3M88A

Crystal structure of the cysteine protease inhibitor, ehicp2, from entamoeba histolytica
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
b'PHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEPHPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amoebiasin-2
publication title Crystal structure of the cysteine protease inhibitor 2 from Entamoeba histolytica: functional convergence of a common protein fold.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 22
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m88A00
2NQDA 2FO8A 3E1ZA 3PNRB 3CBJB 2H7WA 2OULB 2WGNB 2NNRA 2C34A 3M88A 3M86A 3CBKB
chains in the Genus database with same CATH superfamily
3FTSA 2CGRH 4FMKA 4AOFA 4FQ2L 2EABA 3OR6A 2VLRE 3ZE1B 4F37K 4RWYL 1UA3A 4LVNC 1S7WB 1UZ8A 4FABH 1PDKB 1XL4A 3EYOB 4G2AA 3LX9A 4B60A 4HOZA 5BV7H 5ILTL 1U92B 1SYSB 2VDNL 4HWNA 5BMFH 5T1JA 2F6AA 4A2GA 3X1FA 4Z7WB 4DF9A 3GSXA 3DVGB 3SB3A 5HYQA 2EXSA 2KC0A 1FHGA 3RNQA 1G0YR 1UOKA 4LL1A 4Y1SA 2K8QA 3LKSB 3V55A 2HJLB 1IQWH 3HN5A 2COQA 4JDVA 5EU6B 3KD4A 1O6SB 2ZUYA 4GAJL 2APVA 1N59B 2FQGA 5DYOA 2D73A 2XY1A 1YEWA 3D39A 3F58H 1W8EA 5PAZA 2EIBA 3FO0L 4OIBA 5TGBA 2BHFA 2EC8A 1VRSA 2CAKA 1JPSL 3UO8B 3NCYS 1ZLUK 4HK3J 1RZGB 4JZJC 4XE5B 5E70A 4CGTA 5C0CA 2OMXB 5H4ZA 1IRAY 4U6VL 1EHXA 2AV7A 3BEWB 4YGVA 4B9PA 1MXGA 5TDPA 3E0GA 1C1EH 1YN6A 1PZ3A 3FQ4A 4UQ2A 3RL1B 1C16B 2HT3D 4YHMH 1MG2C 1T2JA 1B4JH 1HVXA 3VYNA 2X4SB 1P1ZB 4B6ZA 4XN7A 1E4XI 4FQXA 2IAMC 4APXA 2AK4E 2JKRM 3QRBA 1T1ZA 5FF6B 1WFIA 3AJ7A 1EEYB 1YEHL 1OE2A 3GZOA 4X7SH 2FJGB 4V1DB 3PWJB 3P30L 4KZDH 1JF1A 2W9EH 2VM4A 4FNLL 2H6UA 4PPTA 4DGUA 4Y9GA 3BVNB 3A6CL 4JO4L 3ATBA 4Q74A 2DIJA 1EZSA 3ABKB 1JMXA 3RGBA 3H3BC 4FQCH 4E5XG 5TTRA 3L1GA 3P11L 2H2PC 2X3CA 1HHJA 2XN2A 3G5WA 5JZ7D 1FF5A 1G7JB 1UM6H 4L1SA 3TN0C 1FAIL 2PWHA 3ESVF 3DX2A 1TZHB 5C3TA 4MQ7B 4QHUB 3DRQB 4RNRA 5CEYA 3TCLA 5F3BB 4DP1X 3WAJA 3ZTDC 1OAJA 3FN0H 5I30L 2ZYIA 1VADA 3OKOB 1LO4H 1VLXA 3S34L 2DMCA 1UACL 4ENEC 1L7IL 5LWYH 3QQDB 5IQMA 3UTTA 3GUTA 4HIHB 3BN9C 4KBPA 2UWEA 5A7BA 2H5UA 3TZVD 1FN4B 1X5KA 4JW3A 3O6KL 4A55A 4LLYB 4XNYL 3S96B 4U1JA 2BS8A 3CN3A 2CRIA 4FE9A 3T2PA 3T2OA 2YKLH 1P7BA 4ETQB 4WO0A 5HHXL 4YSSA 1BBJA 1IGYA 1OB1B 2WZPD 1J48A 1AR1D 2OMVB 1FH5L 3N1FC 4LGSB 5A2KH 2KPNA 2NUTA 3EHBD 4W1TA 1JYNA 4JDTH 4FGMA 1TVDA 3NRFA 2W60B 1LE5B 5F7DB 4KTEL 1NGZB 4GXUM 5TE4L 4ZNEE 3MV7E 3HG1A 1MFNA 4EUPG 5H94A 5AW4B 3ARFD 1VFOA 1OP5H 4HFWB 2W59A 3QDMB 2NY0B 1RFDL 2Y5EA 1PSKL 3ZHLA 2XQYA 2XTJE 4E9LA 4LSPH 4MD0A 4K94L 4PS4H 4NIKB 4FN0A 4N0YL 3SBQA 3CFNA 35C8H 4X0KB 1JDDA 4PGBA 1JGUH 1O5DT 3QC5X 1HL9A 3IDYB 4S2SA 1H8NA 4PJEB 4MNGB 4L3EE 3H8NA 1IARB 2ZAGA 3D6GA 1IEAB 3E8UH 4OCSL 5EZLA 3IMWA 3VI4E 4FHBD 3N40P 5D7JD 3RWHA 3U82B 2MWCA 1CD9B 2ZSWA 2AJ3B 3S3PA 3AS2A 1AACA 2JIXD 5B7EA 1WV7T 2F54B 2OPCA 3QUML 4P4KA 2KT6A 4H88L 3QAZB 1CGVA 5I8CB 1UXSB 2OULB 1DN2A 1ZA3A 1P1VA 2JB6B 4JPKH 4XTRC 4YL4A 4FFVC 1H3XA 3BKYL 3FFDB 4WKZA 1IAIH 2F15A 3NJVA 2XV2A 1G7HB 3ARED 1A6TB 4JFFA 3TO2A 3S88H 4QPEA 1KXQA 3BWUC 3P0GB 5I75C 3DYPA 3IE9A 1KC5H 5D96B 4EN3D 3WFDH 3D2UB 4JRXD 2DQJL 4IOFD 5FGBA 5FYLH 3CDYA 4X6DE 5I8EB 5IW6B 3CH1B 2DI7A 5IF0B 3FO9B 3T1FB 3EO1A 1A1NA 4OI9A 3UDWC 4TYUA 2CKBB 1A6AB 4RDBA 4K07A 1J86A 1S5IH 2FBJH 2AJZA 5HYSB 4YDNA 1HT6A 4ZUVB 5C8JB 5DJ0B 4Z8FH 1FL5B 4POYA 2JB5H 3V0GA 2WQUA 1WC7B 1K8IA 2FVNA 2QSVA 1A5FL 3TNMA 3PJNA 2ORBL 1M57B 1YQVL 1T20B 2CRMA 3PGFL 4NIYE 1COBA 3CMGA 1JXDA 2EXYC 5K59F 1Z66A 4RBPK 3WFCH 4NN6C 1T1WA 2EP6A 1F42A 2QQKL 3B7SA 4K3EH 4UM9D 4HLEA 1P9MC 1NCWH 4MWFB 4RMWA 3O45A 3PG2A 4DQAA 5IZ7A 4AV0A 1RUPL 1W9XA 1RK7A 1N12A 1KFGA 4Q9BA 5KN5B 4UT6H 5I6KA 1Z3GH 5C08D 2Y5TB 2BNUB 2CM5A 3IPEA 3RWFB 1TSRA 4E42A 1FHNA 3PDGA 4ONFL 3JVFC 1FZKB 5KTEH 5F7HA 3LN4B 5HDQH 2IDUA 1CDGA 4J27A 4JNXA 2XZZA 5D4IA 5F9AC 4WF7A 4UTCA 2E7HA 4S0HA 1BQLH 3G6JA 4Y4HD 3U4EA 3VM5A 2R2BA 3B7UX 1UT9A 3IN2A 4NQVB 1HL4A 3ARBD 2Q20A 1Y7VA 1HXYB 2ZSVA 1DSYA 4AYSA 4AT6A 3DXAD 2FT6A 1XGUB 5KSAA 5DF0A 3C2AH 1XV8A 2RJMA 5IMKB 3VH8G 3KJ4C 5C07E 4D94A 2HKHH 4Q6IA 3H9SA 2VLKA 3OKMA 4PJ9D 5IQLA 4MA1C 2KQNA 5KS9E 3T6QC 3H2WA 1FNGA 2ZXBA 3EFDH 4BFOA 2QQQA 5JHBA 4UT9A 3V4PL 1QFWM 4ODHH 4M7ZC 2I24N 1UQSA 3DRTA 4HCIA 2CNZA 5EN2A 3D07A 4KKRA 1LEIB 1QLFA 1MCPL 2R7EA 3CZFB 4ZX5A 3FH7A 4HWBL 1JHTB 4OF8A 4PVBA 3FONA 4HIXH 5JXAL 3VFTB 2CR0A 5FPIA 5IREA 3EH1A 1P6AB 2DQGL 5CHNB 1YC8A 4PJ7A 4PJBE 1AQHA 2J5WA 3EXJA 4G7QB 5AKTA 3V0EA 2BVYA 1WQVT 4KKBC 2XFXB 1IAII 2B16A 3TV3H 4C58B 2J21A 4MQTB 3MI6A 4WI2A 2GIMA 5J12B 4Y2DB 4JJOA 2EEBA 3ERXA 3O0LA 4DGVL 3WJJA 5TE7H 4POUB 4LQFH 5JIMA 3SGKA 3RDJA 3TBVA 4XVTL 2WUCL 1E67A 1GA2A 3HA0A 3P9WB 5HPOA 2G60H 4PBWD 3OSVA 1H5BB 2DM2A 3OPZH 3S35L 3HS8A 3HRZA 2QZ5A 1M42A 1CGSL 5E4EB 5CCGE 4ZXBB 2NW3A 5TQ2L 5DUML 4YIQA 1PAMA 1L0YA 4R90H 4U7SA 3NK4A 2YRZA 2QL1A 3BKCH 2ZX8A 5FGCE 3EYSL 1WAAF 5JHMA 2V2XB 4BIKA 3DSNA 4JFEA 1XCWA 3QRGH 1RIHH 4DN4L 5ITBL 4ZPTB 4ZX6A 4Z7OE 3RIKA 2APSA 2JH2A 4FI8A 1Z9SB 4X8CA 3V9CA 4X8GA 5I1KH 4A63A 1AO7D 3HHMA 4JO3H 4ZMQA 1JYXA 1UD2A 1CIUA 4J8RA 3STBA 2OSXA 3SE3A 3M07A 4P4RB 4XWOC 4OAWA 3NA9L 3BRFA 4F7EB 2IQAA 1RH8A 4XBPA 2GYSA 4GI9A 4GAYB 4IMKC 1M7XA 2AK1L 1XEUA 4GKZA 1E8ZA 5G5DA 1TMCB 2JCCE 4HCGA 4P2OA 2NNFA 3TYFA 2UY7B 4CMMA 3ARDB 4PJHA 3AXLB 5DURD 5BQDA 3IFOA 2QJDA 3NEEA 4BRVA 4TUJB 5HD8C 1VZGA 3MLWL 4NZDA 4YSTA 3UAJC 5MENB 4OLYL 3O3DB 4WFGD 4NC1C 5FECA 4NQQA 4ZMPA 4J3BA 1C5DB 2HG0A 2MKLC 3G5VB 5AL8A 3U1QA 4MXWL 4IU3B 4QUOA 2O5YL 1HCFX 2B4CL 3G6DL 5KYYA 4MQXD 1GW0A 3KWWA 4OI7A 4OSUH 1TO5A 2IAAC 3D18A 3CZGA 5CD3A 1O7DC 5T1MB 1OZUA 2KS0A 1NLDL 2H2PD 3PQYE 4LBAA 1ZDSA 1C9SA 1GIGL 1PLAA 2PETA 1EO8L 2FQEA 1EDQA 2V33A 2QLYA 3NVQA 4Q2ZA 3WN5A 1IAMA 2WB7A 4BSWA 1DVSA 2OLDA 2R51A 4OGXH 2WXPA 4HA1A 5IVZA 5HBBA 1U36A 1BMGA 5B1KA 4IRSD 4WEBH 4JKPH 2OXGA 4PCYA 4ENED 1FI8C 5KSBE 3VFUA 3GBEA 5E0QA 2Y3AA 4XVJL 4JY5H 4BWUA 3BP7A 2GJ6E 4YHLH 4FRWA 3OKNA 4FJYA 4MRCA 5PCYA 1HZLA 4MYPA 3UABA 2OP4H 2BSRB 2VW4A 1FLTX 2NY7H 1KGIA 2G3NA 4HJJL 5DA0B 2B1OA 4L1DA 5JQ6H 2HX8A 3SJVB 1DLFL 1WCQA 3O0RL 3OKKB 3VI3E 1KPVA 1OM3L 1KCSH 2YPLD 5CCHE 1OTTC 1G7MA 5HJ3A 3CJJA 3STLA 4PP2A 3C5ZA 4KRPB 3D33A 4WO4A 3SOTA 1IFHL 5KVGH 2APTA 5DVOA 5F88B 3K6SA 2WNKA 2O61B 4MB1A 1SRDA 1RUML 2BSTA 1LO3H 4R0LB 4G6AD 3WNJA 1CMOA 3S3SA 5GRUL 2OL3B 1V55B 4I85A 1TNNA 5IWLC 2BNQD 5IEKB 1RK1A 2NNXA 1B0WA 25C8H 3LKRA 4AC2A 1Z9OA 1DLHA 4MASA 1QO3A 1R3IH 4P57A 2HA1A 2YEVB 5C0BA 3IMBA 2JELL 1P4BH 4IGBD 2Q8AL 3UPAA 3T6WA 5MHSE 1GYAA 1N4XL 4PR5A 3P4NA 1CWVA 1EXGA 3V0WL 3H7BA 4HKZA 5FO7A 3CHOA 3S8WA 4GW4B 5DVLA 3A22A 3N0AA 4GBXB 2EC9U 5EEXA 3LMJL 4JHWL 4HCRL 2DL9A 1SVCP 3HG3A 1FZOA 1EEZB 1I1FB 3MGTA 3FQXB 5DHYB 4BZ1H 3NRQA 4LLVA 1KXVC 2YRBA 2KPWA 2AXGB 2WGXA 3RDTC 4YQXL 3MBEA 2H0FA 4XTRD 1CJYA 3QORA 5DK0B 3O2DA 2PWGA 2CDGB 1UJTA 5D7LE 1NGQH 1LQBC 1NDTA 3GSQB 1JHLH 5D2NB 1AC6A 1AHWA 1HWHB 1J18A 3UADA 5CJXC 2X88A 5K39A 1EEQA 4NO5A 5AZUA 3HE7D 4PW4A 4C83B 1MCRA 1TU2A 2H26B 1E5CA 1E4WL 3GXTA 1OOAA 5KEZA 1BZ7A 3TXAA 4G6MH 5AYUL 2IDCA 1MFMA 3W9EA 3D25B 4DP8X 1VAHA 2E9GA 4FXKC 3IGAA 4ZW3A 1AKJD 5FA3B 3LH2L 1E7VA 3QQ3B 5E8PA 5EULV 1EZVY 3HI6L 3R06B 5AW8B 3U0PB 3C09C 5FCUL 3QYCA 4I8DA 4ANVA 1Q94A 3IAGC 1CD1B 3WMPA 2MIZA 1T2QH 2DKMA 4XBGB 1NUDA 2BJMH 2V17H 4XCNA 4RISL 3EZ8A 3TC9A 1BMZA 3TNNB 1A9VA 3D39E 1L9OA 4RGOH 4XODA 4PRIA 2R0ZH 4HIJA 2QADC 1SEBA 3A47A 5D72H 4YZFE 4U0RC 2QDVA 2LU7A 4WWKC 1U3HC 1XIWB 1FSKC 5C0CE 4NQED 3QCUH 5D5MA 2L7JA 3LIUA 1U93A 3WUZA 5ESVA 2EADA 4AVHA 3MUGA 4EF3A 2E5EA 1DVXA 1OAUH 3ZDZF 3IMRA 4X2UA 2BLFA 2VJ0A 2QGBA 3LRMA 2ZKXA 3MV7B 4PJXA 2QFPA 4E5XA 2DQHH 4RFOH 4WFFE 1H9DA 1MFVA 3FRPG 4HF5L 4B3EA 1JBJA 3RBSA 4LNVA 4PUBH 3LZOA 1XSKA 4F8LA 2XTJB 4ONHA 3RGHA 1E27B 2KDYA 4BINA 4AK2A 4XX1G 1OSEA 1R3KB 5IBUB 3BRDA 1DQKA 5DFVC 2I5YH 2WBJD 4UU9A 1NKRA 3CE1A 2YARA 2COVD 1JPFB 1Z6JT 2E9BA 4P5KB 3VI4B 3JYBA 3JBG7 5JPNB 1P5VB 3NOIA 2ADJB 4NNXA 2JI3A 5FYKU 5DRNB 3R8QA 4NJ9L 3C75A 3NCCB 1JK9A 3W56A 1WHOA 2QSCL 4GKLA 4LCUB 4RWYH 4I18C 1KIQA 3L81A 3AB0C 1FUNA 3REVA 3UTTE 2K3TA 2AVFA 1G5GA 1YMMD 3CFBA 3U83A 5K1JA 2UWEE 2QPEB 3DDFA 5C0AA 5ILTH 3EG9A 1WIPA 2VDNH 1NBVL 1LE9B 3E8VA 3QO1B 4N0FB 5ESAB 5FKPA 3MRIA 5CEXB 3DVFA 3BW9A 4GNKB 1NOAA 4RZCB 3WIAA 4AGLA 3GMOB 5C0JA 4TNEA 4LSUL 4AQAB 4LFHD 5HGAA 4KNTA 3HG4A 1Q1PA 5AOLA 5F1IA 5IB2A 3FQNA 4GAJH 5KBMA 3DNKA 1KB5H 3H55A 5JHDD 1CR9L 4KDTA 1ESOA 1A2YA 2OXHB 1QSFE 1RUAL 2DLIA 2XVLA 1ZJAA 1JPSH 1WBXA 1L0XA 1TQCC 3HG1E 3N5AA 2MMXA 3L7FB 4U1KA 1FE8L 1ZT7A 4U6VH 2VL5A 3KDMB 1GJWA 2X3BA 2R0KH 3BAYA 4KO9A 3ZQWA 1Z7JA 2P24A 5EZOL 4O9HL 2VLJB 3CFJA 3LHPL 5LNDA 4EKJA 1A1OA 4KNUA 4LPUA 4PS8A 3BP5B 4EZLA 1XCTB 3CAFA 3H7LA 4HUWB 4DCQA 4XWOD 2BHZA 4Z6AT 3CDFA 3U7YL 5CP3H 3LEXB 1CI5A 1X5IA 4CVWA 3ZE0E 2JK5B 3GJEB 3CG8A 1FVEB 4FNLH 4K3DL 2D3VA 3HLAA 4TNVK 1TF4A 4PJCA 4YFDB 2QVMA 3QJVB 2GSGA 2P5WA 3A6CH 4JO4H 1UWEL 3QR0A 4JZOB 2QLVB 2ZWZA 1OGAA 5HD8D 2TRHA 5IM7B 4JFDD 4IIQB 3OHXB 3UAJD 5AOMA 1BREA 2EXWC 4PGCB 4K7PY 3QS3A 4WUUD 5E6ZA 2JKIS 3Q2NA 4R7XA 4XPHH 4Z3GA 1FAIH 3STZA 1IMHC 4M7KL 4K2UH 4X6CA 4BZ2L 5K5YA 2BSEA 3ENEA 1CUOA 1FVDA 3AM8C 4NKOB 4ZYKA 4R5XA 1AGDB 5JW4Q 3PUCA 3OMAB 5I2IA 1QSEA 1S78C 3GFUA 4FZEL 5SWSA 3WEOA 2PUQT 5I30H 4JFFE 1TJMA 3BSZL 3S34H 1KXQE 3QWNA 1UACH 3LXCA 1L7IH 1NEZG 1S3KL 5DHVB 3HN3A 3P73B 2W81C 4QKTA 1JNHA 3QUXB 1A9BA 5JTWA 1XF4A 5HDBE 5JPMB 3NIGE 3L3GA 1HSAA 2DIEA 5F7KC 1X6NA 4TUKL 5AVYB 3VXPB 3MLXL 1BQHB 4TRPL 1UWXK 5HHXH 4NI3A 5AVWB 2Z0UA 3F6LA 1I3RB 3UH8A 7TAAA 2JKSA 1FH5H 5HDOA 2YXVA 5D7HA 1LDPL 1QYGL 4PJBB 4EDXA 4WHDA 1I1YA 1PAZA 3HRPA 4MJID 1EJFA 3P4MB 4YWGH 4ZFZB 3WDIA 4UTAA 3IU3B 3SKMA 1GZPB 1SDAB 3QHZL 4MMZB 4U6XA 3ESUF 3VFVA 4ZUSB 3TIEB 5KBDA 3B34A 2BCKB 1E6OL 4OM0L 3MQIA 1GJIA 3FCSB 1BBDL 1RFDH 3EKCA 1OANA 4K7PL 1U8PA 2YSSA 3T3MB 4AXWB 1PSKH 4QWWC 4L4VD 4Y9FA 1M53A 1KIUA 4K94H 4PD4J 1KTBA 3R0MA 4N0YH 5I23A 4UDTB 1HXKA 4TNWF 3WNLA 4A37A 3MNMA 4Z18A 5FOBA 4G9FD 4AQZA 2VMDA 2FEEL 2X0WA 2FIRT 3K2KA 1G1OA 5DHXB 3VH8A 2X42A 1JK8A 1YUKB 2AEIT 2J8UB 4A2FA 1TCRB 3GRGA 4OCSH 1UKQA 2GCYB 2WTRA 3L13A 5AW7B 4ZZKA 1F4YL 2DD8L 3LKNA 3ZLQC 1QTPA 2DQCL 1VFBA 3MV8D 3RVWD 2GK0B 1EHAA 4MZ3A 1KXTA 3Q6FB 4YHPB 1I1RA 1K8DB 2XWBA 5DZPA 5DLML 1S9KC 1W15A 3QUMH 5LBSA 1WYJA 3DO7B 5IUSA 2OZNA 1M1SA 1EFXB 5I1HL 4GIOA 3L17A 2JKXA 2P44B 3H9SE 3QEGL 5IHZB 2AQPA 4W9DC 1I1AB 4OJEH 4YMPA 2FB4L 3N50A 2XCMC 5D2LA 1N5AA 5B1BB 1W72A 4KY1L 3BLBA 4ZK8A 4F27A 4TULL 1MG3C 5BUAA 1PX3A 4ANWA 3U7WH 2CIIB 5C2UB 2CLZB 2EVGA 4PP1C 1J5CA 1PEWA 2JCCB 2Z3FA 2Q76A 1U8QB 3DK0A 3RDTD 3VJ6A 2DQJH 1YEKL 4PJ7E 1OHQA 1MHHB 1EO7A 5J56B 3VW3H 3TOPA 2J57A 2NTFA 2X6VA 4KROC 2JQMA 4P46B 1H6TA 4TVUA 3EGDB 5C09D 1F4HA 2W9LA 5FWQA 1BZOA 2J12B 3QEQA 5IEHA 3WXVL 1BFOB 1DBBL 4YR6A 1RIVL 3RB5A 3UMTA 4A6YA 1A5FH 5GXBB 1MHCB 5DQJB 2ORBH 4H8UA 1YQVH 3PGFH 1L5GB 5GGSY 1TZIB 5T1KA 1J1PH 4ZOAA 5JYMA 2YGOA 3NIFE 1AI1L 2QQKH 3OG6B 5D6DC 1HI6A 3QJZA 3TIDB 1I8LC 3DV4A 4JDZB 4DEWA 4LO9A 4V2BA 1N7ML 5C0NC 3SDAA 3PXJA 5FB8A 4WHCA 3ARGC 3F2LA 3RGVB 4CADA 1QFOA 4FYQA 5L4IA 4E0RA 4JFEE 4LT7A 3X3FL 4XNZB 4ODWA 4ONFH 2GJJA 3VD7A 3QA3A 4BQ9A 1EQWA 1ZXQA 2A4CA 5C0EA 2ENPA 3AG2B 1NWOA 4N90D 4ANUA 1Y6KR 2VAJA 5JOEA 4S0SD 4JQVC 1PD0A 4UILL 1TUPA 2CU9A 3PDDA 5CSZA 3RWJA 2BK8A 2QADD 3FU3A 3PDOA 3QG6A 3MOAL 2DQFA 4ONGH 1SUJA 4PB0H 1ACCA 4WK2B 4WWKD 1U3HD 1MIML 1CXHA 3NIDE 3IGFA 2DWSA 5H8DA 3G6AA 2WQWA 1EXHA 3AXHA 2NY4B 1G6RA 2QGCA 4MB3A 4L3CB 4Y5XA 4H8WC 1R46A 1E9QB 3CXHK 4PJHE 4M6NL 5KW9L 4AUYA 4JVWA 5TH2A 4DPAX 3JTTB 3RVXC 4G5AA 4YC2B 1MJJA 5HDRA 3O2WL 1SDDB 1MCPH 2I25N 5JDSB 2EICA 4HWBH 3AQDA 3SE8L 3QFDA 1PFOA 3GK8L 4GLRH 1NOFA 5CR1A 3C6LD 2Y6SD 1HJCA 1CVSC 2DQGH 4H0IA 1MWAL 3BQVA 5GS1A 2J56A 3KLQA 2VABA 1UEYA 5CKGA 4QHKJ 1ZS8B 1NPNA 4BFIA 4N3UA 4XNXL 5JYLA 3K81A 3QZMA 1SHXA 3HS0C 3MO1B 5DFVD 4ZAKD 3ARVA 1KBBA 5IG7A 4AE0A 3M1BB 4DGVH 3E6FA 1X7QB 2PABA 4XVTH 8CGTA 2WUCH 3GMMB 4PRDB 2G5BA 1BSIA 4AZ8B 3HAEH 2Y25A 1XDTT 3I6SA 4NGHL 4F33A 1ND0B 2G3MA 2BSBA 1DQTA 3B3IA 3EYFA 5EZPA 3CHXA 4Z7QF 5TQ2H 5DUMH 3VXUD 2A4EA 4P48A 2WXRA 4JL2A 2EKSB 2Z91A 1CLCA 2NRDA 4JCWA 3QUYC 1TKWB 4N20A 3WKMH 4HBCL 2BDNH 1T03H 3VSUA 1HH6B 3EYSH 4AG4H 5E0FA 5EUOA 5EO9B 1YECH 1BQ5A 5ITBH 4DN4H 3L95A 1Q9WB 3QCTL 1MCWW 5FO8B 4LPCA 4O02B 1N3NB 4JR9L 2HVJB 2JQAA 3D7PA 3U1SL 4Q7DA 3WG7B 3O6FA 3TA3B 3G5ZA 1YEIL 1UZ8B 3NA9H 4HGKC 3VVWA 1G9MC 1PNDA 4F92B 3V7AG 5SWQA 5DS8A 3IU4L 5ISZA 2AK1H 4KHTH 5HJGA 3WGUB 1HKLL 2B2XL 3UPRB 4TTDD 5HYQB 2NYYC 3RNQB 4Y9BA 2PCXA 4TLKA 3C5SA 3KM2A 1FFNB 2HAZA 5C0BE 2CJUL 4RH4A 4B41A 4BV1A 5D1ZD 4DP6X 1UM4L 1WFJA 5IUCA 2EYSA 4OLYH 4X7TA 3V0IA 4ERSH 5DGQA 4BWWA 4CC0A 4PWKA 4JFUA 2C7UA 5DYOB 4LAQL 1BJ8A 4ICWA 3D39B 3SBPA 1WGOA 5CEZD 2J1XA 3TH4T 2FLMA 5GGTL 4MXWH 1UOLA 4JUTA 5LGJA 3QIUB 3G6DH 5KG9B 2RMNA 4Y2NA 2WUBH 5C0CB 5KVEE 5J6GA 3QJHB 2AV7B 4N2BA 4YGVB 3U0TA 3ZTNL 3QFJB 5EIIG 4ZFQA 5ID1B 4UQ2B 1JNJA 2XJLA 5HGGS 1HCVA 1OK0A 3NJLA 3F7KA 1NLDH 3QDGA 4LRNL 2VN3A 4JM2A 2CLVA 4RMSA 3O4LD 4PJAA 1GIGH 1MVFA 1EO8H 3HE6A 1UXMA 4RQQA 4PRHE 4WKXA 1T1ZB 1OHZA 3L3JB 3OTTA 1S78D 4QCIA 2ED9A 5IW1A 3WDJA 3IXTB 4NM8L 2FQDA 4B9IA 3VTMA 5EEVA 2W65B 1JF5A 4Y0GA 3TA4D 1G0XA 1YYML 4XVJH 3LRGA 4HULB 1PX4A 4RDQF 4W6WB 5DFWH 4F3FA 4OGAD 1QI4A 5E5MA 3VSVA 4ELKA 2XJKA 4KXZH 4HJJH 2GIYA 3LIZA 1JGLH 5T5NF 5JLZA 1QX1A 4BKLA 1HHJB 3F7VA 5B21A 1IX2A 4JG0L 4L9LA 3O0RH 3ZKSD 1OM3H 4MAYC 4TLUA 4N9GA 5HHME 4NQDD 2E7DA 1NC4B 3D0LB 5CEYB 3C87A 5MI0C 5IVXE 3IE4A 1T04A 1IFHH 4HK0A 3U6XS 3UTOA 3WMSA 1VADB 5DZNA 5JW4R 2WLIB 1RUMH 4QT5A 2IPUK 2R2CA 3GUTB 1IBFA 3DBXB 2UZPA 4HJGB 3CFKA 3EO0A 5GRUH 3SQOL 4PRIE 3KPRE 2X6BA 4OCRL 3FRPA 2C3VB 4U1JB 1GTFA 2DBJA 5DRXA 4YSUA 2PPCA 4IRJB 2WNWA 3CSTA 1FIGH 2VZUA 4B5ZA 3RAJL 3OKYA 1BBJB 1IGYB 3RZCA 1TZ8A 2JELH 5GGUB 2Q8AH 2M8XA 3VRLE 2F61A 2CHDA 1G9EA 1N4XH 2NUTB 3V0WH 3O3UN 3MLSL 2X4RB 4XNUL 5EEUA 2X6UA 2LU5A 3E3QE 3GJFA 3Q48A 3PAVA 1O6VA 3LMJH 4PJXE 1SBSL 4HCRH 1E6JL 2ED6A 4GMSL 1URIA 1LLAA 3AVEA 5KVDE 3DTUB 1EAJA 3V0JA 2I85A 3F8UB 4GUCA 1Q9KA 3RWIA 4GSRA 4MJHA 4NNPL 3EOBA 3TT1L 4URTB 1YEFL 4EJ1C 4MD0B 4YQXH 3CWGA 3FSVA 1B0RA 4OUOA 3ZRFC 2CBTA 3D4YA 5DJ2A 4PGBB 1JD7A 1KELL 3BKJL 2J7LA 4Q14A 4X8JB 4S2SB 3QULA 3O9WA 4NOBA 1SY6L 3HC2A 3QQ9C 4LHUD 1XXDC 3ZE0B 4EO5A 2WKGA 2Z35A 5D1QA 4LU5L 4U7KA 4M43H 1E4KA 3MJ7B 2Z31A 3ZE2F 3ZBMA 2EQDA 3H3KA 1HHIA 2OCFD 4ZS6C 3RWHB 3I3BA 2ZSWB 1VGKA 3CVHL 3E2HB 1E4WH 4HGWA 3IJ9A 4U6HA 2AQTA 2IAND 2OTPA 5L2JA 5AYUH 4P4KB 4GIPD 3CQPA 4KNQA 1QACA 3TS8A 4KH9A 4NZFA 3LH2H 2ZTBA 4FQXC 4W9KC 5C0AE 3DX8A 3ME0A 5JXEA 1ZV9A 1ZA3B 2CCWA 2K3HA 3HI6H 4WKZB 4MJ2A 5DMJB 4XP4L 5FCUH 1KT2A 3UOAB 4PAZA 4UWQB 1QKZL 4JFFB 5FWRA 3TO2B 4WHTA 3N1PC 4A7GA 1DHKA 4Y19D 5JR1H 3FQUB 3P02A 1UD8A 2XVKA 3GKZA 3DURA 4I0PA 1LD9B 4HWZA 2IWGA 2HFFA 3QXTA 3QWQB 5C0ND 3EO1B 1WGVA 1RP9A 3QH3B 3ARGD 3N1QC 1CD0A 3EH3B 5AW2B 3AS0A 2AJZB 4F2FA 4HD9A 5GGQL 4B0MM 4QYOB 2FYVA 2YRPA 1RZJC 3OF6A 1SEQH 1K8IB 3FFOA 1EANA 3CK0H 1UCTA 1RPKA 1C12A 2EIZB 1E4HA 3G5YB 3GKWH 4NXKA 4D2NA 1JCVA 1WEJL 2BSDA 1I85A 2VZ3A 1T1WB 1M05B 3HNVL 4JQIL 3VRJA 3DJZA 4AYMC 4XPGL 5EIQA 4HUKB 4NUPA 4ENZA 1GAFL 3O45B 4BFRA 1A7NL 2ALWA 3S6CA 43C9A 1DE4A 3VQ2C 3KLLA 4UNTA 4PJCE 4DO6A 4KHXL 2WP3O 4FXTA 2YPVA 5ICYA 1NEZA 1B2WH 4C56A 4E42B 4I77L 3DVNA 4G8FA 1OGAE 2H45A 1NIAA 4I5BB 4KXDA 1KTJA 1H8LA 4XB3A 4DO4A 2B39A 3DTXA 4IBLT 1JZDC 2ICWJ 1TEYA 1EAOA 3G6JB 4L4JA 5E9DD 2R2BB 4X6CE 1Q0YL 4QTHA 3P54A 3AGVA 3ES6A 1TZOA 1QATA 4NJ9H 1QSEE 5FAAA 1E9OA 3LZNA 1K2DA 2QSCH 5C0GA 4AT6B 1W0YT 2YMXL 1NANI 5IP4A 2WMPA 3F84A 5LAPA 5KSAB 1S7QA 3P3UA 1Z32X 5CMAA 2QMKA 3W37A 4G72B 1URZA 2FJSA 1JWUB 2AV1A 3W0WD 5IBLD 4Q6IB 1I31A 1FP5A 2VLKB 2YXFA 3H9SB 3MRJA 1NBVH 3UBXG 4FG2A 2OSLA 4JVUA 2E0PA 1EERB 2B3RA 5EN2B 3DRTB 1S7UA 5I1CL 2NZIA 1QLFB 4HHGA 4LSUH 4R4BB 1VKXA 3QNFA 1T7XA 4KO6A 4KVCL 1A6UL 2CKBL 4JN1L 3FONB 1BQKA 3Q2LA 4E9SA 4A04A 5DUJA 1ZWIA 4PJ7B 1TJIH 3N1MC 3TCXA 5LNGA 3GRBA 1CR9H 3H9ZA 4TXVB 1RUAH 1A4CA 2A74B 3QUYD 3H0TA 4NUGL 1SHSA 3KLAB 3AAZB 1INQA 4WI3A 3X11B 1FE8H 4P2AA 5ITFB 2LU3A 5T1LB 3C08H 5SWZB 4X8XA 2W91A 3BMVA 3V0DA 3MV9A 5EZOH 5ANME 1MEXH 1YPZB 2QGEA 4O9HH 3TBVB 1RUQL 5DHDA 4EI5C 3LHPH 5F7EL 4CSTA 4ISVA 3TVMC 4IKKA 2DLHA 2BZCA 4KQ4L 1MCJA 1F6AA 3HRZB 3A4AA 4OZHA 4IJTA 3VD3A 1KPRA 3U7YH 2NW3B 2XBTA 4M6MH 2E7BA 3RFRA 4JK0D 4CGUB 2YLKA 1AGEA 4DZ8B 2EDKA 2VDRB 3L3IA 5F9WB 4K3DH 5DJAA 2YAMA 2DYRB 2NYYD 1UWEH 1GSMA 4FA7B 1UM5L 2DQEL 1I75A 3DSNB 4JFEB 4MMXA 2DMGA 4PGZA 3WEAA 5CU5A 4YFEA 3I74A 2X1PA 4A68A 1IGCH 1IVTA 4PRNA 2PCFA 3MNVA 1A02N 2ITCB 2VE6A 3BWAB 1AZVA 4M7KH 4J8RB 2JWYA 4BZ2H 5DWUL 5CJOL 4M48L 5LCVL 4OAWB 3KYOA 3K0YA 4ESKA 4XBPB 2ARJA 3NIDB 5D2LE 3KNBA 4FZEH 1WT5A 5DUPL 4ZPVB 2EE0A 3RE0A 3BSZH 4KI5D 4UB0L 3IB4A 1S3KH 2APBA 3PY9A 3TH2T 2C4FT 5G5DB 2EDHA 4P2OB 2X6CA 3TYFB 3BXNA 5EF0A 4PJ5B 4CMMB 5FLVA 4PJHB 2WCGA 3WD5L 1HX0A 1R19A 3NH7L 2R9HC 3IFOB 5IROD 1PS3A 3FHAA 5KUMA 4TUKH 5FHBL 1GYVA 3MLXH 3QHFL 5L8JB 4P5TA 3J2PA 4PJIE 4JVPA 4TRPH 4HC1L 5C0RH 1U3YA 3BT0A 1YHPA 3NCYP 1CGWA 3QEQE 2FJUB 1FYTD 3SDCA 3SDXF 4A7UA 2OKMA 3N3EA 3NG5A 1LP9E 1R5WB 1LDPH 5KYYB 3FSOA 3AU1A 3QCVL 3KWWB 2N1TE 3GMRA 3QIBD 2J6EA 4KTGA 4ODXA 1G7PA 2NNCA 3QXDA 2KZBA 4L5FE 3KXFE 3R4DA 3UEZA 4GFTB 1MCBA 3WTWA 3VE0A 3G5XA 3QHZH 1E6OH 1WITA 1U2HA 3KEDA 4OM0H 5I0WA 4E41A 1V8HA 4M03A 3RX8A 1OVZA 3BGMA 1OK8A 3LRLA 3ZMEA 3BUQA 2QQLL 2VMJA 3WN5B 4NQCD 1BM7A 4BSWB 3MX0A 3QJSB 1ILUA 4RFEB 4Y8AA 5IVZB 2CKNA 3WNPA 3ABZA 2NXYD 2OXGB 3K3QA 1T66C 2V3FA 3B2UC 3BP7B 3L9YA 2VN6A 2ZCHL 2VXVL 2Z7UA 3CHQA 3K6DA 3SPJA 3OKNB 2LLGA 2Y1YA 5J8OA 3GHBL 1NBZA 2AQNA 4D0DA 1F4YH 2YA2A 3QK0A 3JWNG 5FYJD 2AXWA 4FTDA 2DQCH 5KZCB 5KYUA 2IWFA 3EJCA 2P43B 4QTIL 2E75C 5I8OL 3O3EA 4AL8C 1CGTA 1KPVB 3OGCA 5DLMH 1T22B 1CN4A 4OCMC 1RPQA 3STLB 1W6WA 1TQBB 4PP2B 1MNNA 1BX2B 3C5ZB 4WO4B 1L6PA 5T1DL 5I1HH 2IOOA 2ZICA 2KBGA 3QEGH 5FYJH 2YAPA 2ADGB 4KKAC 2Y1AA 2BSTB 2FB4H 2ZUXA 3MA9L 4JKWA 5M95B 2E27L 3HB3B 1KIRA 1IBGL 1UD4A 3CD4A 3L5HA 3GB7A 3RI5K 1RK1B 3VX0A 3LKRB 4O5LL 1DLHB 2GTWA 3I02A 1QO3B 4C4BA 4P57B 1I9RL 1H6FA 5C0BB 4H0HB 1X5MA 3UIYA 4L4TA 2D7QA 1VPOL 4LCWD 4U1GB 3FAXA 1FO0A 3CSYB 5M94B 4PR5B 3P4NB 4TSAL 5ENWA 5FO7B 1K4DA 1NBYA 4HKZB 5JOPE 3FT4A 3QQ9D 2WBWB 1ZLSL 3ZTCC 3WXVH 4B7LA 2WQVA 1DBBH 3PWLA 1RIVH 3FXIC 1FZOB 4GRLA 3QUZA 4K5MA 3MGTB 3ZKNC 4LLVB 2JKWA 3T0EB 2WWOA 3QG7L 1AI1H 4HSQA 3MBEB 4P04A 3II1A 2X1OA 1XB8A 4NLAA 1AD9A 4ZODA 1N7MH 4ICXA 3RA7L 2AJVL 3CFMA 3QORB 5GGRY 5E6UB 4LASL 2WVUA 2OBGA 3KR3L 2GK2A 5EUOE 1WD9A 1AHWB 3X3FH 2FJHB 2IBGA 1FORL 3PP4H 5DCCA 2JKNA 5K39B 3GHPA 5GZOD 4NO5B 4G1MA 5DQ9B 1AGBA 1T1YA 1TU2B 2NUPA 2PWFA 3PS6A 2X7LA 2WVTA 3IT8D 5GS2D 4UILH 4Z78A 3WKQA 1BZ7B 2W5PA 2X89A 3QXAA 9CGTA 3MOAH 2UZIL 5FIEA 1MIMH 1NDGA 3NUKA 5EU5A 5B1CA 1QUNA 3IGAB 4LHQB 5B3JF 3MROA 4R2GC 2EE6A 5E8PB 1TQWA 4BA0A 4OZFH 1MZYA 4EIUA 2VQTA 5AG9A 3VB9A 1DBMH 3EUUA 3FFCD 5ISZE 2VDOL 4HALA 4HKBB 3LS5H 3D4GA 4OFYA 4EZMA 4NKIH 1WAEA 1Q94B 2OL3L 4F9PA 4M6NH 5EIIA 4KX7A 3S3DB 1ZVSB 2OJEB 4MGXA 4FLRA 3NSJA 3ZMNA 1N5YL 3PPSA 4MJ5A 3VGHA 2D7MA 3CHPA 3H9YA 1WO2A 3O2WH 4XCNB 1T5WA 4F9LA 4BBWA 3SE8H 3QO0A 4PRIB 3GK8H 4HIJB 4RA3A 5HHOA 1P4LA 3GBNL 5IQ7L 5D96C 1SEBB 5FS5A 3FOLA 3MR9A 1HINL 1ZGLP 1TFPA 3H42H 5DZAA 2W07A 4M93B 5D5MB 2FHBA 1TXKA 1U93B 5ESVB 3S4SG 4P2QD 3MUGB 4PIBA 4XNXH 4HPHA 3I6LE 4DP4X 2VTFA 3ZDXB 4BFEA 3BIBX 2QTVA 4O2EB 1XSIA 3CC5A 3WLWD 2FBOJ 3VXMA 3CFCL 4PJAE 4IOSD 4XC3L 3ZTJG 3Q6GL 3KLHC 4FNUA 3VXSA 4NGHH 4X4KA 5F9JA 1BF5A 1F3DJ 4YK4B 3ML8A 4ONHB 1BCIA 5F89A 3K72B 2IGLA 2IPKA 3FNKA 4XXWC 3D12B 1UUNA 1UB5A 4HBCH 1OSYA 1JZGA 4WI4A 3K0WA 5GS3A 1TTCA 3V5DB 4MCNA 4UU9B 1XSJA 3BWSA 1S3RA 4KZDL 1RQ5A 3QCTH 1NPUA 4F7KA 4NSKA 1GOHA 3L5IA 4NNXB 3MRGA 2EIJB 4G59C 2I60L 1JK9B 3U1SH 3ZJAA 2O30A 5J1TC 1HOCB 1KIQB 3B43A 1YEIH 3SE6A 5L4MA 3REVB 4KXBA 4EVNA 4W9IC 3CFBB 1HEZA 4Q6YA 4DQOL 1BJ1J 1BVZA 3HW7A 3V6BR 3IU4H 4JG1L 3EG9B 4YHNA 5F7WC 2A6KB 5E00A 1HKLH 2JJSC 2VR4A 1OP5K 1SLUA 3V4VA 2D7OA 5FKPB 2AHIA 2VQUA 2N7SA 3DI2B 4XZ4A 3CZSA 5KVFE 4CRPA 4BFGA 5E2TL 1UM4H 1MDTA 3CFIC 5F1IB 3ILDA 3VXRD 3LN9A 4L48A 3LEYL 4XX1E 4JKKA 4HDIB 4LPTA 2XWZA 2VSKB 3O4OB 1AD0A 1T7ZA 1ZHLA 5GGTH 5T3XE 3HMXA 2JI2A 4POZC 3UC0L 4B50A 4TQ8A 2IDTA 4U1KB 1A7PL 1ZT7B 5EUKB 1HH9B 5IT2L 4P2RA 3ZTNH 3OMIB 5HHNB 2P24B 2V37A 1L7TL 1GPOL 3IWUA 1ZLUH 3CFJB 5EWIL 3SOBL 4LRNH 1A1OB 3QIWB 4K15A 1OW0A 4YSAA 3CX5J 3OGOE 4XMPL 4YNYA 5TQ0L 1RI8A 1ZEAH 3F01A 3NJFA 2V6HA 4QRFA 4BFFA 1AOZA 3PAUA 4NPKA 2A73B 2CH8A 4NM8H 5AUMA 5C0IA 1MIEL 2MQCA 3HLAB 4J3TA 4PJCB 1YYMH 2OCCB 1AZCA 2P5WB 3CXDL 4FNTA 1C08A 5EG6C 1NSNL 4OZIF 1BYOA 1MCDA 4QHKI 5HDWA 1OGAB 4N2OA 3U2SB 5LXGL 2JQZA 4LVHB 3ZK0A 4HG4J 1XZWA 3IGLA 3NPSB 3TWCL 5C9JA 3KPQA 4I0CC 3MAWA 4JG0H 3VGBA 1U8KA 5HDLA 1QFUL 5EU6D 3BDYH 4X6CB 3LZQA 4NX0A 5E6RB 1ED3A 5I2IB 1QSEB 5SWSB 2V5MA 2CE6A 4N8VA 3BJLA 5DFTA 1A7QL 2ZJSL 4GQ9L 1AQKL 2NX5E 3GTNA 2WOBA 1XF4B 2OV0A 2WIIA 3SQOH 2VM9A 3L3GB 1QPPA 1HSAB 4OCRH 1CICC 1AZZC 3P9LA 1IM9B 2IXQA 1ASOA 2VSCA 3RAJH 4Z76A 1MWOA 4PWFA 3OC5A 4QRBA 4WI6A 1JNNL 2EEFA 1OAZL 3V52L 3VWKB 4X50A 3H54A 2W0FA 4QRSB 3ROOA 1D5RA 3MLSH 2JCWA 1VF5C 1VFAB 3AMKA 3B2UD 4YHYC 4HPYL 1I1YB 4V1DD 5AVVB 3HZVA 3JV6A 3ZDYF 5L88L 1BOGA 1L9TA 1SBSH 3VMNA 1E6JH 2XWJA 4KVNL 4GMSH 3JSSA 3VFVB 4DP5X 1QA9B 4RDQG 4K8RC 1FRGL 1I7RA 2DJMA 1FZJA 4HMDA 1TEFA 4XNQA 2IDFA 4NNPH 3TT1H 3VVVA 4Y7OC 5T5NG 1JZ8A 1KIUB 1MNUH 1S7SA 5ICZA 3C2SA 4QR7A 1DQLH 2OR9L 4YLQT 4XOEA 1BP3B 4PJDA 3QDHA 2MPVA 5FOBB 2MNWA 4MJJA 1KELH 3BKJH 2Y7LA 4N3TA 1KOAA 1RP8A 4KDTC 2FBRA 3L4TA 1J5DA 1JK8B 1SY6H 2VZVA 3QPQC 3W39A 4TVSa 5BOZG 2WTRB 4LU5H 3FUHA 3B2MA 1EUTA 2PXYB 1LNUA 1U8LA 3LKNB 1UKSA 3JWOL 3L1FA 1E3ZA 1B0GB 3PGDB 4Y4KC 4MCMA 4YPGA 3CVHH 3TZVA 4J5VA 5EC1A 1U8MA 1WVZA 1IE5A 2XWBB 2ZOWA 1CXEA 3B9AA 2VQ4A 3LH8A 4R8WL 1DQMH 3EBHA 4AYFA 4PS7A 1BAFL 4G43A 2HVKA 2OMTA 3H2QA 3IJHA 3MGOA 3UP6A 4KAQL 5B8CB 4EZJA 2PW2B 2D7TL 2Y4SA 4XP4H 4OIIL 1UOWA 3MFFA 5D2LB 5BOJA 4K5NA 1W72B 1J8HB 1QKZH 4BDVA 2FWUA 1H3GA 5HVWA 5B1JA 3ZKND 1ITCA 5C3IA 3VJ6B 3WNOA 2O72A 3ARFA 1QWNA 1VACA 4YE4L 3QDMD 1H3PL 1ONQB 4UOZA 1MW1A 3FW6A 3PWPE 4JRYB 1DQDL 3GSRA 1MJ8L 4LFHG 2G9KA 1TETL 3BOVA 2XG4B 1M2OA 3LZRA 4LRIA 2CDFB 5CNHA 3U1PA 4A2LA 2ETWA 2IFGA 5I5JA 2P28B 2HCZX 3GRWA 4OLWL 2NPLX 3QEQB 4K5PA 5IEHB 1JN6A 3MV9E 4KI5F 1CFBA 4XP9H 1BXUA 1S9WB 2B1AL 2CHXA 3FTGA 5DXWA 1EMTL 4HV8A 2DWEA 3U30B 4A6YB 1QFWI 3KLKA 1U8OA 3T6ZA 4IRZA 3VG9C 3IMSA 4TSBL 3A67H 1U8HB 1WEJH 3HNVH 4JQIH 6PCYA 1SVBA 4XPGH 4ZUWA 3HNTL 4OD1L 1Z9PA 5AAPA 5E6IC 1KZYA 3DV4B 1GAFH 3BPOB 2F54D 1NM9A 5L7XH 2O6EA 1A7NH 1W16A 2EKJA 3SDAB 4XXCA 5FB8B 1I8UA 5F7YC 4U1SA 3BRGC 4KHXH 5GGVY 2VMFA 5DJ8A 4CADB 1U8IA 4FDWA 4I77H 3E1F1 5C1MB 4ODWB 2PP7A 5D7SL 2DWTA 5C0EB 2CXGA 4JFPA 5L0QB 3THML 4XRCA 4UOJA 7PAZA 1OAQL 1DJSA 1JZHA 3RWJB 3CU1A 5CSZB 4ALAC 1EAPA 3D2UD 4EN3A 2DQFB 4BK5A 5IFHL 4JRXA 3OL2A 3BIAX 3Q1SL 3EJPA 4P5MB 5DGRA 3MBWA 1MAKA 3G6AB 2YMXH 3EGSB 5E5LA 3RZWA 4DOHE 1HE7A 3GMLA 3MJ6A 1F18A 1X5GA 4Z0XA 4TV3A 3T0AA 1EZLA 2G9HA 2F5BL 5G2NA 5IFJA 5GRYA 1E40A 3OB0H 1GC1C 3F00A 3FF7A 4AJVA 2K4WA 1MJJB 3OX8A 3OKDB 5KAQF 3KLHD 5I1CH 1MY5A 5C97A 5FV1L 4RAUB 1CZ8L 3L3OA 4KVCH 5DO2C 1A6UH 2CKBH 4JN1H 3T0XA 4ZMZA 4ABVA 2B9AA 4WW2F 1J1OL 3BIKA 2A6DA 4UM9A 2GEEA 4AKOA 1UWGH 5GS1B 3A6BL 3V5KA 2FK9A 3UJTL 3HBZA 5GGVL 1LWHA 4NUGH 3T2NL 4FHJA 4H26B 4XVUC 3C12A 5FXCH 1RPUA 3SE4A 4NM4L 5C08A 1HSBA 1BG9A 3T4AB 5IG7B 1CXLA 2PO6A 2OI9C 3E6FB 4E41E 3QJFA 3B2PA 1O5PA 1RUQH 3LCYA 4I9WE 3B5TA 2ESVD 5F7EH 2TSBA 1XF3A 1SUHA 4EN2A 3WKPA 4KQ4H 2CA4A 3UPCA 3MVSA 1IGML 4HKJA 1YUHA 4UQEA 3ARBA 3B3IB 3EYFB 4X83A 3MKGA 5IHUL 2Z91B 3DXAA 3DROA 3IMTA 3W5NA 1Z9NA 2VN4A 4UIMB 3ZT5A 1JV2A 1NCCL 1HTYA 1UM5H 2DQEH 2IG2L 5EUOB 1WK0A 1A4BA 3PLYA 3L95B 3SIKA 3FCBA 2D0GA 3MDJA 5DDHB 1NMCC 4HLJA 3F12A 3FU9A 1R3LA 1PYWB 2F9BT 1EVUA 3LQZA 3O6LL 1WRFA 3QT2A 1YNTF 4IJ3C 5DRWA 2O26U 3O6FB 5CJOH 4M48H 5DWUH 4ZSOB 3DHPA 5LCVH 1E5UI 4AEFA 2P8LA 2EZ0C 3IKKA 5DUPH 2VZSA 1DBJH 3VFOA 5DS8B 3NYKA 2VDPL 1UG9A 1AY1L 3EZJB 2XUWA 3KH4A 1EPFA 2X53A 4MA3A 2BERA 4H1LG 1HXMA 4Y2DD 1MWAA 5TF0A 3C5SB 4X5QA 3WD5H 2WOYA 1MJUL 3DUUA 3EYQC 3NH7H 2YZ1A 4JGNA 4KWUA 4JBSA 4L4TE 3ZSSA 3ECVA 4X42A 3VO0A 1LYQA 3QHFH 4QY8A 4HC1H 2C7UB 3V6FA 4B9ZA 5FYKE 1RZ7L 1GYWA 2ICWI 3MLVL 1KGWA 2XZAH 1BQUA 1VEOA 4JN2A 4XZUA 2P8MA 5LGJB 4YSDA 4G6JH 2BFGA 2ZG2A 3QCVH 1LMKA 3ZTEA 5J6GB 4IBTA 4PTUA 4W4OC 1F1DA 3U0TB 3BAXA 3HFML 4BXSV 3GEWB 2VRQA 3ZU8A 2M83A 1Y07A 3QDGB 2X6AA 4UQ3A 3U4KA 4JM2B 2CLVB 1O7SA 4QRPA 4ZOCA 3ROLB 3BPNC 2X12A 5MEOA 5F9OL 1OCWL 1BV8A 4MLSA 4RQQB 3BVUA 3T77A 1S9VA 2VO8A 3DETC 3V7AE 2QQLH 2IH8A 1T0NA 1AO7A 2I7SA 3IJSB 1KIPB 4QCIB 4W9HC 1LXMA 5E8EA 4CVXA 2E9IA 4GKSB 1RHHA 3WNIA 4MCYB 1OTUC 3ORJA 4K71C 4JPIA 2JF1A 3LJ3A 4BWTA 1EK3A 1MCCA 4R3SA 3ZO9A 3BP6A 4JZJA 1ZKAA 2OZ4L 1FJ1A 4I3SL 4F3FB 4F7MA 2VXVH 2LT9A 5FFGA 2GJPA 4XE0A 5E5MB 4O02L 4ELKB 1CICD 3MV11 4NDMA 4YDJA 1SM3L 3GBML 1MXDA 3ARDD 3KJ6L 5JLZB 4QTIH 1VHPA 4BKLB 3F7VB 3LNDA 4L9LB 4RGNE 5I8OH 4BQ6A 2D7PA 3BH8A 3K7UA 5DYFA 2IAMA 2XTLA 1KYAA 3V6OE 1AKPA 1KENL 4IIQC 3W3BA 5MEND 1WCBA 4XCEA 5FX3A 3NJJA 4JM0A 5T1DH 1S2EA 2Y0SA 1JGEA 2CHNA 4HK0B 4CNIB 4MJ6A 4BE5A 1HESA 4DKDC 5I5MA 2J8OA 4Y5VB 4QT5B 3ECQA 3F7YA 3MA9H 1WAAE 2WLLB 1MAML 3BYTA 2E27H 5A2LH 3NZUA 3GTTA 4XVOA 3QWRD 2ATAA 1IBGH 5HHOE 2XXCB 3FRPB 3KGSA 2IV9A 3IDMA 5HY9A 4NAJA 4O5LH 4F37F 3TN0A 5T3ZD 3L3HA 4MFHA 3US9A 1VPOH 3CZLA 3VD9A 3ULUC 5GHWH 4TSAH 4OT1L 1GGYA 1DJIA 5LVEA 3UTSB 1PKOA 1KB3A 3CHRA 3D30A 4JFXA 3HAEG 4CA4A 3SBWC 4AGNA 3O8XB 1E4JA 3SPGA 1JGVH 5CZXC 4JGJA 2YGPA 2FECL 3FU0A 4KK9C 5M7QA 4XMLL 2CMRL 2HLEB 1Q1JL 1YN7A 3RWIB 3SY6A 5T5FA 3QG7H 4GUOA 3EOBB 4LBEA 4WDIA 3MUJA 2ZUUA 4PWJA 3SJVD 5HPMB 1LO0L 4DEPC 1X5YA 1CFQB 2XHNA 3QDJA 5DJ2B 5H35B 3RA7H 2AJVH 1JERA 4LASH 5ADPL 1CQYA 3KR3H 3TBWA 3QULB 3O9WB 4ZX4A 3ZUCA 4IBSA 4KRLB 4XPFL 5I6XB 2EDXA 3EJZD 1FORH 5D1QB 4G5ZH 5LBGA 4UT7H 4C55A 2Z31B 2ZUSA 1L9QA 1HHIB 1NMBL 1OSZA 2PYEB 1VGKB 3PL6C 4K73A 4HGWB 2H32A 4U6HB 5CLWA 3D9AL 1F97A 4CILA 1RZJL 3OJVC 5L2JB 4GP8B 4LDEB 2EINB 1W8NA 1WZKA 4Y2OA 3RWEB 4NRYB 3SKUD 1MLBA 4QOKE 1V54B 3ME0B 4IGBA 4J39A 4KRMB 4PSRA 2VDOH 1FYHB 3ZE1F 1TDQA 3D69B 4Q6KA 2MEJB 1KT2B 4GP5B 2J6WA 2OL3H 1KN2L 2CBOA 3EDEA 3EH2A 2MRYA 2X28A 4WHTB 3UYRL 3NZ8A 4TVPD 2XPYA 4JGMA 4HEMA 2F8OA 2I69A 3ULVC 1JYVA 5H37G 1N5YH 3DURB 3WIFA 4Z7WF 4I0PB 3FBQA 1ZLDA 4HWZB 1P84J 2A5UA 2HFFB 4RZKA 5E6ID 3DUHA 4NNYA 5IQ7H 1SMAA 3GBNH 3KPPA 2XKNB 1HINH 2Q3ZA 4XMXA 4AJ0A 4TVPH 4P2RE 1TTFA 1P69B 3ATDA 4N68A 1C12B 3FB7A 2EO7A 1YEDB 2XI9A 3CFCH 4XP1L 5I74C 2BP8A 3P4OA 3VRJB 1WZ1L 4JQXC 4XC3H 3HE7A 3Q6GH 5HHPA 1AJ7H 2R8SL 1T6VN 3EOYG 4M5ZL 3PYCA 4FP8L 5I28A 3P3TA 5J1AB 3UDWA 4FLSA 4Y89A 3RZCC 4M4RA 1QMUA 2GT9A 1AKJA 1SJEA 2IH9A 1NEZB 5IMMB 2AFNA 2GAZA 4C56B 2NZ9C 4HT1L 4N1CA 4OLUL 2K78A 1FC2D 1S4IA 3NFPA 3VFRA 4PLJC 1F3DH 4KKNA 3MOQA 3DTXB 3DHMA 4WLCA 5DO2D 3ZHKA 5F1KC 3NJKA 3MA7B 4QRRD 2MH4A 4OFDA 3G7TA 4GS7C 3Q06A 3HG0A 1KCRL 2I60H 3GMNB 3F7QA 1E9OB 1K2DB 4UMGA 3V0AC 2R56L 2I9TB 2WMPB 1QLEL 1S7QB 4XVUD 1XIWD 2EUVA 1HYSD 5IJKC 4DQOH 4NQEA 2AV1B 4JG1H 3WHXB 4MDJA 1RHFA 2ZKMX 1LM8V 3MRJB 2OSLB 5K9KB 5E9AA 4FKHA 3QYMA 1WIOA 3VFGL 2A6IA 1N6QL 1S7UB 4IBUA 1VKXB 2XN1A 2CJ3A 3MYJA 4YC2C 1G7IA 2OX5A 4HFUL 5E2TH 2HJKB 3WUWG 1IJ9A 3FUKA 1ZWIB 4WU7A 4BELD 3LEYH 1TJXA 4P06A 1ML0A 1NDMA 1AS7A 2CHZA 1KYFA 3BC9A 4GRMB 3H0TB 2XVBA 4LSTL 2XTJD 4XPTH 1YCSA 3UC0H 3JZ7A 1INQB 3MACL 1A7PH 1UASA 1JWMA 1SGKA 1XTMA 2JJWA 4XOCA 3RTQB 5FR3A 1X5FA 4IYKA 4M5YL 3MV9B 1L7TH 1GPOH 2WYTA 4O51B 5EWIH 3ISRA 3SOBH 2C9SA 3MZTA 5IGXL 4XGZB 1BGXH 2ATKB 2FQFA 5T33H 3WFZA 4QRTA 3ZKXC 1IZJA 3NRPA 4ISVB 4PJDE 4TQIA 4GO8A 5CIPH 2ZP0T 4XMPH 5TQ0H 1F6AB 3VGAC 5I5RA 2EZ0D 2DJUA 4OZHB 3OMNB 1KPRB 4M61A 3K5RA 4H13C 1NTDA 3V6ZA 1AGEB 1IC7L 1U8CB 3ZDZE 1J5OL 1T7VA 3L3IB 1MIEH 2GBTA 1HQRA 2HTLD 2IIJA 2CJTA 5DJAB 1TLKA 3CXDH 3NCWA 3L3DA 4QXTA 4FFWC 1PZ2A 1NSNH 3K2MC 4APQC 2PLTA 4PJEF 4MMXB 4LHUG 5JORA 1B3IA 5LXGH 3A4FA 4RWHA 2NQ3A 4B9GA 3TWCH 2XV3A 3X12A 4F93B 5A2CA 3ETBF 3EH5B 1QFUH 2VE6B 1I85C 1LEKB 3L9RA 2L7EA 3Q0HA 3V4PB 2HX7A 2Y36L 3KYOB 5BJTA 1JWSA 3IETA 2ARJB 3QQ4A 4HZLB 3KNBB 4HUMB 3AW5A 4LEOA 1RZ8A 3K8KA 1N0LA 2XX0A 4UT9L 3LZFL 1XZ0A 2OMNA 3TA3C 3BEVA 4DOHB 2BOLA 2R0WH 1A7QH 2ZJSH 3PREA 1JMZA 1AQKH 1Q9LB 3BXNB 5E8NA 5EPMA 3QZWB 1CXKA 3DJTA 3ETTA 2X09A 3QR2A 1EDHA 2FX7L 4QJ5B 2B5IB 3LXUX 2VLJD 3JV0A 3U46A 4CUCA 1NFDA 4P5TB 5EU3B 5LG1A 1KGCD 1T2XA 1RLWA 5J57B 5IHWA 1A21A 1JNNH 1OAZH 1OTUD 2FL5B 3V52H 3SDCB 1WLHA 4HUVA 4PSPA 3HIZA 1RVFH 3MCLL 1OP3H 4HPYH 1UWXH 2XYBA 2IWEA 1EV2E 3ZKQD 3QXDB 5L88H 1X9LA 4P9HL 2F53A 3QIUC 3D1MC 2IALA 4KVNH 3VE0B 5DT1H 1QOKA 4XN2A 1MLCA 5AG8A 2BXYA 1ECZA 1FRGH 3VFMB 3KEHA 4JAMB 3ZO0A 1TVBA 3SPIA 4JFDA 3CSFA 4TLTA 3UAJA 3HLKA 2CCVA 2X87A 5AZ2L 2VO5A 4WUUA 2GJRA 1IGJA 1EEUA 2VDRL 1MVYA 3MX0B 2NZ1A 4H40A 3LV3A 3X1GA 4AMWA 2CXKA 4XR8C 3QNXA 2R59A 3NGBC 1NAKL 2EE2A 4WIQA 2EYRA 1S9XB 4XOBA 3GSVB 4AM0B 2XQ0A 1NBZB 4D0DB 3H6AA 2Q2EB 3JWOH 3QUXD 3C8DA 4JRXE 5IJVA 1KY6A 3L1OH 4IMLA 4PJ8C 4QD2E 5E5UB 3PCYA 2VN5A 1HHKA 4R8WH 2WVSA 3IGKA 1BAFH 1M71B 3FK3A 3Q1EA 3AU0A 3C5JA 3CXFA 5DHVH 3E38A 4E9VA 1QFPA 4KAQH 1BXXA 1FZMB 2QDWA 4WWID 4OIIH 4U3CA 2VSDA 5I9QC 4D9QD 4KDVA 5CZXD 4MJIA 1KIRB 4LF3A 4GT0A 4PHZA 3BSHA 1JP5A 3GB7B 3KHQA 2XN9D 1XGRB 1O7VA 2GTWB 2NSQA 3I02B 1H3PH 4IEFB 4JPVH 4YE4H 5DA4A 5EFIA 4DUVA 4NHUA 4OZGA 1DQDH 3LRSB 1KEGL 1MJ8H 1FO0B 5KBKA 4L4VA 5CN3A 1BPLB 1TETH 5ENWB 1NBYB 4YDLB 2ZPKL 5C08E 2NXZB 4DPBX 1LK3L 4OLWH 4F7TA 1XR8A 15C8L 3JWNE 2B1AH 3HVDA 4MHHG 1EMTH 1O9VA 1XAUA 2NY2C 1D7BA 4ODUA 1MI5D 3C6EA 3OKEA 4G3YL 1CDHA 1YJDL 2VXUL 3PL6D 1WA1X 2YXMA 3BGFB 4G80A 3S35X 3RL2A 5IWLA 3SZKC 4OF5A 4R4ND 4CU7A 3Q8AA 1P7QB 1E50A 4P8QA 5KOMC 1DQQA 4QXVA 2VQ1B 3HNTH 4OD1H 3IMVA 2EJ1A 3KYMA 3CFUA 2CBPA 5LN4A 3FHEA 4IBWA 3DXAE 4UV4L 3ESNA 2K6WA 1EFXD 4MA8H 5EDXA 3QQNA 2DY2A 4L0YA 2AW2A 3EGXA 1VB9A 4RCAA 2ICCA 4MVBC 5F8QC 4M8VA 3RIAK 5D7SH 4H1LA 1I8MA 4QGTA 4PW9A 3ULVD 3THMH 3LKPA 4X7EC 1AGBB 1OAQH 3M17A 2NUPB 1AMXA 2X7LB 4HKXA 4Z78B 1B4TA 2VDLB 3QXAB 3LB6C 4KKZA 5IFHH 3RDTA 5SV3A 1L9NA 3GZPA 4TF4A 1NDGB 3IM1A 4KPHL 3Q1SH 1QUNB 3MROB 4RGNB 4Y16C 4JCLA 4ANKA 1UD3A 5D71L 1R3JB 3Q9PA 4R7VA 3QJQB 1MCOL 4GUPA 5KBNC 4P46D 5HGHA 4TM9A 1WWBX 4I0KA 5LAXA 1A6WL 2F5BH 2MTPA 4GG6B 5C09A 1CLZL 5EIIB 1F4XL 2VCOA 1XGQA 4DVBA 5BO1H 5CJXA 5HVHC 2Y07H 4U1IA 1JV5B 5ECGA 3UTQA 1QD0A 4L3AA 3OC8A 3U6RA 5LHDA 4HP5A 5CJ8A 4ZRGA 3GIVB 3D85B 5L4FA 1IE4A 2E8YA 1CZ8H 1Z9LA 4K5LA 5HHOB 1P4LB 3GS0A 4ZUUA 3CPLA 2FHFA 3N44F 3ZX1A 2R69A 3MR9B 4FXKA 2ENJA 3ABMB 4PWEA 1A6ZA 5DEGB 4NZTL 5GGVH 4RFNB 5A43C 4Y4FC 1OCOB 1BAWA 2BMKB 5JIDA 1A25A 4NM4H 4PLJD 2J1YA 5EC2A 2UZXA 1P4UA 2YA1A 4QGYA 1U3ZA 3V8CA 1NAMA 3CC5B 1I9JH 4TSCL 3VXMB 2AEOA 1OOWA 2J2ZB 4NZUH 1AO7E 2YO3A 4JRFA 2QEJA 4RIRA 5AW3B 4ETYA 3NCJL 1PY9A 2A9DA 3O2DL 2JJUA 3VXSB 1IFGA 5F9JB 1IGMH 2ZKYA 1PLBA 4KK8D 4RSVA 4QIRA 4WWKA 1UFGA 1U3HA 3IDGA 4I1PA 2ZG3A 1YMHA 4N2IA 5F89B 3UMNA 4L2LA 4HAFA 5IHUH 1GGUA 2IPKB 1CDBA 4YHOL 1KTKE 1IILE 3I6GA 2RTTA 4H0LC 1NCCH 1RULL 1YG9A 2GY5A 1WFOA 5K33A 2CGZA 4Z5RB 2DICA 1XSOA 2MCPL 2G0KA 4MA7L 4GRLC 3QUZC 5GS0L 2OCJA 1EBPA 1UH3A 5ICUA 3MRGB 4WFGE 5HYIA 2RA1A 4D0CA 3O6LH 2O4EA 1ZA6B 3MYZA 5EO1A 3RIFK 3VFPA 5G55A 1P2CA 2F18A 1ZTXE 4EVNB 1D3CA 3T8MA 1HEZB 1NCDL 4MDRA 4UTBA 4LP4A 4HQQH 4Q9RL 3R1GL 2VDPH 3HAEA 3ZDWA 2DWDA 5FDYA 4EE2A 1B3JA 5DR5L 4YHNB 1OLLA 3V4VB 1G84A 3NSDA 4ZAKA 3Q8FA 1BIIA 5GGRA 3TJPA 2VDMB 4NBZB 1MJUH 1M7UA 3EDDA 2WQRA 5DD1H 4PG2C 2VMCA 2AJYL 4MX7B 3LKQB 4ZBJA 1PX8A 3HJEA 4FEMA 1N70A 1ZSDB 5FK9A 4AYID 3QARA 3VQLA 1RZ7H 1J0ZA 1AD0B 1ZHLB 3MLVH 3ZYZA 1IBDA 4CJ0A 3GSUA 1E30A 1NIEA 2VXQH 2UY6A 4FFWD 3MJWA 2AK4A 2K9FB 3V6OC 1CXFA 4APQD 4P2RB 2A74C 3VRIB 3SPHA 1DJWA 5KVGE 4Y5YA 4Y8DC 3BPLC 5KVDL 4AGQA 2W80C 1PKQA 5E1QA 2G3ZA 4KGJA 1DBKL 2XG5A 5F9OH 2YPLE 1OCWH 5C92A 2WVVA 4F9LC 4RESB 3ZZQA 3WE1A 2WQAA 1OV8A 5C0IB 3TA3D 3X14A 2CM6A 1TTAA 4F20A 3U7AA 4E9RA 3EF4A 3N06B 2OMZA 2OZ4H 1HHHB 1MVUA 1FA4A 2R1YA 4I3SH 1C08B 8FABA 3LPPA 4IKNA 5HGDA 3DLQR 4CU8A 4O02H 3OAUL 5H37A 5TJWK 2A6JA 4DGYL 3W38A 1SM3H 4AI7A 3GBMH 2DQTL 5DC4B 3P2BA 2EDRA 1S9YB 2PF6A 2VIRA 3KPQB 2YD5A 3MREA 2DBLL 1U8KB 4FA8A 3KPNA 4LSVL 3OD3A 3BAIA 1JDCA 1I82A 4MBOA 5E03A 4Z7QE 7PCYA 4HS8L 1ED3B 3KCWA 4QRAA 2XWCA 3DIVA 2FEDD 1BDYA 1T0MA 3OVUB 5FHAL 4U7MA 1V3KA 3IWVA 3QIUD 4N8VB 3V9EA 4BE6A 3D51A 4HEME 3H9HA 2V7NB 1MAMH 5GRWA 2XIBA 5JHAA 1UURA 2WIIB 3QFJD 4KKCC 3WTSA 2XFGB 1UUSA 3EYVA 4JFTA 3TEUA 3P9LB 4M7LL 4PVNA 2IXQB 4F7CB 2DLFL 2HUEA 1P7KA 4OJCA 4Z76B 1QSZA 3O4LA 1XQ4A 3RILA 3F5WB 1F3JA 4GH7B 2W0FB 3Q5OA 3AM8A 3F83A 4JJ5A 4LPXA 3US0A 2PR4L 1YAZA 4OT1H 2DYPD 3RWGA 1PZ5A 1YNKL 1R47A 5F6IB 4I9XA 12E8L 3HZVB 3JV6B 1XD0A 1XTLA 5EBLA 3VWJB 3MRQA 4U1NA 3GMQA 3PJLA 1IC5L 5G4MA 4HMCA 3K46A 1Y1DA 2PKDA 1F11A 3S36L 2Z34A 3SCMB 4YVNA 2VZ1A 3OAZH 3LDBC 1I7RB 1PFCA 4PJ8D 1IL1A 1FZJB 2D3LA 3V10A 5JA8B 1R5VA 2CMRH 1N2RA 4XMLH 4XNQB 1Q1JH 4NCC2 3T0WA 4U1MA 3O41A 1EZVX 3JVGC 2APXA 1S7SB 1T6WA 5ICZB 3OPUA 5HI4C 3G08A 3FUJA 1YAIA 4EMZA 4PJDB 4WGVB 1QP1A 3I85A 1NC4D 4NQDA 2CK0H 4GO6B 4NP4H 5ADPH 1AQ8A 1T4KA 4H20L 1ZRUA 3UBFA 1G1YA 4OFKA 4F2MB 4X98A 3MU3A 3BVVA 5DZLA 3SGDH 3W39B 5CILL 1KLGA 2H3NB 3ZDZB 1UWYA 4OBSA 1ZGLM 1D5IL 1LNUB 1REIA 1U8LB 3HMWL 1NMBH 2WC7A 2XPZA 3PWVA 3ZN6A 3QEUA 4ADIA 3KCPA 3U9UB 5I0VA 3WUWA 3D9AH 3D09A 3IK2A 1RZJH 4HOXA 3VI4F 4KX9A 2MQ0A 2YQ2A 3QJTB 4IRJD 4NHCL 4AYFB 2D31B 1TJHL 4G43B 2HVKB 2OMTB 4L8SB 4PS3A 2F1EA 5BV7C 4NQEE 5D93C 3KZ8A 3IJHB 4WV1A 3GD1C 3MGOB 4TNVF 1PF3A 1AR1B 1OM9A 5I0ZA 3BYYA 2NY2D 3EHBB 4X6DA 2VXSL 1E3FA 4B95C 3PV6A 4M5SA 1KJ2L 4BDVB 3UYRH 1E5BA 1CL7H 3FL7A 3LKOA 5E7BA 4XMVA 1OALA 4U1HA 3WGVB 2WNXA 4R6UA 2N7AA 3WKYA 4JKLA 4BXVA 3ARFB 1QVOB 1XMEB 3KS0J 3BUYA 3M45A 4QHMB 1BYPA 1XEDA 2W0PA 3CZJA 3RUGA 1AG6A 3K1KC 5JQIB 2X2JA 2I9LA 3PNWB 4LSQL 1GGTA 1KSRA 4B96A 3T8VA 1JDAA 3PAYA 3ABGA 4ALAL 3V6FB 2AVGA 2A83A 3FTGB 4HV8B 2DWEB 3TX4A 1MN4A 1XAKA 4K9JA 5CJBA 3FQYA 5DD6B 3ZIMA 1BECA 1U8OB 4LHUA 2EVJA 4XP1H 1ZS2A 2X2HA 4AITA 4A39A 1XVSA 3FT1A 3INUL 1WZ1H 1CBJA 3LB6D 4AMKL 4ZUWB 3LPFA 2R8SH 1IZKA 1PPIA 2HT3C 2TAAA 4M5ZH 4PI0A 4PVMA 3FQ2A 3W81A 4FP8H 1GC1L 4MNQD 2XXFA 4FFYL 4MNHA 4JO2L 3E6HA 1QBAA 2H0EA 1GGCL 1LK2B 3KE0A 1OCZB 4U1SB 1YMME 2KYIA 5DJ8B 1DQJB 1A4JB 3PABA 3ZPDA 3NK3A 2C4FU 1EAQA 1UFUA 4GQZA 3N85H 4K7FA 4HT1H 1LVEA 4OLUH 1G7QA 1PCXA 3UL4A 4F2EA 4JFPB 3WHE0 4LLDA 4EZKA 4XRCB 1F86A 3RHWK 1KYOJ 2NY1B 1EGJA 5LBSL 4Y19A 2AZUA 3ZOAA 5DMYA 1EAPB 3GNML 4N0RA 4P5SA 3ZYJA 4CBPA 1S7TA 5I1LA 3IFLL 5D6DA 5KS9A 1KCRH 1JZ6A 1CF1A 5JHDE 1M7DB 1KBWA 5EOQL 5CS7A 3MBWB 2BVQB 5AVZB 3D52A 3KWXA 1GJUA 2R56H 1OGPA 3UROR 3T65B 1W0WA 2V2TA 4Y4FD 1W72L 1QLEH 2WXMA 3SGDI 3ARGA 4LDLB 1UC6A 3U36B 3BZ4A 3BZFA 3TM6A 2O5XL 4NRZA 2X05A 1XH3A 1TQUA 3ZE2E 5IJBC 2HFEA 4LPYA 4N6RA 5LGHH 1NFDE 3OX8B 1RV6X 2Y7QB 2Y7SA 3VFGH 1N6QH 4OZIA 4PWIA 4YOKA 4N28A 4H7VA 3R18A 4JQVA 3L3OB 1RJYA 2HT4C 2HWZL 4HFUH 4RGMC 4GQQA 3TZVC 2CO7A 2A6DB 4OCWL 4FYSA 4XNBA 4UM9B 5J11B 4OLZL 5JOFB 3IF1A 4A6YL 2G2PA 2MTAA 4J3OH 2F53E 4LSTH 3VYPA 2CD0A 3DVIA 3MACH 4OCXL 4PD4K 2WLYA 5C08B 4PJBF 4UUJA 4L5FL 5KSUA 2PO6B 4FHKA 4M5YH 2KHAA 3DBSA 4K7PX 1GVIA 3QJFB 2FGZA 2FGWL 4FXGC 4OCYL 4P23C 2H2SD 4JFDE 2NY5L 3DPBA 1BZ8A 5BPPA 5CXPA 2QBWA 5ESQA 4NC1E 5CU9A 5IGXH 3EDJA 4WUUE 1XF3B 4UQBA 3K91A 3FCGA 1T0PB 5E9DA 3WE6B 2R23B 1OAKL 1OL0A 2EIMB 3JV4A 1Y0LA 1U3JA 3T3MF 4HKJB 1YUHB 5L6YL 3ARBB 2HB0A 2P8PB 1J88A 4OD3L 5DQDH 2XOTA 4J3SA 5JO5B 4AUUA 4LMQE 4BHUA 2I07B 4JMXA 4KXAA 5EOCJ 4L0PB 2Q87A 1IC7H 1KEML 3F65A 1J5OH 3DROB 4LRIC 1O7DE 3HS0A 4M4PA 5K9JH 4CC1A 3HG2A 3M7OA 2EO9A 3ML9A 4QHNA 1U95B 2VLKD 3FUDA 2J8UF 3BPCB 3EFOA 4OVUA 4G42A 4OZFB 4ZJ9A 4ABWA 2YUXA 4J4PC 1R3LB 2ZX9A 2WKOF 3LQZB 2B15A 1G6RL 5FUZL 4NYLA 4OUUB 5D7JC 2UYLA 2Y36H 3NDYE 5GGSB 5TPWL 5HYJD 3LYRA 2J43A 1NMAL 4MJIE 5AALA 2H9GB 4UT9H 2FYYA 3VFOB 4UZSA 2GKIA 3QUYA 3ARQA 3FUEA 1NCUA 3FUNA 2UVFA 3B5HA 3LZPA 4MA3B 5AOZA 1HXMB 2FH6A 5T1LD 5SWZD 3HR6A 1MWAB 3LXAA 5AWNL 3ULVF 3CCHA 2RR3A 4P3CL 2ENQA 5FDWB 2D4FA 3DUUB 4IOIB 4JREC 4WK0B 3OXRB 4ORGA 4OZGE 3HG5A 2RQ8A 3T1WA 3AREC 4L4VE 2JCCF 4QY8B 4PWGA 3HBQA 4ELMF 1TTBA 1N6UA 2ZUQB 2G4EA 2H3KA 5IK3A 4ONOA 3U25A 1G4RA 2ADIA 3QB7C 4EN3C 2OMUA 4Z23A 5LDUA 4ELDA 4G9FE 4JN2B 1RZPA 4IOFC 4LVNB 4XZUB 5IHHA 3MCLH 3FQTA 4LLMB 3MOBL 1NGYB 1RL1A 3KM1A 4ZQTA 4IKLA 4P9HH 5DJZA 4OQ1A 3A3YB 3EADA 3WEMA 2H41A 1BEYL 3MV8E 3X1NA 4UQ3B 5E1AB 2H6PA 4H44C 4JFED 4QRPB 4NLHA 5GSVA 2X6MA 4WSJA 4X5XA 5E2UL 5BXFA 1V10A 3KGTA 4F1SA 2A9BA 1ET8A 4LKCA 1DQIA 3DGGB 3T77B 1AHMA 2NSXA 1O0VA 2CALA 3WY3A 1T0NB 1AO7B 1VERA 3BQUC 3MNZA 2VDRH 3OR7B 5E8EB 5AZ2H 5IV2A 2WNGA 1MSPA 5IOKA 3CLEL 1X4ZA 1RHHB 5C0FB 3S37X 1N8ZA 4NAMA 1JCKA 5F3FA 4R3SB 1D7DA 1DCLA 3BP6B 3GIZL 2NT0A 1NAKH 4HD5A 4JZJB 4UCFA 2BC4A 3SDYL 3VI3A 2Z4QA 1FJ1B 4L8CA 4F7MB 3T09A 4WSKA 5CGMA 3RY6C 4B9KC 1AIFA 2EDEA 5HTSA 4NDMB 4PJ5D 1F58L 3BVTA 1SZNA 2NT1A 3GSNA 2R1WA 3BH8B 2IAMB 3P69A 5IROA 3MLUL 3X1EA 1EXUA 2DKSA 1WCBB 4DAGL 3MLYL 2Z8RA 1DEDA 3ZYOA 5I1EL 3OZLA 4Y4HC 1JGEB 4XO3A 5ID0A 5C09E 5HI5D 1FYTA 3ATEA 1NICA 2Y5QA 4XBMA 3WJLC 2ITDA 3F7YB 2OFQA 4DN3L 4IBVA 1U0QA 4Z7UA 3C60C 5HYSG 3D3VB 4XHJD 2IOMA 1N26A 1MCFA 3UFIA 1M7IB 4W6YB 4FERA 3KYNA 4GQPH 4PJ9C 3IDMB 5HY9B 2X3AA 1IEBA 1WBZA 3TN0B 3L3HB 4NFCA 1KEGH 4Z7VF 2HKFL 1IAKB 1XF5A 4ZW5A 5FGRA 1P5UC 1LK3H 4XCFH 3QRFM 3VWKC 15C8H 3CMOL 5I6PA 5CZKA 6PAZA 2V4LA 4JFXB 5TDNA 3OKLA 4G3YH 4N90E 1H15A 1YJDH 2R2EA 2VXUH 1IEHA 2ZXEB 4MTMA 1JPST 1W8OA 5TDOA 5D7LA 4B53A 3NABL 2HKAA 4F57L 5KZCD 3CZUB 4F5CA 5I71C 4WENB 3GDCA 3SDXE 5DK3A 3JWDC 1F00I 2G2RB 3QDJB 4UV4H 3MJ9A 4TL5A 2LVEA 4GYBA 2A2QT 3C5ZD 3FU5A 2Z8WC 4RX4D 4LXFA 5I16B 4DFHA 5I1JL 3TBWB 3RLSA 5J6HA 1CT8A 1GTNA 3TCTA 3LIZL 1YNLL 4R96A 1ZTMA 1C5BL 4X6FA 2FRGP 3JXAA 3NJMA 4IHOA 3KLDA 1BW8A 1OSZB 3HB3D 4G8EA 4WI0A 1NGXA 3RB7A 3CX2A 3K6NA 2QKIC 3M8OL 4LEBA 4OLEA 3VXNA 2PTVA 1HCZA 3COOA 4OLXL 1PZSA 4HJUA 4KPHH 4HEPA 4Y2OB 4P07A 2N0MA 1JTTA 3HZKB 4Y1AB 1MLBB 5D71H 4BGDA 1KCVL 4IU2B 4LCWA 1MCOH 1DN0A 3EJSA 1BF2A 4X4ZA 4XO5A 3HZMA 3T6VA 1CLZH 1F4XH 1C5CL 1CIDA 4M29A 1KYDA 3NZ8B 3BESR 4FA6A 5FFOA 5DO8A 3WIFB 4PV8A 5J13C 2OMBA 4FEIA 5KVFL 1CYXA 4NNYB 1ZPLA 2CO6B 5F44A 3T0ED 4TNFA 4I48A 1I53A 4QHPA 3KPPB 3C8HA 3KPOA 4U33A 5T3XL 1HILA 3IDNA 5LO7A 1QABA 4NZTH 2WK2A 3OB8A 1RU9L 3SSGA 1KPUA 1KTDA 1BM3L 5B38B 2Y24A 2NTSP 4WNQA 1PKQE 2IH3B 3JUYA 4LHJB 3FB7B 1XWVA 4TSCH 5I75B 4HSAC 1GZHC 3BAJA 1JVOA 4QJ4B 3QQXA 4M8QA 2O6PA 2BP8B 3P2DA 3P4OB 1MCHA 4FKKA 4MQXC 4N2NA 5EBWA 4LLUA 4LCCC 3TPUA 2QQNL 1TPXC 4MCZB 4N0UB 3NCJH 3O2DH 1U8NA 1Y6MR 5INDA 2IEPA 5E1HB 3WAKA 2VW7A 5LLIC 4M4RB 5DSCA 2GT9B 1AKJB 3CVHB 4XP6L 4C8XA 1MCIA 1SJEB 1LEGB 3IAPA 2GAZB 3DX7A 3FFCA 4YHOH 5CJQH 1RULH 3VFRB 4A38A 3LPWA 1A7RL 4XWGL 3N43B 4IRSC 4O2FB 5GPRA 4JKMA 4LE8A 4Y7MA 3J8F7 4EI0A 2MCPH 2N0KA 2HT4D 4NN6B 3RWDA 5GS0H 3AY4A 4AGMA 1HHGA 5CCJA 1FL6A 1I7ZA 3NTCL 4K3GA 4QDGA 1FFQA 1KCUL 1B9KA 1Q8MA 4JY4A 5CEZE 3Q2WA 4OJYA 1BG1A 3BP4A 1IKOP 1GKOA 3VFWA 2P9RA 4LPWA 1NCDH 3VGEA 4NQEB 4Q9RH 1M6OA 4GXUN 4MDJB 3FPYA 5C70A 3IDJA 5DR5H 2QHRL 2AJUL 4P23D 1UGNA 2ITFA 5F7AA 3RU8L 4AQ1C 1QSFA 2A6IB 4KQ3L 4H2CA 3OHMB 1M2VA 2IMNA 3O4LE 3MYJB 5D1XC 6FABL 3M46A 1QTSA 2AJYH 3BO8A 4G6AC 4ZS7L 5A1AA 1FFTB 5BS0B 1UT1A 4WU7B 4GEJA 1M56B 5AD0A 3IDIA 4DNLA 4DKAA 1OQOA 4PGDA 4LNRA 5J3HC 3HI5L 3LSOB 3B9EA 1JI2A 1FL3A 2YXWA 4YBQC 4D8PB 2DDQL 4LK4A 4FMFA 1JWMB 4G82A 4BEIA 1Z5LA 3KJ4B 4IGBC 5A2FA 4JY6A 4Z7IA 2DWYA 4KO5A 3CDCA 4MA1B 1HNYA 2XC8A 4LVOC 3NFNB 3DPDA 5KVDH 4ZZFA 4M7ZB 4J4PD 1QEWB 2RQEA 2GFBA 5HYEA 4QRTB 1DBKH 1TVHB 1RZQA 2BZDA 2FT7A 3X2QB 4NQDE 2YPVL 4M61B 1D5ZA 4YHKL 3V6ZB 4XAWL 1D6VL 5ICXA 3VXQA 1HQRB 1P4IL 4OKVB 3NJNA 5FYLD 4QXTB 2PTTA 5DEZA 2X4NB 1OAXH 4YSCA 1WFNA 1TYJA 4L29A 5EHFA 2XTSA 3MRHA 3WL9B 3OAUH 3ZE0F 4AH2A 4DGYH 4EI5A 2ICWB 4PREA 4I89A 4FXLA 2E76C 4HISA 3ARTA 1NFKA 3T3PE 3X12B 2WSPA 4Z3EA 2DBLH 3TVMA 2NDFA 3L9RB 4GG8A 5DJXA 1OCRB 3HE7C 2YN3A 4G7VL 3IETB 4HS8H 3QQ4B 4WJG3 2XSKA 3F6JA 3WFBL 4LEOB 2UXGA 5FHAH 1RZ8B 2YN5A 1N0LB 5CD5C 4HS3A 5E2JA 2EILB 3BEVB 3RJDA 2WKLA 3RJOA 1ZV2A 5EPMB 4RMVA 4ZTOL 5E8NB 4QEGA 4YFLI 3FQWB 5DVMA 3DSFL 3ZGHA 2VM3A 2FO8A 3CUPA 1RUKL 1AGCB 3VD1A 2EC9T 3RUGE 2WW8A 5JW3L 4M7LH 1NFDB 4OH2A 3MLZL 3QIWD 1QPKA 3BQUD 3UZEC 5IB3A 1S7XB 3AG3B 1OB0A 2BOCA 3FT0A 3V79C 4NKMA 43CAA 4HUVB 4I2XA 4QYAA 2XKUA 12E8H 3W11C 2FUQA 1S7WA 2F53B 2IALB 2P5WD 3ESOA 3NESA 3S36H 1NLBL 1MLCB 2XQBL 6TAAA 4J3OF 3HTLX 4I13B 3VQ1C 1VEPA 2WD0A 1Y1UA 2IANE 1TVBB 2JE8A 4JFDB 4EQ3A 3CFEB 2H4EA 1JAEA 4WUUB 1XGTB 1IGJB 4NWUL 1IKFL 3HC4L 5EU6A 3LV3B 2WXJA 1ADQA