3WHE1

A new conserved neutralizing epitope at the globular head of hemagglutinin in h3n2 influenza viruses
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
226
structure length
226
Chain Sequence
QVQLVQSGAEVKKPGASVTVSCQVSGYTLTSYGLSWVRQAPGQGLEWVGWINTYDGQTKYVKKFQGRVTMTTHTGTNTAYMEMKSLRSDDTAVYYCARVEGVRGVMGFHYYPMDVWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved Neutralizing Epitope at Globular Head of Hemagglutinin in H3N2 Influenza Viruses.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin
total genus 27
structure length 226
sequence length 226
chains with identical sequence 3, 5, 7, 9, M, O, Q, S, U, W, Y
ec nomenclature
pdb deposition date 2013-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe102
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3whe101
5F1NA 1GH7A 1ZE3C 2I27N 3G9AB 1BX2B 1YEIL 2XZAH 5F7NC 4O4YH 1IVLA 5HI4D 3ARFD 1AGDA 1X4YA 1P7HL 1B0RB 3MLWL 3R8BB 2WAHA 4PJDA 4JHAL 3OKKA 5EN2B 1LVEA 4MJ5A 2BC4A 2IANE 5L6YL 3GMRB 5C0CA 1NCAH 3RWJB 1UA6L 4HIXL 4OKDA 5JDSB 3GMOB 1C5CL 3RUGE 4GBXD 2XQYK 5AUMA 2R56H 3BXNA 1T83C 5I1IL 5HD8C 3H9ZA 5C09D 2A6JB 4WHDA 5LXGH 2R0LL 2A6IA 2P43B 1RVFL 3TP4A 2CK0L 1TCMA 3BKMH 4X7EC 4BUGA 2C3VA 4Y16C 3RKPA 1VA9A 3MBEC 3ULVD 2CDEA 4FXGB 3MBXH 3CPLB 4AH2B 3GRWA 3CC5B 2RQ8A 4EDWL 4N0YL 2CK0H 3IAQA 1JHTB 1RSFA 3U6RB 4S2SB 5FUZH 1XF5B 5A43C 4MDIA 4QHKI 5KVDL 2AERT 3PWNB 4YEFA 4AY0A 1IAII 1LQSR 3T0XA 3MYJA 4QHUA 5ESAB 5F7HA 3MYZA 2Y9RT 3RFZC 2NY6D 4FXLA 1Y0LB 2D0FA 1W72H 1Q38A 4OCSH 4L4VB 3D2UA 3DV6B 4MAYD 3EYFA 3LKOA 2CRZA 4JY4B 1P69B 1NBZB 2V7HB 2Z8SA 5C9JB 1HWGB 4GFTB 2BVTA 1FZKA 4L8BB 3HPLA 1CBVL 3OKMB 1VB9A 2DWEB 5HHMD 4CN4A 5GISL 2Z0BA 4Q7DA 5H94A 4XVJL 4ZUWB 5L8LB 3CSYB 1Q94B 4DJMA 3T0EB 4JFEE 4F8QA 3L3DA 4MS8C 3F8UB 4WU7B 3SDDA 1T4KB 5IHBA 3O6FA 1TMCB 3CIQA 2BHZA 4JM4H 4MQTB 1ED3A 2VLKB 1DVFC 2DM3A 1INQB 3TH2T 2F8VA 5F9OH 3O2WL 2X10A 5J7CC 4ZG1A 2DTML 1DEEA 3V8OA 4FQIL 1B3JA 2CLVA 1ZXQA 3O8XC 1ES0A 4KKCD 3RUGF 3STBA 4E5XB 2HJLA 3UYRH 1AHWC 3BUTA 5EBMA 4NGHH 1NH6A 2ZZUT 1AIFA 3W2DH 1NCCH 3VWKC 1EHNA 2AI0H 1KTDA 3IFPA 4HDIA 4Y7MA 4XP5H 4L8DB 4OZGA 4ELKA 1RIUH 4X5XB 3CZJA 1EBAA 5K33A 4XCCL 2ILLA 1BVLA 4F7PB 1UCBL 3IJYB 2F74A 3MV8A 3KPRD 3OQ3B 5BS0E 3CFBB 1NUFA 2UZIL 1D3CA 3O6KH 2NXZB 3T0WA 4QWWD 3DRQA 5TFSH 2SEBA 5L2KE 4XP5L 3WKMH 1JFQH 1NDGB 2APBA 4CUCA 4UUJB 3E2HC 4HUXB 1IFHL 4NQEE 5J11C 5D2NB 3MXWL 1LDPL 4QRRA 3BAEL 1SEBB 4HWZA 4G5ZL 4EDXA 2Y06H 1QRNE 2BFVL 5KOMC 3PWPA 3MFFA 2H8PB 1UM6H 4JFQB 4N8PA 4AL8L 4XMKH 3SE9H 4PGEB 3Q1SL 5C7XL 3O2DH 3PWVA 5J06A 4FFZH 2EIZA 3OF6A 1T6WA 2VDOL 1UVQA 1KIRB 1WUNT 4XC3H 5IBTH 2GIYA 4KI5E 4NKIH 4ZUTB 2XV6B 1M05B 4FQPA 5EUOA 3M8OL 5H35A 3QI9C 5F89B 4POZD 3TJHC 4LKXA 5E00A 5CEYA 1CLYH 3EW3B 4TUOA 1OTUC 2HRPH 2JKXA 2UUDH 3BPNC 1CDHA 4IHOB 4IMKA 1ZS8A 4JPKH 1L7IH 4HC1L 4JO3L 4Y16D 4YK4C 3BQUB 3ZE1E 4JEGB 2BHUA 3QPQD 2NY3D 2UZYB 3ZDYE 4RAUB 4XVUC 3SQOH 1MAMH 4ZUUB 2V9TA 1DQJA 2NY4B 2E3VA 3QQ4B 3FQTA 4X8XA 1IILE 3RVWD 5BMFL 5JOFA 4NQUA 1W8NA 3IFOB 1N5AB 4H0IA 2AK4E 4GRLB 1N59B 4DUVA 3TLRA 2AABH 4X6CE 5DUMH 5FO8A 1V7NL 2F8XC 4NZTL 4AIZA 1QBML 4WHYH 3RHWK 2NR6C 3FT3A 4RMSA 3STZB 2X44D 4XPHH 3MCKB 4RWYL 4YHYC 4Q2ZA 3WFEL 5DVKA 4KUCD 5CFHA 3GRWL 1OQOA 3WLBA 4GRMA 1TFHA 2XTJC 1OY3B 3L3JB 3MLRH 5DRWB 1LK3H 3K2UH 3IXAB 5E9DA 3C6LD 4GW1B 4X8JA 5GHWH 3HMXA 3BZ4B 4FFWD 3DXAD 4OGAD 4JN1L 1GJIA 4TSCH 4JG0H 1BOYA 3RGVA 2YD8A 1IBGL 4WW2B 5E5MB 1MI5D 2FCBA 5A3IC 1CG9B 1P4BH 2R69H 3BZEA 1U8OB 5HVWA 3VGFA 4AYFA 4X99A 5JPNA 2AEQH 2VLJE 3GSOA 4NKQB 4NO0D 4K3EH 1QA9B 4XPAL 3NMEA 1MUJB 3BESR 4FQCH 1YY9D 1VACA 1KSRA 5E8EB 4TN9A 3TBWB 3SCMB 4P46A 4UINH 2D03L 4P5TD 3RWEB 3D6GA 3FQNB 4U1MA 2W0PA 1UM5H 1AXSA 3VA6A 2FX9H 1GSMA 4V2CB 2ZUQB 4LL9A 5DQDH 1TZIA 4OCWL 4R7DA 8CGTA 3LQZB 1DN0B 1X4XA 1PZ5A 5DJCB 4U1IB 2WZPD 4KKLD 4RGNB 1PKQB 2HT3C 3HE6C 3QXAA 1EFXB 3D0LB 4NM8H 3PDGA 4AH2A 1QRNA 3H6JA 4PJBE 4K3DL 3ARVA 1AR1D 5L2JB 4LHUA 4NKOA 1HHHB 3AU1B 3HZKB 5C0AE 3S6CA 5F9WB 4S2SA 1EHXA 4QOKD 2V2XB 3QEHB 3VFSA 3LN5B 2A38A 5HTSA 1MRDL 4LGSB 3RWCA 1TCRB 3HLAB 4LVEA 3FRPG 4UT6H 4OLEA 5I8CB 5CJBA 4BKLB 3Q5OA 5HHOD 4QOKB 3FT4A 3MLYH 1U92B 5ADPH 4LLQB 1KLUB 3C5ZA 2F5BH 3QFDA 4GO6B 1CGXA 2DQEH 1XF1A 4LSQH 4MB4A 4A2LA 3B9KA 4MSWA 4XNQA 3D3VB 4JFDB 5SX4I 2R2BA 2F53D 2XN9D 3Q6FA 1NANH 4KGLA 5FYLD 2AJXL 5KVGH 2JK5B 4S1SL 1N8ZA 1CL7H 1I1YB 3BFOA 1IC5H 5CJXC 2GJ6E 1RJYB 2OX5A 4JM2C 5D7JC 4NZTH 2EKSB 2R29L 5DVLA 2OL3L 4BM7A 4WI2A 1QVOA 4OD2B 5EC1B 3T3MF 4PJAA 5ACMA 4U3HA 2ORBH 3MNVA 2W59A 4R4BA 1BVLB 4GAFB 4P57B 2DQUH 1DL7L 3ZYIA 4I5BB 2EYTB 4N0FB 2AP2A 3MJGX 2OXHA 3D69B 3SGJA 1OGAB 1BD2E 5J3HC 3TYGL 4ELKB 2HKFL 4JRYB 3QEGL 1QHPA 4ELMB 3W0WB 1IEHA 2ICEA 3RNQB 3BD3A 1IQDB 1CXHA 5ERWB 1VGEH 4AT6A 3W5MA 5CJQL 3OHXB 2W92A 3JWOH 3S7GA 1LNUB 2KH2B 3OXSB 3ZDYF 3Q3GA 1I1AD 4TSBH 1KJVA 4GMSL 2AJSL 3QIWC 3CXDH 2BNRD 1P4IL 2Z93A 1CXKA 3ARPA 4M5ZH 5DVNA 2Z31B 3SDDC 5IBUG 1RZGA 4BH7B 1N3NA 4Y19E 3HA0A 1JPST 3EYQD 2Z9TA 4ERSL 5GS0C 3VU2A 1EAPB 4NN5C 3CXDL 4TUJB 3GM8A 3O3AA 3LZFH 4FQXC 1ITCA 2CRIA 1A0QH 4XB8A 5ICYB 2CJUL 1FBIH 2OLDA 5CMAA 4BQ6A 3E3QE 3ZO0A 1MCLA 5F8RC 3NAAL 3IDNB 3LEXB 2WUCH 3S3JA 2VQ1B 2DQFB 2NY4D 1F90H 3ULUH 2N7BA 2JJWA 4ZO9A 3VXRA 1QR4A 3BYTA 5I17B 4HWBH 2X89D 3TWCH 5TFSL 5ABDE 3ARXA 3TO2B 2Y7QB 2VQUA 4YZFF 4XCEA 5CJXA 1AKJD 2B39A 1GC1C 4P2RA 2NTFA 4UNUA 4I3RL 3A6CH 5D2LB 4ZPVA 3LS5H 5DLMH 1NMBL 1HDMB 1Q0YH 1YNTB 3BZFA 3OJVC 2AJUH 3CUPA 1OM3H 1D6VH 1MVUB 1CDIA 1MFDH 1OW0A 3CXHJ 3GMQB 3MRFA 4NC2B 5GRYA 1CXEA 2VDOH 3D25B 2IALA 3IDMA 4PJ9D 1S78D 2CLRB 3WDIA 2G5RA 4JDTL 4NCC2 1B0GB 2BHYA 5AWNL 4S1SH 4I0CC 2VR5A 3QUKA 5IIEA 3M8OH 4QT5A 1MLCA 3OGOE 1X6NA 3GSUA 4PJ7A 4P23A 1UXSA 4YWGL 2MJWA 2C4XA 2PTVA 5C07D 1UM4L 4PJFF 1B9ZA 4JQIL 4M6ML 4MXQC 4HJJL 3TBYB 5IEHB 4F7CA 1CXFA 2FWOB 4XPBH 2V5TA 5IVZB 1LGVA 2UY6A 5TDNA 1KNOB 5EU5A 3RI5K 5FDWA 2DICA 3QIUB 1V8HA 1YEJL 1H8OA 1OTTC 1FLRL 3WN5C 3KDMB 3IKCA 4P2RD 3ESUF 1V05A 4GG8B 4HK0A 5FOJA 5ADOL 5JDJA 3LEVH 4H25A 4P5MA 2Q8AH 3ZKND 2O5YL 1IM9A 3GMMA 3OX8A 4TOYH 1R5VB 3HRZB 4GMSH 2CDGA 3MRRB 3BN3B 4G8FB 4HXBH 3WS6A 4G80B 3WFBH 4RIRA 4OCLC 2YPVL 5C0RL 1JZ7A 2K7PA 1MCEA 2W91A 3P9LA 3QDAA 5D7IF 3QHFH 1OP3H 5ENWA 4P4RA 1MNUH 3BGMA 4OGXL 5F1KC 4KHTL 5HGHB 4HWBA 1OF2B 2ED7A 5FGBC 5B8CA 5KJRH 5I66A 5FO9B 3HMWL 3NTCL 4LSTH 5I1AA 4QYOA 2FGWH 4JFFE 3ZLQC 1WIUA 1B6UA 4YUEH 4WI9A 4F7MA 3GMPB 4UV7L 12E8H 3QO0A 4CNIA 5DEZA 4JPIA 5DHYA 4GMTL 2R2HB 2R4SH 4Z18A 4OLZH 5I0DA 1ZANL 4PJ7F 2V2TA 3RL1B 3J7HA 2YBRB 3RWCB 2JIXD 2N7AA 2MHAB 1SYVA 4O4YL 2NXYB 4JO1H 1F5WA 1BF2A 2Y5EA 3OB8A 4XHJC 2EDWA 3NZ8A 3KS0J 3IDXL 3V6FB 1O7VA 1U8QA 3JVGA 1QLEH 4ODTL 4PJXE 3CFBA 1FJ1A 2LTQB 1EBPA 4M7ZC 4QY8A 1K8DA 2OP4L 3D0VA 1KPUA 4QNPF 5MI0B 4KJQD 1CFNA 1CQYA 1TQBB 3P73B 3VE0A 3UBXB 3V0VB 2MTPA 1A6WH 1RHHB 4R8WH 4OD3L 4KQ4H 4PJ5E 1B4JH 5FDYA 3IFLL 3E6FB 2LU7A 1KIPB 5KSBB 1I3GL 2M1KA 4APQD 1H3WM 4PGEA 3VGAB 3AGVA 3QNYA 4NUGL 1M7IB 5IK3A 1P7QD 4Z5RA 1FG2A 3SQBA 4F37F 5IBTL 3D69A 4XP1H 3V5KA 5J8OA 2IMMA 2V5RA 4NO0B 2UUDK 4JRYA 4XCFL 5DJDA 5E1AB 2WWMD 1OAQH 3P2TA 1SJVA 5EU3A 4M6OL 3ZT7A 2YK1H 3SE4C 4P2YA 5F44A 4CVZB 1QNZL 5BRZD 4HMDA 3ULVF 1V3JA 4ZS6C 3K4DA 2ITDB 3MQIA 1I1CA 3BUYA 4YFDB 1T1ZA 3GIZL 2VSCA 4KJYB 4V1DE 5C0NC 2BVYA 2D7OA 3AS0A 4UAOB 1KUMA 2OZ4L 4FQHA 3QRGH 2AEWA 3MXVL 1JCKA 2A6KA 3VFVA 3BPLC 4YDKH 5JXAH 1H8SA 4OZFH 2E5EA 2IAND 4P3DA 1VFMA 2Y6SD 3MRJB 5I1JH 4PLOB 5KSAB 1G9MC 4Y5YC 1X5ZA 3MFGB 1OARH 4BUHA 5C70A 5MEOB 4P9HH 2E7MA 1DANU 5CCKH 1MOEA 1RIHH 2P24A 4YHLH 5EPMA 3D39E 2DLFH 3LY6A 4NQSA 2OI9C 3BOVA 1J8HD 4PREB 4PTTB 4CDHA 5KSAD 3SE3A 2OS7A 2VXQL 4P5TA 3BSZH 3CLEL 4KAQL 1KACB 1ZWIA 3VRLF 2HMID 2ZOLB 1REIA 5DRZA 4G8EB 2QKIB 3HUJA 4OZHB 4NUJB 1MCWW 3SKOA 4O58H 4OCRH 5SWSB 5AUMB 4GRMB 2YPLB 4PBVC 5DJZA 4F8TA 2YC1B 4I3SL 3N1QC 4HS8H 2H26A 2R1WA 3GMQA 3MRFB 4XPGL 3HI6L 4U0QB 3W0WD 1Q0XH 3VRIA 4X99B 1JPFA 3WIHL 2BNUA 4PLKC 2FRGP 3GJFB 4PJEF 5FYKU 5IMLB 1N6VA 4YHKH 2H1PH 1U3HB 3TZVA 2AEQL 3CMOL 3CC5A 5IVXA 3ZE2E 3SN6N 5IB4B 2MOVA 2YN3A 2OP4H 3ARDD 1MCPL 1CFQB 3LQMA 3QQ3A 3RY5A 5HI3C 1Q9OB 3B9KC 2CKBL 3KPSA 4HX1A 1MCFA 5ILTH 1FNAA 1TZIB 3VWKA 5JNYB 5D7IA 5HHPB 1M6OA 4PJ7B 4Q97A 5DC9B 5I2IA 3JV0A 4GAJH 1H5BC 4NC1C 4LSSL 4O51B 2X4UB 4L1HA 1TNNA 3IYLW 2NX5E 3FRUB 2G5BB 3TN0B 3F7YB 1INEH 5I1HH 4MNQB 1S3KH 3CJJA 2HWZH 3T4YA 1T0MA 1NCTA 2OTWB 4PJAE 1BFVH 3D2UB 1Z0MA 1MWAH 3LDBB 1JRHH 4L5FH 1LP9E 1YZZA 1RFDH 2W0LA 1KPRB 1FRGH 1PY9A 3TA3B 3O4OC 3DMMC 1KJ3L 4S0TD 5EZIH 4TVPD 1YJDL 4P2QA 1JRHL 5ISZA 3FO0H 1HHKA 3O9WC 1FDLL 4QLRA 4LSQL 2ADGA 5C0EB 1TVHA 4PRHB 2Q76B 1OHQA 3T1FB 3VI3F 3I2CH 3LD8C 4JJHA 5B3NA 2PW1B 2NZIA 4WO4A 5IGXH 4Z8FH 2I07B 4XPTH 1CFSA 1Q1JL 4K3HA 5C08E 3KWWA 1MCSA 3IDGA 3B9VA 3P11L 5F3BB 2ID5A 1OOAA 3PGDA 4YHLL 3KLHD 2OSLA 3IT8D 3U6RA 2FIKB 2IQAA 3MUGB 3UTTE 3S9DB 5T3XL 3S5LB 2FX8L 2L7UA 4P3WA 4QRTA 1CIDA 4JJ5B 2Z35B 1HILA 1T5XB 1XGPA 3OZ9H 4HUNB 4XH2A 4HFWB 4UTBH 3TH3T 4PJIF 4LDEB 4KZDH 2H41A 2HT2D 1S7TB 2OTPA 1I1RA 3BKCL 5KG9A 5IBLC 3D18B 3PUCA 3FQWA 1E6JL 2Y1VA 1U8MB 3MLVL 1LDSA 4RFNC 4UT9H 3V6OA 1BLNA 4XPGH 1IAOB 3B2VL 3QPXH 1NLBH 3S96B 2AABL 1HHJA 2EYRA 4DW2H 2AV7B 1KEGH 5HGBA 1TJGH 5F7UA 2HT2C 4KY1L 5E6IB 3C8KB 3VXOB 3SGKA 1LE5A 1NGZB 2F58H 1M05A 3QIBB 1OARL 3IB4A 3CFJA 5J1SC 2I60H 3G6DL 4B41A 4LLMB 3TT1H 1D9KB 3BKJL 4NQEA 5TDPB 5ITBH 2YKLH 3OTTA 3JV5A 4PG9A 1KBGH 3AMLA 3T0ED 3KLHC 5LAXB 2YR3A 3IAGC 2MCG1 4U2YA 4HBCH 1DE4B 4LCUB 3S37H 4X5WA 4PJ9B 4KRLB 4B0MM 1GGIL 2K9UA 4OZGB 2ZSVB 3PWJB 1RU9L 2LVCA 2AK4D 3O6LH 4Z7WF 2WIMA 4EIGB 1ZSDA 1NEZG 3UZVB 4LMQE 2GKIA 2X89A 5GS0L 1HXYA 1GXEA 1ZHBB 1NFDB 4XC1H 5HY9A 3NCMA 3EO1A 3RTQC 4NQVA 2DBLH 3PE9A 3WBDA 4BH8B 3DMMD 4LU5L 4LLVB 4G9FB 5GGRY 2PETA 1P7KB 1SBBA 5K9QI 3VXSB 2E6PA 3HC3L 4XI5C 2EYSA 5CIPA 4YHMH 5E2UL 3T4AB 4BK5A 1UWEL 5TF1H 4FQHB 4NFCA 3RZCB 1A6WL 1HOCA 3B5HA 5D2LA 5KOVC 1A1OA 3AM8C 4OI8A 2HT4C 3SBWC 1BQUA 2H2SC 4WO4C 3VXSD 1WSST 3P9MA 4TSAH 5ACLA 2CDFB 3V4UL 2ZOKB 4W6XB 3OV6A 2PXYB 1NUDA 4X6BB 4JPKL 4NYLA 5DK0A 4N5ED 3Q1SH 5HGAA 1T1XB 4MCZA 5L88L 5T1LD 1LK2A 1UXSB 1IGCH 1F3RB 4K7FA 3ZYOA 4Q9RL 5ID0B 3TM6A 4M7KL 4IMLA 3K8MA 2B7DT 3GDBA 4YIQA 1RQ5A 4P4KA 1CGVA 1TITA 2QKIA 1A5FL 1L6XA 3MV7E 4NQDD 5DC4B 3CXHK 4RGMB 4NC1E 5DFWH 3QR2A 2L0DA 1MWAL 1QFOA 4NUJA 3SKOB 5JUEL 3RVXC 1DQLH 3DVNA 5E8EA 4M7KH 1OT1A 3EYFB 1I85A 1NGWA 3T2QA 5JHDE 4ORGB 1NQBA 5GJSL 1FNSH 4AM0B 4QGYA 3QXUA 2Q86B 1QEWB 4KHXH 2BX5A 3C60D 5ITFB 3DMMA 4BZ2H 4OTXH 1HNFA 3T09A 1MREL 2QADD 1XF4B 5GRJH 1X5AA 2HMIC 1HKLL 4A6YB 4LLAA 5TH2B 2DKUA 4PJ8B 5I8KH 1CU4H 2VAAA 2BRRH 4BFIB 5HGDB 5JZ7D 2EDFA 3EO9L 4GRWH 2DLHA 4U1KA 3WEXB 3W11C 4PJ5D 3WLBB 1D5XA 2YUXA 3HLAA 4PJIB 3EHBC 3U46A 1HKLH 3NVQA 4GXVL 1P4BL 3NIGE 5D6CB 1Z5LB 4HBCL 5BRZB 2P5WA 5B39G 1LP9F 2ATKB 4XCNA 4YHIA 2YUWA 3JWOC 5I76B 4JKKA 3NIFF 3G6JF 5ANME 3TC9A 3FQUB 5KW9L 4PJIE 3D3VD 1KB5L 3MLZL 4F7TB 3HC4H 2HT4D 1NKRA 4ZOAA 4WGVB 1XIWD 4Y5VC 4NQDA 3TO4B 2G75B 4H26B 2PYEB 1MH5B 5I9QC 2FJGA 3QFDB 5FA3B 5C07B 5DLML 1EEUA 3GJFK 3MLZH 4RGOL 1C08B 1K5NA 5D8JH 1SM3L 3VMPA 4JO1L 3O4LA 4ZFGH 3W9DA 1OM3L 2GY7B 1D5MA 3V6OC 5D5ME 5IW6B 5B38B 1KCUL 5D71H 2QSQA 3A67H 1P2CB 3MRDB 3G5ZA 2GK0B 2JJSA 4MJ4A 4ZTPH 3D0VB 2V7HA 1WICA 4K8RL 1T22B 4ZUVA 5ALBH 1A22B 1U8IA 3QXAB 4Z7WB 4JFQA 5AZEL 4HUKB 4G9FD 1IQDA 5ISZD 4HHAA 1KPUB 4LASH 5DHVH 2PW2A 4OZ4B 4KKAC 4ODHL 3TBTB 4NWTL 4WUUB 3GI8L 2EDTA 1IGCL 1SVZA 1QZ1A 4QTHA 4Z95H 4FG6C 1CLYL 4NQTA 4Y19D 2Q87A 4N9OB 4J8RB 4NOFA 3B43A 3MV9A 4ZFOB 3X13B 4ODHH 5E70A 2FJFA 5KSVB 5I8EA 3S96A 4Y4FA 5L8JB 4JLRA 4QRUB 3C60C 4K07A 2O26U 5KTEL 4UQ3A 1H3VA 3BUYB 4YGAB 1I1AC 3FB7B 1XFPA 4OSUH 1H3UA 2FD6H 4WEUD 2HVKA 3SY0B 3OKDA 3B5TA 2V6HA 3E0GA 2G60L 3N9GL 4HXBL 4LSUL 3MPCA 1J8HB 4PJGB 1I7ZB 3BJLA 4NP4H 5CILL 1RZ8A 1MHHB 5J1TC 4UDTB 5ISZE 3QUXD 5MEOA 4OQTH 4DFHA 5MEQA 3EKCA 2VLLA 5AYUL 3JVGC 4XHQA 3MACH 4NHCL 4L3AA 3VW3H 1RZFL 1LD9B 2CK2A 2XNAA 2OK0L 5IF0A 2MPAL 6CGTA 4FRWA 3WNLA 4ZPVB 2P8PB 3BWUC 5DHXB 1G9MH 5KSUA 2ZSVA 3PWJA 3MRQB 1JGUH 5ETUA 2GJZA 4ZSOB 1DP0A 2YRLA 1JPTL 2R4SL 4HC1H 3CUPB 4Y2DB 1T66C 2FH6A 5I16A 1OT2A 3O11B 4J1UB 4YC2C 4GSDL 5C2UB 2MNUA 5D1QA 3ULVH 4JVPA 1L0QA 2R4RL 5EDXA 4ODXB 1HI6A 35C8L 3DUUB 3SJVB 4PJ5A 1F4YL 3ULUD 4K8RD 4F58H 4RISH 5BMFH 4JO4H 4H1LG 5CJQH 2VNCA 5CKAA 3MGOA 2YC1A 1GGTA 3L6FA 5HJ3B 2CKBA 4V1DA 3V79C 1CGYA 2X4RB 2APWA 3HE7C 3S88L 1KGCE 2NY1C 1TPXB 2QHLA 3GSOB 3E3QC 1X5HA 3REVA 1J11A 1YQVH 3KR3L 4DGYL 5HYSA 3OAYK 2V17L 1KCRL 4QT5B 1KYOK 2CLZA 1G7PA 5A2KH 3G6JB 3NA9H 4I2XB 3OR7B 4P49A 4LPUA 2X1WL 1E27B 4O9HH 5I1GL 2AXHA 2YEZB 1M71A 3U79A 2QSTA 4Q9QL 3ALPA 3EDDA 4NUGH 4WHTA 1G9EA 4RA0C 5KW9H 3N06B 4IOIA 1EZVX 1LO2H 1P4LA 5DJ2B 3P30L 3STZA 3TVMD 32C2B 3EOTL 3O6ML 4H25B 2D7NA 4Z7VE 1F4WH 3VDCA 1NANI 4OCXL 1YEGL 2NY0D 4HAGA 1TZHB 2Y5TA 3IKCB 3KJ6H 4G80A 1INEL 5E4EC 3MRMA 2OJZL 3OGCA 3I84A 7CGTA 3EBAA 3TFKC 1C5DA 5FKPB 3SDYL 1OCWH 5EULV 3RUGA 1QBBA 1DLHB 4QNPE 1ZT4B 1F6AA 3QDJA 1LHZA 1YJDH 3ARDB 5IBLD 4Z7UF 5D4QA 2RR3A 1JNNH 5SWZD 3F7VA 4RA3A 5HVHB 2IPUK 3V5DB 2JELL 1LP9A 1I7RB 2KUTA 3LMJL 3CLFL 3DYMA 2BNRB 4MLIA 3TO4D 3VXUB 4CJ0A 2VDLL 1L0XA 4HC1A 5F72S 4NM4L 3U4BH 1D5XB 4JFHD 3WFHB 4EBQH 3SGKC 2P8MA 3SE8H 1HYSC 5A2IH 5GIRB 4BQCA 4APQA 1V7ML 5HYJE 1LWRA 3NA4A 4R7NB 1RUKH 4OFYA 3QEQD 1UWGL 5FM5M 1EA9C 2IQ9L 2BVOB 2OR9L 5F7LB 4YPJA 3GO1H 3U0TA 2GI7A 2X4TB 5L7XL 1MY7A 3VGGA 1DFBH 2XN9E 3O4LB 3OHXA 5HDBE 4R4FL 2VE6B 5DMGC 4JAMA 1F6LL 1VGEL 4WRLA 1RPQA 1JK8B 4ZAKA 1X5IA 5FA3A 2YPVH 4K9EC 3MRCA 2YSSA 3V6FA 4OJFH 3VE0B 4JFYB 4PJGF 2ICWI 5C6WH 3T0EA 2DKSA 3ABZA 3MREA 3QFJA 1E6JH 2C3GA 2PXYD 3PP4H 5AD0A 3RWDA 3IDYB 2EICA 4E42A 1U6AL 1BIIB 2AJYL 4RFEA 2BOCA 2E9WA 2VISA 5JPMA 2BRRL 1A3RL 4P9HL 5GS2H 5CILH 2E9BA 1EV2E 1I1FA 1FG2B 1JHLH 1W0WB 1OF2A 4EJ1C 1RZGB 1X44A 2BJML 4OZHE 1HHJB 5GZOC 1Q9WA 2B20A 3T3PE 3C8KA 1S7XB 3FTGA 4Y89A 4XZUA 2AEIT 2GITA 1HCVA 1ITBB 1OTSC 1XCQA 3GMPA 5FUOH 3VFTA 1HHKB 4GAJL 1CFBA 4OCYH 4OFPA 1K4DB 2DQGH 1EFQA 4JHAH 4KMTL 4M48L 2AXFA 5DJDB 1ZGLB 3FJTA 4P23C 4WUUD 4XWOD 5HI5C 2NY1D 3VXUE 3UTQA 5I1CH 3D9AH 2BNRE 1P84K 1SJXA 3GSWA 3K1DA 2IFFL 4YGVB 2M2DA 3DNKA 2NTFB 4N1EA 5F7DB 1BBDL 3K0WA 4ZSOE 4NFBA 1OWWA 3VCLA 4LP5A 3HG1A 1GGCL 1KTLB 3LEYH 4ZFOL 4FFVD 3RNKA 1MCKA 3GHBH 5F88A 3UYPA 4ACPA 3WXWH 5I1DA 1ZT1B 4YHKL 3LS5L 1G0YR 1JF1A 5INCB 4UOW0 1ZLUH 5DD1L 1NFDA 2XFXA 4HFWA 2E9JA 5F7YC 3G9VA 5FHBH 4D0BB 1CFNB 4QWWC 4G7VH 4PJDE 1WLHA 3L3HB 4PB0L 4H8WL 3FFCD 3MRKA 1F3DH 5D72H 1UZ6F 4ZO8A 1OTSD 4R0LB 2RCSH 4MMXC 3BVNB 4KK6D 4N90E 3LQAH 1UM6L 4IRSC 3BE1H 5IHZB 3W39A 2RFXA 1I9JL 4XNZB 2JJVA 4X7SH 5B39B 4ZYKB 5BOPA 2G2RB 3OAUL 1J5OH 4OB5H 3FCTB 3EYSL 4WWKA 1I3UA 5TE6H 4IOSD 2RCSL 4S11A 3BW9A 4HJ0C 4MCZB 3SE8L 4KKBC 1UB5B 4O02H 1UG9A 5KSUB 4TUJA 3GSUB 1QP1A 1WIPA 3QFJD 1Z6JT 3VXMD 5AZ2L 1EEQA 4WY7H 3U30B 1C12B 2J4WL 5IR1A 4PJ5B 5TE6L 1MIMH 3D39A 1AGCA 3TPKA 2WBJB 1QO3B 3GBML 4OZHF 1XR8A 3HPJB 2NY6B 3J8F7 4OF3A 5IMOA 3ZHKA 2FATH 2ENSA 1ZAGA 3ILQD 3QG6A 2PR4H 1G7QA 1N2RB 4MDJA 5I74C 4HG4K 1J05A 5FYKE 4L3CA 5DXWA 2R8SH 4HH8A 4OIIH 4NQXB 4PJEB 1MHPH 3FHAA 3QEQA 4KHXL 5GGSB 1FAKT 4J6RH 1CF8H 2VKWA 2ADFH 4GKNB 3WCYA 5CJ5A 4OFVA 1T1YA 4GS7C 5LCVL 5HY9B 4XVTL 3KPSB 4HX1B 5EBLB 4KMLB 2I60L 3G6DH 5C0RH 4U1SB 2BCKA 2EH8H 2XKUA 4QRPD 5D5MB 1CDGA 3U9UB 1UFUA 4NQCB 3L9RB 4K94L 4Y4HB 4JPWH 4LBEB 1ZA6A 1ADQA 2D4FA 1J7VR 1WVZA 1MFBL 1QYGH 3WHXB 4FQLL 3PDOA 3VXTA 3X14A 3EO9H 3UZEA 1A7QH 4FZ8L 5KZCB 4KTEL 3MRHA 4YQXH 2IPTL 1U8OA 3OB0H 3UJJH 4NRXB 5C9JA 4CVWA 3WL9A 1S78C 1R3KB 2FZ3A 2IBZY 3T0DA 4KU1A 2ZSWA 5ISZB 3U46B 5AYQA 4HJGA 1GZQA 4FQQA 4G8IA 3DGCR 3KYNA 4PJGE 1J8HE 5LGJA 3MOAL 5C07A 1JPSL 4FMFA 1T4KA 2ZP0T 1DN2A 1U58B 4EI5A 3QHZL 1IC1A 1JUFA 5EOTA 2G75A 3LKPB 4ZXBA 4ODVL 4Y4FC 5T1KA 1FFOB 5IB4A 4PV8A 3NZ8B 4MMZC 1HXMA 1AP2A 1CICB 5B38A 1QQDA 3DSNA 5DJCA 4U05A 2DQHH 4O9HL 1A7NL 1E4WL 4APQC 3TCLB 1FJ1B 2H3NB 3KWWB 3RDTB 3V9FA 4FQIH 4EN3B 4XH2B 3KHOA 1J0YA 2BNRA 3UEZA 1QFWH 5TGBB 5IESH 5GGUB 4OF8A 1F3JA 3NGBC 3CDCA 2P8LA 3IFLH 1DUZB 4QXUH 3VG0H 2P4AB 1UADC 1DQQA 1KJ2B 4YXLL 4E41B 5HDLA 1JWMA 1Q72L 3C9NA 3ZHDA 3ARTA 2H32A 4NM8L 3ROLA 3THML 2DLGA 1MWAA 2CH8A 3N1PC 3MR9A 2FYYB 4ISVA 1KFAL 4W6WB 5GGTL 2WWKT 1P6FA 1IGYA 4K8RC 2WLYA 1EO8H 1DBBL 2Z4QB 3U1SL 5LWYL 2ZG3A 3D87B 1D9KD 4I9WE 1A7RL 2ZPKL 4JFYA 4JPIB 5DHYB 3F7PC 2WQRA 1LO0H 3MNZA 5DMIH 1VENA 3GNMH 3GIZH 4PG9B 4CKVX 3L3OB 3WUZA 3PWUA 5J12C 1KIRA 5DMKB 5KVFH 4DN3L 1BAFH 4OTXL 1NMCC 2ESVD 2GT9A 4QRUA 5E8OB 4ZUTA 3WJLC 4JPVH 3S36X 5HHXH 4LOUD 4KTYA 1C5CH 1ZTXH 2PYEE 1OGTA 3BE1L 1EERB 1UVQB 4P57A 1GOHA 3I6GB 3SY0A 5EC2A 2D7MA 1CIUA 2W9LA 4L9LC 4M4PA 4HGMA 4AMKL 5KSAA 1FVEB 1IAKB 4LEXH 2A77H 4Z7NE 2JCCF 3BHBA 4WI7A 1WZ1L 3MRNB 4CVXA 4XPTL 4RAVB 5BRZE 1A5FH 4LNRA 4JM2D 2Y6SC 3ARED 3RVTC 1E0OB 2B4CL 4LIQH 4ZPTB 2VDPH 4D9LH 4ODWB 2EE6A 1H3XA 3S8WA 1X5FA 2DLEA 4RAHA 3NCJL 2DDQH 4XP9H 4QHMB 4XBEL 1NFDF 3KYMA 4FN0A 4X9BA 1J87A 5ETUB 1A4KB 5FO8B 2L4OA 1YEKL 4PG2A 3L3HA 4JHZA 2YPLA 4YE4H 1I8MA 1XGYH 4UUJA 3X3GH 4NQCE 3QQNA 3OAZK 2D7TL 2GAZA 5GQBA 3U48A 3ZSTA 1S9VB 1T21B 5EO1B 3TZVD 2XFXB 2IJ0C 5IHZA 4QCIA 3V6ZB 3SBWA 4TNWF 1YA5A 1NFIB 5CBEB 2GCYB 2FO1A 4N5EC 4HV8A 1CU4L 1VSCA 2OTUB 1NMAL 2NYYD 5KVEH 2DMCA 5T1MB 1EGJH 4N1HB 4GW1A 3MCKA 4CMMB 4I0PA 4UILH 4PJHA 4ERSH 2ESVA 4FQJH 4X5WB 5GSVB 1HEZB 2UVEA 5IVXB 1T2QL 1SMAA 4M48H 1D5BA 2ZUTA 2ERJC 2HVKB 2XY2A 4HWUA 2QQKH 2ICES 1BQHB 1N6QH 2LAGB 25C8H 3KYOA 4MXVE 5F1IA 5T5FH 3VXPA 3DVNB 3R4DA 5CGYC 1NSNL 4UV4H 5FA4B 3VWJA 2C7UA 3G5YB 1QO3A 1QSEA 2HFGH 3WNKA 4GW4A 2VXUH 4MHHG 1HSAB 4J3SA 4LAJH 3OR6B 2AEPH 1WFOA 4GXUM 4JFDE 1S8DB 3VD9A 1CE6A 5C08B 1QACA 2ADGB 1EIBA 2VXUL 5L0QC 3QAZB 1MCQA 2OR8A 4R2GC 4DOHB 3SO3C 5GZOD 2R0WL 1YYMH 4OAWA 3LV3A 1GZPA 3QRFM 4MZ3A 5D7LE 1I3GH 4MQXC 3T0EC 4PRHE 4TUKL 1NFDE 5IFJA 1BECA 4YXHH 4JFEA 1ETZB 1T7YA 1K6QH 5BVJB 2GUOB 4J3XA 5D7SL 1W0VB 1RD6A 2EXWD 1DVFB 4JGJA 5F9JA 2W1NA 4Q2ZB 3F6IA 4OBRA 1GHFH 5FV1L 3OKKB 5MERB 1LP9B 1WZ1H 2FB4L 3QEHA 2DQJH 3P77A 1JPTH 1AHWB 2CLZB 3E6HA 3X11A 3U7AA 4QF1B 2AV1A 3K8KA 1D5MB 5GS2D 5IVNA 3U9PH 3BZDA 5CSZA 4IJ3B 4CMHC 4P5MB 3NPSC 3HI1A 3GSNA 3BWAA 1JTOA 1ULVA 5IB2B 3KPQB 5BV7L 2HJKB 4EN3D 4IRJA 4MQ7A 1NGXA 2NXZC 4TSBL 4ZNEE 2JIXA 1I7TB 4PJ7E 1XR9A 1FO0L 1PEZA 1YEKH 4Q6YA 5J13B 5J11B 1G9NC 4LEOA 3PGFL 3B2VH 5DK2B 5ADOH 3VFRA 2QQLH 5EU6B 1QA9A 2D7TH 2JTDA 4E42B 1H3PH 2PW2B 4PGDA 5DD6A 1VACB 3DV4B 3EJYC 4PJCF 3NIFE 43CAB 5C0IA 2P5WD 3QCUL 4Z77B 1UH3A 4W4OA 5FM8A 5HPMB 3QFJB 2XIDA 4HIIA 5ESAA 4KAQH 1BVKA 3GGWB 4MGXA 1DL7H 3AM8A 1UWXH 1M7DA 4GUPB 3QO0B 4CNIB 1XIWA 4ZQKB 2VDKH 5SWQA 3FOLA 3IJHB 4Q9QH 3UTTB 3O45B 5A40E 3RGVC 4YH6A 3VRLE 2X4OB 3HE7D 3H9HA 5FHAH 5B3JE 5GRVK 1XH3A 1ROWA 1YNKL 1Z2KA 1OAUL 3N85L 3VXME 4F57H 3RPKA 2A74B 3L5XL 3SPVA 4ZO7A 1IAIM 3M07A 4PY7A 4P2OD 4PRPA 1KN2L 2OSLB 5JHLL 1FVDA 1K4DA 3N1FC 1S7VB 1MJ7L 3OXSA 3BQUC 4LSPL 1PLGL 5GIRA 4Z0XA 5GZNC 5IHLB 4QRTB 1A3QA 1U8LA 3ARRA 2LV4A 3CDGA 3WKML 4O2EA 3VA2C 1P5VA 5FKAB 1A7PL 1BZ7A 1DDHB 3ETBF 3LKRB 5IQ9A 3MCG1 5IVXF 3OG6B 1N64L 3UCRA 2GFBA 4LFHD 3MC0A 5KS9A 1CI5A 4UNTA 5DI8B 4HDIB 2VMFA 5AWNH 5J9PB 5DD3H 5EOCH 5FOBB 5INCA 1EMTH 2DIJA 1MQKL 1MEXH 3B9KD 4FQJL 4XTRD 1S9WB 5I6XC 4H8WH 4KI1A 4KKCC 3FB5A 3S98A 1CT8B 2EKSA 3LOWA 3OXRA 1XCTA 1IAKA 3TBTA 4ZPTA 3P9MB 1A7BA 1KV3A 1IM3B 3OKLA 2EEDA 4WWKD 4RFEB 1B4JL 3EIFA 2X4QA 3L3IB 3CU1A 2XTJB 3LPWA 3KPPA 3O11A 3RWJA 4PRNB 4H8WC 4Z7VB 4OQTA 4XP1L 4WV1B 3C2SA 4YBLC 4LHUD 2IAMC 1NGWB 5E9DB 1DSFH 2CUHA 3D25A 1P84J 2A6IB 5HDQL 2APFA 5DGQA 2CMRL 5A3ID 3NN8A 1HINH 5KSBE 4MDJB 1PY4A 3FFCE 4G6AC 2OYPA 3C2AL 1VHPA 1JYXA 3WNMA 1U8JA 5DRNA 5MHSD 5F7MC 4DKFL 5K59E 1RZJC 4TULH 5C0FA 4YEEA 5GGSY 2PKDA 2FSEA 5I30L 2XQBH 3MROB 1IGTA 2WIIB 1SJEA 1JGUL 3ZKSD 4C56B 4YDLB 1RUPH 1G6RA 3QEGH 1JF1B 1C7SA 3QI9D 4G3YL 4GKNA 1K85A 4NQCA 3QCVL 3WSQL 1CD1B 3SJVE 4OT1H 1I9RL 3QDGA 3V7MA 1LILA 2YWYA 4KK9D 3DX8A 3HE6B 4U1SA 3DBXA 3WEXA 3X12A 2DRUA 4EI5D 3DETC 2WP3T 4PJIA 5DSCA 3WO4B 1MFBH 1QYGL 4X4ME 1ORSA 3B3IA 3DTXA 3D9AL 5D1QB 2Z8RA 5CBAB 3PP3H 3OGCB 5L2JA 1I8LC 3PXHA 4HS3A 4I48A 2ZCHL 3LSOA 4XB7A 1QHOA 4WNQA 3WUWB 3PP3K 5ACZA 3LN5A 3RY6C 2VLKA 2V17H 3I3DA 1I7RA 4UMGA 5FAAA 2CGRH 1MHEA 4V1DB 3BP7A 2XRAL 3GMOA 4LPTA 2ZCKH 3L3DB 2A0LC 4X6DB 3VFGL 1OSPL 2PO6B 3RWGB 3UO1L 5HYSB 2YUZA 1I1AA 2CUIA 1JNLL 3A6BL 4G7YH 4OGZA 3BI9X 3HB3C 1T80A 4MXWL 3NZHL 4KQ4L 5HYQA 1U8KA 2EE2A 1KJMB 5FUOL 1HHIA 3UO1H 2CXGA 4DVBB 4A2MA 1N26A 1D5ZB 1UJ3C 5HHOA 2O5ZH 5HYIA 8FABB 4ETYA 5LJYH 5IM7A 4FTVE 1BEYL 5DZOA 1MHCB 2P5EB 4D8PA 4YHNB 1ZANH 4ELMF 3AAZA 3JWNC 1QVOB 4OD2A 2AAVA 4IDJL 5EC1A 1NUGA 1YNKH 4HIEB 1U95B 3WNNA 5J89A 2J3SA 1SBSH 2BNQD 3BDYH 5BOZG 2ZNXA 4KUZH 4WI8A 4WUUE 4QXGH 3GSNB 1OP5H 5HGGS 4PGBB 1NCDH 5GGTH 1YMHB 4YNYA 3EOTH 3UTSE 1T66D 3LHPL 4M1DH 1T89A 2QJDA 1OW0C 1KB5B 3EZ8A 4PJXB 4C57C 2V2XA 2X5PA 1YYML 5F7KC 4C54A 4LF3B 4Z77A 3GSNH 5LGKA 4HZLA 3A6CL 4QHLB 3QIWB 4YHOL 3QH3A 5C09E 3TV3H 3ZKXC 3PWVB 4ZTPL 1M7DB 4J4PA 4LPWA 3KVQA 4BSVB 2QLVB 5C6PB 3UBXA 1INQA 3O8XD 4FQQB 4NO3A 1C08A 1K5NB 1R3JA 2J1KA 5MENA 2IQAB 3MUGA 1ZLUK 2YWZA 2DD8L 5DEFB 1CVRA 1JNNL 5SWZA 5DD5H 5CINH 1YEDA 5F3HA 4D9RD 5C07E 5IK3B 3F58L 5F7EH 3DI3B 1UGNA 4OKVB 4DTGH 4M8QB 4M6OH 4B7LA 3FMGL 1F2XK 3IF1B 3PWLA 1MF2H 4GRLA 5D2LF 5C08D 3UTSD 2CPCA 1BLNB 4CVXB 2VZSA 4HUXA 1B2WL 2F15A 1BBJA 5J56B 4XNXL 3FQTB 1ZOXA 4LKCB 2SEBB 2UWEA 5DS8A 4WFHD 3G04B 3QNZB 5HYEA 4BQBA 5A16B 3HZVB 4JB9L 1KB9J 1P9MA 2ITCB 2BSED 5E08L 4DGIH 4MJIE 3EAKA 4U6YA 5DFVC 3SKMA 2A2QT 1SVCP 2P46B 3QUMA 3Q48A 1NFIA 3IXAA 3HG1E 2NQCA 1BFTA 1ND0A 1DEDA 4P5TB 1TJHL 1JMXA 1QPXA 4N0CC 4Y19B 4ALAL 1UC6A 3L6FB 2AJ3A 2HFFA 4WWID 3W0WA 2GAZB 2VLMD 1JGLH 4M62H 1J1XH 5IKCA 1RUQH 2XA3A 4LVOB 1A1MB 2IPKA 2EDRA 3L3OA 4RMTA 3NOIA 1BJMA 1X4ZA 3DO7B 3G6JA 1H15B 4R97C 3LKSA 3S37L 4PRDA 1AO7E 1MJ7H 2EIBA 3KYOB 3CVHA 3QDMD 1F13A 1NDMA 5CMAB 1MRCL 1XF5A 1BD2B 2CIKA 5FA4A 3PHOB 3T2PA 2R1WB 3IRZA 4X6DF 1KEML 4ODBD 3QHZH 2VR9A 5L6YH 5AG9A 2IFFH 4D0BA 2BVPB 4LVHC 3WFCL 4PBWD 2IANA 1EO5A 5IMMA 5JQ6H 2H6PA 1J8KA 5HHVL 2A6DB 3D85A 1QLFA 1VFAB 3SDYH 2GJ6B 3L1OH 3RWHA 4JM2F 5DZNA 2E7LA 5D2LE 2AK1L 2PTTA 2R0KL 4I18A 4PY8I 4U1NA 4JANA 5HVGB 1NEUA 4MAYA 3NABL 1SY6L 5JNYA 1MI5B 4Q0XH 3QUYA 2Q7YB 5H2BB 4JCMA 5GJTH 4MJ5B 2N56A 1BWMA 4PTTA 1DVFA 5F9JB 3F12A 3DYPA 5F7WC 3L3JA 5DRWA 2W9DH 2GQHA 1R3KA 2FZ3B 4X7SL 2X2YA 3KPNA 1J1OL 1YPZA 5E8PA 3QJFA 3BT2H 1XT5A 2IWGA 4JZJB 1MFAL 4AM0A 4M7LT 3QT2A 4RX4D 1ADQH 1VADB 1MJJA 4XRCB 5FCUH 1CYGA 1XGTB 3SDCC 2EEAA 1OAZH 1MJUH 4R4FH 3WMSA 1I7UB 3QSKB 2CDEB 1S9YB 2BXZA 1MUJA 1D6VL 5FO7A 2OMNA 1MIML 4NQXA 1PKQE 3DIFA 4N68A 1PAMA 3ARUA 3VRIB 1XR9B 4NIKB 1G7LA 2A83B 1I1YA 2VB5A 4Z6AT 1GAFL 2CQVA 4X80L 3MRMB 2BRQA 3HAEG 3PWPE 1F58L 3P0GB 1KCSH 1YECH 2H3NA 5FYJL 3RDTA 1HHGA 3BSZL 3CLEH 3T1WA 4Y4KB 3QIUD 2W60B 1MCWM 1LE9A 1YYLH 4Y8AA 5DA4A 1V7NH 4IEFB 1QR1A 5KSBF 1J0JA 4K7PH 5EOQH 3H3PH 4J12A 4U1JB 5BV7C 4BZYA 3RPIA 1TQCB 4XVSH 1I8KB 5E6ZA 5HI3D 5CSBA 1G9NH 3DRTA 1XIWB 4LSTL 1FL5B 2IQ9H 1OAXH 1WZKA 1BQLL 3MR9B 12E8L 4HIIB 1T03L 4K71B 2GTZA 2P48B 4AT6B 3IVKB 5E2WL 3VXUA 3MRGB 1IAIL 4HIHA 2MQ3A 4OV5A 4XHJD 1A9EB 1YY9C 1SMOA 3PHSA 1KELH 1CDUA 5IQ7L 4LSVH 2Y4SA 3DROA 4IM8A 4YE4L 1U93A 2OJEA 2V5SA 4Q6IA 3VGEA 1KXQE 2D0HA 4EXKA 2X4NB 1TJGL 5I71B 1INDH 1C16A 1W8OA 2Z31A 3AXLB 4Y5VA 5DTFA 3IDIA 3WXWL 3PJSA 3KPRE 4YDJB 2H2PD 4JY5H 3WHE1 3OKNB 3D3VE 3WO3B 4WW1B 1KLGB 4P5KA 5FKAA 1Y6NR 1QQDB 1DR9A 5GSRB 4AENB 2OR7A 2D3VA 3MOAH 2ITDA 4UAOC 3QIBA 2BVQA 4KKLC 1JYWA 1T3FA 3UJTL 1G6VK 3I6GA 3OL2A 4MB3A 5KSAC 3ULUL 4OZFA 4X0KB 1EPFA 3PNWA 1AY1H 1SYVB 3EO0B 4ONOA 3MRNA 3BO8B 1IKFL 4PRPE 4PRIB 1MY5A 4KRNA 4M1GH 3QG7L 4L5FL 3REWA 2JCCB 5ESQA 4NKMB 1NC4D 5DWUH 1VGKB 4PJBA 2FIKA 4RGNE 2JJUA 2FJHA 4XNMB 1LEGB 1NCNA 2FH8A 3SDAC 1R0AL 4MNQE 3HFML 2AJUL 3DPBA 1KB9K 2DI8A 3QDGE 5E8DH 2FL5A 3GSNL 3P73A 3I2CL 4HFUH 5DS8B 2AK4A 1JWSB 5EBWA 5L9DH 1WZLA 1S9VA 2WBWB 5EO1A 3OSKA 5CEZD 2EC9T 4FG6D 2XZQL 5M94B 3Q0HA 5JXEA 2XPGA 1A6ZB 4YBQC 4MA1B 4YZFE 3BISA 5JA8B 4XMLL 4PY8J 1XF2A 1T1YB 3STLB 5JW4R 2J6EL 2OL3B 1U3HC 5I75C 1DQJB 5ID1A 4X80H 1C1EL 1CL7I 1EAPA 4E9LA 4R8WL 2I25N 2CDFA 4H20H 1LD9A 2XNAB 2DJUA 1SY6A 2BVEA 5IFAL 3LKSB 4DK3A 2I9TA 1FLTX 2YA2A 2DIAA 2XYCA 4KZDL 1QFUH 2VERN 4G43B 5IGXL 4GG6A 5FXCH 1IKNC 3KPMA 4RNRA 3BKML 1CLOL 4NKDA 5I16B 2R0ZH 1IGTB 2KPNA 3MLPA 4Z78B 3RVWC 3TIEB 3GJEA 4WY7L 2MPAH 3GI9H 3BT2L 3CX2A 5EUKA 1OP5K 4L1DA 4LVNC 3GBMH 3UC0H 1GZQB 4NSKB 1T1WB 2NY3C 2X4UA 2XA8L 3C8HA 1U36A 2ARWA 1AXTL 1I3RB 2C5DC 1P9MC 4RGOH 5HYJD 5D1XB 3RWHB 5IFJB 4EIZC 1CE1L 2X42A 1MREH 2IALB 3TF7C 3D39B 4Q9BA 4ZTOH 1QSFA 4YHPB 2AVGA 1KCUH 2BJMH 5GGRA 1D6EB 4KV5E 1RJZB 3SCMD 3VXNB 5BS0D 3ZL4L 2QQKL 1SYSB 3TNNB 3WJJA 4JFEB 2H9GA 3T0EE 4XVJH 1IEAB 4AEEA 4DAGL 4GAGL 5DYOB 2JK5A 2AJVH 2DWDA 1D5BB 4GXVH 1PX3A 1TJIH 3OJ2C 3TBVB 1EH9A 3SHSA 4G6AD 4CADA 4PUBL 5JPNB 2IPUG 3ZHLA 2EIEA 4J4PC 5FGBA 1MFEH 5I76A 4L4VE 3VXPB 3QZWG 5HHNB 5EUOE 3GJFA 4EUPG 4H1LH 4IOFC 1CLZL 2FYYA 5E2WH 3RTQA 3MXWH 1F11A 2B1HL 4P46B 2D31A 5EU6D 1T7XA 2BSSB 4JY6A 3QYCA 3ZKNC 4HUVB 3C9NB 4MWFB 3ULVE 3KPSD 2DWEA 3EOBA 4NZRL 3MBEA 4PGCB 2V2WB 3KPTA 1GPOL 3RVXD 1MIEH 3M17B 4EI6B 4O51A 4C83A 4ORZC 1F3DJ 2NX5D 5AEAA 1NBQA 1PEWA 4HQQH 1QRNB 5EB9A 4B53A 1X6LA 3VWJD 1M6OB 2AQ3A 1AI1H 3HRZA 1RJLA 1WZMA 3S35X 3ZZ1A 3H7LA 5T1LA 3EYVB 3X3FL 1A4JB 4X6EB 4RQQA 4KK8C 1CGWA 4PRAB 3N50A 4WUUA 1QSZA 3NCEB 1J9CT 1L6ZA 4I1NB 1KOAA 1XGQA 4MJ6B 1IKFH 4OZGF 3P11H 1J1OH 3TA3A 1LO3L 5E94A 3V5KB 4N8CH 4JREB 4I0PC 1FAIH 3HRPA 4YWGH 1F02I 2VR4A 4PJ9C 4CBPA 2V9QA 3ET9F 2YBRA 1BM3H 3L3KB 3TYGH 4UT6L 4EN3A 4G6MH 1Y18A 1JK8A 4ZAKB 1OTTD 3MRGA 1JGEA 3L3GA 4RAVA 3W9EB 5F6IB 4Q9RH 5C0EA 2XACC 1C8PA 5C0GA 3U7WL 2HRPL 3WLWD 4I8DA 2QR0A 1W72L 5IMKA 1XGUA 1U93B 2OJEB 4ONGL 4OSUL 4JFFB 4Y5XA 4JO3H 3MFFB 4Y16A 3RJQB 4M6AA 1II4E 3QJHB 5HYSG 3QDMB 3B6SB 1FYTB 2YD6A 1JHKH 4TULL 5KVFL 5ELIA 3G6AA 3GBLA 3AVEA 4DW2L 4WI6A 1B0WA 1J8HA 2OL3H 1T20B 4FS0A 3MLRL 5E08H 4UTAH 3RZCC 1RUPL 2E7BA 3FQRB 1OAKH 4UU9B 1S9WA 1RUMH 4D9RE 4TNWK 2J88L 5FYLL 1WWBX 5D1ZD 4U6YB 4LPCA 1G9ML 3EYUH 1MFCL 1S7RA 1G7JB 2YD3A 4PR5B 3L3IA 5JHLH 3MLUL 2IH3B 3HR5B 4KROC 4GBXC 1YNLL 4RRPG 4HS8L 1BFOA 3CFJB 4MNHA 2BNUB 2DAVA 3GI9L 3BMVA 5HDOA 4NO0A 3ARBB 1Z9MA 5E1AA 1RZ7L 5LAXA 1ZKAA 1K2DB 2EEBA 2FX7L 3FAXA 4TRPH 1T1ZB 4RGMC 1F4XH 3MODL 4ONFH 2EXYC 1XF2B 4J3WA 5JOPE 5EFIB 5DJ0A 1FP5A 1LO5A 3WV0A 4E0RA 1JMZA 5FM5O 4OF5A 3UMTA 1TZGH 4N0RA 1HH9A 3R1GL 2J5LB 4BQ8A 1QFWL 1DLFH 4AQOA 1PG7H 1VCAA 3MRJA 3T0AA 4BH8A 3RX7A 3JXAA 4M6NH 4G8FA 4HH9A 3O2WH 1YEEL 3O6FC 2QADC 5IP4A 1CDCA 5E5UB 4ZD3L 1W0VA 4MAYB 4EBQL 4PJ8C 3AROA 3JBG7 4NRYB 4CJ1A 2VLRD 3NABH 4U1GC 4YO0B 1DUYA 2BMKB 1UEYA 3F65A 4FXKA 3VD3A 2MKWA 1FSKC 3MUJA 4R90L 1IJ9A 1QFWM 2H26B 1L7IL 4U33A 2DBLL 3S5LG 4FABL 5DK0B 2R2HA 1YEFL 4DKFH 5GRZA 1NGXB 1RULL 4KMQA 5GGRB 3T0VA 2ZWLT 1IGIL 5IJKA 3BDXA 4HQQL 2F54A 2XT1B 1H15A 1YMME 5EBLA 4F3FB 3GMRA 3CVHB 5T3ZE 2X70B 2Q6WB 1LO4H 1U2CA 4JRXD 2ICWB 5I1KH 5DFVD 1U8HB 3LMJH 4E41D 4ZODA 1YJDC 1AR1C 3SE3C 5GGQL 3V5DA 1H3GA 5FUCC 3MV9D 5T1KD 5CINL 2ARJA 2CDGB 5D96B 4XPHL 1MCOL 1O7SA 1G7PB 2CRYA 3VFSB 4WHCA 5EA0H 1YDPB 3E1F1 1JJUA 4XI5D 4CN6A 5CP7A 2W60A 3OX8B 4YHZH 1BVKB 3GGWA 4N0UB 2VDKL 4OLXL 1ORSB 5EG6C 2H32H 4I18B 4BYHA 2VZTA 3FO2B 4RIRB 5EZOH 2X4TA 3MOBH 3MLTB 1KIQB 1WISA 3EFFB 3W0WE 2R23B 3DVFA 1YPZE 3VXOA 4OZ4A 1MRCH 3MYJB 3PIQB 3LS4H 4HZAA 5K9OB 1IAOA 2DKMA 1NEZB 2R1YA 4Q6IB 3LKOB 5FO9A 4CVZA 2FEEL 3BJ91 3NZHH 4PJXF 1LE5B 1BOGA 5FHBL 2RHEA 2X6MA 4RDQF 3LH2L 3C08L 1I1AB 3QHFL 1A14H 4NO3B 4QRQA 5DJXA 5D72L 5IB2A 5JO5A 2H1PL 2B5IC 2AK1H 1JGLL 3KPOB 3LIZH 2EC9U 2NW2B 1U8KB 3PL6C 4OM0H 1DBJL 2FBJL 4JFOB 3AREB 2YZ1A 4K8RH 2XRAH 3P30H 3RZWA 1OAYH 2IMNA 2PYFA 1CXIA 2YHGA 1E6OL 2MQCA 5KS9F 1T0PB 4QY8B 3UTQB 4Z9KB 3PGDB 1CTOA 3IRPX 1GCFA 1G7LB 2A83A 5E00B 1BBJB 1MELA 3NCYP 4L4TA 3VGDA 1P53A 3JWDH 1U95A 5DRXB 1PD6A 4XNYH 3G04A 3QNZA 2ADIA 4F57L 1E4KC 4IDLA 2R69L 2VZUA 2QL1A 4YX2H 4K2UH 4PRIA 3CFCL 3HC3H 3VCLB 1BJ1J 2YA1A 5C0AB 3FOLB 3IJHA 3WFDL 5DJYB 1T6VN 5TQ2L 5KANI 4O2CB 5SX5H 3QPQC 3MLXL 5HGBB 1A7PH 5EORH 5LQBL 3U0WH 2YD1A 4NYLB 4QRRB 1FORL 1F4HA 5TJWK 2R0KH 1N64H 1UENA 3VI4F 5LGHH 1HI6B 3WFZA 1OTUD 1UKTA 3NN8B 3HHRB 5JOPD 3SGDH 2E27H 3W81A 3WXVL 5I1KL 1J86A 1QBLL 4QRRE 5I1IH 1SJEB 2NY1B 2EDXA 5DR5L 1A1MA 1I1FB 4Y88A 3QI9A 1XGRB 4LASL 2KKQA 3R06A 3FB6B 3O9WD 3OKEA 4EUPB 2P1YA 3MACL 4NHCH 3KPMB 4JDZB 3NH7L 4RNRB 5CWSA 3UYOD 4XNXH 5BO1L 1JGVL 2ESVE 5C2BL 4YQXL 5SX4H 4X9HA 2WUBL 1PX4A 2O5XH 4P9ML 4YBHA 1ZS8B 4RWHA 2QBWA 4R4NC 4LAQH 1FCGA 1G7MB 3ZT5A 3U0PB 3ZYJA 4QRPE 4DKDC 2F19H 4PREA 1IGIH 3PQYA 3BIBX 4Q74A 2A6DA 1TTUA 1AD9A 4KK8D 1XMWA 3HCVA 1B2WH 4Z7UB 4UT9L 4G6FB 4X7CC 2DQDH 1CQKA 1AQKH 3WIHA 1MPAH 5CD5D 4JN2A 1FG9C 1E28B 5BCAA 1AD0A 2IH1B 2LABA 3CX5J 1MCPH 4WFFE 5SWSD 2R29H 5F1NB 5HGDA 1Z0NA 4HKJA 5I73C 3X14B 1Z3GH 3ARDC 4KMTH 3H3PL 4PS4H 2X4PA 2AK4B 1BQHA 2PW1A 3ZDZE 5E8PB 2HH0H 4R96A 1UEMA 3EOYG 2EZ0D 5HVHC 2G9HB 2P5WB 1KB5H 5DRNB 4U1LA 3VI3E 1KGCD 2WINA 3ILQC 2VXSL 1ZA3A 4LQFH 3P0YL 4NT6B 3O8XB 3REVB 1YPZB 1WV7T 3KG5A 1MRFH 5B3JF 3I75B 3OKYA 4I3SH 3VWKB 1X5JA 1FO0A 3VXUD 3MGOB 3LN9A 2C3VB 25C8L 2Z35A 2X05A 5F8QC 4QHKJ 4XCCH 1JPSH 1DBBH 3U1SH 2JF1A 4UOW1 1INDL 4HIEA 1JVKA 4GG6B 3MUHL 2J8UE 3HUJF 2DN7A 3MRRA 4DGVL 2G5BA 4X7TB 1T7VA 4ETQA 1U8HA 2CGRL 2F54B 3DHJA 4OZIE 3QUZC 2F5AH 3E2HB 4Z7WA 3S3PA 5ALBL 4F3FA 1QLRA 2AEPL 2FDBP 5HDBF 3GSRB 3NFNB 1URLA 5F9DC 1RK1A 3IDYC 1DVFD 3MTRA 2AV7A 1UXWB 4JY4A 1YDPA 1FGVH 3O2VH 2FHFA 2YD4A 4P2QB 4U1MB 5D1XA 2PCPB 2GTZB 1V3MA 2VIRB 4Y1AB 3X3FH 4MA8H 3SKJL 5KAQG 2ARJB 1BJ8A 3QQ9D 4IS6A 4KK5D 4WEMB 1A8JH 4OD1L 4X6DA 1DN0A 4HS6A 1S7QB 4NQEB 4MJ6A 4WTWA 3RA7L 3H7BB 2O61A 1Z5LA 4J3OC 1N4XL 1JYNA 4P59H 1SJHB 4M7LL 3WHXA 2WM0A 1S5HA 1MI5E 3F58H 5F7EL 3VFNB 4UTBL 5SWZB 3ECBA 5D7LD 2X7LB 4HBQA 1EJOH 2DQEL 3FO1A 3ZDZF 5F70A 4XVUD 3RA7H 5HPOA 3MRIB 3BKCH 3MA7A 4WCYH 2DF3A 3VFOA 4AEHH 3BN9C 2EDDA 1ES0B 4XP4L 5KVMC 4ODSL 3DXAA 1FLRH 2XKNB 5C8JA 3L3KA 3IDGB 4Q9CA 1T5XA 5DO2D 1WIOA 4LMQI 1CBVH 4MZ2A 1JL8A 2GW5A 5CP3A 3SGEI 5EORL 5LQBH 2F19L 2YN5A 4AG4L 4OFKA 4ENED 5GJSH 4X4XA 3VH8A 1EHAA 1CD8A 4FMKA 4P2OB 4QHNB 3TV3L 1I7ZA 3FN9A 5SX5K 2BVQB 5HPMA 1VERA 4GRLC 5AYUH 4OIAA 5CZVL 1YMHA 1DTUA 3TN0D 4HKBA 2ITCA 4YPGA 5IEKA 1ORQB 4ZQKA 3UP1A 2W0FA 2QTEA 1GAFH 4YHZL 3RU8H 2IPKB 4TYUA 5ALCH 4HXAL 3MNWA 6FABH 4HW6A 1NDGA 1CR9H 1RUAH 1LMKA 5CJOL 2MQ0A 3OJDB 4HJJH 4L4JA 2NY7L 3P0VH 3LCYA 4PY7B 4Y4HD 2IAMA 3RY6A 4A6YH 3QIWD 2XN9A 3MV8E 5GPRA 1UWXK 4TPRL 3R8QA 3KXFA 1NBYA 3DHMA 4JY5L 3ARFC 4FTVA 2HFGL 3GUTB 1FL6A 3MJ7A 1PSKL 1TVBA 5I8EB 2FLBT 5C0DA 3TPUB 2EXWC 5E0QA 4GKSB 5DUBA 1GGCH 2PNDA 2GSIB 1MQ8A 5K9KB 1YMMB 5EIIB 2VABA 2ENYA 3FB8A 2VLJA 2AXFB 2NY5C 3AB0C 4YDVB 3P40A 5J4MA 1RAMA 4NJAH 4GXUN 5TF0A 3W5NA 1R24B 4PYHA 2KBGA 5E9DD 3GSWB 2CLRA 1GOGA 3SE9L 1XEDA 1Z9LA 1AGFA 2XWJB 4POUB 5HHVH 3C87A 5DMKA 3FB6A 1SHMA 5IJKC 4M02A 2P7TA 4PD4J 4F33B 1QG3A 1J1PL 1JPGA 4OBSA 1FYTE 3ILPA 3QDME 4JM2A 4UDUB 1XGRA 2ZUQC 3V6BR 4HK3N 4J3UA 2ZKHH 5ICYA 1EEZA 1BFVL 1KC5L 1P7QA 5CSGA 2NW3B 2YPKB 2HTKC 4EVNB 4Y4HC 5DZLA 5MP6H 4ZD3H 3QUXA 5IEHA 2B1HH 4AEIH 3RIAK 4J1UA 2HVJB 2X1OA 3SOBL 4LBEA 1TZHA 2Y5TB 3NFSL 2BVUA 5D1ZC 3B2UD 3TVMC 3G5YA 3BP5A 2PO6D 3FO0L 3LEYL 3U7WH 4ZS7H 1OCWL 1DBAH 1DUYB 3T2OA 4DGVH 5C09B 2C3HA 3RBGA 3SOBH 3GSQB 4HSQA 4I9WD 4X8JB 4FTVD 1QLEL 1IC7H 4FHBD 2F5AL 3MLYL 1HDMA 4F9PA 2Q20A 1G7HB 4LLDA 4NWUH 4PGZA 1AD9B 3I02A 1OVZA 1HZHH 1U41A 5DHVB 1CD0A 3HS0B 5JHDD 4WDIB 3EOAA 2VDNH 4W68A 1G0DA 4F2MA 5IBUB 4EKXA 1UA6H 4HIXH 5MEND 5CBEA 4NWUL 1CICC 3OZ9L 3ZKQD 2X4PB 1AGCB 1H3TA 4JKMA 4L3CB 4APQB 4NNXA 2COQA 5IMMB 4N8VG 2D31B 2EE9A 3QNXB 4EN3C 3KLAB 5IOPB 4UB0H 1MFCH 4JR9H 3RY4A 3VRJB 1F00I 2JB5H 3K74B 5EH1A 1WWWX 5MHSE 4AIXA 4H20L 3T2NL 3U2SB 1YNLH 4PP2A 2V7NA 2Y07L 5JUEH 5EWIH 2VLJD 3MV8B 4CGTA 4XBGB 5FHAL 3PWNA 2EDYA 3RL1A 1KPRA 3NCYS 5ECJE 3WN5A 3JV4A 2MHAA 2HRLA 3T3ME 5FEBA 4PLJD 2O5YH 2DQTL 4PJ8D 5C3LD 2VISB 1DQQB 1KJ2A 2YSSB 2FX7H 1I75A 5T3XE 1FO0H 2VAAB 4NRYA 4BFIA 4X6DE 1JHKL 5FYJE 2PO6A 2YMXH 3MMEA 4LSRH 3RWGA 5DDHA 3JTTA 4ZMAT 4QXTA 2UY7A 3GJFH 4PPTA 1J0IA 1S7UA 3DROB 3QUXC 2I07A 3V6OE 5GS1B 3QWRA 2VDRH 4K9EL 5ICZA 3RRQA 5DJ8B 1N0XH 4PRBA 3NFNA 3SDDB 3DWTA 3FT4B 3QBTB 5ICXA 3U36A 2AI0L 2DLFL 4NQDB 3O45A 1NMCB 3K4AA 3QISA 4H0GA 1VKXA 4OAWB 4NRZA 2VXSH 1B90A 3CH8A 3PWUB 2X4OA 4NN7C 3V7AE 3VFTB 4JJ5A 4P9HC 2NR6D 2VWEE 3LIZL 4OM0L 4OLZL 3SDDD 3RAJH 5CEYB 3JZ7A 3UPAA 1JNHA 1FFOA 1KTLA 4L9LB 4JCLA 4R7NA 2NW2A 4HWNA 4DAGH 1BZ9A 3GKWL 4HLZH 3EO0A 4DKAA 4FP8H 4DWHA 1HIMH 1S5HB 1AO7D 4LFHG 2FJHB 3W9EA 1IKNA 5SWZE 1P2CA 1EUTA 1LEKB 1S3KL 3MRBB 4R3SB 2MKLC 4UZGA 5CUSL 1RU9H 4L29A 1QSVA 4P0DA 3CCHA 1ZV5A 1GGBH 4M5YL 1NAKL 2AV1B 1MCIA 4U6HB 2R2CA 3GZKA 3O2DL 3HI5L 4I3RH 5GGVL 2RFXB 4Y1AE 3MV8D 4P2QE 5TGBA 4MA7H 4PP1C 1IC7L 1JFQL 2P47B 2NYYC 2G2RA 3GNML 1JZ2A 5EU4B 5E7FA 3S4SB 3TESA 5E99L 1MFDL 4FOMA 5J6HB 2ZG2A 4B5EA 1PW3A 3PIQA 2DLIA 4NC0B 1ED3B 2AJZB 5IEKB 1NUNB 5F96H 1MFNA 3PJSB 4U1HA 3V0VA 4XGZA 1R6VA 2F54E 5EUOB 3UPCA 5DQJA 4WTZG 1DEEB 1XCTB 1QD0A 1YY8B 3L5WA 2HN7A 4HKZB 4GG6E 1NBVL 1DBMH 3I6KA 1JTTA 4OLWH 1ZLVH 1F8TH 3U4BL 4EUPA 4R90H 1A7OH 1FL6B 5D93B 2HWZL 3BDBA 1ADQL 2RBLA 1SQ2N 3C09B 5GSVA 5CEZL 4L4TE 5CZXC 1I9IL 3CFKB 5IV2A 3UTPD 2VDPL 2VWEC 2OR9H 1NBYB 4XP6H 5E8DL 2JCCE 1MHHA 4LDLB 1FE8H 5B4MC 4H5SA 1NGPH 1BM3L 3LEXA 4M9OA 3QIUC 2E8ZA 2VAJA 3IFNH 1WBXA 4PJFE 5F1IB 5BZDA 1AGEB 4IRSA 4X6CF 4HWEL 1N59A 4JFZH 3TT3L 4G8GB 3IFOA 3BPOC 2KZWA 3VH8G 1NGPL 3MRQA 3DUSA 1G6RB 4JRWA 4LOUC 4GKZB 4Z8FL 3IXTA 1AGFB 2XWJA 4UU9A 1SYSA 3RL2B 3WIIL 1MCRA 3PP4L 5L0QB 4KI5D 2DJ4A 2P7TB 1MPAL 3SO3B 4F33A 3VXMB 2EDKA 1QSFB 4ODWA 4MLSA 1YNTA 3BZFB 1HYRC 3QDHA 2WWKO 4FA8A 4LQ1A 4UILL 3H9SB 1KPVB 1JN6A 4N0YH 4QRPB 1RZ7H 2VUOA 3EJJX 4G8IB 4O58L 5IWLA 2J12B 1B88A 2DQCH 3L5IA 3I6LD 2WINB 4DZBB 3FL7A 4BSJA 4L9DA 4IDJH 4LIQL 2NY5H 4D9LL 4D3CL 1F11B 4HK3J 2OTUA 1F4WL 3CD4A 5TDOA 1OP9A 3SDCA 2KQNA 1C12A 5IMOB 2ESVB 1QEWA 4N90D 4G43A 5E2TH 4K2UL 1S7WA 4KGJA 2XA8H 1A6TA 2X70A 2QSCL 4FNLH 3AC0A 4LP4A 1NGQL 2EC8A 4ZOCA 3RBSA 5DMJB 1IC4H 2D9CA 4D3CH 1CGSL 4XWGH 5CP3H 1GGBL 4JDZA 4HUUA 3NPSB 1G7IA 2CO7B 3S34H 3TGXA 3S36H 3WKNA 5CD5C 2AXJA 5I18H 3EOBB 3NIDF 4KY1H 4JFXB 3RP1A 3V5HA 4X9IA 3DURB 1WBZB 1F3JB 3G5XB 1KCRH 3DV6A 4EQ3A 1DQDH 5J13C 1WGOA 4DUWA 3KJ4C 4MAUL 4PV9A 1JZ4A 1A4JA 4X6EA 3P3YA 5MI0C 2DTMH 5IB1B 3MOQA 2EDLA 2PCPA 1A1NB 4XBGA 3K1KC 3WDHA 3I6LE 3RDTD 1GGIH 3KLAA 4N0UA 3TEUA 2E6QA 1DSFL 2WBKA 4Y4KD 3ZKMD 3VFPA 2ZUYA 1DBML 2DYPB 3BD5A 3RWIB 4EXPX 1GZPB 3MLTA 5C86A 4EI5C 1U8NB 1BD2D 4LGPB 3JSSA 1JV5A 2ZSWB 5SWQB 4E5XA 2GUOA 4HD9A 5FO7B 1ZGLA 4S1QH 2O61B 1UYWL 2G9HA 2IG2L 4QOKA 3LV3B 4BZ1L 4DOHE 5A2JH 3B8SA 1CL7L 4JHWL 1MFAH 5GS1A 4OJFL 3VFNA 4I48B 1E4XI 3C60A 5DURB 2BFVH 3AREA 5B8CB 2CRMA 2DMKA 5C0GB 3JTTB 3ELAT 2XWTA 1EAJA 2QHRH 5LBSL 2NXYD 1GIGH 5EUOF 4BZ2L 4Y16B 4O2FA 3SCMA 4OT1L 5CSZB 4LEXL 4M3JA 3N1GC 4U6VL 4M93B 2Q76A 3BPLB 3C2AH 4MYWB 3MJ8B 1NC2D 2OMBA 4Y1AD 2V2TB 2AXGB 2WLZA 3OKOA 1J0ZA 4UTAL 3X11B 3EDEA 3SDCD 2LE9A 2B0SH 3LQZA 5AD0B 1DE4A 3T2NH 3HMWH 3NTCH 2BOCB 5A2LH 1FYHB 4CL7A 3OWEA 4QTHB 5KS9B 4LNRB 2LQRA 5I6XB 1YEDB 4KI5F 4YAQB 4L9LA 5EOQL 5IWLC 4RQQB 1QRND 2ATPB 4MNGB 5GHWL 2W0FB 1UJTA 1W72A 3IF1A 3O0RL 5DJ6A 1AO7B 1VFUA 1EJ6A 4QCIB 3OKLB 3M1BA 3CU7A 5H35B 1FGNL 5F6HJ 5HHQB 1FFNB 1KEGL 3ZTJH 2Q8AL 4ODUA 1ZGLM 1IEBA 2JB6A 1KJ2L 3C5ZC 2B4CC 2VZOA 4YBLB 3MOBL 2IAMB 4LSPH 1ACYL 3NCFB 2OZ4A 3HPJA 2GSIA 2FBJH 3HI6H 2X40A 3TT1L 1KB5A 1JZ5A 4XPAH 4YDVA 5DUML 5DT1L 1YN6A 4C4KO 3BKYH 3MJ7B 5JO5B 4XGZB 5DJ0B 2IGFH 5EO9B 5IROC 3BP4A 5E6YA 3U4AA 4ZO6A 4G6KH 4OLVL 4PJHF 2P5ED 4N8VB 1VPOL 5JORA 1FFPB 4LLYA 1OSZB 1N5AA 4HWBL 1MCBA 4L8SC 1SY6H 1EMTL 2A1WH 1ZT7A 2K7QA 3LN4A 2FSEB 3RIFF 2MFNA 1K9TA 4KUZL 5D70H 5DEFA 1P7QB 4F7CB 4OM1L 3BVNA 4J4PD 3SDXB 3BH9A 4Y5YA 1FBIL 3U4EB 4O2EB 3FQRA 4QO1A 1H5BB 3CVIL 4KRPC 4WUKL 5AZ2H 2O5ZL 4YPGB 2P24B 3O3EA 4MB5A 1G7MA 1GC1H 1NC4A 3MJ9A 4YR6B 9CGTA 1U8PB 2BSRA 4NHUB 4WTXA 2R1XA 2PR4L 3LAFA 4MCYA 5D8JL 1FNLA 4WJ5B 3WFCH 4Y0GA 1RJCA 3B5GA 1T21A 3NIGF 3MO1A 5F97E 2X4QB 1KTKE 3CFEB 3DMMB 3KPPB 2RJMA 3QRGL 3BP5B 3Q5YA 4XXCA 1KENH 1QLFB 4JQVA 3S4SG 3CNKA 2DTSA 1FGVL 3O2VL 1Y6KR 3O9WB 1QKZH 1RZJL 5HXMA 3GUTA 2I9TB 3ULUF 1GIGL 4Q0XL 3CZFB 4POYA 1MQKH 3LD8B 3KPLB 1GHFL 3GSXA 4CU8A 3GB7B 4QTIL 1JGVH 5C2BH 4N8CL 3RKDC 4UT7H 3I75A 3GO1L 3HAEA 3MLSL 3BPCA 3BPNB 4WFEE 5IMLA 2DI7A 4YK4B 3TBYA 3LRSA 3ROOB 4I13B 3ZMRA 3F5WB 4OF7A 5DF0A 5FGRA 4I0PD 4IRJB 2VDLH 4MQ7B 1BZQK 3BIKA 4R7DB 5HYQB 2X41A 4MD0A 1YPZF 3CAFA 3VWJB 3EFFA 4RFOL 2C3WA 4L3ED 1T7ZA 4P4KB 1JPGB 1MH5A 1OPGH 4XX1G 2Y07H 3O6FD 4UDUA 5E2VL 1HH6A 2HJKA 3V5HB 4DKEH 4WFHE 5L2KD 3DYOA 3S35L 2FO4A 3FO2A 4X7TA 4CW1A 5DEGB 1HINL 2HTLD 2NY2C 2OZ4H 3HZMA 3O4LD 4RFOH 2PN5A 1QBMH 3F7YA 1T5WA 4GAYB 5I1JL 4RFNB 4F37K 5KJRL 2VLRB 3NFPA 5INDB 2HH0L 2X1PA 4YHYB 5K59F 1KULA 5IB1A 5DJXB 3TN0A 1M1SA 2CLVB 4PJXA 1BOGB 3ZKXB 4WFED 5EU7E 2ZNWA 4QXTB 4GUPA 4A6YA 3KPRA 1RIVH 1AQKL 4U1LB 3TFKD 5CS7A 1ZEAL 4QRQB 3SGDI 2OQJB 1ETZA 1D7FA 3C6SA 2A9NH 3QXDB 1RZFH 2OK0H 4W4OC 2I9LA 5HHNA 4F15C 1EHLH 4WW2C 2AJVL 4BELD 1FIGH 4OGYH 2F74B 3BH8A 4CN1A 4ZNCD 1IGJA 2BSSA 1R3HB 5BRZA 4QHUB 1KCVL 4X7FC 2FGWL 1PQZB 2HFEA 1FVDB 1PSKH 3MRCB 2P44B 3HI1B 3GEWB 4R3SA 3KPQA 3FQXB 3MREB 1G6RH 2GFBB 2ADIB 2H45A 2VXVH 1AQDA 1PKOA 4NJAL 4JZNA 1LEIB 3SCMC 3QEQE 3L95A 4X4XB 3AAZB 3VG9B 3VH8B 3CSBA 3UTZB 1DUZA 1U0QA 5ERWA 1VFBA 1EK3A 1CCZA 4JQXC 3UTSB 5IM7B 4YFLF 4U7MA 2A0LD 4LKCA 2NLJA 3QXVA 3UTTD 2P49B 3ARZA 1MCDA 1A0QL 2J8OA 4ZNEA 5E24E 5JQ6L 5FYKH 1FVCB 1TIUA 3SDXF 4Y4KA 4HS6B 1IGFL 3FFCB 4JDVB 3CLFH 3E6FA 3S4SA 3D39D 4FFYH 4FTVB 3VD4A 1HK6A 2ZOLA 1U91B 3RIFK 4YNYB 2GHWB 2GEEA 4YXKL 2APTA 2PTUA 4XNYL 4OIBA 3GIVA 2A74A 4Z76B 2Q3ZA 3R06B 3IDJA 3ALXA 3T8XB 4KK9C 3ARFA 5HDQH 2HKHL 3MV01 3VD5A 2QEJA 2EDQA 3DRQB 3CFKA 3BHBB 3M1BB 2MWCA 1X7QA 3P4NB 1N5YL 3WFDH 4ZFOA 1KCKA 4BQ9A 5C0JB 3K4ZA 3CVHH 1D9KA 5LBSH 1A9EA 3JUZA 2VRAA 4KC3B 3WDJA 3K8LA 3RVVC 4P3CL 2A6KB 1U8JB 3MRKB 1QRKA 2E9IA 1T20A 3FZUC 3C5SA 4JM2B 2C3XA 4DCQA 2V5MA 1K3IA 4ODSH 4LARH 3CVHL 3WUWG 2VXQH 5DVOA 1NCUA 3QDJE 3RVUC 3DUSB 3ZL4H 5B38G 1EVTC 3FN3A 1KIUA 3DUHA 1S7SB 4OIIL 4ZFFB 3FO9A 1XF3B 5KVEL 3OJMB 2VKXA 4GAGH 1K8IA 3V7AG 3HNSL 4LCIL 5JR1H 1T03H 2ADFL 1S5IH 1H5BA 2QV2A 3LB6C 1RUQL 4YDIL 5EUKB 3V0AC 3WFEH 3R0NA 15C8L 1JN6B 1UWGH 5FM4A 4GSDH 4YR6A 5KBNC 5E6ID 4K7PY 5JIPA 3EYUL 3QWOA 1I3RA 5D9SB 4NCC1 3WIFA 4GMTH 4HJ0D 1NSNH 1KPVA 3F7QA 2AJSH 4H88L 3I9GH 5GXBB 4P46D 1OPGL 4XNUH 5CJOH 2BXYA 1AJ7H 4FZEH 4RX4A 1VDGA 5C0DB 5MENE 1R3LA 2XI9A 1FNHA 5J1AA 1T1XA 5F21B 2Z92A 2Z31C 1FV1B 3TO4C 5FUCE 2HG5A 5I9QB 4ZDHA 5ID0A 4PJCE 4WJ5A 1W2KT 1IRAY 2ZOKA 5JOFB 1I8LA 3BP7B 2VXVL 3JV6B 4JZJA 4TPRH 4PRDB 1RURH 2X1QA 3SDCB 2VC2H 1IARB 4NN5B 4RDQG 4OLYL 3DO3A 5I8OL 3QFJE 3GKZA 2XOTA 1CGSH 2PUQT 4FQXB 3EZJB 4WO4D 1VPOH 1IZKA 3ZTJG 5D5MA 1XGTA 1RJZA 2ZKHL 5C7XH 1RY7B 5I18L 1KXVC 3E8UH 5I1GH 3O4LE 1Z3GL 3ZE2F 3ZT6A 3BP6A 3Q6GL 3AUVA 1K6QL 3ZSSA 2XTJE 4RMUA 1P5UA 1NCCL 3JWDL 4LLWB 1KFAH 5L88H 4P2RE 2DQHL 1HSBA 1X5XA 3GFUA 3E8UL 3HE6A 4ORGA 1UH4A 4MX7A 3QDGB 3QUYC 4HGWB 5HYJB 2YEZA 3IXTB 2FB4H 3ARBD 2YS4A 2R9HC 4GQPH 1L9MA 2OBGA 1XIWC 1UACL 4HCRL 1OP3K 5CUSH 1WWAX 4M7LH 5DSCB 3IS0X 3DI2B 3UTTA 4LSSH 3QDGD 1N0LA 4UIKH 3QIBD 3H2WA 5ENWB 2VDML 4P2CG 3SQOL 5JLZA 2X9YA 1UWEH 4CW1B 4AEHL 3TYFA 5LGHL 4PD4K 1MJUL 3PQYD 4DZBA 1TENA 1C5BH 3C60B 2LFGA 5CAYB 3WXVH 5E4IA 4L8BA 1H0DB 1T89C 3FONB 4ZS7L 5GRWA 5IB5B 5I71C 3TZVC 3QXTA 4I77L 4MJ2A 4TUKH 3R0MA 1MHPL 2WBJD 4UOJA 1MJJB 4XRCA 3QCUH 2FX8H 4OZFG 1D6EA 2BY1A 3QQ3B 4NKIL 1PG7X 5FYKL 2JIXB 1HHIB 2YRZA 1CFSB 5KVDH 1L4IA 4DN3H 3KPRB 3SKJH 1OQXA 4E41A 4OB5L 5F1OB 3MRBA 4GQ9L 1JNHB 1LEKA 2HTKD 5MEPB 3IJSA 4KDTC 4S1RL 2AS5M 4MXVF 1CDYA 4XX1E 3GSRA 4X4YA 2W65A 2VL5B 1Q1JH 3NCJH 4XP9L 1KN4L 3C6LB 4LRNL 7FABL 4NBXB 3GBNH 2F54D 1MCOH 3V4PL 1CT8A 3WN5B 5IMKB 3HC4L 1XGPB 2AQ2A 1TCRA 1OAQL 3UROR 3CMGA 2AKRB 4GQ9H 3FOMB 1MAML 5IW6A 2EDEA 1NL0L 1K4CB 4W81A 2ARJQ 3MRDA 1S7QA 3G5ZB 3GMLB 4JB9H 5FUZL 4NNPH 3UTZA 1PVHA 3O0RH 3FAWA 1ERNA 3SDAB 2VLME 5FYLE 4JQXA 5J6HA 1CTNA 3G08B 5T5NG 5I15H 4NBYB 3HC0B 3UTPE 2R2EB 5L8KB 1A47A 1W0YT 4U49A 2Z8WC 5FK9A 4PIRF 3S34L 4RCAA 3L7EB 4OCSL 2C4FT 3VD7A 3FO1B 2QQNH 4LF3A 5T3ZH 4J8RA 5D7JD 1YY8A 4AMKH 1TVHB 1QSEE 4PRHA 3T1FA 1S7VA 3PWPB 5CJ8A 1RJYA 1ZEAH 4MAUH 3A6OA 2IFGA 4MVBC 4G6FD 3IETA 1TPXC 4KJYA 1IGMH 5GZND 5I1LB 1A6ZA 4QKXB 5I75B 1LK3L 4LGRB 1S9XA 3MV7A 3VFVB 4IMLB 5IESL 2B8OT 3NA9L 1TDQA 3QUML 1BZ9B 5ID1B 2FLRT 4JRXB 4NZRH 3MRPB 1UKQA 3UDWC 4XCYA 2C1PA 3RGVD 4C58B 5C0AA 4NQVB 3QUZA 5D7LB 1ZHBA 1LNUA 1XR8B 2O93L 2NCMA 1WT5A 1AH1A 1WF5A 4U7SA 1JRHI 1JGEB 1YC7A 3L3GB 3ZDXE 4BZ1H 4N0CD 3UTOA 1NKOA 2VXTH 4LLVA 3BGFB 4UDTA 5E99H 3VDBA 4KV5F 5HHME 4FQ1H 5FCSH 1KJ3H 3MZGB 1TQBC