1XAUA

Structure of the btla ectodomain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
CEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural determinants of herpesvirus entry mediator recognition by murine B and T lymphocyte attenuator.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords B- and T-lymphocyte attenuator
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1xauA00
4Z7NF 1ZHLA 3JZ7A 2MHAA 3KYOB 5FO7A 4LSPH 3IDIA 5T3XE 1V8HA 1HXYA 5DVMA 5B22A 1C5BH 3ARRA 3TCLB 3FRPA 3MNVB 2BVPA 2VAJA 4I18A 5HHNA 5C8JA 2RAMA 1ZANL 4WCYL 1C5DB 1TVBA 2HTLD 5DJYB 5J12C 1U3HA 1DE4B 4JFYB 4RDQF 3RY5A 3MLRH 3OBAA 3ULVF 2NXZB 4TVPE 1C5BL 1CWVA 1VGEH 3OG4B 4OKVB 5IVXA 1CFBA 1GAFL 3BKMH 3MV8A 4LEXH 2RB8A 3JVGC 5IMOA 3L5WB 3NIFE 1BQHG 2Y07L 3DV6B 2AVGA 2CH8A 2XICA 1RUQH 3SE3A 1MFCL 3VGAC 5DRWB 2LABA 4P46B 3L5XH 4P4KD 1NFDE 2CRYA 2W07A 4XVJH 1FNSH 1S7RB 3N85L 4KQ4L 4WJ5A 1G7HB 1N59B 4PD4K 2OTWA 5L2JB 4ZO8A 3U0PA 1I1YB 5K9JL 5DDHB 4YDKL 5DD6B 1E6OH 3D0VA 3G6AA 1PQZA 3PWPE 4P49A 1FSKC 4XWOC 3QRFM 4ODVH 1IC4L 3D9AL 3OR7A 4ONFH 1EIBA 4LP4A 1AH1A 4GJTB 5L9DH 4W6XB 1AGBB 2X9YA 2YEZB 2ZUVA 1I9EA 1QFHA 2AK1H 1K6QH 3OL2A 4WUKL 5KW9L 4NQDE 2WNGA 3KPPA 3O9WA 3RL1B 5I9QC 2VN7A 4D8PA 4PRPA 4R0LC 5FUZL 3D2UA 3FCTA 2ZWLT 1F11A 4OIAA 1RZKC 2EH8L 4JR9L 4QEGA 3DYOA 1E28B 4KROB 4YHPA 3CDFA 2IPUG 1XZ0B 3DGGA 1QFWI 3QI9C 3H42L 3MCKA 2DL2A 1JWUB 2FATL 3FB6B 43C9B 2P24B 3CH1B 4K94C 5IMLA 1NKOA 4NSKA 2YXMA 4YPGB 5DI8A 3FQUA 5IKCA 1NMBL 1GOGA 1DQTA 3OR6A 1T80A 4HUWB 4YX2H 2W92A 5IMMB 1AR1C 3LS4L 4EI6A 1ND0A 2EEBA 4BUGA 1ZLUK 1A1OA 5IWLA 1VEOA 3HR5B 5BRZE 4JFEE 1UXSA 3W5NA 3P0VL 2OBGA 2R29L 1FFOB 1OSZA 2EDNA 1VHPA 1EHXA 5FM8A 1R24A 2R4SH 4PREA 4XNMB 3IXAA 4MSWB 4ZPVA 3PWNB 4MS8D 1L9MA 2R0KH 4H26A 2XRAH 3QAZB 4HIIB 5DMJB 3TLRA 5GGRB 4MHHI 3KJ6L 4PP1C 4LSRL 5CEZH 1OSZB 5D8JL 3O6FB 1JNHB 4H8WH 1MJUL 2W59A 5JUEH 1OWRM 5DD0L 3JV6B 1T89A 4DN4H 2WANA 3BD4A 3CAFA 5BRZB 2LU3A 1GIGL 4L4TA 2QQLL 4UILH 5HYJB 5EU5B 1CGYA 1YMME 4WV1A 2X4PA 3W9DA 3W0WB 3HPLA 1OP9A 4XPGH 2H3NB 2XQYG 4PB0L 5INCB 1ZKAA 4L1HA 3QXTA 4LRIC 1OD9A 1ES0A 4YHPB 5L2KE 2X4NA 4LSDA 1MHHB 5E4EC 5IW1A 2VIRA 4KHTL 1NCDH 4RFOL 2C5DC 5AUMB 5I76A 5GGRY 3WN5B 3PF2A 4PJ8A 4PGDA 5LAXB 5C08A 3F62A 5JIKA 2VR9A 2V2XA 1U3YA 3QUXA 3ZE0E 3S9DB 2XTLA 1RV6X 1AGDB 1FZOB 4JFEA 4XX1E 3U1SH 2HVKA 4MS8C 5I1KL 1I7RA 4RGNC 2ZP0T 3X13B 4CNIA 2ICWI 3ILQC 5EZIH 25C8L 2APBA 5AYUL 2OR7A 5EORH 1JK8B 1ZVYA 4BH8A 1BQSA 2OX5A 5AZEH 1BREA 1SJHA 4PJ7F 4P3WA 5D4QA 4C83A 3BPLC 4K3EL 4Y4KC 5C08D 4YK4B 1MCNA 1M71A 3H9SA 1XGUA 4KJPD 2JLLA 4RZCA 1LD9B 3UYRH 1D9KB 1LDPL 1CFTA 5ANME 3P77A 1MCHA 4YFDB 2QSVA 4Z76B 1FL3A 4R3SB 4APQD 5HGBB 1FYTB 1OQXA 1TENA 4P2OA 2X70B 3TN0B 2OR9L 2X4RB 3PHQA 2Y23A 1RPQA 2EIDA 4W4OA 3DO7A 3V2AR 1XF1A 4C56A 3L6FA 4WI2A 3BOVA 4UOW1 1A9BA 1WISA 4ERSL 1JF1A 1JWMA 2DQEH 2HFTA 3BWAA 1ZTXL 5D7KE 2R4RH 1DR9A 3OKEA 5CCKH 5DVLA 3DSNA 5JMRA 3IAGC 4PJDB 1KIPA 1QSFB 5CEXB 4JZJC 4ZG1A 2PO6A 2DD8H 3C5SA 3MRHA 4O2EB 4MDIA 3TN0C 5DHYB 2GK2A 1TNMA 2PF6A 4LLMB 5IB2B 1Q0XL 4J7RA 1QFUL 3CFCL 3RI5K 4HMDA 4JPVH 4MWFA 1JPTH 3D0VB 5ELIA 1JWMB 3BWAB 5DMGC 3QZWA 4P3DB 3RBSA 4RRPG 4JQVC 4K8RD 4YHNA 3U30C 5HYJD 5F9DC 3LRGA 5EU7E 1GZPB 4EUPA 3P9MA 5CCKL 1U8PA 2ZCHH 1FL6B 4M02A 5BXFB 1AQDA 5F96H 3HZYA 4IBLT 3IF1B 1EJOL 1RIVH 5DQDL 3QG6A 1LILA 3D87B 1UWGH 2BY0A 3DYPA 2VSDA 3GMRA 2NZ9D 4HUUA 5DR5L 3BZ4B 4JY6B 5HHVH 1XGUB 5EBLA 1NEUA 1NSNH 3X14B 2UWEA 2DBLL 5TDNA 1CICC 2L0DA 4NKOA 4IOFC 2Z92B 4GW1A 5J56B 5GRXG 5HPMB 4Z8FL 1IL1B 3BEVA 4AYFA 1HHGA 1J1OL 2Q7YB 4KQ3H 1TJIH 3G5ZA 3D3VE 1G0DA 2ICWJ 4XHJD 5A3ID 5EORL 3X3GH 1PYWA 4MAYD 4P48A 1RZGB 4F7CB 1JMZA 1WQVT 2Z92A 1C12B 3V7AG 5B8CB 2R69L 3VG9C 4XNMA 1KJ2B 4EOWH 3B6SA 3O2DH 4FXKB 4M03A 3HNTH 4OFYA 3LY6A 1FH5H 3KJ4C 2J8OA 2R69H 1YJDH 1Q72H 4UDUA 5ERWA 4U6TA 5HHME 3ZTJG 5MHSE 1H3TA 1KCVL 2B4CH 3VXME 3BGMB 3BHBA 5ECJE 1X5ZA 1J11A 4KQ3L 3T3MF 3T65A 3JXAA 5FKPA 2YD5A 5DJ0A 4TTDC 1A7OH 4CU8A 2Z31D 4CVWA 3GMOB 1T2QL 1EZVX 2NY6C 5GRVK 2E9WA 1D5BA 1U8HA 4TUJB 3QO1B 5D7LB 4RA0C 2QKIB 3QDJE 4GS7B 2BC4B 4LBEA 4XBGA 5CZKA 1KF9B 4X6EA 2XRAL 5KVDL 1LO4L 3VXPB 3QJHA 1AGDA 2UY7A 3WHE0 4BFEA 2J8UE 4OCRH 1F11B 5A3IC 2Q7YA 4NZUH 4U0RC 3HG1D 3U4AA 1DBML 3GMNB 3O9WC 5C09D 4J6RH 1UVQA 4U1MB 1JK8A 2ED8A 3I9GH 4IOFD 4I3SH 1NCUA 2FO4A 4HFWB 3BO8B 3SGDI 3NACH 4EZMA 5JA8B 1FNAA 5IOPB 1AC0A 1MEXH 5DLMH 4KV5F 1QHPA 4HLJA 5EIQA 1TZHA 2IPUK 1MCSA 1M6OB 5HJ3A 4KZEL 1V3MA 5ANMA 2ENYA 3IXTA 3FFCE 1IAMA 1LP9E 4X6CB 1CLZH 4L9LC 1A7PL 4KGLA 4ETYA 1MREH 4HWBL 4PFEA 3VFSA 4UAOB 2BSRA 1G7JA 3JVGA 2V5MA 1T21B 2VDKL 4MCYB 5KW9H 3ILPB 3O45A 1KNOB 2ZCKL 4Z7VE 5GRUL 1MJ7L 4ZUWB 3OKEB 3D0LB 4L3EA 1N5AB 2Z8VC 4AJ0A 5LGHH 2DWEB 3ARGC 1XIWA 3IJSA 5T1DL 5TDOA 1KN2H 3W81A 2H32A 2IG2L 1VENA 4KFZC 2HTKD 5D1ZA 4NOBA 2O26U 4M1DH 4P0DA 5AAWA 1MFCH 5FUOH 2AGJL 4WI3A 3E1F1 3PIQA 1RZIB 4JKPL 2DKUA 3GIZL 5ADOH 3RPIB 2G75B 5DFTA 5SWSA 1WGOA 1GGBH 1UM4H 5ABDE 3SE9L 4U1LA 3T3PF 2YPLB 4ZOBA 5SV4A 3ULUE 2MMXA 1TJGL 4PY8J 3ULUL 3E2HC 1U6AL 5CJQL 1F58L 1OAYL 2VDOH 2XFXB 3LIZH 3DBXA 3STLB 1Q8MA 2ESVE 5DK3A 2CDGB 2VXUH 3F65A 4JFFB 4WUUB 3A67L 4NOFA 4CNIB 2WUBH 3MCKB 2FSEB 3FQXA 4FFYH 2X4TA 3DI2B 2E6JA 5J6HB 3FT4A 4FTVD 4YAQA 4NBYB 3T2NH 3GBNH 1DUZA 4BKLB 1HHGB 2WSKA 4NQVB 4ZXBC 1AD9B 3GGWA 5DHVA 3TH2T 4HS8L 2M8XA 5EU6B 4PJCB 3TBWB 5I30H 3EYVB 3F7VB 1KC5L 2VDML 5ID1B 2EIZA 4OZ4A 4F7CA 1DEEA 1U0QA 3BIAX 4JLRA 2YD7A 4ZDHA 5DFWH 1QBAA 2B7DT 3D0LA 3KXFB 1D5IL 1NDMA 2HRPH 4KK6D 4NC0B 5D8JH 4A2MA 3QXUA 3LKSB 3LKNB 5HGAA 3U9UB 4JFFD 3OXRB 4WUUD 5KAQF 3V6OE 3QQ9D 4FXKA 4N8CH 3MLYH 4PTTB 1HXYB 2HH0L 4ONHB 2GSGB 4HKZB 2EYRA 2R4SL 4JLRB 3STZB 2R8SH 5KN5A 3DUUA 3RBGA 3ROOB 1T4KA 5BJTB 3U2SB 5J9PB 4EN3C 3MNWA 5JORA 1PY9A 3RUGE 4HXAH 3HTLX 4M7LH 3SE8L 1MLBB 3ARTA 5MHSD 3FO9B 1JGEB 3T4AA 3CXDH 1T1WA 1WAAA 3VXSE 2EKJA 3CDCA 4NO5A 4WV1B 4PJEE 4OGAC 5FGCE 4OJFL 2X41A 4BJLA 4DAGL 5J9PA 5GS0H 1VFOA 4YHNB 1R3KA 2HFEB 1CQKA 3Q5TA 2YSSB 2E27L 2OP4L 3THML 2HG5B 4W6WB 3RWHA 5EBMA 3VFMA 3DXAD 5DUPL 5I1IH 3QUZA 1P84J 1F8TL 1TETH 1FN4A 1NUDA 5D9SB 4HJ0C 3VXPA 2AI0H 4X6DE 1N0LA 1K8IB 2FBJL 2NQCA 2G5RA 3ARFB 2A6IA 1HHJA 1NLDL 2MTPA 1EEZB 2D03L 4J8RA 2Q86A 5L9DL 1YMMA 3BQUB 1Z9MA 3PNWB 3RWFB 1RFDH 3K46A 3WHXA 4NYLB 3CU7A 2APXA 4HWNA 1H0DA 4X8JA 5JMOC 3QUYA 3TN0D 2YPVL 1I8LA 1PD6A 4C83B 4MJIE 5DT1H 1GC1L 1J1PH 4NCDA 3DUSB 4PG2C 1BIHA 4EDXA 5IMLB 4OZIE 1MH5B 5J0BA 5EZJB 5DI8B 4NO3B 4N0YL 3VXNB 2DF3A 4IJ3C 2E7CA 3MMEB 2BFVH 1NGWB 1XCTB 5F1KC 1FO0H 5CUSH 3QFJD 4HUXA 5E7BA 5DUBA 1IGCL 2FWOB 5BS0B 2PNDA 2GFBB 4H0HB 3I3EA 1EEYB 3VFGL 4OGZA 1I3GL 4R2GD 1OF2B 4YIQB 2F5AH 4HIJB 4XTRD 1ZANH 4G6KL 3VG9B 3DOSA 1OAQH 3TJEH 3E8UH 2VUOA 4ZFZA 2XA8L 1YY8B 3HKFA 4DTGH 3VE0A 4C4KT 2HRLA 4Z7UE 1IGFL 3MRCB 1EEYA 1JFQL 2XI9A 3GIVB 4M9OA 4QXGH 4Q97A 4F7EA 5IG7B 1IKNC 1BM3H 5C6TH 3C6LB 3D2UB 3KXFE 2IALA 1OLLA 3MLWH 3U0WL 3B9KD 1E6JL 2DN7A 5BZWB 3EOTH 3C5ZA 1IGTA 1RQ5A 2A77H 1K5NA 1IEBA 4XPHL 1Y6NR 3SBWC 4JHWL 5HYJA 3PL6B 4FQLL 2OTWB 4OLZL 2OZ4A 4GXVH 4JPKH 3L3KA 5L6YL 1IGIL 1QUNA 1J0YA 4YK4C 1OAZH 1SEBB 3DO3A 2J8UF 5D6DA 1ZHLB 3ZTNL 1RIUH 1ZK9A 3I85A 3KGRA 1NJ9A 1YEKH 3UTQB 2I26N 1BF2A 1FFOA 2CXKA 1SMOA 1UKTA 3D2UD 4TPRH 3QJFA 3BGAA 1UXWB 5I6XC 3A6BL 4O51B 3BUYA 1KIQB 3KPNB 5JO5B 1R3LA 3AM8C 3IXAB 4MSWA 1P4BL 2P5WE 4X80H 4WTXA 3R06B 3OB8A 1QFWH 1U58B 4O58H 2N1KA 2IPKB 1WIUA 4KK8C 3RA7L 2AQ3A 2NR6D 1ZHKB 1IKFH 3TIEA 1MQKH 4JHBA 4NHCH 4M93C 4JQXA 4OZHF 3QFDB 3GMMA 4BQCA 4DWHA 3QEHB 5IVXF 2H9GA 5HI5C 3CK0L 4E9LA 5FM4A 3GSVA 3MX0A 3CMOL 4LHUD 2EECA 3QIBC 1BECA 2D31A 4ZUUB 4XBEL 1DQJA 5TQ0H 5E8EB 1MJ8H 4MCYA 1MNUH 5MEOB 1J0IA 1Z2KA 1KT2B 3GRWL 1ONQA 3ECBB 4K8RL 4E41B 5GGUA 3OR7B 5E5MB 3OX8A 5DWUL 1KV3A 1UH4A 3ESUF 2HFFB 3SE4A 4IDJL 3K4AA 3WS3A 2R1YB 5LBSL 2JB6A 2DI7A 3T1WA 4OF8A 2H6PB 3VRIB 4U3CA 3ARYA 3B2VH 5K9OA 3I6GB 3X3FL 4K23L 5HY9B 2F58H 2IH1B 4LPWA 5CWSB 3P4NB 4U1IB 3GSWA 1A14H 1ACYL 2QHLA 5JXAL 1V3JA 1DBAL 5DK2A 3SDCA 1YNTA 1CE6A 4XXCA 1HHKA 4NUGL 5DQJB 2XY2A 3BFOA 4GKNB 4ZO7A 1MPAL 4UDTA 3WO4C 1WZ1H 3LSOA 3GSWB 1ZLSH 2VIRB 4PJ8D 43CAB 1JI1A 1ZT4B 3MRDB 5I1GL 4NNPL 1HHHA 1FYHB 1JYVA 2V2XB 2CJUH 3VXRE 2X6MA 4HFWA 1P2CB 4NP4H 5H37G 4PJCA 3TBWA 3T0EA 3MNVA 2UWEB 4Z7UA 4XTRC 1RZFL 1A9BB 2OXGA 1HQRA 1I1RA 4M61B 3KXFA 1LDSA 1TLKA 1LE5A 2PCPB 2IC2A 4H20L 3JTTB 1JCKA 3HAEH 2Y36L 1NCTA 3PP4H 4U1HA 3SDAB 1K4CB 3VH8G 2HTLC 1P7QA 4RZCB 3WS6C 3FRUA 1CDHA 1T04B 3LQMA 4OZFA 1S5HB 3PWPD 4AQ1B 1UEMA 4MWFB 3SKOA 2YPKA 4JM4L 1OAKL 2NYYC 4QRSA 3C60D 4N5ED 4XNUH 4DTGL 2EDWA 3IKCA 4M43L 2RFXB 2DWEA 5D5MA 3DHJA 1G6RA 3K8KA 3BP7B 4P5TD 3BDYL 4TRPH 4N1EA 2XWBA 2JJSC 3KLAA 2MCPL 4NUGH 4UDUB 1FRGL 4R0LB 3PGFL 4RFNB 4Q7DA 5CEYB 3C5ZB 3KPRE 5JZ7D 2QBWA 2MSPA 2BFVL 2YSSA 5IIEA 5HDOA 5TF0A 4JREB 2P8PA 4PJ5D 1T7ZA 3D39D 3LMJH 1F4XL 2E9JA 5MERB 3LQZA 5CGTA 1KEMH 2BMKB 2FEEL 3RWCB 4MMZC 3LS5H 5D9SA 3TV3L 4QOKD 1L6ZA 3EYQC 1G7PA 3Q6GH 3IAQA 1F3DJ 1F4AA 3ARFA 4NN6B 1MCPH 4QF1A 1IBGH 5DMIL 2H1PL 1D9KA 1RFDL 2BY1A 4PG9A 3GSRB 5EOCH 1EHLH 1HQ4A 3V4PL 3I2CL 2ZSWB 2VDQL 3E2HB 4J23A 2Q3AA 2YZ1A 5C0RL 1I1FB 3RX8A 4B5EA 2Z31B 3O8XC 3UP1A 5EU6A 1F02I 1NDGA 2YD4A 2QADD 3X14A 2YBRB 1S3KL 2AJSH 5T1MB 4LCYA 4PV8B 1HHIA 3CGTA 2PYEE 3WL9B 1KPVB 2R9HD 3NZ8B 4XP9L 5GS0L 3PWNA 1D6EA 2VZTA 4O58L 4NO2A 4YZFE 2X2YA 3KWWA 4LPTA 4Y4HC 5DEGA 4KK6C 3OKMB 3MREB 5FKPB 4NQTA 4XAKE 2VLME 1AGFB 3WEXA 5J89A 5FV1L 4KK9D 2EDQA 4GAJH 1B4RA 4E41A 2P1YA 5ETUA 4TPRL 4GRLC 5KSAD 4K94L 5BRZA 2ZOLB 5GSRB 3NCJH 4ZAKB 4L5FL 4GW4A 3P4OB 2DQDH 2BC4A 4U7MA 2NY6D 3MCLL 1MFEH 4JG0H 4LKXA 1U3HC 4P23A 1IAIH 2AJUL 1I9RH 1L7TL 4L9LA 1IC5H 1YDPA 5FGRA 5L6YH 1ETZB 3BSZL 3MROA 4ZNEE 1CXEA 2PYEB 3VXUA 3H6JA 4JM2D 2EE2A 2VLJE 3PL6A 4IS6B 3BGFB 2VXVH 3KPPB 2WP3O 2WQRA 1N8ZA 2BHUA 5I19H 2D7TL 1I7RB 1IGFH 2R2CA 3N1FC 1L0QA 3BDXA 4PJAF 1RZIA 4RRPA 1BOGA 2R0WL 1A3RH 3OPZH 1VFBB 2R1WA 5IBLC 5ICXA 4FTVA 2PKDA 2QHRH 2NW3B 2CDFB 3LVEA 3VJ6B 4OCYH 3K2MC 1NGQL 5E94B 4AEHH 4U1NA 5E9DD 5J12B 3A67H 2BJMH 5CKAA 3BUYB 1N5YH 2XWTB 2JIXA 1J8HE 4TSCL 1U6AH 5CJQH 1PX4A 3DMMC 2BSRB 3BPOC 1I1AA 2ITDA 3SOBH 5J13B 1A47A 1IGJB 4XC1L 5SWZD 3QUYD 2NNAB 1DP0A 4J4PC 3MGTA 3AY4A 3VXMB 3WUWB 1WIPA 1EH9A 3TZVC 5IFAH 3I50H 5DRZB 2DI9A 3PV6A 1U8NB 4S1SH 4HZLA 1PG7L 3PWPA 4HUXB 2CKBA 3B4NA 4OLXH 1FVDA 5DMKB 1U93B 1YEIH 3AREC 2E7LC 1JPGB 3R0NA 1YEHH 3QWOB 3CJJA 3UTSB 3DTXA 2ICWB 2AV7A 4PJDF 3KLHD 3S36L 1CN4A 3W82A 2G5BA 4WI6A 1DBJH 4MJID 1QVOB 3AY4C 2I24N 2E9IA 4J3SA 2ZCKH 4JFPA 4U0RB 3SDXB 1IM9D 3IKKA 1BJ1H 3QDHA 5DJ2A 5ADPH 4YHZH 4PJGA 3CUPB 3SN6N 3PQYA 4H8WC 1TETL 4QHUB 3I6KA 4OF7A 3MV7A 3GMNA 3LRSA 4LCCB 1UVQB 2C1OB 5IJKC 3N1GC 1WCBA 2GY5A 5IV2B 5ITBL 4DAGH 4L29B 1KFAH 4RFEA 1C1EL 5C09B 2P5EA 3QULB 3CUPA 5L2KB 3O4OC 1DUZB 3MYJA 1S9XB 4JM2B 5I1HL 4S1SL 2YK1H 1KPUA 5DJXA 4WW2A 4W4NA 3UAJC 3CVIH 4LNRB 1S7QA 4PJAA 1CXKA 2AJVL 3I50L 3NABH 4OZIB 4O00A 5D1QA 3SDDB 3LD8C 1CFNA 2W9DH 1IEAB 4KKCC 4O51A 1F45A 2J88H 5C09A 2Q8AH 4K3HA 4TSCH 4I48A 3KPSD 2YD3A 3JBG7 1CDBA 4OAWB 2X42A 3WSQH 5TPWL 4OSUL 3H9SB 1U8MA 1X4YA 3HE6D 5DMKA 1NC2B 1BX2A 5ICYB 2X4TB 3HFML 2F53A 4ZD3H 2FD6L 2Z8RA 5B8CA 1WWCA 4XMLH 4GKSA 3L5IA 2R0WH 3C8KB 1S9KC 2ARJQ 3D3VB 5KSBE 4JFQA 1RUPH 1WBXA 4F8QA 1IQWL 2C26A 4LVHC 3VCLB 3WNKA 5EZOH 4PBWD 3TO4C 1G9EA 3N0PB 5DUMH 3BE1H 3UTZB 5AG9A 4Y4HA 1B2WH 5GJTL 1RIHL 5SWSD 2C4FT 2KBGA 3IDXH 5C07A 3GJFH 1WFOA 1VFAB 2EDTA 4HJJH 1P1ZB 1YYML 2F8VA 4OSUH 4AZ8A 1KLGB 1I9RL 2HLFD 1TTGA 1FH5L 3ESVF 4OLUL 3MV8B 3LKQB 4OZFH 1P9MC 5ESAA 4PP1D 3CCHA 3O2DL 5GQBA 2XN9B 3NCJL 2H3NA 3ROOA 5HXMA 3EJJX 3C5JA 1FGVH 1FGNL 3EOYG 1R0AH 2VUYA 5ADOL 1ADQH 2ZCLH 1P1ZA 3DI3B 4AIZB 3P9MB 5IW1B 2JB5H 15C8H 4KXZI 3JTSB 3SDXF 3GIVA 4LLWB 3CPLA 4Z0BL 3VFRA 3X3GL 2VLJA 4LIQH 4HKXB 1ODAA 3BH9B 4M1DL 2FB4H 4TSAH 3FKUS 4NGHL 4QWWC 5L88L 4HHAB 3L3DB 2NW2A 2MHAB 4PJDE 3ARUA 2DQFA 1WF5A 5D71H 4KTDL 1KJMB 3U36B 1UM6L 5DC9B 1JYXA 3C60B 3MLTB 3QHFH 1KN2L 4Z0XA 1K3ZA 2V6HA 1CF8L 3LKPB 3ARDB 4ZUTB 1P4IH 3JWOH 5MI0C 5LXGH 4M93B 4QRPA 4JKWA 5JNYB 1WITA 3STBA 4I3RL 5HYQA 1BBDL 2VDKH 4XPTH 1KULA 1MFDH 3BKJL 3WN5C 2WQ8A 3MRIA 2KQNA 3V0WH 4EJ1C 2VRAA 3S36H 12E8H 1VGKA 4JZJB 4NQUA 1CT8A 4DOHE 3BVNB 4LRIA 4YR6B 1UXWA 4F9LA 3BYTA 4HUWA 5T1LD 1OCWL 3LKRA 3VFSB 1R3LB 5HYQB 1R5VA 1QD0A 4BUHA 3NCBB 4HQQL 2XZZA 4D9RE 2AEQL 1MH5A 3TH3T 3O4LB 3CX2A 4EQ3A 1KCRH 4U31A 4YHOH 5DZOA 4U1JB 4GW5A 2GEEA 3SOBL 1AGBA 4WO4B 5E1AA 3TT3H 1KJVA 1F6FB 2VISB 2BNRA 4HIJA 2VYRE 4JN2A 1CYGA 1NGQH 4ZS6C 4R97B 1CDJA 1EEZA 1FVCA 2Q1EA 1JPFB 1R5WA 3FQRA 3HNVH 1CFQB 5DD5H 2QQKL 4LOUD 3UCRA 3V6ZB 3H9HA 5E1AB 4YXHL 1ZLVH 1JZ3A 4OZGA 5HYJE 3ZE1F 2ZUUA 1MF2H 3W0WA 4BZ2L 4DKFH 4LHUB 1A1MA 1PKQE 4R96B 1FP5A 4LCWB 1FQ9C 1PEZA 4LAQL 1WBZA 1JZ2A 2VDLL 4H5SA 3H7BB 3QYCA 3DUSA 3OJDB 3QO0A 4WO4D 3Q5YA 2GJZB 2UWEE 3V6OC 4RAVA 1BOGB 4OCSH 3RGVC 1G9NL 1FIGL 2O5YH 5D96B 5AYUH 3KYKH 4X7SH 2PW2A 2NY2B 3ARGA 2XKNA 4LGPB 5IR1A 4JRYD 4WEUD 5FUCE 3MCLH 4YDLB 2NY1B 2FHBA 4LDLB 3FN9A 4HCRH 3MGTB 3L3HA 1JNHA 4RWYH 3UXFA 1S5IL 1BBJB 5EU6D 3ARSA 1JTPA 3TP4A 4ZFZB 4U1KB 5GS1C 2XQYK 4JRXE 3DRTB 4DCQB 3GJEA 2P5EE 5JR1L 5D7JA 5E6IA 5T33H 5HYSB 1IJ9A 1U58A 4GAYB 2AJZB 1GJIA 1XGQB 2CD0A 4OM1L 1FE8L 4YXKL 1NC4D 2E6PA 4YDJA 5JQ6H 4MAUL 1INDL 4R97C 4G6AD 1GIGH 5FV2A 1Q9LB 2AXJA 4DGYH 2Z8WC 1IKNA 4L9DA 3FOMB 4XMPL 3QDAA 1Q9KB 5TF1L 3MUHL 4MJ6B 4JKMA 3BHBB 3RDTB 2MFNA 3HZKB 3D1MC 1JGLH 3A6CL 5C08B 3KNBB 3V52H 1I3RB 3VFPA 5LWYL 4X4XA 5DRNB 3UYPA 2B0SH 4URTB 5FDWA 4GRLB 1SEBA 5DWUH 1R3KB 2DWDA 3QI9D 3ARBC 3KHOA 4HEPG 4D0DB 5DF0A 1G6RB 1IFHL 5DMIH 2BHZA 3H3BC 4UIKH 5IB3A 1VFMA 5F96L 4FQ1L 4NCC1 5TFSL 4LFHD 5CKGA 1I8KB 3VD9A 3HI6H 4F7PA 2IAMC 3BH9A 4HKXA 4L4VA 1PY4A 4B50A 4K7FB 4Z7QE 1HKLL 4XCNB 4GMSL 3N1PC 4LSTL 3U36A 4JRYB 3RNQB 3CFJA 3RA7H 1BIIB 4APQA 2HT2D 4Y89A 4F7PB 1FSKB 4U33A 1A2YB 5T1KA 5E8NA 5T5FH 1NFDA 2AQ1A 5DFVC 2OL3A 1FCGA 3P9WB 4Z6AT 3T0DA 1BQHA 2C3HA 3LB6C 4DZBA 3GB7B 1ZT1A 4XPBH 3GSVB 5B3JE 1J0JA 1JRHL 2A9NH 4U6VH 4JB9H 4PG9B 2EIZB 4OZ4B 2OL3H 1K6QL 4WUKH 1QFOA 1X5LA 3BRDA 2WWKT 1CU4L 1DBKL 1OP5K 2XACC 3OJVC 1I1FA 1MFNA 1QHOA 4CVUA 4LIQE 2QSCH 5GS0C 4Q6YA 1RZJC 3QUZC 4OUOA 2DQHH 1MVUA 3KPSA 3VMNA 4YPJA 5D7JC 5C0AD 4K3EH 2H26B 3FO2B 2A77L 3L9RB 2BOCB 3S98A 3QZWB 4R26H 4PRHB 4X4MA 4ZO6A 1RI8A 4L8BB 2C1PA 5CEYA 5DVOA 5IB4A 4HG4J 5E2UH 4YBLB 4LNVA 5TDOB 3RAJL 3RVWC 3N1MC 3U4EB 4LEXL 4XNYH 5I8EB 3X17A 3OF6A 3U1SL 4OIIH 1K3IA 4Y4FB 4LVNB 3P30L 5EO9A 3VFWA 2P8MB 4JFOA 4I4WA 5FOBB 1EJ6A 3PQYB 3B2UD 1CIDA 2RFXA 4JKKA 4LASL 4MZ2A 3IGAB 2WBWB 3AU1B 4LPUA 4KXZH 1HWGB 4G42A 2FJHA 4G8GB 3K0WA 3BJLA 4WWKA 5AYQA 5EULV 2EKSA 4LLWA 4XNZB 3QZWG 5D7JD 2A6KA 4XNQA 3FB5A 4Y5VC 3CSYB 4ONOA 3SO3B 1K8IA 5DD1H 1C7TA 3S4SA 2F9BT 4G6FB 3G04B 2IPTH 4YHKL 3VH8B 3MJ6A 1EGJL 3QCVH 1RUMH 2UYLB 1RUAL 4Z77B 3DROB 1EBAA 1H3GA 2VXQH 4CBPA 2YUZA 2D3VA 4IRJB 4J2XA 5HHMD 1HYSC 2P8LB 1AQKH 3MRMA 3S35L 3VI4F 1FDLH 3LOWA 4U1SB 3W0WD 2DTMH 3MOAH 2ERJB 3QNYB 4JZNA 3HRZA 5F1NB 5CBEA 1A6ZB 2NTSP 2R9HC 2VITA 5IK3B 2BRRH 5CS7A 4JFHD 1GGCL 2IFGA 4MNGA 1B9ZA 5CLWA 2APVA 4HV8B 3OAZH 5EOQL 1YN7A 1JMXA 4R90L 2J3SA 3FO1A 5JW4Q 2YD1A 4M4RA 5I1CH 1A6ZA 4OTXH 1H3UA 3BDBA 4HDIA 4XVUC 2IAMD 3TF7C 5FYLE 1ONQB 4MNHB 2EC9T 3JV6A 4BM7A 1INEL 4JHZA 1KLUB 3DV6A 3WNNA 5K33A 2HFFA 4JPIA 2VDNL 2JJSA 2I07A 1KCUL 5CIPH 5DJ8B 5HDQH 5A2KH 1K85A 1ZXQA 3H42H 4GRMB 3MUGA 5EU7C 2H6PA 5EU3A 3LRHA 4UUJB 1JF6A 1NCCL 1U92A 4MJ5B 4X4XB 4XNQB 3A6BH 5FDWB 4EI5C 5I1CL 3PL6D 3QQ3A 3HE7B 2X9XA 2ESVD 5D7SL 2W9EH 1VFBA 2NLJB 2R1WB 3V6FB 5C0EA 1YNTB 4JE4B 4NWTH 5GISL 3GSOB 3EJYC 4E0RB 2UYLA 5D7IA 8FABA 4LLVB 2Y7QB 4XPAL 4M1GL 1RJZB 4KUZH 4V1DB 2W65A 1CDYA 3MOAL 3IVKB 4KTEH 1MHCA 3DETC 4Q0XH 5I15H 4HEME 4ZNCD 3PDGA 3DX6A 5KAQG 5C0BA 3IFLL 2NTFA 3FB6A 1MI5D 1RJYB 1FVEA 5DO2D 4X83A 1JL8A 4MA1C 4G6FD 1MHEB 5IQ7H 1BM3L 2DLGA 4KMQA 1FBIH 4UTAH 1EZVY 3FB7A 3OKDB 3T0ED 3QUML 1AO7B 5E8NB 4NZJA 5JO5A 4R7NB 2HVJA 3EYSL 1P9MA 3NH7L 1FG9C 5D1ZC 1GVIA 1BVKB 2LTQC 3TO4B 5JIHA 2AJYH 2FZ3A 4LPVA 4XB7A 2DQIL 5DD3H 1AGFA 3D39E 5F7DA 1TVHB 4UIMB 2F5AL 4YQXL 1LEGA 1S7VA 1RZJL 2P47B 4FQCL 3DHMA 4YHYB 1TFHA 4PP2B 4JFDD 3SY0A 4QKXB 4KDTA 1QTYT 1AE6L 4WHDA 2YA2A 5F3BA 2D7MA 4ZS6D 2CUHA 3L3OA 3FHAA 5DA4A 4UINL 1MCLA 1FBIL 1X4ZA 1HCFX 5E2UL 3MRQA 3ZHLA 3D85B 3E3QC 1J18A 4S10A 3PWPB 3OXSA 5JOPE 4R26L 3CSPA 3WD5H 5L0QC 5F3BB 4KU1A 4PTTA 4Q0XL 4PRDA 2QR0A 5I66A 1IC1A 4S1DC 3B9EA 1ZVSA 2IG2H 1W8NA 2IJ0C 5IGXL 1MCWW 3MXWL 4OI9A 4R0LA 2YD9A 5T1DH 2H2PC 3RIFK 1DBKH 1UJTA 4LMQE 1IEHA 3PE9A 1Y18A 1MLCB 4IHOB 3LEXB 2WW8A 3VRJA 3SDDA 4NNXB 4YWGH 3PDOA 2BMKA 3RWCA 4PJ8B 1XF5A 2D7NA 4I5BA 3V5HB 4PTUA 5C6WH 2E5EA 5J1TC 1H15A 3MRPA 4KH2A 5F1SA 2DJ4A 2GSIA 4G6JH 2Q76B 3ULUD 5TH2A 4RBPH 1XR9B 2EDRA 2X09A 2OP4H 2L4OA 3THMH 5D2LB 1Z9OA 4QRRD 1JF5A 1EVUA 5DLML 4ZDHB 1U8QB 3MPCA 3BRGC 1LGVA 3AM8A 4WY7H 4U1SA 5EN2A 3RZCB 5C09E 3ZKQD 1JNNL 3WMSA 3WLWC 1H8OA 4KKAD 4OB5H 4Z7WF 1INQB 2Q87A 1M71B 2BVTA 3HR5A 3FQWB 3NGBB 4NKMA 5T1LA 3T0EB 3H8NA 3TBYB 1P4LB 4J6RL 4KK8D 4MNGE 3UYOD 2EE9A 1W72A 2GYSA 4EI5A 3AVEA 3QIWC 3OKOB 2LAAA 2O5ZH 1UWXH 3BW9A 4MYWB 4OCRL 1Y6MR 2Y6SC 5E99L 2BRRL 2ILLA 1K4CA 5GRZA 2BNUA 5C1MB 1XGYL 3CLFL 2H9GB 1RURL 4XAKD 5MEND 1T7YA 4OM0L 4FQIH 5CJOH 4HMEA 2YA1A 5GGTL 5DJ2B 1P4LA 5D7LE 3C5ZC 4PLJC 4DW2L 2VXQL 5E9DE 4JQVA 3BQUD 3MJGX 2VDMH 4JHAH 2EDFA 1AXTL 1MFAL 4PJBF 1Y0LB 2YN3A 2IPTL 4OKVA 1JPSH 4PYGA 4GBXC 4LKXB 3MLXL 4MAUH 3BD3A 1HSAB 3QQ4B 2V2TA 4LSSH 4NNXA 4RAHA 3IU4H 3T2NL 1KTDA 2VNCA 3LPWA 2CGRH 1F4YL 3MJ7A 2FX9H 1DQDL 4UTBH 2F54D 2NXYD 5I75B 4JY5H 4LBEB 1YJDL 5H35A 4GG8A 1JN6A 1HIML 1KLGA 3GI8L 3BQUC 4AK1A 3B9VA 3QXDB 3SQOH 3IF1A 2EH7H 4ZTPL 1G7HA 4ODTL 5JHLH 3MRKA 3DVGB 4JN2B 5DQJA 5FYJE 2D9QB 3OQ3B 5GGQL 3GMRB 3SDDD 2F53E 2WIIA 4HIHA 4C58B 4L3ED 4MQXD 5SV3A 3TCLA 2Z91B 3G04A 1VPOL 2MOVA 4E42A 3QIUC 5KSBA 1EAJA 1Q0YH 4KK5C 3ZKND 3RTQA 2VLLA 4ODHL 4OCSL 1XH3A 2EIBA 3FB7B 2JIXB 1D5XA 1EEUA 4MQSB 4WWKC 3RRQA 5JDSB 2DQHL 1RMFH 5E9DB 2QSCL 1PX3A 1IZJA 1KB9J 1HN1A 3MRJA 2FH8A 3B5GA 5F88A 5B4MD 5ACMA 4P9ML 1F6AB 1NL0H 1DTUA 1QRND 2O61B 1TVDA 5B39G 4P23D 4U1HB 3MRIB 3VXRB 3MXVL 3WFDH 4F15C 4XPBL 1UWGL 2ZSVB 4PRIA 5EBWB 4POUB 3BIKB 1T03L 1RIVL 1HOCA 1I9JH 2HJFA 4JPWH 3L3HB 2JJTA 3IDJB 4X5WB 3VA2C 2WLYA 2ADGA 3AXLB 3LKRB 5FECB 4GMTL 1VESA 5FB8B 1XGRB 4MHHG 1U8IA 1Z5LB 1OVZA 2FX7L 1D3CA 5D7JB 4OBRA 4OLVH 3EHBD 3GEWB 3QDGB 3VFRB 4DKEL 4I9WE 5I74C 1FC1A 4X5WA 5D2LE 1H3PL 5D2NB 1YDPB 5C7XH 3PIQB 5TFSH 3OJDA 1MRDL 1YQVL 5LGJB 2R4RL 4LCCA 1NJ9B 1ZTXH 1OTUC 3B9KA 5KSBB 3VD3A 4NSKB 2C3VB 1KJVB 1PDKA 3CFEB 4B0MM 2DQCH 2V9QA 5DJDB 3V0WL 2HLAA 5LWYH 5HY9A 3QIWA 4CN4A 1EUTA 1B4JH 1OT2A 4OBSA 2V9RA 4Z7WB 5MENE 5FFLA 3TZVB 3JWOL 1A6UL 1TIUA 4XMPH 4P9MH 2JJWA 3QEQA 2DM4A 5AUMA 1LK3H 1OL0A 2NW3A 1T2QH 1QSVA 1WIOA 4BK5A 4OLYL 5D71L 1DFBL 4OM1H 3GK8L 1BP3B 3TPUB 1WFTA 5T33L 4YGAB 1IAIM 1X6NA 5E24E 3QI9B 2YR3A 1MIMH 1QACA 5D1XC 5DYOB 2Z0BA 4GKSB 4K71C 2J8HA 1Q72L 5E2VH 4JG1H 2EDKA 5FYLL 3V5KA 2VZVA 2FIRT 1U3HB 5EU4A 1ADQL 2UUDK 2ZCLL 1ERNA 3PWUB 1S7VB 3HNTL 1JNLH 4N0FB 2AXHA 3B8SA 1SY6H 3OG6B 1Z5LA 2CLVA 2X1PA 1F5WA 1ZHBB 3QDGA 1FAIL 4KHTH 2K3TA 1UFUA 3QWRD 1RJLA 2GKIA 3GMPB 5EOTB 1JUFB 1FIGH 4ELMA 1RIHH 3QWQB 1E27B 3RL2B 4LVEA 1S5HA 1RK1B 5DRXB 3L6FB 2GJJA 2B5IC 1F2XK 1JPSL 1J1XH 5IWLC 1AXTH 1MF2L 4JHAL 2GTZB 5GS1B 3HE7A 1OLZA 3KR3L 1JUFA 3QO1A 4M9PA 2AJXH 4N0RA 3O8XB 5HHVL 1LVEA 1KELL 2AEIT 2CO6B 3VFMB 3ZT5A 2LV4A 4FFZL 3VWKA 5MEPB 1M7IB 4QTHB 5DD5L 5I73B 4N0CD 1RURH 2NY1C 3CLFH 4Z7NE 1I9IL 2FR4B 4NQDD 5E99H 3ZKSD 1U3JA 4P2QB 2LVEA 5J8OA 3GSUA 2ZCHL 2APTA 3KPRD 5JXED 3UDWC 3SDCC 1BZQK 5EO0B 3K1KC 2WBJA 1U8QA 4L4VB 3NTCH 3L7EA 2SEBA 4YO0A 5BO1L 4HQQH 4N0FA 1J88A 3O8XD 1XAUA 4F58H 4EVNB 4JGJA 5CBAA 2NZ9C 2VDRH 5CSZA 1QSFE 1T5WA 1BVLA 5F6IC 1N6UA 2H26A 5IF0B 2LAGB 2DQEL 2X4SA 2YC1A 4Z18A 1W72B 1T0PB 5DJYA 3SE3C 5JXEA 1MAJA 3GHEL 3L7EB 1LEGB 4KV5E 4OZHA 3E6FA 1YPZA 3OXRA 4G3YH 5FF6B 4HKJB 4PJ9A 3WHE1 1OF2A 2DQJH 5IB5B 3P3YA 3HMWL 1FL5B 3SDCD 3STZA 1NL0L 1FZJB 2ZUWA 5JOPD 4RFNC 3M07A 1LMKA 1U8PB 5HYSG 3FB8A 3OXSB 3B2UC 4H25A 4DKAA 2VO5A 4I18C 4FQXB 4QOKA 2BY3A 1CGVA 3V4VL 3N85H 5B3NA 4QNPF 1NAMA 1EDQA 2CKBL 4TSAL 1WWAX 2H2SD 3IETB 5F3HB 2CIKA 5BV7B 5ETUB 1Q0YL 2BERA 3RVWD 3WXVH 1BD2B 4FQ2L 2V5SA 4GW4B 3RDTC 4J3VA 4LCIH 4Z77A 3BKML 2JK5A 3JTSA 1XF4B 4PRAA 3UZQA 5IV2A 3GI9H 1WAAE 2QSTA 1OB1A 5EG6C 3TVMA 4Z78A 5F89B 4QHNB 2ZG3A 3VXOA 1HWHB 1NCDL 4J3UA 1WK0A 4M6OH 4RAVB 3ZE1E 2C9AA 2OSLB 3PWLB 4WU5B 1KSRA 1XR9A 4XX1G 2VH5L 4E0RA 3C60A 3MLTA 1BJMA 3SBWA 5IKCB 4P2QD 1FJ1B 2CLZA 1B0GB 4GUPB 3KPNA 4U3HA 4FNLL 3BRFA 3S8WA 4D94A 2OLDA 3IS1X 3QUMH 2QQLH 3MLXH 5CGYC 2P43B 3JV4B 4UTAL 1HYRC 2DMCA 4DZ8B 4PJ9B 4KK9C 4PY8I 5ALBH 2F54B 1CI5A 3UJTH 1P84K 3WEXB 2QEJA 1I4FA 2BNQB 4KKLD 3QEQD 1KLUA 3WFHA 3W2DL 3JWDH 3AS0A 1YNKL 5IB1B 3M1BB 5TE4H 1XGYH 2CLVB 4FFVC 3ES6A 4U6HB 4XI5C 1RAMA 1T0MB 3QNZB 4DZ8A 4UMGA 1G7MB 3KDMB 5IEHB 3IDGB 3LKOA 4NWTL 5ANMB 2JE8A 3U46B 4JFFE 4WUUE 2HAZA 2N56A 3EOBB 3O4LA 4DQOH 1DUYA 4R4NC 4N0UB 3OX8B 3RY6C 2HKHH 4HIEB 4BH7B 1CGUA 4YLQT 4OCMC 3RIFF 3RJQB 1MRFL 2R29H 4QHMB 3LH2H 4M5YL 5H2BA 5IFHL 2D2OA 2FL5B 4L3EE 1JGEA 2DLHA 2X4PB 3MNZB 4XP4H 3W9DB 1CFVL 1QFWM 5C92A 3LS4H 1CICD 1NBYB 1C1EH 4UU9B 5EUOB 4YBHA 4LVHB 4G43B 1DUYB 2WM0A 3QA3A 1INEH 3SPVA 3AAZB 1DLFL 5ITFA 1R5IB 3ZDYE 4GG6F 5C0CB 4JDTL 1QRNB 1CCZA 5MEPA 2NTFB 3EYQD 4NJAH 4YBQC 1SEQL 2X5PA 2JIXD 4YDIH 3F5WA 1S3KH 1ZT7A 2AJSL 5FK9B 2NCMA 3QEGL 2XT1B 4G7VH 3QIBD 3FN3A 1IM3B 1TZGH 1XMWA 5J6GB 1UACH 1FG2A 2BOBA 4QHUA 1U8OA 3H2WA 3GSOA 2NNAA 5JHDD 3D9AH 5DMGD 3MV9E 5JOFB 5KS9B 5F7DB 1UJ3B 3MXWH 4MX7B 1G6RL 2IADA 4JANB 4ZTOH 3V5HA 5K9JH 5F71A 1H0DB 4X8JB 3RVXC 2P48B 1Q94A 2EYTA 4CVXB 3RVVC 3ZHDA 2I60L 3UTSE 3K1DA 3W5MA 4L1DA 3W39A 1PZ5B 3TEUA 4M7JL 5CHNB 1CFTB 2FSEA 1OGTB 3D25A 4KKBC 1T20A 4C55A 4D0CA 2MCG1 1CT8B 5F88B 3OGOE 4JN1H 2QSQA 4PJ5A 1CFSA 4RBPK 5F1IB 3O0RH 1X5IA 5HPOA 3DV4B 4WO4C 5KVEH 5KZCB 1VGEL 4KJQC 3KPSB 3S4SG 3FQWA 5D96C 1A6TB 4YXLL 3RKDC 2Y25A 4A6YA 2WWMD 1FL5A 4GAYA 1CGTA 1R3HB 5FGSA 4WU7B 2ICEB 4D9QE 3OKLB 4N8PA 5K59E 3CU1A 4FG6C 3HZMB 4L3AA 3CVHH 3WKNA 2XWJA 3CD4A 3FB8B 3FL7A 4N9OB 1YEDB 5HGGS 3FT2A 2OK0H 3EYSH 2QQNL 1FNFA 3ZKMD 4F37F 2AXFB 2E6QA 3B43A 3EDJA 5JPMA 3NN8B 5D6DC 4QYOA 5BV7H 1UWXK 5K9OB 2BNRB 5L8KB 3P0YH 1BFVH 5FDYA 3U2SA 1UQSB 3L7FA 3TO2A 4J4PA 4DK3A 5IJKA 4LCWE 2AW2A 1IGTB 4UV7L 5TE7H 3NA4A 1DQML 4U1GC 3MA7A 3KYMA 2FECI 4QRUA 1CLOH 3DARA 3NFSH 4KUZL 1BLNA 5DHVB 3VXOB 4R7NA 2PTUA 4P2QA 3WNMA 2PW1B 2CJUL 1J8HD 1RZKL 4L5FH 3RVXD 2OL3L 2Q6WB 4TUOA 2FZ3B 1JZ8A 2A9NL 2G2RB 2Z4QB 1IC7L 2OS7A 1A2YA 3G5YB 3VXSD 3PWJA 3TO4D 1DBBL 1HHJB 1WBXB 3RUGA 3VFOB 2WIMA 4O2CB 4QXUL 4PRBA 3MV11 4F9PA 2R23A 4QRTB 4JRXB 3RFZC 1NKRA 1H3VA 1DBAH 4R8WL 2XZAL 5KSUB 4LSTH 3DGCR 4R3SA 1HKLH 1CBVH 2AABH 4P2OB 3TN0A 2ADFH 5F7YC 5K9KB 2PO6C 4JZJA 3FRUB 2D31B 5C0RH 4K9EC 3HB3C 1BFTA 1T7XA 1S78C 3BPLB 5F9AC 3MODH 3ZT7A 3FN0L 1EHLL 3ZMRA 5E56A 3SGKA 2OMBA 3CX5K 5DS8B 1YUHA 5IB4B 2YUVA 3WV0A 4W4OC 1Q9KA 3ARVA 4G8EB 3V52L 3RP1A 3T65B 4DVBA 4O02H 4PRPE 1F42A 2DTML 2BVQB 3KPTA 1HKFA 3MV9A 5FGBA 2Y5TB 3AFLA 1U92B 5TQ0L 1EXUB 2ARWA 2IANA 1S7TA 4JGMA 1LWRA 4P4KB 1VSCA 1RUAH 1NCNA 1CD0A 1JV5B 1CBVL 3U79A 3LMJL 3G6JE 2Q7NA 3AC0A 2R2HB 1V3LA 1ZAGA 2V7HA 1E4WH 1FE8H 3HZYB 4LLAA 4YXKH 1UYWH 1S7RA 3VGAB 1VB9A 6FABL 4MQ7A 1EXUA 1JGUL 4F7EB 3ZL4H 1QFWL 3UTTD 1HH9A 3WCYA 4G8FB 4OFVA 3CVHB 5DK0A 1P4BH 4F9LC 4QXTB 1Z6JT 1BFSA 3MFFB 3NCYP 3KLDA 5ICXB 2KL6A 2X89D 2YEZA 5JW4M 3U7WL 4ZXBD 3CFJB 2B1AH 3VI3F 4OD3H 3NFPB 1HYSD 3ZDYF 4GG6E 4NKOB 4XMKL 3KPSE 3MRLB 4DUXA 32C2B 2R2EB 5FHAH 3VWJA 2XV6B 2VSCA 1IL1A 4ODWB 5I17A 4B53A 1C5CL 1VADA 1QQDA 3UBXI 3QO0B 1AD0A 1BQLH 3JV4A 1A1NB 2UY6A 4D3CL 2ZSVA 3KYKL 3VU2A 3BJ91 5CAYB 5EUKB 2F15A 3WUWA 1FFNA 3ULVE 4JFDA 4BQBA 1CFSB 1CGSL 3QP3A 3L5WA 2DBJA 4MNQD 4P2CG 2AJ3B 4NZDA 1DQLH 2H8PB 1YN7B 4WV1C 1BFVL 1KBGH 5ID0A 4WFFE 4G8IA 4PRNB 5BV7L 5I1LB 4ORZC 3VFUA 3MR9A 2OJZH 5HTSA 4XCEB 1PZUB 1HXMA 5KOMC 2GTWB 2J4WH 4TQEL 4MLSA 4HH9B 2OK0L 3HNVL 3O6KH 5I0ZA 3O4OB 1I7ZA 4WI5A 2A1WL 3EYUH 4FZEH 5B39B 1WBYA 1A6WH 2EC8A 3INUL 4AH2A 2FL5A 5F97E 3SCMA 2YMXH 1BZ9A 3MLSL 5FYKE 1SJVA 3FCTB 1JGUH 1AI1H 3OAUL 3I6KB 4MXVE 3VGHA 2W1NA 3QQ3B 3QCTH 3MA9H 4QXTA 3UMTA 3FRPG 4KKNA 4X9BA 3FOMA 4KZDL 3RWHB 3SPVB 2FO1A 4RQQA 4CADB 1R5IA 1CICA 1AIFB 3BN9C 3I6LD 3IGAA 2RR3A 35C8L 1S7SA 1X5AA 4ODSH 2VLLB 4NDMB 3UPRB 3OR6B 5DJCB 3WJJC 4M7JH 5FK9A 4R4FL 5F7MC 3ARED 2EZ0C 4WFGE 1A22B 2NMSA 4HGKC 1DVFA 5D1XB 2WV3A 3QPXL 4WTWA 2BVOA 2Q6WA 3QI9A 3QXVA 4Y16B 3DX7B 1Q9WB 4F15B 2YA0A 1RD6A 4GKNA 3V5KB 4NQVA 1JGLL 3A6CH 1MJ8L 1NGXA 3O2WH 4GKOA 5JLZA 1ZGLP 1NLDH 3B9DA 1OOAA 3G9AB 3OGCB 3V6BR 3CSGA 4P5KA 4DUVA 1PG7W 3HNSH 4X9FA 2AI0L 4R4ND 4LEOA 3QEGH 4EXKA 2IMMA 5FYKU 4CVZB 1SEQH 3VXNA 5T1MA 1ZLUH 5J11B 4XVUD 2WBJB 2W0LA 3EFDL 4BFBD 5JXEC 4H1LB 2QADC 1DLFH 2JJUA 4P5MA 5LG1A 4FFVD 1Q9OA 4Y7MA 5GZNC 1J0HA 5JW4R 1BQHB 1WZLA 2AK4A 2IGFH 1WBYB 3M1BA 4U6YB 4MJ6A 5GRJH 5SX4I 4CDHA 2XTJB 1PVHA 3SGKC 1RULH 5GZOD 4MD0B 3HPLB 4RGMB 4M5YH 4UQ3A 1V5JA 3RVUD 1Y0LA 1T6WA 4D0DA 4DK6A 4LF3A 4ZAKA 5ALCL 3WUZA 9CGTA 4ZFFA 1MCWM 3QQ4A 1HSAA 3HUJB 3MUJA 3BN3B 3MRCA 3O3AA 3EZ8A 1T1YA 1GOFA 4L9LB 4QRSB 5EH1A 1AXSA 3RU8L 5D1XA 1ZHNA 4ODXA 1GZQA 3BH8A 3VI3E 3WIIH 1QBML 4P2RE 3BAEL 5DHYA 2GITB 1D7FA 3O3AB 4QHKJ 3PDOB 4PRID 5GZOC 3IETA 5F3HA 4LLVA 4PV9B 3GUTB 2IH3A 3WDIA 1IM3A 2CXGA 2WIIB 1S9XA 1UJ3C 3EO1A 3SDXE 3QUXC 1CIUA 2P5WD 2QQKH 2QQNH 1R3JA 2BHYA 1LD9A 4UBDD 3NA9H 4FXLA 1SJEA 3ARDA 4ZUTA 2UZXB 3JUYA 3GSQB 4M61A 1KN4L 1WT5C 5FCUL 1I3GH 3QUZD 5IESH 1Q9OB 3SDAA 2JCCA 5ESQA 4LLUA 3E6FB 2G9HA 3NCYS 2BCKB 5ILTL 2PTTB 5I18H 3EW3B 4S1RL 4YHOL 1M05A 3R8BB 4UV4L 3R4DA 3TYGH 4UIMA 3MOBH 2VJXA 3H9YA 3GDBA 4IRSC 1OGAA 3W0WE 4ZFGH 4EVNA 1J10A 5IT2L 2EZ0D 4Y19E 4JO4H 1U93A 3RZWA 5IB2A 2OTUA 3BT2H 4P9HC 2YPVH 3O11B 3HMXA 4L3CB 6CGTA 2ZJSL 1WFUA 1HZHL 3UX9B 3RZCC 4PB9L 2GTZA 5GS1A 5BJTA 3WFHB 4K2UH 4U1JA 3NZ8A 4HFUH 2IBZX 2DM3A 1MFDL 2BVEA 2FJHB 4G8GA 4XPTL 1I7TB 2P44B 3MOQA 2VISA 4CU6A 1PFCA 5T3XH 4A6YH 1JZ5A 1KCLA 1S7TB 2VLKA 1KTRL 4N0UA 2CIIB 4K3DH 1AGCB 4X6DB 1JV5A 4PB9H 3RVTD 3QXAA 3H9HB 4PLKC 4I0PA 1XF2A 4JO1L 1S7SB 2YZ8A 4YFLF 4IRJA 3LQAL 3HI1A 4OIBA 2ZUYA 2GQHA 2GCYB 2XY1A 2P5EB 2R2BB 5F7KC 5EO1A 1ETZA 3VWKD 2AEPL 1CFVH 4XP4L 1XT5A 3NACL 3HRPA 4PJEB 1BQUA 2QKIA 2C7UB 4X5XB 4F7TB 1KJMA 4PJFB 3I9GL 4I0PB 2ESVB 1S78D 4XBGB 1GPOL 4HGWA 2HKFL 3LAFA 5D7IB 3L1OL 3T4YB 4MAYB 4X98B 4EI6B 5BS0D 2HT3D 2FJFB 4OV5B 1LEIA 2VC2H 4S1QH 5KTEH 2HH0H 1YEGH 3MLYL 2KH2B 1QQDB 1DQQA 4WFFD 4AEHL 3MREA 4OCYL 2DYPD 1OAXH 3NA9L 4TOYH 2XXCB 4LGSB 3W2DH 2ZG1A 3B3IA 4PUBH 4KK5D 5M7QA 4OUUA 4LSUH 4WGWB 3NVQA 3P11L 3VDAA 3KR3H 3G6JB 3GMMB 3BE1L 5DEFA 5DUML 5KSVB 3BMVA 1D5ZA 5I30L 4V1DD 1TQBC 1RUPL 3VW3H 4MJ5A 2D0FA 4LSUL 4JFXB 4XMLL 5KVFL 4PJXA 2CSPA 3B83A 4U4BA 4WHCA 1SYSA 3HFMH 4ZD3L 3V5DA 5D5MF 4PP2A 3EFFB 4PGEB 5H37H 2NXYC 2WZPD 3PHOA 4U6HA 3L5JA 4S1QL 3U7AA 3BIBX 5HHXH 4XZUA 1O7VA 3TWCL 2HKFH 3EOBA 3RHWK 2E7BA 3G6AB 4GBXD 4ISVB 3P4NA 1JE6A 4U1IA 3T3ME 1FNEA 1SYSB 3TCXA 2FX8L 1P7KB 2Y6SD 5FYLH 2AJVH 3AB0C 5LGJA 1FZKB 2XTJE 1KTKE 2OQJA 3WS6A 5DHVH 1FVEB 4LARL 2DM7A 4JANA 2VXTL 2IH3B 2IGFL 3MTRA 1T22B 1RSFA 1J1OH 4ZO9A 5GRWA 3CVHA 1DFBH 4NQCE 3SCMC 3F6IA 3L3GB 3G08B 1KXQE 2IQAA 3QB7C 5CHNA 4FN0A 4G9DA 2J12B 2P45B 1JPST 1C8PA 3HC3L 4FQQA 4P57A 3RX7A 3ULSB 5CGMA 3CH1A 2DBLH 3B3IB 1FLRL 4JDZA 5ADPL 1NSNL 4PJ5B 5ICZA 1QYGH 5L2KA 2D7OA 2J6EA 4YO0B 2YS4A 5GRUH 4HUVB 3DV4A 5KSVA 4WW2B 2BCKA 4Y1AB 3I2CH 3MYZA 2GJ6B 3QDJB 5HYIA 4JFFA 4WUUA 4WDIA 5INDA 1UADC 1A6VH 3IDMA 4XT1C 3O45B 1C12A 3GHEH 4M7ZC 4OZFG 1EJOH 5DYOA 3K8MA 3MLPA 4IOSD 4CN1A 2XPGB 4QRRB 3OKKB 4KZEH 3ARXA 1RJCA 2W60B 2H8PA 4OZHB 3TIEB 5FO8B 5I1JL 4F8TA 3CFBB 3RVTC 5CSGA 2VDRL 4C59B 1H3PH 4MZ3A 2H32B 2XG5A 5E08H 3S5LA 1NMAH 3NZHL 2R0ZL 1F4XH 1NMCC 3MC0A 4Y19D 3FO2A 3L9RA 5I1EH 4XCYB 5A40E 3TYGL 2ZUSA 3MFGB 4UV4H 1I8IB 4PJXF 2XZQL 3D48R 1G7QA 1FNEB 3JV5A 3RX5A 5C0CA 2OXHA 2YMXL 5BQ7B 2NXZD 4L4TB 3MA7B 1ACZA 3BDYH 1B90A 4LCUA 5FCUH 3RWJB 3G6DH 1BMGA 4KRMB 5CSBA 4PTUB 1HEZB 3WFDL 5E2WL 3GBMH 4NQCA 5D6CA 3TJHD 5SWZB 3WKML 2BRQA 3SDDC 1A3LL 2PYFA 2X4NB 3BZFB 1J8KA 4P46A 4BQ6A 4C56E 1REIA 1UT9A 1JZ4A 3K2UL 3V6ZA 1UZ6F 2YD2A 3SDCB 1NPUA 3FFCD 3OV6A 4YBLC 1GH7A 3UC0L 2C3VA 1CXFA 4O5LL 5DD6A 2JF1A 3I02A 2VAAB 5GS2H 5D6CB 1QSEE 4P4KA 1UQSA 3L7FB 1TZIA 4Q6IB 2HFEA 4LVNC 1UWEL 2HT4D 3PWLA 4WU5A 3S3JA 4FTVB 2BVUA 4ODHH 1KCVH 2B4CL 1X6LA 3PJSB 1KTLA 2ZUQC 1Q9WA 3G5VB 4LU5H 1XIWC 2E8ZA 1QP1A 3WE6B 5FKAB 4O2FA 4FQJL 4PJ7A 1P7QD 1JTOA 1LEIB 4XI5D 3MLZL 2J6EH 4JG0L 1UH3A 2BXZA 4QT5A 4Z7OE 2J5LB 2DQDL 2EDDA 3QDMA 3R8QA 3ZSTA 5I73C 4ODTH 4RGOH 4KWUA 2B1AL 2V2WB 5E95B 1UB5A 1NLBL 4MA8H 1JZ6A 2AV1A 1WZ1L 3F7YA 4X6FA 1A1OB 3IJHA 2OTPA 1DQDH 3SEPA 2X1QA 3NCCB 1CLCA 2D0HA 3MRBB 5F8RC 3DO7B 3V0VB 5IQ9A 4CMMB 4HJ0D 4EI5D 1T2JA 3N9GH 4NZTL 5J13C 3EOAA 4L3EB 4FQXD 4GRWH 4IMKA 2A6DA 4LQFL 3GSNH 3KVQA 5H2BB 5DZLA 1NGPL 4MA7H 4GRLD 3VRLE 4HAGA 3FHQA 5FYJH 1D5MA 3CDGB 4PRIB 1FORH 3DVNB 5GGTH 4P23B 2CPCA 3QUZB 1I7TA 3MRKB 4D8PB 3EKCA 3V4PH 1AJ7L 1AP2B 1SYVB 2R0KL 3I02B 2P8MA 3QNXB 1NCBH 2RCSL 2WBKA 4UT7L 3RDTD 2CIIA 1WT5A 4FA8A 3EDEA 4X7TB 3UO1L 5E70A 1JHKH 2OQJB 3S6CA 3FT3A 1F90L 4TUOB 1U8KB 1Y6KR 2K1MA 2VZSA 1VA9A 3BKYH 4PGZA 3U0PB 3QULA 3VWJB 4DKEH 4ODSL 3KPLA 4BSVB 3UPCA 1QFUH 3CFCH 1LHZA 4OLVL 3FFCA 4WW2F 4PJHA 4XVSL 4XCNA 1G6VK 3IRZA 2IQAB 4HX1A 1MHHA 2FX7H 1TCRB 4R7DB 1QNZH 5JA9A 4OI7A 2DD8L 1IEBB 3MRJB 3U9PL 3P2TA 4APQB 4OZGB 1A8JH 3GSRA 5KS9F 1T1XB 4F80A 1DLHB 1K8DB 4RMWA 2DMKA 5BMFL 4N5UA 4JPWL 4QRPE 1I9JL 5IROA 5IVZA 2HVJB 4H5SB 4QRRE 3EYVA 4IOIB 5CBEB 4YWGL 1M6OA 4RMTA 1VKXB 2F54A 2AK1L 2D0GA 5DA0B 4ZAKC 3IFNH 1T5XA 4JFQB 3C9NA 4NN6C 3F7QA 5I8KL 3TFKD 4ODVL 3VCLA 1NAKL 5I6XB 1SBSL 5J11C 1RMFL 1TQCB 3R06A 4J3OC 4NHUA 1EHNA 3ZDXF 2Y36H 1BPVA 2Q8BL 2WINA 4LKCB 4JHWH 3P77B 4KQ4H 4UV7H 5TE7L 5ESVB 4HLZG 3QNXA 3QEUA 1ZHKA 4Z7OF 3O9WD 2WAHA 1U41A 4P9HH 4N8VB 1BQLL 1Z3GL 1LQSR 2HWZL 2JKXA 1CL7I 2X4RA 3PHQB 4G8IB 3QG7L 1JFQH 4QXGL 5JW5B 3JWNC 4OF0A 3O2VH 5FHAL 1WSST 1HSBB 3BUTA 5C0BD 4AENB 3TJEL 2HVKB 1I7ZB 2EH7L 4FQCH 4MMXC 4TUJA 5A16B 3DGGB 1KGCD 2UV3A 4M7LT 1FZKA 5CINL 1NQBA 3JWDC 1L9NA 5CD3A 4LGRB 5CIPB 3UROR 2R2EA 1TDQA 2FX9L 3EJYD 4Y4KB 3RTQC 5K9QI 1ES0B 4BYHA 1HDMB 2ORBL 1DJSA 3TIDA 4M1CC 5HGDA 4OQ1A 5C08E 2VOTA 5IQ7L 4X7DC 5E5RB 1MFAH 3WJLA 4CVZA 4PG2A 1R6VA 1FFNB 2NX5E 3UTPE 3G5VA 4AMKH 5TDPB 4ZUVA 5GGVY 3I3BA 1T5XB 1J1PL 1FZMA 4WFHE 5DT1L 4AG4L 3MRMB 3KJ6H 4PJ8C 2A83A 4OT1H 1YQ2A 2O5XH 3LB6D 4Z5RB 4LP5A 1KUMA 3SJVD 5HHQA 2EEAA 4K9EH 5E2TL 5IJVA 5BW7A 3EYFB 5DFVD 1IGJA 3QCUH 3QXWA 5FA3A 1TZHB 4KTYA 4NWUL 1HINL 4HV8A 1YEEL 4POZC 2OYPA 2X4UA 1TZGL 3BW9B 4LLQA 5JLZB 1URLA 4TN9A 5MI0B 5IVXB 2V5RA 5GZND 4QRQA 4MDIB 3RIAF 2AABL 5E8PB 3IU3B 4O9HH 4X9HA 3L3OB 1A0QL 3VRIA 4EXPX 4LFHG 1EMTL 4GRWB 3REVA 3BEWA 4YHLL 5AG8A 1I3VA 2VDNH 4GW5B 1LP9A 4PS4H 4X4YA 2XWJB 3EFFA 4XCCL 3CSBA 4FMFA 4Y5YB 4QXUH 4WJ5B 5J3HD 5JW3L 2R0LL 2EH8H 4JR9H 2IWGA 4P2RD 4EDWH 3DXAA 4NKIL 4UDTB 3CMGA 3RY6A 1HI6B 2P7TB 1JP5A 4U6XB 1S9VB 1ROWA 4DVRL 3BGMA 3C5SB 2R8SL 2DICA 3FMGH 4G5ZL 3LEXA 3Q1SH 4Y1AE 4IMLA 3U6RA 4RDQG 5IMKA 2VLKB 4JM2F 2EEDA 2W65B 1FDLL 3U7YH 1GZPA 3PABB 5DJXB 1S9VA 1OPGH 4LNRA 4XB8A 2P24A 3MBXH 3RNKB 1ZA3B 3VGEA 3D3VD 4NYLA 4DJMA 4P57B 3ULSA 1B88A 2DLIA 4S2SB 1NCWL 1GGIH 1CD9B 4X4ME 1JVKA 4YHML 4GAFB 5FO9B 1LO2H 3CX5J 2XN9D 4RMQA 5KJRL 3C60C 4N5EC 2ESVA 3W9EB 3RNKA 3CVHL 4JFDB 5I16B 3K81A 1RZJH 2BOCA 4XP6H 5C0DA 5H94A 4BQ9A 4Q9QH 1EAPB 4OQTL 2MQ0A 2HT4C 4WHTA 4JZNB 4DFHA 3G5XB 2ITCA 4BA8A 1VFUA 5IBTL 2VL5A 3NGBC 4R4BA 4XNYL 3ULVD 4PV8A 4NKDA 1ZSDA 3RAJH 5EA0L 1EFXD 1N0XH 1KCKA 4U05A 1VFAA 1WFNA 5FB8A 4NZRH 3SGEH 1AQDB 1R3IL 3S88L 3QG6B 2BVQA 1GSMA 1WAAF 5IG7A 2CUIA 4KY1H 1TQCC 2AXFA 3O11A 4GO6B 5INCA 3CCHB 4HUUB 2XKSA 2X1OA 5D7KD 3OKNA 3EJZC 5MP6L 5ACZB 3AMKA 1I85A 4MJ2A 3MRGB 4FFWC 5DJCA 1CG9B 1FV1B 3GSQA 4GKZB 5GS3A 1DN0B 3MRFA 1F8TH 3QH3B 1TXKA 4MA3B 3TA3A 4OV5A 1IQDA 4BSVA 5JW3H 1I7UB 2I9LB 4JDTH 3T0XA 4F33B 1LO3L 2Q86B 4HWUA 4I77L 2F19H 1A6AA 1F97A 2YN5A 3WDJA 4EKXA 3I6LE 1E4XI 4WNQA 3Q6FB 5F21B 3HE6A 4HK0A 1EMTH 3KPOB 4MLIA 4XGZA 3HN3A 4NQCD 4Y4FD 4TVPL 2DDQH 5E03A 1A9EB 3DX6B 4QRTA 4LAJH 3TBYA 3HB3D 1IT9H 4EDXB 4GRWF 2V2WA 5F9JA 4JDZB 4HS3B 4WNQB 4P5MB 5ICZB 2PCPA 2PUQT 4KROD 5BCAA 3PWUA 3T09A 1N7MH 5E6ID 3RGHA 4Y4FC 2O61A 4MQXC 1NCBL 2ZOLA 1MCQA 5GSRA 4DCQA 3P4OA 4RWHA 5E2TH 1P7QB 4X6FB 1AJ7H 3QDJA 5ID0B 1XGQA 1MY5A 5GGVL 3BIKA 3DMMB 1KELH 1AY1H 3SKNB 1B0RA 1ULVA 2ED9A 3ULVH 1NGPH 1P5UA 4Y5XB 4AMKL 5IUSA 2VZ3A 5ALBL 4LF3B 3AAZA 5ITFB 1JGVH 4LQFH 2GI7A 3WJLC 2KDGA 1A7OL 1XF2B 1JYWA 5C0BE 1T83C 2ORBH 1ZS8A 2IANE 4Y1AD 5DD1L 2YD8A 4FNLH 1KNOA 1J86A 1G9MH 1V3KA 4P46D 5CWSA 3O3DA 1WWWX 3DLQR 3MNWB 5HDBE 5JORB 3GSXA 3CC5A 1FAIH 2CMRH 4LASH 1CE6B 2G5BB 1BAFH 5K93A 3S7GA 3QXDA 4HT1L 4HCRL 2CRMA 1UCBL 5GJSL 4B7IA 3BO8A 4M7KH 5EC1B 4Y19B 2P42B 3BZ4A 1YC8A 3EO1B 4QF1B 2M26A 4WFHD 3MFFA 2HT3C 4LU5L 1W2KT 4P9HL 1T20B 2AGJH 1ORSB 5JOEA 4HS3A 1IAOA 3FQUB 5AD0B 1UG9A 1A7BA 2JELL 4MB3A 1FHGA 4KJQD 1TMCB 3DBXB 4OLYH 3A0OA 2Y5EA 2PXYC 4TYUA 4Z8FH 4O5LH 3UC0H 2DMBA 1SBSH 4BZ2H 3QPQC 3V8CA 4NRXB 1WEJH 1CU4H 4WFED 1LE5B 3IFOA 1A3LH 1O5DT 3SJVE 1EUUA 2B39A 4Y1AA 3MBED 3QFDA 5E2WH 2GJ6A 4KJWD 4ZFOL 3F7VA 4Y16C 3G6DL 4Z7QF 1KEGH 5E6IB 5MEQB 4A2LA 4G7YH 5GGRA 1KB5L 2BVPB 4IIQC 4MNHA 4PRHA 5MEOA 5ERWB 5T5FL 1XGTA 4X6BB 4ISVA 2FRGP 2IBZY 5EOTA 3JWOC 1N6QL 4GQPH 2V17H 1H8NA 3MUGB 5AWNH 2D4FA 4F58L 2IBBA 4ZFFB 4GMSH 5FGCB 1DDHA 3K4DA 4S1DD 2UVFA 4RFEB 4PJ9D 5D72L 1SHMA 3V9FA 3VDBA 3BKYL 4PLOB 1A64A 4ZFOA 5I1JH 1BD2A 4AL8H 1OCWH 1NAML 4YH6A 4KVNH 2ZUQB 4M4PA 2XTJC 4G9FB 1P6AB 1KOAA 1A4JA 3BZEA 5DJAB 1A6VL 5E6YA 3TZVD 1H8SA 3DNKA 2LE9A 3X12A 2HLAB 1CVSC 5IM7A 4M8QB 1NBQA 1WEJL 1BX2B 2DJUA 3S97C 5ICYA 1X5XA 5FA4A 1DEEB 3GJFK 2EICA 3UYRL 3MRDA 4QO1A 3F8UB 1U2CA 2F5BL 3KPRA 1NFDB 2VAAA 3GFUA 3N9GL 1AKJD 4WI9A 5KVGL 2SEBB 2CK0H 1I1AB 2ITDB 4NM4L 1KACB 3ARDD 4RX4A 2PTTA 2VABB 3ALXA 1N26A 2NPLX 1G1YA 1PLGH 4JRYE 3PV6B 5HHOE 4X6BA 2X4SB 5I1KH 3QUYB 5GGQH 2HJLA 3B8YA 5CGYD 1SY6L 2VR4A 4Q58C 1T66D 1JNLL 3TBTB 4JDVB 4OLUH 3U30B 2GHWB 4GFTB 3MBEB 5C0IB 5I75C 2VXSL 1PLGL 1QBLH 5E1HB 3HE6C 4OCWH 2VZ1A 4U7SA 4XH2B 4KAQH 4UTBL 2ZPKH 3ZO0A 5DJ8A 3BPNB 1F4YH 4Q9CA 1G9ML 4JFPB 1QPXA 1N6VA 2VDLH 4J3TA 2P49B 4N9GA 3RL2A 4JDVA 4NPYB 4FTVE 4G9FD 1T0NB 1RK1A 3O6FA 3QA3B 1T89C 3ECBA 1EBPA 3JSSA 5TGBA 5IW6B 1P7KA 3PG2A 2F8OA 5DD0H 3P11H 5KSAC 4H8WL 3RVUC 3BI9X 4E42B 5DTFB 1I85C 4IHOA 3O8XA 4M62H 4LSRH 3I3DA 4KRLB 1OHQA 1F6LL 3UDWA 5F9WC 4WWKB 4Z7VB 1YMHA 5GXBB 5HBBA 1WICA 3KPRB 5EPMB 1D5XB 4Y19A 3SKJL 4UOJA 4PJ7B 4H0IA 4Y4HD 4EQ2A 1A3QA 2R2BA 3ARDC 2KKQA 4AEIL 4JREC 3ALWA 3FONB 3HPJA 1JGDB 3NIDF 2CDEA 1W72L 5EBLB 4TVPD 4YHIB 3VFTB 2OR8A 5C7XL 3EDDA 4FRWA 3L3KB 1AHWC 3VXUD 1JHLH 3ZKXC 4JPVL 5CMAB 1CDCA 3O41B 1JNNH 3LN5A 2AEQH 5F70A 2HJLB 5I1HH 1V7NL 3C2AH 1MCKA 3ZDZE 1KFAL 3TFKC 3KJ4B 2GAZB 4AM0A 3HE7D 3ELAT 4GMTH 1BOYA 4RGNB 1I8MA 4GRWE 1X5FA 2KUTA 3M17A 4YIQA 1EV2E 1WZKA 4ZUVB 3TT1H 3O41A 5IVZB 2CKBB 2OR9H 1XGRA 1UXSB 4OLWH 1XR8B 3QUMB 4WU7A 4FP8H 4PJ9C 4JVPA 5KN5B 1I8IA 1XGTB 3EHBC 1G7QB 1EEQA 1FLRH 4PJXB 3MCG1 5TGBB 1LDPH 3CDYA 4ZS7L 3T77B 1W8OA 4GXUM 3QHFL 4RQQB 1KENH 1NC4B 3DRTA 5DK2B 3SDAD 1XCQA 3CH8A 1BD2D 2JELH 4X0KA 3SGJC 1FNGB 1V05A 4UT6H 3V95A 3T08A 5I2IB 4Z0BH 4P5TC 5LGKA 2W0FB 1PG7H 4D9QD 4KJWC 1D5BB 1U8HB 25C8H 1OAUH 4X6DA 5FHBH 3PWVB 2CDEB 3H7LA 3ZLQC 4QXWA 3WS3B 1QRNA 4CN6A 2NY1D 5B3JF 2HYMA 4N0CC 1XF4A 1NBZA 5IMMA 1P53A 1UCBH 4X6CE 5GJSH 4JM2A 1MWAL 2BOBB 4Y88A 5GGTA 4ZSOE 3PWVA 3G08A 5LCVH 4N1CA 1NANH 4PJFA 3ARZA 4YDLC 3QDGE 3VXUE 1SQ2N 2QHRL 1YNLH 1UENA 4PB0H 4LSPL 2C3GA 4I48B 4PJIF 3PP3K 4PRIE 4XXCC 2PTVA 3ILQD 4P59H 2D7TH 1GGIL 4U6YA 2HMIC 2A0LD 2R23B 4NUJB 1O7SA 4WENB 3NPSC 4DN4L 5TDNB 3H3PL 4CAGA 3MO1A 3ULVL 1OPGL 1PSKL 2YRLA 1AY1L 3UBXA 2ZUTA 2P4AB 4MCZB 1MAMH 3G6JA 3GJFB 3K3QA 4XBPB 5CJXA 4CU7A 2JCCE 5CSZB 2FDBP 1KPRB 1A4KB 3DXAB 3IDGA 4NBZB 1WLHA 5ALCH 1EAPA 5D7SH 1A7NH 4RISH 5DGQA 1UKQA 1KPVA 5GHWH 1SVCP 5FYJU 3JUZA 4XRCB 4QHMA 3GJFA 2IAND 5IB3B 4EDWL 3IFPA 4RNRB 2LTQB 1UGNA 3DRQB 4KVCH 4MGXA 5C9KA 5CILH 4ZOAA 1V7MH 4TULH 2YK1L 5DDHA 3LQZB 4JO2H 1AP2A 1SYVA 2VWEC 3I84A 5MENA 3U6RB 2KZ1B 3MSPA 4KMTH 4Y4KA 1D9KD 4QOKE 1KIPB 4KHXL 4X7FC 5SWZA 3C09B 4IIQA 4X6DF 4BELD 1A02N 2ZNXA 4YNYB 4BZ1H 1M7DA 4H88H 3TJHC 4HH8A 5I8CA 4JKLA 1A0QH 4XVTL 1L0YA 3RWDB 1YMHB 2D4DA 2I5YH 3WUWG 4YGVA 2HFGL 1VERA 3HNSL 4NRYA 4A6YL 4BZYA 5FOBA 4PJHB 3ZDZF 5CJ5A 4OF6A 4ORGB 4CW1B 1JGDA 1YPZE 4X9IA 1HINH 3BGFC 1C16B 2VQTA 1RK0A 4ZQKB 1IGYB 1RU9H 3QHZH 4Z7UB 2VB5A 4PJFF 5KSAB 1S7UA 1OSPL 3L3IB 3Q5OA 4V2BA 3GMLB 3QPXH 5JNYA 4WFGD 4XNZC 5F7FA 3BKCH 3MRFB 3NCMA 5C0AB 2GCYA 4WWID 4LLYB 4MVBC 3MLVH 3PXHA 4M48L 1KB5B 4HXBL 1I7UA 1R3IH 2I9LA 4NO2B 4XVJL 1AD0B 4JO4L 3VGFA 3IT8D 4OLXL 3GKZA 2X40A 4R4FH 5L7XH 3IU3A 3LS5L 1XGPB 3ZYOA 1X4XA 2A9MH 4CDGC 4BK4A 3MOBL 4YEFA 1GCFA 2FH6A 2X7LB 3BEWB 4EIZC 3QPQD 4EI5B 2C1PB 3IYLW 4PJIB 3MA9L 4JJ5A 3KPQA 4XGZB 3G6JF 1GAFH 4IRJC 5HI4D 4IRZH 3WIFA 5EC2B 2MCPH 3MLSH 1PKQA 4JFED 1A9EA 4JY4A 4J1UB 1NAMB 5C0ND 2C4FU 5EO9B 3WYRA 2X4QB 4LVOB 5GS2D 5A43C 1N3NB 4WVRA 3OKNB 1CGWA 2X1XR 2A38A 2N7AA 3NH7H 1QSEA 4TQEH 3P30H 2NY7H 4Y2DA 1X5GA 5D93C 4FABH 3VDCA 3I6GA 5JPNB 1GGYA 2IANB 3CSYA 3QH3A 3DTXB 5DQ9A 1FVCB 3E3QE 3FQRB 4ZXBA 5J57B 1QSEB 1QBMH 3PHOB 4Y2DB 1I8KA 1A4JB 3BXNB 1ZS8B 5D93B 3B9AA 3CFEA 2MKLC 5DJDA 1N4XL 2A6JA 4DN3H 3T4YA 4D3CH 2FCBA 1Q38A 5KVMC 3ARWA 3LSOB 3FMGL 4G5ZH 4NP4L 3KPLB 3RQ3A 5FO9A 4OD1L 5I8KH 3HRZB 4IRJD 5HI4C 3TZVA 2V9TA 3VXSB 4DVRH 3CC5B 3GSXB 3DURB 2W9EL 4K3JH 3MRNB 4NNPH 3ARFD 1CD8A 1LO0L 5TDPA 1I1AC 5C9JA 5AZ2H 1FFQA 4OUUB 3S3PA 4KKBD 2XOTA 4AT6A 4IMKC 5CMAA 5DEFB 5F7NC 4DGIL 3IAPA 1NCAL 1KCUH 1QLEL 1K2DA 2ICCA 4OZGE 5E6IC 4E5XB 3MRNA 4Z7UF 4M3JA 1HQRB 2EDBA 3ZE0F 4YFLI 1GGTA 5EU4B 3TA3C 4ZUSA 5C2BL 5BVPL 4M5ZL 3KPOA 2IMNA 4L4VD 4D0BB 1PZ5A 2BSED 1EFXB 1BHGA 4OZFB 3IDMB 5D1ZB 1XR8A 3QUMA 5DJ0B 4O02L 4XZUB 3LEVH 2Y06L 3N50A 4UQ3B 3C8HA 5DQ9B 5F44A 5J3HC 4HH9A 5E00B 5I9QB 2D9CA 2MPAH 4KKAC 3WXWL 3HUJA 2NX5D 4PJHE 1MCPL 1X5JA 1XF3B 5BVJA 4OT1L 1OTTD 1WCBB 3DVFA 2PR4L 4GQ9H 1AQKL 1DVFD 4ZSOB 3DPBA 1QA9A 4YE4H 4FQHA 3EDKA 4G6MH 3WJJA 4NHCL 4ELKB 1TTUA 1MCEA 4YHKH 3EJZD 3FT2B 3SKUD 4F33A 5LQBL 2J5LC 1INDH 4KZDH 3T0VA 2PXYA 3ZDXE 1OD7A 1CR9H 1HILB 3TM6A 5IFJB 4TUKL 1IAOB 4QYOB 1QLEH 3MV8D 4K7FA 1CTOA 4R96A 3J7HA 4G8FA 4JY6A 4TRPL 3INUH 1H3WM 4GAGL 4XWOD 1S5IH 4OF3A 1ORQA 5HGDB 5F72S 3C8DA 1BWWA 5HVHC 2DKSA 4LHQB 1LO0H 5F7HA 5EO0A 2W0PA 5FXCH 4M43H 5HD8C 4K3JL 4XNUL 1P69B 5DVKA 4LLYA 1B3JA 2FGWL 5F1NA 4HZLB 2GK0A 5C0GB 1UB6A 5T3XD 3QG7H 1OM3L 2A83B 1S7QB 4PJAB 4JGUA 1T5WB 3NFSL 3S5LB 1YMMB 5F9OH 3ULVC 3QWOA 5FA3B 3OKLA 2X7LA 3FT4B 3RKDD 2BP3A 2UZYB 4XPFL 1BWMA 1OGAB 2Q8BH 3DMMD 5F6HJ 5E8OB 4AEFA 4ZPVB 3O81A 1J87A 5D70L 5C0AE 4LPXA 2GJ6E 1LEKA 1X7QB 4C56B 3S3SA 4C54A 4KDTC 2NY6B 3EBAA 4BSWB 4XMKH 4UBDC 4LRNH 1OTSD 4JB9L 1RJLB 1JRHH 3VRLF 1ZV5A 5I1DA 2BSTA 3MNZA 1Y18B 2AERT 1GOHA 4KDVA 3TT3L 3VXTB 4Y4FA 5DO2C 1NBYA 5JIPA 3P9LA 1CK0L 3CLEL 4HHAA 1AGCA 3L3JB 1CR9L 1OW0C 3DJ9A 2PW1A 1KJ3L 4G42B 1ZEAH 4Z0XB 2N7BA 2A6JB 4NO5B 3WFBH 1DANT 2DAVA 1U8LB 4V1DA 3BP6A 4IMLB 1FG2B 2I60H 4K71B 3M45A 3EGSA 4RMSA 1YEFL 3O4LD 1JHKL 2DKMA 4K7PY 1CQYA 2K9UA 2VABA 5ID1A 4U1MA 2RCSH 3NFNA 4UT7H 1JWSB 3T8XB 3QFJA 1UB5B 3MODL 3HR6A 2DRUA 1CDGA 3DVGA 4NQSB 4D9RD 4NNYB 1U8LA 3KHQA 4HD9A 4EBQL 4QGTA 3ROLB 4M8QA 2WBJD 1QYGL 3QIBB 4WEBH 3CK0H 4MA7L 4OQTA 4PRHE 5CBAB 1BVKA 3TO4A 4MNGB 3UTZA 3VXMA 3GSNL 4YDIL 4M5ZH 4CUCA 5IMOB 5BVPH 4Y5YC 1T7VA 4QGYA 4X6CA 4KTDH 4NNYA 4CKVX 2DQUH 1NBVH 4ODBD 3O6MH 1EERB 5C07B 1UZ6E 5IBLD 4I0CC 4XAWL 1E4KC 2FB4L 1WVZA 2X10A 4WHTB 5IVOA 4G8EA 4OJFH 3G5XA 4QRQB 3S37H 4F9PC 2ATPA 8CGTA 1JRHI 4XHQA 1S9WA 4OCXL 4NO3A 4TTDD 2EYSB 4P5TB 2VR5A 4W70A 5IW3A 4MA8L 4RWYL 2YPKB 3SE8H 4JZOB 4M7LL 4GLRH 4WI8A 3FQNB 5AZ2L 2OZ4L 4PJBB 4PJDA 4X7TA 7FABH 2DB8A 5AAMA 4DQOL 3BZEB 5TQ2L 3BP7A 1ZGLA 3UTTE 4FQXA 4DOHB 4OD1H 2NZIA 2LU7A 1FYTE 1FN4B 1S9YA 3DX9B 3QDJD 1S9WB 2MQCA 4ENEC 1K4DB 2EDHA 5EPMA 2BX5A 4PJGF 1IGIH 5TE4L 2ZOKA 1T66C 4PPTA 3U0TB 5HVFB 1DQMH 1X5HA 3QDGD 4NCC2 4XXDA 3VW3L 3O6FD 4M6AA 3T04D 4YPGA 1XF5B 5I71B 2Y7QA 4X0KB 5HDLA 3C87A 1KIQA 2C4XA 4QRPB 1T22A 5J6GA 2XFXA 1KPUB 3STLA 1FO0A 4HS8H 3U0TA 4P59L 5FYKH 5BZWA 5JDSA 5TH2B 3K8LA 2AS5M 4POYA 2R56H 2HN7B 2VDPL