4QOKD

Structural basis for ineffective t-cell responses to mhc anchor residue improved heteroclitic peptides
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
194
structure length
194
Chain Sequence
QEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNVAGKSTFGDGTTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title Structural basis for ineffective T-cell responses to MHC anchor residue-improved "heteroclitic" peptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2014-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qokD02
5IEKA 5ISZD 2XXCB 2OJZH 4KK8C 4MNQE 4PRDB 3L95A 5I8EA 4NDMB 5IIEB 4MNGE 4YBHA 3R0MA 3U0PA 5C2UB 1I3RA 3VH8G 5DD6B 4WI8A 1G9MH 1NBZA 3IKKA 1A6UL 4S2SA 1ZHNB 5C08B 2AK1L 3IGAB 2BOBB 1S9YA 4MD4B 2ZUTA 4I3GA 3KS0J 3U9PL 1AXIB 3G5YB 2OK0H 4Y19B 2D7MA 4KKCD 4PJDB 2Y06L 4K94H 5J12C 3TZVD 5E8NB 4LDOB 1Y0LB 3TYFA 3VXNB 5JOPE 4LSDA 3DX7B 2EDKA 1AGCA 3GMOB 4LCYA 2PO6A 5EZIH 3W9DB 5FCSH 5AD0B 2X2YA 4EBQL 1TMCB 2G5RA 4ERSH 3BPCA 4EI5C 4NQDA 3LEXA 1AQKL 3M1BA 6CGTA 3MRFA 1J87A 2VLKD 2YPVL 3GSUA 2MNUA 1UZ6F 3QIBC 1NJ9A 5FYJD 1OAQL 1QHOA 1Q0XL 3KYOB 3I85A 3KYNA 4KUZH 4N1CA 4IRZH 4ZODA 1K85A 1QUNA 2F58L 1AGDA 1J1XL 3FN0L 4N8VG 2X1XR 1XF3A 5JIHA 4XH2A 1J18A 1VADA 2AJ3A 3GHBH 1LGVA 4KTEL 4F3FB 5C92A 3JTTB 3I75B 4HGWA 3RGVA 4Y19D 3MV7E 3ZSSA 1JZ5A 4U6VH 2WQ8A 5BMFL 1U8NB 3H7LA 4F7EA 1XF2B 3CFJB 4OZFA 1HEZB 4XB8A 4JFOB 1V05A 5D2NB 4N0CC 2XN9A 4XNXH 2B4CC 4JRYE 1BM3L 4BUHA 4OCXL 5HHMB 1YPZB 1JGVL 3T3MF 1JGLH 2VDMH 3FT2A 3IDIA 1MFBL 4HIJB 1JRHH 2HWZH 5JZ7C 5ICYB 4GQPH 3WIHL 3L3IB 3QFJB 3G9VA 1TVBB 4LLUA 5DK3A 1D6EA 4POYA 3CK0L 2A6KB 3UPCA 3AM8C 3L3DA 4G80B 2R0KL 1EXUA 3OV6A 4U0RC 1Y6NR 4YHIB 4C83A 4PJBF 4NO2A 2X70B 2XZQH 4YJZL 2R8SL 1D9KC 2J8UB 3T0EC 5SX4I 4CL7A 3TA3B 3PJSA 4F8QA 4WWKB 3W9EB 3B8SA 3QEQD 4ELMA 1EZVY 5BS0A 4F7CB 1PG7H 5EOCJ 3LV3A 4U3HA 1TENA 1ND0B 3NFSL 1ZLUH 2YA0A 5D6CB 4Z7UE 3MTRA 3SJVA 2R1XA 1QSEA 4N90D 3D85A 4FXGB 4QWWC 3ZDZF 2Q86A 1DLFL 4JFPA 5BVJA 1G84A 2QKIB 3INUL 2DTSA 2R4SH 2CRIA 2GSIB 5EC1B 4X6DE 5HHMD 2EXYD 3ZHKA 5CKGA 5K9KB 4CMMA 1U3ZA 4G5ZL 4ZFOB 4KWUA 4TTDD 1DQQA 3U36B 5DFVD 2EDJA 3HE6B 1YMMA 1WC7B 1S7UA 4WCYH 5INCB 5IVNA 3QDAA 3IDUA 3HG1E 2A73A 1CBVL 4PTUB 3SGJA 5EO9A 5D71L 1ZHKB 1U8QA 2I5YL 2D2OA 3BQUC 5IG7B 3EHBC 1B4JL 4ZNEA 2JE8A 3TA3D 3IJHA 4M4RA 3ROLB 4O5LH 4DEPB 1X6NA 2Q20A 3CSPA 3BHBB 5DMJB 1CICB 4UBDC 3G6DL 3ARDA 4BZYA 2PYEE 1N0XH 5FGBA 5B39G 5KVEH 2LTQB 4H20H 1OAXL 2V7NA 4LMQI 1R3HA 3QDGB 1N3NA 1AE6L 5JXEC 1FFOB 1KN4H 1YY8A 3JV4B 4MJIE 3U0TA 2AK4E 4H26B 3LQAH 3QNZB 3V6FB 5C0DB 1D5BB 1VFBB 4LIQH 3QO1A 2VSCA 1QKZL 3QUKB 1TJHH 3HE6D 1A7OL 3DI3B 3U48A 3BP7A 3VXUE 1U8KA 3X12B 1BLNA 3GSOB 2WMPA 4HIXH 5EWIL 4RMRA 4JM4H 3NABH 3WL9B 1ORQA 4RFNB 3FFCB 4EZMA 1JL8A 2Y25A 3QJFA 3GUTB 4OV5B 4JPVL 3WBDA 1A4KB 1WBZB 5JDSB 3RX5A 5E08H 4QRTA 1CICD 5FK9B 2I9TB 4Z7OF 1QFWH 2YRLA 5CBAB 2AP2A 1F2QA 4NN5C 4LKXA 1T1XB 3ARWA 2ADGB 3QDGD 3KLHD 4OZHA 2GITA 2HT2C 1KLFA 2DLTA 3GMRA 1YUHB 1BFVL 3D0LA 4GAJL 5L2KD 3RWDB 5DO2D 1QLEL 1A3RH 3RZCA 1Q9KA 4DUVA 3BN3B 4RX4D 1NBZB 3RDTC 5BW7A 5FO9B 4S2SB 2Y9RT 1KB5H 3MRGA 5T1LB 1UKTA 3VG9C 1KEGL 5ANME 2E6JA 3F8UB 3LRSB 5C0BD 3K0WA 2GAZA 1NC4B 1B90A 2MFNA 3FFCD 2Q8BH 1OAUH 1S9XA 3TYFB 5ILTH 2VL5A 3GKWH 4TSBH 4H1LH 2F15A 2W92A 3HRZA 2ZCHH 2ORBH 5CJXC 4YHZH 4NHUA 1AGCB 1WIUA 2PO6B 4FQCH 1X5YA 2BFVH 2GW5A 1MVUA 5T3ZD 5J11B 1UCTA 4PJ8D 2ICES 3VGDA 2VLKE 3G08B 1E6OH 1A7QL 4JVPA 1WCBA 5KJRH 3LEXB 3M1BB 4XPBL 3VGHA 4HEPG 4JKKA 2UZXB 4V1DD 2ITCA 4R9HA 5ENWA 3MFFA 4QHMA 4JDVB 4M93B 5JLZB 4MHHI 3KYNB 2HLFC 3L7FB 3VG0H 2Y36H 3O4OB 4UDTA 5C08E 4Z77A 5DGQA 3LKQA 3AB0B 5IF0A 4FZ8L 2QQNL 5JOEA 1HSAA 2DQEL 2YD7A 3IDYB 4XH2B 4Y19E 2AJ3B 5T1LD 4K71C 4PJDE 5HGAB 5HHXH 2WP3T 1R3KA 3MNVA 1RZIB 3AFLA 2IH1A 5ALCH 4NWUL 1NC4D 1OY3B 1K4CA 4HCRH 5CKAA 1E27B 4F7EB 1MRFH 1CLYH 2ATKA 5AG9A 4KK9D 3ARQA 3O9WA 1A9EA 2XN9B 5E2TH 3OB0H 3RTQC 4QHNB 5KSAC 3Q3GA 2HAZA 3NIFE 5CILH 3MNWA 4LOUC 1O7VA 4W4OA 4OI8A 3QIWC 1KULA 3C08H 5BVPL 1T21A 1MCDA 4D2NA 5I19L 4NGHL 4CNIA 4D0CB 5B38G 3BIKB 3NAAH 4FXKB 2CR6A 5I74B 1K5NA 2B4CL 1D6EB 1MY7A 4QXUL 3WCYA 4XVTH 5T3XL 5M95B 5E94A 3LMJL 1FPTL 4O2FB 5EUKA 3RVTC 3P0GB 4K3HA 4WW1B 4Q7DA 1OP3K 4NO2B 1XIWB 4YDVB 1PLGL 4KI1A 3RY4A 3UMTA 1GC1H 4YFEA 5IJVB 5F6HI 2Z35B 3MLXL 5MI0C 5D2NE 1EFXA 5GGVH 2FGZA 4C54A 5C0AB 4N90E 5C6PB 4RGOH 1FCGA 1NUGA 1HKLL 1OAYL 2CD0A 5K9OA 1NCCL 3WYRA 4Q58C 4YC2C 3SJVB 5DMGC 1QSEB 3OAUL 2AABL 3RA7H 4PB9H 5HHME 1YPZE 5ACLA 2MJWA 4NCDA 5BVJB 1T0NB 1DBAH 4ZXBA 4S1DC 4I77H 1Y6KR 2X4NA 1WEJL 2DLHA 1MFDL 4L9LC 1FLRH 1LDPL 3QFJE 1KIPA 3HLAA 3SO3B 1JF6A 1FIGL 5CJBA 4OCYH 5D7IB 1YJDH 3MOQA 2ZG1A 1DQQB 2HG5B 4MXWL 4DZBB 1G9NC 3VRJB 1JRHI 1IFHH 1NGZB 1YMMB 1ZGLA 1S7UB 5ITBH 3W39B 3CFCH 2J8UE 4FG6D 2XXMB 4OCRH 5CEZE 2FD6H 1XIWD 5EO9B 3X13A 1T2QL 1KTDB 1U8QB 2HYMA 1OARH 5A2IH 5T33H 2HA1A 3L5XH 4TNWK 35C8H 1JP5A 4FFWD 1BFTA 2VZUA 4JQIL 5K59E 3GK8L 3BDYL 5KVGH 4Z9KB 1HILA 3LPWA 1YEEL 3KPQA 3ARDB 5C0AD 4E0RA 5ESVB 1QBLL 4P2CG 4WFEE 4FFVD 4PJAF 4NZJA 1BOGA 1I9JL 5F6IB 2NXYC 3ESUF 3GIZH 5DI8A 2V7NB 1MHPL 1R3HB 5HHQB 3BYTA 4Z7VF 3OF6D 1N3NB 5GZOD 4I4WA 3DRTB 2ARJA 5HDQH 5TE4H 3DNKA 3KPLB 2J6EA 3SE9L 5GGRY 2YPKA 3ZZ1A 5C9KA 5A43C 2ERJB 5TF1L 2DQDL 3ESVF 9CGTA 5EOTA 3E0GA 1X3DA 3CXDL 1U58A 2OZ4L 4ZFFA 1JPTH 5C0ND 1YMMD 4OLZL 4NN6C 4DJMA 1AJ7L 1H8OA 3BP7B 1U8KB 1I9IL 3FQWA 1EUTA 4A2MA 4W6YB 4JCLA 4XP1H 5FUCE 2I27N 4J4PD 3SHSA 2CXKA 3NPSB 4KU1A 4Y2OA 5CMAB 2D9QB 4D8PA 7CGTA 1K9TA 1Q1JL 2JIXB 3IAGC 4GLRI 2F5AL 5H94B 2VUYA 3EYSH 4QXTB 5AG8A 3ULUE 3QDGE 3FO9A 4PY8J 3LSOA 4LKXB 3DO7A 5ID1A 1QPPA 4JRXD 4OLXH 1KEML 5ICXA 5EU6B 3O6FC 3GMRB 4M6OL 3D0LB 4XZUB 4I5BB 1AIFB 1OPGL 4F33A 2EDXA 1KCUL 3QWQB 5CLTA 5SWSA 2EKJA 2BJMH 4OGZA 3MRGB 4PGBB 1U8PB 5M94B 3QCVH 1K6QH 4QF1B 1S5IH 3FFCE 3GBLA 5JO5B 3V5KA 2GAZB 4PS4L 3ULVC 4NJ9L 3TO4A 1S9XB 3GMMB 1BJMA 2BSTB 2OYPA 4MX7B 1CDCA 3GRWL 2JIXD 3CSYA 1FZJA 2ZZUT 3NA9H 1XGQB 1MVUB 4PG2C 1MCRA 4JZJA 4G43A 1FV1A 3FT3B 3OKOB 5K9JL 3O3AA 1QD0A 3JXAA 4YBQC 1HHJB 3QUYA 5L2JB 1OTUD 1H8NA 1QFWI 2ITCB 5EU6D 5J1AB 2XY1A 3STZA 4I9WD 5IMOA 1IVLA 1CD0A 1NBYA 4UOW1 5F9OH 4NFBA 4UDTB 3EOAB 3WFDH 4WW2F 1MCSA 4KK5C 2DS4A 3B6SB 3X11A 3QWOA 2EEBA 1AC0A 4YHLH 5J8OA 4JANA 4ZNCD 5FYKD 1T83A 3QQ3B 4IDJH 3MBXL 3VFOB 2ATKB 3AXLA 1KN2L 4X9HA 2A74A 3Q3GB 1WAAF 1MQ8A 4R0LA 1ED3B 4KKLC 3H42H 3N85H 4ZUWA 3VFNB 4WV1A 5EBLB 3QRFM 1T21B 2DL2A 2H2PC 2QSCL 3VI3E 2KH2B 3QUMH 4CNIB 2CRYA 3B4NA 2JELH 1T03H 2DQGH 5I66A 3DBXB 3S35L 3H9YA 4ZUSB 3S4SG 5AZ2H 3PWVA 3TBTB 4W81A 1KFAH 3PGFH 1K5NB 4YHNA 4QNPF 2LVEA 4AQOA 2QLVB 5DUBA 4HUNB 4WW2C 1DL7H 1YN6B 2L7UA 5IM7A 3MRQA 2ZUSA 1ZLSL 5FO7A 4P59H 1A21A 1ADQH 3TWCL 3ARBD 1XGPB 4DW2H 5DZOA 1EFXB 1ES0A 2XN9E 4F7MA 1MNUH 4H8WH 1FZMB 4XC1L 4XPHH 1NSNL 3C6SB 3AREA 1C5BH 3DVIA 5K9OB 5F7EL 4XP4L 2NY2B 2DQJH 3OJMB 3QCTH 2X10A 1IKNC 3PWUB 3UTZA 5DJAB 5CZXD 4JPIA 4MZ3A 5E99L 3HLAB 3DXAB 3K2UH 2R0WH 1BWWA 4GSDH 4I48A 1T66C 3EDJA 1JWMA 1DBBH 4HSQA 1PGRB 2HFGL 3FZUD 1S7QA 1DVFA 4UIMA 4EDXB 3HS0B 4L4TB 2DD8L 3GSQA 3LKSA 3EO0A 3SKJL 1ZGLB 1I7ZB 4RDQG 4P5MB 3G6JF 4M8QA 4YHPA 1CFVL 4GJTB 4JO2L 1G7PB 1QRND 1RURH 2NNAA 4FMKA 4LPVA 4XAWH 5E9DA 5FHBH 4YDJB 4M3KB 4HLJA 4DGIH 3GSRB 2YEZB 4HLZG 1E4KA 1H3PH 3BEVB 5DVOA 4RMQA 4CU8A 5C0AE 4Q9RH 3RVVD 1G9NL 3JWOH 3QQ4B 2MKLC 3CFDB 2O5XL 3SJVE 1DANT 1QSEE 3B5HA 1FG2A 2UZIL 4E0RB 2MQ0A 3LPGA 5EO0A 4IDLA 4JPKL 4Y4KA 1JPGB 1I8LA 5K9QI 1Y18B 2NY2D 5TFSH 3B5GA 3RVXD 3GSXA 2C3WA 2F53B 1AGEB 2B1HH 2HFTA 1KUMA 4UT7H 3RVUD 4I4WB 5EIIB 5HSFA 1HZHH 4KZEL 5D7IE 1MREH 2F8VA 2VQTA 3DXAD 5DGRA 1B3JA 1T1ZA 4DK3A 1YMME 4M43H 3ZT6A 4PGDB 5EOTB 2MTPA 4M7ZB 4L4TD 4LGRB 3FCTA 4IMLA 4QKXB 4Z18A 1U58B 4P4KB 2E5EA 4WEUD 5GGRB 4JG0H 4HMDA 3FQWB 1OHQA 3D18B 2IPTH 3R1GL 4I18A 1KT2A 4U1KA 1YMHA 5FHAL 3AMKA 3KR3L 4LEXL 4K23H 1N6QL 1CL7H 3UZEA 1NGXA 3T3PF 3CZFB 1UZ8A 3MOBL 3VCLA 3K4ZA 2ITDA 2DQTL 2AJYH 1EEYA 5HI5D 4M6NL 4Y1AA 3LSOB 5DRNA 2F53D 4E5XA 1MIML 3WFZA 2QL1A 4RFOH 4Q74A 4XNUH 3PL6A 2LABA 1P69B 2HRLA 1RK0A 2X9XA 3C6LA 1OAKL 4F33B 3MRKB 4P49A 2ID5A 5SWSB 3SE4C 1KLGA 3NTCL 4Y4FA 5E2VL 2UWEF 2CKBH 4P4KD 3DI2B 3O6ML 4JKPL 3C60A 1BFSA 3LOWA 3LH2L 1H0DA 3V5KB 1AHWA 3DX8A 2I60H 3TO4B 2EDYA 4M9PA 5AZEH 5BXFA 4Y16A 1FZJB 5GGTH 4HS8H 3LD8C 4G43B 1YEGH 1MPAL 1FV1B 3ZL4L 2R1YB 1UM4L 3IDMB 2HKHL 1EPFA 3SKMA 1SYSA 4PV8B 3HI6H 1AR1D 3C5JB 5EU6E 3ULVL 4LVOB 2HN7A 1CG9B 4G6JL 1TTUA 1BECA 2DJSA 2EECA 4BFIA 4LCIL 4HQQH 5F89A 3STZB 1JHLH 1NBYB 3HZMA 4HWZB 4PJ9B 2QHLA 1MJUH 4FZEH 4L29B 4I3RH 4XMPL 4M7JH 3O8XA 5C3TA 1M71A 4KI5C 5SWSD 5I75C 4UV7H 1OM3L 2EDOA 3QWOB 4WTXA 1ZLUK 4P5TD 4MJ4A 1QEWA 1IEBA 5CBEA 3ZDXE 4P46D 1FC1A 4X5WB 3NOIA 4JANB 1MF2L 4OTXH 4HX1B 4MXQC 4LSUH 2F74B 3ZE1E 3QG7L 4XP6L 3WIHA 4QRRB 3UDWC 1OQOA 2A74B 1EGJL 4FMFA 5C07B 5EU5B 2YD9A 1E4XL 4F7PA 2H41A 3QWRD 2OP4L 4HV8A 1I4FB 1NCAH 1QBML 2LV4A 3GNMH 4XCNB 1QBBA 2G2RA 3S5LA 3T2PA 4DK6A 3VFRA 3JBG7 2XA8L 3HR5A 1MFEL 4Z6AT 5I66B 1JE6A 3MA9L 2VSDA 3O2DH 3G6AA 1MCJA 5CIPB 4PJ9D 1Q8MA 5JHDA 4PLOB 1BPVA 3X17A 5DUBB 3NCEB 3WSQH 5IM7B 3BESR 3MRQB 5IK3A 1A1MB 1ZEAL 3BN9C 5FO7B 5EBMA 4NQCB 1UB6B 2NXZC 1DEEA 3WO4C 3MYJA 2H32A 3WDHA 5I15L 1DLHB 4ZAKA 1M6OA 1ES0B 1AY1L 2EZ0D 3WLWC 3MX0A 4X7SL 1QHPA 4FTVA 1FJ1B 3AREB 4QRRD 4UILL 4XVUC 3AAZB 5C07D 3HCVA 1QYGL 4G9DA 2DQCL 1FBIL 3VI4F 1YA5A 3UTZB 1W72H 3VFMB 1KPUA 4JPIB 1XGRA 3TH2T 5IB3A 2OL3L 1NMBL 3JWNC 4I48B 2AV7A 1JWMB 3L5WB 2AAVA 3LS4L 5CEXA 3Q5TA 1WBXA 5LAXA 5D70L 1TCRA 1RIUH 3DMMB 4UIMB 1FC2D 5E1HB 2W59A 2E7HA 3ZYJA 3EO0B 4HXBL 1FNSH 3DLQR 1X5FA 2DIJA 2NNAB 1T04A 2VABB 5E9DB 4GXUM 4PJ7A 1NEZA 4WFHD 4X8JA 1DQML 4JJ5A 4WIQA 4NQCD 4X6FA 3KNBA 5KSBA 4BSVB 1HYSC 3NCJL 2NY3B 2HT3C 3FAXA 4X9GA 5CP7B 3LEVH 3F12B 4OD2A 3S6CA 4JREC 2WZPD 4ZFZA 2JJWA 4XP9L 5EO0B 4Y4KB 3DHJA 4JQXA 1EHLH 5JIPA 4I2XA 3FQTA 3RL2A 4AY0A 5T1KB 2XZAL 2EH8H 4NO5A 3C8KA 3DXAE 4F9PC 4D9QE 1PDKA 1ZT4B 3GMNB 1CDBA 5D72L 5J7CC 4L4TE 4C56D 1FCCA 2APXA 3QRGL 4GRLB 1WWCA 5CS7A 1FL3A 2CPCA 2IGFH 3DMMD 3PHQA 3FCTB 2X1QA 1WUNT 5FYJU 1DQJB 4E41B 5GS0H 1QVOB 1S3KL 3Q48A 5MP6L 4GRMA 4X6CF 3QG6A 2VAAA 5DUPL 4PYGA 4Q9CA 4PBWD 5E9DD 5L88L 1ZA3A 2AXFB 2R29L 4I18B 4U1KB 3ZTJG 2X4OA 5C0CA 1NGXB 4H25B 1X4ZA 3RUGA 2NY3D 2X4UA 2OQJA 3NZHH 2FJFA 2P46B 2NZ9C 2XI9A 2YMXH 4NN7B 1GHFH 4FQ2H 1EEYB 1DP0A 2F53E 1VEOA 1ZTXH 2V7HA 2EDFA 4JY4B 1C1EH 4X7EC 5DRNB 5T1KD 3DGCR 4E5XB 1IEHA 1MCOH 2FCBA 2NY0C 4IRJC 3PL6B 5IQ7L 3C6LB 3SDYL 3FHQA 1UENA 1MCPL 4GRLD 1ETZA 3GMQB 3UTSB 1FGVL 1A1OB 1KLGB 4Y4FB 1HQ4A 1FVEA 4Z7NF 1MH5A 3OB0K 4J6RL 4F37K 4E41D 1HDMA 3C60B 3ARFD 1H0DB 5JR1H 3BXNB 2H26A 4BA8A 2NY7L 3PV6A 3DX8B 5EBWB 5D1QC 4XP5H 2BNQA 3ZYOA 1U42A 4UNTA 1CLOL 12E8L 3EYQC 3PIQA 3MSPA 4Y16B 1RMFL 4O02H 3W81A 5DHVB 1OT2A 1AXTH 1X7QA 3MUY1 5HXMA 5M7QA 1NCWH 5TE7L 1HXMB 2Y5TB 3OWEA 4EI5A 1QZ1A 4G6KL 2VNCA 1FO0H 2EIZA 5FV1L 4EOWL 3BPLC 2UZYB 4LEOA 5DD5L 3VXRA 3QIBA 4Y8DC 5F3BB 4YO0A 5F89B 3FQNB 2D3VA 5SWSE 4U1NA 1EO8L 5FCUH 1D5MA 1MHEA 1HINH 3UTSD 3O8XB 1WWAX 4P2QA 2XIDA 3U79A 1T5WA 1RUKH 1QEWB 1IEBB 4Q2ZA 1KIUA 1A3LH 3MLSH 5ABDE 3DETD 5CD5C 1J1PL 5E6ID 3MO1A 1HH9B 5MERA 3MXWH 3T08A 3VDCA 1CI5A 1KJ2H 1FFQA 4ZOAA 4Z0BH 4NPYB 4DKFH 2XRAL 4QYOA 1I9RH 4NO3B 2GUOA 3MLYL 5IFHH 5GGSY 2OMBA 2ZJSL 4U31A 5E2UL 2G2RB 1MHHB 4OFYD 1FVCA 1BZ7B 1X5IA 1PY4A 3VFRB 3V7AE 3HR5B 1FFRA 1FIEA 1LK2A 2NY1C 1UYWH 1NAMH 4Y8AA 5KANG 3TN0B 4JHZA 2W0PA 4ZS6C 1KTLA 1O5DT 5I1AA 4K8RH 5JHDB 4AMKH 3AM8A 4MWFB 1EFQA 4UINH 1X44A 2DM2A 3UPRA 1TQBC 4BSWA 3LCYA 4RFEA 1D9KA 3T0EA 1DEEB 5IUSA 2H32B 1U8JB 1BBDH 3QBTB 4LSRH 1AI1H 3KHQA 4OM0L 4BH7A 4B5EA 3BRFA 1M6OB 4QGYA 1JFQH 1KF9B 4QRRE 3UAJC 4LCWB 5C07E 15C8L 1WIPA 4LPUA 4FTVB 3WS6C 3A67H 4XXDB 3FJTA 1L9NA 5E7BA 1RZFL 2HTKD 5ETUA 3HCVB 4G9DB 4XNQB 4EN3A 1NANH 1QFUL 2PW2A 1KV3A 1L4IA 3BW9A 5IB3B 4ZFGH 1N0LA 5D5MB 5CLWA 1Q0YH 1KTRL 1F90L 1PKOA 3T2QA 2AJXH 1I7RA 2AV7B 3ZKND 4P3CH 2A6DB 5CEXB 3TN0D 1WBXB 5LAXB 1TCRB 4GBXD 3NVQA 4HWNA 5DFTA 3TCXA 5I18L 2IFGA 3OTTA 4NQCE 4PJBA 2IH3A 3E6FB 1T04B 4AEFA 1GZQA 2C3VA 1NEZB 1JK8B 2ED9A 3BQUA 4JJ5B 4IRZL 3KNBB 4M6MH 2CRMA 4YXLH 2HJLA 4OT1H 4LCWD 1F4WH 4JN1L 4OD2B 1XGTA 2Y4SA 4ZFZB 5J13C 1JNNH 2YC1B 3FQTB 1NMAH 3RL2B 3MCKB 2OZ4A 2H45A 3N1QC 3HE7B 4NO5B 5JXEA 3C8KB 1G1CA 4DQOH 3GM8A 3PP4L 5DJ0A 1IJ9A 2Z4QA 4G42A 3ZYZA 4PLNC 4OD3L 1FH5H 3GSWA 4IRSC 3O2WH 4LF3A 1JPFA 3HZKA 1I7UB 1FL3B 3OKLA 1G6RL 5SX5H 4X4MA 4CW1A 3EDFA 4OIBA 2VDML 4XCFL 5E9DE 5T5FL 3C5ZA 5IVXF 4GRMB 3QG6B 3OG4B 3KPRA 2EC9U 1JTOA 4GFTB 5DRXB 1JYVA 1TJIL 5C0CB 1ROWA 3VMOA 3S36H 2W9DH 4HXAL 4XGZB 2MQ3A 4ZPTB 3CLEL 2AGJH 3K8KA 4MA1B 3WKNA 1D7FA 1OW0A 3FKUS 4PGCA 5FF6A 5DMKB 4WO4C 2ZUUA 3QXTA 1R5WA 4F15C 1OTTC 4J3VA 2X4QA 4O4YL 2Y7QA 3HE7D 5A1AA 3RFZC 2D31B 3BEWA 2VISA 3NPZB 1X5GA 4AT6A 2VDQL 3MUHL 3KVQA 5C70A 2CUIA 4G8EA 5F96H 4M48H 1J86A 5D6DC 1VENA 5JUEL 3RDTA 5IQ9A 1ETZB 4G7VH 3HNSL 4HZAA 4E41E 2R4SL 1SVCP 3QUZC 4OSUH 4RMSA 4YXKL 3MRIA 4BZ1H 2YS4A 4YEEA 4LHUA 5CWSA 5LXGL 1ZK9A 2EH7L 1CT8B 1ACZA 2XQBH 1G7QA 3P9LB 3ZKQD 1YYLH 5I9QB 3PV6B 5J12B 4Y5VA 4QRUA 1U3YA 2D4DA 5CJXA 3I50H 3PIQB 4J1UA 5IKCB 5GJSL 1FL6A 4YDKL 5IV2A 1OTSC 2EDDA 2VDLL 1KPVB 1MFAL 4EI5B 3MRDA 4NZRH 2EIZB 3EJYD 1P1ZA 1U2HA 4PUBH 4YR6B 1SY6L 3A6CH 3SBWA 2W0FA 3RU8L 4KK8D 2YWYA 5KVEL 3KPPA 5I30L 1CE1L 3UTSE 5J4MA 2Y6SD 4Y5XA 4JB9L 4L3EB 5E8DH 1D5MB 1BF8A 1HHHB 1MHEB 2IADA 3MACL 3TVMC 4NQSA 4OLYL 3U9UB 3B3IA 1INDH 4NWTH 4Z0XA 4AIXA 4BQ9A 4RCAA 1PSKL 4KKNA 4MA8L 3WNMA 4Q2ZB 1Q38A 5JIIA 5TPWH 2HKFL 1GGBH 1LK3L 2YR3A 4HIIA 2GK0A 4ENEC 4IIQC 5IHUH 3CMGA 4PRBA 3JWDC 3QYCA 1MWAH 1U3HC 3RTQA 1UEYA 4ORGB 5F3HB 1B2WL 4JM4L 3KJ6H 2WIIA 2D7OA 1R6VA 5D7SH 4EI5D 1KGCD 3F5WB 1MCNA 3BKJL 3IETA 3U82B 1C5DA 2HRPL 1LO0L 1CK0H 4KMTL 3GIVA 3SKUD 1P4BL 4XMLL 4W6WB 2FO4A 4OM1L 4OD1H 5GGSB 4GXVL 1RHFA 2CDFA 5KN5B 4HS3B 1KTLB 5I1AB 2VQ1A 3BUTA 4ONGH 5CSGA 4HFUH 4L3ED 5I76A 5DJZA 4U0RB 5F6HJ 4R4ND 3UPRB 3D3VA 1V3JA 3DX9B 1D9KB 2EYSA 3T0EB 4WNQB 1CD9B 4U3XA 1X4XA 3WFEH 1NLBL 4LDLB 1O7SA 4H0GA 3CVHH 2P8PB 4XNYL 5TJWK 4XX1E 3BP4A 2XZZA 4N0CD 3BRGC 3QHFH 5IMKB 3NZ8B 2VDNL 2A38A 3RWJA 3BH8A 3OZ9L 4L9LA 3BW9B 4LLVA 3A6OA 1X6LA 3P0YH 5DJ6A 1WTLA 5JZ7D 1I7RB 2MKWA 5JHDE 2ZSVA 5KJRL 1DR9A 4U1GB 1RZ7L 3NIDE 1MSPA 3VFWA 4PJHB 4GKZA 5B4MD 3G5VA 3MRCA 2YKLH 1DANU 2IH3B 1GZQB 3VD9A 2EDNA 2FECL 3BQUB 2NCMA 3T0ED 1IMHC 1YQVH 2E7LC 2Y36L 2DTMH 3JTSB 4LCWE 5L7XH 2HJLB 2YD4A 3GO1L 4DZ8A 2B1AL 2D7TH 4FTVE 1CD1A 3SGDH 1JWUA 5IB4A 5SWQA 4K3DL 5HHXL 1XGTB 5MEQA 1N5YH 1KSRA 3U2SB 1F4AA 4YWGH 4QWWD 5TQ0L 1QPXA 4P9HC 4HCRL 5D5ME 2VMFA 3WNOA 1MLBA 3MUGA 3MR9A 5EN2A 4N9GA 3LIZH 3BIAX 3EAKA 1IT9L 4G3YH 5DJ0B 4G42B 4HH8A 4L4VB 5CILL 1MEXL 4NQED 4R7NA 3GSWB 2ZNWA 3STLB 3HZKB 4OGXH 1T20A 3OKLB 1EAPA 2FJHB 1EEQA 3L1OH 2IANA 1CE6A 3Q2CA 4PRAA 5IB1A 1KJMA 1RUML 1WITA 2BY3A 5FKPA 3UJIL 5DMIH 2HTLC 3KPRB 2FEDC 4X6BB 1VGKB 1D5XB 5FOJA 4AIZB 4NZTH 2C9AA 4OUOA 4L8CB 2DQHH 2P8MA 5IBTL 1PZUB 3V7AG 1CGTA 4WHTB 5GS2D 5FYKU 3NN8B 4ETQB 2FR4B 5E5UB 4LASL 4PJAA 5GS1A 4NN5B 1R5WB 1IGIL 2YN3A 2Y7QB 5EOQL 5GISL 5GGVL 3LB6C 3O6FA 4UTAH 4AT6B 2A6IA 4LSPH 5IMMA 1IZKA 3HMWH 3U46B 4L4VD 3OHXA 3WO3B 1UWXH 3CCHB 4WFFD 5ESQB 3V6ZA 5I16A 4I77L 4HULB 2JJVA 3DSNA 3VXSA 2WWKT 4Y7MA 3VG9B 3VDAA 4KKBD 1P7HL 1TNNA 5CWSB 4DFIA 4U1SA 4PBVC 5C0CE 5TF0A 4PV9A 3OR6B 4UTBH 4XAKD 4WTZA 3U1SH 3LDBC 4RSVA 1KENH 1U3JA 1KIRA 3MOAL 4I3SL 2F5BL 2ADIA 3BKMH 4HLZH 4J1UB 4MAYD 3QXVA 3EFFA 4PG9A 4PG2A 4GAYA 1FL6B 1OARL 5T33L 1EHNA 5HPMA 5I1DB 3RY5A 4NC2B 1P9MC 1UJTA 4YXHL 1FYHB 2I07B 3TF7C 1V7NH 3B2VL 2XNAA 4Q6YA 4G7YL 2OR9H 4U3CA 3SE8L 3V4UH 2NW2B 3KPPB 2X89D 3VW3L 2ZKHL 3NFNB 1FHGA 1R3IL 3TPUB 1C7SA 2IADB 2VZ3A 1S5HA 1DJSA 1RULL 1T7XA 3MLVH 4WI6A 3TNNA 1EGJA 4Z0XB 4MCZB 1B0GA 4K71B 3S88L 1FYTA 4UT6H 1T0MA 5KAQF 3KDMA 5EU7C 1H3VA 5ADOL 4BKLB 1XT5A 2ZOLA 3P4OB 1ZS8B 2VXTH 2GK0B 2AEPL 4PRBB 4XPTH 1BFOB 5GHWH 1NLDH 1TETL 1UB5A 1A2YB 3RTQB 1T7VA 5KSAB 1SBSH 1RZKC 2VDPL 5BO1H 5K33A 4KPHL 1KGCE 2HH0L 1TITA 4FQIL 2WIIB 3QIWB 4XTRD 4KXZH 2PXYC 5DQDL 4JFEA 1J8KA 2EDTA 3MJ9H 3IETB 1C5DB 1AD9A 3KPSA 3GIVB 1H8SA 2FO4B 3JWDL 2DQUL 4I1NB 4L3EE 4KJWC 5J9PB 2VQ1B 3SGEI 1H3GA 4G9FD 4IOFC 2OXGA 5DJZB 4WW2A 3U4BL 4M7KL 1IAKA 4JAMB 2QSQA 3I2CH 5IBLC 3D3VB 1KIQB 1LEIB 3FB8A 4LSSH 2CIIA 2EYSB 3BOVA 5IFJA 5C6TL 4L1DA 3LS5L 2EICA 5GGUA 1J8HB 5MI0B 2OL3A 2FB4H 5CGYC 1XGYH 2XZCL 5GJTH 3BP4B 1HWGB 5T3XE 3FFDA 2FNBA 4X5XA 5KSAD 4YC2B 2IFFL 1WAAA 1KCLA 2FECI 2NTSP 3QIWD 1IKNA 4MLIA 4U6XB 5D96C 4MQSB 2KUTA 4JHBA 3VFGL 3BH8B 5FB8A 4LLVB 4HPYL 5DJ6B 2J8HA 5HHNB 4YX2H 2H6PA 4LHQB 1HQRA 3O6LH 1GPOL 2BNRA 5HGGS 2ZSVB 5JNYB 3HAEB 1G7MA 1KG0A 1CGUA 5HYJA 5C0GA 2V2TA 5CEZH 4XXCC 3VFWB 3G5VB 3MRCB 5C0IA 3SKNA 1YEKL 3T0EE 5FXCH 4Z95L 2YD2A 5JQ6L 4P23D 3LKNA 5CJOL 1L7TH 1MIEH 4CUCA 5E2JA 1L6ZA 4GQ9L 1J8HD 2XACC 1SYVA 4RAUA 1CD1B 5JDJA 1JWUB 3OJDB 2DL9A 1N4XL 5SWQB 2AW2A 1INEH 1RIHH 2A0LC 2LVCA 5DD0H 2DM3A 5MEQB 5F1SA 4UUJA 2ATPB 2NXYB 5HTSA 3P73A 3IDJA 3WIIH 4GMTL 1RVFL 3RRQA 3MR9B 3VFTB 4N9GB 3KWWA 2CLRB 1RJYB 2AQ3A 4OZ4A 2IWGA 5LVEA 3UROR 4JKMA 2Q6WA 1MAMH 3K4AA 5FDWB 3FQXA 3N85L 4FQ1H 4PJHE 3UJTH 3EIFA 3IFLH 5I1GL 1VERA 4U1MA 3GMPA 4P9HL 2IALA 5LCVH 4Y2DC 5CZVL 1QQDB 3TV3L 1CE6B 4PRAB 4QTHA 1KJMB 5FKPB 3G6JA 1MJJA 4WDIA 1ZV5A 2JB5H 3GJFK 2UY6A 3QPXL 3IXAB 5JW5A 2EKSA 5DVLA 5EPMA 4AYFA 5A3IC 2AI0H 1L0XA 3ULUH 4JN2A 1V3MA 3HR6A 3DTXB 3FO1A 1D6VH 5TQ2H 4QO1A 4PJAB 5BZWA 2E9WA 3WFHA 1LP9F 2YWZA 5DK2B 4MHHG 2CDEA 1U8HA 2OCFD 4L4VE 1AO7B 3VFSA 3GSNA 2GTWA 3O6FB 4A6YL 4WFFE 3D2UA 1UXSA 1OP5H 1RU9L 3FB6B 4ORZC 1KCVH 3IU4L 5C2BL 1LO2L 2NY6B 3RP1A 2IMNA 4PR5A 4HG4J 3VXQA 3QIUA 1U8OA 3VXSB 2OJEA 3E8UH 3KPRE 3WS3B 1VSCA 5IHZB 4XX1G 3GB7A 1DSFH 5DUMH 3UCRA 4X80L 4YFDB 2AEQH 3MUJA 2A1WH 3SGJC 1JPSL 1IAIL 2ADIB 5IJKA 4PG9B 3U0WH 3ZKSD 4PRHB 2FH8A 4N8CH 4MVBC 3ZKMC 4ZO9A 5EO1B 4WEBL 5I1HL 1CGYA 1ZGLP 4NZUL 1JYNA 4TRPH 5TDPB 3JWOL 5IEHA 3QCUH 3PE9A 1AO7D 4U4BA 4KVNH 4XBPA 1EMTH 3MNZA 5KBNC 5E00A 1ZSDB 3MJ8B 3SDCB 1XF5A 4BM7A 2R2EB 3MROA 3S34L 1CF8H 2NY6D 3O2VL 1WTGT 2NX5A 2IF7A 3S3JA 4PRPD 3H6JA 4GT7A 1JGUH 2O5ZH 2UWEA 1JNHB 1B0GB 1FYTB 1T0MB 2FBJL 4GW4A 3KDMB 4QXGH 4J3SA 1YECL 1TZGH 1TZIA 4JY5H 2ZOLB 4JCMA 2G5BA 3BSZH 3NCFB 3ULVD 2QV2A 3L7EA 3FOLA 3UP1A 2Q1EA 3X3GL 2EE9A 1Q72H 1I7TB 3M17A 3ZTJH 1UB5B 5ALBL 3UDWA 4ONHA 4Z7OE 3HB3D 2YPLB 1HI6A 2AJSH 2FIKA 4M62H 2V17H 5CINL 5DZNA 1C16B 4PJGF 4PRHD 2UV3A 1A7BA 5KTEH 4JFEB 4YBQD 2EC8A 5GRUH 4TVPL 3GSVA 4LBEA 3MODL 4H88L 4LCUA 2FGWH 3KPSB 4GMSH 4AL8H 5C9JA 1NEZG 5CEYA 1FORL 4P4RB 4PGZA 4TSCH 2EIBA 5F7WC 4XPAH 1RZKL 3SDCD 4L8BA 4L8DA 4OLWH 1Z9SA 1H9VA 1OSZB 4WW2B 4G6AC 5GRJL 3C2AH 3MPCA 2BXZA 3QXDB 1YNTA 4XNUL 2O5YH 3PGDA 1UKSA 4OZFH 2DQIH 3OR7A 2JKXA 4HWBL 2CIIB 4A2LA 4D9LL 2E6QA 2OX5A 4AEIL 1W0YT 5CJQL 2RFXA 2XKUA 2OL3B 3BUYA 3V6OC 4FABL 4MJ6A 4JZOA 2CKBL 5DJXA 2UYLA 2P5EA 3UZVB 2EXWC 3FFDB 3MV01 3DSFH 4HAFA 1SJHB 2BVPA 1P4IH 3H3PL 2YPLD 3DVNA 3TM6A 5SX5K 4XWGL 4R90H 3S8WA 4JFED 3RIAF 2FDBP 5FA4B 4U0QB 3FB5A 2H2PD 3ARPA 1K2DA 4OCLC 1J1OH 4YFLI 3WUWA 3BRDA 4J3XA 2DYPD 2PKDA 2BNRB 1RIVL 2R9HD 4XNMB 1KG0B 1PAMA 5HYJB 4TUKL 1IM9B 1DUZA 2WUCH 1TZHA 3HI5H 3D3VE 1RQ5A 5EUOF 3SKNB 3OPZH 1U95A 2NR6D 4NRYB 4JFZL 1DE4A 2E3VA 4NNXB 4MA3B 3ZMRA 5H35A 3CLFL 1OGTA 1J8HE 4HUWA 1IAOB 4NKMA 4APQC 1A7PH 3RI5K 1VB9A 4G6ML 2ADJB 2QQKL 4U6YB 3BPOC 4CVXB 3QUXD 3ARRA 1FFNA 3BO8A 1AXSB 1HKFA 1G6RA 2VLLB 5L6YL 1UM6H 3P73B 4OV6F 4HBCL 3EJZC 4PJCF 1KJVB 4QEGA 2A83B 4F9PA 1OQXA 3OXRB 4HPOL 1YEIL 4OZIB 1YEHH 1NCBL 3F65A 2FH6A 3CGTA 4ODHH 1T7WA 3I9GH 3J8F7 5F7YC 4CBPA 5IFAL 4YGVB 5A2JH 1VFOA 2VDOL 1HCFX 1JTPA 3FQXB 5D1ZC 4DN3L 1HIMH 3WXWH 3S3PA 1E4WH 1QSFA 1IM9D 3GMPB 4U1MB 1JPST 3THML 3IAPA 2LU3A 1W72B 4KGJA 1MJJB 3U7AA 4WDIB 3TBYB 4UAOC 5DJYB 3BYYA 4UV4L 3OKEB 5GZNC 1IM3B 5JW5B 1S9VB 1A64A 1TQCC 3ECBA 2CJUL 1S7TA 3T77B 1J12A 3T4YA 2BMKA 3FO1B 4U2ZA 3MRMA 4XWOC 5TH2A 4F80A 4JO4L 3TJEL 3NACL 1UKQA 2E7BA 4RAVA 3Q5YA 2GY5A 4BFBD 3F62A 1FVDA 4LSTH 5BRZA 3SPVB 1CS6A 1PEWA 3DGGA 2YUZA 4IRJA 1OCWH 1UXSB 3PWLA 1IAII 2FWOB 4HWEH 3UEZA 5I8CB 3LKOA 1RFDL 4KK6C 2MCG1 4MDIA 4P9ML 4WHCA 2EYRA 1TVHA 5FECA 5FIEA 4NO0A 1F3JA 4LRNL 3VXQB 4WGWB 1U8OB 1UM5L 2OJEB 4RGND 1OOAA 3P30L 3C5SA 3GB7B 3SOBL 1UJ3B 4L4JA 4X6CA 2Q7YA 4D9RD 4YUEH 3BVNA 1JIBA 5D1QA 1HSBA 4NM4L 4YPGA 5FKAA 5IHBA 1P7KB 4PJAE 3HA0A 2Q3ZA 3LD8B 1MCBA 2I9LA 1AFVL 1J05A 1EEUA 5D4QA 1AO7E 4O9HH 1GGTA 3LY6A 4JHWH 1MCCA 4FQXA 3L3GA 4XBPB 3D0VA 5E00B 5DSCA 2VE6A 1XF5B 4IHOA 4TUJB 3MROB 3D9AL 1JV5A 3VXSE 4YDLC 2NX5B 1YNLH 4JGUA 2E9IA 4G8GA 1JZ7A 3MV9A 2C1OA 5I75B 2UWEB 4XPFH 3EOBB 4OIIL 3ULVE 4HUVA 3GI8H 4XCEA 4GW4B 3EYVA 3ORJA 4HK3J 1E6JH 1TZIB 4G6FB 8CGTA 4ZD3H 4C4KT 4FFZL 1UACH 4JFQB 1MI5A 5AWNL 4M1GL 3M17B 4PRHE 2V5YA 4JFDA 5GS0D 1HI6B 1L7IL 1YY9C 3FT4B 2C3GA 1CXKA 3AC0A 5IESH 5AYUL 3ALPA 4JDTH 3CD4A 5FGRA 5IWLA 5IVOA 3GSVB 3HC3L 2NMSA 3BKCL 1IGCL 4LCUB 2X1OA 4ZTPH 5C9JB 2OBGA 2RAMA 2Q8AL 4KV5F 1SM3L 1HYRC 1MAJA 1ZTXL 1FDLL 1KB5A 4NYLB 4NQXA 3GJFB 3O3UN 3OX8B 4ODTH 4POZC 1F6AA 2OTWB 2XPGA 1FYTE 1C12A 4KI5D 3MRNA 4N0YH 3I6KA 1YNTB 4HUKB 4ODVL 2DWEA 1LVEA 3MZTA 2NXZB 3IJSA 4ODBD 2WSKA 3WO4B 1T4KB 2VC2H 1UCBL 3K81A 1INQA 4HFWB 2RFXB 5HJ3A 5K9QG 5GRWA 5FO8A 2OTPA 3ALWA 4MJ6B 4NC1C 5F7LB 5CCKH 1EO5A 2P5EB 2YPLE 4HF5L 3WS6A 3D48R 3GI9H 4S11A 3WD5H 5EULV 1F13A 3BGAA 4HH9A 4YHMH 1A7NH 4JFEE 3DVNB 4LLWA 3QXAA 4N1HB 1T2XA 3QA3B 4JPWH 4M61B 1R3LA 3KPSE 5IB2A 3SDAC 3FB5B 1KBGL 1K2DB 1JTTA 2DLFH 4L8SA 3D5OF 4UB0L 3WNLA 1KJ2B 3EFDL 4U7SA 3VDBA 4NQVA 1O0VA 5JW4R 3WXVH 3IDXL 1OGAD 3FRPA 1JHTA 1DUZB 5FA3B 4ODSH 2CSPA 1TZHB 3BZEB 4LLDA 5HHOD 3ISWA 3U7YH 1DE4B 1NBVH 3VFPB 2BXYA 5DJDA 5IT2L 1EZVX 5H35B 4K9EC 2W9EL 1A7RH 3BN9D 1F5WA 4HCRA 3T0DA 4HUWB 4NKMB 1AGFB 4Z7UF 2E6PA 5JIKA 4EEEA 1LWRA 1ZVSA 1OAZH 4ELKA 2YD6A 1DFBL 2D03H 3WLWD 4PJIF 5F1KC 4JREB 2Z91A 1UWXK 1QP1A 1T83C 1WFNA 2QTEA 4HDIA 1A3LL 4MNHB 4K7FB 1G6RB 4JO1L 3X3FL 4CJ1A 4DVBB 4LLMB 4F57H 1A14L 1R0AH 1BVLB 4ZSOA 3JUYA 2CMRL 2BNRE 4JZNA 4IJ3C 4AK1A 4KDTC 5HYJE 2ESVA 4N5UA 3MZGB 4QNPE 5DC4B 3MLRL 2VH5L 3ILPB 3MLTA 1DBJL 1QSFB 2R4RH 4ZO8A 3HRPA 4MAUL 3LHPL 4QHKI 4F58L 1C08A 4LU5L 1MRCH 4WU5B 4NCC2 2FSEA 3G5XB 5BJTA 2B8OT 5I1EH 1Z0NA 3MRBA 5D7JC 3MV8D 3ES6B 1HYSD 4K8RD 1ZANL 3MLZH 4PJFB 5D1XC 1S7TB 3FRUA 3OL2A 3WIFA 3UX9B 1DUYA 2ZUQB 2BMKB 4CADA 4TSAL 1W2KT 3CFKB 2H1PL 2EE3A 2DQFA 2X4SA 4WO4A 2AERT 4RAVB 4TQEH 3F7YB 2J6EH 1BBDL 1F4YH 4Y5YC 4OZIE 1FVDB 4R2GC 5KVDL 3EKCA 2IQ9L 3TH3T 5DQJB 2NY0B 1CZ8L 2A77L 4IRJB 1ZT7A 3PWLB 2WM0A 4N5EC 3WLBA 1CR9L 3LKOB 5D6DA 3SQOH 4M1DH 5FECB 1TVHB 1F3JB 3PQYB 5HGDB 3VD7A 5E0QA 1BD2D 3QUZA 4KJPC 3U7WH 1VACA 4D9RE 2VDRL 5FDYA 2J7LA 1DVFC 3C5SB 1UGNA 3DV6A 4GW1B 4LQFL 5IVXA 1NUNB 2AJXL 4PLKD 1PW3A 1W0WA 4WY7L 1KC5H 1WT5A 1A6AA 4U1LA 1T0PB 4CDGC 1QLRA 3BVNB 3DARA 3Q5OA 5D1QB 1HSBB 1IQWL 1KNOA 2DKMA 1U92B 4YPGB 4J3UA 5FKAB 1EUUA 2WBJD 1V3KA 1KTKE 2NZ9D 5ELIA 3V79C 1Q9OB 2MOVA 3B9KD 3CX5K 1YYMH 4HT1H 3V4VH 3EYOB 1HE7A 1OP3H 3BPLB 3WKML 5ESAA 4R4FH 1NCDH 2NY0D 2PR4H 5JHLH 1CGWA 4DCQA 2VE6B 1IC7L 4WU7A 5LQBL 3QDJD 3TVMA 4WHYG 3EDDA 3D87B 2NY5H 3PQYD 4G8GB 3MV9B 1IC5H 1U91B 4KHXL 4RDQF 4R7DB 4X9IA 3EYUH 5EIQA 4HUVB 4RISL 3B2UC 3EYVB 2P1YA 3G5ZA 3T3PE 2QSTA 3K8MA 4MS8C 1EVTC 2M1KA 4IIQA 5EZOL 3AS1A 2KZ1B 3EYQD 4KTDH 5C0JB 4PGEA 4FN0A 2PTTB 4JFDB 3HAEG 3I6LD 5ITFA 2G9HA 1IC4L 2VR4A 4UIKL 2DBJA 3UTPD 1UA6L 4MQXC 4FQJH 4MJ5A 2BVQA 3O6KH 1A3QA 1S7WB 1OLLA 2NY1B 1F00I 4NKDA 4PJDF 4NFDA 4P5KA 2NX5E 1QNZL 2VXSL 1ZWIA 4KI5E 2MPAH 5ICZA 1QR1A 8FABB 3GJEA 2UWEE 1F6AB 4PRIB 5EA0L 1J0YA 2XPGB 4MNQD 4Y4HA 1C12B 3I6KB 5DR5L 4OCSL 4EDWL 1TQBB 2DBLH 4FQLL 3PWJA 4U6TA 2NYYD 4MD5A 4OLUH 1WWWX 1IQDA 5J1SC 3T2OA 5TDNA 5C3LD 4KHTL 5FO8B 3HPLA 1R24B 5GSVB 4NHCH 1AHWC 3IKCA 4WHDA 3UPAA 1B0RA 4AEHL 3EW3B 3REVA 1FRGH 1LO3L 1E4JA 4EVNB 1PY9A 4QRSA 3VMPA 1NGQL 1R3LB 1GGCH 5HI4C 3E2HC 2JLLA 1CXHA 2Z31B 3R06B 4EXPX 4D94A 2NY1D 3BGFC 4HC1L 1CFTA 3MC0A 1JHTB 3UJJH 1FN4A 2W60A 1BEYL 5E7FA 2QADC 4PRID 5D8JH 3MRRB 3H9SA 5E8OA 5SX4H 1OSPL 2R0LH 4QHUA 4XMKH 4DN4L 2E7LA 3HNVH 2P5EE 1ZVSB 2APFA 2V5SA 3V9FA 4TULH 4ELKB 1S9WA 5I1JL 1CCZA 3NCBB 4NWTL 1QA9A 1OP5K 3LN9A 3QZWB 1A6VH 1CGSH 2FATL 2Z91B 5J13B 2DLIA 3V52H 3TESA 3FOMB 1D5IH 4K9EL 3EO9L 3QUMA 1RUQH 1DQLH 3P4MA 3HTLX 3UC0L 2FYYA 4AEEA 4UQ2A 5EU3A 3D39A 4PY7A 3IDNA 1WK0A 2Z31D 4JZNB 1RZGA 2J8UF 4M8VA 2DF3A 2ESVB 4IRSB 4XHJD 4XC3L 4HIHB 1ZHBB 4NKQB 4LARL 2QQQA 3S37H 5L9DH 2ZCKL 1RY7B 4KZDH 5K59F 4LKCA 1K3IA 5CSBA 3WFCH 1LHZA 5D2NC 2HJFA 1C08B 4LLYA 5J6HB 1JYWA 2FSEB 5SWZA 5GSRA 1B0WA 1NMCB 1PYWB 2R2BA 3QPQD 4G8IA 5CSZA 5HHVL 3MRBB 3UYRH 1F4XL 4A6YA 4NM8L 2EXYC 3FRUB 3GBML 4FP8H 4FQQB 3WIFB 1PX3A 2AJUL 1DUYB 2IPUK 1MFCH 3AU1A 4ZAKC 5C0EB 3VFVA 5EFIA 4WWID 4YNYB 5IR1B 1A6WL 4WO4B 3O4LA 1ACYL 4LSVH 4KROD 1KCSH 4F15B 5DFVC 1U0QA 2Q87A 4MMXC 1WCQA 4KQ3L 3W2DH 3MLPA 4Z8FH 4YDIL 4QTIL 3SDDA 3RVWD 1NL0H 3WLBB 1I1AD 5AUMA 3FQUA 4HKXA 2ESVD 2HLAA 4IRSD 1QSFE 1MCKA 2N4IA 5BQ7B 5H2BB 3ARZA 3QUZB 1VACB 1FZKA 2RCSL 1RZJC 3BWAA 5IVXB 5T5NG 3ARYA 3TNMB 3O0RL 1W0WB 3AS0A 1A6AB 3T1FB 1M05B 4PJFE 1MCLA 3HZYA 5E6YA 2GCYB 2QHRL 1KNOB 4K3JL 2ICWI 4NOBA 1A6UH 3MLUL 3P40A 1I8IA 4LP5A 3VJ6B 1NAKL 2AK1H 1VPOL 1T22A 3U9PH 3VD5A 3KXFA 4TTGA 4PLJC 3HNTL 2AEWA 2DDQL 2XWJA 2Y06H 1I1FB 4NKIL 4WO4D 3QXWA 1P9MA 4B7IA 1OTTD 3VXMB 2YRPA 4OF8A 5DDHB 4JFFA 2FEEI 1AKJA 1KCRL 2LAGB 1ZT1A 2DM7A 4L5FL 4DCQB 3HFML 4WEMB 3PQYE 5EOCL 4EBQH 4BK5A 5JXAL 2XQYK 4WU7B 2X4RA 4HIEB 4ODWA 2FX8L 5GIRA 1AQKH 2GQHA 4NNPL 5J56B 2BY2A 3TVMB 2A9ML 2YPVH 1KPRA 4MJID 1J0HA 2AK4D 4HJJL 4XB7A 3OKMB 2K1MA 2W65B 1ERNA 4OCNC 1OAQH 1S7VA 1Q0XH 1S7XA 4AM0A 1WFUA 4GKNB 3ET9F 2YA1A 1BGXL 1A0QL 1J1XH 3VXUD 3SCMD 3FN0H 4R6UA 3ZDYE 1U3HB 1PQZA 3Q6FA 4PGEB 3QDMA 3V8CA 4KTEH 5KSUA 3STBA 5DO2C 5I8OL 2G9HB 3ROOA 1NGWA 4URTB 1GIGL 5J89A 2PXYA 1LILA 4DKEL 5BMFH 1RJLA 4HD9A 1JUFA 1OD7A 3VXMD 3F6LA 4HWBA 4MJ5B 4CVZA 1CFNB 2BVQB 4OQTL 3UTQA 4QCIA 4EUPA 1WLHA 4OI9A 4P5KB 4G8GE 3MV9E 3VWJB 1Z5LA 1BM3H 1QR1B 2BCKA 2CKBA 4OCXH 3GJEB 5JPMA 4Z7NE 1VFAA 3O45A 4I0PB 5T1MA 1JGVH 2GFBA 5EC2A 3LKPA 1MFBH 3PWJB 4PJ8C 2IC2A 3FTGB 3WIHH 1JF1A 2C3XA 4LPWA 1IQDB 4NIKB 3V0WL 1HNGA 2YSSA 5TDNB 1YDPA 1JGEA 1WISA 4S1QL 2YBRB 3ULSA 1CFBA 3L3HB 1NKOA 2R0KH 3T04D 2J2ZA 4ENED 3HPLB 4JFDE 3IFPA 1R3JB 4UU9A 2F19H 1U3HD 3REVB 2R8SH 3G04A 3QNXA 2V5TA 3IFOA 5FOBA 1GJIA 4CRPA 4X8XA 2EDEA 2LFGA 1BX2A 1P84K 5LGHL 4JM2B 3L3KB 3NFSH 5FYJL 3O3EA 1BJ1H 4PRIE 2YK1L 3CVIL 1DLFH 2VLMD 4M7LL 4U05A 1FN4B 2W60B 2XG4A 2CK0L 4RIRA 3VWJD 4XXCA 2J4WL 2H32H 5E1AA 3VXPA 3INUH 4KK9C 2GHWB 4I0PD 5GRXG 3OG6B 4ZS7L 2P42B 3VRIB 4RWYL 3EUUA 1CVSC 2F54A 2X40A 5C08D 3LN4B 1A47A 3E6HB 4OGAC 3RWCA 1F2XK 4OB5L 1S9WB 3QJHA 5HDLA 5J3HD 1CBVH 4F7TA 1LO5B 2EO1A 5D71H 2I5YH 3HUJB 3VFUA 1KB9K 1GAFL 5DD1L 43C9A 3VXOA 1B4JH 4P2RA 1XEDA 3K1KC 3AB0C 1PBYA 4V2CB 5EU3B 1CQKA 2GJ6A 1MFNA 4JM2D 3BAEL 1SBSL 1NCNA 4X4YA 3TT1L 3B83A 4JG1L 5DJ2A 43CAA 4FHBD 4XBGB 1OAXH 3MRHB 1W0VA 2PETA 1JZ2A 4Y2DA 3VH8A 3D25A 1AE6H 4LKCB 3TBVA 1NFDF 3MBEA 2XWTA 5JORA 5MEPB 5GRZA 2XKNA 1J7VR 5SWZB 3SDXA 3WEXA 3A6BL 5IOPA 4G8IB 4ZDHB 1E28A 2VR5A 4A6YB 3REWB 1QKZH 4EKXA 4U6HA 3ZHLA 4Z7WF 1A7OH 3PP3H 4NT6B 3AU1B 1ZLVH 2OXHA 3RHWK 5EFIB 5D7IF 1M7IA 5EWIH 3HC0A 3ZHDA 4PJ5A 1BZQK 3TCLB 3RWFB 4N0RA 2JJSA 4JPVH 5IBUB 1NUFA 4R26L 2ESVE 4EN3C 4FG6C 1AGBB 2JJTC 3W0WA 2VZVA 4HKXB 5BV7C 2I26N 4XI5D 1JZ4A 4YIQB 1CDIA 2E7CA 4AZ8A 4BH8A 5F21B 1FNHA 3QFJD 3WFBL 2CLVA 4QRPB 4G8FA 5JW4M 3L3JA 1CLZH 1CDJA 1ZVHA 4EJ1C 1BFVH 5ADPL 2HTLD 5GRYA 4JR9L 3UTTB 1EEZA 2EEDA 1QLEH 5DJCB 3PNWA 4M5ZH 3LDBB 3J7HA 3HZYB 1S7RA 2FX9L 1WZ1L 4GLRH 1JN6A 5GZOC 4RNRB 1I8IB 4QLRA 3V5DA 2R2HA 5CEZD 1KEGH 4OIAA 2FX7L 5F9JA 1RZJL 3KXFB 1N7MH 1PJ9A 4WWKD 1AC6A 5C8JA 2XWJB 2NY4C 4Y89A 1F11A 1LP9A 5C0NC 2ZUXA 4UQ3B 2W0LA 3VXTA 4JFFB 4WFED 3WMSA 4U1IA 3P4NA 1ZT1B 4J4PC 2FRGP 1MCIA 7FABL 3PHOB 4ZFOL 1IGJA 4XPBH 4PP1D 1MAKA 5IVXE 1KPRB 3IJYA 4QRPD 4I8DA 1P2CA 1IEAA 1U93A 2JK5A 5B8CC 3TT3L 1SJEA 1TJGL 3C5ZC 3UTTD 1S7XB 4AM0B 1C5CH 4WI2A 4HUUA 4GUPA 4R96A 1VDGA 2QJDA 4FZ8H 2QQNH 2BSRA 2DQEH 1PQZB 3QDMB 1EHXA 4GH7B 3KXFD 1RJZA 1LEGB 3PWPB 3ROOB 1JGDA 5JPNA 3NFPA 2PXYB 4M7LT 3VXME 4NWUH 4OJFL 1L9MA 1RJLB 3MREB 3ARGA 3NCYS 1SVZA 2H3NA 4LPCA 4XVSL 4K3EL 1OW0C 4MDJB 1JUFB 1I85C 4CVZB 2ED8A 4TPRL 3UTQB 3ULUD 4EUPB 1OP9A 3RWEA 4GW5A 4R8WL 5IEKB 5C86A 2P44B 1IBGL 4LLAA 5I1CH 3GBNL 1Z5LB 3L95B 5I8EB 5BVPH 3U0PB 1OLZA 3O45B 5T1MB 1I3RB 3P9WB 3LKPB 3ZE1F 5I19H 4NSKA 4NGHH 2G60L 1JF1B 1L0YA 2P5WA 1S9YB 3CDYA 4H0IA 2KPNA 2YSSB 4IOIA 5J06A 2B4CH 4QXUH 3OXSA 5T3XH 3ULSB 3V6OA 3LMJH 1OTUC 1FPTH 3IFPB 5F8RC 4Y5VC 1F45A 5FUZL 1PLGH 2P48B 5T3ZL 1A6PA 3G04B 25C8L 3QNXB 4MMZC 5FM5M 1BVKA 4LCYB 1N64L 3PWPD 4PJGA 5D96B 5B39A 3MLXH 5DC0A 3KPMA 3C9NA 1BX2B 1A4JA 4JHAL 4WI3A 3VD4A 3BPCB 4NQDB 3MRFB 1WZKA 3GSUB 4QOKA 2VLME 1I3GL 1HKLH 1OAYH 1NCCH 3O3EB 4PREA 3OAUH 2AABH 3SBWC 3EDKA 1NJ9B 3CX5J 4RIRB 4TRPL 4K07A 1FLTX 4YK4C 4FFYL 3QCUL 3HMXL 1WEJH 2K9UA 2VZTA 1MFDH 4KMLB 4Y5XC 5DT1L 1AGDB 5IBLD 4QY8A 1FIGH 1XF3B 3F58L 3NH7L 1VADB 1NFIA 1LDSA 3BZDA 4APQA 1BQSA 2B7DT 4MXWH 4HGWB 3RGVB 5HYIA 3K46A 5CGYD 3C09C 4OFIA 1OVZA 1JMZA 1T2QH 4OZFB 3LAFA 3BSZL 3VXOB 1H3XA 2PO6D 4OZGA 4P2RB 3V0VA 2C7UA 4JQIH 4ESKA 1GSMA 3QT2A 3GK8H 1MJ8L 5KOVC 1DQDL 3IDGA 5MENA 3MCLL 2GJ6B 4NQDD 4UT9L 1XFPA 1QG3A 1QBLH 3FT2B 4X4XA 3IDIB 5DJ2B 4EI6A 3ARBC 3QAZC 1I9JH 5D1ZA 4JJHA 1R5VA 1CWVA 1M7XA 1MHPH 3ZTNL 5HVGB 1W0VB 3QDHA 4LLUB 1IRAY 4Y2DB 5GGQL 2EYTA 3PABA 2WINA 5EUOA 1RUAH 2XWTB 2GJZA 3L3DB 3AS3A 5GS2H 1EXUB 2XKNB 3SE9H 4C83B 4XBEL 3DVGA 1FNEA 3SDXB 2JJUA 5TF1H 2H8PA 2DQDH 4NP4L 4OCWL 5CZXC 3CXDH 3RGVD 2OZ4H 1PG7X 2V2XA 4OLZH 4U6HB 3BD4A 1F97A 1AJ7H 3PJSB 3HUJE 1MHCA 2IMMA 2BRRH 4E9LA 1I9IH 4ELMB 2A0LD 1EH9A 1UVQA 1G0YR 5BS0B 3HC0B 4PP2A 3FZUC 5I1IL 4PJ5B 1U6AL 1U8IA 4YE4L 3LV3B 2XN9D 3DRQA 2R1XB 2WV3A 4PJCA 3D85B 5I0DA 2Q86B 1ZXQA 1Q1JH 4JFPB 3OGCA 2F5AH 2VXQH 4KQ4L 2E27H 4YHOL 2VLJA 2WP3O 4CMMB 2Q76A 1OB1A 4BH8B 2CLVB 1KEMH 3R8BB 1C8PA 1UEMA 2WQRA 3F7RA 4M6OH 4OLVL 5SWZE 1LQSR 3U30C 2XG5A 1EEZB 2NY2C 1NGPL 4P2YA 3RVXC 2A73B 4D0DA 1OPGH 3VGEA 3OKDA 5BV7L 5INDA 1S7RB 3LQZA 1JN6B 2BHYA 1PG7W 3RVUC 3H8NA 3V5DB 2R2HB 4GG6F 3IJHB 5F9JB 1WBYA 4LLQA 5I0ZA 2ICWA 5C8JB 5BS0D 4PS4H 2YHGA 5GRVK 4NJ9H 1LP9B 1GOFA 1PD6A 1M1SA 4ETYA 3SJVD 1QSED 4P2OC 3D85D 3GRWH 5C09A 3HC4L 5KVFL 1NC2A 4U1IB 3VWKA 2AXGA 3P4NB 1YY8B 3X14A 3Q1SL 2P7TA 3U0TB 5K9JH 4QRPE 5DVNA 1AQDA 1IGJB 3VA6A 4ZUTA 4RGMC 3UTTE 1IKFL 3QO1B 4X98A 4HJ0C 1IEAB 1U93B 3K74B 2JK5B 4TOYL 4WUUA 1SJEB 3IFNL 3P0VL 3QR2A 5LGKA 1BLNB 1JNLL 1Z9OA 2VXUL 4GUPB 4R96B 4AG4L 3BGMA 4Z7QE 5L8KB 3MJ7A 1ORQB 3KXFE 3K4DA 3QJFB 3T2NL 2DIBA 4CVUA 3WJLC 2GT9A 3FRPG 2OTUA 1RJZB 2GSGA 2YUXA 1JZ3A 1J0IA 5JPNB 3DV4A 4MNGA 4QRTB 5JOFA 3ARDD 4LQ1A 3TBSA 2PNDA 3Q6GH 4JFFE 2EC9T 3MBXH 4P4KC 5GS1C 2BVOA 3BDBA 1B6UA 1KN2H 3VRLF 2EDRA 4TNVK 4OZHB 2GITB 3OKKA 1GL4B 3HPJA 1GVIA 2N1KA 4L1HA 3G9AB 3QZWG 3RZCB 1Q9KB 5DHYA 4XPGL 6FABL 2O61A 4NSKB 1A5FL 4HWEL 2ZCLL 2D7NA 5LJYH 4JFXA 5E5RB 1K4DA 3S35H 3WN5C 3CFEA 4XRCA 1NQBA 4IOIB 5KS9A 1AR1C 3SKOA 3OXSB 3BP6A 4ODUA 5C0FA 3BZ4A 3QDME 5D93C 1SHMA 5DMYA 2VL5B 3PWPE 5IVZA 4HC1A 3HRZB 3BISA 1ZLSH 4IMKC 4NHUB 2FLRT 1BVKB 4PJGB 4XCCL 3TWCH 4PJEF 3C9NB 4TNWF 3SDAA 3I6GA 1WCBB 1H3WM 4LCCC 4P5TC 3FO2A 2ZPKL 4DGVL 2Q3AA 2VOTA 4XC1H 4P46C 5F7EH 4XP4H 4PREB 5ENWB 3MFFB 4P57A 2WUBL 4QHMB 3KLSA 3MV7A 2HJKA 1WZLA 2IQAA 1EJOL 4V2BA 1Z9LA 3RZCD 4G6AD 5E99H 1UH3A 1P53A 4Z77B 3LKQB 5IF0B 4GS7C 4CGTA 3KYAA 1HSAB 1TPXC 4WHYH 3MLWL 4APQB 2HFGH 3T8XA 5E4EC 3V5HA 2R69L 5FYKL 2DD8H 4JRYA 3RWHA 5DLML 4PTTA 1R3KB 3KAAA 5LBSL 3SKJH 5A16A 3MNVB 4X7TA 2IH1B 3BJLA 1LO4L 4U1HA 1CFVH 4JO2H 1K4CB 4XPFL 4PJXF 3PUCA 2EXWD 5F88A 3TO2A 4YBLC 3O9WB 4PJ9C 3WDJA 5ECJE 1A9EB 3RJDA 4ZD3L 1MQKL 4OZGB 4CDHA 3V0VB 4NQDE 2AJVL 3HAEH 5I1LA 2A9NL 3EYFA 3MNWB 3ARUA 5EORL 4PIRF 1G9NH 5DHXB 1IARB 2NTFA 2XY2A 3IDGB 5MENB 2GI7A 2O5XH 1BZ9A 2VIRA 4KDTA 3QHZL 4X4XB 1D5ZA 4JPKH 4NJAL 5GPRA 3ZKXC 2BSED 1R5VB 4KY1L 3LEYL 1FFPA 3ILQC 4K7PY 1Q94A 2H9GA 4JFYA 2EYTB 2WINB 4DTGL 2GJZB 4W4NA 5E94B 4KZEH 4RBPH 4KDVA 5EUKB 1FAIL 3CUPA 3CVHA 2AXJA 3KPNA 3DVGB 1FNEB 2B5IC 4Z7UA 5D7JA 1TQCB 5D1XA 2COQA 4MXVE 4N0YL 2NZIA 2V2XB 1MHCB 4PJIA 2B2XL 3MV11 4MYWB 3JV6A 1UVQB 1QLFA 1KXQE 4P2RE 4PP2B 1K8IA 5FHAH 3O9WD 1U8IB 3KR3H 4LEXH 1N6QH 1RPQA 5HDOA 4Y5YA 4Q0XL 2GJ6E 3EJZD 2X4PA 3MOBH 5DC9B 4ZXBB 1EIBA 2DQTH 4I0CC 2X4NB 4ZTOH 3HG1A 5J57B 4M6NH 1KIPB 4EIZC 5L8JB 1EA9C 1HNFA 2Q76B 2PCPA 4PGJA 4XCYA 5TDOA 1P84J 4OF6A 3SDXE 3TLRA 4O58L 2PYEA 1OAKH 3EO1A 3OKDB 3T65A 3X13B 3IYLW 3BE1L 2C4FT 3NTCH 2V9TA 2VZSA 5E2VH 4ELME 3EOYG 3O6MH 5BS0E 4OF7A 5D2LF 4JKPH 1WBYB 4LLQB 4PJ5E 2ICWB 4R4BA 4XWOD 1EFXD 1SBBA 4QXWA 3LH2H 1HILB 3KPQB 4KGLA 1UT9A 1OAZL 1JBJA 4R3SA 1BOGB 4PB0L 5F7NC 3B8YA 3AY4A 5DI8B 5JA8B 5C09B 4LAQL 4ZXBD 2D9CA 2BZDA 1NC2B 5DWUL 2AXGB 2DI9A 1J9CT 3CMOL 2BDNL 4WTWA 1MPAH 1P7QA 3ZL4H 2ARJB 1UM4H 2JCCF 2Y07L 3S4SA 2HKHH 2YZ1A 4CVWA 3PWNA 1KB9J 4YDLB 4D9QD 3ULVH 2YPKB 4NNYA 2NY3C 5CHNA 3RL1A 1UWEL 3DROA 3HKFA 4G6JH 4BZ2L 4ZUTB 1JYXA 1X5AA 4X98B 4LCIH 3O41A 4ZFFB 4WUUB 1EHAA 1CXLA 2AQ1A 4XMPH 1RUPL 3BGMB 2Z92A 4LSQH 4ZNEE 3LRHA 5ISZA 4OQTA 2ZUVA 5C7XL 1OM3H 4OUUA 1G7HA 3H7BA 4D8PB 1G0DA 3I84A 4ZQKA 1X5HA 1LNUA 2OTUB 4HWUA 1LP9E 3T0WA 1XCTA 3DV4B 4GRLC 1MF2H 3TIDA 4FS0A 3NGBC 2P24A 3S96A 4HUMB 3MLZL 1N6VA 3QH3A 5TE6L 5EZJA 3QG7H 3FO9B 3V8OA 2BVOB 4XP6H 4Q9QL 3CJJA 3ARFC 3DO7B 5ID1B 4L3AA 5ANMA 5ICXB 1E4XH 3TZVA 3HPJB 2OP4H 1EVUA 1QBMH 4GAGL 1RHHA 4GG8A 3RIFK 2HVJA 5DHYB 2O61B 2XA8H 4NN7C 3SN6N 3QIUC 1MFEH 4JFXB 1BAFL 3MA9H 3K7UA 3F7QA 4X5LA 1ZKAA 4MB4A 3FONA 5KS9B 2VLKA 3BD3A 1DBML 3BP6B 5E2WL 4LVNC 5DK0A 3JV5A 1VKXA 4NRXA 1ZA6A 4PRDA 5IVZB 1UWGL 4NDMA 5IIEA 4LPTA 3E1F1 1ZEAH 1YY9D 3CSYB 5IJKC 5I15H 5DD6A 1EX0A 4JZJB 1KELL 5DTFA 4WVRA 1ZHNA 1AY1H 3O3AB 2BOBA 5F44A 2M2DA 3FO2B 4X7SH 4OZHE 4M5YL 3QUYB 4UILH 4Y19A 2YRZA 1WQVT 3DETC 2JB6A 4PJDA 1QYGH 5E6IC 1J88A 2DQCH 5IMOB 4IM8A 1FBIH 1Y0LA 4X83A 2HJKB 3LKRA 4POZD 3PP3K 3DX7A 3LPFA 3EZ8A 4YQXL 2OL3H 1ZLVK 1NMBH 5DYOA 4CN1A 3N1PC 3W11D 4FXLA 3X11B 3LS4H 3V6OE 3T8XB 5D70H 5IBUG 2J5LC 1BHGA 3RWHB 2GK2A 3VGFA 4HXBH 5A16B 3T09A 1TLKA 5AAWA 2UUDH 2DKUA 3TO4D 3VD3A 4PJGE 5F88B 3AXLB 4NUGL 4NC0B 1DQMH 4ISVA 2K3TA 2V5MA 4CMHC 4R0LB 5I1LB 3NIDF 3NCJH 1CXIA 3EYFB 1BQLL 2ZP0T 4ZUWB 4WV1B 2VIRB 5HYFA 2J88L 3JTTA 1KXVC 2R15A 4XP9H 1D5ZB 3QUYD 3WJJC 1YN7A 1U8NA 1IGML 1FFPB 3QEQA 3PDDA 3PWVB 2XZAH 4DGYL 1G9MC 1XF2A 2H9GB 4JFYB 4YHNB 4JFOA 5D2NA 4OBSA 2HT4C 2IBGA 3EOTL 5D72H 3RNKA 2DN7A 1FP5A 3QRGH 1TIUA 3OBAA 3IB4A 5D7JB 3F6IA 4K94C 1YNKL 5D1XB 3MXVL 3UBXI 5D5MF 1KJ3L 2X7LA 3M8OL 1S3KH 4PJIB 2R0ZL 5MP6H 5ICYA 4OLUL 3VE0A 3JV6B 1QLFB 4F7MB 5DUPH 3TN0C 4OZGE 1EJ6A 1K8IB 4GBXC 1FNAA 2A6KA 4Y5YB 1MJ7L 4G80A 1CGVA 5MENE 2QQLL 4R2GB 3CU7A 3OAZH 4ONFL 3P11H 4YHIA 5KSVA 2ICCA 1N5AA 4HHAA 5H8DA 2J8UA 2LAAA 4LVHB 3TA3A 1J5OL 4JO3L 3KYKL 4M4PA 4BFEA 2YD5A 3VMNA 2YA2A 1S7QB 1DVFB 4F7CA 3GSQB 3LKSB 3V4PL 5IQ7H 5D6CA 3OQ3B 4M8QB 4YHPB 3SDYH 4JGMA 2DAVA 4HZLA 3EO1B 1H5BC 3T65B 4NZDA 5I1KL 1SEQL 1MCPH 3RX8A 1FGVH 2GSIA 5EC1A 4EUPG 1V7ML 4J6RH 3QISA 3ZE0E 4R4BB 4KJQC 3T0XA 4ZFOA 2NY7H 1RAMA 3U36A 1FG2B 5I8KL 5I73B 3V7MA 3ARED 1WC7A 3GSXB 1CLOH 12E8H 1U8LA 4K2UL 1RMFH 1CGSL 1QSZA 2IPUG 5HYEA 1P7QB 5IG7A 5TE7H 2IPKA 4P3DA 4G6KH 1T1ZB 4NNYB 5CHNB 4EOWH 3A0OA 3ROLA 4S1SH 5DD5H 3VGAC 1CICA 1DVFD 1WSST 3FQRA 4IMLB 2VWEC 3O41B 4POUB 1MCEA 5DXWA 1F8TH 4BSJA 1ZMYA 1EO8H 2B0SL 2Z92B 3HE7C 1KT2B 5ISZB 1YMHB 2CUHA 1LEKA 1XR8A 5LG1A 1FFOA 3WFCL 1WIOA 5KG9A 5EB9A 5L2KA 1UZ8B 1LNUB 4DAGL 3VCLB 5C0DA 5ID0A 1TDQA 4RX4A 2ITDB 2W0KA 1VFBA 1J1PH 3TIDB 1T7YA 4ONOA 2P24B 2EIEA 5C09E 4Y4KD 3QH3B 4JKLA 5EZJB 4Y1AB 3RBGA 3GSOA 1HOCA 1HK6A 3VGGA 5C0BA 3OKYA 2XRAH 2CGRL 4LSVL 5IGXL 3C2SA 3FFCA 3MLYH 2ZJSH 1A6TA 4GG8B 1BBJA 1RK0B 2ADFH 2HVJB 5E2UH 3GHEH 5JDSA 2E9BA 5E4IA 4FOMA 3HZVA 5LGJA 3DUSA 3BKYL 4WUUE 4OZFG 4PJ8A 1Q9LA 3L5JA 3RKDD 3PG2A 1IGYA 4XVJL 2IAMC 2XQYG 4NOFA 4C57C 3GSNL 2KQNA 1YEJL 3EJYC 1WF5A 5DK0B 4V1DA 4I0KA 2ADGA 1AHWB 1P6FA 3LZFL 1VKXB 4NRXB 4M9OA 1ZA6B 1YUHA 3S7GA 1Z3GL 3RWDA 5BXFB 4ZOEA 2Y6SC 4O2CA 3HMXA 5DTFB 5FO9A 3E2HB 4OM0H 2HMID 1FG9C 4MQXD 2ZG2A 4S1RL 1J10A 5E24E 3GJFH 5T1LA 5HGHA 15C8H 3SKMB 1SYSB 4Y1AD 2HN7B 1EDQA 3N9GL 2VDKL 1I9EA 3LRSA 2WLYA 4BFIB 1RZFH 2JB6B 1QFHA 3BGFB 4FQXC 3LQAC 1NC4A 5I9QC 4OGYL 5LWYL 2HVKA 2RR3A 3HZMB 3PL6D 1QFUH 2QADB 3LKRB 4YHKL 3C6LD 1E4XI 3BT2L 4FNLL 4FQPA 1T80A 4BQ6A 1F90H 3MA7A 5DYOB 2MCPL 1M71B 1DBKL 5KS9E 3G08A 2X42A 4Y4FD 2ZNXA 4NC1E 5CJ5A 3C60D 5CBEB 2BOCA 3FO0L 4KMQA 5HDBF 5FYLL 4WUKL 5I18H 3AROA 3TJHD 3ZE2F 1FSKB 4JDVA 5ACMA 5TGBA 5JLZA 5JW4N 2FLBT 3L7FA 4ISVB 1DN0A 1JHKL 4Y16D 1GZPA 2IG2L 5KW9L 1GGIH 4ZPVA 4F7PB 5HI4D 5DD3L 4UNUA 4HV8B 4R4NC 4KV5E 5T1DL 1CDHA 4M02A 1QFWM 4JN1H 1CU4L 4DVRH 2FHBA 3S5LB 5HGAA 5EIVA 5IWLC 3MRLA 5JW3L 3UO1L 1RZIA 1YN7B 3QEQB 1E27A 4RMTA 3G6AB 2RJMA 2QADD 3OAYH 3PP4H 4QHNA 1QRKA 2N56A 4OD3H 1PEZA 2OI9B 3O8XD 4AQ1B 2OJZL 3RNKB 5IK3B 1SJXA 4MZ2A 1G6RH 2XTJB 3DO3A 5EBMB 3HI1A 5I2IA 3MYJB 4XCFH 1E0OB 5T5FH 2X7LB 4KRLB 1G9ML 4D0CA 4ZAKB 3BIKA 1IE5A 3VE0B 4F37F 4FXKA 3TH4T 4J3OC 5K93A 2OK0L 1TJIH 2DJ4A 4PJHF 4KFZC 5B4MC 1JCKA 4O2FA 4K94L 4WW1A 2F19L 4HXAH 4B50A 4P3WA 1XIWA 5KSVB 4CN4A 3CLEH 1N5AB 4HHAB 4UMGA 2JJTA 1QOKA 2A2QT 4YDVA 4WFGD 1KPUB 2Z93A 1XGRB 4UI2A 3K8LA 5EZIL 4L8SC 5IJVA 2Z35A 5KOMC 4NUJA 4RAHA 2VXVH 4O4YH 4X7FC 4ERSL 2D0HA 5C0AA 1N2RA 2VDQH 5JHDD 5A2KH 1NFDA 4HZLB 1T0NA 5EU4A 4PJ7B 5JUEH 3OF6A 2W9LA 4X8JB 3HNSH 4KUZL 4PJIE 2XTJD 4NFCA 4X6FB 2EDHA 4YXKH 5KSBB 4DUXA 4Z7WA 4GRWB 4E42A 2E8YA 5LXGH 4ZAKD 5SV4A 2EH7H 3GHBL 5D7IA 3R4DA 4U1GC 2HG5A 4DZBA 4FTVD 2ZUYA 3VRJA 2CDGA 1NDGA 1NGZA 4I2XB 4U6VL 1Z0MA 1U8LB 3W39A 3AUVA 5GJSH 4YDKH 1KTDA 4J4PA 2VDLH 1MFAH 3F7PC 4XNXL 4RMVA 2IPKB 4P3DB 5HI3C 2IBZY 5CGMA 3R0NA 3FN9A 1SY6H 3FQRB 5E6ZA 3RU8H 3PHQB 5ESVA 1JGLL 5B8CA 5I30H 1CE1H 1JRHL 1GC1C 2HWZL 2VAAB 4JB9H 5HHQA 2LU4A 1ZA3B 4JRXA 3MACH 4PYHA 1LEKB 3WNKA 5I71C 1XR8B 2X4OB 1D3CA 3DRTA 4OLYH 5KG9B 1I75A 5L2KB 3KPLA 1PSKH 4MA8H 3RUGB 2X4UB 4PLJD 2OQJB 1GOHA 2HKFH 2FJFB 2XZQL 5ID0B 5CUSH 2BVYA 1ITBB 1LK3H 1P4LA 4JRWA 2GKIA 2V7HB 1I85A 3QI9C 4U33A 4P99A 4KKBC 5HPOA 4OAWA 1HOCB 5C0BB 1B2WH 3K1DA 4WGVB 1PG7L 2Z8SA 2R39A 3MCG1 2CH8A 1YJDC 1A6TB 4LP4A 5CMAA 1BBJB 2Y5EA 3BKJH 2JIXA 2HRPH 1LO0H 3HZVB 4KMTH 2X1PA 4MAYC 5DJ8A 2EDWA 3DUSB 1P4BH 1Y6MR 3I3EA 4XMLH 1FNFA 4PJ8B 5H94A 2P45B 1Q9LB 4OM1H 1IGYB 2DLEA 4GXVH 1HQ4B 1FVEB 4QXTA 1MH5B 3P77A 3QEGH 5ISZE 1HDMB 1WT5C 1I8KA 3SO5A 2H26B 4V1DB 3I02A 5EU6A 1CLZL 5C0CD 2BNQB 4WCYL 4XZUA 4I5BA 4KDWA 1AIFA 5CP3A 4OI7A 4KUCD 1GRWA 1KCKA 4M5ZL 4O2CB 1NLBH 4Y1AE 1X7QB 4PGBA 1U8PA 4XNYH 5HGHB 4RBPK 3B9AA 1N7ML 3GMLA 3HHRB 4NBYB 4QF1A 5JO5A 4O5LL 4J8RA 4LEOB 3VXRB 3SGEH 3QIBB 2VDNH 4YO0B 2DMKA 2HVKB 4DFHA 1N0XL 3GMMA 2BSTA 4HMEA 1CD8A 4H20L 3OZ9H 4MX7A 4U1NB 3OJ2C 2VKXA 3FB7A 1XGQA 3MA7B 1KN4L 4P2QB 3FT3A 4XTRC 1G7JA 3OKOA 1RZ7H 1T5WB 3LQAL 2BOCB 1HHJA 3DOSA 3BZFA 5FYJE 4HMCA 3VGBA 4LIQL 5L2JA 4JLRA 3MO1B 1SJVA 5J1AA 5B22A 1TJHL 2FJGA 2BNQD 5MERB 5TGBB 1QTYT 3T4AA 1NCTA 4Z78A 1DN0B 1C5CL 1GZPB 4HIXL 5J0BA 3EOAA 4ZPVB 4QYOB 2UVEA 3NABL 3GO1H 2B1AH 2GUOB 3B6SA 5GQBA 4K3DH 1UFUA 1FVCB 2NLJA 3MRLB 1MUJA 3ARBA 5E08L 1XCQA 3VXRD 1BJ1J 2AKRA 3QIBD 1LK2B 5TQ0H 3FMGH 3RJQB 3AMLA 2X09A 3QQ3A 1QFWL 3VFOA 1J0ZA 3RAJH 2FHFA 1IT9H 1ED3A 1MEXH 4X99A 4Y4HC 5I1CL 4P2QD 1HHIA 1T1WA 4BSWB 4RFEB 3KLDA 5EBLA 3VFNA 4OGAD 1A3RL 3HI1B 5I2IB 1RUMH 4BH7B 5IB5A 3UJIH 1KB5L 3DBXA 4MD0A 4ZUSA 3UBXA 3TBTA 4QHLA 5ETUB 1JZ6A 4WFGE 4RMWA 1YN6A 5T3XD 1QRNA 2Q8BL 5IBTH 1OAUL 2BHUA 2VLRA 5ILTL 4EN3B 3GKWL 3WNNA 4TSBL 2PW2B 3TGXA 2ZCHL 2Z93B 2ORBL 4YHZL 3QEQE 5BV7B 2GTZA 4P23C 4FQCL 4LASH 2BFVL 3S98A 32C2A 1XGPA 1YEFH 4NUJB 4MQ7A 1IGIH 1E6OL 2C4FU 2CIKA 4Q6IC 5EOQH 5GISH 1FZMA 1N2RB 1S78C 3C6SA 1NFDB 3L3OA 5E95B 1F58H 5FV2A 4JY6A 5JW4Q 2XTJE 4PJBB 2C3VB 5EU4B 3PV7A 2BVTA 3PWUA 3KHOA 5DJAA 3I3BA 1LMKA 1D9KD 3VG0L 4BK4A 2VUOA 4Z7WB 1CIDA 3DXAA 4E42B 2JF1A 2KZWA 2NY4B 4EDXA 3HS0A 4L4TA 2CDGB 1NDGB 4S0TD 3MOAH 4I3SH 5ALCL 1I7ZA 4P2OA 2F5BH 4P5MA 2J8OA 3DYMA 1G7PA 4U1JA 4EN3D 1MRFL 1UC6A 2AV1A 4YDJA 1CLYL 3TBWA 4AH2A 2GJJA 3GSRA 2YEZA 4J12A 5E2TL 2Z4QB 3BEVA 2RHEA 3IRZA 4YXHH 4HKBA 4LF3B 1JPFB 5IW3A 3C08L 3B2VH 3QQ4A 3CFDA 4G7YH 4CW1B 3SE8H 5B8CB 1U8MA 1JPGA 4PJ7E 3C5ZB 3VW3H 1Y18A 2BX5A 2ZKHH 4LPXA 5JMOC 3NAAL 2F53A 1T3FA 1AGEA 1TVDA 3S36X 5KSBE 1R3IH 3O81A 4JRXB 5DA4A 4GRWE 1RULH 3BQUD 3BPNC 3EHBD 4XVTL 5EIIA 1RUAL 4H8WC 4GG6A 3WJLA 3S88H 4M00A 3CPLA 5ADOH<