA 3ZMRA 3BO8A 4KMTH 4HKJB 2R56H 5J13C 1X5HA 2BVUA 2HFEA 3U4EA 4XWGL 5D2NA 2DKUA 5J1SC 3WHXB 1F6AB 3QO0A 4HDIB 1SYSA 4B41A 1G7LA 5F7NC 4BH7B 4V1DE 1C7TA 3MJ9L 1DFBL 3D85A 5K9OB 2V2WA 4RA3A 1EERB 4FA8A 3KAAA 4UV4L 1HIMH 1LO2H 1KNOA 5GRVL 3T0VA 3U46A 3VXRD 4G9FB 1WTLA 4ZAKC 1GGBH 3VFNA 1JL8A 3G08B 5L8JB 2I07A 5GJSL 2IG2L 1ZGLM 3W0WA 1QSFA 5DQ9A 3WV0A 2W0FB 3QFJA 4S10A 2Y25A 4YC2C 3IDNA 1D6EB 2ZG2A 3CGTA 1OAYH 4JQXA 4J6RL 1JWUB 1BLNB 2K7PA 3RL1A 2PXYD 5C7XH 4WGVB 4N0UA 4JZJC 1NGZB 1Z5LB 3FOLB 4QLRA 3UTSA 4KK5D 1HEZB 2NLJB 4G8GA 1DLHA 3FN9A 4ELKA 3BKMH 4DN3H 2C3WA 5GISH 3ZTNL 1ZT7A 1F58H 4GXVL 3VFTB 4OFKA 5DK0B 1QLRA 1HCVA 1HINH 4P5MB 3TN0C 4YO0A 2ARJB 3PWJA 1CE1H 1B0WA 2KZWA