5T3ZH

3.5 angstrom crystal structure of a fully and natively glycosylated bg505 sosip.664 hiv-1 env trimer in complex with the broadly neutralizing antibodies ioma and 10-1074
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
235
structure length
230
Chain Sequence
QVQLQESGPGLVKPSETLSVTCSVSGDSMNNYYWTWIRQSPGKGLEWIGYISDRESATYNPSLNSRVVISRDTSKNQLSLKLNSVTPADTAVYYCATARRGQRIYGVVSFGEFFYYYSMDVWGKGTTVTVSSASTKGPSVFPLAPSSKTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160
publication title Natively glycosylated HIV-1 Env structure reveals new mode for antibody recognition of the CD4-binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 31
structure length 230
sequence length 235
ec nomenclature
pdb deposition date 2016-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t3zH02
1SEBA 5LCVL 4NZDA 1VFMA 3NMEA 5DUPL 2NYYD 5ICYB 2MCG1 3MRPB 3FQWB 3FJTA 4PJCF 5JOPD 3BJLA 4OZGF 4OCYL 2OR7A 4XRCA 3EAKA 4JRYD 4ZG1A 2PXYD 3P0YL 4O02H 2XN9A 5CJQH 2VZVA 2FGWL 4NQDE 5GGVY 4U6HB 2FWOA 3QEHA 1KXVC 2IPTH 7FABH 2YRPA 4LLMB 5IROC 3SDCC 2BY2A 3HAEG 5I30L 4EXKA 4NPYB 3K8KA 4N0UA 5E2VH 3QFJA 4L9LB 1JNNH 5E94B 3ZL4L 1YMMA 4NRZB 1RIHL 1FYTE 4HKJA 4IRSA 4KHTH 5TDOB 4U6YA 5JHDE 4X99B 4OBRA 4APQB 4ELMA 3CDCA 4RWHA 2ZCKL 4OCLC 1A7RH 3VWJB 1VESA 1LD9B 3G5XB 3VRLE 1A14H 3NAAL 4HJ0D 3HMXH 5IFJB 1N7MH 4WWKC 5GGRA 5H8DA 2Q6WA 3QCUH 1JTOA 2QQQA 4FXKB 3WHXB 1VPOH 4U6XA 1NFKA 1Q9LB 3Q6FB 1XIWD 1BQHB 1WIOA 3MYJA 4PYGA 4Y2DC 3PWPD 3O45B 1QHPA 1YEFH 1WBXB 5ITBH 1ORSB 3SDXF 4RRPG 3SDAB 5GGSY 3MR9B 3TN0B 1NQBA 3R06A 2Z91B 3SDCA 1FG2B 3EO0B 4WU7B 1ZLSL 2JB6A 4GKNB 4HUMB 5ERWA 5GXBB 1OAZH 1M05A 5BJTB 5MEQB 3R4DA 3WFBL 3CXDH 5GS0C 4FQHA 3GSXA 4N0FB 1CICB 4V2CB 5FHBH 3FFCB 4FTVB 3UBXG 3OKMA 1FAIL 4W4OA 3HC0B 5TF1H 3WNLA 1NCUA 1KB5A 2NXYD 1JP5A 4FG6C 4WWKA 4PG2C 3VXUB 1PKQE 1BFTA 5FGBC 1DBBL 4G8EA 1A22B 3VXRD 1JCKA 3LKOA 5HHQB 1CU4H 1J0KA 3AS2A 1M6OA 1G7PB 1X5AA 4Y2DA 4ZTOL 3OAZK 2UYLA 5BRZB 1CD9B 4GBXD 3CLFH 5T1DL 3DVGA 4HAFA 3OWEA 4GQPH 1WFTA 3P77A 5HI5D 1EBAA 5C9JB 3BKMH 5CLTA 5E4EC 3K4DA 4R96B 3U36B 4J3WA 4K07A 5E2WL 4D0DA 2X40A 1F3JB 4NUJA 2YUXA 1L0XA 4PJFA 5C2UB 3HTLX 5F7UA 4WW1B 4BM7A 4E5XA 1TCRA 3D39E 5H2BA 3IKCA 3LKQB 3MNVB 1U92A 4KVCL 1U91A 1BD2A 2BHYA 3PQYA 4Z7UA 3OJDB 3VRJB 3VXSE 5F1IA 3UP1A 5KVDH 5D2NC 4NZTL 2DD8L 4CVUA 5A2KH 1G7QA 3MOAL 3QQ4B 2VLKE 1A3RL 2OI9B 4PG2A 5MHSE 1PG7H 3Q1SL 1S7XB 5DJZB 1FO0A 5FGBA 3VG9B 1CN4A 5J13B 1AGFB 2FRGP 2VDPL 3TT3H 5EZJB 5I71B 1OQXA 4XVUD 3UDWA 4N9GB 1FZMA 2NY1B 4KTYA 5D1XA 5JR1L 3UTOA 4LQ1A 4NCC1 5C09A 3B9KD 5E2JA 4LBEB 4LSSL 4NQVB 2X4RB 3NA9H 2VB5A 3O4LA 2CRYA 3TA3D 3HMWL 5T3XD 2VWEC 3T2NL 8CGTA 4WHCA 1N6UA 2WLYA 3BKJH 1AGBB 1ES0B 5FM4A 4U1HB 1DBKL 5J1TC 5KTEL 2X1OA 1U6AH 4MNHA 4UV4H 4DQOH 2OBGA 3MV11 1G6RB 3MLWL 3WJJC 3UJJH 3RU8L 1ODAA 2E9BA 4EXPX 2AK4B 4RMQA 1LO5A 3QPQD 3QIBB 4NWTH 3I9GH 5D2NA 5IW6A 1ZLUH 5BS0B 2BNUA 4UTBL 1M7IB 1WT5C 3O9WD 2EIEA 4GSDH 3Q2CA 3IDUA 1OVZA 3MUY1 4LPYA 1AJ7H 5SX5H 5MENA 4KI5C 5IBLC 4AQOA 4PY7A 3ULUD 5HYSG 1EO5A 1H9VA 2OXHA 4NQTA 2OR9L 5DMIH 1GRWA 1ITBB 3CH8A 3U6RB 1LK2A 2HKHL 5TE6H 1Q0YL 4MHHI 2G60L 1KC5H 4MNGA 3MO1A 3S35H 4P2RE 3P73A 4NM8L 3EOBA 4KK5C 4X6DA 1JFQL 3FQNA 5E5UB 5D7IE 4XNQB 1HHKB 3RWDA 3L1OL 3DI3B 1MJUH 2DM3A 3CVHL 2DJ4A 2I9LB 4G6MH 4NDMB 1R3HB 4NBXB 5DZOA 4D2NA 1RY7B 1UB6A 4YHYC 1GZQB 1CYGA 4PS4H 3WJJA 1C5BH 5DMJB 3D2UD 4PD4J 2XY2A 1UWEL 1J12A 5C0BA 4BSWB 3HI1B 4H25B 4XP1H 3QZWA 3FT2B 1N4XL 2FBJL 2UUDH 3LEXA 5CCKH 4HHAA 1WT5A 1A6ZB 5F7WC 1S7TB 2Q3AA 1QZ1A 3K4AA 1RUPH 1VFOA 1MF2L 1MI5A 5D1QD 1QFOA 2AGJL 1QA9B 3ARFB 4R2GC 2Z31B 5GHWH 4HDIB 3JZ7A 3RP1A 3BXNB 5HYEA 3U4AA 1Z3GH 3UO1L 1ZGLP 3LMJL 3IDXL 5FM5M 5TJWK 4QHMA 2BP3A 3O3BB 1P2CB 4XPAL 1J8KA 4KTEH 1LEGB 4MXVF 5JIHA 1DQJB 1EO7A 2P44B 3O41A 4QHKJ 3GFUA 4YDVA 3U2SB 3EDKA 4JM4H 5K59F 3G5YA 1GZPA 2H45A 4QRPD 3GUTB 3S96B 25C8H 1MHPH 4JN1L 1J9CT 2VH5H 4XPTL 2UWEF 1GGTA 4L3AA 2ADIA 3R1GL 1ZEAL 2AJSL 2YK1L 3STLB 4JM2B 5L9DL 1F58H 3QEGH 3VGHA 3HZMA 2D4FA 5CZVL 5KVGL 4NZUH 5ESQA 1QSEA 4K2UL 4ERSH 3QQ9D 1AH1A 1T1ZA 5ITFB 1S9KC 5E00A 5DJDB 1HHHA 4Y4KA 3CGTA 5GGVH 3T1WA 4P23A 3VFSB 4TRPH 4ZXBC 2E6PA 2DWDB 3V5KA 1A7NL 1CDBA 3FB5A 1KULA 1DN0A 2H26A 4QLRA 1KGCD 1F42A 2ICWJ 4HUWB 4XVSL 3VFTA 5E9DE 3AS0A 5I9QB 1FL6B 3GHBH 3CFBB 1IKNC 3VXPB 1CZ8H 4NHCH 3DO7B 5I1AA 3D0LA 2JLLA 4O4YL 4XBGA 4JO1L 1OL0A 1D6EB 2XQYK 4LCWB 1JGLL 1WCBA 4X8JB 1JL8A 5DK2B 3BT2H 3T3PE 3I6KA 4N9OB 4R6UA 1OGAA 3G6JE 4Z78A 1E28B 5I2IB 4PJDE 2DIAA 4MD0B 2P42B 4E41A 2I9TB 3IXAB 5FO8A 4KI1A 4HT1H 2AI0H 1I9IH 3ARQA 1JVKA 3WIHL 4XPGL 4F7MA 4RAVA 1BFSA 4H0IA 4TSCL 4OUOA 4FQPA 3VRIB 2WWMD 4PJ9C 4YDLB 4HGMA 3OZ9L 3QDGD 4JQVA 5H35A 4HH8A 3MRLB 1JZ6A 1IKNA 1R5WB 1ZHLB 3QUXC 2XY1A 1WEJL 1AP2B 5IB3B 2EYSA 1I1FB 4G7YL 3OB0H 2GJ6E 2IEPA 1CK0L 2VITB 4WV1C 3WHE0 1YECH 3EHBC 3BPCB 2VZ3A 4POZD 4Y16C 5DHVH 1ZT1A 1SYSA 4X0KB 2BVTA 2PW1A 3QUKA 5J1AB 4PJCA 2E3VA 4OZGA 1BEYH 4YGVB 5D70L 3KPPB 4Y5XB 1ZE3C 4XP5H 4MNQA 3VH8A 5D2LF 1LO4H 3D18A 4QRTA 3Q0HA 1A4JB 3ARGD 3SQOL 4QRQB 1A1OB 2FECI 1RHHA 2R1YA 4N0YH 1DQMH 3PHQA 4PJ9A 2VLRE 5EO1A 2VXTL 3HUJE 5D7JC 4UB0L 4JFQA 1G7HB 4TOYL 3MLPA 1JWUB 1JYXA 2BSRA 1XFPA 3TO4D 1CLYH 3QUXA 4WHTB 2AABH 5TGBA 1KLUA 1S78D 4PJIA 3TESA 5DS8A 2NR6D 1GL4B 3TT1L 4NRXA 1RZJH 3KXFB 1MCDA 4JN2A 4KJQD 1XGTB 2AXHA 1F8TH 2FLBT 4JRXD 5EU6A 5L6YL 5AWNH 3SKMA 4BSVB 4JHAH 3BP5B 1RZKH 5CJOL 5KN5A 5CWSB 4OCWH 4Q7DA 5JDJA 3DX7B 4NJ9H 5AAMA 5GZOC 1TIUA 1CDIA 1CVSC 2ZUWA 3WD5H 5C08A 1C7SA 2W0PA 5FUCE 4HCRA 4M48H 4ONFL 5EOQH 1MWAL 1BAFL 4LLQB 5EC1B 4P3WA 2EE3A 3SDXA 2RAMA 3TNNB 4HG4J 2A9NH 5FYKH 1NC4A 1KCRH 5DK0A 2FIKA 4L8SB 4EUPB 4IOFD 3CU7A 1KTLB 5JTWA 2V2XB 2LU3A 3WUZA 1NSNH 5I75B 2XN9D 2IF7A 5DRWA 1PX3A 3ARDA 3EZJB 3S4SA 4IS6B 4H88L 4I2XE 1MHEA 1FNAA 3QUYD 4UAOC 4S2SB 2WNGA 3R0NA 5MP6L 2V2WA 2JELL 4LFHG 1WCQA 3MRDA 1RK0B 3SCMC 3OX8A 3QFJD 3L7FA 2NY0D 3BJ91 1KNOA 3K2UL 5E2TL 1NDGB 3BH8B 4U1JA 1N5AB 3V5HA 1KCSH 4QNPF 4I0PB 1JZ5A 4OFPA 3E1F1 3HZVA 2JIXB 2DQFB 5IB5A 1T7VA 4R4BA 3SGDH 3F7QA 2DLFL 4XC1L 4F2MB 3RL2B 5LWYL 4UT6H 2ERJB 2B0SL 2ADJA 3LRSA 3SOBH 1AGDB 4KKNA 3SQBA 4AIOA 3VFWA 4M6OH 1KBGL 4JFXB 3MROB 4U1SA 4YHOL 3CMOH 2YMXH 3KVQA 3LSOB 2X7LB 2GFBB 3HAEH 5D1ZB 1LO3H 3IFNH 3V0AC 1PX4A 4LPCA 3NN8A 5DDHA 1AFVH 4H8WH 4F15B 1H0DA 3FO9A 1I7RA 1IGTA 3SDCD 5MERA 1JF6A 2IG2H 4GW1B 1QR1A 1F6AA 4YXLL 2NW3B 2BNQB 4GW5B 3SCMA 5FCUH 4I0KA 2R8SH 2H2PC 3BPLC 5JHLH 3O4OC 3FN0L 3VWJD 4X4ME 5CJXC 5E5MB 1ZTXL 3SKJL 5L2KE 3RZCB 4OI9A 3QG7H 4LSQH 1N6QH 1CD0A 2AXJA 3MTRA 4LVNB 4NBZB 4Y4HB 3MV8A 3GHEH 1KCUL 4J3XA 5I19L 4K3GA 3FO0H 4Z5RA 3B9EA 1CGWA 4WWKD 5DJ8B 1KACB 1G7IB 2X1XR 3G9VA 4F8TA 2ILLA 1P7HL 1UWGL 3N85H 4JDZB 1QACA 2PCPB 1QPPA 3CX2A 4Y2DD 3DTXA 2YUVA 3EDJA 4WEBH 1IAOA 1JHTB 2BSSB 4CVXB 2QADC 1E6JL 1IAKA 3X14B 4I77H 4O2CB 4JZNA 4PUBH 4XB8A 1FFNA 1A1MA 5CIPB 5AG8A 1MJ7H 3SBWC 1C5CL 4UTAL 2B4CL 2E8YA 3RKPA 3D69A 4LEOA 1UA6L 3MXWH 3BHBB 4OKVB 4LSDA 5JXED 4DGVH 2BSTB 5D4QA 1JGVL 5GS0D 5CJXA 1KUMA 2ZSWA 4GRWH 1YEDA 4Z9KB 4KY1L 4NQCA 2Q8AL 2PTUA 5L8JB 2A9ML 4LSVH 4CRPA 4JFEE 4PB9H 1I9EA 1MFBH 1RUAL 1AD0B 2HRPH 4HX1B 1K9TA 1X5JA 3KJ4C 3NIGF 3ILQC 3S7GA 2BERA 1NCAH 4WNQB 2W0LA 3HC3L 4U6TA 1EFXB 3EOAA 1Q94B 1YY8A 2FEDC 3V7AG 3QJHA 4HKZB 3TZVB 2HJLA 1MAJA 3FKUS 3IFPA 4KZEH 4GAFB 1PYWA 3EJYC 4I4WA 4YXKH 3MJ8B 4M4RA 4ELKB 5C09D 1FL3A 2OQJB 3HG1A 2I07A 4KPHH 5ANMA 3SBWA 2H9GA 5EA0H 3O4LD 3EO1B 4YC2C 2CR6A 4NNXA 1E0OB 1MH5B 4WI6A 3REVA 3NIDF 3CDGA 3IJSA 3SJVA 4P5MA 5DHYA 3RL1B 5JPNB 2EIZB 2DI8A 4H1LA 4ODWB 1NBQA 4PJHE 4V1DE 5DF0A 4MWFA 4M43H 3EDEA 4AT6B 4S1QL 2XQBH 2J3SA 1CFTB 1MFDH 3DV6A 1XF3A 4OCRH 5B38G 2BJML 1AXIB 1FIGL 3CVHB 5EWIL 4PRIB 3JUYA 1K8IA 2VMFA 4RMVA 5DJCA 1OTUC 2HFGH 4AQ1B 4XI5D 1NEZB 1CGXA 1UYWH 1WF5A 3STZA 3GMQB 5MEND 2J6EL 3DYPA 4TQEL 1ZKAA 3C09B 4GQ9H 4WI2A 2SEBB 1VFAB 1EEZB 1EXUB 3SN6N 2IALB 4PREB 32C2B 1P7QB 2CKBH 2P43B 1FNSH 4PTUA 2YPLE 2H3NA 2UWEA 4MLIA 3RPIA 4L3CB 3BZ4B 4JPWH 4LLYB 4JFZH 4MD4A 4MJ6A 1IGIH 4U3HA 5DGQA 4QRSB 1CCZA 4LSRH 1CFSA 4MB4A 4I3RL 3ARZA 4EI5B 3ORJA 2LV4A 4BZ2L 5CMAA 5C0BD 2ADFH 5DK3A 4GRWE 1CVRA 2GHWB 2VAAA 1YMHB 4Y19A 1TENA 2IH3B 3MRIB 4PJ7F 2ARJB 4TVPD 1T1YA 3AS1A 1ZT7B 5DURD 5CKGA 1Z5LA 4NCDA 1MI5D 1QFWH 2X4OA 1QRNA 3B3IB 1AGEA 4ZDHA 1D5BA 1PQZB 1K2DA 1CD1B 2JF1A 2R0LL 4J2XA 4G6JL 1J11A 3L5XL 3RJDA 1ZA6A 2XKNB 3MBEC 3GIVB 3QCTL 1NLBH 1X5XA 2YKLL 2IANA 4GXVH 3U7WL 4ODXA 2DBLL 1N2RA 3P0VH 1OAKH 4MA1B 1OT2A 1WJ3A 5K9KB 1JGEA 3F6IA 3IU3A 5ELIA 1T1WA 2GT9A 1RJZB 4JANB 1OQOA 1KIQA 2CMRH 3VXME 1Q9WB 3LQMA 1AKJA 4P9HH 2HN7A 3TBYA 2X4NA 4NN6C 1KN2L 1U93A 2DOCA 5T1KA 5DLMH 3TBVB 3MRHB 4U7KA 3ARFD 1AXTH 4YE4L 5KJRH 5ETUA 4OF3A 1JPTL 1LO2L 3ROOB 3WN5C 1XCTB 1BOGA 4XBEH 5KAQF 3W11C 2C3VA 2KPNA 4R2GD 4YHMH 3W39B 1QSED 3NOIA 4CADA 5KSAC 4PRPA 3VXOA 3CJJA 1TZGH 4QHNB 5EUKB 4W6WB 1QO3A 3QDMB 3GBLA 3MYZA 3MBEA 1BIIB 4XHJD 5TDNA 3TBSB 2JCCE 5DRNB 3OG4B 2YSSB 5EIQA 4CMHB 3IDJA 4OFKA 4JFFE 3DRTB 3U4EB 2GJJA 4KQ4L 5GS1B 1PZUB 3CZFA 1VENA 3LKNB 1BGXL 4NZRH 5DQDH 1V7NH 2HKFL 4JZOB 1ONQB 5IVXF 1EV2E 3DUSB 4HIXL 4OAWB 1B88A 3QDJE 5CJ8A 1KPVA 2N7BA 1A8JH 2G2RB 5D2LA 1KSRA 3MUGA 1YQVL 4HUVB 3NH7H 5HHOE 4HJGB 2IJ0C 1MREL 4L29A 2MHAA 5F7EL 4ZFZA 4HZLA 3MJ9L 1D5IL 3EYVB 4M93B 4AEHH 5KSAA 3PWJA 4ETQA 1ZA3B 5E6ID 3SGDI 5HYJA 4OT1H 1KPRB 3IFLL 2WINB 3TF7C 4KDWA 4YDKH 4ZXBD 4I18C 4L1HA 4Q9BA 4XMKH 1HCVA 2GUOB 5DJ0A 1IZKA 1EH9A 5MEOB 4NCC2 1EJ6A 1T66C 4I5BA 3OXRA 5F1SA 3V5DB 4LLDB 2Q3ZA 4Z76A 5CJQL 2MQCA 2J5LC 4C54A 3P4LA 3RA7H 2PYEB 7FABL 2FZ3B 1A6UH 5CGMA 1YJDC 4NO2A 3AXLA 3BRFA 2F54A 2J8UB 3V0VA 4G80A 1I7ZA 4O51A 4N1EA 1XZ0A 5IESL 5E2VL 5EBWB 1JNNL 3ZKXC 4PJXB 3I02A 2CUMA 4J3SA 1CE1H 1JN6B 4LCUA 5I1LA 2Y72A 5FUZH 2CDFB 4AMKL 1T0MA 1A7RL 5KVMC 3UTTB 2YN5A 4I18A 3CC5B 3UEZA 3ZTNL 4PRHE 1A14L 1KTDA 3HMXL 2IFFH 2VZUA 3T65B 3A6CH 3CX5K 1EGJH 1KCVH 1MWAB 4FQJH 1FBIH 3U0WL 3K4ZA 1VPOL 4OZFB 4U1IB 3QUXD 1B0WA 1IAII 1JWSB 1ZSDA 1YEFL 5ITBL 4R7NB 3OJMB 4BFGA 3EHBD 1TNNA 2DQHL 4Y16D 5A16A 1UQSB 4M5ZH 1CQKA 1P4BL 2X70B 2EIBA 2LU4A 4RMWA 4UMGA 4IHOA 4W6YB 5JQ6H 1ZHKA 5IMOB 3ZKQD 3W0WE 5C08D 4F7CB 1D7FA 3EIFA 5EPMA 3CSPA 5L7XL 2OTPA 4MDJB 4UV7H 4MA7L 4CVWA 5JQHC 5TF1L 1NC4D 4E9LA 1KV3A 4DTGH 1AC6A 4IOIA 5T3XH 1UH4A 5D7JD 5LQBL 3BP6B 3J7HA 1AQDB 1QLEH 4AZ8A 1VACA 2J88L 4GMSL 3C5JA 5EDXA 4XVTH 3DMMC 3LV3A 2DL2A 1XCQB 3MCKB 4L5FL 4Q97A 1AGCA 2A38A 2VN4A 2A6IA 4R3SB 1KLGB 2VYRE 4JFDE 4TUKH 5CKAA 1GPOH 3S36L 4HBCL 3GSNH 5FYLD 5AYUH 5CUSH 2HMIC 4M6MH 3BKML 5JW5B 5D72L 4QTIH 5I1GL 3T1FA 5LBSH 4H26B 3QZWG 4ISVA 3B2VH 4OZ4A 1NBVL 4P2OB 4UQ3A 5D7SH 5GZOD 4GG6E 1U3HB 1F6FB 4ODUB 4X7TB 2VDKH 2YEZA 5GGRY 4HWEL 1MCSA 3DECA 3GSQA 3TH3T 4GKSA 1NAMH 5HVHC 1PBYA 1PG7L 2OX5A 5T5FL 5HHNB 3BW9B 3VI3E 3JSSA 4JG0H 4LAQH 1EEYA 2FHCA 3ABZA 3DHJA 4UI2A 3FHQA 5JUEH 2R0WL 5DVNA 3TT3L 2QTEA 2R2EB 3MRQB 4Q6IB 1Q72H 4UU9B 3H42H 1XGRB 4R4FL 3SCMD 5JW3H 3JWDL 4FMFA 1IARB 2IAMD 4ODBD 5K9JL 4XNZB 3HA0A 4XX1G 3S37X 4WHYG 4KUZL 1UC6A 3TYGL 3MRCA 4I3GA 4GG8A 1MCWM 1U6AL 4P3CH 4UV4L 3ULVE 1YUHB 3LPFA 3P4NB 4UNUA 3WFDH 1LK3H 5E8EB 3VXNA 2VXVL 5M7QA 4NWTL 1P5UA 5D8JL 1J8HE 3NACH 4NQED 5EU3A 4QXTB 1QFWI 1AJ7L 2A2QT 5CP3A 1NMBL 4YBLC 5A43C 4NBYB 4FQ2H 3BP4B 5ICYA 2VOTA 4P2QA 2B1AL 3MRRB 1MCFA 3BGFC 4OGZA 4HIEB 3QR2A 4QXUL 4B7LA 1R24B 2I60H 1QSVA 2OJZH 1UB5B 3SKUD 2AQ3A 3BWAB 5FDWB 2R4RL 1Z0MA 4HSQA 4MGXA 5KSUA 3MOBH 4MJ5A 4O58L 2A83B 3LRHA 3UTSE 2H2PD 1DUZB 1P5VA 2BNRD 4RA0C 2C7UA 4X7FC 1QFUL 4L3EA 5C6WH 4L4TE 5CS7A 2ZG2A 5E94A 4NQCD 3ROLB 4NN7C 2AP2A 3T77B 2FO1A 5ENWB 2BRRL 2ESVE 4MQXC 5TDOA 1NEUA 1EIBA 3B6SB 2BVQB 4IM8A 5GRUL 5F88A 1CICC 3DUUA 4NNPL 2ZUYA 3N1QC 3M45A 2D7TL 1U8MA 1T2QL 4XP1L 1EO8H 1LD9A 3G5XA 4PJ5A 5CCKL 1BQSA 1VFBB 1KJMA 2XI9A 2XQYG 4KROC 4XP6H 3X12B 1MRCH 1J0JA 2Y23A 3LEVL 3I6LE 4NKMA 3WHXA 2XA8H 2QADD 3S34H 3Q6FA 1FL5B 2C3GA 2W1NA 5C1MB 4X6CB 3H9ZA 3O45A 1WBXA 2ORBL 4TSAH 5HJ3B 2NW2A 1MIMH 5AYQA 3IGAB 3J8F7 4HXAL 4PJ7A 2Z91A 3FRUB 2HFEB 1FG2A 4G8GB 3SO5A 4GKNA 3SJVD 1RJLA 1MNUH 2FJGB 5IB2B 3L3HB 5MEQA 4JM4L 1Y6KR 1QBLH 5ADPH 4XMPL 5CD5D 3FN3A 5ID0B 1SYVB 25C8L 4N0FA 2Z35B 1PDKA 1CICA 3BI9X 1HKFA 1L7TL 2W0FA 3FFCA 2GI7A 3ILQD 12E8H 2NX5E 1PLGH 1K5NB 4HS3B 3VH8G 5F6IB 4D3CH 1OHQA 4LARH 4D0BA 2QQNH 1F58L 1FNGB 5L88L 1I7UA 6FABL 1DBAL 1OF2B 1WAAF 4DEPC 2O5ZH 1P4IL 3IAQA 4YJZL 3VXUA 1QSFE 1VEPA 4NZUL 3EJYD 5IHUH 4WUUD 4OSUH 4ORZC 3STBA 3T3PF 5B22A 3CVIL 4DAGL 2NY1C 4UT7L 5DWUL 4FQXB 2BVYA 3NZHL 2IQ9H 4MCYB 3KPQA 4Y5VC 5SWSE 4HV8B 4LHUB 2BHUA 2YRZA 4DZBB 4FFYH 2R1XA 1DBJH 2BXZA 4Q9QL 1JHKH 1PEZA 2QLVB 3IDNB 4ODVH 5GSRA 1F3JA 3QI9B 4NHCL 5I76B 3BDBA 1DEDA 3GMRB 3PL6B 4GAYA 3LKQA 4L8CB 4Y19D 1LP9A 1OTUD 5EC2B 6CGTA 3OJDA 3T2PA 1L6XA 1NGXA 1NCCL 4I3SL 4MB3A 2CLRB 3DHMA 1OGTA 1QRND 4K3HA 3QQ4A 3HPLA 1S5IH 1WBYB 5DFVC 4YX2H 3D6GA 5DJZA 3KNBB 5IVXA 3N0PB 1G0DA 2C26A 4YK4B 4KK6D 1AGFA 4QOKB 5IMLB 4ZUUB 4R0LB 1V3KA 5IWLC 3S4SG 4LF3A 4Y5VA 1FVCA 2R29H 5D96C 4KK9C 5L0QC 4NQVA 2X4RA 3IJYB 4WJ5A 3B4NA 1I7TB 5EZOH 1K8DA 4NQDA 4QXGH 3ZKNC 4BK4A 3ZKMC 1HHIB 1AKJD 1NMAH 4K7PX 5T1KD 3VXTA 3WFHB 1G6RA 4RGNB 2APBA 1I8MA 4R97C 1HI6B 1FYTA 2QHRL 2Y7QB 5T1LD 5BS0A 4UUJB 4Z7WE 5JHDA 3NCMA 1R3KA 3DX8B 4KKAC 5GJTH 2DDQH 2R2BB 4G5ZH 5F1NB 4PRPD 3U46B 2HT4C 1SMOA 1DQQA 4I1NB 3ECBA 1P6FA 2BY3A 2H41A 2QJDA 2YHGA 1ZAGA 4P4RB 3GSOA 3TVMC 2EZ0C 5BQ7B 3MLUL 2AW2A 2EEDA 5IWLA 3SE8H 3IKKA 2Y36H 4M7KH 1BJMA 1DQML 5DC9B 5IW1B 4F7PB 4KGJA 5CGTA 2Q87A 2VXUH 2XG4A 5J6GB 1G9NH 2GSIB 5GPRA 4JY4A 3VD3A 5J12C 2AABL 3C8HA 1R3HA 4YR6A 5C0CD 3UTPE 2P5WB 5JNYB 3B5TA 2CJUH 4FFWC 3QO0A 3ZYOA 1T20A 3IU4L 3RGVC 4F7EB 1F8TL 4QHKI 4BSWA 1NANH 4PRBA 4MS8C 3HI1A 4H25A 3RIFF 3FT2A 1RUMH 1K6QH 3T0EB 3O0RH 1SQ2N 2R15A 3W11D 1IKFH 5J6HA 1A6ZA 1S7TA 5D7LE 5EOCJ 2DQUL 3OR6B 3QP3A 4M8VA 3WD5L 5HYJD 3NFPA 2N4IA 1BFVL 1WSST 3CXHK 2Z31A 4UT9H 4YBQC 3WFZA 4N8VG 1VKXA 3S9DB 4RDQF 3TVMA 2C3XA 4MAYC 5F3HB 3AMKA 5LAXA 3QUML 5FYKL 1U2HA 4ZSOE 2PYFA 5CD3B 5B21A 3MLZH 3P4MA 5FK9B 3O3BA 4E0RA 1P2CA 5INCA 1ZLWH 4HMDA 1JTPA 4S10A 1DVFB 3PWUB 3MODL 1RQ5A 1P1ZB 4MDIB 5C6PB 3U2SA 1UCBH 4AEFA 1EK3A 2D7MA 4XPHL 1HH9A 3DBXA 3JWOL 4WDIA 3BGAA 4S0SD 3HE6C 4IDJH 5D9SB 2ICWI 2C3HA 2XZCH 3RGVA 3JWNC 3QHZH 4FQLH 3BZFB 2PTVA 1J1PH 2F54D 5T1MB 5FKAA 2X4QA 3BN9D 2X4UB 3DGCR 4TULH 4MJIE 2NTFB 4XCYB 3IDMB 1B6DA 4XCFH 5JW4N 2WWKT 1PAMA 3D39A 1U0QA 4K94H 3RX7A 3RFZC 5IHLB 2R1WB 1S5HB 3H2WA 2Y5TB 4XP4H 5ITFA 1FC2D 4GW4B 1OSPH 5DJDA 3WEXB 4Y2OA 3HZYB 2VLKA 5CEXA 1S8DB 1YEEL 3OQ3B 1DQLL 3VFSA 3QEQE 2ARJQ 5E8OA 3SOBL 4F8QA 4MMZC 1T66D 1E4XL 1KIPA 2FB4L 4M6OL 2W0KA 1IQDA 1YYLL 4N0UE 4ZPVB 5IB4A 5KSBE 3FOMA 4NKOB 2YMXL 1B2WL 5IQ7H 1ZLVH 1YMME 1ZS8B 2A74B 4I13B 5CSZB 5AZEH 2X4TB 1LGVA 1RU9H 2EEBA 1EUUA 1LO3L 3VXPA 1T5WB 4ELME 3K74B 4H1LG 2Y1VA 3O6LH 4C56B 3IF1A 3HE6A 3MX0A 4ZYKB 2YC1B 5IG7A 4MYWB 3OAYK 4LCWA 3VJ6B 1HQRA 4Z95L 5JOEA 2ED8A 2V9TA 4KH2A 4L8DB 5C70A 4LPVA 5FCUL 2APWA 2XZAL 1U58B 1S9XB 4UQ2A 3SE3C 5DD1L 5IMMB 1LNUB 5D7IB 1RD6A 2XV6B 4KTDH 1H3PL 3IXAA 2ZCLH 3HN3A 4YPGB 5E99H 1N6QL 2F5AH 5F9AC 1TJIH 3PUCA 4TNVF 4XC3H 3O6KL 3GHEL 1IVLA 4Y5XC 4F33A 5BO1H 3PGFL 1MJJB 2YUWA 2X41A 3ARTA 3VDBA 3QDAA 2HT2C 4WFED 3OHXA 4HK0A 3P9MA 5C0AE 2ED7A 4Y1AD 3ZE0E 4P4KD 3MRKA 4QRUB 4CNIB 1JNLL 2W9DH 4WEBL 4YDIH 3MUZ1 2DYPA 1KJ2H 3JV5A 3P11L 4PUBL 3EDFA 1DANU 3PGCB 4IDLA 1AP2A 3U82B 1I1FA 2LVCA 4D9RD 3VDAA 4QRRB 4FQCL 4MXWL 3BPCA 3NFSH 1CR9H 4WENB 2ZNXA 1MFAH 3ALWA 3SE3A 4ZS6C 5LGKA 1J1OH 3GKZA 5D7KD 3GK8H 3CFEB 4X0KA 5KG9A 2O26U 1MFEH 5J1AA 3P4OB 5I15H 4O00A 4LSVL 4YGVA 3KPPA 1EMTL 1K4DB 3P30L 2V7NB 4Y5XA 3IJHB 3DSNA 3QO1B 1CBVL 1A5FH 1VGKB 3UZEA 2WBJC 3WXWH 4HH9B 3ZE2F 1ERNA 4QRQA 3BDXA 1BBJB 4GAJH 1NC2A 4PJHF 3CDFA 3DURA 4DGYL 5LVEA 3V7MA 3AAZB 5F9OH 3DMMD 4IIQB 1G7HA 3Q3GA 2QBWA 4EDWL 1R5IB 3ZE1F 4A6YL 4POYA 4NQSB 5I75C 1T03H 3JV4A 3IB4A 4YXKL 4F57H 4WHTA 2HMID 1DLHA 3C2SA 1HHGB 1U3HD 3RHWK 1BD2E 4TVPH 1AHWB 3KXFA 4ODSL 3PQYE 1XGTA 4Z7UE 2GCYA 1B4JH 2F53B 1CI5A 4MZ3A 4X6EB 1ACYH 4LCIH 1D9KC 2FSEA 3E2HB 2L4OA 1A7OH 1KFAL 4R26L 5CWSA 1S7SB 5C71A 2DKSA 1CGVA 3TJEH 5F3BB 1XGUA 1PW3A 1ZV5A 4BH7A 3QNZB 1E4WL 4OCRL 1I8IA 3KLDA 3DX9B 4D9LH 1GC1H 5EC1A 5DEZA 4CN4A 3VGDA 4P5TC 2HFGL 3WMSA 1R0AL 1UYWL 2E7CA 1RIUH 4L8SA 3RDTB 4P2QD 4QEGA 1REIA 3B8YA 1ZANH 4ODTL 43CAB 2V5RA 3SDYL 4AENB 3FQRA 2V2XA 2LE9A 1MCBA 4K9EL 4AK1A 1WBZA 4NN5C 4IS6A 4WU5B 1CG9B 4S2SA 3ARBB 2VXQL 1CIDA 2XFXA 2ID5A 5D2NE 3GJEB 5SWQB 4L3ED 5FXCH 5FYJH 1RK0A 1D9KA 5BVJA 1ZGLM 5FM8A 2MOVA 4OGYL 2P4AB 2D7NA 2XTJD 3LDBC 1NDGA 3BH8A 3KPMB 1N5AA 5DVLA 1GJIA 4Z7VE 5JLZB 3MJ7B 1IC5H 4XXCC 4OD1L 4OF8A 1A4KA 4FQIL 4F3FA 2KH2B 4Q9CA 3LEYH 5J1SC 5ESAB 1UVQA 4MNGE 3RL2A 4F2MA 3H9SD 4K23L 2ENYA 3F65A 2IBZY 4EBQL 4X6DE 4ZFGH 3MLXH 2VWEE 3HNTH 1AI1H 3AS3A 4JFXA 3D9AL 3TIDA 3MROA 1QYGH 1I3RB 2X7LA 3ISWA 1G6VK 1V3LA 2GFBA 4LMQE 4WO4B 1G9MH 5D1ZA 4F37F 4XCNA 4ZODA 5F7FA 4PP2B 3OXSB 5C0RH 2P7TA 4YAQA 4WY7H 1HIMH 2IADB 5IBUB 2BCKA 1H5BC 4WTWA 2EH7H 4GXVL 4FXGB 4N5EC 3K7UA 4X4YA 3DJ9A 3JXAA 4GW5A 1WZMA 1GGIH 2P8MB 1OCWH 4MQXD 1EHNA 3E3QE 3SKOA 1FZJB 4L4VE 1R5VA 4O5LL 4KI5E 5ISZB 2JCCF 3C9NB 3RZCA 3ZDZE 5FO7B 5I73B 1MY7A 1NANI 1MUJB 4MQSB 1I3UA 1NGZA 2HTKC 3A6BL 3RBGA 5C2BL 5ICZB 1FGVL 4Y4HA 3QEUB 2X9WA 4KROD 1XR8B 3WE6B 4KAQH 4DKEH 2O5YL 5HHMD 1T04A 4XAKE 2RR3A 4ESKA 4G7VL 1ED3B 2LTQB 4YHML 4RGOH 5FUCC 3TZVC 1FNEB 5CHNB 3UMTA 3GO1H 4MQ7B 4X9HA 1NL0H 3F12A 4NRYB 1U8OB 4WUKL 1JHTA 2WM0A 3X14A 4O2CA 2LFGA 2VLRA 3FMGL 3NCJL 1H5BA 1IFHH 1JWMB 3KLAB 3E6FB 1JE6A 3UROR 3L3GB 4H20L 3C8KB 2VO5A 1UGNA 4XX1E 2BSTA 3V4UH 3RPKA 1GSMA 4U0RB 1DJSA 2DIBA 5GGSB 5CLWA 5FYJE 3QIUB 4Y4FB 4JREB 2DJSA 4HWZB 4U6VL 2EDFA 3I84A 4AEEA 8FABB 1FFRA 1CFBA 3GMPB 2ICCA 1YNKL 3MCLL 3RIFK 3LN4B 5IJVA 3BVNB 3NH7L 1XF5B 1CLOL 1JMZA 2XWJB 3WJLC 1Q94A 3DXAB 3MNWA 3BKCH 5JPMB 3TZVA 2IH1A 3C09C 3IT8D 3BH9A 3RWIA 3ZTJG 3CCHA 1EHXA 3ESVF 4FABH 1T0NB 3KPLB 3GMMB 4PLKC 1NCDH 5K93A 1YA5A 5F9JB 2I24N 4KQ3H 4XMKL 1CXLA 4OLYH 4UINH 2BY0A 1IEAB 1F4XH 1OGAE 2C4FT 3C6SB 1QQDA 3WUWA 1TLKA 3V0WL 1UZ6E 1WZLA 5HDQL 4NQDD 4JQXC 1MH5A 1NBYB 3KPSE 3UCRA 3ZZ1A 4E41E 4I2XA 1F11B 4AY0A 5JPNA 2EIZA 4UBDC 3TCXA 4YWGH 3BP7A 4AT6A 3RWCB 3H3PH 2IBBA 2V7HB 1HXMB 3K1KC 3O8XC 4LKXB 1CFTA 3T8XA 3TJHC 4DOHE 3BE1H 1PG7X 3Q5OA 1FYTD 1RZJC 5HDOA 1EERB 2BFVH 4D9QE 2VLJB 5JHDD 2FCBA 4Z7OE 3TGXA 5DHVA 4YPJA 2DAVA 4GO6B 5DFVD 1RZKC 1N59A 1NEZA 4KUCD 5E8DH 3WJLA 1CL7L 1CE1L 4HIHB 5MI0B 2SEBA 1VFAA 3H0TB 4ZTPH 1EEZA 5E7BA 2IALA 32C2A 1WV7T 5ID1A 1EAPA 3GSVB 4TUJB 1NUNB 5E1AA 4YEEA 4KK9D 3BEWA 2CGRH 2ZUVA 4QTHB 3O3AB 1CT8A 2F19H 3BZ4A 2V5MA 1T1XB 3A6CL 1KCVL 1D5ZB 4JJ5B 4LLYA 4JQXA 2D7OA 4X80H 3ARPA 4MA1C 3ZKND 3ZKMD 1T3FB 3QUMB 4WWID 2HH0L 5HGDA 4QHLB 4QRSA 1TTFA 4EKXA 1OAYL 4EI5A 2Y06H 4OZGE 3RY4A 3WXVH 1UEYA 4HULB 3IFOB 5DJ6A 1II4E 5ICXB 4N1HB 3O8XA 5DQ9A 4MNQE 1S7UB 1NUGA 2DL9A 5CINH 3P9LB 4X4MA 4N0CC 3MRIA 5J3HC 4LLAA 2CIKB 4KKAD 3U7YH 5L2KA 2VJXA 5JQ6L 5TDPB 4ORGA 1PY4A 1MFCH 3RVUD 4EVNB 3M17A 2HT4D 2DQIL 2X89A 5H94B 4LCCC 1TVDA 3QQ3A 1Z9OA 3T08A 2EZ0D 3S35X 3GMLB 4JPKL 1LVEA 4UV7L 5FAAA 3C60D 2YD7A 1RZIA 2BVEA 5T3XL 3BESR 4LMQI 4RNRB 5EU6E 1MQKL 1OWRM 4OLXH 3WNPA 3IRPX 4W70A 4XPBL 5ADOL 4OTXL 4XVTL 2K7QA 4U31A 1TITA 3HB3C 4NNYA 3UC0H 3TBWB 2CLZB 1ZWIB 3K0WA 4ALAL 1JGUL 2FHBA 3RGVD 3MNZB 1T2JA 2Y07L 4LSTL 5BW7C 5IHBA 3GSNL 4H8WC 5EU5B 5CUSL 5AYUL 4ZUSB 2AK1L 3CU1A 3SDXE 4N8CL 1CDYA 2NY2D 5C0JA 5I1KL 3B2VL 4NYLA 3WIFA 4BYHA 3ROOA 5D7SL 3D39D 4QYOA 5IM7B 4PGEB 4LCCA 2JB5L 2NY6C 4YBQD 4ZFOL 1HYSC 3VXSD 1EJOL 5FKPB 3PWLA 4MAYD 2VLKD 4U7MA 4BUGA 5MHSD 1I9JH 3C5SB 4KJYB 2KQMA 2K3TA 4P3DB 2QSTA 4KKBC 4KXZH 3FZUC 4OCSL 2N7AA 2CK0H 1UJ3C 3MLRL 3SEPA 4KK8C 4DK6A 1R3LA 3ULVF 4JG0L 4Z0BH 5TQ2H 3G04B 4IMLA 3RY6C 1IILE 3FO1A 1Q1JL 2QR0A 1H3XA 1ONQA 2NXZB 3DUSA 4OAWA 4HEME 4JFPA 1Q72L 5BW7A 4XGZA 5FEBA 4G9FB 3WFEL 3VWKC 2CIIB 4HUVA 2DTMH 4Y5YB 4PJHA 1RJYB 3NFNB 4U49A 1OTTC 1A6TB 1KENH 1S7VB 4V1DA 5E8PB 4PR5B 3GB7B 3K3QA 2E9IA 4FXLA 1JGDB 1ZVHA 3D0VA 1MCRA 3BDYL 1JRHH 1RFDH 3CXHJ 2WW8A 3LS5H 5DQJA 3UBXB 3AU1B 1ZA3A 1QFPA 1HH6A 5IMKA 1ZOXA 3LQAC 4U1GB 2WINA 2BVPA 4K71B 1BVLA 3NACL 4BZ1H 4PGBB 3V4PL 4LU5L 5EZIH 2AEPH 1UJ3A 4J12A 3GMOB 1HXYB 4H1LH 4L4JA 5FYKU 1Z9MA 5MEOA 4OM1L 3UPRA 1HSBA 3RY6A 3C5ZD 2XG5A 1B0GB 1CE6A 2IGFL 3V5DA 2YPLA 4LLDA 5KAQG 1FVEB 2I60L 4P2RD 1QBML 2AV1A 4P46B 3QQNA 5C07B 1J7VR 1CGSH 5EU7E 3MV8E 4X5XB 1QKZL 1ZK9A 3MPCA 4GAGL 5MEPB 3V8CA 1S9VA 4A6YB 3VWKA 3U0TB 5GISL 2VE6B 1NFIB 5F7DB 3EBAA 4PJ8C 4MX7B 4WW2B 1AQKL 2XRAH 4M9PA 5FA4B 3BUTA 1DDHA 3O6MH 4XWOD 3OKNB 1JN6A 3MV7B 3KYNA 2CDFA 1WFNA 3T0WA 2HG5A 2NY4C 3FFDB 4LDLB 4HFWB 1EO8L 1WIUA 2UZIH 3D3VB 3KPNA 4M1CD 1NC2D 4U1NB 4KRPB 4D8PA 4Q2ZB 5LKNA 5GJSL 2VLME 1OM3H 5GGTH 3MV9B 2VQTA 1Z6JT 4OD3H 4MHHG 4DVRH 4OCNC 4F37K 3U9PL 1FE8H 3KYMA 3H9YA 1BQLL 4U1LA 1B9ZA 5JDSA 1Q9KB 1E4KC 1UACH 1MIML 4HS6A 3K8LA 4ZS6D 5T3ZH 3H9HA 1FRGH 3VXMA 2X70A 1KEGH 4K55A 1MNUL 3T4YA 4DN4H 4P2OC 3OR7A 1J10A 3EOTL 1BFOB 4C83A 3F7YB 4HIIB 2JJUA 5I6XB 4F7CA 2C1OB 2A73B 4K7FA 2ARWA 4JAMB 1RZ7H 2WBJD 4BA8A 4MDJA 4J8RB 4YEFA 1GGCL 3HG1E 1CXIA 4XXDB 4LARL 2NY3C 5EOCH 2JTDA 3NCYP 5TH2A 2NY5L 4FA8A 2O5ZL 5E4IA 2RB8A 1DE4A 3FB7A 3V6FB 4OQTH 3GMNB 5DA0B 5J9PB 4OSUL 5HYSB 2JCCA 1UM5L 3QUZC 3LPWA 3RVTC 3VCLA 3MCKA 4XBPB 2VDMH 4YDJB 3VD5A 3R8QA 3BEVA 5HPOA 3KYOA 1KLGA 4FQQA 1E4KA 4JZJB 5E9DD 4C57C 4MVBC 3DX6B 2BK8A 3UZVB 4XTRC 1D9KD 4B53A 1JNHA 5JW5A 3WO4B 1XGPA 3WIIH 2FJHA 2E7HA 5GRWA 4LKCA 4MSWA 3GSRB 4MXVE 4P2OA 5F7LB 5DEFB 1MVUB 4ODVL 4M1GH 4RBPH 3IDIB 5DFTA 4YHZH 3KAAA 4CVZB 5K59E 3RWFB 1I3GL 1TPXB 1DBMH 3IAGC 4X7TA 1IGYA 1EHAA 5C0FB 2PN5A 4P9HC 3L3IB 3D85B 1OSZB 4K8RC 1C1EH 5HHOA 3QH3B 4P5TD 2MFNA 2UWEE 3ULSB 4JHZA 3TCLB 1U41A 3X13B 3UYOD 4LIQE 3IDGA 1ND0B 1IC1A 3IYLW 3TNMA 5LGJA 1E6OH 3BW9A 1KJ3L 4R90H 3FQXB 3QUZA 4Y8AA 4F7TB 4AM0B 1C16B 2GITB 1LE9B 1K85A 2IC2A 4OCMC 2LABA 2DQEH 1FDLL 3MRQA 4XB7A 4Q6IA 3X3FH 2PXYB 4OI8A 2G75A 3PJSB 1AC0A 2VDRL 4FN0A 3ALPA 4PRHB 4CU6A 3LD8B 5JIPA 2O93L 5EO9A 4HLZG 2EDRA 4QXGL 2B1HL 1I4FB 4YHKH 2GJ6D 3FO2B 3QIWC 5T3ZE 3N06B 3ARYA 1YUHA 1JPGB 3HLAA 3P4NA 4TPRH 5FA3B 3FT4B 5CSGA 1OAXL 2CR3A 3GI9L 4RA3A 2IANE 1YNLH 5F7MC 2DDQL 2ADGA 2G5BB 2A6DB 3HI5H 2I5YL 1KTKE 3BP4A 1JZ7A 1U8IA 3OAUH 5C7XH 1CGTA 3MRRA 1UWXH 2VTFA 4KRMB 4HIEA 2RCSL 1R24A 4W6XB 2VLRD 1CS6A 5GSVB 2CH8A 1UB5A 5DJ2A 1AO7B 3SE8L 3BD3A 1LEIA 1GAFL 2Y36L 5FDWA 4EI6A 2QSCH 4OV5A 3ARXA 3PWPB 1MCPL 3BQUC 2VXUL 1DUZA 1IBGH 1KELH 3ES6B 4DWHA 2J8HA 1T5XA 2NLJA 2EXYC 3QWOB 2YBRB 2V2TB 1NLDH 3E8UL 4PTTB 3QIWA 4XP9H 3T77A 2DQGL 4NP4H 5CBEA 2VIRA 5IVOA 5I8EB 2R2HA 4POUB 2BVQA 1I8KB 2HTKD 5SWZE 1BVKA 4BQ8A 4PB0L 5D5MB 5DD0H 3SO3B 1RUML 5F6IC 1VFBA 3W0WA 3QNXB 4OLVH 1BBDH 3RIAF 2AJXL 2NXYB 2P5EE 2L0DA 2PO6D 4NKDB 4HJJH 4KC3B 2D9CA 3NABH 4PFEA 2BC4B 3RNQB 4KXZI 3BKYH 4P59L 4OIAA 3VMPA 1S7WB 3AREC 2EKJA 1YEIH 3G5ZB 1T83C 5D2LE 2E27H 2R56L 5HJ3A 4Y4FD 4FQXC 4GBXB 4JKLA 2EE2A 3VGAC 3U83A 3FRUA 5ALBH 3FCTA 4GKOA 3VXQA 3JBG7 2NZ9C 4ZOAA 3U30C 2IQAB 3F7PC 1IGMH 1T2XA 1FLTX 5IF0B 1SEQH 1SYVA 1A6VH 1KB5L 2Z35A 2VLLB 3MBXL 2ZJSL 3WFCH 1A7QH 1N6VA 3QHZL 1IL1B 3LKPB 1J1PL 3PL6C 5KSBF 4PRAB 1F45A 2KZ1B 2ZSVB 4GT7A 1H15B 1K5NA 3QISA 4HS3A 3S3PA 3ZTJH 5HGBB 1SBSL 4Y88A 4XCFL 4QCIB 1TJHH 1JRHI 4NKIH 2FJFA 3ULVC 3MQIA 1W0VA 1OF2A 4F58L 5KW9H 2UVEA 2DQTL 4F9PC 3FONA 3PWNB 4IRZH 1GOGA 1OSPL 4PLKD 5HDBE 3GSWA 2AXFA 2ICEA 3AREA 1T83A 2EH8H 5E8NB 3HNVH 4M7LT 4GH7B 4FQXA 1J8HB 3BZEB 4W81A 1DR9A 5GS0L 3RTQC 4JJHA 1P4LA 2MPAH 4LHUA 3L5WA 3B9KB 4IRJC 4KMTH 5IQ7L 2FIRT 4A2LA 1Y18B 3RX5A 4DZBA 4UBDD 1A7BA 4DUXA 2Q76A 3TA3B 3IDNA 3WSQL 2RFXB 2IBGA 4AEIH 2JK5A 2M1KA 3IDYC 3O8XD 3TJHD 5ABDE 2CRMA 2DI7A 4G3YL 3CFKA 1TVHB 3PL6A 4ZS7H 2RJMA 4O2EB 3U7AA 4V2BA 2GTWB 5L2KD 5EC2A 1FO0L 5KS9B 3QRGH 3UTSB 4RIRB 5DJXB 2X89D 2ZUQB 5HYFA 3HNSL 5I8OL 4FZ8H 2J2ZA 3GSNB 1F4YH 1IGCL 4XNYL 4NQUA 4BZYA 5FECB 1F4AA 4F9PA 1U8NA 5KZCD 5J06A 4XC3L 1OARH 2VRAA 5BO1L 4QOKA 4G8IB 1CGYA 4Z0XB 4ZFOB 5GQBA 1EBPA 2V5SA 5KSVB 2F74B 3BGMA 3RTQA 4LPUA 2OP4H 3B2UC 3DSFL 3VFRB 1A6WL 2VABA 1OB1A 4IRJA 4J1UA 3V6ZB 1YC7A 3WLBB 3WS6C 3BRDA 3OJ2C 3HFML 2ZCHH 3AGVA 1OAUL 1NFDB 3TC9A 4OCXH 4K3DL 1I1AD 4BFEA 2XPGB 3WFHA 3MFGB 4RAHA 4N0CD 5CP3H 5J3HD 1JK8B 3DETC 1U8HB 3O2VL 3D2UB 5B3NA 2KQNA 2ESVA 2Y7QA 5I16B 2DF3A 4UUJA 5HDLA 3S5LA 1J1OL 2APTA 3L9RA 2N1KA 3DX8A 4JFED 4PIRF 4S1DD 1MFEL 5DO2C 3U46A 2WIIA 2AJ3A 1UM4L 2VISA 1Q9OB 3DVNB 5D1QB 5IVZA 5IUSA 1RV6X 4I48A 4P4RA 4X83A 1V7MH 2NX5B 3QFDB 4PBWD 4KRNA 1QSZA 1E4JA 3JTSA 3HKFA 3WS6A 1INQB 2FX9H 1JZ8A 1SJEB 3KPRA 4AH2B 2F5BL 1YEGH 2JKXA 2OTWA 3DV4A 2Z4QB 5F7KC 2C1PB 5LGHH 4HWBA 4XNUL 4Q9RH 1N8ZA 4OLUL 4F57L 1DUYB 1KJVB 2X5PA 3HC4L 2P5WA 4NO5A 3PABA 4UILL 2Q8BH 5BV7L 5I8KH 5JXAH 3BYTA 2DQJH 4TVPL 4QRPB 4JY6A 4F7EA 2CXGA 5HHVH 3VGBA 5J7CC 3WO3B 1B4JL 4J4PC 2D2OA 2ICWA 4LCIL 2YD1A 4V1DD 3T0EA 3QXVA 5I1CL 1KN4H 4OLWL 2NY6D 2YWZA 3K46A 4UIKL 1HYSD 2CDGB 3BPNB 3TJEL 3NCYS 4FFVC 2AEQH 3HI6L 2EDDA 1RURH 4PJBB 3MXVH 2A6KA 4KKBD 4M7LH 2AKRB 5C0NC 3NIGE 1S7QB 2W65B 4KK8D 2VC2H 3B83A 1QSFA 3SPVB 2BMKA 1MLCB 4NM4H 3WL9B 3VGGA 1ZANL 5IB1B 4LLUB 2YPLD 2IPKB 4PJEB 3PWUA 5E2UL 1RZ8B 1G7JA 4MDIA 5DEGA 5HGAB 2WK2A 1K4CB 5D9SA 5F93C 4YHPB 3VWKD 3BZFA 3INUL 4ZPTB 4ZAKC 4J4PA 3RX8A 1XF4B 1HQ4B 3SGKC 4YNYA 1OTTD 1XR9A 4JLRB 3LKSB 3TPUA 3R0MA 4EQ3A 4NHUA 3DVIA 1PVHA 4XCYA 3IDMA 5HGHB 3NIDE 1LO0H 4HBQA 3E0GA 4J3TA 2D0GA 5HI3C 2Q7NA 1DL7H 3VFPA 3EYOB 4JO2L 3EFFB 4WFHE 3DWTA 3MUJA 2WLZA 3Q48A 2P1YA 1OAQL 4ZFGL 1CFQB 3MLXL 1HOCA 1QYGL 3WUWG 5KVFH 2QHLA 5EOTA 2COQA 3QDGB 4GFTB 4TVSa 5CSZA 2X4TA 5IKCA 3KDMB 1TQBC 4DZ8B 4WTXA 5C6TL 2AJUL 3B43A 4ZYKA 1HIML 2YC1A 2YD5A 4RDQG 3VJ6A 4PJ5E 3SGKA 3VXMD 1RUQL 5JIKA 4PJ8D 1FZKA 5GGQH 4NOFA 1FZOB 1U58A 1S9XA 2FO4B 1NBZB 3CAFA 4WEUD 2GY5A 1LNUA 3QCVH 4YIQB 3AY4A 1NEZG 5CEZH 3RKDD 4YPGA 5I1EL 2NY4D 3MLVL 4M00A 2R0KL 5HXMA 5B38B 1X4YA 3C6LB 3C2AH 1M4KA 2YPVH 3NGBB 1MJJA 1H3UA 5GRZA 4TTGA 1S9YB 3BIKA 5J0BA 1KIRB 1A3LH 3ZMRA 3ARGB 3CK0H 4L8BB 4HUUA 5IGXH 3RUGB 4RGOL 5JO5A 1HSAB 4QY8A 2ZWLT 4QRUA 4CNIA 3GO1L 4IIQC 3VFMA 1G6RH 5TQ0H 1NCWH 1NL0L 3N1PC 4JFFD 2X1WL 4X6BA 5DTFB 2Q86B 5JW4Q 3L3DB 1FGNH 3H6JA 1SHMA 4QWWC 3FFCE 4FTVE 3NVQA 1IFHL 3RWHB 2W07A 3MLSH 1FVDB 2LQRA 4YBHA 1RULH 3G08B 3I3BA 3QDJD 4FFZH 4H5SB 4JRXB 4PLOB 1V5JA 2AEIT 1W0WA 3UTQB 5I18H 3O6FC 5DRZB 3T0VA 1WITA 3VXUE 4YQXH 4O2FB 3P4OA 1IT9L 3CFDA 3PHSA 1N3NB 5DR5H 1WK0A 5HHOD 2V7NA 3THMH 3W5NA 3IJHA 2A77H 5I17A 3QO1A 5D7LA 5BRZE 2NY3D 1VGKA 1KG0B 2FGZA 4HMEA 5F8RC 5GRXG 2NPLX 5EIIB 1BBJA 1SEBB 4I8DA 3QUZD 4IIQA 3RVTD 5FGRA 2ZPKH 3LHPL 1R5IA 1FFOB 2HJKA 3FT3A 5HHXH 4ZSOA 5CP7A 4BUHA 3S88H 2W9EH 3UTZA 5LG1A 4Z7OF 2XN9B 3H7BB 4MVBD 3BZDA 1MY5A 1NCDL 3MRNA 2FWOB 4HQQH 4XTRD 1JHLL 3BSZH 3QUYB 2CK2A 1QEWA 5BVPH 3OKOB 4X6EA 1CF8H 1MRFH 4EOWH 1G9NC 1DQDH 4HCRL 3O6FA 4N0UB 3QFJB 3V4VH 2UUDK 3OKEA 1IC7L 2NY0B 2OTUA 4HKJB 3TYFA 2B5IB 1A2YA 4U6YB 3SGEH 3AB0B 5E56A 4K8RD 5HGGS 3H3PL 5DVMA 3V79C 1W2KT 5CEZE 5EG6C 4MCZA 3DX9A 2BFVL 5HY9B 3HPJB 5IEHB 2G9HB 4CN1A 1YDPB 4NQXB 1DFBL 3ARUA 5TPWH 5ECJE 4GS7C 5KVEH 4AENA 4PRHD 3PIQB 5FYLL 4U6XB 3PDGA 1EEUA 2WV3A 3QEQA 4HLZH 3JTTA 2OL3A 1PZ5A 2YA2A 3BYYA 2XNAA 3MCG1 3TBTA 5KSBA 2F19L 3ARBA 1JPSL 2AK4E 2P8PA 3O3EA 3SDCB 5SWQA 5BS0E 2IPUK 1R3JB 4ZUTB 2JB6B 5ERWB 3QIWD 1S7RA 2VDOH 3EW3B 2L7JA 1M05B 3MJGX 1WWWX 5IEKB 2EDNA 3LIZH 4W4OC 2C5DC 3L6FB 3HE7C 4G6FD 3GSXB 5DVOA 4EIZC 3MJ7A 4R8WL 4ONGL 3S8WA 5TE7H 1NAKL 5CINL 3OKMB 1MJ8H 2OR8A 4GLRI 3W0WD 3U7YL 3AM8C 5EUOB 1JYNA 1KB5B 1FAKT 2XIDA 4RSVA 4A2MA 2WUBH 5H37G 1AO7D 3QPXL 4WWKB 4X98A 5F6HI 1RUKL 3ME0A 1JPFA 1I3RA 1F4WH 4K94C 4OBSA 4AYFA 1PSKL 4OGAC 4G8EB 3LKOB 4Y2DB 5C0AA 2FR4A 3D25B 5DFWH 2UYLB 3OXSA 4OB5H 2MKWA 3BQUD 2F8OA 2IADA 3DVGB 4BFIB 3M1BB 4LRIC 2H6PA 2EXYD 4JFDD 4YHIB 1XGYH 5DJAA 4U0RC 1FZJA 1QLFA 1RZFH 3QSKB 3UC0L 4D0DB 5ISZA 4NUJB 3HE7A 1UCTA 4WCYH 3QIUC 4PJFB 5B3JF 1LMKA 3PHOB 4DUVA 4E5XB 3W82A 1CIUA 1TCRB 2CLVA 5IK3A 5GGUA 3TPKA 1U92B 4MAUH 5ICZA 1U91B 3GRWH 1XF2A 4WGVB 5IFAH 3GI8H 3S98A 3AM8A 1XR8A 5F1IB 3WE6A 4U1KA 1C5DA 5D71L 1G1YA 4PGZA 3EFDH 3LS4H 5TE4L 4KU1A 1UXSA 2AXGB 2W38A 4N1CA 1K3IA 3UDWC 2X4SA 1FO0B 2DJUA 5D1XC 2Z92A 4BQBA 5HD8C 1UZ8A 3BPOB 3ARED 3MLTA 1U8OA 4UIMB 1I9JL 1S3KH 4YZFF 4UNTA 5CAYB 2XACC 2DQDL 4LQFH 2DM2A 3X3GH 3ZT7A 3LZFL 3KLAA 4LRIA 3E6FA 4U4BA 5C09B 3U9UA 3VFGH 1MIEL 2YD2A 3L3GA 5E4EB 3PP4L 4Z0BL 3OB0K 2H8PB 2NZ9D 5TFSH 3O4LB 1XGQB 3D5OF 1P53A 1X6LA 2AERT 3H3KA 1I1CA 3QIUA 3UYRH 4U1MA 4LNVA 4HWZA 4MA8L 4MNHB 1MAKA 2H2SC 3KWWA 1HINH 4JG1H 5DVKA 3MC0A 1LO5B 1MCKA 2DTML 5C0DA 5GS2H 4X5WB 1J5OH 5IW6B 3ULVD 3HCVA 5ACMA 2BNUB 1KENL 4TTDC 5DUPH 4ZFFB 1J8HD 3FB8A 3LS5L 5MENB 5MI0C 5DD5L 4KWUA 4PY7B 3PDOB 2E7LA 3I2CL 3TO2A 3N1MC 4OCYH 1HKLL 4HIJB 4MLSA 3VW3H 3PV6A 1TCMA 3P0YH 2FGWH 3GMMA 3RTQD 1LK2B 2HFFA 4LCWE 5EZIL 5F9JA 1V3JA 2AEPL 1U42A 1NGYA 4IRJD 1H3VA 1D6VL 3EOBB 3GM0A 4XWGL 3FQNB 3NIFF 5I30H 3LN9A 4OM0L 1TXKA 1QP1A 3RWDB 3C08L 1F11A 3ZL4H 4LP4A 1OP3K 3F7VA 3UTSD 1YNTB 4AL8L 3MRBB 1KJ2A 4K3EH 1UB6B 3E6HB 4R4NC 3RWCA 4L4TD 1RJCA 2ZCKH 3MA9H 5C0BB 1JI2A 4EUPH 4LSPH 2R39A 2ESVD 4H0GA 3E3QC 2VLJA 3QZWB 4PLNC 2HWZL 1C12A 4Z7VA 5BV7B 3NAAH 1B90A 5DURB 1MI5B 1BM3L 2VUYA 4P57A 3H0TA 1NCBH 2GSGB 1WZ1H 3GJFB 3GSVA 4TUJA 2UZIL 4RQQA 5FUOL 1GC1C 3B2UD 3I6LD 4G9DA 4QTHA 5I1HH 2ITDB 1J87A 5GRYA 1D5ZA 4JJ5A 4JFYB 3DUHA 4LFHD 1T3FA 1ZLSH 3QUMA 3ILPB 2OM5A 4PV9A 4QHLA 4LK4A 4YDVB 2O61A 2PKDA 3WFBH 2D7QA 4YHYB 4TNWK 1IC4H 3DETD 3N9GL 1S7UA 4BKLA 4X4XA 4L4VA 3MA7A 2ADIB 1G9EA 1KEGL 2CIKA 2OZ4L 3AFLA 5TDPA 5DO2D 1NDMB 3EUUA 4EVNA 2NX5D 4JO4H 3HZMB 4Y4KC 4R2GB 2AJYL 4EJ1C 4WHDA 4P23C 1QSEB 1RZ7L 1T1ZB 3GMLA 1HHHB 4ZTOH 1BLNB 4OFYA 5FF6A 3KXFE 5EFIB 5F21B 1QSFD 3KR3H 5EOCL 2FX8H 5T1DH 1FSKC 4KVNH 4IMKA 3V5KB 3FB5B 4UNVA 1DN0B 2H26B 1UXWB 4LNRA 1BX2B 2DKUA 2UZXB 3GIZL 5SWSD 5E2WH 2VDML 1H3TA 2EDHA 1G9MC 3D0LB 4XBGB 5GZND 1MQ8A 4Y89A 1J1XH 3K8MA 1MCOL 4J4PD 5FGCB 4HXBL 2FX7H 5DT1L 3KGRA 4KVCH 1WCBB 3BOVA 3I6KB 4J3VA 4Z78B 2YA0A 2D7PA 2QQKH 5IM7A 3SGEI 1ETZA 2DD8H 4XAWL 4M1GL 3MOAH 3ARVA 2OK0L 3S37L 1A3RH 1MRDH 5BZDA 1AD9A 1C1EL 2HLAA 4U1GC 2VDPH 5E6IB 4ZOBA 1QVOA 4F7MB 4JQVC 4P3DA 1IMHC 4XZUA 4ZXBB 4JGJA 4M3KB 1MHCA 2EDXA 2X2YA 3LQZB 4LSSH 35C8L 5DSCA 5H35B 1WAAE 3G04A 3HMWH 2E7MA 1YN7B 3T2NH 2BSED 3ARRA 4M1DH 4HW6A 4OLEA 2DQEL 2E7BA 3KLSA 5KTEH 3ULUF 2X4PB 2GTZA 3ZT6A 4RRPA 4ZAKD 4G9FA 3KPSA 1BF2A 2EC9T 2FD6H 3MLWH 1O5DT 3Q6GL 3RU8H 2CIIA 4WFGE 4XHQA 5ALCL 4CU7A 1ZT1B 1L0YA 3NFNA 1S7VA 1A6TA 1L4IA 1SYSB 4YHKL 5HI3D 1QLRA 3GB7A 1U36A 4F9LC 1I1RA 3QUKB 1CTNA 4GOSA 4PJCB 1FLRL 2QSVA 3AU1A 4TPRL 2FATL 1L7IL 1BIHA 3T0AA 2EDYA 3VH8B 2H32B 2OR9H 3D18B 5HYQA 5IR1A 1HHJB 1YNLL 1RHHB 4JDTL 2R1YB 2BNQE 2G60H 3GMOA 3PHQB 4IJ3B 4JRWA 3RVVD 4NM8H 3O11B 3OAUL 4LHUG 2MKLC 1JFQH 4JFQB 1GIGL 5BOZG 1X5YA 5J11C 2DLEA 3L1OH 3P0GB 4NGHL 3IRZA 5M95B 5JMRA 3QUXB 3X11A 5TGBB 4PJIB 3QAZC 4DVBB 2RBLA 2E5EA 4JN2B 5MEPA 4KKLD 4WV1B 1HDMB 1UWEH 3CFIC 3EO9L 1AY1L 2EYTB 4Y16B 3SKMB 3UTPD 1NFIA 1TZHA 2FBJH 3C6LD 5DI8B 4MX7A 4XP9L 4PGDB 4QF1A 4F9LA 5FA4A 4RCAA 1YEKL 5AEAA 2MMXA 5AZ2L 3HZKA 2AGJH 5I6XC 4KDVA 4X7SL 5C08B 5D7LD 2UY6A 2GAZA 1RZGA 4GUPB 4EDXA 1G7LB 2W9LA 1AE6L 4M61B 4QT5A 1NC4B 1Y6MR 3GBNH 4MJ2A 5DK0B 1KEML 1SJHA 3UO1H 3LMJH 3IDXH 2DMBA 4XPAH 4OUUB 5D7JB 3MV9A 3ARDC 1YJDL 5C0EB 4ACPA 2I25N 4OGXL 4NFDA 3NABL 5DYOB 5JORA 4QWWD 3FB6A 3MRMA 1UENA 3BKYL 5DRWB 3OSKA 3S4SB 1Y6NR 2WBKA 3FQTB 4IOSD 4PJGB 2V2WB 4XPTH 4EN3D 2V6HA 5ALBL 3O6FD 4ENEC 3OX8B 3R1GH 15C8H 2WP3O 5C9KA 3L7FB 2AJSH 2YK1H 2EDKA 5HDBF 5L9DH 1NMCC 4PJEF 1A6AA 1INEL 3S5LG 1Q0XL 1U3JA 1IGML 3F7YA 4HIIA 4U1JB 1A6VL 4JR9L 2C1OA 5IQ9A 4MJID 5KVGH 3WFCL 5BMFH 3HZVB 3L3KA 5D6DA 4ODHL 3BMVA 3OKKA 2BVOA 4XXDA 4R9HA 5I66A 3JV6A 3W2DL 4LLVA 1A21A 3GGWA 3LRSB 4NKIL 5E6ZA 1WFOA 3L3JA 1NCTA 1A7NH 3LKRA 4ONOA 5KW9L 4U1SB 3GMNA 1Z2KA 1MAMH 5J9PA 4XVSH 2NYYC 3FTGB 3OGOE 4IRZL 3QEQD 2R0ZL 2ATPB 3I50L 1H8SA 1KCKA 4FZEH 2YXFA 1YMMD 2VZSA 5F7HA 2JJSC 3FO9B 4UDUA 3BIAX 1LILA 1IGTB 5MERB 4IRSD 3VFVA 3DX6A 4PRIE 1JGLH 5EBGA 1F6AB 3SCMB 4KMTL 1XT5A 2IAMB 2ENSA 2VAJA 3OPZH 4DGIH 5DEFA 1BECA 1MVUA 4AEIL 5EU7C 2DRUA 5AUMB 3RWFA 4K7PL 1CLCA 1F3RB 2A1WL 3L3IA 2FEEI 4GKZA 3LVEA 3QH3A 3H3BC 3O3UN 3ULSA 3QRGL 4NJAH 4LGSB 4Z5RB 3X13A 4TSCH 5JOFA 4NQEB 1A9EB 1ND0A 1HEZB 5DGRA 2AVGA 3KPTA 2VDLL 3OZ9H 1NUFA 2R2CA 3MRGA 4N8VB 2P24B 5JMOC 3FQXA 5C0AD 3DTXB 4S1RL 2BVUA 1KT2B 2GITA 2WQ8A 5FCSH 1LE9A 3I6GA 4XH2B 1IAOB 5F72S 1TZIA 4ZD3H 1IAKB 4JZNB 1MLBB 2Q7YA 4JRYA 2JJSA 4LGPB 1FFNB 1XIWC 4YHLH 1A1MB 1LDSA 3PJSA 2OP4L 2V9RA 4G7YH 1RMFH 1YEHL 3D69B 4LEOB 1CK0H 4NO3A 4CU8A 3RUGF 1VERA 3BPLB 2BNRB 2CSPA 3O4OB 2APVA 2MCPH 5BXFB 2ZOKA 3NBNA 1I4FA 3FO2A 4JFOA 2ZSWB 1YEDB 4NQCB 4HC1L 4DFHA 5H37H 4OFIA 1JZ4A 4KMQA 4RISH 2VDNH 2FL5B 5B39A 5FA3A 3NPSC 3FT4A 3PNWA 3DGGA 1D3CA 2VL5A 3CFCH 3SQOH 1SMAA 2VDQL 2G5BA 1L9MA 2A6DA 3EOAB 3GSUA 2BX5A 1YY8B 3ZDXE 4NWUH 1ORQA 3QJHB 4OGAD 2VXTH 3T04D 2HJLB 4UB0H 3RJQB 5C8JA 4K3JL 5EBMA 1IAIH 2IWGA 3IFPB 5DD3H 1EZVY 1CFVH 2QADB 4I4WB 1CDJA 4CMMA 4BSJA 3SDDC 1XIWA 3TT1H 2I07B 3PWPA 5ANMB 5JIIA 2EC8A 3C8DA 5I1IL 5T5NF 4ZNEA 5L6YH 1UM6H 3ES6A 5BOPA 3KYKH 4XCEB 1TVBB 2Y25A 3REVB 3LQAH 3CDGB 1BD2D 5CJOH 5D6CA 5LGHL 2YBRA 3IJSB 3DYOA 3SJVB 5FO9B 2V2TA 3PQYD 4P5MB 4M6AA 5E6YA 2BOCA 2XXMB 4H1LB 4BELD 1H8OA 2EDEA 4DCQA 3C87A 3U1SL 2GKIA 4FG6D 1MCEA 2Q8BL 5I8KL 3SY0A 3QDME 1ZT4A 1J05B 1XF3B 3DV6B 3KJ4B 5A3IC 1MWAH 1A9BB 1OLLA 1K8IB 4OZFH 5D93C 1OD7A 1X5LA 4NKDA 5D1XD 1HE7A 2JJWA 4JQIH 1F90H 1LHZA 3RNKB 5I1DA 3MXVL 4WUUB 2ZOLA 4M7LL 3VXRA 3SDDA 3EGSA 2H1PL 5F9WC 1S7WA 4PTUB 2H3NB 1T4KA 2UWEB 3RPIB 4XVUC 3ZE2E 4PLJC 4GBXA 3OKDB 4J6RH 3IETA 1SY6A 2JELH 4YC2B 3TWCH 1LEKA 4MD4B 1UJTA 4GRLC 3V6OE 1G7MA 1CFSB 5IBTL 3JVGC 3ZE1E 3K2UH 5I0ZA 3FQUA 2H2SD 4JHWL 4DK3A 5IF0A 5CMAB 2ED9A 2ZSVA 3CFJB 1H15A 4Y19B 2JJTA 3CIQA 2DLFH 3K81A 4XC1H 5LWYH 2DKMA 4TTDD 1Z5LB 2B0SH 5KOMC 4EZMA 4Y7MA 3O9WC 3F58L 1QRNB 1KBGH 1DL7L 3HRPA 1AGEB 4YHOH 1D5BB 2ZP0T 3LOWA 1BF8A 4I0CC 1YY9C 2PYEE 3ULUC 1ZA6B 2O5XL 2VZ1A 4LVOC 4TUOA 4HUXA 4UOW0 5E8NA 1ZXQA 1BZ7A 3GZKA 3BZEA 3VE0A 3S3SA 3UJIL 4OF7A 5EUOF 2QV2A 2J8UE 1FN4A 4ODXB 4PBXA 2ATKA 2C4FU 3MLYL 4YXLH 2F8XC 5GGTA 1ZGLA 1Y18A 4GRLA 4PJXE 2P49B 3WDJA 3WS3B 3FN0H 2GT9B 1TJGL 3JVGA 2ITCA 4RAUA 4R4ND 5FFLA 3DOSA 3SKJH 2UZYB 1AKJB 3HS0A 4Z7QF 3TBYB 2LAAA 5ILTH 1U93B 4N90E 2V17H 3UTTE 4L4VD 5T1KB 3BUYA 4KI5D 4P5KB 4G42A 5IBLD 2GTWA 5GGQL 4C55A 5I19H 3EYFA 2J7LA 2BZDA 5DJXA 4LAJH 5T1LB 3O9WA 4WI8A 2EE9A 5FECA 3GKWL 1UWGH 4PRPB 3VXOB 4PJFF 3JV0A 4KK5D 4XAKD 2YPVL 4OFYD 2YPKA 3FOLB 1QO3B 2DTSA 3V8OA 3MBEB 4G8IA 43C9A 1UKSA 3UPAA 5A2JH 5IGXL 2VZOA 4ZO7A 3UZQA 4WIQA 3VFRA 4UTAH 3V6ZA 1ZVSA 4MD5A 4JPVL 2D03L 4OQTA 1Y0LA 4K8RH 1JGVH 2HAZA 2PNDA 4OV6F 5A1AA 5DJYB 4KY1H 3RWEB 4NN6B 2MJWA 5C0CB 3UJTL 4LSUH 3MLSL 2WIMA 4LCYB 5FYJD 2OJEA 1U8HA 3D2UA 3BIBX 5I18L 3WN5B 3H7LA 2XZQL 3HC3H 3MGTB 1FFPA 4Y4KD 1JZ2A 4YQXL 5SWZA 4P23D 4HZLB 3ESUF 3KYAA 3V52L 3PWJB 5DR5L 4ETQB 1Q9OA 1IEHA 3THML 3LCYA 3I75A 5I0DA 1YPZB 1Q8MA 5HYJB 1TQCC 2A77L 1DEEB 2NCMA 1IGJA 4PRNA 2AJVL 2P5EA 4M3JA 3QFDA 3LH2L 5A2LH 5DJ0B 2M2DA 1R3IL 3KJ6H 4AH2A 1A3QA 3UXFA 4JB9L 4I5BB 2ZPKL 3OXRB 3WKML 4Z8FH 2DI9A 5AG9A 5I1JH 4QHUA 1OGAD 4HQQL 4OD2B 3KPSD 1IM9A 1I9RL 4HKBB 4E41D 4S1QH 3MACH 3AXLB 2EYRB 3GBML 1FIGH 2F54B 1CF8L 1YQ2A 3M8OL 3V0VB 4EOWL 4G80B 1I7ZB 2OSLA 3F5WB 1XZ0B 3NCFB 5E95B 2XWBA 4PJAB 2BDNH 3V4VL 1U95A 1EEQA 2CDGA 4M7ZC 1P69B 2J6EH 3D87B 4D9QD 4LCUB 5I1LB 4JCMA 1T0MB 3GNMH 4QKXB 1UH3A 2AKRA 5FM5O 5INDB 1T80A 4X9IA 3T09A 4I18B 1AR2A 1S7QA 3SPVA 5TPWL 4NO0A 1IEBB 4O02L 2WWMC 1N64H 5IB1A 4LLUA 5KVEL 4PJEA 2IPTL 3F8UB 2VSCA 4EQ2A 2FYYA 1ZSDB 1W0YT 4I3RH 2DWEA 1H8NA 2LVEA 4BZ2H 2IBZX 4YHPA 3T3MF 4ZPTA 4R7DA 5A16B 4KHTL 4PBVC 1HQ4A 5E70A 3LKSA 1MHHA 4CAGA 4IHOB 5GRVL 4MNQD 1ZHKB 4POZC 5CEYA 2DLHA 3NZ8A 3ELAT 3DROA 1T22B 5EO0B 2OYPA 4YO0A 3P9WB 4PJ9D 4WRLA 3OGCA 1IM3A 4WI9A 1N7ML 1MJ8L 1FYHB 4G6JH 3NGBC 3CPLB 3QCUL 3SE4C 2DB8A 4GXUN 2VKWA 4IOIB 4Z7NF 2WUBL 3ARGC 2DBLH 1CXKA 1N5YH 4Y1AB 1VACB 3C5JB 3QDGA 3RAJH 3EYSH 4P4KB 2WAHA 5EU6D 1O7SA 3QG6A 3MRJA 4DZ8A 5B8CB 3KPOB 3L7EA 1T89C 4X7DC 5FB8A 3TO4C 1OAZL 3ULVH 1S78C 1KN2H 3CDYA 3OJVC 3CXDL 1KPUB 3HR5A 3ETBF 1U8LA 2E6JA 1FP5A 3QJFA 3T1FB 3QWQB 5FHBL 4ISVB 3W81A 1E27B 1JPTH 2Q1EA 1NBZA 4UQ3B 4OZHB 4CL7A 5SV4A 4OZIB 4NC1E 4G43B 4JPIB 4KJWC 2AJZB 1ULVA 3RWJA 5B38A 3U4BH 4MAUL 2YEZB 2L7UA 4X6CE 4JM2F 3SE4A 2FECL 1CTOA 3ZDYF 1J0HA 5IT2H 3GSQB 2WSKA 3VGEA 3A6OA 3ARGA 1WUNT 3EFDL 4L8BA 3ARDD 4AIZA 1CU4L 3RUGA 4G8GE 4KQ4H 4BK5A 1HSAA 4KKCC 3CLFL 3IAPA 1L9NA 1BGXH 3DMMB 4C59B 2D31A 2HKFH 1W72A 4RFNB 4HIXH 2Q86A 3KHOA 1SM3H 1T89A 1V05A 3L3DA 4MA3A 2Z93A 3TO4A 1CLZH 3TIEB 3VFGL 4ENED 1FVDA 3F62A 3G08A 4H5SA 1YQVH 3UTQA 4TSBH 5DRZA 1MREH 2HJFA 5FHAH 3WDIA 2AQ2A 3UYRL 2AS5M 5EH1A 4O2FA 2ZNWA 5F7EH 2NY0C 4BQ9A 5IIEA 3MRCB 4GG8B 1WC7A 5KVDL 3MJ9H 1D5IH 5F7YC 2BOBB 2N56A 2NNAB 5EBLA 1J5OL 5EU3B 2GIYA 4HWBH 5HVHB 5EIIA 1P84K 2PTTA 1X5HA 2F15A 1ADQA 1S9WA 4P2QB 3RGHA 4CKVX 1FFOA 3CSGA 5K9OB 5CBAA 3VW3L 3MFFB 3NA9L 1ZHBB 4LDEB 4Z18A 5I74B 1BJ1J 3H7BA 4HK3J 1U8QB 5SX4H 3TM6A 5KSUB 4MJ5B 3QUYA 1I1YA 4L9LC 3BKJL 3KS0J 3OKOA 3O3DB 5LXGH 4DQOL 2C7UB 3L95B 2A6JA 3CH1B 4L3EB 1BZ9A 4UDTB 5IESH 3MV8D 4APQC 3W9EA 3UJJL 4XNMA 1QR4A 3VWJC 3I9GL 2XTJB 4K3EL 1BJ8A 4M02A 5F88B 5AAWA 3OMZA 3DUUB 4PJIF 4QOKE 3MA9L 4GSDL 4AMKH 4LSPL 1U8MB 4S1SH 3GM8A 5HY9A 2FEEL 4PJ5B 4URTB 3HPJA 1XH3B 3MRPA 3FQWA 2G9HA 1KJMB 5IEHA 1OD9A 4NZJA 3ZTNH 1YDPA 4NQXA 3H9SB 4YBLB 3K2MC 5DMIL 4U6HA 5TE6L 3BGFB 1NCBL 4NKMB 1ZLWK 3U0WH 1KC5L 1WZ1L 3PIQA 3S35L 3SDAC 3TN0C 2VLMD 4LLMA 4DW2H 3M07A 1IQWH 4NPYA 5I1HL 4RGNE 2NW2B 4L9LA 4NT6B 1MJUL 4NRZA 4OLZH 2DQHH 5IROA 4G6ML 4PJ7B 1A0QH 1R3JA 4ZUTA 4X99A 4JFHE 1P4BH 1RJLB 4APQA 4PS4L 1O7VA 1C5BL 5JXEC 5IEKA 4NN7B 1FNFA 4YH6A 3VWJA 3L6FA 1CDUA 1IC4L 2W0FB 3KLHC 5L7XH 3LN5B 1RUPL 1VEMA 5IFJA 4PJGF 1WTGT 4MA7H 5EUOA 4FXKA 5GHWL 4D0BB 4KROB 5LQBH 1I7UB 3KPRE 1Q9LA 4JO4L 5HHMB 1BREA 1BQHA 1M7XA 3HG1D 1Z3GL 2DMKA 1FH5H 2EO1A 3G9AB 1ORSA 1KXTB 2J88H 4GMSH 3RHWF 3SDAA 3MR9A 3TN0A 3SDDD 1ZLVK 3BPOC 2P5WE 4C58B 4KTEL 3D25A 4EIGB 4L5FH 2UV3A 1OP5H 3EO0A 3QHTC 4WU7A 5FIEA 3KR3L 2FX8L 3S6CA 2XOTA 1M7DB 4KVNL 3S36H 4HBCH 1B0RB 5HTSA 4BFIA 3M1BA 3KPQB 5BJTA 3HRZB 1B4RA 3T0EE 4U33A 5D72H 5I1GH 2R1XB 5JXEA 1MHPL 4YHIA 1NBVH 4FTVA 2VH5L 3PWVB 2HVKB 5GSRB 3QWRA 3HC0A 3CD4A 2VSDA 3PHOA 3SKNB 1J1XL 5A3ID 2FEDD 1YYMH 4X4ZA 4GAYB 2FX7L 3QEGL 2OS7A 1LP9B 2OI9C 4HGWB 4HWEH 1NGXB 2QQKL 4CGTA 4ERSL 4JO3H 3RVWC 3IVKB 2EEAA 1OGTB 3VG9C 5HHQA 5JW4M 5J13C 4DEPB 1G7PA 2ZKHH 3HPLB 5T5FH 5GS3A 2AXGA 1MRDL 5I71C 4XI5C 3F7RA 5GGVL 1MCCA 5BRZA 4N0RA 5FOBB 5IVXB 1G84A 4TRPL 1HZHH 1NKRA 5C9JA 2R0WH 4UIMA 1WVZA 5M94B 2CUIA 4PLJD 5AD0B 4R96A 3U36A 4M62H 4LF3B 4Y5VB 1FVCB 3GHBL 4R4FH 3JWDH 3I85A 1CZ8L 4GRLD 4WJ5B 2H8PA 2W59A 4M03A 1XGQA 2DM4A 4WW1A 5K9JH 2EIDA 1K8DB 4NQDB 3MNVA 4M1DL 4Z77B 1U8PB 3BT2L 4KUZH 3TYGH 1SJXA 3VRJA 3VG0H 3QIBC 4XNXH 4MMXC 3VXTB 2FD6L 2PF6A 1IAIM 4HD9A 1VADB 5DUMH 2IFGA 1I8MB 5T3ZD 2VXVH 2Z0BA 1FYTB 1IGFH 1S7XA 4X5WA 1FNHA 5D8JH 4HT1L 1J0IA 2AI0L 1I9IL 5JHDB 1QPXA 1R3KB 5BV7C 1OLZA 4LLWB 5EZJA 1NMBH 3P2TA 4ZFFA 4N9GA 3FRPA 2B1AH 1DQQB 2IAND 3ECBB 5BZWB 3MZTA 3MZGB 1YY9D 3CZJA 3QHFH 3PDOA 4LBEA 4C56E 4QXUH 4HIJA 3BFOA 3GSOB 4PPTA 5EN2B 1GGUA 1LDPH 1RI8A 2R4RH 5D96B 4O58H 1D5XB 5L0QB 1AGBA 1ES0A 4U1HA 1TDQA 4M6NH 1F2XK 2J12B 1QFUH 4JY4B 4RZCB 1YECL 3ZKSD 1YNTA 3MREB 2BRRH 2AK4A 3GJFK 3MRBA 3QIBA 4YR6B 3MV01 1RIVH 2YZ1A 1PY9A 5GRUH 3E6HA 1M7IA 1VHPA 3QO0B 1T20B 3OB8A 4R97B 4NNPH 4Q74A 4PRBB 1J0YA 2D7TH 1T2QH 1M71B 3VFNB 4C4KO 1BEYL 5J6HB 2M26A 3ARFC 2Z31C 1VDGA 5SWZD 3ZHLA 4XP5L 1F00I 2EDQA 3MBED 2OL3H 1DSFH 1LO4L 3U6RA 3NFPB 3LEVH 1VKXB 2GSGA 4N0YL 4W4NA 3GJFA 4ZMAT 3TVMB 1NGPH 2P5ED 4PGCB 2WZPD 5LAXB 3C60B 2KUTA 4BQCA 3EYQC 2OXGA 2PYFB 4XNQA 1YZZA 3GBNL 4QRRE 1HHKA 2ORBH 3P4MB 4XHJC 2ITDA 1PKQB 4E0RB 4HXAH 1CLYL 2I9LA 4YFDB 4NDMA 4DKAA 5INCB 4JFYA 2HVJB 4ZOCA 1RZJL 1GZQA 3ILPA 5J12B 3CSBA 5AWNL 1IM9D 4XMPH 3WLWC 4B5EA 1HH9B 3DBXB 4JHAL 4WDIB 1IRAY 3G6AB 1RZKL 3I3EA 3R8BB 1L7TH 5B4MC 3RGVB 4OCWL 4JM2C 3AROA 3ZT5A 4NJ9L 5KSAD 5DMKB 2HYMA 5FKAB 2X4QB 1MCNA 2NY2B 3PXHA 15C8L 5B39G 1QA9A 3ARFA 4M48L 3O81A 4HDIA 1NDMA 2CDEB 5EOQL 5L88H 3DRQB 3D39B 3BXNA 1DBAH 6FABH 1P4IH 2A9NL 4RMTA 5BMFL 4GRMB 1KCRL 3VXSB 4GMTH 1HCFX 4MAYB 1LEGA 3ET9F 5E6IC 1BLNA 1DQJA 4HMCA 2VLKB 5CEXB 3CVIH 5EFIA 4BQ6A 4DAGH 4UT7H 5DWUH 4NO0D 1NSNL 5E8OB 2F53E 3NZHH 2DIJA 5I9QC 4XVJH 1KIPB 1IQDB 5IB4B 2HRLA 1QFWM 3FOMB 1MCIA 2EDWA 1MAML 3GUTA 3S96A 1UXWA 4WFFE 1BX2A 4H0HB 2XTLA 2FHFA 5SX4I 4Q9QH 4FZEL 4FHBD 3IF1B 3HE6B 4Q0XH 1EDQA 3STLA 5IG7B 1C08B 4JM2A 1EHLH 2J4WH 1HQRB 1KLFA 5IFHH 2EXWC 5C86A 1G0XA 2APFA 1KCSL 2Y5EA 4ZO8A 3OPZL 4UQ2B 1NCCH 4DGIL 4I3SH 3QXDB 5CSBA 4B0MM 5L8LB 4UT6L