5T3ZH

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
235
structure length
230
Chain Sequence
QVQLQESGPGLVKPSETLSVTCSVSGDSMNNYYWTWIRQSPGKGLEWIGYISDRESATYNPSLNSRVVISRDTSKNQLSLKLNSVTPADTAVYYCATARRGQRIYGVVSFGEFFYYYSMDVWGKGTTVTVSSASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Envelope glycoprotein gp160
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 31
structure length 230
sequence length 235
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zH02
2FBJH 4OGXH 3FQWB 4J1UA 4PJDE 3VWJD 3IFNL 4XVUD 1P7KA 1RJYB 2JCCF 3ARGB 1OWRM 4KJWC 2XICA 3F5WB 2W38A 1EVUA 3D25A 3BGMB 1D6VL 1NKOA 3PJSB 1FPTH 3N85H 5IW3A 3MRLA 4NZTH 4DZ8A 2P44B 3AXLB 3TV3H 3SE9L 2F53B 4K94C 5EBWB 5GRYA 3BJ91 1T1WB 4PY7A 1EIBA 4ZFGH 3EYQC 1J10A 4JFQA 4JFEB 1U91A 5E03A 5A16B 2A6KA 5BQ7A 3LMJL 1I3RA 4Y88A 1B0GB 3EAKA 1G7MA 4U6VL 3IDYC 4MA7H 4XCCH 2BDNL 3RI5F 3SGKC 4FZEH 2A77H 1F3DJ 4CADA 4WDIB 3W9DA 5BMFL 3ULVH 4MCZB 5T5NG 4M7JL 3RWJB 2XKSA 3WCYA 3MA9L 3M17B 1BVKB 4MAYA 3QYCA 4MA8H 5CBEA 4N8VB 3PWNB 5CBAA 2BSTB 5FV2A 3LCYA 4Y4HA 5F8RC 2BRRH 2NZ9D 1HHJB 5JXAH 1HIMH 1C7TA 5I17B 4PGEB 3SPVB 5E70A 2RB8A 1LNUA 1LO2H 4L8DA 4MDJA 3RZCD 5D70L 2BOBB 4LLYA 4E9LA 1JTTA 3ZSSA 5DYOB 2CR6A 3WN5A 4CN1A 3IFLH 4NO0B 1MIMH 4PRNA 2GK2A 2I9TB 4JLRB 1E4JA 4HBCL 3MLTB 4P46B 1XGUA 4HV8B 4PGDB 5DS8A 2YA1A 3DVFA 5IQ7H 1A6TA 1H0DB 5BXFA 3JUZA 2FJGA 4JRXD 4P2YA 2OTWA 3IXAB 2V5YA 4G42B 1KSRA 4YEEA 1ED3B 3ROOB 1RZGA 1MJ7H 1L9NA 1JFQL 2Y7QA 2WLYA 2OXHA 3PHOB 1LO4L 5CSZB 4YHOL 1UJ3B 4BZ2H 4PV8A 1OSZB 4LGRB 1JI1A 3LS5H 4LSQL 2YC1A 1CDIA 1DUYB 3A6BL 2L7UA 4OLYH 3PWLB 3RX7A 5T3ZL 5HGDA 2IALA 1WEJL 2P5EA 1WT5C 4PV9B 2AJVL 4ZUWA 2FJFA 1EUUA 4ZNEA 5ALCL 1M1SA 2NY2D 1PQZA 4ZPTA 1QA9B 4JG0L 3O4LD 1DLFL 4RGNC 2V5TA 1IM3B 5LGHL 4R0LC 2WP3T 5JOPE 1IFHH 1BREA 4JB9L 5DZLA 1WAAF 1FVDB 3LQAC 2L7JA 3BT2H 3IDJA 4M6OL 3DBXA 3V0WL 3MGTA 4OQTA 4UAOC 3EYUH 4MB5A 4ZOAA 1BIHA 3FQTA 5L8LB 2VXSL 3S5LB 4M3KB 3UAJD 4URTB 3TPUA 5IW1B 2NY4D 4Q0XL 1NCAH 3X12B 3CDFA 3CX5J 2R69H 3BESR 1IC7L 5JHDE 3P30H 3QDMB 4KROC 5GRJH 3ABZA 5DEFA 3TYGL 1NMCC 2WAHA 2UZIH 1T83A 5DXWA 2W9DH 3NIGE 4DVRH 2BSRA 2JE8A 2ZG3A 3MACL 4MDIB 1K8DA 1MH5B 4UTBL 1Z0NA 5B38A 2IFGA 3CSGA 4P2OD 5JNYA 3BVNB 2AEIT 4RSVA 5DJ0B 4C59B 5T1DL 2GYSA 4MXWL 1DQDH 1S78D 1I1FA 5EBMB 3QUKB 4RMSA 1KIUA 5ITBL 3WE6A 4G8FA 3T0EE 3O3AB 2R15A 5JOFA 1YYLH 4JKPH 5J3HC 1J1OH 4IOIB 3L3DA 4ZS6D 4M1GL 5DGQA 3V4PH 1P6AB 3DV6B 3QUZA 4UV4L 3FZUD 2OZ4A 1LO5B 4DKEH 4JAMB 1ZT7B 4QTHA 3GB7B 1QACA 2KL6A 1TTFA 3VGHA 1MCEA 5E4IA 4PJFA 3PHQB 4WFHD 1CIDA 5I1DA 1LVEA 1L9MA 5DVMA 5FYJL 2XWTB 1N3NA 1U8HA 2HMIC 2OK0L 3TJEH 1KNOB 4JRXA 2ZNXA 3F7YA 5D1QB 4Y19D 3VFOA 1G7PA 2AJUL 4NQED 2P43B 1C8PA 1ETZB 5JMOC 4U1GC 3VXUD 3C6LD 3CGTA 2QQNH 1PGRB 1DQTA 1A7OH 4X80L 3KYOA 4HGWA 1GAFL 3VDAA 3DMMB 5DRXB 5EBLA 2XZAH 1IAKB 4KKAC 2X5PA 2H6PB 3T8XA 2OTPA 2OBGA 5FO7B 4WEBH 1QBBA 2PCPB 2K9UA 4J12A 5E6IB 5K9JH 4NQDB 1CTNA 1MCLA 2WW8A 3HFMH 5C0AE 2FX9H 5DRZA 3RDTC 4GKOA 5F1IA 2JCCA 5GJSH 3O4LA 2AXFA 4J4PD 4G8GD 4ZO7A 4LLQB 4QT5A 2YD9A 2AK4B 1J05B 3QXAB 4IMKA 3MBEB 5IOPA 2HT2D 4U49A 3RX8A 3ZKMD 4GW5B 2CDGA 4B50A 2A6JA 2WBKA 3OR6A 1OWWA 5CILH 4NZRH 4ODHL 3DV4A 3ROLA 4HUWA 1I7UA 4R9HA 5CIPH 5F7MC 2FH8A 5B8CA 4PD4K 1AXSA 4LVNB 1JF6A 4FQXB 3O2WL 5CIPA 5I1GL 4G6AD 3D18A 1PZUB 4AT6B 3D5OF 1HQ4B 1KLUB 4Q6IB 5KSVB 1L0XA 2OP4H 2I5YH 4IRZL 1IMHC 2DLFL 3UYRL 1E6JH 3EOTL 4KGJA 1QSFE 3OAUL 1ACYH 3T4AB 2BJMH 4QXGH 4LGSB 4UU9B 1CG9A 4I3SL 3EJYC 3HZYA 5E2WL 3UZEA 2NY6C 2XWBA 2EDXA 4NRYA 4QOKE 4ZFZA 4TVSa 5EIQA 3BPNB 4LHQB 1MF2L 3ILPA 3U79A 1ONQA 1INEL 2IBZX 2MPAL 4ZSOA 1SEQL 1NGZA 3FT4A 2D3VA 2E27H 1NEZA 4FXGB 3RZWA 2PR4L 4LOUD 5IESL 4I0PB 3GHBH 1P7QD 3TYFA 3MLWH 4LIQH 1XT5A 4NKIL 5F70A 3L5WB 1MUJA 4HKXA 5DRWB 3OPZL 1GZPB 2IFFH 3NFSL 2B4CL 3ULUF 1EEYB 1TTGA 1LP9B 3B9EA 4JJHA 4HIXH 3IU4H 3NPSC 3RVTC 1NL0L 2I07B 4QHLA 4N1HB 3LEXA 1IGTB 5EU3A 2ZG1A 4Y19A 4KTEH 3C5ZB 1S5IL 1G7JA 1G6RH 4KI1A 3VXUA 3GMNB 5I1CL 3C6LA 1TVHB 4NO2B 1KN4L 4PR5B 1O5DT 1CFSB 3I6LD 5ICZB 3ARPA 4P2RE 4DKAA 3FHQA 1QNZH 1UM6L 3QUYC 1VEMA 5AAWA 4LLVB 3IT8D 4ZUUB 1SJEB 3QDGD 2X6MA 1AP2B 3DUUA 5J06A 1BOGA 1EERB 3RWEA 3E1F1 2J6EL 2VUOA 1MFAL 4YHLL 4TOYL 1JHLH 2FYYA 5BZWA 3W82A 3ZYZA 3CUPB 5CEXA 5IVXE 5E94A 3HMWH 4MJ4A 4HJ0D 4PJIE 3LRSB 1I85A 1KB5L 3DYPA 3TBSB 4TNWF 2P7TB 2MNUA 1WAAA 1FP5A 5TPWL 2D2OA 3QIUC 3QUMA 1J5OL 3UJTH 4LCIH 1I3VA 4QRRD 4V1DA 3TO4D 1T2XA 3SKNB 3IETB 1TDQA 3U36A 3E3QE 4KVCL 3CXDL 3ZTNL 4R2GB 1B6UA 1RI8A 4JM4L 1NAKH 3BP4B 1A1MA 1UQSB 5I8CA 4U1JB 5ETUA 5JHLH 4FABH 4JKKA 5I73C 4UDUA 1YDPA 2PYFA 3PL6A 2AEPL 5J11B 5KOVC 3HPJB 3SO5A 3O3UN 1U8OB 4Y2OA 3U30C 1FGVH 5CAYB 4G9DB 4Y4KC 1AQKL 3ALPA 3J8F7 2XZCL 4I2XE 5HVFB 1QSEE 4JKMA 4QEGA 4WUUA 1MCSA 4RCAA 2W91A 3D39D 3QQNA 4FQ2H 4EIGB 4YAQA 3IU3B 4UILL 5BS0D 5DJDB 3EHBD 2VZUA 5EWIH 1QD0A 2W0KA 1ZE3C 2XA8L 4LCYB 4L8CA 2OI9B 1JGLH 5E6ZA 1UH3A 1JF1A 4HUUA 1IAII 1JRHL 2LVCA 5LXGL 3IRZA 1DQLH 2X10A 4XNMA 5EULV 4BZ1L 3O0RL 5DHVH 2AQ2A 3Q3GA 1Q94A 3DLQR 5FGBC 4P5TB 1P7QA 4PGCA 1T20B 4YEFA 4P2QB 5DHVA 3ULUD 4HS6B 2CLZB 3BH9A 3BD3A 1T1YA 3B9KB 1IC4L 3MRIA 4LVHB 1T0NA 1T04A 2BMKA 3P4MA 5EO0A 1HYSC 2BC4B 1FO0H 3GMQB 1IKNC 4O5LL 3MRCA 3KXFD 1X6NA 2FNBA 4F9LA 4OLVH 2EXYD 1R3IL 3CIQA 5IB3B 4X8JA 3VI4F 1DL7H 1B90A 3L3OA 2IAMA 1XF2B 4QF1B 4PJ7E 4JQVC 2CSPA 5LGJA 3AMLA 4PRHE 5F3BB 4PJGB 3S88H 1KELH 2ICWJ 3O3DA 4L5FL 1CICB 3BQUC 3V6OA 3U0TA 2ZJSH 4UI2A 2X40A 3GJFK 3WNPA 4UIMB 1I8MA 4HMCA 3G5XB 2ENYA 5H37G 3H0TA 4P23C 2EYSA 1NDGB 2P5WE 2YUWA 4Q9QH 4GKSB 3OZ9H 1LK2B 4KK9C 4AENB 4HJJL 2O5ZL 3DSFH 1PDKA 4TNVK 4R8WL 4LDLB 3OXRB 4H0GA 2X1XR 3JV0A 3TO4A 2F54A 1OLLA 3VXRB 3HS0A 1JNLL 4RFNC 5DD0L 1GGCL 1HINL 4XXDA 1CF8H 1XCQA 3WFZA 3BKML 5CJXA 1A21A 4MNHA 1OAXL 4XVJL 1UB5A 3RWIB 2YKLL 3LOWA 5LCVH 3KWWA 5B39B 5F7HA 3MRJA 5HJ3B 3GM8A 1NFDE 3G6JB 3KDMA 4IRSB 4JFPA 2E7HA 4MQXD 3C60A 3VG0H 1TVBA 1FZKB 3PGFH 3LQZA 4Z9KB 3BDXA 4DZBA 3UC0L 1KJ2H 1MLBB 4OGXL 1YN6A 3D39A 1J8HE 3DXAB 4Z95H 4GXUM 1F13A 5ESVA 4H5SB 3O9WB 5IHBA 3RNQB 4JY6B 3IB4A 5E2JA 3OB0K 5GRXG 1ZGLA 1AXIB 4ONFH 5INCB 4ZFFB 2ZUUA 1ZLVK 1OL0A 1IZJA 4UIKH 1FPTL 3LV3A 3TCLA 2YUXA 1N5AB 1I7ZA 3KPRE 1T2JA 1A7BA 3JXAA 3N1QC 5IIEA 5DURB 4QGTA 1WWCA 4ZFGL 1RUKL 2A0LC 5E8DL 4MJ6A 4D3CL 1CLOH 4GG6E 2AKRB 1OT1A 1XGTA 1D5MB 3F6LA 3EUUA 1NLBH 5IMLB 4DK6A 3BKCH 3ES6A 3TEUA 1TJIH 5F1OB 4TTGA 1H5BC 3PQYE 4FZEL 2FLBT 2UYLB 1QLFA 3KXFA 2GJ6B 4ZFOB 1FE8L 1LHZA 3S96A 3U4BL 2ADFL 3T09A 4FTVE 5T3ZE 4F7MA 1BVZA 3QO1A 3L3HA 2ZKHL 3JWOH 1MJJA 5HDOA 4ZUVA 1YPZF 5GGUA 5JXAL 1U8IA 3GJFH 2CRYA 3QNZA 4S1QL 1LO2L 4Z78A 2FECI 1UH4A 4XVSH 2F9BT 4Y4FD 5INDA 3RGVD 1A3LH 1T03H 1KENL 3SE8H 4I3RH 3U9PH 1WTLA 1BF2A 2O5YL 4NRXB 3N1GC 4L8SA 4PRAA 3WUWA 3RL1B 1MIML 2X4PA 4JFHD 1CFNB 4QRUA 1I9EA 3W39A 3D2UD 2A74B 5ID1B 1YEFH 5LGKA 1QSZA 3JTSB 1INDH 3JWDL 2FIKB 4XWOC 5CINH 1YNTB 4FRWA 2GCYB 4PJ8D 2A9MH 3DURA 4C57C 3LPFA 2BVPB 3WBDA 5I19H 1K4CA 3IDYB 4DGYH 1VGEH 4P4KC 1NMBL 4XB8A 3D3VB 2J2ZA 5C3TA 1FNGB 1PD6A 1X5IA 1Q72L 2HN7A 1KCUH 3ZDZE 3C08L 1FL5B 4NO3A 4OLYL 5H8DA 4W6YB 2DBLH 4RX4D 5T1LB 2I60H 1OQOA 2KDGA 2AEQH 3QWOB 4H20H 3VXTA 5D71H 4U31A 1MRFH 3RWDA 5E1AB 5D7SH 4IRJC 2VLJB 3CLEH 1ZLVH 3L7EB 5IR1A 3QFJD 3FHAA 3IKCA 1VCAA 3P9MA 3AAZA 2VRAA 4OQTL 3IS1X 2X4OA 3U0PA 2MTPA 4RQQB 3DYMA 3C9NB 1HSBA 3Q2CA 2ICWB 3S3SA 2DMBA 2LTQC 4XPHL 4U1IA 1OCWL 4C56A 1BM3H 3EYUL 4LKXB 1OAQL 2D9CA 3NN8A 4W81A 3TNMB 4U3CA 4C55A 2HLAA 2ZP0T 3S37X 4ZAKC 2R69L 3MQIA 1HE7A 3MO1B 3P30L 3OBAA 5GRJL 4U2ZA 2UZIL 5IQ9B 4FA8A 1CTOA 5ITFA 2W9DL 4AEEA 5BCAA 5I1KL 4LP4A 3GSRB 1D5BA 1RZJC 3U2SB 4EXKA 3BUTA 3ULSB 2IGFH 1QVOA 3RUGB 4CN4A 5C6WH 1DQDL 4Q6YA 1MHCB 2E6QA 4CJ0A 5T1KB 5T3XE 3GBNL 2DRUA 2CUMA 1ZLSH 5C09B 2OZ4L 4HCRH 4JKPL 5C1MB 4OCXH 1BZ9B 2HFGL 1QFUH 3S36L 1NJ9B 4HCRA 5JIHA 4DKEL 4HK0A 4KY1L 4RGNB 1HHIA 4WNQB 4Y8AA 3D69B 3SDAD 1YMMD 4R0LB 1Q9KA 4RWHA 3RKPA 4EIZC 1DQQB 5C0CE 5SWQA 5I66A 3ARED 3UTZB 5JPMB 4QXTB 4UAOB 4MZ3A 3MODL 1B2WH 5J1SC 2ZOKB 2GTZB 5GGVL 3SGDH 2CKBB 1VENA 1KJVA 4TVPH 2YZ1A 4ONHA 2DJ4A 4Q97A 3DNKA 1LO0L 1OGTA 1M7DA 1A7OL 4KROB 3NABL 5D2LF 1NMCB 2PTUA 3OG4B 3OKLA 5SV3A 2DKSA 1AR1C 1NDMB 2VDRH 1ZT1B 2J5LC 3BE1L 3QCUL 2X4RB 5E7FA 4RX4A 2AV1B 3S37L 4U1HB 4GRLD 4WEBL 1J0ZA 5J0BA 5I30H 3MV8E 1UWXK 2LAAA 2IF7A 3GIZL 1HK6A 1J0HA 1RZIB 2VL5A 5ISZA 2EKJA 3QFJA 3QZWG 1ZMYA 2CPCA 1MCDA 3K8MA 1PVHA 3FQUB 2XWJA 2FEDC 4IHOB 4NYLA 8FABA 3P2TA 2FGZA 4KUCF 4NJ9H 4HC1H 2ARJA 2HJLA 2WK2A 4K9EL 4CW1A 3LAFA 3A6OA 4GAYA 1QRNE 4C54A 3V6ZA 4N0RA 5D8JL 4LPTA 3EOYG 1IJ9A 2VQUA 3HMXH 3MNVA 2ZOLA 2IPKA 4XCYB 4XBPB 3EOBA 5T5FL 5JUEH 4IMLA 4XWGH 5D7JC 3BW9B 4U1GB 4GKNA 1MHHA 3NOIA 4PPTA 2JJWA 2GT9A 1M05B 1E6JL 3OB8A 4DEPC 5DJYA 3D9AH 5GGQL 5F9AC 2O5XL 4HWUA 1ACYL 4QXGL 3VE0B 2UZYB 1FFPA 4X6EA 1YPZA 4X7EC 5J6GA 2A83A 5F1NA 4S0TD 1T6WA 1U3HA 5KSAB 4UDTB 4QRQA 3QG7H 4HLJA 3VXQA 2HLFD 2QL1A 4DK3A 4BM7A 4OIBA 1ZWIB 1MFBH 1TXKA 3IDGB 1X5YA 3NFNB 5TDPB 3HE7C 3RDTB 1YEGH 2NY3C 2QSVA 3MRHB 4XPBH 4FFWC 2DD8L 4YBHA 1O7VA 5DHYB 1OW0A 2V2TB 3O6FC 3SDAA 2AJZB 1A8JH 3FFCE 5DQJA 1FG9C 3CVIH 4YDKL 5EPMB 5KZCD 3AREA 4HAFA 4HIXL 2G5BA 2H32H 3QJFA 3U6RA 3PWVB 4GW4B 3OKMA 2C1PB 4EUPA 2COQA 1MI5A 4BFBD 1WCBA 1U8LA 5MENE 4KTEL 4XX1E 1JN6A 1NBZB 4CVZA 1INQB 3SJVE 4Z76A 3BHBA 4O51B 3Q6FB 5CZXD 2XN9E 3MR9B 2A38A 1RUAH 5E56A 1MCIA 2ICWI 1UWXH 1NC4D 2EDRA 3E6FA 4FZ8H 5GS3A 2MQ0A 1PYWB 1X5LA 5CKGA 1NBYA 1TZGH 1Y6MR 4G80A 3QULA 2NY6B 4MJIE 1JL8A 4HWZA 1PZ5B 2H45A 5F9JB 3RJDA 3BOVA 1BQSA 4IIQA 3MRMB 3QUML 2GFBB 4JY4A 3DGGA 1FZJA 4H8WH 4X5WA 4U0RC 1SYSB 5HTSA 4ORGB 5DD3H 1FYTE 3UJTL 3VRIB 2NR6D 2N56A 3HAEH 3BJLA 4ONGL 4IDJH 2VH5H 2PYEA 3B4NA 2FEEI 3GNMH 5DRNA 4XHQA 4XPTH 3HAEA 3NPSB 1N64L 4X6BB 5B3JE 3DI2B 4G8EB 3LKPA 5JHLL 4GW1A 4FABL 1SYVB 3RL2A 1BBDH 4ZQKA 1CL7I 1P4BH 2WQ8A 3VU2A 2HH0L 3E3QC 3WHXB 1EEZA 1UKSA 3FB5B 1G0YR 4KV5F 2QADC 3MV7A 4KK6C 3VXNB 4GRMB 2PW2B 3DVNB 2P8LA 5HD8C 1VDGA 3U46A 2DI9A 4JVWA 1CE1H 4XBEL 4OJFH 1ZS8A 3QUYB 4FQ2L 1WBXB 3C6SA 3SKMB 2D7TL 1RY7B 4GKZA 4F7CB 4LRIC 4WI7A 3WFDH 1IGCH 4YX2H 5C9KA 5J1AA 2BNRD 3T3MF 2Y5TA 2H1PH 3VXMB 4YDJA 1AJ7L 5D7LB 3NCBB 5BRZA 1JPTH 4KHXL 5DMIL 5KVEL 3RQ3A 1DDHB 4BFIA 3HNVL 5EU7E 1DQLL 1BX2B 4PJHA 4Z7VF 1EV2E 1H3XA 1JNNH 3O2DH 4XNZC 1VACB 1WGOA 2VKWA 3KHOA 4XHJD 4JANA 4JDVB 4E42B 2MCPL 5C71A 3O2DA 3QIUB 4X6CE 3R1GL 1BQHG 2WUCL 1QR1A 1MNUL 2JLLA 1Q9LA 4KQ4H 2LAGB 4DFIA 5C0EB 4FG6C 4Y89A 4U1NA 1M7XA 4KI5F 4UT6H 2G9HB 5BJTA 5I73B 4QRTA 4ODSL 4P5KB 5FHBH 4NKMB 1F4XH 5EZIL 2AI0H 1S8DA 4RIRA 2MQCA 3PV6A 3GSUA 3U30B 5HGAA 3P4NA 4Y4KB 4FQHA 1KELL 3NZHH 1QR4A 1JE6A 4MJ2A 4PLKD 1YNKL 2ED7A 4D9RD 1ZSDA 5GRVL 1JWUB 3KLAB 2PKDA 3TBVB 4JQIH 3ZSTA 4PBXA 4F9PC 2PXYA 4MNQA 5DD5H 3SKUD 3HZMB 4FQQA 3RA7L 4UT9L 2R0ZH 1OPGL 3LKNA 2A1WL 3VXSD 4DN3H 3SQOH 4KFZC 4AM0A 3C5JB 1NBVH 3ZDXF 3WNKA 1V3MA 2O61A 2VNCA 5SWSB 4JQXA 5GS0C 3WJLC 4JDTL 1IQDB 4W4OC 5DJXB 3LS4H 4XMKL 1Y0LA 4ZPVB 1VADB 1KPRB 2IQAA 1T1ZA 3KPQA 3ULVE 3WFHB 1T22A 1I1YA 2NLJA 5CJQL 4HEPG 2R39A 5C2BH 3CFDB 2YUZA 3PDOB 3WL9A 3MOBH 1HSAA 5EB9A 3PG2A 1OM3H 1I8IB 1D3CA 1C08B 2J88H 3EJZD 5D6DC 3EYVA 1BWMA 1D6EA 2R1WB 1ZA3A 4MWFA 1XGYL 1NCUA 4JPVH 3PGFL 4Y5YA 3CNKA 1HXYA 3MCKB 3QEQA 4R6UA 1UWEH 1IQWH 3RHWK 1JNHA 4CVUA 5ANMA 2YD1A 1U8QA 3LZFH 5KSBF 1D9KA 2BNRA 3FCTA 1N2RB 3QIWC 3BQUB 4ONFL 5DC4B 4LFHD 2VDOL 4ZYKB 3TIDA 5IKCA 3AU1B 2V9QA 3B2VH 4P23B 2YPLB 3G5VA 4ZODA 1Q0XH 2R0KH 4AQ1B 1FSKC 5FYKD 3ULUL 3VCLB 1BFOA 1GC1L 4NP4H 2V7NB 1ZLUK 4NM4H 3G9AB 3UPRB 3TH3T 5IFAH 3STZB 5FUZH 4RZCA 2Q7YB 3ZT6A 4IBLT 5KAQF 4YE4H 1CLOL 4WTWA 5EIIB 5T1MA 1BVLB 4RFNB 2PTVA 2FZ3A 5GGRY 1B4RA 4HIIA 3BKCL 1CDHA 5HHNA 4OF3A 2H2SD 2QTEA 4JM2F 3OL2A 5DZOA 1TZIB 5I1IL 2DJUA 5IF0B 1MCPH 1MWAA 5BZDB 3H3BC 4Z7UE 5IB2B 3FO9A 3JWOL 1K4DA 1S3KL 2VZ3A 1FRGL 2DQGL 3ARDD 4WCYL 4HHAA 5DD1H 1WC7B 2Z31D 5GSVB 1NLDH 2QHRH 1DSFH 1N8ZA 4PTTB 5CHNB 5FCSH 2R8SH 4K3JH 2ADGA 4U1LB 5HYFA 5MEPB 4LSPH 4N8VG 3WHE1 4ZXBA 1YECH 3BSZH 1F4HA 3IXTB 3O3BA 4X98B 5H94A 4WFEE 5GIRB 3TJHD 3VXSA 3LN4B 4PJDB 4R26H 4E5XA 4MX7B 1BIIA 3SGJC 2BSSA 4OZIE 5I74C 1YEFL 4OCRL 4AIZB 3ZMRA 1YEIL 4K7FB 4OLXH 4PRID 4JRYD 2XQYG 3FAWA 1RPQA 4HH9B 3ARXA 1XCTB 3MUGB 2A9ML 1G7QB 5GS2D 5I19L 1FHGA 5EUOB 4DGYL 1VGEL 1QFOA 2DI8A 5FECA 2N1KA 3N1PC 1P2CA 1I4FA 4Y5VA 2A9NH 1CVRA 1H5BB 3MC0A 3QH3A 5JW5A 1DVFC 4X7CC 4FP8L 1YN7B 5LWYH 3CSBA 3TZVC 3KLSA 3WO4C 5I1EH 1U8NA 2CO7B 5IVOA 4G6KL 3BP6A 2HVJA 2E6JA 5JDSA 2DBLL 5D1ZC 1WFUA 2CLVA 2I60L 3ARGD 3FOMB 3NACL 3Q5TA 4NKOB 5DR5H 5DUBA 5KVDH 4KKBC 1Q1JH 1IGFL 2KZ1B 3THMH 4LCWB 4O2EA 2HFFB 1Z9OA 2AEQL 1QTYT 4H20L 4QXUH 2L4OA 4R4FH 1DUZB 2NY5L 3CLEL 5IJKA 2D7MA 5FV1L 3OGCB 5FYKH 3OKDA 3ARBC 1A6PA 3FB8B 4M9PA 1YEHH 2BOCB 4HUXB 5I9QC 1R5WB 2WINA 5IK3B 4JFED 4WWKA 1ZLUH 2XG5A 4Z7VA 5MHSD 1TIUA 3FFDA 3JVGA 4JRXE 3EIFA 2EDDA 4HKBA 2EYRB 1MRDL 1BM3L 4HIJA 2YPVH 1E4KA 2AXGB 5C07D 3WLWC 2Z35A 5IW6B 4XI5D 5DJ8A 3I50H 5KSUA 3D1MC 2NX5A 1S9WA 2J8UF 3MLXH 3S8WA 1EO7A 1ULVA 4X6DF 3SCMD 5JLZB 2ZCHL 2VXTL 3TA3C 1X7QB 3ZKNC 5E99L 3MV9A 4PP2A 5FGCE 3WFBH 5L6YL 1ZKAA 4EDXB 2X70B 3QIBC 4P4KB 3S6CA 1L7TH 3U9UB 1FIGL 3S5LG 2ZNWA 3EZJB 1P9MA 2HT4C 1HQRA 4JHWH 4OLWL 5KOMC 2HT3C 1MVUA 5DA4A 1QBLH 2QEJA 3IDUA 2FB4H 2XQYK 3VI3E 4BKLA 3O4LE 1MFEH 2Z31A 4OBSA 2J7LA 1W0WA 2FL5A 4FXKA 4HCRL 5DK0B 5HHOB 4NRZB 3VG9C 5JR1L 4OCXL 2O26U 4IRJB 5AWNH 4P46D 3L5HA 3RFZC 5BVPH 1TVDA 1KIQB 2GK0A 2X05A 4KVNH 2ICEB 1PG7X 2ITCB 2LTQB 5E00A 5GISH 4R7DB 2Z91B 2BCKA 5GS2H 4C4KT 2XXMB 4JRYA 3BZFB 2VQ1A 2X9YA 4XP1L 3GMMA 3Q5OA 1FVCA 4M6ML 5DUPH 5C2UB 1TZHB 3BP5A 4JO2L 4ZAKB 3IGAB 2GSGB 3LRHA 4NJAH 4N0FB 3NCFB 1ITBB 1SQ2N 1OP5K 1BFVL 1S9KC 5DQ9B 2VDRL 4MJ5B 5TH2B 4G9FB 4WW2F 5MERA 4K3EH 4NGHH 4LSSL 2YRZA 3N0PB 1RJYA 3MNWA 4XPFH 1U3ZA 3F5WA 3VRLF 1E27B 4ZSOE 1X3DA 2XQBH 1A7QL 3T4YB 4XVTL 3EFFB 4YK4C 1GGYA 5KSBA 2BFVH 2GY5A 2VAAB 4YHZL 25C8H 2UUDK 4MMXC 4WFHE 1I9IH 4JR9H 4TUJB 3MJGX 5HI4D 4BQ8A 1BOYA 4LIQE 5B4MD 1YEEL 4BUGA 2K7PA 2BNUA 4NQEE 3ARWA 3P11L 3QDMD 5C07A 3QUXA 4NO5B 3CLFH 3CMOH 4LLWA 5IMKB 3SE4A 3RWJA 2LFGA 4QHUB 4MA3A 2B4CC 3SCMA 1RUQH 5F88A 3RGHA 4K3HA 3UBXB 5JUEL 3HC4H 3PUCA 3PWNA 3GGWB 4PREA 2FH6A 5HDBE 1KF9B 5TDNB 3SPVA 2YBRB 3QXTA 4LQFH 5GGSB 1F6LL 4ISVA 3ALWA 1MJUH 5ENWB 2J5LB 2BOBA 1F58L 1MOEA 5DYOA 4G8GE 1I3GL 1DBAH 1T5WA 4M6NH 3QPXL 1PFCA 1KXVC 5E2UL 4S1DD 5F44A 1HXMB 1MFBL 3L3KB 1QFWI 1WAAE 2HRLA 2I9TA 3FRPA 1YEGL 4HV8A 4PBVC 3S97C 4NZUH 2C4XA 4XPBL 4B0MM 1CDCA 3TIEA 1TETL 4JDZA 5FM4A 2VUYA 5D1QD 1HH9B 4YLQT 1ED3A 3ROOA 4WENB 2VC2L 3V0VA 4PJEE 2B1HH 1NH6A 3NIGF 2H3NA 3PHOA 5EH1A 5KVFH 2NYYC 3OHXB 1OSZA 3RPIA 3AY4C 4PJBE 2VLKA 3QQ9C 2AJYL 2V9TA 1U6AH 3IDMB 4S2SA 4X4ZA 4PJ9D 3DMMD 1OP5H 4KK5C 3TC9A 3QT2A 2R2BA 1I3UA 2Q3AA 1UACH 2HKFH 1S7UB 2FGWL 3QDHA 1Z0MA 5D7JB 2HJFB 1A5FL 1RUAL 1KIRB 3ARFC 3JV6A 5FB8A 5E6ID 2CLRB 5F3HA 3DUSB 4NQDD 4V2CB 1NC2D 5BOZG 3I75B 3MTRA 4DEPB 4FZ8L 1QA9A 1IVLA 2G60L 3GKZA 1U93B 2EICA 4ZOBA 2DQJH 1PKQB 2AK4D 4K2UH 3RVXD 3HB3C 2Q76B 2UUDH 4HFWB 5E8EB 5TGBB 3JV4B 1AD9A 5SWZD 4X7FC 1Z2KA 2XKNA 3K4AA 5T33L 2IBBA 1U2CA 1EJOH 4H8WL 2NY3B 3HI5L 4QOKB 1QO3B 3H9YA 4OM1L 3GMPB 5DD3L 4YBLC 1JPGA 5EO1A 3WDJA 3O6FB 4IDLA 4WHCA 1DBBL 4FQXD 5HHQB 2VH5L 4G6MH 5I18L 1ZHNB 2ITDB 1EA9C 4MDIA 4X6DA 3MLUH 3C5SA 4NKQB 4CMHC 1MH5A 1IILE 3I6GB 2V5SA 4CMMB 4XTRC 1BBDL 3B3IA 2VN4A 4KZDH 3VH8B 4I1NB 1CFVH 2AGJH 3M1BB 3VD5A 4KJPD 2EXWD 5HHVH 1FN4B 4MZ2A 3QDGE 4MAUL 4TRPL 5CS7A 4NC2B 1SY6A 3QUKA 5CMAA 3IFOA 4I4WA 4MQSB 2F19L 3NAAL 3O3AA 2ATPB 5F1SA 1YQ2A 4JGJA 5D1XC 1CE1L 4OJFL 1MHEB 1C5BL 2QQKH 5C7XH 4R4BB 3TWCH 1QUNA 5JIPA 5LBSH 3DV6A 3DX9B 1J0IA 1V3LA 1F97A 3L1OH 4YDIL 3WFDL 1IGCL 4UBDC 4YX2L 5A2JH 4I0PD 5H2BA 3ISWA 2H1PL 5A2FA 2IEPA 1E4XI 2APTA 3ORJA 1JPTL 1YNLH 4HIEB 3T0XA 3U1SL 4QRRE 2XFXB 3U7YH 4BSWB 1JNNL 4OF0A 3O2DL 2OSLA 1SEBB 5DO2C 1IAIH 4Y8DC 3TM6A 1SM3L 4D9LH 3HUJB 5IBTL 4U0RB 4YDVA 4MQ7A 2HFEB 2AJXH 3C5ZD 4F57H 5EU7C 1J0KA 1ETZA 5FO8A 3WJJA 5DT1L 3VFTA 4KGLA 3O6MH 4N9GB 1JGEB 1AGCB 2BZDA 1ZT4A 2NNAB 4GAJL 4PJ9A 1XGRB 2C7UB 4YNYB 5KN5B 1A47A 1F3DH 1OF2A 3MLSH 2WBJC 4TTDD 4WV1C 5C08B 4BSVB 4DOHE 4FQCL 4ACPA 5FHBL 1UVQB 4X9BA 4ZO6A 4F7TB 3D39E 4FFVC 5TE4H 3CFBA 4PJ5B 3T1FB 1F4XL 3OKOB 5BS0E 2QADB 4G43A 5K9KB 1WJ3A 3A67L 3DO3A 3I85A 4N8CH 4LLMB 1NC2A 4WW2A 5D2NC 1KT2B 4LEOB 4XCEB 5D96C 2AK4A 1J05A 4M1DL 3MRPA 2NY1C 3P73A 2UVFA 2JB6A 5SWZA 5DD5L 3TP4A 3MA7B 3UBXI 1QSEB 2R0ZL 1ORSB 1G7HB 4L9LA 4R2GD 3SQOL 4JZNB 2OL3H 3ZE0E 1NBVL 4GRWB 4QHNB 2CIKA 4NPYB 4ODTH 4XNZB 3H2WA 1BMGA 3REWB 4FQXA 2OL3A 1EXUA 2LV4A 2YHGA 5EUKA 2OJEA 3V6FB 3X13B 1EGJA 3KXFE 3LS4L 4I77H 1JPSH 5KSVA 1G9ML 2IH1B 2W9EL 3MZGB 4JFXB 4LPYA 3PGDA 4U1SA 4WVRA 3LKQB 5D7IB 1AGEB 4XBGA 4D0BB 5C2BL 3DX6A 1ZGLP 2EZ0D 1T66C 1CXLA 2P48B 1OM3L 3L95B 2J88L 2BY2A 3T0VA 1CGTA 4R4NC 1KEGL 2NCMA 4MAYC 5IVXF 4JPVL 4M7ZC 4PJIF 1PBYA 3NCYP 4UT7H 1IQWL 4AH2A 5I76B 4NFDA 1KJ3L 1FDLL 3TN0A 2H9GB 5F7EH 2FX8H 3LZFL 4P49A 2JJTA 4HKJA 1B88A 2X9XA 3OKNB 1AGDB 1EEUA 2CJUH 4P5TD 5B39G 4PJ7B 2DQCH 1EX0A 3MZTA 5DJCA 5DQDH 3RVWD 3EO9H 1GZPA 3S4SA 4P2QD 1OAUH 4FMKA 2VYRE 2R0KL 1JPFA 1KCKA 5FUOL 3KPPB 5FM8A 3WN5C 4QRPB 3B9KD 3VFWB 1PY4A 3CFJA 5A1AA 3KLDA 5JHDA 2FJHB 2Y25A 4K7PX 5C0BD 3C5ZA 5ADOH 4YE4L 3GMNA 2G75A 4F2MB 1PEWA 1LWRA 1VB9A 2F5BH 4KJYB 1B9ZA 5FCUH 1TQCC 1DEEB 5HHMB 3TVMA 1ZVSB 5HI3C 1MWAL 5D6CB 3JWDC 2P8PA 5DJZB 4IM8A 4EQ2A 4CVXB 1SJEA 1UCTA 3T0EA 1IARB 4XP6L 4PB9L 1NANI 2ZSWB 1CICD 4M1CD 5IBLC 2W0FB 1N6UA 2IMNA 1X9QA 5AYQA 4ELKB 3WV0A 3FAXA 3LN5A 4QY8A 3PE9A 4KQ3L 5AUMA 3CMGA 3WNLA 2AK1H 4LDOB 1MCOH 4HFUH 4AZ8A 1XFPA 4ZDHB 1NLDL 5FA4A 1DSFL 5IJVB 3MX0A 4WU7B 4JPKH 2R8SL 1RZ8B 3CCHB 3TBSA 4K3JL 3LY6A 1DBMH 1FH5L 2C3VB 1NAMA 5GGTH 1UZ8A 4RAHA 3QIWB 1CK0L 1K2DA 3T0BA 1Z5LA 1OAYH 2DJSA 5CD3A 3SKNA 3VXRD 5GGTA 3E6HB 1ADQA 1JGUL 4P2CG 4MNGB 1EHNA 4YHPB 3UDWA 1FSKB 1AIFA 5JW4R 1OSPH 1UQSA 4NNXB 4X99B 3PP4H 1B0RA 4X7SL 2LQRA 3MNZB 4UINL 5IMOB 1U95A 4OLXL 4HPOH 3GSXA 2ZUXA 1M71A 4LARH 2I24N 2XY2A 1JV5B 3QB7C 2R56H 3QBTB 2A9NL 1T83C 3QA3B 1J1XL 5JW4Q 2EDHA 1ZVHA 3DXAD 3R06B 4XZUA 5C0AA 3O9WD 5HYQB 5DR5L 1YEJL 2IBGA 3CC5B 5IHUH 5KVDL 4YZFE 5C3LD 5I1JH 2ORBH 1VSCA 3PQYB 4ZTPH 5DDHA 2JJUA 1ES0A 4EJ1C 4LSVH 3QI9D 4U7KA 3RJQB 4P5TA 4L4VB 4JFHE 3CDGB 5FYKL 1SJHA 1RV6X 4X4YA 5DURD 1IRAY 1JF5A 5DWUH 3PGCA 4ODWA 3QUZC 4P2QA 5D9SB 4HS6A 4WY7H 2DL9A 2JJVA 3TH2T 3B9KA 5IM7B 3KPMB 1F6AA 4OCMC 1AXTL 3GSQA 1KFAH 1I8KB 2DWEA 4R96A 5DTFA 5C0BA 4GXVL 3MROA 2GJ6D 3MLXL 5I74B 1NFDF 3KS0J 4TVPE 2C1OA 3FN0L 1OTTC 1HEZB 1JZ2A 1QSFA 4HH8A 3CH1A 5BO1H 5L88L 3RUGF 4PJXB 5DLML 1L7TL 3GO1L 2WIIA 4J3UA 1ZXQA 1FZOB 3IJSB 4OZGB 1DVFB 2FO4B 3DX8B 4JHWL 1CICA 3K8LA 3TZVB 2DQDH 3WO4B 3EYFA 4G6FB 2XNAB 5JORB 4Z77B 1QBLL 4OZ4A 4D8PB 4LNRA 3QFJE 5D1ZB 4KH2A 4N0UA 1MFEL 3LDBB 3CFEA 1Y18A 1CT8B 5E1HB 5IEHB 1KBGL 1T89A 2R1YB 1JGVH 3ZT7A 3BPCB 3RVVC 1I9JH 5AWNL 1PY9A 2AERT 4YC2C 1T21B 4M7LT 1F2XK 3SOBH 1BP3B 3ARBB 3G5ZB 5EOQL 4IMKC 3WDHA 5I9QB 3UTSB 1DCLA 4KVNL 4Z0XA 1MFDH 4ZUSB 3SDXE 3L6FB 1I8LA 3QNYB 5EZJA 4X8XA 3D3VD 4NQXB 3KPNB 1CIUA 4K9EC 3HNSH 5B8CC 2LVEA 4G3YH 4P2RA 5EU4A 5CSGA 5FUCC 5HPMB 1HI6A 3OKEB 1AR2A 3TA3B 2YUVA 4E0RB 4HF5H 4POUB 4NJAL 1WBYA 2X4QA 1YEKH 4P9ML 1C16A 3RWHB 1YPZE 1VHPA 3QIBB 4XPGL 1BEYL 4K8RD 5JW3L 4I8DA 2VLJD 4HK3J 4K3EL 3O9WA 4NGHL 5IVXA 2VXVH 4JY6A 4PJIA 1CFTB 5IEKA 5IROA 5JPNA 1FJ1B 1KYOJ 2FLRT 1LK3L 5EN2A 5KJRL 1FG2B 1S78C 4N8PA 2XQBL 1SVCP 2IWGA 3QI9A 2VXUL 4NWTH 4YIQB 5IFJA 1OAZH 4XB7A 2V2XA 3STLB 4PB0H 1DP0A 1YMME 1U58A 1I9IL 4ZS6C 3EDKA 3VG9B 3GSOB 2VLRB 1JJUA 4LGPB 4XP5H 4JR9L 1IEHA 4NN7C 2P24B 3FZUC 5TQ2L 5FDWA 1U8MB 4HQQH 4N0YH 1F4YL 3B83A 1OB1B 3ZHLA 2X1OA 5EU6B 4PTUB 5IMLA 1T1XB 1P5UA 5DD6A 2KUTA 4FNLL 1Z6JT 3ZDZF 5FKPB 1FVEB 3SKOA 4EXPX 3AVEA 3LKOB 4PGBB 3AM8A 2DQHL 3X3FL 4ETYA 2HJKB 3HC4L 1YY8B 4F58L 5BW7A 4JCMA 1RFDH 4HS3B 4NC1C 1DQJB 4WHDA 1C5DA 2X4SA 5C09D 4B7LA 4NDMA 1EHLL 1MJUL 2EIBA 3LRGA 3NH7H 1V5JA 4F7EB 2UWEE 3P0YH 1HKFA 2D7QA 3F8UB 4M6NL 4RGND 4NRXA 3GSVA 1HILB 5KVGL 4QHKI 2DYPB 4JEGB 1CFBA 4K94H 5JQ6H 1CFNA 4YK4B 5GGRA 2QQLL 5MP6H 1MPAL 2BXYA 3CXHJ 3Q5YA 2A74A 1I85C 4WW1A 2E7LA 3QWRD 2FATH 2VABB 3T65A 1B4JL 1RJLB 3MREB 1N26A 3OGOE 3H3PH 1YNTA 2BVEA 1Y6KR 2GCYA 4KRMB 4PRDA 3EO1B 5J6HA 1MRCH 4Y1AB 4JFOB 5KVFL 3D3VA 3KG5A 4U1MA 4OV5A 2Z8VC 1IAMA 3DTXB 4KROD 1BGXL 3SGKA 1ZHBB 2Z8WC 5KANI 4P99A 1FL5A 1BD2B 4UUJB 2XI9A 2BVYA 5EFIA 2O93L 2VISB 4K8RH 5IVZB 1M6OB 4P3DA 3PL6C 1QQDB 4F15C 1ITCA 5D5MB 5HVHC 3HR5B 3QWOA 1IAOB 2ENSA 1YQVH 2EDEA 3F12B 5FEBA 3OSKA 2VLJA 4GQ9H 2P5WA 3L3JA 1H3PH 5EG6C 1KLFA 5E5MA 3LEYH 1IGMH 5J3HD 1TJGL 4K2UL 4TSBH 5CP7B 4PJHE 3WS3B 1FGNH 4TPRH 5I2IB 3VFMA 4U7SA 4OCYH 1U9KA 4XCFL 3H9HB 4EDWH 5ICXB 3RTQA 3S3PA 2DIAA 1MJ8L 1LDSA 5JO5B 3MXVH 2RJMA 3GSNB 4WHTA 3GI9H 3TNMA 4GUPA 2QLVB 5HGHB 1GYAA 3DVGA 4H25B 3MLRH 4F8TA 3MO1A 2CDEA 4G6ML 4U4BA 1KB5B 2K1MA 3LSOB 5IQ9A 4Z8FH 4NT6B 1S7XB 3ZL4L 3GSRA 5AZ2H 1NFDA 1S7WA 1VFBB 5L2KB 1KCSH 4ZS7H 4NQVB 3PWPD 1REIA 4XMPH 2R0LL 2VDKH 5CWSB 4UQ2A 1EH9A 4GOSA 1SY6L 3RUGA 3FFCB 5DGRA 4L3CA 3MRDB 3IDXH 4F9LC 1KTDB 3TESA 5HHVL 1YY9C 2E7BA 4KKAD 3QQ4B 1CL7H 1XEDA 2IAMC 5KSAD 3FQNA 1EPFA 4PUBH 5D4QA 3ARFB 3AS1A 2WZPD 2AJSH 3UO1L 1CFQB 2QQKL 2A73B 5C7XL 5F9OH 3TWCL 1BZ9A 2VDNH 3RDTD 3DGCR 3SJVB 3S98A 1NJ9A 1A1NB 3LQAH 1KTRL 4ELME 3V6OC 1VKXB 2X9WA 5ICYB 3SBWA 2P4AB 1YNLL 5FA3A 4OTXH 5C0DA 3AB0C 4DFHA 2D03L 2CKBH 4NQCB 4QXTA 1QEWB 3QWRA 2CXGA 1J7VR 3TH4T 3HRZA 4GMTH 4D9LL 5I71C 1ND0A 5GS1A 2Y36H 4M7LL 4MD4A 1RHHA 2CMRH 4YBLB 3TO4C 4MD0B 5IV2A 1A7PL 3V7AG 4OCLC 2JIXA 2PO6D 1U8KB 1JWMB 3CZFA 1Z3GL 4PJAE 5CJXC 5E9DB 3OXSA 3I02A 4CMHB 2BNQB 3VMOA 3MLSL 5DK2A 3UZVB 2C3WA 3HLAB 8CGTA 1DLHB 1HH6A 3EJYD 3I3BA 3V79C 2VIRB 2NY6D 2HKHL 1RZIA 1BLNB 1KTLB 3C60C 4JREC 2BNRE 3GI8L 2YD3A 4HKZB 5D1XB 1A1OB 4LF3B 3QEHB 4K3GA 4ODXB 4QLRA 4IHOA 3IVKA 3MJ6A 3WLBA 3M8OH 4JCLA 1GVIA 3FQXB 5EORL 3D6GA 4L8BA 3QO0A 2EIEA 2OL3L 3HI1B 1DN0B 4WUKL 4Z0BL 3FONB 1EGJL 3MLZH 3MLVH 3QDJB 3VGFA 5HGBB 3BRFA 1JZ7A 5MEOA 3LEVH 4LLUB 1OTSD 3ULUC 2DQUH 1GC1C 5AD0A 5FYJU 3IJHB 3PWPA 5F9WC 5L0QC 1Q9OA 4J23A 3P9LB 1KLGB 3BKJH 4IS6B 4ESKA 2YPKB 1TCRA 3QUYD 1HOCA 2EXYC 4Y2DA 3C09C 2WBJB 3GBLA 4WV1B 5E8OA 3TT1L 5KSAA 1I7RA 1VEPA 4D9RE 3V5DA 4L4TB 1KXQE 3ARQA 3VXMD 4CU6A 1B0WA 5D7LD 5C9JB 4LDEB 2NW3A 3TO2A 3U83A 1XR9A 5D2NB 1IEBB 2DQTH 5HYIA 5F7EL 3RDTA 1KGCD 2DQIL 2FX8L 1CXKA 3GRWA 2BY1A 5D96B 5TE6H 3MRHA 3JWOC 4FFYH 2CJUL 2Z0BA 5DHYA 3VXSE 4J1UB 1U3YA 2B8OT 2DQCL 4DGIH 2NY1B 4OIIH 3EO9L 4K7PH 4QHMA 4GAGH 1E6OH 4H26B 4DVBA 4L8SC 5AG9A 1A9EA 1W72H 5L9DH 2CK0H 3MRLB 4FMFA 4APQA 4GT7A 3VFSA 1DFBH 2CKNA 3SHSA 3WS6A 4XMLH 1NMAL 3G04B 1W72A 4PY7B 3GBML 3QISA 2VZ1A 2YWZA 4NC0B 2B1AL 4LRNH 4JFQB 1U91B 1HHGB 5BQ7B 2PO6A 3HG1B 1I3RB 4KV5E 4HJGA 1BPVA 4ALAH 4YBQD 4Y4KD 1F42A 4G5ZL 4O58L 4JHAL 3I2CH 4CADB 1X5FA 1NGQH 3W9DB 1MCWW 1A4JA 2CIIA 3HI6H 5F7LB 2CK2A 4MAYB 3KVQA 4OFPA 3VMNA 5CBEB 5HDQL 4M7ZB 1WZ1L 5CBAB 3MRMA 3IDIA 1NAML 5EC1A 2FWOB 1WK0A 3QEGH 3BGAA 4JPKL 4JG1L 3OJVC 4Z7VE 4H1LA 1F90H 5FYKE 4J3WA 5DFVC 5GGTL 1LNUB 4X6CF 4QWWD 1WITA 4L8DB 2FECL 4MDJB 3IDNA 1ADQL 1OAYL 4WJ5B 5SWSD 4OCWH 2NY5C 1SBSH 4LLYB 4PRPB 2N7AA 1MREL 2APBA 3WN5B 1GOGA 1HKLH 3U7WL 4PRNB 1LE5A 3PP4L 3CDCA 3KPSD 1NEUA 4HPOL 5F72S 1XGUB 1YZZA 5DS8B 3NCJH 2X44D 4XP9H 4XRCA 5IG7A 1A6TB 3FB5A 5BXFB 4AK1A 1EAPA 4P9HH 4RMWA 2YA2A 2PW2A 1VESA 1RZGB 1TQCB 4KKLD 3NTCH 1IM9D 2JK5A 2Y7QB 1AFVH 3MV8A 1RJCA 1HNFA 4AL8H 5LVEA 3QUYA 3PABA 4PV8B 2QV2A 3S34H 3T77A 2WIMA 2YEZA 4AEIH 1LEGA 5I1JL 5IHUL 3TNNA 3BKYH 4ZTPL 5HGDB 2CUIA 2P5EB 1DDHA 3QHFH 1JRHI 4K71C 4P23D 2YPLD 1AO7E 4ZUWB 2FJFB 1FYTD 4OUUB 4KK9D 7CGTA 1KPVA 1QRNA 3MRRA 1PQZB 2CR3A 4R7NA 5TQ0L 4ZPTB 5DWUL 2QR0A 3AROA 3RIAK 3EFDL 2DN7A 3BYTA 4PRIE 2P42B 3GMOA 3FOLA 3ULVF 1CD0A 5M7QA 1KFAL 1MCKA 1FLRL 4YWGH 1A9BA 3IDJB 3DHMA 3UTPD 3DBXB 2J1KA 4P57A 4F37F 2V2WB 2BP3A 3FQTB 3G6DH 4P5KA 4D9QD 2WV3A 3V4VH 1QLRA 4WO4A 3TPUB 5BO1L 1L0YA 2BY3A 4HUVA 4WI6A 1ACZA 1A14H 4LSTH 5HYSA 2PTTA 4ENED 1KJMB 3Q1SH 4G6JH 1P1ZA 3UJIL 5DEFB 3R8BB 2MQ3A 2EDQA 4LHJB 5GXBB 3KLAA 1K8DB 4HS8H 1JTPA 5B38B 3OF6A 5F89A 1DBJH 3S35L 4LHUA 5JNYB 5L2JB 5IMMB 1N7MH 2R23A 2DI7A 4RNRA 3G08B 3WIFB 1RAMA 1FORH 1I1FB 1CBVL 4JFEE 1EEQA 4O02L 3GK8L 4W70A 3WE6B 1IT9L 4G8FB 5JOFB 5FGBA 3P0VH 3SOBL 5C07E 2K7QA 2VLMD 3VGEA 1IQDA 5M95B 3QUZB 4FFZL 2A0LD 5MENA 2GI7A 1MY5A 1TFHA 4ZPVA 1KEML 2GAZA 5MI0C 1ROWA 1KPRA 5GZNC 1BF8A 4OAWA 1P84K 3B5GA 4PJFB 4KXZH 1IC5L 3KPSA 5CJBA 2XN9A 1A7NH 3A0OA 1U8HB 1F11B 4Z7UF 2NXZC 3P4LA 3QXDA 4NOFA 4PS4L 1ZHKA 4HF5L 4M00A 1G7PB 2Z9TA 1X5GA 4ERSH 1IM9A 1YEKL 5HGGS 4Z5RA 3O6KH 4LCWD 4OM0L 2FR4A 5I0ZA 1U2HA 1NGYB 2A6DA 1LQSR 3W0WB 4TSCL 5CEYB 3P9WB 4HGWB 5EA0H 2V5RA 4TUKH 1O7SA 5F97E 3KYKH 5EBLB 4ZYKA 1IGJB 2E7CA 4WTZG 3T8XB 1MELA 2I25N 1KC5L 1U3HC 4P23A 2YPLA 2VDLH 3WD5L 1FYTA 1VGKA 4OZIF 5K59E 4LPUA 5L7XL 2FDBP 1JK8A 1RUPL 3CDYA 3STZA 5DRZB 2C5DC 2W9LA 3WXWH 5F1IB 3BRDA 2JCCB 3O4LB 2AXFB 5DMKA 5D7KD 4QT5B 1T7WA 5EIIA 1A7RL 4JO4H 3KJ6H 4OZFA 5E5RB 4RGOL 5F7KC 4RDQF 3SDAC 4JN2A 3ALXA 3ULVD 4UQ3A 5BVJB 4XWOD 4X5XA 5IOPB 1NCCH 4RAVB 2DM2A 3DHJA 3EDJA 5DJAB 3AREC 4KTDH 5GSRB 2CDGB 4P4KD 2BK8A 3DV4B 3HNTL 2MHAB 5IF0A 1I7UB 5B8CB 1AXSB 3GMLA 1RFDL 2YR3A 2HVKA 1V7ML 1JGDA 3D18B 3I6KA 3UPAA 5HVWA 1CXFA 3MYZA 5DI8A 5HHOD 3DWTA 4UNUA 4IRJD 2H41A 3MOAH 3UBXG 3VXOA 5MEPA 1NKRA 4NQSA 2R0WH 2WBWB 1UXWA 3EO0A 1CG9B 3HZYB 1MQKL 2XWBB 2X09A 1AGBB 2H26A 4NRYB 4ZFZB 4X6CA 3WFCH 4IIQC 5MP6L 3ILPB 5DUMH 1QFWH 2EDBA 5ERWB 1ONQB 3QDME 3KGRA 5FF6B 3WMSA 4ZSOB 1NGZB 4RAUA 4NN7B 3FT4B 3QAZC 3H3PL 1ZK9A 4HH9A 1NEZB 3VFRA 2E9BA 4CAGA 3TYFB 1P4IH 5EUOA 2EDLA 5F7DB 4LSRL 1TTUA 4ZAKD 1MUJB 3CZJA 4HKXB 4L3ED 2YMXH 1LEIB 3DRQA 1QYGH 3OAYK 4YFLF 1TLKA 4OB5H 1CR9H 3LEXB 5EU3B 4G9FD 3VI3F 4DAGL 4JE4B 2GKIA 4Y19B 4HGMA 4K8RL 2DAVA 3NA4A 3QRGH 5T5NF 5EDXA 1UB6B 1G7JB 4LCWA 3VXUB 3BDYH 3NVQA 3BO8B 3CSYA 2C3XA 2ZUYA 1X4YA 4FXLA 1EHXA 3HC3H 4I5BB 3B43A 1H3PL 3G6AA 1IGML 1ZGLM 3R0MA 4M43H 2CGRH 2IBZY 4WFED 4TSBL 1KN2H 1FGNL 3FMGH 3L5XL 4FQJH 3DUUB 2VDPL 1W0VB 1PSKH 3OKYA 1GHFH 1U8PA 2FYYB 4BA8A 5BZWB 5CEXB 5TDOA 5IW6A 3G5YA 1VPOH 5E94B 3TPKA 4M62H 2W65B 5L8KB 2W60A 2BHUA 1D5IH 4XNXH 5I1HL 3VFPA 3T3PE 1N0XL 3W9EA 3ZTJG 3QUMB 3RIFK 4V1DB 4EDXA 2X70A 1RK1A 3O8XD 1TQBC 3DYOA 3U9UA 1SHMA 3GJEA 4ZS7L 3U36B 3INUL 3FT3A 4NQDE 1AR1D 2WM0A 3ZE1E 3QCTH 1A1MB 4LEXH 2W92A 4KPHH 5I8CB 1WZKA 1YUHA 3V52H 4Z6AT 5E2VH 4UDUB 1YDPB 4OT1L 5DEGA 2PYFB 3QHZH 2AK4E 3VRLE 3PL6B 4F15B 5HVHB 3ILQC 1CDUA 5DK0A 3VDBA 4NRZA 1MEXH 4OFYD 5SWZE 1AKJD 3E8UH 1V3JA 4DUWA 1FCGA 1WBZB 2X4NA 3VH8G 1U36A 4WUUB 5K9OA 12E8L 4TYUA 4YAQB 2PW1A 3F7VA 5C0GA 3MRQA 1S9YA 2PXYC 4OTXL 5E8PA 3FO0L 1G1YA 1E4XH 1I1CA 4L8CB 4R7DA 2Z91A 1JF1B 4HUUB 5CFHA 3BD4A 4Z7OF 3Q3GB 4X7TA 2CMRL 3OAYH 4OSUL 1A6WL 5HDBF 4PGCB 3RPKA 4L3EA 1UKQA 4LVEA 1RZJH 2BHYA 4Y5XA 5D7JD 3LKRA 4JFFD 4YXKH 4ONOA 4Z7UA 1T1YB 1A2YB 2Y06H 3S7GA 2Z4QA 4BH8A 4MJ5A 5EOCJ 3VWJA 5TH2A 4G9FA 1T0NB 1QBMH 1T04B 2BMKB 3P4MB 5EO0B 3O11A 1G9MC 1MCCA 4BZYA 3BP7A 3F7RA 3QWQB 2G2RA 1JYWA 1BAFH 3MRCB 1L7IL 5A2IH 3K4DA 3T4YA 4NBYB 4X8JB 2IAMB 1NGPH 4O9HL 1X5JA 4Y5YC 4OI8A 3QJHB 4DUVA 2R1XA 1N59B 1MCQA 4HPYL 3DETC 5LGJB 3WKML 1NUNB 3NMEA 3MBXH 1WIPA 4KHTH 1LP9E 2NY3D 1NGWA 3O3DB 4NHCH 3M8OL 4G8IA 1AHWA 4FFWD 1D9KC 4PJEF 4OZIA 3U0TB 4C58B 2R2CA 3O6FD 1AGFA 1I8MB 1AD0A 1U92A 4HX1A 4PJBF 3CAFA 3H0TB 3KPOA 2EYSB 1FFQA 3AB0B 1JI2A 1P7HL 2NTSP 4QHUA 1FAIL 4J3VA 3JTTA 5I71B 5TF0A 35C8H 4KUZH 1JHKH 3LEVL 1IBGL 1EO8L 2DQUL 5LJYH 2EH7H 2NY0C 3FO2A 3O8XA 1BHGA 3MCLL 3TO4B 3B8SA 2F54B 5IHLB 3HS0B 3OMZA 4YUEH 2IQ9L 3RZCA 4POYA 4DCQA 4XXDB 1WLHA 3B6SA 3MUHL 3QG6A 1XCQB 4PLOB 5FO9A 4HXAH 4MNHB 1TENA 4PJCB 1R5VA 1NCDH 2BSED 3F6IA 1CLYH 1CGSH 3JZ7A 3KWWB 1K8IA 1TMCB 5HPOA 3GRWL 4XP4L 5HYJD 3KDMB 4GS7C 4JFPB 3EGSA 3C60B 4JREB 1AKJA 1TVBB 2DQTL 3LQZB 4DZBB 1S7VA 5TE6L 3H9SD 2WP3O 4FFYL 1YN6B 3D39B 2R29H 2QSCH 4DGIL 2D31A 3GSWB 2NY7L 4ZXBC 1N4XL 5ADPH 2Y07L 4PRBA 4NUGH 4FQIL 3OHXA 2CRIA 3LV3B 3Q0HA 3TCLB 1W72L 3SE3A 4K3DH 1T2QL 5J56B 2Z92B 1I7ZB 4FQPA 4XMLL 1B3JA 2HWZH 1BQLL 2YD4A 3PWJA 2KKQA 3PNWA 4CU8A 3HKFA 5HI5D 4I3GA 5C08D 4EQ3A 3D85D 1MIEL 4LRNL 4UTAL 2HJFA 4JFFA 4MJ6B 4PJ5D 2B2XL 1I9RL 3RRQA 4F33A 5T3XL 1XGTB 2QADD 4KK6D 1J9CT 4LU5L 3ES6B 5F9WB 3MXWH 4U6HA 4LASH 2ARJQ 4Y5VC 3BISA 5L0QB 3T2OA 3ZTJH 1QLFB 1NGQL 1YA5A 3KXFB 4UOW0 2R2HB 1MAKA 3WO3B 3S96B 4B7IA 2J4WH 3C09B 5E8EA 3DX7A 5TGBA 2ZCKH 4F7MB 5TF1H 5JW4N 1NANH 3QO1B 3L3HB 1MJJB 4OUOA 1T7XA 1JZ5A 4P2QE 5GGUB 4JZOA 1AI1H 1BWWA 2QKIA 5IWLA 5CP3H 1U8IB 5IJKC 3IJYA 5JXED 1QO3A 4Z78B 2RQ8A 1F3JA 5EOTB 3NZ8A 1N0LA 3O6FA 4OD3H 4LPWA 3CPLA 4NKDA 4OCWL 5INDB 1SBSL 1GGIH 2UV3A 5C0BE 3X3GH 4WWKC 5HY9A 2JELH 1D5XA 1YJDH 4ODUA 4CN6A 3JVGC 2C4FU 1K5NA 2V7HA 3WUWB 4L8SB 4PRAB 1RIUL 4P59H 3I6GA 1E4KC 2X4PB 4P2OA 4YXLL 1NPUA 4CMMA 4FG6D 4QRUB 3PHSA 3W39B 3NCJL 2MKLC 1PLGH 1HZHH 3M1BA 4XP9L 2VDMH 2C3HA 4P9HL 2ATPA 1MAML 2XZQL 3DURB 3M07A 4KI5C 1AFVL 5TE7H 4U3XA 1A3RH 1K4CB 2XACC 4GMSH 4R4BA 1EUTA 4N0UE 4P48A 2HN7B 1NFIA 4LMQI 3BMVA 3S34L 1P9MC 2KQMA 2F15A 2V6HA 1UWGH 2OM5A 4NO3B 5HYJA 3BKYL 4XCNA 4JO1H 4L1DA 3QHFL 3HTLX 3QCVH 3ZE0F 3UTQB 5FHAL 3FB7B 3H9SA 2Z31C 3VXRE 1LEKA 4QRPD 2D7OA 4JVPA 4E41D 5HHPA 1YEDB 2XG4A 1EMTH 4NQEA 4QYOA 3GHEH 2NW2B 5ACMA 3BZ4A 1XR8A 5D72L 3IKCB 3P9MB 5GS0D 5KANG 2FHCA 2SEBA 3OAZK 1G6RA 3U0PB 1FNFA 4JHZA 3KPTA 1HSBB 3MRBA 5HHMD 3DRTA 2IADA 4U1IB 4C56B 4DN4L 3SY0B 4PY8J 5KN5A 3U48A 2OR9H 2Z93B 3G6DL 5C08A 3D85A 3NN8B 4OZGF 3DXAE 3T1FA 4AMKH 4DGVH 2HLAB 4LSTL 4LAQH 1TITA 3Q1SL 5EZLB 4RRPG 4J4PA 4G8GA 1ZV5A 1OGAD 4XC3H 5ITFB 1A3QA 3R0NA 1HDMA 1OTUD 1D5BB 1OARH 4G7YH 1A6UL 4TNVF 3FJTA 2EYTA 1QKZL 4RISH 2D0FA 2JTDA 1RIHH 3OX8A 3BI9X 3OR7A 3QIWD 5GGVY 3SKJH 1N7ML 4GRWH 3BRGC 1HYRC 4M3JA 5H35B 2ZUTA 3CSPA 5ILTL 1E0OB 4XNYL 1FORL 4Z18A 4K71B 4CBPA 1FIEA 1UM4H 2BVQA 4QHNA 1U41A 1BFTA 4PJEA 5JXEA 3GIVA 5AYUH 1S7QB 5J9PA 1KCRL 3P0VL 1UH2A 3K1KC 4LK4A 4PJBA 2ADJB 2EDYA 2DL2A 2GJ6E 4MXQD 3KYNA 4HK0B 4C83A 1HHIB 1YC7A 1J87A 1NQBA 3V5HA 5IB4B 3VGAC 3SDDD 1HHKB 1H3UA 2V17L 5ESQA 3QUXC 3TT3L 1AGEA 1F45A 1W0YT 4XI5C 1XF4A 5I66B 5SWQB 3SE4C 5E0QA 3SCMC 4TULH 4POZC 2VR4A 5E95B 2WWKO 1RIVH 1KJVB 4I48B 4ERSL 5C0IA 3QEUA 3ME0A 4TSAL 5J4MA 4JM2C 4ONHB 3X14A 3O6KL 4RWYH 2APWA 3O3EB 1OGTB 1M7DB 5F6IC 3U0WH 3TBWA 3OKLB 3VFVA 3VRJA 4L4VD 5EA0L 4TUKL 1JYNA 5F7NC 3MMEA 2DLIA 3LIZL 4KDWA 3IFNH 4F9PA 1WCQA 1ORQB 5I8EA 2VDLL 2AW2A 1CE6A 4E41A 2VL5B 3GZKA 3T0AA 5C70A 5I15L 2FJHA 1R0AH 4XGZA 5ISZB 2E8ZA 5GS0H 1BQUA 3OAZH 2DDQL 2IMMA 3V95A 3D3VE 2XTJC 4AEHH 2W59A 2C3GA 2XWJB 1FO0A 3LPGA 4OGAC 4NYLB 3LKSA 2R4RL 3FKUS 8FABB 5E2TH 1UA6L 4J8RA 3LMJH 1S7SA 1FFOA 5MI0B 3UCRA 4U6VH 4BELD 4Q9RL 4KTDL 4F7PA 1KG0A 3QDGA 5DJZA 4GAYB 4GAFB 3V6ZB 1KCVH 2BDNH 1DVFD 2AAVA 2ZSWA 4YZFF 2NXZB 4M7JH 3NPZB 1RMFL 2IPKB 2QBWA 2VLJE 2BVTA 2XZZA 4IMLB 1OGAA 2EDKA 4KKBD 1EBPA 4MSWA 4GKNB 4HGKC 5CGYC 4WU7A 2GT9B 3NFPA 5I16A 5DJYB 3MOAL 4QRRA 2OQJB 1VFUA 2Y9RT 2DMKA 2D4DA 2R0WL 2ADIA 1EZVX 1R6VA 5FAAA 4X6EB 2ARWA 1YPZB 3R8QA 5J6GB 4KDTA 5DSCA 5F1NB 3GEWB 1U3HB 3UTSD 5FKAA 3CH8A 1TJHH 3HZVA 3VXQB 1QSVA 4Z7NF 5EC2A 3WIIH 2F5AL 5J12C 2LE9A 5IMOA 3RU8H 1FL3A 3O4OC 4QNPF 4YGVA 5HI4C 5B4MC 3ZE2F 1HHHA 43CAA 1P4IL 3SDDA 5FYJD 3SDAB 3ZKND 2YMXL 2FBJL 3RUGE 2P8MA 1BZ7B 1QYGL 3H3KA 1JFQH 1E28A 3ARVA 2LU7A 3QA3A 3AREB 5D5MF 1LO4H 2G5BB 4OB5L 3QIBD 3QJFB 4YHOH 3U6RB 5BS0A 5CSBA 3C87A 3R06A 4O4YH 1KJ2A 3OKMB 4EUPB 1MI5B 5IGXH 1WCBB 1KIPB 1U8LB 2ESVB 4LSQH 2HT4D 5C09E 1XIWD 2GY7B 3DUHA 3CC5A 3A6BH 1JN6B 2ICES 4CVZB 1WEJH 3N85L 4NZTL 4NIKB 4Z76B 3BHBB 1A0QH 2AJVH 4RGNE 3AGVA 3UTTD 3C8KB 3QPQC 3TV3L 4YHNA 4RFEA 5ALCH 3PWUB 1U3JA 3CDGA 3MJ8B 2WWMC 2J8HA 1UXSA 3ARRA 3EOAA 3E6FB 1AQDA 2VLRD 4GSDH 4JG0H 5J13C 4MA1C 2OLDA 3BIAX 2F58H 3KNBA 3DECA 4G80B 3SDXF 4S1DC 4MA7L 4XCCL 5LGHH 5EU6D 4HWZB 3MYJA 3DO7A 1I8KA 2A77L 2IPUG 1OHQA 4M6OH 3ULVL 3V0WH 4IIQB 3L3IA 2NZIA 5IT2H 4MA8L 4JY4B 1D5IL 3DGGB 4HDIA 5LAXA 1M7IB 4X5WB 1J86A 4Q2ZA 4CUCA 4NSKA 3QAZB 3RWCA 4Q0XH 1BJ1J 1UG9A 3WJJC 1T3FA 3WNMA 2BRRL 3KHQA 1HIML 1X6LA 1IC7H 2C4FT 2PYEB 2R9HD 3TYGH 3IJSA 2EIDA 3BX7C 4OZGA 4YQXH 2ZUWA 4BJLA 4PJ9C 3GJFA 4LEXL 3LKPB 5DVOA 4UTBH 4GW1B 5J57B 5E2VL 3RL2B 4X0KA 5L8JB 1FCCA 2VO5A 3IFLL 1EEZB 4OLUH 5T1DH 1CT8A 2DYPD 3MV7B 4Q9CA 4WW2C 1MEXL 5ITBH 2P8LB 4M61A 4WEMB 5IQ7L 3O41A 5DMJB 2D0GA 1ZS8B 2DIJA 3RVXC 3C6SB 3ARTA 4B41A 4GKZB 4X5LA 4UV4H 5IB5B 1MJ7L 3UTSA 5JA9A 4BQBA 4WI3A 2Y5TB 4D0DA 4OI9A 4YDJB 4BZ2L 4Y1AD 5BRZB 4TVPD 4BFIB 4L9LC 3LS5L 4LSUH 5FYJH 4U33A 4CNIA 1XF5A 2OK0H 3S36X 1DBKH 1UYWH 3RP1A 1BD2D 3PWPE 3OJMB 4JANB 1FL6A 1C12A 3OKKB 4YXKL 4ZO8A 3OB0H 1Q9LB 1TQBB 2Y06L 2Y6SC 3F7PC 1WUNT 3SDCC 1UZ6E 3O45A 3FL7A 2IPUK 2UWEF 2AV7A 3ZDYE 1XIWA 4U1NB 1GAFH 3D0VA 3MJ9H 4AJ0A 4DQOH 2NXYD 3P40A 1FFNA 1QLEH 1IFHL 2DLEA 4LBEA 5BJTB 3D0LA 3BT2L 3MJ9A 5D2LB 3UTTA 3RWFA 5I8OH 2XPGB 3CVHH 4Z7WF 2GSIA 1S8DB 1RVFH 5CKAA 4RIRB 3PV6B 3TN0C 3GSUB 5J1TC 5HGAB 3P4NB 4FQHB 2VLLA 4MD5A 4KHTL 5H37H 3CVHA 2JJTC 1NCAL 2HTLC 5EU6A 4XNUH 1PX4A 2PXYB 3A6CH 4MNQB 4DVRL 3MFFB 4FQQB 2KQNA 2X1QA 1FVEA 4JPIB 4LKCB 4MCYB 1XF1A 4WHYG 5L2KD 3T08A 4KKNA 3LKOA 1JHKL 4JZJA 3QQ9D 3UPCA 3F58H 4YO0A 1YY8A 4OIAA 2O61B 3EKCA 3HRPA 4KK5D 4HS3A 2C26A 3K8KA 1G0DA 1YYLL 3ARFD 1CCZA 1J1OL 2RR3A 3TVMC 3ZYIA 1FNEA 4Y4FA 3RGVA 3V4PL 4IRZH 3UYRH 4HXAL 3EOTH 3KPQB 4FHBD 4PJHF 4X9FA 1T22B 4YJZL 2X89D 1NCDL 3T0EC 2X7LB 3PIQA 3WL9B 4I3SH 1HSAB 1CGSL 4J3SA 2AABH 1P69B 5E2WH 2DBJA 1GGTA 3EYVB 4GBXC 1D6EB 1ZA3B 4MWFB 3D2UA 4Y5YB 5ABDE 3QEQB 2MCG1 1MF2H 2EDWA 3TJEL 4UV7H 2DF3A 4NQCD 4HG4K 2VSDA 1MFCH 5F7YC 1INEH 5JZ7C 3W11C 2VABA 1IL1A 1KYOK 2OCFD 1SEQH 2ERJC 5ANMB 4Y16C 4NCC2 1P6FA 3MREA 4PJ8A 2PR4H 5AZEH 5IESH 1D9KB 2BNRB 3FCTB 2QQNL 3EO1A 4NKIH 4Y1AA 2ATKA 4JFOA 3BEWA 3OPZH 3MLYH 2B4CH 3TIDB 5IKCB 15C8H 1LILA 4XXCA 3G5VB 3UDWC 4K3DL 1NL0H 2W0PA 4A2LA 2XZAL 4YPGA 1BFOB 5E9DD 2YD7A 3AS0A 4J2XA 4RBPK 1J11A 1R3LA 1YMHA 4XTRD 2GIYA 4D2NA 4RZCB 3BN9D 2I26N 4UMGA 3KS0H 1QQDA 1S5IH 2NY0B 5D5MA 5K9JL 5I1CH 3HFML 5T1MB 2FX9L 4HIIB 5GJSL 1RUMH 3E2HC 3MXWL 3VXME 1JBJA 3VW3H 3FTGB 5D7LE 4ELMF 2A6IA 2RIKA 1UM6H 1HWHB 3V7AE 3IS0X 4O2FA 1G7LA 1KGCE 2MSPA 2YK1H 2ZCKL 5TF1L 4UBDD 2Q86A 1MWAB 4LCUA 3GSNH 2GTWA 2J6EH 5CILL 4NZRL 3FO9B 1MFAH 2BVOB 4GS7B 4HC1A 4YHLH 4D0CA 4TOYH 3MRGB 3AC0A 3GSNA 1NCWH 3JBG7 3U4EA 4HHAB 3BZDA 4U3HA 4P5TC 3SDXA 5HGHA 3QDJD 1N8ZB 4JRWA 4P4RA 1GZQA 3HMXA 4YHIA 3ESVF 3VFNA 5TPWH 1J5OH 3LSOA 4ZXBB 1YJDL 4PYHA 5AEAA 2OP4L 2I5YL 1T7YA 3B9KC 3CXHK 2DWDA 4KKCD 4PJAF 7FABH 3O3BB 5F7WC 4LVHC 5H94B 3CXDH 4P59L 2BJML 4JVUA 4E5XB 1WWAX 3L9RA 4JM4H 4M5ZH 2BSSB 1G1CA 1HZHL 1KTDA 2EDJA 2VDML 3QQ4A 1U0QA 3PDDA 3Q6GH 4U6YA 3ZT5A 3V4UH 1Z9MA 4N9OB 2AEPH 4FFVD 3BMWA 5TE7L 4NUJA 1A3RL 2A73A 2EDFA 3T0WA 3UYOD 5E8NA 5FECB 4GMSL 1UM5H 2XZCH 2E27L 1I4FB 2X89A 4Y5VB 3QH3B 5JW5B 4CKVX 5M94B 4Y0GA 2HG5A 3GHBL 3MLWL 1UWGL 4LIQL 1YMMA 2CD0A 3P4OA 4WI8A 2YSSB 2IFFL 4BUHA 1R3JA 2NY1D 3GKWH 5JDSB 4IEFB 1P4LA 1XGPA 3IU4L 5DUBB 5E5UB 5SWSE 2BERA 1QEWA 4O2EB 4JFDB 1JRHH 1T89C 5LXGH 1LD9A 1RSFA 2H32A 5KG9A 2VITB 4BZ1H 3E0GA 5CJOH 1G6RL 1D5ZA 1SJVA 2AJ3A 4MD0A 5C0JB 4KZEH 1UENA 3KPSE 2EEDA 2VZTA 2YD5A 4WWKB 3FN3A 3CFKA 2VSCA 1U8KA 1QNZL 3FFDB 3HG1D 3V0AC 5IVNA 4L4JA 3R4DA 1T5XA 1IC4H 1DE4B 3MJ7A 1I8LC 1CS6A 4OZHF 4RGMC 1EFXB 4HIJB 2F74A 4JFZH 2OR9L 4GRLA 2Q20A 5DJ8B 1BBJA 1HCVA 4NN5C 5C92A 5KSUB 5C0FA 2NX5B 1T66D 4AMKL 5I1AA 3I9GH 5IB1A 3TFKC 4DGVL 4DKDC 1JHLL 1S7RA 4WHYH 2UWEA 3HMWL 4X6FB 3MV9B 4PP2B 4HKZA 1J18A 3BUYA 2EIZB 4HUMB 4XC3L 3P77A 4W6XB 5DJ2A 5FXCH 2IAND 4EI5D 1BZQK 2VDQH 2VZOA 3N9GH 4G7YL 2YPLE 1G9NH 4L5FH 4ZOEA 3O9WC 4LCIL 4RISL 5DVKA 1RIHL 2IC2A 1HQRB 3H7LA 4Z7WA 5IROC 1K9TA 1MVUB 1G9EA 3UMTA 4XH2A 3BGFC 4PRPD 4BKLB 3K4ZA 1AE6H 3QI9C 1NAKL 1EO5A 1GGUA 2Z31B 3PV7A 4YHKH 3FONA 5GZOD 4FXKB 3QDJA 3IF1B 2DTSA 4HJJH 1I75A 4R3SA 3UTPE 5B38G 5DMGD 4R8WH 3V8CA 1Z9LA 3WEXA 2LABA 5DJ6B 3IJHA 1J12A 5FM5O 1T0MA 2NQCA 1FGVL 1JNLH 4D9QE 1A64A 2GK0B 3UEZA 3X11A 4L29A 5E00B 4IS6A 5DK3A 3BKMH 2CUHA 4U1KA 5HI3D 3RHWF 4NHUA 2CH8A 4XVJH 5DVLA 2BCKB 3AM8C 4JRYB 1IGYA 1T80A 5EWIL 4LP5A 3GMMB 3FRUB 1JGLL 1F6FB 1RIVL 1FVCB 4N5UA 3EYOA 5BW7C 1QHPA 4LVOC 5C6TH 4RWYL 3BP5B 2P5ED 5D2NA 5DC0A 1RZKC 1ZA6A 3UC0H 5JQHC 1P84J 3QXWA 3LB6C 1CWVA 5MERB 3H8NA 2IH3A 4P3CH 3FO1B 3RKDC 3RY4A 3MNWB 4H26A 4JFYA 2VLME 4OGYH 1NGXB 3TBYA 2Q6WA 4I9WD 3QZWA 1FO0L 1R0AL 1KULA 5GS0L 5KSBB 5E24E 5FYLD 4HSQA 5EUOE 5KVMC 3G04A 4KJQC 1UEMA 1QPPA 1IAIM 4OLVL 2E7LC 4AEHL 1DL7L 1II4E 2APVA 2GEEA 1RUKH 2EECA 4FN0A 4JJ5A 1WV7T 5E8DH 5E2TL 4D3CH 4BFEA 1HHGA 3T0DA 3HG1A 3HZKA 2R2EA 1NC4A 2BNUB 3S88L 3VGAB 1C1EH 4Q7DA 3VWKD 1NUGA 5C07B 1KCVL 3QUXB 4LLWB 2W1NA 4LCWE 1GOFA 4EVNA 1A6AA 2ZJSL 1Q9WA 2XA3A 5IFHH 1FE8H 4MA3B 3SCMB 3U4BH 2ADFH 3DIFA 2XT1B 4OD1H 5F88B 3DSNA 1BJMA 1OOAA 4Q9QL 4PREB 3HCVA 3OZ9L 4ELMA 2DMCA 2HP4A 4JM2B 2ZKHH 1TPXC 2IANA 4EI5A 1VFAA 2FWOA 4U6XA 2DKMA 4K8RC 3DSFL 1TNNA 2B7DT 4WFGD 3FT2A 5F6IB 2E3VA 3K0WA 4S1QH 3BZEB 3VD3A 1J0YA 4ISVB 4NNYA 1A6ZB 4WJ5A 1JMXA 1CLZH 1OAKH 3GUTA 1KENH 4PRPA 3WXVH 5FM5M 3QUZD 5E08H 1CF8L 1OY3B 5D7KE 6FABH 1T5WB 5A2KH 5EU5A 1TJHL 2O5YH 5JMRA 3OJDA 3QFDA 3WIIL 5KS9F 3RTQC 1X5XA 4WU5A 5ECJE 4OF5A 3RU8L 5BV7H 1CDJA 5LCVL 5C0ND 4ZMAT 2NTFA 3BH8A 4MVBD 2XTJB 3OWEA 2EKSB 4H0HB 4PJAA 3TIEB 3VG0L 4M5YH 4JDZB 1ZEAH 4EN3D 4OKDA 3JWDH 1OTTD 1GRWA 4HMDA 1KJ2L 3V0VB 2ID5A 2H3NB 4Z95L 1NMBH 4NFBA 5I1LA 3U4AA 1S5HA 1Q72H 4O4YL 3RPIB 4GLRH 1PEZA 3W0WD 5HVGB 5IGXL 2VLKB 3TCXA 1NEZG 3MGAA 5HHOE 3C08H 4S2SB 4UIKL 4H88H 1PX3A 2R2BB 3SN6N 2CQVA 4M4PA 1A0QL 3JV6B 4OUUA 5FB8B 4OV6F 4RA0C 5F3HB 1RD6A 4OKVA 1CGXA 1ZAGA 4GSDL 4GG8B 3RVVD 4TUOA 2F58L 3DJ9A 3QRFM 4F3FB 1HWGB 3CX2A 1NLBL 5FYLH 3WFEH 3V5KA 3MRKB 4OQTH 3SBWC 1TJIL 1KUMA 3QSKB 1WWBX 3EDDA 1AD9B 4MMZC 1IGIH 4XPHH 4CRPA 2XKNB 3VDCA 2GJZA 1OCWH 1F3RB 5IT2L 4HEME 2V2WA 4L3EE 5J12B 4ETQA 3BEVA 1OAQH 5GS1C 3O4OB 5FK9A 2XOTA 4G9FE 1JPGB 1CD1A 5EO1B 4YHYC 4OZHA 1KJMA 3L3GA 3VWKA 3RI5K 2YRLA 4LCCA 4YQXL 2EE6A 4IOFD 2J8UB 4ZD3H 5I1KH 4XVSL 2FSEA 1S7TB 1A3LL 4X6DB 1T03L 3C5SB 3SE8L 1LE9A 4I3RL 3U9PL 3RX5A 3B3IB 5L2JA 5IMMA 1AO7D 3CFIC 5K59F 4OLUL 3G08A 3WIFA 2DTMH 4OGZA 4JHBA 5CMAB 3IFOB 4I4WB 3JSSA 3W5MA 3GMRB 3GBNH 2VN7A 2OZ4H 1DTUA 2ED8A 4X4XA 1INDL 3H7BB 2UVEA 5CINL 3MRFA 2HFGH 5J13B 4MA1B 3S36H 4HIHB 3MGOA 4KY1H 5CEZD 5LG1A 5H2BB 4BYHA 5MEQA 1V7NH 2P46B 4ZUTB 2IJ0C 2DOCA 3DROB 5AAMA 1KCUL 5IHZA 4LSUL 5FYKU 3KYMA 4NZJA 4Q74A 3REVB 1F11A 4HULB 5K9QI 1DBKL 2OSLB 1UYWL 2RAMA 3MODH 1PAMA 2FRGP 4EN3A 1GPOH 5GGVH 1BQHA 4YDVB 3BXNA 1XZ0A 4MQ7B 4BFGA 2CDFA 1CVSC 5FO8B 4HZLA 3VFTB 5D71L 1LO0H 1MRFL 5D7SL 5F7UA 3WNOA 2X4UA 3KJ4C 2I9LA 1NGYA 3NABH 5F8QC 1GGBH 3W0WA 4EI6B 5CEYA 1ZT4B 2F53D 4N1EA 3MJ9L 4DQOL 3BE1H 4PJ9B 1QLEL 3HC0A 1KPUB 1IGJA 3BIKA 3QCUH 1OF2B 2XY1A 4Y2DC 5IBUG 5KSAC 3S37H 3FQRA 2X41A 3CFBB 2RFXA 5I8OL 3CVHL 3GIZH 1EVTC 1RVFL 4G43B 5TJWK 4R90H 3IRPX 4WW2B 1NC2B 1X5HA 1K85A 1F4AA 3MRNA 2HTKC 4DKFH 2AXHA 4MYWB 3MRPB 4ZTOH 5LQBH 3P73B 2X4TA 5BVJA 4XNUL 4MHHI 2JB6B 5SWZB 2D7NA 3A6CL 4RAVA 5DJAA 4K9EH 4V1DD 5GSRA 1RK0A 4KRPC 4AQOA 5SX4I 4JFFE 4L9LB 2IGFL 3VXPA 4APQC 2MHAA 5D8JH 3F58L 3VFUB 3WS6C 2CIKB 4GH7B 2H2PC 5ACZA 4M8QB 2YD2A 5T5FH 1ZHLB 4PJCF 2OL3B 1EXUB 3ARDA 5EUKB 2DQFA 2OJEB 1PW3A 1PKQE 1MLCA 4XNQB 1ZLSL 1R24B 4NO0D 3PL6D 4PLJC 2PO6C 5A43C 4M4RA 1XH3A 4WI9A 3ZO0A 2DM3A 3SDCB 4UB0H 3PGDB 4U1SB 1QFUL 4UNTA 5GGQH 2O5XH 4A6YH 3BWAA 1GSMA 4XBGB 1ZVYA 1S9VA 1AO7A 4AEFA 3DX6B 3WYRA 4WUUD 3T04D 3FB6A 2XIDA 5ID0A 2AABL 5C8JA 1AGBA 4A6YA 4KXZI 4KK8C 1GXEA 4YR6A 3NIDE 4AH2B 1B2WL 4UV7L 5ERWA 5CEZH 1MFCL 4PRIA 4O2CB 3TN0B 3IFPA 1XGQA 3HE6C 5FF6A 3T3PF 2VJXA 5A2LH 4HKJB 4TVPL 3TGXA 3VFGH 5AZEL 2DD8H 4N5ED 1MCBA 3HN3A 5KS9A 5F7DA 5DJCB 3MLYL 1LEIA 3S4SB 15C8L 3FQWA 2CXKA 4YDKH 1JPFB 4M03A 1JNJA 3ZE1F 1OD9A 5CCKH 3CFJB 3ARGA 5JHDB 1OTSC 1FNSH 1I1AC 1K6QH 5I30L 3BGMA 2PF6A 1UB6A 3PJSA 3BO8A 1YY9D 2G75B 2IAMD 4HWEH 5I8KH 1RUML 2VMFA 3AXLA 4I5BA 3VW3L 2F53A 5HYJE 5EBWA 3TVMB 1T1WA 4QO1A 4P9HC 2WWKT 2P8PB 5A16A 4JFEA 4QCIB 2YK1L 4NCDA 4NJ9L 4HC1L 1B0GA 3H9SE 3T0EB 1W0VA 5F93C 5DMYA 3ZZ1A 5GJTH 2IG2H 3GSNL 3HUJE 1C7SA 1CD9B 4GBXB 3UROR 3LN5B 4QY8B 4WDIA 4HK3N 5AUMB 5GRVK 4MCZA 1NCWL 3HMXL 2W65A 3QUMH 3M17A 1BVKA 5FA4B 1NSNH 4GQPH 2ERJB 4N8VA 1MHPH 2HAZA 4Y16B 4Z7OE 4XWGL 4K7PY 1NAMB 1UZ8B 2BSTA 5I75C 1K2DB 4C4KO 1Z5LB 1HHJA 5CD3B 2F54D 5I17A 4PGEA 5C08E 4ONGH 2DLGA 1SVZA 7FABL 3RVUC 3D9AL 4HT1H 4U6TA 2DICA 4PJ5E 1AIFB 1N64H 1NUDA 2I27N 4M5ZL 4EOWH 1JZ3A 2A2QT 1B0RB