3WHE1

A new conserved neutralizing epitope at the globular head of hemagglutinin in h3n2 influenza viruses
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
226
structure length
226
Chain Sequence
QVQLVQSGAEVKKPGASVTVSCQVSGYTLTSYGLSWVRQAPGQGLEWVGWINTYDGQTKYVKKFQGRVTMTTHTGTNTAYMEMKSLRSDDTAVYYCARVEGVRGVMGFHYYPMDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
publication title Conserved Neutralizing Epitope at Globular Head of Hemagglutinin in H3N2 Influenza Viruses.
pubmed doi rcsb
source organism Influenza a virus
total genus 27
structure length 226
sequence length 226
chains with identical sequence 3, 5, 7, 9, M, O, Q, S, U, W, Y
ec nomenclature
pdb deposition date 2013-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe102
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe101
2XV6B 2Q8BL 2BX5A 1CLCA 3MJ8B 4KTDL 3HUJE 4FQPA 3MO1B 4NN7B 3ARVA 2DTSA 2XTJB 4F8QA 2IG2L 4TULH 8FABA 3RVXC 3JUYA 5KW9L 2VNCA 4CMHC 5T1KD 4XPGL 1JGEB 1K8IB 4X4ZA 4M00A 4S10A 3V8CA 1XGUB 5EC1B 1DBAL 4DEPC 1MAML 3VFGL 1DUYA 3L3OB 4RFNB 1LP9F 3THMH 5KN5B 2VRAA 3NCYP 4YWGL 3S8WA 4GKZB 3FT3A 2JK5A 4TSBH 3STLB 3UBXA 1WBZB 3PWLB 2GSIB 5EU4A 4U05A 1BM3L 3JWOC 4G6JL 2BHYA 4GAGL 3EBAA 4NZTH 4WU7B 4FFVC 1G7MB 4CJ1A 4XWGL 4M6MH 3EYSL 5FHBL 4M5YL 5I8KL 1ZHLA 4H88H 3OF6A 2V17H 1S8DB 3C09C 3SJVA 1BLNA 3QWRD 4DKAA 4QTIH 2HKFL 1S7RA 4QHLB 3RVVD 1BFOB 1ZLUH 5EB9A 2BCKA 3LHPL 2BVOA 2D0HA 4FQQA 4P4KC 3CVHB 1XCTA 2VLMD 3GRWL 3EGSB 4LPXA 4PJIB 3VXTA 4YX2L 3WJLA 3CVIL 3X13B 2WIIA 3DXAE 4JFZL 3FFCB 1MJ8L 1A4JA 3HUJF 3KG5A 2P24B 1T03H 4AL8L 4XXDB 1FHGA 2PYED 5D1ZD 1QBML 4BFIB 2VXQH 3BFOA 3QIUC 4K71C 2G2RA 1P69B 3FTGA 2VDMH 4U1SB 3RUGA 3TA3D 3MLTA 3V52L 35C8L 1QRND 4OLXL 4YHLH 3QQ4B 3WHXA 4M02A 1CLYL 1P7QD 1ED3A 2MPAH 3ILPB 1MF2L 1R3IH 4ZS6C 5CSZA 4Y4FD 4GRMB 5B22A 2FGZA 5BJTA 2IFFL 1VFBA 1MHEA 4I0PC 3WNKA 1FJ1B 4G42A 1KLUA 4LCCC 1A6ZB 1Q1JL 1V3KA 4L3EB 5EOTA 3LZFH 5BS0E 4PJFB 2EDJA 5E2TL 3HMXA 1W72H 2UYLB 4N5UA 4ONGL 4FQXA 1G9NH 5HGHA 1J8HB 1UWGL 5E2VH 3SO5A 5HHOA 3OV6A 3Q3GB 4U3HA 3QUKB 5CBEA 4EUPA 3L95B 5HI4C 4PGJA 3U9PL 3WFDL 4YQXH 1QLEL 3G5VB 1EERB 4PRDA 5DYOA 1BECA 2QEJA 4PJXE 4ZNEA 2E8YA 4RIRA 1QFUH 2DWEA 3SDCA 1EHNA 5C0RL 1G9MC 4LCWA 1RJLB 2AI0H 5CGYC 2R1WB 1Z5LB 1U3HA 4OKDA 4X80H 1A2YA 4K3GA 4Y4KB 1NANH 4WI2A 4UU9A 3H0TB 4UV7L 4WEBL 1WSST 1CGWA 3PDOB 4NHUB 2OJZL 4R0LA 4LP5A 3ZLQC 3U79A 2X2YA 5ID1A 3NABL 3NPZB 1FVCB 1EK3A 2YD5A 1CXEA 1E27B 3LRHA 4XP9L 4AEHL 2PTUA 3E1F1 1YUHA 5CIPB 4Z95H 5AZEL 1I9IL 1YJDC 5I1AB 5TQ2L 4CN4A 4U6HA 5BXFA 5DUBB 2D7TL 4JDTL 1NCBL 1YYLH 1ZT7B 2P47B 12E8H 3IFNH 4F7MB 3S35H 3TBVB 1FAIL 2AK4E 4MCYB 1KFAL 3P0VH 4PJXF 4IIQA 4JO4H 1G7LB 1ZLWK 3NACH 3SN6N 1SYVA 4PY8J 1J0KA 1EGJA 1RJYA 2C7UB 5DK0A 5HDOA 3LS5L 1Z3GL 4HBCL 2PXYB 4HKBA 1GZQB 4F80A 9CGTA 1A9BB 1IAIL 4PB9H 3BPLC 2IMMA 3VWKB 1SQ2N 3UZQA 3ARDA 1H3GA 5BMFL 3OF6D 1A9EA 1ZHBB 3DX6A 3HCVA 1P1ZA 1KTLA 1WVZA 3SDXA 5F21B 1GAFL 2XKNA 3ZYZA 1I1CA 3RNKA 2H2PC 3AS2A 4HBQA 1LEGA 1LO2H 2VUOA 2VLRB 4LBEA 4M6OL 5DT1H 2VLME 2DQGL 2XKUA 1D5ZA 4ELKA 5D7SH 2NNAB 1AR1C 4KV5E 3GK8L 1K4CB 3CDCA 4HAGA 4IRJD 5L8LB 1U8QA 4J8RA 4Y4HB 3VDBA 3CNKA 3D85B 5TH2B 3PJSB 2CIIB 4D9RD 1CBVH 3C60B 4GQ9H 2B39A 4OLWL 3E2HC 3NFPA 3MLZL 1A1NB 1GHFH 5CINH 3BKCL 4L29B 3UTPD 3GMLB 4PJCE 5D71L 2BNQA 3PUCA 3PP4H 1R6VA 3ZKMD 3WEXA 4NQDA 1F11A 1FGNL 4LGRB 3REVA 2CD0A 5H37H 2Y4SA 1NDGB 3JVGA 4IOIA 4X6CB 5IKCB 3EYFB 4X9FA 1UJ3C 3O2WH 5DHXB 1B0GA 1JNLL 4JZOA 1KF9B 2I60H 1FE8H 1JPFA 4FQXD 4X8JA 1CXIA 2J6EH 2IANB 4UDUA 3LDBB 5EPMA 4MQXD 3B83A 5HHOD 1ZVYA 3SDDB 3QHFL 4LSTH 3Q0HA 1LE5B 3VDCA 1HXMA 3B9KB 5EUOE 3CFBB 4PJEA 4R2GD 3SDCD 1DBBH 4KV5F 4P59H 4KKAD 4LCWD 3GSOB 3R8BB 3SY0B 4YGVB 1RV6X 3L6FA 3V4PL 3GHBH 4YHMH 1I1YB 1XGTB 1U3HD 1JWMA 4M3JA 1OVZA 3EJYD 1FL3B 2O26U 4JKKA 5T33L 2FX8H 1F58H 4LLQB 4P46B 2BHZA 1P84K 4PJ9A 4PLKD 1L0XA 3FT4B 3TN0C 3NH7H 4PJ8B 1YDPA 5HJ3B 2D4FA 2AGJL 1FFNB 1S9VA 1DQML 4L9LC 4UIKH 4O2CA 3RX5A 2ATKB 4ZPTA 3BEWB 1UACL 3KWWA 1T0NA 1UB6B 1V05A 2BXZA 4J4PA 5CJOH 4YBLC 1A4KB 1M05A 3MRCB 1LO3H 1NCAH 2NLJA 5FKPB 4J3SA 5IGXH 1GYAA 3RWDB 2ICWA 4I77L 5ISZB 5CUSL 3B3IB 2FJFB 2HLAA 3CU7A 1LO4L 4YNYA 1I1FB 3LPGA 3EYVA 3BH9A 4XWGH 3EYSH 25C8H 3MV11 5EUOF 1A7BA 4MX7B 3WYRA 1ZANL 2DQCH 4QRRB 2IH3A 4JJ5B 5L0QC 1OGTB 2DLGA 1QQDA 3PL6B 2FR4B 1QPPA 3BHBB 4TOYH 4L8BB 3RA7L 2BY3A 3VE0B 2NW3A 1X5LA 1YC8A 3BGMB 2X4RA 4KI5C 3Q6FA 1UGNA 3ABZA 3OG4B 2EYTB 1EMTH 5J13B 1MHPL 4HKZA 4UIMA 2VISB 3QNZB 2VQTA 4EDWH 1XGRB 1V3LA 3VCLA 3RVUC 5E4EB 1ZSDA 1DVFA 4S11A 4Y8DC 3PWVA 3IAPA 5H8DA 4X6FB 2AAVA 3NIFE 1WBXA 3GBMH 1K5NA 5IJVB 2V5MA 4GSDH 3V5DB 4KKBC 4LP4A 1T5XA 1QP1A 5IB1B 3IFPB 3L5XL 3EDEA 4LLMB 4UQ2B 4Z7VE 3FN9A 3D69B 2AJ3A 4D9RE 5HHMD 32C2B 5DO2D 4ONGH 3RL1A 3QJFA 2BNQD 4I0CC 1UWGH 2C4XA 2OXGA 4EKXA 1IARB 2GW5A 4HUVB 3OAYH 2CDFB 1UM6L 1L0YA 4UB0H 5GRVL 4BH8B 1KNOA 2R4SL 4ZFGH 1TQCC 2D2OA 4NUJA 1ZT1B 1SHMA 3KLAB 4GXVL 3QQ3B 3ARXA 5IW1B 1H3PL 1I3UA 3O3EA 2ORBL 3VI4E 1ROWA 3MLVH 4R4FH 4PGBA 1LGVA 2XQBL 4BZ1L 4NKMA 1I7TA 3B43A 3ZDYF 3ELAT 3D2UB 5DFVD 1CGUA 5F1IB 5ENWA 1I3RB 4JFYB 3EHBD 2Y7QB 2H3NA 4EDXB 4I3GA 2X9XA 1S7UB 5L88L 3FQUA 3SE9L 4D3CL 1P7HL 2GAZA 1WFTA 4G8IA 3UP1A 1SYSA 4OFKA 3O4LA 3L7EA 3L3JB 5SX4H 1KEMH 4PYGA 4Z7VF 4P9HL 2B5IC 4R96B 4F15C 3G5XB 3X11A 3WNOA 4MJ5B 3UBXG 4BSVB 4OD1H 2NY2B 2NY7H 1LK3L 3BZFA 3F7RA 5F6IB 1PG7W 3CXDH 1L9NA 4PJ9D 1F3JA 5E7BA 1GZPA 4TRPL 3RWEB 3U0TB 1B4JH 4ALAL 4Y5XA 2DQDL 2MNUA 2H32B 4HLJA 4Y88A 1QNZL 4G9FB 5ICYA 3T8XB 2APBA 1RIVL 4RGMC 2C3XA 1UZ8A 3BW9A 2HWZL 2G9HA 4CVZA 5KSAD 3T09A 5MI0B 1V8HA 2ZPKL 5IHUL 3VI4F 1RIUL 3HC4H 2XWTA 2VN7A 4HWZB 3RTQB 4JKPH 5GS0H 2F53B 5FK9A 5IMMA 2GTWB 1N0XH 2Z93A 5BMFH 3HAEA 1U42A 3MA7A 1VGKB 5CLWA 2P1YA 1QZ1A 3ZDXE 1FO0H 1UEMA 2L4OA 1KN4L 1C1EL 4M8QB 4J2XA 3VFMA 3ARRA 4JO2L 4LSUH 2J3SA 3H42H 2A9NL 3DBXA 3WFHB 1A02N 1JWUB 3LH2H 2GUOA 4BFGA 4O00A 2HT2D 3O4OC 3TIEB 2HJFA 1LILA 1FVDB 4RWYL 5EO9A 3I6GA 2QHRL 1LEIA 4X8XA 3EYOA 1DVFD 3RKPA 3PDDA 3NAAH 5D71H 4EUPG 3O3BB 1WAAE 4FQJL 1X5YA 4KJQD 3GM8A 2O61B 5E5MA 2WV3A 1CCZA 3HR5B 5M94B 1UB5A 2MKWA 2P5WA 1UXWA 3ARBA 4ZUTB 3P9MA 3F7VB 4JRYE 4PJAA 3RPIB 3WLWC 4ZXBC 2NY0D 3FQNB 1MLCA 4IRSB 4KMQA 4JFPB 4NGHH 4JN2A 3QHFH 2BNQE 2CIKA 3ZDXF 1JYWA 4XHQA 4RBPK 1DANT 1UWEL 3LSOB 4UUJB 2ADGB 3KXFB 1NGZA 3Q48A 3MNVA 1GPOH 4KUZH 5T3ZD 4RFOL 2W92A 2QKIA 1I8LC 5FA3A 4LKXA 4MHHI 3VFOB 3TO4A 4D94A 5KVDL 4K3DH 5JIKA 5ERWA 2YZ8A 1CE6B 4YDIL 3CPLA 4RZCB 4PRNB 1BVLA 3AREC 4IRZL 1DEDA 2ENYA 4CGTA 1AFVL 3VMPA 3SEPA 2NTFA 1A6UH 1KT2A 1QYGL 3L5JA 1WAAF 1DANU 1T2XA 1X6NA 5HY9B 3KPRA 3O9WC 5FYKU 3U1SH 1G9EA 5IESL 3VXMB 4YK4B 4WUKL 1YPZE 4NC1C 5AG9A 5SWQB 3MCKB 4BH7B 1PX3A 1PYWA 1U8IB 4TTDC 4WNQA 4Q2ZA 4NRYB 1WEJL 1S78C 2D7OA 1RZKC 1FVEA 1MUJB 4NT6B 3HNSH 2PUQT 2ARJA 3HR6A 4FXGB 3L3HA 2NY6C 5KANG 4HF5H 5C08A 1JZ2A 5GRXG 1TJIL 2BC4A 1RUKH 1FNGA 4AM0B 4P23C 1T66D 1ZHNB 2E9WA 3I6KA 5C71A 4UI2A 4KDWA 4Z76B 3RNQB 5IT2H 5IW6A 4U1GB 1I1AB 2APTA 1BIIB 5D9SB 4MJIB 2FZ3A 2HJLB 2J4WL 1MJ7L 2VDPL 5T1MB 5I18L 5IFHL 4WHYG 3MV7A 4X7TB 3UPCA 5E99L 3N1FC 5MEPA 1I1RA 1FNAA 5HYFA 1L4IA 4PJHB 2W0PA 3KS0H 2V2XB 5FYJE 1KJVB 4QWWC 4U1HA 2R0LH 2OQJB 1F4XL 2DDQL 3UROR 4L4VE 5DWUH 3M8OL 4HV8B 5FYKH 1G1YA 5LJYH 4GW5A 1KIRA 4WI7A 4NO5B 4G8GE 3QNXB 4N8PA 4WV1C 4BQ9A 2J88L 2RAMA 1AHWA 2HH0L 4P3DA 4RGND 3DVNA 3PWJB 2W9DL 3CZFB 1I8IA 3KPNA 4F7TA 1XF2A 5T3XE 3F5WA 3S37H 1DBJL 3D39A 3O8XC 5BV7H 2BY1A 1QFWI 1NMBL 1J1PH 4HPYH 4LCUA 3GB7B 5ITFA 2A77L 4JKWA 1EHAA 2P5WD 1N26A 3M17B 5DHVH 5LWYL 2NW2B 1W72B 2W60B 5EN2A 1H15A 3MCLL 3ARBD 5IJKC 3VXPA 1JL8A 2NXZC 2A9MH 3BEVB 5D2NB 1SEBB 4WWID 2WANA 1V7MH 4LIQL 4O5LL 4F7PA 1HWHB 3NCJH 2ICEA 3MJ9A 5BVJB 1YEHH 1JN6A 1A6AA 3RWCB 3TJHD 4GBXD 4DZ8A 4HIEB 4XPHH 4UNUA 1MRCL 3N9GL 2HRPL 2EE6A 4HMEA 4YBQD 3ZKSD 1LK2B 5DQJB 5HHPA 2YOCA 5LGKA 1R3JA 5D7JA 3NGBC 4HWNA 4JB9L 4TUOA 5DMYA 3BOVA 2CRIA 3TO4D 4Z18A 5HI3D 3C9NB 4GG8B 3IDIA 5IV2B 2HFTA 2XQYG 3MLUH 2FD6L 3SO3C 3SDYH 2PR4L 2X9WA 4YC2B 5TFSL 4XMLL 3LEYL 3HPLA 3ZHDA 2J5LC 4HZLB 4DKFH 4LLDB 5IB3B 1KPVB 2VL5A 1DDHB 1IC5L 3QEHA 5IEHB 1G6RH 2H45A 2D03L 3MRPB 3BZ4A 3MA9H 1KB5A 2NR6C 3LPFA 2CK2A 1NGPL 2NY5H 2VN4A 4RNRB 4WCYH 4XNXH 3HNVH 2DD8L 1OLZA 1U2CA 2ZPKH 2VIRB 5I0DA 1D6VH 4D2NA 3TPUA 3L1OH 3I3BA 5IB5A 1AQKH 5DQ9B 2ARJQ 4IMLA 3C2AL 4DW2L 5JDJA 5C08D 3MUHL 1RUPL 2EEDA 3LKOB 5E2WL 4PD4J 1WFOA 1OSPL 5E8OB 3UJJL 4UBDC 1XZ0B 4JPKL 4X4XB 4GKZA 4JO2H 4MD0B 1IGYB 4U4BA 4TUJA 1YQ2A 4JHWH 4MNHB 3B9DA 4N1EA 3WFZA 3CGTA 4MB5A 5J0BA 1G7MA 5IQ7L 3MV7D 5GRJH 1CDJA 3QFDB 2J8UE 2NY3B 4WFGD 2FRGP 4PRPA 2AJUH 3IJHB 3QEQB 1BFOA 1B9ZA 5LQBL 3MROA 4QHMA 1FZJA 2NPLX 5GGUB 2IAMB 4APQA 3EUUA 4AENB 5A16B 4U6VL 1F42A 1N4XH 5GGSB 2EDTA 1IGIL 5F9AC 3IB4A 1T1ZB 1OD9A 3X13A 1J88A 3RVVC 2EDXA 2B1AL 3REWB 4XXDA 4MD4B 1S5IL 3WJJA 4Z5RB 3QH3B 2VXUH 4ZNCD 4KDTC 3LQMA 3SBWA 2C3WA 3NFSH 4GW1B 3GIVA 2Z9TA 4YDLC 3TF7C 5CHNB 4U7SA 3QQ4A 1XIWA 3MBXH 5D1ZC 1RUAH 2AK1L 5DUPL 1ZVHA 3D39D 3C5ZA 3KYKH 4EI6B 3ILPA 2H26B 4G6FB 2VDQH 4OLYH 1RHHA 2DLFH 1UWEH 5HYQB 3VXUA 4CADA 5JUEL 3J7HA 1FJ1A 2R69L 3FQWB 1HIML 4L3EA 5H35A 3FO9A 4KRNA 3KJ4C 5IOPB 3VW3L 3TVMB 1J5OL 3BGFB 4NKDB 5FO8B 4CW1A 4L5FL 2JKXA 3PWUA 3UTSD 1ZHKA 3O3AB 4YUEH 3MXVL 3IVKB 4D8PA 2B20A 2YA2A 1C5DA 2M2DA 3BI9X 4YHYC 1UKSA 1ZMYA 2Q8AL 3BRDA 4HX1B 1JPSL 3G5VA 4WU5B 1CGVA 2LVCA 5L9DL 3C6LA 5D7JD 2AJSH 1GC1L 4FXKA 2BOBB 1KCSL 1U2HA 5DURD 3Q5OA 1RJLA 3ARWA 5JZ7D 3TCLB 1HI6B 1EBAA 2Y07H 2YR3A 4JDVB 3PF2A 1Z5LA 3U82B 3RY6C 2W0FA 3EOAB 4LLUB 2UVFA 2PNDA 4GMSH 2OZ4L 1OWWA 5K9JL 4OM0H 1WT5A 3PDOA 3VFWB 3DV4B 1VCAA 5CEZL 3AMKA 4EI5B 5C09B 4FFWD 3QO0B 2DRUA 2QV2A 1AP2B 1FVCA 4OF6A 1NJ9B 2PW1A 2R2EB 1U8JB 3KVQA 4Z7NE 3AS1A 2VLKB 5FFLA 5CIPA 2XTJD 4E41E 1A47A 5EWIH 4JPVH 5EUKA 5I1AA 2HMIC 5C07B 5CZXD 1OLLA 5DUBA 1X4ZA 3MV8A 5FDWB 2VDPH 5IFHH 2IBZY 4WI9A 5GJSL 1ODAA 2OP4L 4HH9A 3RWHB 1CL7H 1NKRA 2BY0A 1R0AL 3QZWB 5C08E 4JJHA 4XPAL 5TE6L 3EW3B 3UO1H 3MX0A 2ICWJ 5F7LB 4DGIL 1F4XH 4NWUL 3QCUH 3DVGA 4JRXB 2O5ZL 2R0WH 2PXYA 3JTTB 4UNVA 3QDHA 1A9BA 2V9QA 1U8LB 2X1PA 2R15A 1AO7A 3VWKA 2V2TA 1AGFB 3H2WA 3F7YB 1INQB 4XHJD 2IPTH 1U6AL 5EFIA 3MGTA 5T5NF 3N85L 2J88H 4WFGE 4P9ML 4UQ3B 5DJYA 4APQD 1F3DJ 5SV3A 4OB5H 3DRQA 4AT6A 4NHCL 1SM3L 4YDVB 1JZ5A 4LVNC 3IGAB 4LKCB 4WUUA 5ILTH 2A77H 1FZOA 1K4CA 5I6XB 5D7IB 3MCLH 3WJLC 4P99A 3PJSA 2CIIA 1U8OA 5FCUH 5KVFH 3OKNA 4M62H 4I13B 4J12A 4ZAKB 5TE4L 4ZMAT 5C0JA 3B9EA 4LNRA 1T0MB 4L29A 1RZ8A 4IRJC 2UZIH 2X4PB 4DZBB 4JANB 1YEIH 2EDYA 3C5ZD 4MZ2A 1K85A 1S7VB 5D8JL 5LGHH 3RBGA 5T5NG 2ZWLT 1YEKL 2X41A 1P4BH 2B0SL 4GRWB 1TTGA 4FFZL 3FMGH 5SWZB 1JHKL 1QKZL 4L3ED 4ODUA 5HYSB 2X42A 1WIOA 2R8SL 3ZKMC 2QL1A 3WIHH 3RDTC 2JB6B 2Z31B 3R06B 1BFTA 1TNNA 2Q86B 4N0FA 3G6AA 4P2OA 1AXTH 2AQ3A 3QA3A 3UTSE 4QXTB 3SHSA 1TVBA 5ID0A 3WFBL 2QSTA 4FQXC 3P11H 2WWMD 3S9DB 4MCZA 3X12A 3ARGC 3C6LD 4MQXC 1KN2L 3MOAL 1S7QB 3G04A 4AG4L 3MACH 1FH5L 1Q9KB 4Q9RH 3GSOA 1O5DT 4C56A 4LPYA 2Z91A 3OMZA 5ANMB 3SY0A 4YGVA 1BWWA 4FNLL 4RAVB 4R2GC 4YHNA 1JGUL 5I17B 1MCKA 1ZTXL 3DYOA 4KKAC 4HFUL 5GJTH 1M6OB 4PY8I 4LLQA 1HKLL 3T0EE 3W81A 4IJ3B 1CFVH 1UM5H 4PB0L 3FT4A 3HZKB 3KNBB 3NA4A 5FGBC 5E8PB 1U3HC 1MY7A 3NIDF 3A6BL 1KC5L 3EJYC 2EYRB 4IHOB 1WBYA 1JPST 1OF2A 2Y06L 3GJFH 4HHAB 4MAYC 1LO5B 2O5YL 3HTLX 4KKLD 1YN7B 4U49A 2XT1B 2FLBT 3A6CL 5ESVA 1UB6A 3ARSA 5EBGA 1LDPH 3MRCA 1Q0XH 3RIAF 2BJMH 1NUDA 5FKPA 5DGRA 4D0CB 4Z77A 3GSRA 3ULVD 3RWDA 1BD2A 2XTJE 3MV8D 3B3IA 5IROA 2AKRB 2FJFA 3W82A 1I1FA 4QXGH 4RCAA 1DP0A 1BQLH 3JWOL 1FO0B 5IM7B 5IMLB 1IFHL 3RKDD 2QLVB 4QRRA 2W38A 1UT9A 3NIGE 2OL3L 4LCIL 1MIEH 5HVFB 4LGSB 3U6RB 3X17A 5F7UA 3O6FB 1W0WA 4IIQC 2PXYD 3K1DA 4ETQB 4GAYA 3VE0A 1FIGL 1KCVH 2NXYD 4BKLA 5EBLA 3VWKD 5CWSB 4HJGB 3O0RH 1ADQL 2VQ1B 4R6UA 3S36H 4R90H 3UJIH 1S9WA 1KENL 3VGFA 2VDKH 3VH8A 1BIHA 4OIAA 1MSPA 3EFFB 3QCVL 3WNNA 4R4BB 4YH6A 4GG6B 2VLRD 3IRZA 5I75B 3FB8B 4WUUD 4X6FA 4PJIE 5IJVA 5GSRA 2IJ0C 1MEXH 3FFCE 4Y4HD 1R5VA 1KIQB 4A6YA 3GUTB 4S1RL 4UQ2A 1HIMH 1HNFA 1NUGA 2YSSB 4D9LL 2AVGA 3DUSA 3S98A 3QDAA 4PJGA 4XWOC 5DMJB 4M93B 5IIEB 4KQ3H 3NIGF 4UINL 4HC1A 4DOHB 3W2DL 3VXOA 1P53A 3BZEA 1OAUL 1UKTA 1YQVL 2FL5B 5DO2C 1CQYA 3PWPB 4K7PH 4BH8A 5F9JB 5F1SA 1HHHB 5L9DH 3C2SA 4QT5B 4ODVH 2CRYA 4OIBA 1RUQL 4UT9L 1ZGLM 4L3EE 3WE6B 1IT9L 4PJFE 4MVBD 1R3HB 1ZT1A 3KLAA 3QQ3A 3K46A 1NC4B 1UA6H 4P2OD 3KPOB 4NNXB 4FZEL 3SDDD 3JVGC 3PIQB 4YO0B 1EFXB 4AEFA 1J8HE 3B9KD 5HBBA 1I3RA 5JW5A 4O9HH 3WN5A 3I75B 1G7JA 2OZ4H 1EVUA 4NNPH 3W39B 4N8CH 4FG6D 4M61B 3GMPB 4YBHA 3GHEH 3IDYB 3OL2A 1BBJB 5A3IC 3BT2H 5DFVC 4C56D 1F8TH 2EKSB 3NCYS 5HI5D 4E9LA 3LB6C 3EHBC 2LAGB 3QIWB 3G5XA 1MCDA 1XT5A 1NCCL 1NPUA 5HGAB 1WZ1L 1E4WL 4OLEA 4ZUWB 4NQEA 5LCVH 4OZFH 2I5YH 4OCRL 3LS4L 3FL7A 4X4YB 4K23L 4CN1A 3OGOE 3STBA 2OK0L 4U6YA 4IOFD 4E0RB 1ES0A 4XP4H 4JFEB 1MFEL 2WK2A 4BELD 3GZKA 5IFAL 1GIGL 3MLPA 4XVJL 5IG7B 4PJFF 1FQ9C 1NFIB 2PO6A 4QF1B 2V5SA 2WUCH 4KK6D 3QXDA 5TE6H 4YBLB 2N4IA 3MGOB 1KJMA 1MCOL 4ZTOL 5D5MB 2PTVA 4ODWB 5DK2B 3MRRB 1BD2D 4YDJB 5ISZD 1J18A 2AJXH 3B6SB 2J8OA 3DSNA 2DQUH 5KSAC 2WBKA 3ULVE 1YYML 4MA3A 4GMTL 2R2HB 4GAJH 3IFLL 2HT3D 4FS0A 4QRRD 2IMNA 5JLZB 1IGCH 4XGZA 4M8QA 5DMIH 4Q97A 3PL6D 3GMQA 3MR9B 1A7NH 3QIBB 3RY4A 3TIDB 1GCFA 4HPOL 3ZKQD 3P40A 3LRSB 3FO0L 1KIPA 1V7NH 3WFHA 2YC1B 3CFIC 1VFUA 4K9EC 4TTGA 1HH9A 3T4AA 2D3VA 2I25N 2Q3ZA 4HIXL 5DZLA 2DQJL 3EOTH 5F8RC 5BV7B 1OAYL 3FCTB 3TCXA 2X1WL 5C0ND 4MXWH 4OTXH 4ODXA 4YAQA 2O61A 4GLRH 2VLRE 1QFPA 5F89B 1ZXQA 3GMOB 4IOSD 6FABH 3HR5A 5JO5A 1EPFA 4I0KA 1DVFC 3GIZL 1JTOA 4TSCH 2VR4A 1JGDB 4H5SA 2D9CA 4HS8L 4KJQC 3F7VA 3RGVA 4Q6IA 1F00I 1NUNB 4OCWL 3ULVF 3DARA 4PTUB 3O6KH 1LNUB 3D3VB 1OAKL 2VLJB 4JFPA 1HYRC 4OFDA 5ESQA 3MRDA 1BJ1H 3AC0A 5FM4A 3WUWB 2HKHH 5I1KH 4JM2B 4H1LH 3FN0L 2X44D 4U31A 1MRFL 2HT4D 1G1CA 1KJ2L 2ADGA 5DD5L 1DLHA 3DWTA 2NY0C 1U36A 3SKMB 2AXFA 2F5AL 3QULA 2P5EA 1OQXA 3ES6B 1XGYH 4RISH 1EZVX 1TZHB 5D6DC 4F9PA 3VFOA 4X6CE 2OR7A 1INDL 4GQPH 5TF1H 5EU7E 2R0ZL 5I1CH 3P4NB 3P77A 2ATPB 3QDJA 4UOW1 2IANE 4HWEL 1X4YA 2VDRH 4XRCB 4PBVC 1ZTXH 2APVA 4RRPA 2FX7L 4O58H 3VGBA 3OHXB 2M8XA 5IBTH 1CT8A 3ULUD 1FL6B 1BJMA 4NCDA 2E7CA 4XCFL 1G6RB 1U91B 3FKUS 4LARH 4OT1L 2O5YH 4OGXL 4U0RC 1SMOA 2NY2D 4DGYH 1DQLL 2EZ0C 3BP7B 4MWFB 1OT2A 2DJSA 4LEXH 4ZUVB 1MREH 3W9EB 2V5TA 1FC1A 2P45B 1UM4H 3WDIA 2V6HA 3N1GC 2B1HL 5I30H 1HDMA 3FO2B 2CKNA 1U3JA 1MUJA 1FIEA 3MNZB 4NT6A 4XP5H 2IFGA 4MS8D 2VZTA 4FXGA 5FECB 1CI5A 1VB9A 3T04D 4TQEH 5GSVA 4I48A 4W4OA 4Y5XC 4AM0A 4X6CF 2PO6D 4NZRL 4ZFZB 4LLAA 2AJZB 4G7VL 3BKYL 3LEXB 2C1OB 4PGCB 1OOAA 1JHTB 1Y6NR 5GGRA 3RTQD 3KPPA 2F53D 1I1AA 5D9SA 4MJIA 2HJLA 5KTEH 5ISZE 1YC7A 1T66C 3QUYB 3JWDL 4OLZH 5GIRB 1VA9A 3IF1B 2NYYD 2OBGA 3QNYB 4HEPG 3CSPA 4PJHA 3QCVH 4QRRE 1NAKH 2OQJA 3CXHK 1JGLH 3DLQR 3VFPA 2C5DC 4YR6A 4WGWB 3PABB 3AUVA 2YUXA 1NCDL 4NO5A 5D2LB 2CDGA 2XZQH 1ZV5A 4IBLT 3PHOA 1PG7H 1OTUD 5D1XB 5DD3H 4N9OB 5SX5K 4MJ4A 5IMOB 1N8ZB 4Q9CA 1CG9B 4DKDC 3HE7A 3CFJB 4L3AA 1CQKA 1ORSA 2G60L 3GB7A 1T6VN 1YMMA 4JZNB 4BYHA 2NW2A 4LSSH 2A38A 1I7ZB 1OM3L 1W72A 3TJEL 3K8KA 3LN5B 4H8WH 4LQ1A 4ORGB 3RGVD 2R2BA 1QFWH 3ZTNH 4HK0B 1A7OH 5D2NA 5J06A 3V2AR 5DJDB 1TJGH 3KPSA 4ONFH 4X7SH 2FH6A 1IGMH 2DWDA 1VHPA 4IRSD 2D4DA 2YXMA 4FZEH 2VXSH 2P8MA 1NCWL 3OKKA 3RWCA 1G9MH 1AI1H 1FYTB 1DQQB 1CGSH 3OPZL 4Y2DB 3KXFD 4ZFOB 4P5KB 3CFCL 3HZVB 4Z7WB 4KPHL 4PP1D 2P7TB 1LK2A 3IDUA 1TVHB 5HYJB 4FTVB 3OAYK 2P5ED 2IGFH 4RGOL 3MGAA 4MXQD 2EDRA 4NN5C 1HZHL 3TJHC 4GBXC 3R1GH 2EE9A 4PG9B 3RY5A 2I24N 1F45A 4JFOA 1MQKH 5IW3A 1YECH 5AYUH 3SQBA 2F9BT 4XB7A 4EXPX 1IZKA 1Z9LA 2FBJL 3D0VB 3RU8H 4AQOA 3TO4C 5DJ2A 4HZLA 1LEKB 1OARL 3BPNB 3U0PB 5IB3A 5EO0A 2EDFA 2V9RA 1I7UA 3G9AB 3NCCB 2IQAB 1M71A 1T7XA 1YJDH 2B8OT 1SY6H 2DM3A 3PGFH 4M7JL 3ULUE 2ZZUT 5IEHA 3V5KA 3MRPA 3MRFA 1Y0LB 2GFBA 4WI6A 3HS0A 3MRGB 2PYFB 4RNRA 3SCMA 3ARUA 4LK4A 2XI9A 3QQ9C 3N06B 1NGWA 4YIQB 5JXEA 3DHJA 5FF6A 3KGRA 1IAKB 5DLML 5GZND 4IMKA 3UBXI 4XP6L 1TMCB 3QUXB 5I9QB 5L2KB 5K9KB 3TZVA 5D1QB 1KJ3L 4XI5C 3VH8G 1QO3A 5LBSH 1VPOL 5C8JB 3WO4B 4G9FE 3GSQB 1C5CL 3O41B 4ESKA 5GGSY 4ZG1A 5C7XL 4L9DA 3LKOA 4HWBH 5I19H 1J87A 5A2FA 1PSKH 3X3GH 5E8OA 5LXGH 4XNUH 2YD7A 3RAJH 5DHYB 4OD2B 4HIJA 2QQNH 2NY1D 4J7RA 4AEIL 1I1AD 2RB8A 1XAUA 4MJID 2CJUH 3ROLB 4YPGA 4XP1H 4KFZC 2DBJA 3AM8A 5DDHB 2F53E 3C6SB 1JTTA 4XVTL 3QUMB 4X7EC 3WHE0 5F88B 3K2UL 4R26L 3ZTJG 5MERB 2XN9A 3OJDB 1KGCD 2VOTA 4LQFH 2IAMA 3ULUF 1HXYB 4C83B 5GGSA 2MCG1 4S2SA 4MAUH 3H8NA 5GGTL 3DX8A 3T0DA 3REWA 1TETL 3QFJB 4LSPH 1NGQL 1I85C 3QAZB 2MKLC 1NAML 1H8SA 4C4KT 2EDWA 1T4KB 1GL4B 3SOBL 4HCRL 4O02H 3ULSA 1FRGL 4OCWH 4OGYH 4JR9H 2NMSA 3FOLB 3GMNB 4JHAL 1AY1H 1XCQB 5CMAA 1OAQL 2GSGB 3L3DB 1YEJH 2YRPA 1X5KA 1MFDH 3HE7D 2XRAH 3MLXH 1AHWC 4HUXB 2ZUQC 1RULL 1S9XB 2Q20A 5KVGL 5FM8A 4N0YL 5HYQA 3WSQL 3VFUA 3ZE1E 1RVFH 1SEQH 4ZFOL 3SE4A 5CD3B 5F97E 4NKDA 2J6EA 1JI2A 4FQLH 4IDJH 1D5MA 3P9LB 3MRNA 1BBDH 1CLOH 4Z0BH 4JAMA 4F8TA 3TESA 3C08L 4ZTPL 5JQ6H 5CILH 4F7EA 4LGPB 3O3DB 1RSFA 4H26B 4PLNC 1YY9D 1BGXL 5J11C 3KXFE 3P0GB 4GT7A 2CUHA 4LIQE 1N64L 5D7LB 4NM8L 3OG6B 2QR0B 4Y5VB 1HI6A 1C7TA 1E6JH 5D7JC 1GGCH 1X3DA 4PUBH 3EOAA 3W0WB 5EZOL 5GHWH 4KQ4L 4PGDB 1QSEA 2A1WH 4N9GA 5JZ7C 5C0BB 2YUWA 1PG7X 1A7RL 1N59B 1MH5A 3ECBB 2ZG2A 3GJFB 3LKQA 5H94B 4LRNH 4LHJB 4ZYKB 1FFPB 3T0EC 3VXSB 3VXME 1AP2A 2OJEA 2VMFA 2R2EA 3BUYB 1RPQA 3SCMD 5DUMH 3IJYA 1J05A 1F90H 4FFWC 3QXVA 4L8SB 5JXED 1BEYH 1NBVH 3B5GA 3TZVD 3CU1A 1CD1B 5HHXH 4TNWK 4NN7C 2XTJC 5B3JF 2VDLL 5CZXC 1QFOA 3QZWA 3RIFF 3LIZL 3QUML 5T1KB 1CDGA 1OAZL 5F96H 4U2ZA 4NKIL 5INDB 1ZLWH 5CJ5A 3AY4A 3PGCB 5KANI 3W9DA 4JRXA 5HVWA 4RFNC 5CP7B 5AZ2L 3JTTA 5I1GL 4NIKB 3PV7A 2DLHA 3FO1A 4PJBB 5K93A 1U8LA 1Q9WB 2VXVL 4X9GA 2G75B 1AGFA 1F4HA 1RZIA 4MJIE 3UZVB 5DC4B 1O7VA 3QEQD 3F6LA 3CH1B 2IAMD 4K55A 1WV7T 4PJHE 4CMMB 3NZHL 3UZEA 4HUWB 1KGCE 4NO0A 4XHJC 4JG0H 1R5WB 3HAEH 1OGAA 1HHKA 4FQIL 2AEPL 1D5IH 3ZSTA 2LABA 3TV3L 2CDEB 1QLRA 3WXVH 2JJSC 3Q5TA 2FGWH 3NFNA 3RWJB 1EUUA 4G8FB 2R1XB 4JPWH 1OSZB 4NJ9H 4HQQH 4CL7A 1CDCA 1Z0MA 5HD8D 2PYEB 2AJVL 1S7VA 5GGVL 1FPTH 1CE1L 4G6FD 1X5AA 3WIFA 3TA3B 3ARYA 3CFEB 2JCCA 5F9OH 4DTGH 1QRNB 4AMKL 1TCRB 2R29L 4L8CB 3QWOA 4KK9D 1K4DB 1JF1B 4KC3B 3UTZA 5B38A 1JZ6A 5GRVK 5LAXB 3TBYB 5AEAA 3TEUA 2OX5A 2X70B 5CSBA 1MFAH 1PBYA 4Y4FB 2AEQH 5FGCB 2O93L 4PGZA 5D2NE 1A6VL 1FLTX 1T5WA 1WWWX 5F7DA 4QXTA 1B88A 4QTHA 5ICXB 3PQYA 4GFTB 4PJHF 2DM7A 5C3LD 2OYPA 4KKNA 3HHRB 1IBGL 3SGDI 2VAJA 1TLKA 4QGYA 2VE6A 4TVPH 2X4UB 4U1KB 1JP5A 4O51B 4OSUL 2XYCA 4NQVA 2KPNA 1Q9KA 3GSVB 1AXSB 1TZIB 4G80A 5FDYA 3DGCR 2LAAA 4OZFB 1NSNL 1PFCA 4RAVA 4U7MA 3FN3A 5E8EB 2ZUWA 3MRIB 4Q9BA 4EVNA 4YDKH 5A2IH 5I17A 1C7SA 1QSED 1AE6H 1IAOA 2A0LC 4PY7A 2XZAH 3VWJA 2EDKA 3HZKA 3KNBA 2FJHA 3D0LA 4EI5D 1I8MA 5E8PA 2ICWI 1A5FH 1CK0L 2LFGA 5HHVL 2XFXA 4IHOA 4Y4KC 2ED7A 2X7LA 4QHUB 1LO5A 2J1KA 2ZOLB 3TFKC 1YN7A 2GJ6B 5EA0L 5IQ9A 4WWKB 5F7FA 4POZD 1NH6A 1MVUB 1AGCB 4PRAB 2PTTA 4PV9B 2VLKD 2YXFA 3K0WA 4XPFH 1W2KT 4OM1H 1HH6A 1HKFA 1L7IH 2BRRH 1G7IA 4YHZH 4F9LA 1FSKC 4KKLC 4D0CA 2XNAB 4XCNB 1KACB 1CWVA 5F71A 4ODSL 3L9RA 4Y0GA 4ODHL 2CXKA 2CRMA 5JA9A 1BZ9A 1YNKL 3PHQA 5IMLA 5FOJA 8FABB 2BVQA 3BN3B 3I85A 3ULVC 5BOPA 3LQAC 5HHQA 5JMRA 3DGGB 3U6RA 5JHLL 2YEZB 4JRXD 4YHKL 1EJOL 1DUYB 4GAFB 4ETQA 4PJDA 4V1DA 1IQWH 3FONA 1TTFA 2O5XL 5GS3A 1FG9C 3D87B 5CWSA 3FT3B 1NAMH 1XGPB 3PG2A 5AWNH 2PXYC 4NQXA 3SGJC 4HFWA 1QFWM 1D7FA 1BZQK 1JHLL 1XEDA 2NXYC 5C0GA 2YWZA 4Z8FL 3BE1L 3QEQE 3VWKC 1VEPA 3VG0H 4JHAH 4GG6A 4NO0D 2H6PA 1ZHLB 3NPSB 3SJVB 1BLNB 4G3YH 4HAFA 3QG6A 1F4YH 1KYOK 2WP3O 2JF1A 1OGAD 5E9DB 2BVOB 4FQQB 1XCTB 2R9HC 4F58H 1TTUA 1LE9A 1UH2A 3U46A 3VXTB 2WLYA 1RK0A 3ZYOA 2WIIB 1JPGA 2DKSA 2YMXL 3F7PC 4TNVF 3HG1A 4Y4HC 2F54B 2PKDA 1IM9B 1Q72L 3VFRB 2Z92B 2G2RB 3EFDL 1VKXA 2HFGH 4Q0XH 3C60C 3WD5L 3RUGB 1Q9LA 4KZDL 3QG7L 3MUZ1 3WHXB 4GRLA 3T3PE 2F58H 1FNFA 1TNMA 1HHHA 1WQVT 3WUZA 5KG9A 1PZUB 3I02A 3WE6A 2EXYD 5C0AA 1R3HA 1N3NB 2E9BA 4OZGA 5E03A 5IBLD 5BJTB 1MHEB 1RFDH 4KUCD 4YE4H 4NNXA 4G42B 1KLUB 5EOTB 3PIQA 4M1GL 4YO0A 2F8XC 2DAVA 2Y5EA 4LCYA 4JEGB 4MVBC 1S7XA 5EU7C 2QQQA 3ZHLA 3C5JA 4P2OC 2L0DA 1RZJH 3I75A 3LDBC 2MQ0A 5D72L 5HGHB 2GEEA 3SDDC 1A7RH 2EECA 3HFML 5HHOB 1KPRA 3AROA 3GMPA 3B9KC 5CBEB 1NLDL 4EUPB 5A2LH 4ODBD 3LD8B 1RZKH 3DNKA 4KTEH 5MEOB 4ZOCA 5DYOB 1ZAGA 4ZUUB 4H0HB 4NWTH 2QSCL 3SDCB 5DVNA 5HI5C 4LCWB 1CICB 5DFTA 2KZWA 3MBEB 3VWJD 2BXYA 1CZ8L 1B90A 3DUUB 4OCSH 2RQ8A 3JV4A 3T3PF 4JFEA 5T1DL 2D31A 4DKEH 5C09E 2XWJB 4P46C 2WBWB 2YKLL 2EO9A 4OCYH 5I16A 4JN1L 1UYWL 4IOFC 4PJ8C 4QF1A 4R0LB 3P0YL 4KROB 4Q7DA 1QR4A 1QVOA 5GS0D 5ADPL 5IF0A 5EOCJ 3MRJB 5D5MA 5ID1B 2VLKE 1HK6A 4YDJA 3OKYA 1P9MA 4KXZH 3B6SA 1DSFH 5FUZL 5C07E 5J3HD 1YUHB 2R2HA 4KZEL 4QXUH 1KB5H 5EZIH 1UENA 4U6HB 5BXFB 4QRPA 1AJ7H 1N7MH 5BOZG 4QYOB 5JLZA 2DLIA 2NY4B 3O6FD 4QHKJ 2HT3C 5H37G 4R97B 4X6BA 3LRSA 4V1DD 3UTQA 5KVEH 5I15H 4PRIA 1ZKAA 4JRXE 5DK0B 1DL7H 3O45A 4ENED 3PL6C 1LO0L 2AQ1A 5IMKA 4WDIA 3EO1B 5IWLA 5KOMC 1RIHH 5E8NA 3KLSA 3FCTA 3ARDB 5J13C 1A9EB 2F74A 4FP8H 2J8HA 3DX6B 3HCVB 1P1ZB 4I3RL 5DHVA 5HDBF 5BVPL 3SDXB 2C3GA 5E4EC 4K3EL 4N8VA 3GM0A 2YPLA 2R29H 2XKNB 4NKOA 3RNKB 3BP6A 1JGDA 1LEGB 5C0NC 1WFUA 5HPMA 2WBJA 2FEDC 4Y1AA 5D7IE 3MXWH 4ODTL 1D5ZB 1KCUH 1K9TA 4ELKB 3DI3B 3SPVA 1U93B 4YJZL 1V5JA 4LHUA 5FUOL 1MCBA 1U92B 2YN5A 4FQHB 4QRQA 3CLEH 4W70A 5DJ0B 3Q1SL 4C57C 5MP6H 4WGVB 3PWPD 1U8HA 5HHMB 3HMXL 4X9BA 3FZUD 3RI5K 3PP3K 4GRWE 4P5MB 2H8PA 5SWZE 5F3BA 4RBPH 3ES6A 3U4AA 5C0AD 3WEXB 3H9YA 1KEGL 2P8PA 4NQDB 1NC4D 1F11B 2HT4C 1T7ZA 4BQCA 4RA3A 3REVB 2ADFL 4WIQA 2AJYH 3T2NH 1T7YA 5I1HL 1ULVA 5TE7L 4IOIB 3RWGB 1A21A 4K94H 4JZOB 1WJ3A 1ZEAL 3ALXA 4X8JB 2DMBA 3OHXA 1ZGLA 1VSCA 2ZCLL 5EPMB 4WRLA 4NM4L 3U4BL 4WFED 1G6RA 1X7QB 1U91A 1F5WA 1FLRH 1J0ZA 4KVCL 1CK0H 2P8LB 3QZWG 3X3FH 1WZKA 5EC2B 3QIWD 1BX2A 5DJXA 4R3SA 2KQMA 5D7IF 1HILA 3VRIA 5ANME 4PJEB 1T83C 1MCLA 3ULUC 1HHGB 2Y5TA 1J10A 4JY5L 4MWFA 2C3VA 4S1SL 4ZUVA 3W9EA 1J11A 1CXHA 3GI8L 3E3QE 3UTTB 4OLUL 1QEWB 1QFHA 2NY2C 2EDOA 1JWMB 4ZFFA 4JFED 5KS9A 1JPTL 2JCCF 3U7YL 5F6IC 4GRWF 2IPUK 3ROOB 5KSUA 1FNLA 1H5BA 4PJ9B 3LEVH 4EOWL 4RWHA 2V2WA 2VZUA 4YHOL 3BKJL 1GH7A 1YDPB 4MS8C 1JHTA 1S9VB 3PNWB 4UILH 4LSQH 3INUL 4KUCF 4P57A 2YHGA 1II4E 3KWWB 2CMRL 4WTZA 4BFBD 5MI0C 1MCHA 1M05B 4UTAH 2NLJB 3FRPG 1EGJL 3BYYA 3QNYA 3V95A 3RTQC 3ZYIA 1CFQA 2ICWB 5DI8A 4QRPD 4X83A 3RQ3A 4C55A 3P30L 2HLAB 3EO9L 1ZT4A 4YNYB 5FYKD 3BH9B 5HGGS 1K3ZA 2NYYC 1KXTB 3QUZA 4PRID 2IH3B 4H0IA 1A0QL 3PABA 2IQ9H 3CSYA 5CEYA 2VKWA 3IU4L 5D2LA 5DRZA 3A67H 4X5LA 1VACB 2NW3B 3AVEA 2X4RB 3ZL4H 5EIVA 2JELL 3VGAB 4XVSH 4HKZB 4UIMB 2R4RH 4GG6E 3TNMB 4NOFA 1N5AA 4WVRA 3EDJA 4BM7A 4M5ZL 4C54A 1OTUC 5JW4Q 3QG7H 1H3TA 43C9A 2YPLD 3WV0A 3PWVB 1ACYL 2DM2A 2WBJD 4ORGA 4Y1AD 3GGWB 1KXVC 5CAYB 3OZ9H 1WBXB 1DLFH 2IC2A 4BZ2L 2BERA 4OLVH 1T5XB 2CK0L 4LHUD 1CTNA 2VLJD 5GGQH 3SE8H 4NBZB 2AJ3B 4DOHE 3EYUH 2YBRB 4P5KA 1INEL 4PJ5A 4Z7WA 1I9RH 2ADJB 3QJFB 4IRSC 1TVHA 4FTVA 2ITDA 3PWPE 5J57B 3WBDA 4PJDF 3BD4A 4M43L 3ZT7A 4G6ML 4LL9A 4DAGH 4GS7B 1KNOB 4MXQC 1PX4A 4JG1H 3PE9A 4N68A 5B4MD 4NUJB 2QSCH 4HJ0D 2ED8A 1LEKA 3MLYL 3U0PA 2IEPA 1CLZH 3O3EB 5FYLH 4GG6F 2FO4A 2YPVL 1T1YA 4PGBB 4JQXC 4M48H 4NKMB 1I7TB 5I1JL 3WS3A 3B8SA 3LY6A 2E6QA 3BWUC 4AZ8A 5ENWB 1MWAL 5T1DH 3H9HB 1FBIL 4U0RB 5KZCB 4NP4L 3MRGA 5F1NA 2PYFA 5DRXA 2GAZB 4G8IB 4YK4C 1TFHA 3O4LB 3EOYG 3L7EB 3OB0K 2DLTA 5E1AB 1IAKA 3PHSA 3X11B 1AKJB 1T04B 1RZFH 1U8NB 4MQ7B 4WEMB 3QUXA 1YY8B 5K9KA 3ARFA 3BZFB 3HNTH 5BW7C 3GO1H 2W9LA 1BFVH 4JFEE 1RURH 1F3JB 1GZPB 1OB1A 3BUTA 3X14A 3K80A 2Z8SA 5E2UH 3S34H 4MNGA 2F19H 2ENSA 4OD2A 2M26A 3BW9B 5D5ME 3ROLA 1SBSL 3U30B 4OUOA 2G9HB 4CVZB 4KY1L 1YNLH 1UCBL 1GGTA 5DMKA 2VABB 5KSVB 4BZYA 2XZZA 5JOPE 4QOKB 2XWTB 5F88A 3OKMA 4U1GC 2CRZA 3KDMA 4G5ZH 5F6HJ 3IDXL 1I1AC 1KIUA 2YD1A 2Q76A 4XCCL 3ARPA 2X4NA 4K9EL 3DSFL 5FK9B 5IMMB 1JTPA 2Z93B 4JGUA 4HJJL 4WO4A 4GKOA 2H1PH 3HAEB 2KH2B 1UXSA 4KTYA 1I3GL 2VDNL 3MA7B 3C5SA 3QUZD 5DA0B 3SDAA 3HI1B 3QFJA 4Y5YA 5GGVY 1RJZA 1KELL 3VFMB 2DQIH 2W9EH 3F6IA 3RWFA 4JDZA 4JO3L 5D1XD 5I74B 1XF3B 3PXHA 3OKLB 2GSGA 3L3DA 1S3KH 3H7LA 4EN3B 3I50H 5L8JB 3P73A 3OXSA 3LMJL 5D7KE 4HUXA 1MRDH 3I6GB 1VGEL 3V0WH 1LEIB 4RGNB 2YPKA 1CGYA 1IL1A 3WIHA 2EEAA 5F3HA 5D5MF 3UDWC 5CD3A 4RFEB 5E5MB 3WS6A 4P48A 3SGEI 5ALBL 2BSSB 1UB5B 2P5WB 1FV1A 1FORL 1P2CA 4OF3A 1MQ8A 1MHCA 5FM5M 1UXWB 3VXRB 3ARBB 3D3VE 1R24B 3MUY1 2VLJE 1G9NC 5IHZB 4A6YH 5D2NC 1QG3A 5EO1A 5DD0H 3NCFB 4Y2DD 2XWBA 3DHMA 4PJAB 1Z9MA 5T3ZL 1F4AA 1S7WA 4ISVA 5HYJD 4FTVD 1MLCB 3TYGL 4H20L 2ZCLH 2Z35A 1YZZA 4JN2B 3U4BH 2BVUA 1F97A 3DX9B 5B8CB 1NGZB 4JVWA 3MNVB 3DETD 5GRYA 1HSBA 2QKIB 3IKCA 3NMEA 5FA3B 4LKXB 3W0WA 5CS7A 2VQUA 1GVIA 5J1TC 2B2XL 4CUCA 1K2DA 3BWAA 5ERWB 2GQHA 3GNML 3N1MC 5C0BA 3MYJA 1VFMA 1N59A 5FKAA 1BVLB 1H0DA 3ECBA 4JQIL 4LU5H 3GJFA 4YC2C 4TUKH 3BKMH 3V0AC 2X1QA 3KPRB 2X10A 4JY4B 4K07A 5GISL 2WUBL 1WZMA 3GSXB 4DGVL 3KYMA 2BNUA 2MCPL 4GJTB 4L8SA 5E6YA 4U1MB 4RDQF 4XNYH 3QUXD 1WWCA 3ARFD 4WFFD 5ITBL 4WNQB 1HE7A 2WZPD 4RSVA 5JXEC 4Q2ZB 4L3CA 1GOHA 4IMKC 2RIKA 4LF3A 4NQSA 1FVEB 4M7LH 2FCBA 2EH8L 4U1LB 2ARJB 4TPRH 5I71B 3L3HB 4ZUSA 1IEAB 3RJQB 2OR9H 2BC4B 2QJDA 5DVKA 3EO0A 3FQRA 2UUDH 2BVYA 3KHQA 1DJSA 1Q9OB 4XX1E 5CZVL 4ETYA 5JHDB 2BVTA 5KSBB 1OWRM 4LHUG 2R0KH 3OWEA 4CNIA 3TYFA 2FZ3B 4DVRH 3WUWG 2VZOA 4K7PY 3WNMA 3MV7B 2NY3C 5JPNA 1IC7L 2JELH 4J6RH 3G6JA 5MEPB 1QBAA 3E8UH 3QFJD 2IAMC 4I4WA 4FFYL 3MLRH 2HP4A 3GBNL 1T89C 3CFKA 2P42B 4MYWB 4MQTB 3RWJA 4DCQA 5A1AA 5D2LE 1ITBB 4G8FA 3GKZA 5FGRA 1OSZA 2C4FU 2VXTH 3L3IA 5ACZB 1WK0A 15C8L 3N1PC 1JGVL 2A83A 5E95B 3CCHA 1WFNA 3CFEA 1NBZA 4PTTA 1OCWL 43CAA 4YXLL 3DVNB 4DN3H 1TCRA 1I8IB 4F7TB 4L8CA 1TQBB 1XF2B 3D39B 1K4DA 3QDMA 5E6ZA 2IADB 4L4TB 3TBYA 4KRMB 2X70A 2EDBA 4KRPB 3T0WA 5ALCL 1IC4L 4Z7OE 5DD1H 5EN2B 1H15B 3UJTL 3TVMC 4ZD3H 3BGFC 5ICXA 1O7SA 1ZLSL 4UV4H 3SKUD 4KMTL 2OZ4A 5EU3B 4FQCH 1PQZB 3FT2A 3KYNA 4EBQH 1FYTE 5EORL 1A14H 1RZ7L 1JF5A 2DQHH 2EE3A 2ZCHH 3SGKA 5FHAH 4Z7WE 4M7KL 4UZGA 2Y25A 1A6AB 4UT7L 5HYJE 1DBMH 4FTVE 4QEGA 2LU7A 3CAFA 3GSVA 4MA7L 4JFQA 3JV5A 1MWAH 5JXAH 1M7DA 1P4IL 2XZCH 5I8OL 5D2LF 4OZFA 2CH8A 1RI8A 5HHPB 4NRZA 1R3JB 5E8EA 4TUOB 3W0WD 2AABL 5DVOA 4WTZG 4XX1G 4I9WD 4J3VA 5C0BD 2CLZA 1FNSL 3IDIB 1J1OH 2XXMB 1SJHB 1K8DA 1N5YH 4X5WA 4NSKB 3VXSD 3RX8A 4QHUA 1RHFA 3VD9A 4WWKA 2VL5B 3FB7A 4XPBH 4EI5C 3LKPA 4LSVL 4LPVA 3TT1H 2PF6A 4R7DA 1CR9H 2IALB 4Z7OF 5F7HA 2VLLA 1IQDA 2YZ1A 2J12B 1K6QH 3QEHB 4NJAH 2XACC 4ZOEA 3BZ4B 2GCYA 1KB5B 2D9QB 4POZC 4MD5A 2W65A 4L8DA 1QPXA 3EYQD 2QADD 2Y6SD 5FYJH 1DN2A 5L2KE 4Z7WF 4WFFE 3MCG1 3GKWL 1JRHI 3LQZA 3TPUB 5IB5B 4IMLB 4K9EH 3S96A 4LASL 3DGGA 4WW1A 5EOCH 1EHLH 2YEZA 4MMXC 4LLWA 1L7TL 3N0PB 4PJ7B 5BRZB 5I8EA 1WWAX 3MOBH 3ZKND 2R56H 3HI5H 3V4VL 3KS0J 5FEBA 5I1DB 4Y7MA 1P7KB 5BCAA 1FZKB 1OW0C 2EO1A 4JHBA 1W8OA 1B0RA 1XGPA 1GGIL 5T3XH 4F57L 4JO3H 4TUJB 1J86A 1S9YA 4O4YL 2QQLH 4PGEA 4PRPB 4XMKH 5K9QG 4G6KL 3MROB 1MJUH 4QHMB 5E9DA 2UWEA 1FZJB 3DX7B 1AC0A 4APQB 4Z7UB 1D9KA 5JW3L 4GUPB 5L7XL 3QFJE 2XG5A 4JPIB 3RL2B 4Q9QL 3VG9B 1TVDA 1ZVSA 1J1XL 1NLBL 2ADIA 4HD9A 3DURA 1DBKH 5I1LB 5I6XC 2F54A 2Y36H 1IM9A 3VFRA 4H1LA 2Z92A 3O6LL 3V7MA 1KCRL 1SJEA 2APWA 3OJMB 1Z2KA 1C12B 4ZAKC 3GIVB 1EO8H 1NL0H 1T22A 2W0KA 5A2KH 1NKOA 1XIWB 4QY8A 3QDMD 4NO2A 5B39B 3C5ZB 1EXUA 1A3RL 4OFYD 4KVNH 1RHHB 3MJ9L 1N3NA 1OPGL 2GT9B 2N7BA 3N1QC 3F58H 1I4FA 3VXUB 3AXLA 4CADB 5C6TL 4QKXB 3GSNL 3GMRB 5TDPA 4HT1L 4TN9A 5H35B 3CC5A 3FO9B 5DFWH 2P49B 3SQOH 7FABH 1IC1A 4CW1B 3H6JA 1SJVA 2EXYC 4U1IA 5C2BH 2Z31C 3MQIA 5I1IH 1JNHA 3PWUB 4PP2A 2VO5A 4TSAH 5GRUH 1ZHKB 2APXA 2ZCKH 2P4AB 2HVKA 4D8PB 4HK3J 1C5DB 1SJXA 3BX7C 5E08L 2CKBH 4G7YH 2B4CL 4XBEH 1TCMA 1WC7B 1YEEL 5MEOA 5D7LE 3C6LB 3TBTA 4ZUUA 4FXKB 3H9SA 2NZ9C 3BDYL 1ZK9A 4DGVH 1MHHA 4ZQKA 1CICA 4MA8H 3W0WE 3MBEA 2C1PB 1YEGL 4OF5A 3MREA 4Z78A 4OI9A 3DUUA 5C0BE 4NUGH 3ILQC 1T2QL 2W0FB 1KBGH 3E3QC 4JQVA 2FECI 2GJ6D 2OL3A 2XWJA 3VWJC 5GS2H 3MJ6A 1NCNA 3VXSE 4IJ3C 4R8WL 4WWKD 1EEZA 4NZJA 2FLRT 1NDMA 3MRHB 5TPWL 1BAFH 1FG2A 4X4ME 2VC2H 5IR1A 2FB4L 3F8UB 4P4KA 1OAXL 1S5HB 4BFEA 3MRJA 3UYRL 1RAMA 1DUZA 3L7FA 3MUGA 1NMAL 1FSKB 2PW1B 3NZ8A 4PLJC 4U3CA 1OP9A 4QO1A 4NFCA 5GS0C 1MCJA 2JJTA 5EUKB 3QIUA 4NOBA 3DOSA 5JORB 2GK2A 3MV8B 1MLBA 4QYOA 1ZE3C 1YN6A 5J3HC 5F44A 1W0VB 4XVUD 3C8DA 4HH9B 3U9UA 1KTRL 5C0CA 1E4XL 2OR8A 5CFHA 2A6JB 4OQTH 3CDFA 2ZSWA 4PJBE 3O6FC 1KULA 3DPBA 1KYOJ 3DV6B 4I0PA 3DVGB 4LCCA 2AW2A 3CVHL 3EO1A 2BMKB 1HINH 3QCTH 4XAWL 2F5BL 1AO7B 2NXYB 4M6NL 1GSMA 2V2TB 2YD3A 4ENEC 1XR8B 2QSVA 3SJVD 4ERSH 1NGYA 3FAXA 4DN4L 5EFIB 3MGTB 5JA8B 3W11D 3OX8A 1IKFL 1NUFA 5E9DD 5DJYB 4DUVA 2Q3AA 4P2YA 3DRQB 5I75C 4UTBL 1UKQA 3DO7A 4WUUB 2WM0A 3QJHA 4RAUA 4Y89A 1U93A 1A6WH 3NTCH 2EH7H 1FZOB 3BIAX 2F54D 1IM9D 3ZE0F 3VD3A 4C59B 4X7DC 4DQOL 1U92A 2PYEE 4HIHA 1U8OB 3ZMRA 1U8MB 3ZYJA 3H9ZA 3OKNB 4FQHA 5DJ0A 4KMTH 1R3LA 5C0JB 4LNRB 4HDIB 4R7NA 1RZ8B 1N6QL 5F7EH 4M93C 4OCMC 1QRNE 3GSWA 4P5MA 3ZHKA 4HSQA 5K59E 5CJQH 4M6AA 1PKQA 4PJBF 4K8RH 2BFVL 4QRUA 4YHIA 3HMWL 3MLSL 5DJCA 4X99A 2RCSL 1HHJA 1G7PA 2E7LC 4ODUB 1JK8B 5CLTA 5FGCE 4XC3H 1M7IA 2BHUA 3RWGA 1WTGT 3BSZL 4W6WB 1KPUA 2ID5A 1TJHH 4MDJA 1I7RB 1JFQH 1JYNA 4N0FB 3G6AB 4P2OB 3QA3B 3ZE2E 1SY6A 4FA8A 2HVJA 2DQEH 3G6JF 2YK1L 1TVBB 1X7QA 2Y9RT 5ID0B 2P8LA 5EOQH 2APFA 4HXBL 5EC2A 2E6PA 4MCZB 3X12B 2F15A 4BQBA 3H9SD 4HUUA 1HHGA 3IDYC 1MCPH 3G04B 5DR5H 1PEZA 1CICD 4C56B 3MBED 2Z91B 3QIWC 1RK1A 2I9TB 3I6LD 3LAFA 4S1QL 3UTTA 2D0FA 1QEWA 4MNQB 2Q8BH 1LDSA 4YHNB 4KTDH 1VADA 4QHKI 4HWBA 2GJZA 3GEWB 4WEUD 3ROOA 1XF5A 5F8QC 2IG2H 4DK6A 5CEXA 3S5LA 5K59F 1A7PL 5KW9H 4DJMA 2GJ6E 4XPGH 4KROD 5K33A 5E8DL 4P4KD 2XA8L 3ULVL 2VL4A 1DBAH 1WBYB 1OF2B 1MAMH 3WO3B 3VFGH 3PNWA 3LQAL 5ESVB 1ZA3B 2CGRL 3O2VL 2V7NA 3BXNB 1E4KA 3WXWL 4YWGH 3CFDB 5DSCB 3ZE2F 3GDBA 4F37F 4HULB 3QIUD 3LKRB 1P9MC 1MOEA 4Z77B 3GSRB 1I9JL 1BD2B 3ZO0A 1BM3H 4Y19A 5CJBA 4G6JH 4GAGH 2NY4D 3OKOA 4JM4L 1X5GA 4XBPA 2AERT 5FHBH 2IBBA 4M5YH 5I8KH 1PJ9A 2HKFH 3QPXL 5C0CD 3RHWK 1FGVL 4ZS6D 3S3PA 4WENB 3LHPH 5FIEA 4MSWA 5DJZA 3QIBC 3R0MA 1LWRA 4I0PD 3GRWH 1W0WB 1T20A 4YX2H 3JWDC 3CVIH 1XR9A 1VACA 4GAYB 4JFZH 1MJ8H 2GITB 1UJ3A 4BKLB 2BVPA 5EBLB 4AL8H 3ARDD 3VFNA 4KRLB 1QBMH 3TNMA 2WINB 1KJ2A 1S9WB 3IDJA 5SX5H 3SJVE 2JJWA 3V52H 5IWLC 3VH8B 5BV7C 35C8H 3ZDYE 4OLXH 1DFBL 5E9DE 1CLYH 3S88L 2E27L 1HWGB 3I3DA 3GGWA 3ALWA 1EO7A 1MF2H 5C0IA 4HXAL 4OZFG 4PBXA 5GSRB 5KJRL 4POUB 2IFFH 3QRGL 3I84A 1MFBL 1R5VB 4A6YB 1Q1JH 2F54E 5DVMA 5F7KC 5E2TH 3IXTB 2DMCA 4MA1B 3DUSB 3U36B 3DI2B 3RUGE 2YBRA 3BYTA 4PJGB 1NANI 2ADJA 4OV5B 4TVSa 2A6DA 3UTPE 2PW2A 3O2DL 4JM2C 3TP4A 3VXOB 4V2BA 4NQDD 1IGFL 4YXHL 3BZEB 2DYPA 4UNTA 3U9PH 3WFDH 1QLEH 3U0WL 4L9LA 5F9WB 4NQUA 1JNJA 1BMGA 5E4IA 3RGHA 1I3VA 3Q6GL 5C0RH 4M1DL 4KJYA 5J4MA 3VU2A 3D1MC 4ZPVB 4WJ5B 3S4SB 5DQDL 5B4MC 4G8EA 4XPTL 4BQ6A 1C16A 4HJ0C 5HHOE 2UWEF 3GI9L 3F65A 4XH2B 4CRPA 5JW5B 3WN5B 3H9HA 1G7JB 1A1MA 4N0UA 4CU6A 4UV7H 4WEBH 2K3TA 4OCXL 5IK3A 4JGJA 2OJZH 3B2VL 4ZNEE 2ZUXA 2VH5L 2CXGA 1MCNA 2NY5C 4MJ2A 5E1AA 3NABH 2BOCB 3UTTD 4LCWE 4HLZH 3T0XA 1GGBL 1AKJA 1T04A 4XP9H 5C9JA 4AEHH 1JMZA 1TZGL 1U8NA 3I9GL 4MQ7A 4NQEB 3RUGF 1YY8A 4MJ6A 3G08A 4LAQL 3MV9B 4KHTL 2ZUYA 5AZEH 3OXRA 1I9IH 1IEBA 1UCTA 3DJ9A 5TQ2H 1G0YR 2A73A 1MFCL 2D7TH 4JDTH 2ZG3A 1NCBH 4KK5C 4KH2A 4U6YB 4Z7QE 4FQ1L 1ES0B 1FDLL 3FFDA 1FAIH 1DN0A 1KFAH 4KAQL 4PLOB 4J4PD 2PO6B 2JJVA 3QXDB 1Z9OA 2VABA 4OF8A 5T5FL 4PIRF 5KSVA 1KJMB 4LRIC 3LS5H 4QOKA 1Z3GH 4HBCH 4HG4J 4H1LG 1IAIH 1QHPA 5CGTA 2F5BH 4I3SL 4MA3B 3QUYC 4M6NH 4XXCA 2OM5A 4AYFA 3D9AL 3S3JA 3HI6L 5CKGA 5SV4A 1C08A 4GH7B 1JRHL 1Z9SA 3UEZA 1GAFH 2FX9L 3HI1A 4FMKA 4XGZB 4B5EA 2CO7B 3GMQB 4UTBH 4M6OH 1KIPB 2DQGH 4V2CB 4N90D 1XF3A 4J1UA 3OKLA 5IVZB 3GK8H 4EN3A 1HH9B 3O6ML 4XMPL 4HS6A 3QEUA 3T4AB 4JVUA 2YUZA 4P3CL 4W68A 2ILLA 3MJ7A 4DQOH 4Z7QF 5D1XC 3MRLA 3IS1X 3MOQA 4OLWH 1J7VR 3MLZH 3SDXE 1DQDL 3NA9L 3BKCH 3TWCL 4XAKD 2YRZA 3V4UL 4ODXB 1KXQE 4YAQB 4RFEA 1ZLVK 2BSSA 3QXUA 1YA5A 3TPKA 3MODL 5JO5B 4HC1L 1FGNH 2BDNL 3RZCB 1BOGA 3VXRA 4H5SB 4OD3L 1R24A 5IHZA 3RGVB 4Q6IB 3BVNA 3QEGL 5JPMA 1JUFA 1JNLH 1JV5B 5HHME 5ESQB 3MRDB 1JNNL 2DYPD 3DX9A 4Y2DC 2DOCA 4XT1C 5B8CA 1DLHB 4NQDE 1AQDA 5HDQL 4OJFL 2AXFB 5F9DC 5CCKL 3QULB 2P5EB 3BRGC 4G9DA 4DFHA 3ULUL 3DETC 1QBLL 4GO6B 4HW6A 3V4PH 3P77B 3HE6B 3QDJB 2QQKL 3SDXF 5L6YL 4ZSOA 3BPNC 3WKML 3GFUA 5E94A 1T1WA 5T33H 4PRHB 5KZCD 4JY4A 1CT8B 5GRWA 1ZS8B 4G43B 3GSXA 4YHPA 5DJAA 3HPJA 3O4LD 4PJEE 4LSRL 4P2RB 5F6HI 2AGJH 2ZKHL 1DQMH 4U1MA 1AKJD 3LQAH 2MWCA 4UT6L 5DJ8A 1UACH 1CVSC 1F4WL 2EIDA 3UTTE 1MIML 4KI5D 2DBLL 1NCTA 3G6DL 3CD4A 1XMWA 3S97C 1HDMB 3WL9A 4I77H 3PGDA 5CUSH 3QUXC 5I9QC 1Q94A 5D1QC 4ELMA 4U1LA 3RVUD 1LO4H 2C26A 2XA3A 2QTEA 3WO4C 1IEAA 4M1CD 5GSVB 1CU4L 2FECL 1C8PA 2ERJB 1IKNC 2JB5L 3AMLA 1ZANH 4I48B 1CGXA 1NAMA 5GZOD 4KKBD 1Q9OA 3CMGA 1MPAL 4QOKD 1RQ5A 3FB6B 4PS4L 5JHDA 5GGRB 1QD0A 5KSBA 3KPPB 2NY1B 1ETZA 5C0EB 1G6VK 3RA7H 1NFKA 1JZ4A 5B3NA 2DTML 3IRPX 1NQBA 3I2CL 1FC2D 4ZXBA 1MHPH 5MEQA 4XTRD 1KB9J 3KPMA 4PJEF 5DEGB 5A2JH 4AIZA 1IGTB 3VFPB 5EZJA 1I8LA 4HXAH 4YZFE 4LVOB 4ZOAA 4YR6B 3HZYA 3QAZC 5ACZA 4EN3D 4N90E 4WY7L 3L5XH 4NN6B 5GRZA 2CDGB 2R23B 2OLDA 1D6EA 1LP9A 3PHOB 2R2CA 3AREA 4WFHD 2FATL 2HFFA 4I2XA 1RMFL 3H7BA 3HE7B 2IADA 4L4TA 1BJ1J 1ORSB 2AP2A 4NQCA 1YMMB 3O9WA 5SX4I 1KCLA 1X5IA 4XNMA 1LHZA 5EZLB 1H3UA 1UM6H 5IFJA 3VXRD 5HGDB 2R2BB 2R4SH 2OTUA 4TVPD 4QLRA 2GKIA 5EU3A 4NYLA 1PQZA 4GXVH 1Q38A 3KPSB 1H3PH 2X9YA 2DWDB 2ORBH 2Q6WA 3HUJA 2P8MB 2CKBB 3OKKB 2XQBH 2X4OA 4BZ1H 3S5LG 2VWEE 2KDGA 4K2UL 4X0KB 2VZVA 5D70L 1UC6A 3CUPA 2V9TA 3AAZB 5L88H 3SE9H 1CF8L 3O81A 4YZFF 3GJEB 4D3CH 3V8OA 5T3ZE 3V6ZB 4P23A 1DR9A 4NPYB 4Y5VC 3OAUL 4JFOB 3U7WL 4P9HH 1WGOA 4M8VA 5KBNC 5J7CC 1SJHA 1JVKA 3DVFA 1LK3H 4LVHB 4PREA 4NSKA 4K7FA 5DJ2B 4NRXA 5C6PB 5EO0B 3KPRD 4TULL 4N1CA 4TRPH 1I7UB 3L5WB 4ALAH 2DQDH 4LNVA 1M71B 1QNZH 4OZIB 2IALA 1AXIB 1N6VA 4U1NB 1I9EA 1QLFA 1RIVH 3O4LE 5E5UB 3V5KB 3GSUB 2I07B 3CSBA 3MRFB 1CIDA 2GFBB 3T77B 3HS0B 2HWZH 1ONQA 3THML 3SCMB 2WSKA 3EDFA 4P49A 3RP1A 4L8SC 5IHUH 2E7HA 4TSBL 1RIUH 3DXAA 1U8KB 1NGWB 5FF6B 4WV1A 3WKNA 5ADOL 4XZUA 2AQ2A 3EYQC 4NZTL 3TZVB 1QO3B 2Y6SC 4M6ML 4H88L 2MTPA 2V17L 3TH3T 1A6TB 4PJ7A 4QTIL 3TC9A 3G5YA 3O8XA 5BRZA 2VR5A 1TDQA 3L3KA 3VRJA 5I1DA 1P7KA 1FZKA 1KN4H 1C1EH 3BISA 4NDMB 4GKNB 1CDHA 2W91A 5JHDD 4HIJB 3DO3A 1AGDA 5IJKA 2A9NH 4QOKE 3ZKNC 1HCVA 4YPGB 1T03L 1M1SA 3MRMA 3BD3A 2VDOL 4MDIA 3WLWD 3BP5B 5BS0A 2VXQL 1BF8A 3O11A 4YGAB 4RWYH 2VDML 3QR2A 2XN9B 2FIKA 2QHRH 3DX7A 4Z7UA 4D0DA 4WHCA 5ESAA 4GUPA 3NA9H 4JPIA 3RL2A 1A3LL 3H3PL 4FQJH 2MPAL 1T21A 4S2SB 1R3IL 4UAOB 3MC0A 3DX8B 2VSDA 5I1LA 2BDNH 4KI5F 3MNWB 3NOIA 3LZFL 5I76B 3ARED 4POYA 3STZA 1W72L 1C12A 3ULSB 5J8OA 1AR2A 4WFHE 5CMAB 2X89A 1G9NL 4RGNE 1OY3B 5B39A 2GK0A 4HS3A 4L4TD 5E2VL 4MZ3A 2HFEA 3TA3C 4NQCD 5CSGA 3O9WD 3DTXA 7CGTA 4XCYA 1CVRA 2GT9A 4KRPD 1HQ4B 1XGQA 2BZDA 4JFFB 3GMRA 4YQXL 5I2IA 2DL2A 3VFUB 5DD6B 2P5WE 4RFOH 5M7QA 1FFQA 2QHLA 3S3SA 1QFUL 3VXRE 2AS5M 2VZ3A 4Y4FC 1QA9A 2IBZX 1D5MB 2EDDA 4TTDD 5KVDH 1AC6A 4TVPE 3MRNB 4YDIH 4PJAE 2AI0L 3DYPA 4JAMB 3AU1A 2I9LA 2QQKH 1B3JA 4IRZH 1AFVH 1T1XA 3M07A 4PR5A 2OTWA 5DRWA 4F7EB 4X80L 1QYGH 1WC7A 4A2MA 3SGKC 2NY6D 3FQXA 4GW4A 5IESH 5CD5D 2AK4A 4WUKH 2HA1A 4CVUA 2C1PA 2FJGA 3RRQA 1F4WH 2SEBA 5H2BA 2KUTA 4Z95L 1QSEB 4N9GB 4NQTA 1KTKE 1WEJH 1CYGA 3HAEG 1MH5B 1IAIM 3MRHA 4BK4A 3LKQB 3KPRE 2J7LA 1YYLL 2X1OA 3FB5A 4PD4K 12E8L 3IFNL 1S5HA 3S35L 2X4SB 2OJEB 3P0VL 4JO4L 4WWKC 3QWRA 3NACL 1TJIH 4P2QB 3S7GA 4M3KB 3F12A 3IJYB 3LKNA 1J05B 5GXBB 4PJAF 1JZ7A 3LV3A 2RJMA 5DMGD 5JORA 2A74A 2B7DT 4PB9L 1HCFX 2J4WH 1MJ7H 4F7CA 5I18H 1T0PB 2YN3A 3VDAA 1SMAA 1W0VA 5E99H 5D1ZA 3TBSA 5BRZD 1JJUA 4WHDA 4PJCA 2A6JA 4OFPA 2DDQH 2UUDK 3DV6A 4XVUC 1LO2L 2VYRE 3W9DB 2KBGA 5DT1L 3M8OH 1P7QA 3SKNB 1R3KA 1MCRA 2BMKA 2AV1A 2K7PA 3FO1B 5JHDE 5D7SL 5KSBE 4BSWA 4OKVA 1XR8A 1RZIB 2K7QA 5BS0D 2W0LA 3ARZA 2YD6A 4O2FA 4PRPD 3QI9B 1PDKA 1CBVL 3MV7E 5BZDB 4HGWA 2HH0H 4GQ9L 3JSSA 2Z4QB 1GHFL 5CINL 2W9DH 1ZA6A 3NPSC 4NO0B 5FXCH 1U3YA 1DBJH 5LVEA 3W11C 1NMBH 4N1HB 2P44B 3PP4L 1X9QA 1OGAB 5DXWA 1HHKB 5LWYH 2X5PA 5EUOA 1QLRB 5FO7B 4UDTB 5ICZA 3NFNB 3RJDA 1U8MA 1MJJA 3O2WL 2AEWA 1QSVA 4HDIA 3RY6A 1XIWD 5CP3H 2I60L 1FE8L 4LIQH 4O5LH 2X89D 1A1OA 4Z0XB 2CLVA 1OP3H 3K4AA 1NGXA 2QSQA 1IZJA 3LKSA 4LSTL 3WIFB 5JW4N 3D39E 4DVBB 1MRCH 2JCCB 3N9GH 3PP3H 2HRPH 4L4TE 3VXUD 3NIDE 3QWOB 2Z8WC 2XICA 1JK8A 4CBPA 3OB8A 3UTZB 5B38B 5KSBF 4JB9H 4XBGA 4P59L 1I7RA 2E6JA 3U7WH 5L2JB 1T5WB 5F7DB 2BSRA 1F3RB 4HKJA 1AD9A 2FD6H 3GHBL 4YHML 2CO6B 4QTHB 3PQYB 2PR4H 5TFSH 4XMLH 3LEYH 4Q74A 2ZP0T 2GY5A 2VE6B 2XPGA 2FX8L 1F58L 1CFBA 4HK3N 3VFSB 4NQVB 1IC5H 1U58B 2MHAB 2AK4D 3NH7L 5F7NC 1JYXA 3LD8C 4UBDD 2WP3T 4UIKL 4G80B 2I9TA 2D03H 3VFVA 4MNQA 4F2MA 1NGPH 3SDCC 1QTYT 5CJOL 4EVNB 2DD8H 3DECA 1CICC 1LO3L 1NCAL 3MBEC 1IAOB 5INCA 4PY7B 3VWJB 4M9PA 3DROA 5IGXL 1TPXB 1JF6A 2FJHB 3D0LB 1I8MB 4OCLC 3IXAA 5ADOH 4P4RA 1LD9A 3C2AH 5IVNA 2XQYK 2XFXB 2DIJA 2X7LB 3P9WB 4JQVC 25C8L 4DW2H 1RUPH 5IQ9B 4PLKC 1EVTC 1ZA3A 2DQCL 5E2WH 4WI4A 4R0LC 3BXNA 2PTTB 4KROC 1OSPH 3UJJH 3CFDA 5DSCA 1HH6B 4JPKH 1JWSB 1G7IB 3FOMA 3LKRA 8CGTA 1GOFA 4TOYL 5FA4A 4K3JL 5IQ7H 4Z7VA 2JJTC 2VDOH 3L9RB 4IRJA 1XF1A 1EMTL 1PZ5A 1BZ9B 3PHQB 3TNNA 2BVQB 5DGQA 1BZ7B 4EDWL 2D7MA 5LQBH 3B9AA 3UYPA 4PJ7E 2NY4C 5BRZE 2UV3A 5HHQB 4QNPE 5HHNA 1FNHA 4U6VH 1BVKB 5F7WC 4R97C 1A3LH 1IGIH 3H3PH 5J1AA 4PYHA 4PJDB 4V1DB 3FONB 2B1AH 3GBML 2GITA 2W07A 1AO7D 1UVQA 3RDTA 4GSDL 1MCCA 1S5IH 2ZJSL 4EQ3A 4LLVA 5JW4M 4NQXB 4H25A 1OT1A 2WINA 1YMHA 4HFWB 3G9VA 3TO2B 5JW4R 4PRPE 5C0GB 3ARDC 3Q5YA 2H6PB 2AK1H 4X9IA 5DUPH 4Z7UE 4EXKA 3ARGA 3QG6B 5K9QI 5FM5O 4H8WC 3K7UA 5JUEH 4UB0L 1S7TA 2R69H 1LE9B 3U46B 2LTQB 1ORQA 1RK0B 3VW3H 3IXTA 1JPGB 1J5OH 3U36A 4ZFGL 3U2SB 4L5FH 2H9GB 4OV5A 3UX9B 4FZ8L 3HG1B 3MXVH 4OBRA 3MLVL 4R4FL 3ZT5A 1VKXB 4PJ7F 5KAQF 1Q9LB 4KKCD 4QNPF 5C86A 5FGBA 4W81A 4GRLB 2Q8AH 1CIUA 4I18A 4MAYA 1JPSH 3BQUB 3VXUE 4RQQA 2EXWD 4QHNA 5KG9B 1GC1H 3VA2C 3I02B 1BQHA 3BIKA 5FYLD 4JVPA 4B53A 1KCSH 5C0AB 5IBUG 4OZGB 3M1BA 1LMKA 1KEML 1BP3B 2HMID 4ZPVA 4WJ5A 3S4SA 2A6KA 3E0GA 5DEFA 4OZHB 4OD1L 2NY7L 4LCYB 1S7XB 4XH2A 3C5JB 4Z7UF 3HC3L 1CL7I 2VTFA 3CXDL 2FHBA 5K9JH 1B4JL 4NFDA 1KPRB 5AAMA 5KAQG 5CEZH 3BAEL 1M7XA 5F70A 4LMQE 1P84J 3FQTB 2BOCA 4EZMA 1X4XA 4MNQD 5D96B 3LCYA 4KMLB 3OB0H 3RVTD 4AJ0A 5TF0A 1QR1A 3T4YA 3MV9A 3MMEA 3HC4L 2BSED 5EU5A 3NVQA 4JKPL 1YNTB 5GS0L 3CDGA 1U0QA 1N0XL 3JV4B 5E2JA 2D31B 5GJSH 2OP4H 5HYEA 3VXNB 3KLDA 5C3TA 3OKDA 4PJ9C 1J0JA 3CMOL 1R0AH 5I16B 3TH2T 4XPAH 1FO0L 2ZUUA 1BHGA 5HVHB 1QVOB 1WAAA 3KPQB 4ORZC 3VI3E 1CXKA 4X98A 4DGIH 5IF0B 4EJ1C 4NWUH 2O5ZH 4YFDB 4LSUL 6CGTA 3H42L 3LVEA 5D93B 4J4PC 2YD9A 1C5BL 3LH2L 4JE4B 1E4KC 3DYMA 3ESUF 3T1FA 3V6OA 3MV8E 1NEUA 2WMPA 1T3FA 4XC1L 1U6AH 1CD0A 4JRYA 3N85H 4H0GA 3IFOA 5B39G 4P9MH 4QRPB 1EAPA 2OS7A 3NAAL 3ZZ1A 4NHCH 1SM3H 4X6BB 1CXFA 3UTQB 1G84A 4PRIB 3RDTD 4NNYA 4JLRB 4PBWD 5JIHA 2EC8A 5IVZA 3O45B 1AIFA 1AO7E 3HB3D 2ZUSA 4WW2B 5IMKB 4WDIB 2DF3A 5FCSH 5TE4H 2HT2C 5E8NB 3P2TA 3VGAC 2F74B 3ARGD 1F6AA 5DHVB 4NGHL 5D8JH 2UVEA 3QP3A 1YEKH 4WUUE 3VI3F 4N8VB 4AIOA 2B0SH 4FFZH 2YPLB 3RZCA 1JHKH 4NKOB 1QKZH 1GPOL 3BP6B 4KUZL 1E6OL 5HPMB 2HG5B 2WBJB 4Y1AB 2R8SH 1NMCB 1YPZA 5LGJA 3SPVB 4IS6A 1JV5A 4K3DL 4LHUB 2AXGB 1FNEA 1MWAA 5AYQA 1R5IA 3BPCA 3F62A 4QRQB 1BJ8A 3WFBH 4PJCF 5FO9A 1A6UL 1U8HB 4MAYD 4WI5A 1MVFA 5HXMA 2H8PB 2E7MA 3QDGB 2VWEC 5F3BB 1KN2H 1HQRA 3MOAH 3BP4B 4AG4H 1AGBA 3U1SL 1FH5H 2P8PB 5JNYB 2H41A 1PY4A 5FYLE 5IEKA 4GS7C 4JCLA 3T1WA 3HE6A 1MAKA 4FNLH 1JGUH 3D6GA 2OI9B 2VUYA 4D0BA 1DE4A 4U2YA 5KSAA 4HFUH 3UCRA 3QXTA 2MQ3A 1ZGLB 4PRHA 1HKLH 2ITCA 1ZS8A 4PB0H 4G43A 2ZG1A 1A64A 5EG6C 3HNSL 4P2RA 3A6BH 1KC5H 3P4MA 2Y06H 3TM6A 3UTOA 1BX2B 5DJXB 4R3SB 4ONHA 4C56E 4HF5L 4HMCA 1HILB 3A6CH 3VRIB 4NQED 5GGRY 1RUKL 3QQNA 4P5TB 2Y5TB 1WISA 1D3CA 2C3VB 4MNQE 4L4VA 3MV9D 1S7SA 3BRFA 5EBWA 3MRKA 1NEZA 4AIXA 3K81A 5IT2L 3T0AA 2WNGA 3BN9D 2MFNA 3P3YA 1EJ6A 4K3JH 4ZFFB 4G8GA 5KS9B 5HYIA 4NC0B 1B6DA 3JWOH 5KSUB 3BZDA 5JDSA 1H5BB 3ET9F 1IFHH 2CUMA 2V2WB 2OL3H 4LCIH 5J9PB 3DMMB 2V7HA 1DCLA 2Q1EA 2R0LL 5C9KA 1NBYA 5DWUL 4YFEA 3FB6A 4M1CC 4P57B 5MHSD 3U30C 5C0EA 5FYKL 5GZOC 1FIGH 1BD2E 4OUUA 1WF5A 1ADQH 2ZJSH 3K74B 4XWOD 4QRSB 4JRYD 4ACPA 1CFQB 1KENH 2EIEA 5DI8B 5DEGA 4XXCC 5E24E 1ZT4B 1U8PA 1XH3A 3QWQB 5HDLA 1KLFA 3S37L 4ZDHA 5BV7L 1IGTA 2HTLD 4XTRC 3QUZB 1J1PL 1LVEA 4HPYL 4LPWA 3ME0A 5D6DA 3S35X 1ACZA 4X5XA 5FV2A 2BP3A 3CSYB 4QRTA 1WITA 5CEYB 4NKQB 4Y8AA 5DRZB 4ZO8A 2R23A 4S1RH 2ZNWA 4IDLA 2M1KA 1EEQA 4GRWH 5BO1L 5I74C 4D9LH 2A9ML 5EIIA 5D6CB 4D9QD 1V7ML 5JIIA 4EN3C 4FZ8H 3NCJL 5A43C 1BFSA 4LEOA 3PWNA 4FHBD 1YEHL 1N5AB 4UINH 5DC0A 2DS4A 2ESVB 3W2DH 4XPHL 2CR3A 3OQ3B 3RIAK 4RGNC 1OAUH 5A3ID 43C9B 5FUCE 1YQVH 3RZCD 5EZLA 3LB6D 2VITB 3AB0B 1P6FA 5HGDA 3NIFF 1RUQH 4UT9H 1SVCP 2ARWA 2XG4A 1IT9H 5TQ