3M88A

Crystal structure of the cysteine protease inhibitor, ehicp2, from entamoeba histolytica
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
PHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEPHPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amoebiasin-2
publication title Crystal structure of the cysteine protease inhibitor 2 from Entamoeba histolytica: functional convergence of a common protein fold.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 22
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m88A00
3CBKB 3CBJB 2H7WA 2OULB 3M86A 2NQDA 3PNRB 2FO8A 2WGNB 3E1ZA 2NNRA 2C34A 3M88A
chains in the Genus database with same CATH superfamily
1S9VB 5EIVA 2JI1A 3V4PH 3QUYD 3G5ZA 4F9PA 3BPLB 2EYSA 2PXYA 1U8LA 1LEKA 5F6IB 3LPPA 5CN3A 4HIQA 4NENA 4IKJA 2GY5A 2XZAH 2NY0C 3ERXA 4XNDA 1IGTA 2WJ5A 3P2DA 2WSDA 3ABGA 3HTLX 3U1PA 1UFGA 4G1MB 5EO1B 1J8HE 1QLFA 1VENA 5IB4B 4NHCL 3GSNH 3P3RA 3Q13A 1AS7A 1BJ8A 2PW2A 4TLKA 3QIBC 2D31B 4NM8L 5C0ND 1R3KA 4F91B 2X89A 4ZFGL 2BY3A 5IEHB 5TQ0H 1P7QA 3QXTA 4X6BA 3V79C 4F7KA 1E9OB 4OF5A 3UTSB 1E42A 2AGJL 5C0BB 1B2WH 2IG2H 3KD4A 2RR3A 3RIFF 1YEFH 1ORSB 3QXWA 4Y4HD 1YPZE 4D9QE 2WLIB 2A1WL 3KPSE 4ODTL 4FQHB 4IEFA 2ENPA 4U1HA 3WFDL 2YD2A 2FYYB 3B7RL 5C0CB 3WEOA 1BX2A 3AM8A 4FG6C 4PRIB 4YEFA 1FA4A 3ARFD 2LLLA 2YBRB 3DURB 5J12C 4PJIB 4CILA 5LQBL 3UGXA 4X4XB 2NYYD 3TT1L 1DBKL 2AI0L 3WMSA 4JGJA 2BSTA 3G5YA 1WAPA 4NUGL 1NCUA 4XZ4A 4GG6E 1X5JA 1MH5A 4BZ2A 2R1XB 3B8SA 4YGAB 1MELA 2YRZA 1CXHA 5HHXL 4DO5A 3VG0L 1ZXKA 1NAKH 4PD4J 1KCVL 2DI9A 3CIQA 5D7LB 5ANHA 1P4LA 2WWOA 2R4RL 3TA4D 3NCYS 3SGEI 2YQ2A 1II4E 1P0SE 4N25A 4RGNE 1JPFB 5D96B 3C8KA 5G4MA 4UYPA 4WDIA 3BE1H 3CFEB 3U0WH 3LSOA 3CTTA 4FQQA 2TRHA 1G7IA 5J13B 2H26B 3QUXB 3F8UB 4YQXL 2XTLA 1JZ8A 1BZEA 4ZW7A 1X5GA 4HOZA 3LPWA 3NA9L 2VLJE 1R19A 3VJ6B 4ZX6A 4HEME 4WK2B 5A2FA 3LEYH 3CH1B 4LGSB 3SE6A 4QRRB 3AU1B 1OP3K 3ZYIA 3GBDA 3CVHA 5B38B 4U4BA 5LNGA 2XQBL 4XB3A 1RIUH 4ES8A 3O2WH 5K9KA 3MRQA 2GJRA 1CK0L 4MVBD 4NNYB 3RTQB 1FZJB 4U0RB 1PCXA 4G6JH 1E8XA 3VG9C 3V0WL 3MOQA 5JDSB 5K9JH 1YJDH 3SPVB 5IHUH 3T0ED 4JPVH 5DJZA 1KPUB 2XN9D 3H7LA 2R83A 4Z6AT 3KAAA 1M71B 3BEVA 3QQ9C 1M1XA 2P80A 2Y2WA 4MMXC 1BF8A 4X6EA 3DX2A 4KZ0A 1AGFA 4P9MH 4WIQA 4DAGL 4OFVA 2DLFL 4LVNC 3QFJB 4K5PA 1I3GL 1ETB1 1S5IL 3N41F 3BHBB 3EDDA 3HUJB 2VDQH 1IM9A 1IKFL 5FYJH 4MFHA 4UOJA 1QYGH 3U9UB 4Y4KA 5I66A 3T8MA 5AVYB 2MPVA 2HT2C 1I85C 5L88H 2JTDA 4YZWA 4X4KA 4ZPVA 3L9YA 2WXFA 3JSSA 1JZ4A 3IDYC 2NOYA 3QDAA 3KLSA 2WQWA 2IAMD 5DJXA 4TNEA 1QW8A 4XP9L 2WSKA 4RWYL 2BRRL 3QZBA 2UWEA 4PJ9D 2DKSA 3DIVA 4JJOA 4XMTA 3G6JA 4YHKL 2EVGA 4HH9A 4YK4B 4NKOA 5I1CL 2P9RA 3HI6L 2BWDA 1WD9A 2H3NB 1EZVY 2VQTA 3RA7L 1HKFA 4MXQD 4WKZA 5AVTB 3GI9H 5D7IE 5T1KB 3DJSA 4XI5D 1AP2B 1L0YA 1LDPH 1ZKAA 2DQCL 3QJOA 2MQ0A 1ND0B 4YPJA 3S5LG 5JIDA 3TBTB 3BKMH 5GJSL 3BGAA 4IOSD 2A6DA 5FYKH 2IH9A 3MV9D 5EORL 5AKTA 1LVEA 1TQWA 4MNQA 4RLDA 4PB0H 5I0ZA 2KLSA 4PGCB 5AOZA 5E7FA 4QTIH 1HSAA 2VZTA 5FM8A 1SF3A 4JM2C 4XGZA 4LPVA 1SY6H 1ML0A 5DJ0A 1DQKA 2XBTA 5HYSA 2F54E 5HYJB 1E6JH 2GABA 2HKHL 2Y7MA 5T5FL 2AZAA 2R0LL 2XN0A 5CWSB 3D51A 4XVSH 1M6OB 2Y2TA 3HE6C 4DOHE 2QQNL 3D39E 5C07B 1UT2A 3NIGB 5EUOA 3QUZC 1DUYB 3V4VB 4X5RA 2KH2B 2YC1B 4J3SA 3IDXH 2PUQT 4KK9D 4KO6A 2XICA 2Z4TA 3UZEA 3LZRA 4AQAA 4ZBJA 2N3JA 5I1IH 2ZKHL 4JO5A 5DJ6A 4OZFB 1G9EA 5F44A 1H0DB 2F74A 1MCOH 2P5WA 3FU0A 2YGVA 4HUVB 2AW2A 1LD9A 3UBXA 3MGTB 4FQCL 3D3VB 4UT7L 4HS8L 4FFVD 1MI5D 4DGVH 1H6EA 3B3IA 3PNWB 3V0VA 3S88L 4QRQA 3O0RH 5TFSL 4FFWC 5GRJH 2D7OA 4TRPH 3G5XA 5T3ZE 4WENB 4XP4L 1BQKA 4H1LA 2XKNB 2O61B 1IVTA 5AYUH 1QP1A 3IJHA 3N43B 1MFBL 3GO1L 3GHBH 3SPJA 4LQ1A 5DD0L 2IV9A 3NJLA 2DQEH 1F41A 3UTTD 4XR8C 3MRRA 1XHHA 4F57L 2ADFH 3G7TA 3P9MA 1JMZA 1H9VA 2ICWI 3MRBA 4GUPA 3RB7A 4ATTA 4UNVA 4KXZH 4ZMYA 1RK0A 1A47A 1J0JA 4MMZA 1A7PL 5F70A 2VDMH 5BVJB 2H5UA 3RIKA 3Q8CA 2CIIA 4WCYL 4M1CC 3TGXA 1WITA 1M05B 2GI7A 5BPPA 1KBBA 2UZXB 1I8KB 4KJYB 1HCYA 3AS1A 3L1OH 3JV4A 3VXMB 2UZYA 4TVPE 1BV8A 1K5NA 5F89A 4H25A 1F58H 4JR9H 5DVLA 1GC1H 2EXYC 3LNGA 4JKPL 4WO4B 3MA9L 1AD0B 4HU2A 4RZCA 2KS0A 2WKGA 3ZU8A 1UCBH 2I26N 4QJ4B 4JG0L 1AI1L 2PYFA 2RQEA 4LL1A 3LH9A 4R6UA 3U25A 2Y7OA 1J5OH 1VADB 4KRPB 2ZT9C 4RAVB 4PLJD 4PW4A 3MRMB 5ITBL 3CMOL 2HFTA 4P3CH 5KYXA 2NTFA 1TQBC 1S7WB 2AK4D 5JHMA 1YN7A 4M5ZH 1XSJA 2Q2EB 3P11L 4Q2ZA 5I16A 3DARA 2BS71 2HVBA 3MRHB 1KTCA 5JDJA 3GLZA 4PY8I 1RMFL 3ECVA 4R8WH 4NCC1 5I73B 1MFUA 4IBUA 1E9QA 2WN3A 1JNHA 1R34A 4E0RB 2YSSB 4DVBA 3Q6GH 3CUPB 3KPQA 1HC1A 4NPJA 3FFCD 9PCYA 3SDAB 5IFHL 2WIIB 3R4RA 5KS9F 1IIIA 2K78A 3F58L 3GM8A 5IUSA 3AMKA 4ZNEE 4WUKL 4MASA 4ZUWB 1NCWL 2X87A 2MHAA 4HV8B 2JKSA 5CEZH 2BCKB 1XH0A 3AABA 3DIDA 5CJQH 1FFTB 4HWBL 5F9OL 3PWVA 3O8XB 4WHCA 3R1GL 5H94A 3QC5X 4EZLA 1ECZA 3LY6A 4UTAH 3NMEA 1PX8A 1KJMB 4JFDA 2EDWA 1GCYA 3MNMA 4GXVL 2ZCZA 4DZBB 2HRPH 3MRFA 3CZGA 4XZUB 1HQRA 1XR8A 4A68A 1KBPA 4ISVA 4MNHB 2OL3B 4OFYD 1UG9A 2OMXA 4X99B 3X3GL 1SLVA 5T1JA 2GITB 3C5ZA 4Y1TA 3J8F7 4KVNL 1O6SB 2DDQL 1UZ6F 1WFJA 4C55A 1DJYA 4HUWA 4HWZB 4L37B 2YA0A 3E8UL 4YDLB 4G5ZL 4NPYA 4DUXA 4HUMB 2VM3A 1KPVB 3RDTC 1RERA 4YSUA 4JKMA 1SHWA 3DYOA 1SXAA 2QZ5A 3FB5A 3ZL4H 3SJVB 3MMEA 5JLZA 3E9UA 3T2NH 2FX8L 3W0WA 3DX9B 1JF1A 5DVMA 4MZRA 4GSUA 1SM3L 1DQTA 5I1JH 5EOCH 4CVXA 2EYTA 1NAMH 2NY6D 1FCCA 2P1YA 2OTPA 4M8RA 3WEXB 5JXEC 4FMVA 3PUCA 1RP8A 2VLJD 2JKWA 2N59A 4AE1A 1ETZB 1BYOA 2XA3A 3IPBA 2EO1A 3TBBA 4HKZB 1BA9A 1W72B 2X2UA 1YMMA 1HCFX 3L3KB 4QHPA 1OAQH 1E28A 3WY2A 2KLTA 4M56A 2DIJA 3MREB 3B6SA 2PP7A 2VQ1A 2RACA 2IJ0C 4OD2B 3NCJH 5GJTL 2IDFA 4B60A 2ZAGA 3GXTA 4PJFF 4UQ3B 3T3PB 1L7IL 3PNRB 3OVUB 4QTHA 4ECNA 4AQOA 3FOLB 4GT7A 1IAIM 3IBEA 4EI5D 4A7GA 3CQPA 3BSGA 1NLDH 4WO0A 2PWFA 1E4KC 2ISDA 4Z3EA 1F5WA 2EECA 2BHFA 4GRWF 4HIEA 4MA3B 3EH3B 1E90A 2O5ZH 3QS3A 5EC1A 1DEEB 1J0HA 3KWWB 3V4PL 3UG5A 4YNYB 4DKTA 2NMSA 4NN6C 1R3LA 3TF4A 5T8IA 4TPRH 2BSBA 2XZAL 4OGAD 2WXIA 5I8EA 1IFGA 2YAQA 3NN8A 1IBGL 1WWBX 4K8RH 4PJCE 2P46B 3GSNL 4ZAKC 4ABUA 2CIKB 4BE6A 2ENSA 4LCWA 3I3DA 3IRPX 3K2UH 4LPXA 4N6QA 3MNWB 4NUJA 5TQ0L 4N8VG 2NY3C 4JDTH 3L3JB 1Z0NA 2V2WB 3PWPE 4P5TA 1EERB 1B2WL 2IG2L 2WNGA 4KUZH 3Q7JA 1TPXB 3O6FD 1YEFL 3EJUA 4LE8A 1OGPA 4WHTB 5HD8C 1XF2B 1BJMA 1TXKA 2JK5B 2VE6B 1CDBA 4IHBA 4EKJA 1VACB 1UVQB 1LP9A 5C0DA 7CGTA 1Q9OA 5FO2A 1IB5A 1AGCA 1QFPA 1MCLA 2BP0B 2ZYHA 3T2PA 2V7NB 1INDH 2FECI 4JFXA 3V6ZB 2E27H 5IIEA 2WN2A 5F6HJ 2B1AH 5E2WH 3CHOA 3V5HB 4D9LH 4Z7VB 3D33A 4RMRA 3RWHA 3LVEA 5C9JA 1YY8B 4ALAC 1E3XA 4OLWH 3EH4B 1M2VA 1WAAA 2JELL 2HFFB 5KSBA 2FVNA 2G3ZA 2P47B 3KW8A 3LKPA 1T66C 3REWB 1NAKL 4MJ2A 1EZVX 3EAKA 3MBEA 3IGAB 1L3WA 1AC6A 1X5MA 2QADD 1MQKH 5AVVB 3EYFB 3HPJA 4WW2B 1U8JA 4OGYH 1IBFA 3BE1L 3MA7B 4X4ZA 4XT1C 1MOEA 4MBOA 3SYPA 4CSTA 3P77A 5ADPH 4KROD 5FGCE 1P9MC 4OLUH 2Y1YA 4ZUUB 4I48B 2BNRA 2D7TL 3LEYL 4WTXA 5HGAB 2GJ6E 3FFOA 2UWEF 3CVBA 4LLQB 4HIXH 5DEGA 3JTSA 4R9HA 4NSKA 2AV7A 3FUIA 4NQSB 1HAUA 1FCGA 1RIUL 5AL8A 1LHZA 4FJZA 4FQXC 1GZPA 3ARRA 2A4EA 1YDPA 4G6JL 1WT5A 4GPVA 2HX8A 4P4KC 5IEKB 2WXOA 1T4KA 4IJ3B 1OCRB 5K9JL 4NB7A 1G87A 3BH9B 1YJDL 5EU4B 3S3SA 5IHUL 3DETD 1D5XA 4JPVL 1PLGH 3KYKH 3MRGB 3LKNA 4YHOH 5DUBA 4UM9B 1KWKA 3RZCD 2PYED 3O3DA 2CJTA 5T3ZD 3CHQA 1QSZA 4W4OC 3BSHA 4P9ML 4Z8FH 1JVLA 1IBYA 3EFOA 3PAUA 2OMWA 4OFQA 3B9AA 2FCBA 5I1KL 3DXAA 5FYJL 1EMTH 2OTWA 2VDQL 2CM5A 2VSDA 3SDYH 1QYGL 3HE7C 1XR9B 4OH2A 4WKXA 3G08A 1QI4A 5KOMC 4KOCA 4HALA 5FKAA 3TCLA 5L88L 2MWCA 3HHSB 3WTTA 1O7SA 5FO8B 2GC4C 3G6DL 2DN7A 5C6TH 1SVBA 4HBCH 1RULH 1YO4A 4G6AD 5EBMA 2QHRH 3QBTB 4ZX5A 2BOBA 5T3XE 3K6SB 2IF7A 2X6UA 4OIFA 5J1TC 4S1RH 5A6IA 1DE4A 1XTMA 2CA4A 3VX1A 4ONFH 5F7DB 4Q89A 4JFPA 3D0LB 4RAUA 1CURA 2FO4B 5DQDH 5L8KB 2ZUYA 5EUOF 4X50A 2A9CA 3R19A 4N2EA 2ZOWA 4HEPG 4R96B 4LRIA 3CBRA 4U7MA 5E1IA 1JWSA 3TBYB 4BK5A 3B9KB 3MRIB 1OVZA 1HNGA 2KZWA 4DKEH 5E4OA 1OLLA 1K2DA 4J4PA 4WUUD 4FYRA 1Z3GH 3SBQA 3QQDB 4GRMB 4DTGL 3OKDB 1U93A 1FNEB 5EIQA 1P7KA 4TTGA 4BZ1L 2P8PB 3QE5A 2EDEA 2N1KA 1JD7A 3BUBA 5E5MA 5FYKL 3BJ91 4PB0L 4R4BA 1I1AC 4WK0B 2VWEE 3SE9H 3KG5A 4P2QE 3HS8A 2N7SA 2F15A 4K7PH 5IVZB 1PKQE 4OM0H 2B3IA 4Y2NA 1SHXA 3UPAA 4Y16A 3ZKQD 3O2DH 3EJZC 2BP5M 5D7JB 5L2JA 4N2AA 2IADA 3K8KA 4MXWH 2H1LM 3VE0A 3R06B 5I5MA 2R2EB 1E6JL 1RJLB 2ZOTA 3ARDC 4GXUN 2CLRB 4QT5B 1DVFB 1MCNA 5HPMA 4GMTH 1EBPA 2VTFA 3N2JA 4XVSL 2MEJB 1Z5LB 3APFA 3KPPB 2PPCA 2DEXX 2NLJA 4LDCA 5A40E 3KEHA 4MRBA 5C0AD 7PAZA 5DEJA 1E4XL 2ZXCA 2DM3A 1EXHA 4HKBA 1ZT1A 1PNCA 3L1GA 5DVKA 3HZ3A 4CC1A 3IDXL 2A9BA 3NUKA 4ODHL 4WW1A 3TO4C 3IU3B 4F37K 3S37H 3N40F 5E00A 3NZSA 1A7RH 3M88A 4MKMA 4N1CA 1NOLA 4XTRC 3FU7B 1Y1DA 3OQRA 5I1IL 3DMMD 3GTVA 3HS0A 1J1OH 1XD0A 1E5AA 4BHUI 3M1CA 5DK0B 1MCOL 1ZWIB 3OKMA 5IMOB 4JHBA 1XSKA 1OB0A 3H9HA 3FTVA 4EVNB 4HK0B 2G3XA 4F7TA 5DSCB 2FUTA 1HVXA 1P5UC 2R0WL 5F7UA 2XUWA 4QI3A 2YEZB 4DGVL 3KYMB 5E70A 2YQ3A 4H8UA 1PNDA 3BVVA 3JZYA 5GRJL 4TRPL 2R69A 1OANA 2J55A 3VI3A 1UH4A 3QRGH 4ABQA 5SX5K 5AYUL 2IQAA 5E2VH 5IBUG 3WJMA 1TTBA 2AXGA 3UJIH 5BZDA 3GHBL 3M1BB 2WLZA 3L3HB 2X3AA 2YMOA 3SGEH 1J8HA 5C08B 1ACCA 4XNAA 4KJQD 4AYFB 4GJTB 3WTXA 4IOFC 3V7AG 2VDML 1SHSA 4NKQB 5IB2A 1HSBA 3D50A 2UXVA 3X14A 2R56H 4K3EL 4QXUH 1I3UA 4HKXB 4OZHF 3BXNB 1RZGA 4RRPG 4FHKA 5D8JH 1DQDH 3TPUB 3AVEA 3AS3A 3L1OL 4NC1C 4Z7WB 4U3SB 1GCFA 4F7MA 2NXYC 3BP5B 4YDVB 5TDNA 1F58L 3LRSB 4JR9L 1YPZA 1GC1L 1I1RA 5FB8A 5EEWA 3KPOA 3FONB 3KPSA 1L3NA 1MCBA 4NO5A 4Q6KA 3RNKA 3T1WA 1RY7B 3RJQB 3KEDA 2A9NH 5TPWH 3TA3A 3N9GH 3NCWA 1J5OL 1KB3A 4MJIB 4CN4A 4LT7A 4U0QB 3NGBC 3BUQA 4YHYB 2XXMB 1TTGA 4HS6B 2FX7H 3MZTA 4AIZA 5AUMB 5I8KH 1F90H 4JFZL 4JCMA 2BMKB 4GG6A 4UILH 5AB1A 5DRXB 2AJXH 2EDRA 1U6AH 3QJSB 3MJ6A 4XX5A 4U33A 3U7YL 4R8WL 3Q8FA 1MREH 3V4UH 4JZNA 3MV8B 1TO5A 1VB9A 3L3GB 3LN5B 2BZ7A 4HJSA 1VF5C 3QORD 1N3NA 2IMNA 1MCIA 4FL4B 3TV8A 1N6VA 1Q94A 1I9EA 4M9OA 1RZIB 5CZKA 1TCRB 3GLAA 3JT0A 1N7MH 1UJ3B 1QA9A 1AR1D 3O9WC 2KC0A 1G7QB 4X5PA 4YC2B 3CQQA 5KWYC 2X4UB 5HI3C 4KNSA 1MZZA 4Y9EA 4S1DC 3RPIA 5BRPA 1PY4A 3DPBA 1E65A 3GUFA 4HEMA 2NUTA 3V0FA 4AMWA 5CEZL 4L4TD 5CJQL 4Y9BA 1I1FA 3NPSB 3HBPA 1TYJA 3NIFF 1T3FA 1JWMB 1I31A 4K23H 4RCAA 1YNKH 4NNPH 1XTLA 2IWKA 3U2SB 3VCLA 1GYUA 2APXA 2JIXB 3O41B 4K07A 4U31A 4RMTA 3F7RA 2CUMA 3KPRB 3FTWA 4S2SA 1Z0MA 3NESA 4Y19E 1SJHB 1EHKB 4RVBA 2YWYA 4G8IA 4KKNA 1U3HD 4MB4A 1OAXH 5DT1H 4A7GF 5A7EA 4FI8A 2RFXA 3ZW3A 2EVFA 3C6LC 2Y72A 2VDRL 4BKLB 3P73A 5HHQA 1WBXA 2FJSA 3GYRA 4E36A 2F1EA 1C12B 1T1ZB 4YDZA 1IKNC 3ZL4L 1SBSH 4M5YH 4HSAC 3W57A 2ODHA 2P5EE 3MO1A 2VXTH 4R7DA 5DZJA 4YDJB 4LNRB 5I1JL 4JJHA 2WXLA 1XXDC 4OCRL 1NAML 3ESOA 4XMPL 2BXYA 3RUGB 3PABA 1OW0C 4Y5VB 2OAAA 4IDJL 1WIOA 1CLVA 1S78D 3DNKA 3P40A 3QNYA 3BSZH 3U30C 3Q06A 4F9PC 1JD9A 2AMUA 3GSQA 2XX1A 4ODWA 3ILPA 1F11A 3TN0A 3WUWA 1O9ZA 5BUPA 5C0EB 3S3CB 3BDYL 2WXMA 1OAQL 3O81A 4LQFL 4OUOA 2CO3A 4G6FB 4A2DA 5DD5H 2WZ5A 3PQYB 1YVLA 3AQDA 4UZGA 5BOJA 3NCJL 1SJEB 1LP9F 4O2FB 3HJEA 4PJHA 4XAKD 5JPNA 4ELKA 3FW6A 4JRLA 1GH7A 4GQ9L 4JANB 2ZUUA 5D6CB 1NLDL 4B9IA 4CGUB 3GXUB 5J7CC 2M2DA 1FBIH 1OSPH 2PO6A 4G80A 1JK9A 3D25B 4HGWA 4WWNA 1N10A 3F12B 1WA0X 2CDGB 5IJDC 4LSTH 2O5ZL 5DMGD 4ZS7L 2EUWA 4MJJA 1KB5L 3GRWA 1WAAF 4DP5X 2OFQA 3LPFA 2NT1A 4LMQE 3VGEA 3BRFA 2HTLD 5JIHA 5KSBF 5MEQB 1F1AA 4KNTA 3AM8C 4TPRL 3U1SH 5I30H 2F54A 1OWRM 1UOLA 2NDGA 3GXPA 1GOHA 2OJEA 1YA5A 3KH3A 2XTJB 4K8RL 2HT3C 1CD8A 3MCLH 3X12B 2ITCB 4QRAA 3D39A 3CFTA 3IMRA 1UOKA 4JFOB 1MNNA 3K2UL 5F96H 1P4UA 2Q86A 4GKSA 5AW3B 2G0LA 3BFQG 4RFNB 5G4NA 4F20A 4JDTL 3WKYA 4NJ9H 1OEZW 2QPEB 1OKEA 1A3LH 3MXVH 1L9SA 1SUHA 2PP8A 3N06B 1WBYA 4GAAA 4IRJB 4IU2A 4KQ3H 3BVTA 1CD1B 1MW1A 5C0FA 3RY6C 5GGUA 2X4QB 2CKBH 5HYSG 5KSAC 3CSPA 4XHQA 1INDL 5KJRH 3OB0H 2GK0B 1CGSH 2E27L 5ECJE 1X9LA 2AQ3A 2B1AL 3L9BA 3L13A 5E2WL 1T21A 1ZPUA 3SDCC 4D9LL 1EQWA 1FUNA 5BS0A 5D1QE 4FXGB 3RRQA 1A2YB 4OD1H 5ENWA 3M8OH 4OLWL 4JGMA 4R4FH 4LLMB 4E42B 1PJWA 2R9HC 2ODIA 2NY4B 3V9CA 4MNGB 2PWGA 4L2LA 1S5HA 2FQEA 3HBGA 3UZVB 3FT9A 2APTA 4ZFFA 1C16B 5HHOE 4CADA 3IXAB 3GSXA 2XN2A 4XX1E 3U36A 1PSKH 5EU7E 4UT6H 3H8NA 5L7XH 1RPKA 3BO8B 1D5MB 2XIBA 3WNKA 4OGYL 3FT0A 1SXSA 3IWVA 3ZT7A 3QJZA 1UWEL 3T77A 3NCXA 5C3LD 5CLTA 1GTNA 5ADPL 5IY5B 3UBXI 2WYTA 4OLUL 3HZYA 4DT2A 3TOPA 3SODB 1S46A 4QHLB 5JW4R 5F72S 5GZNC 2IANE 2MOVA 4HIXL 3MNZA 4JHUA 3I84A 3CPLA 1E5ZA 5HHNB 3AMLA 2UYLA 3HEIB 1A6ZA 1JE6A 2DPKA 3HR5B 4QRSB 3WN6A 4OV5B 2BW4A 3KMDA 1AVAA 4JFEB 3WHXA 5CCKH 3WTSA 3TYFB 1OQXA 5F7WC 4OF7A 4MD4A 3GBEA 1AKJB 1PLGL 3KYKL 3QNZB 2P45B 4YHOL 4NAMA 5DHEA 4MSWB 3KVPA 4QLWA 4WU5B 2RQ8A 1XIWB 1U8QB 4HGMA 1Q9KA 1NC2A 3PWLB 4PRPA 4BFJA 3OQ3B 4P2OD 1NCIA 1OCCB 4CNIB 1BPVA 2GVYA 3C09B 3VWKB 1R5IB 1JI2A 4H0GA 1CLYH 1NIDA 1FP5A 4WNSA 1JPGB 1EMTL 4RDQF 3RWGB 5A6LA 3SDYL 1R3IH 1L0QA 5ID1A 2VLKD 4DF9A 2ZF8A 5C09E 3BVXA 2CNZA 1DFBH 1WRFA 1T2JA 4NO0B 4MHHI 4R0LA 4R90L 4D0BB 3T1FA 1QR1B 3PY9A 1MFEL 1LO0H 5ERWA 3T4AA 2P8MA 4X83A 2F5AH 5C6TL 4HUNB 1H8SA 3AREA 1RULL 1JUFB 2DL9A 3Q3GA 2QHRL 3STLB 4KKBC 1IC5H 3GS7A 5EU5B 4ZNEA 5D7KE 1NDMB 2MPAH 4RMBA 4S1RL 2D7PA 3VI4E 3LEXB 4ONFL 3RWJA 4AXWA 5J11C 3EOBB 4BZYA 3MV01 5DQDL 4Y7MA 3NZHH 4K94C 4XCEB 5EBLB 4DGUA 3UYRH 4H2CA 4KI5C 4H8WH 3RFRA 4F5CE 3L4CA 5AZEH 4JGNA 1IEAB 2BNQE 3BGFB 1EXUA 2QKIB 2ZIDA 3F7VA 3RKDC 2FQFA 4B9PA 4OUUB 3ARBA 4DKEL 4JPIA 1MWAH 5SV3A 1EFXD 2VJXA 5GRZA 2F7PA 4XMKH 1MNUH 3NSDA 4JPKL 3BESR 2B2XH 4KHTH 5EIIA 3PDOB 2XRAL 1RJZA 1A3ZA 3Q9QA 4EMZA 4PGEA 3DUSA 3FO1B 5ABAA 2BVUA 4RGOL 2QPDB 4PJ8B 3PUUA 5F9WC 4YHPB 3FF7A 4A6YA 3OWEA 1U92B 1YAIA 3QQ4B 3SE9L 5C0CE 2Z34A 1J9RA 1DBAH 2FEJA 3IDJB 4I3RH 5DS8B 3T6ZA 3VI3F 3V5KB 4K7PL 4HFUH 4W81A 4TL4A 2XZZA 2X4NA 1A7QH 4OM0L 3ARQA 3HZVB 1KWGA 3FQRB 4EUPH 3O2DL 4PJIE 1A4BA 1OTSD 3ULUD 2CHWA 4H8HA 4G42B 4NQEB 3ULSA 2C3VA 2Y6TE 2XCMC 1CYXA 3DV6B 2XJLA 4AGOA 5I0DA 5B1JA 2GTZB 2VN5A 1RK1B 4GMTL 4ZDHB 4KTDL 4ZYKB 1IAKA 3JV5A 5T3ZH 4KKLC 4BFRA 1G7HB 4UZSA 3QCVL 3UZQB 5IQOA 5BXFB 1MCCA 1WVZA 3VH8B 5D7LE 1RIVH 1BOYA 3OD3A 1ZV5A 2CDFA 2EXTA 2YKLH 2GJZA 4J3OG 3W9EA 3W37A 2E9GA 2X6CA 4MB1A 2BIPA 1F4YH 2NSMA 5FW6A 3PGDB 4X7FC 3SSGA 3MFFB 2DWEB 3S37L 4F58H 1A7RL 2WC7A 5CSZA 1SF5A 1HHHB 3NJKA 5A16B 1X4ZA 4I8DA 2NW3B 2X9WA 1J1OL 4JY5H 4QF1B 3OZLA 4PU2A 4Y19D 3C60B 4JQVA 4QRRE 4KQ4H 4PHXA 1HS6A 5DJ8B 3R8BB 5BW7A 4V1DB 1TZIB 3LV3A 4OY9A 3ZE0B 3O45B 1FZOA 5DQ9A 4CU8A 4L1BA 2M83A 2VQ4A 5IKCB 5HHPB 2CLVB 3QRGL 4UQIM 2HWZL 2VABA 3HNTH 1F3JB 3WAKA 5E2VL 3UJIL 3DHUA 3OZ9L 3BX7C 3D05A 4U6TA 3TXAA 2RCSH 2I07B 4F15C 1F3DJ 3P4OA 4PJCA 4Y2DD 5JMRA 1ZGLP 3TU6A 4K8RC 3QFJE 1QFWI 4X8XA 1ZA3A 4L3FA 1VKXA 1HX0A 1KCSH 3B7YA 4ZO7A 5DVOA 3EW3B 4NDMB 5HGHA 1UD6A 1CF8H 3B37A 3TTYA 5D8JL 4P23B 5KZCD 4I18A 1W0VA 3BMVA 3PWPA 3U82B 1RURH 3OKYA 3GMLB 1SDYA 2HUEA 2J2ZA 4NN7C 1U8KB 4UM8A 5IW1B 4ICWA 2X88A 4PTTB 3ZYOA 4XN2A 2WLLA 5JHDE 3WOVA 5TDOB 1BQHA 2XPGA 2XWTA 3H0TB 4UUJA 2NNRA 5TPWL 1TEYA 3RVUC 1YEIH 3N9GL 5EN2A 3FTYA 1KEGH 1Q9LB 5EZLB 3O3EA 3QAZC 5E2UH 2EC8A 3KL3A 3TVMB 4EN2A 4E9RA 4J5VA 3VRIB 2DMKA 5AW7B 2FX7L 3HHRB 1F90L 3SN6N 1AO7A 2AAAA 3MRNB 3QYCA 4N1HB 1CYWA 1CGTA 4I1NB 4WFHD 2NZIA 2FLRT 3CK0L 4C47A 3IRCA 4LL4A 2ZKWA 5D5MB 3RL1B 3L3OA 1NGXA 1U6AL 5I1DB 1OD7A 2C26A 1MCRA 3TTSA 2FEDD 2GEEA 3CZKA 3V4UL 1KJVA 1VESA 5B8CA 3U4AA 3O6LH 1C5DB 4K71B 5GGRA 4OIIH 1MCJA 2FB4H 1ULVA 3V4PB 3C5ZC 3NSFA 3TEZA 4OBRA 3UDWA 4AUUA 1FNHA 4FCHA 1N7ML 2JKJA 4X5XB 3IFOB 4ZW6A 4BV1A 2I7OA 4J3OC 2X6AA 2XA8H 3AY4A 4JAMA 4LHJB 3MV7D 1RKRA 2FUQA 2VRKA 1AQDB 4GS7C 3IJ9A 2GJ6A 4Y4FB 5HJBA 3STBA 5GIRB 4Q9CA 3QUYC 5HYJE 1D5IH 2BDNH 3VRLE 5ICZB 4K23L 2CXKA 1PQZB 3K72A 4ZUTA 2CE6A 2NX5D 1YNKL 3DTXB 3TEUA 4IRSB 4KKRA 4NNPL 2FATH 2DLIA 4AW7A 5KVDE 4NJAH 3H9SE 1D5BB 5C07E 5ID0A 4I5BA 5MHSE 5IROD 3NIGE 4G9FD 4UANA 2Y6SD 1XH2A 5F3BA 4HXAH 4PJHF 5CBEA 4XC3L 5D1QD 3TIDA 5L2KB 2PPFA 5AW9B 1OAXL 1URLA 1PBYA 4N8UA 1EJFA 4XMWA 3CJJA 4DP0X 2ZOLB 2DQFB 4X6CB 4TUOA 3W2DL 4CVWA 4TN9A 4Y4HC 3FO9B 4QNPF 3DVGA 5D70H 4XRCB 3OKLA 1SBSL 4M5YL 4GKZB 4TNVK 3FU6A 4FLQA 1A9EA 2VXTL 2HKFH 5H37A 4R26H 3ME0B 1LWJA 3IDIA 1E8ZA 4M8QB 5GGSA 1XF4B 2VXSL 5B1KA 3NCMA 3P4NB 1OGAB 1GXEA 4IRZH 5LO7A 5MP6H 3EF4A 2NYYC 5DURD 5GS3A 4XOBA 3QEHB 5DUPH 4MX7A 1KBGH 3BSZL 2IMMA 3P4MB 3N1GC 5IVXB 2VAAA 5KG9B 2YSTA 3U7AA 4DERA 4ADJA 4XE5B 4CMHB 2W9DH 2IWGA 4P5KA 2J20A 2AEOA 1N8OE 4JO3H 4PYGA 2ITEA 3QIUB 1Y1UA 2ID5A 2O5NA 4X9YA 4I0KA 5DYFA 3HR6A 3GZOA 2EP6A 4MTMA 5DD5L 4ORGB 3RGVD 3LZFH 5EZIH 3MTXA 4PJEE 4PR5B 1EEYB 2AQPA 3B1UA 3ILDA 3BFOA 2JI2A 4YLCA 1G9HA 3Q01A 1X9RA 4AYMC 2B5IB 5FUOH 3ELQA 3S2CA 1SYSA 4H88H 3EO0B 4FXKC 4L3AA 3ARZA 2LABA 4BH7A 2IDSA 3IN2A 1DEDA 4YGVA 4M5TA 1FBIL 2O93L 1OSPL 1A5FL 4P5TC 2ZF9A 1A4JA 3OR7A 1FL5B 2AJZB 4X0KA 2WK2A 4P2QA 2XWEA 5FDWA 4LSTL 1FVCA 2FK9A 2ZYSA 4NRXA 1PKQA 4L4VB 3S36H 5K1JA 4FFYH 5C09D 1J1PH 2QBWA 4XP1H 4KUCF 1XH3B 3U1SL 2J5WA 5I30L 1KFAH 4EN3B 1T5WA 2JV6A 2FR4B 3T0EC 2GBVA 4KDTA 3WMPA 3NRPA 4CSPA 1N59A 3HZKA 4J3UA 3TP4A 4PGDB 3KM1A 4G8GD 1PAMA 2LFEA 3MCLL 1X7QB 4YWGH 4C59B 5CINH 4ZOCA 4I2XE 4Y9FA 4HUXA 1ZAGA 2XI9A 3ULVD 3NEXA 1INQA 4MAYD 3LNHA 3PYCA 2XWDA 2Q8AL 2AQSA 4JX0A 4MZ3A 3VFWB 3NCYP 4NJ9L 3MBEC 4KQ3L 3AC0A 1QBBA 1M56B 2O6DA 4PFEA 5DTFB 4N28A 4GSRA 2XNAA 2CKBL 4XVJH 4JHZA 3GPSA 1OAUH 1PIFA 1UXSB 4ODUA 2RH0A 3UTSD 4Z1PA 5B39A 2QV4A 3WU1A 5C0BD 4MB5A 3EBAA 3OXSA 2Z4QA 1CGSL 1A7OL 1ZT4A 5F1KC 3HA0A 4FQLH 1VEMA 4PJ9C 4QO1B 5IV2B 1T2QH 4HPOH 3IN0A 5DZAA 5EPMB 3ZTNH 1OP5K 3HLAB 2ZWLT 4TQHA 5C0CD 1LMKA 3M8OL 3P2BA 4R4FL 4GRLB 4PRID 1ZANH 1PAZA 2DLGA 1HHKB 3LKSA 4LP4A 2FJGB 4MXQC 3GLEA 1SN2A 3MC0A 2EEBA 4ZPTA 2VITA 1G84A 2CO4A 2AKRB 4NUPA 3F7KA 3T0VA 1PSKL 2Y5TB 1J1XL 4Z76A 3RWIB 5L7XL 1EZUA 5I26A 1OK0A 4WI8A 4S10A 5E8NB 3DBXA 4LCYA 5TH2B 5I6NA 4HYTB 3ENEA 1U95A 5CIPB 1HL4A 4NXKA 3QCUH 5I71B 1KTRL 1BAGA 1KPRA 3QB7C 5HVGB 3OGCB 4D0CA 2LOEA 1ADQH 4WNQB 4XMLH 3MGOB 5K1VA 1BF2A 1ZLDA 5J89A 3BAWA 4HU8A 4O5LL 4LLUA 5IW6B 1NC4B 1PKOA 2YPLE 5CJ8A 5D6DA 2MQ3A 5EOTB 4YOKA 5IT2H 2ARJB 5C86A 4Q8BA 2AJUL 5CCKL 5AG9A 1B3IA 4QRRD 1FN4B 4YZFE 4UQEA 2I5YH 2WXRA 3DSFH 3PFUA 3IF1A 5G5DB 3ARWA 3NJNA 5GHWL 1I8MA 4HIJA 2I32A 4KXDA 5LDSA 3SBRA 1B0RA 5C0GB 3N04A 3V8CA 4J6RH 1M3IA 4JK0D 2BSDA 3OR6A 4DSYA 4U1JB 3HVNA 2OX5A 1NEZB 1LE5A 32C2A 3GXDA 4KK9C 1RAMA 4QRPB 3ZHNA 3FB8B 1CLYL 2Q3XA 4L3CB 1PX4A 3MJWA 1R3IL 1TZHA 2WBJA 1S7QA 2CAKA 4LB8A 2DJUA 1KNOB 2AXFA 1IGCH 4J4PC 1CFNA 3RFZB 5BRZE 5BQ7A 2AEWA 4LHUB 1DBJH 4Q9RL 1DFBL 2ZXGA 3QIWA 1IVLA 4OIBA 3QFJD 1LO0L 3F6IA 4FKEA 5IVOA 3RWCA 2F5AL 4FFVC 4GBXB 4YHLH 2ROXA 4Q9QL 3WE6A 2L7EA 2X44D 4AIEA 2MPAL 3S3PA 1D7DA 2FJUB 3EFFA 3OC5A 5I8CB 3BLBA 3NZ8B 2OV0A 3MRJA 3GDCA 3U48A 4BSWB 1RZ7H 3NZHL 1IKOP 2NR6A 1NCOA 3JWOH 1T1WB 4Y16C 5ANMB 1G9MC 1JGDA 2CO6B 5AZEL 1DJHA 3DGDA 3KLDA 4TM9A 1KN4H 4Q97A 4U1GC 1LEGB 1EK3A 1ZOXA 3F7QA 1UB5A 3H54A 3WN5B 5JPMA 2B9AA 5DJ2A 4WWKB 4MQ7A 1RUPH 1ZGLB 1VZGA 3HN8A 3ZTDC 1GYAA 2DYRB 2QGCA 1DHKA 1MWAL 2HLAB 1LTXA 3HMXH 2SEBA 3KVDD 5FOBA 1U21A 3MACL 4XMKL 1MNUL 1NBYA 1FG2A 1X7TA 3BPOB 3OSVA 3VQ1C 2V5MA 2B2XL 3L17A 4KHTL 4YIQB 2R1WA 3HG1D 4LVEA 3GSVB 3LH2H 5ISZA 3BGMA 3WO4C 3QT2A 3VMPA 5T5NF 2GUYA 3NPZB 3L95B 1XGUA 2OS7A 3P30H 4HX1A 4P06A 5T1KD 4R7LA 3QEUA 2OI9C 1A6WH 4HAFA 2X2IA 3D85B 3DV4A 5FLVA 1DBAL 3OAZH 4JFFD 3ARPA 3VM7A 4FXTA 4HFUL 1EAOA 4R2GD 1A7QL 2P5EA 1UH2A 1BVNP 1GPOH 4M00A 3PL6A 4Z7VE 1OQOA 1RZ8B 1XF1A 4F33A 3HS9A 1UOWA 2BSRB 2HG5A 2WAQA 4PLJC 5E8DL 3IFPA 4I9WE 3QO1A 1UD8A 3EGSB 4PJCF 5LXGH 5J1AA 3QG6A 4X6FB 5B21A 4FFTA 4GSQA 4P3DB 1TYEB 2Z8WC 4J3TA 2YKLL 5HYJD 2H1PH 4C83B 2RA1A 5ITFB 1SQ2N 3ROLA 2A6IA 1S9WB 2EXSA 2WD0A 4XNBA 3FBQA 5DO2D 4PRDB 5FLUA 3VSVA 1ZGLM 4X9BA 4N3UA 1FH5H 2I25N 1J05A 1F4YL 4OCYL 2Z92B 5GS1C 3ZX1A 4W9ZA 4DN3H 3HAEA 3B5HA 1IRAY 3BOVA 2EYRB 1PF3A 4U6VH 4WI6A 3WTVA 2OMUA 2HMIC 3JQOB 4JY5L 2ADGA 2VW7A 3CXHK 4HIIB 4KJPD 3MJ9H 1E4JA 2FECL 5FA4B 1CQKA 3P3UA 2GTWB 4KQ4L 2A9MH 3QPXH 1WHOA 5F7EH 4NQXB 4QRTB 1TETH 4OGXH 1TKWA 1EJOH 2FHBA 2PCFA 1GJIA 3Q44A 5IK3B 4AJWA 1DQVA 1D6VH 3QDJE 5DMIH 5LAXB 4FFZA 3W39B 3KBPA 4UBDD 1LMIA 3CXHJ 3BIKB 3MOAH 4YHNA 3NG5A 4GQPH 5HJDA 1NBVH 2QGDA 3HNTL 3D3VD 6TAAA 5I6PA 5ADOH 2AFNA 2YD7A 2VDRB 3RIAK 4CKQA 2E7DA 3MLTA 2RCSL 4MS6A 5ESQB 1A9VA 3ZPDA 1A8JH 5EDSA 1C1EH 2JTYA 1CXFA 5KSUA 4PJBB 1Z32X 2IC2A 5L8JB 1JZ2A 5T1LD 4BFIB 3FUMA 5EF3A 1CF8L 2ESVA 5IUCA 1NAMB 4JY4A 1DYZA 3VWJB 4ZK8A 1A1OA 1RURL 4ONHA 4HXBL 2EVJA 1QNIA 2P7TA 3V0IA 4ZS6D 5MENA 3B9VA 3ULUH 1IAII 4ADIA 4RGNC 4QR7A 4JFHD 5IG7B 4YDKH 2EIZB 3QI9A 5B7FA 2NY6C 4AUJA 4AT6A 1YEIL 4ZW5A 4I77H 4B3EA 1KEGL 3ZR6A 5E2UL 1KLUB 3VXMD 1RD6A 3NFSH 4UNUA 1I1CA 4W9DC 4ELMB 2MCMA 3SDDA 3FQWB 3CFJA 3H3PL 4R7XA 4A1RA 1BWWA 4MD5B 3N5AA 1G6RA 5EEVA 2R29A 3ZSTA 2A6JB 3GMNA 1E9PA 5F0LB 4KRPD 4APQD 4QLRA 1VFBA 1S7RA 1W15A 2KBGA 2XXFA 5ESVB 5CJOH 3TBVB 2QT6A 4P2RB 8CGTA 5HHOA 4IBVA 1AGEB 1CS6A 1QQDB 2IH1A 3Q8BA 4ZMVA 3DVIA 2C7UB 3GJFA 3QYNA 2ZD0A 1AMXA 1KB5B 1P53A 4WK4B 4EUPG 3PHQA 4XVUD 3QEQE 1YHPA 1DLFH 1PZ5A 3ABZA 4NP4H 1BLNB 2Y06H 3RLSA 3UAJA 3VACA 4B95C 1BVKB 1Z9NA 4LIQE 4FD0A 5FC9A 3LD8B 2XA8L 3FHAA 3CU7A 3Q1EA 4RX4D 4UOW0 3C08H 1XGYH 3V2AR 4GP8B 2IANA 3DKHA 3MUHL 3BT2H 1QAWA 1D5IL 2BDNL 1L6PA 3O3AA 4JQIA 3SDAD 1AYOA 2FWOA 4JM4H 4R7NB 1T0NA 3V7MA 3S34H 1B4LA 4UV4H 4QKXB 1CCZA 2FATL 4ZD3H 3MR9A 4NJAL 3V6FA 4Z0XA 4P4RB 1KB9K 5DJDA 4C4BA 3BZ4A 2CBTA 3NCCB 4GW4B 1OF2B 2FIKA 1AGBB 5JW5B 4NQDB 4BDVB 3O8XD 1Y6NR 3STZA 4OI7A 4HXAL 4XN1A 2HJKA 4I4WA 4LBEB 1KELH 4L8BA 1DDTA 2ZOOA 4NZTH 2WXPA 5IHBA 4NRYB 4H4NA 3BYYA 1W6LA 2OZNA 3F6LA 2DQIH 1RL1A 4Y8DC 2VISB 3HNSL 4BFGA 1C8QA 3NEEA 4KXAA 3BDXA 4Y5XA 4A2GA 1JGEB 2R2BA 4M93C 4N2HA 1BIIA 3B2PA 4N85A 2H7WA 5D70L 3SCMA 5IP4A 2YK1L 3FCBA 1CLZH 2QV2A 1KZYA 1NJ9B 1MW2A 4Y2OA 5I1LB 4UCFA 4F1ZA 1TFHA 3KCPA 4IRZL 4BK4A 5MP6L 4BGLA 3G9AB 3SJVD 3VI4A 1CI5A 2P4AB 1LK3H 1F02I 1MF2H 3SQBB 1KBGL 1JMXA 3SY0B 5KYWA 3OMNB 2EC9U 4LEXH 1XGQA 4NWUH 2JE8A 2XU9A 2W9DL 1H15B 2WAHA 1MCQA 1OHZA 1PZ3A 4TS6A 4F5CA 4JO3L 2BNQA 4H8WC 1A6TB 1MVFA 2GAZB 2IVFC 3IMWA 5EZOH 5IB4A 1MIMH 4UIKH 4M62H 5MEPA 2QADC 4B9YA 4QOKE 3ZTEA 4X6DE 3LZFL 5EZIL 1B9KA 4GP4B 4K7FA 2WTRB 1CFTB 4LEBA 1N2RB 2P44B 4DK5A 3NTCL 1XGRA 5FUOL 1KZQA 1QHPA 4H88L 4N87A 4P5SA 1J9SA 4Z7WE 5AAPA 3W38A 2D7QA 4AH2B 2XV2A 4UINH 3WS6A 4PV8B 2VXUL 5FUZH 1HH9B 1Q9WB 2WQUA 3ASWA 1I8IB 5C0CA 4RNRA 1PFCA 2BVQB 3SPIA 5CLZA 2WZPA 3DURA 1TZ8A 1UXMA 4PJIA 1J1PL 4Z7NE 4XP1L 4B5ZA 4JPWH 1T0MB 1UM6H 2HT4D 1KFAL 3IJSB 4HAKA 3DETC 5ELIA 4ZTPH 3C2SA 2A2QT 3RZCC 3C6EA 3X3FL 4N90E 1QFWH 2FHFA 3AG4B 3VFVA 2J8UB 4DKFH 2JVUA 4YWGL 5BV7B 5C8JB 5I9QC 1I7RA 5CINL 3ARFB 5D7LA 1QFHA 3RGHA 3M6DA 5F21B 3MV8E 1DUZB 5DRWA 3CFUA 2CLZA 4XBEH 3G3LA 4ZOAA 1NCHA 3LRLA 4BELD 3A24A 3G9VA 2O6EA 3QUXA 4KHXH 2M1KA 5DUMH 3WKNA 3RVWD 4AEHH 2C3HA 5EUKB 3VJ6A 4UTBA 3FT2A 2Z0BA 1FZMA 1MDAA 4N0FB 4MXVE 4G6AC 4XVJL 4XE0A 1YNLH 1TNMA 4HLZH 3D48R 1NANI 4B9JA 2K3TA 1REIA 1S3KH 3HRZA 3WHE0 1K8DA 2L7UA 4ZQKB 1GGBH 3VXSD 3WIHH 2YD4A 4AQEB 4NZFA 4HPOL 3ZTNL 3RTQA 1RU9H 4GW1B 4C4KO 1QNZH 2J1YA 3AG3B 3EDJA 3L9RB 1NA8A 4L2YA 3T8VA 5JDSA 4GO6B 2E3VA 1R4XA 4N0YH 3SPVA 1ZANL 5HJGA 4W9JC 1KPUA 1BXVA 4Z0BH 3DO7B 1EAQA 4X8GA 3HLKA 2VLRD 4Y2LA 1MVYA 2WVUA 1U8CA 2WY3B 1RUQL 3C5JB 3PHOA 1ZLUK 3SDXE 4EPSA 5J9PA 1QPKA 1F86A 3H7BB 4I9WD 5IB1A 3VU1A 1OOWA 3QCTH 4O2EB 2ZXAA 5CZXD 5LBGA 1R5VB 3BHBA 4P8QA 5K93A 3HC4H 1R24A 3WNIA 3U9UA 2LW3A 1JPSL 3D5OF 4Y89A 2H45A 4K4KA 2CBQA 2QSVA 4NLAA 2MNJB 1B0IA 1ADQL 2UY6B 1UD3A 4XMLL 4ZFOB 5FW7A 5BNXD 2DIEA 3WENA 2BERA 4R0LC 3FJTA 2HN7A 5IESH 2MMXA 2BVYA 1PGRB 3RUGE 1PYWA 1E27A 5JHDA 3JV0A 5IT2L 1HNYA 2ICEB 2CRIA 2DBJA 1NOFA 4X98B 5I1HH 1R5WB 2I5YL 1VEPA 2F18A 3ULVH 5ALBH 5E8PB 3EYVB 1F4HA 3WE1A 5BRQA 4J6RL 3GSOB 1ZV2A 3RU8H 2IAMB 4FQ1H 3WLWC 5GGTA 3NQIA 4ZFZA 5T1KA 4FMFA 2CR6A 2WM0A 2OQJB 1MVUB 3ZSSA 4Z77B 2VL4A 3ARBC 2RIKA 4UM9D 3DO3A 3DMMC 1JXFA 4FN0A 2DKUA 1NCDL 5J1SC 2EO7A 3FL7A 3L4XA 1DBJL 3SGJA 3OXRA 4KKPA 5IQLA 3ARGB 4LF3A 4PGCA 3QWOB 5KBMA 3IDGB 2YIHA 1SOXA 3EZ8A 3MN8A 5C7XH 2DL2A 3HI5H 1NFDE 5GGRY 4BH8B 5ACZB 1CXIA 2W59A 3HC0B 1Q0EA 4OKVB 3RTLA 3CSBA 3QUMA 1BREA 1P4BH 5H2BA 3K2IA 4QYOA 2Z31B 4OLZL 3T6VA 1RZ7L 5CD5D 2ITFA 3QUKB 4GT0A 2YMTA 3JWOL 3L4VA 1TU2A 4OF0A 3GEWB 1MCSA 2A73B 3ALPA 3H9SA 3T0BA 2PTTA 5C07A 2VXQA 5DS2A 2E9IA 5D9SA 4XAWL 2P3YA 2VL5A 3HMXL 4KJQC 1M4KA 1HT6A 2ZE0A 4IIQA 1E30A 4WFED 3PAYA 5CAYB 3MRLB 3F00A 1AZZC 3OM3B 4GH7B 3ILQD 5F7LB 3CNKA 1WZKA 3ZOAA 3LH2L 5KYUA 2CDEB 3KGRA 3Q2WA 4RZKA 3V5DA 4AJVA 1KXQA 3SKOA 3P30L 5BZZA 4APXB 3RIFK 1T03H 1A6WL 4Y9GA 2BW5A 2BLFA 2VUKA 2CQVA 3MGTA 3MROB 4AENB 4OTXH 2Y07H 1CL7I 3B2VH 1GPOL 3F7YB 1BD2D 3MFGB 1DANU 5K39B 3TLRA 5BOPA 1A3RL 1HL8A 3UPRB 4OD3H 4LLWB 4OR1A 5LXGL 4XXWA 3DIFA 1SZNA 4MNGE 2G0KA 1IM3B 4P5MB 4NKMA 3VFOA 5GGSY 4JE0A 2BS8A 4JPSA 4RFEB 5HDBB 2WV3A 1MI5B 1PEZA 2FGZA 2I9TB 2G9HB 5F6HI 4ETYA 2BINA 1F8TH 3CMGA 1FH5L 3EH5B 5D93C 4D8OA 3MYJB 5GZOA 4DN3L 3R4DA 4U2ZA 1AY1H 3L3IA 3QJFA 4PJEA 5H37G 1WCQA 3RY4A 4HCRH 4JG1H 1AR1C 2UZXA 2W88A 4ZXBA 4PCTA 1KGWA 4R5TA 5L0QC 4XO8A 3P3SA 2A9ML 3QPXL 3RX9A 2PPEA 5F7EL 3H55A 4I18C 4OGXL 3NRFA 1OPGH 2XWRA 4WO4A 1EJOL 5I8OH 4NO2B 4JZOB 2D0GA 3QNFA 3US1A 1USZA 1D6VL 1Q0XH 2DTSA 3O0LA 4HHGA 4XBPB 5HHMD 2X0UA 2LLGA 1AHWB 3MOAL 2H8PA 5F1IB 4RAVA 4YBLB 4Y5YA 3MRMA 3L5WB 4G43B 1RVFH 5TE7H 1B3JA 1F1DA 1S7WA 4XNMA 4OBSA 1TQCC 1QRNB 3K5SA 3UG3A 4I0PD 4AKOA 5IQ7H 1U3ZA 3S8GB 3IETA 4GI9A 5CFAA 3ECQA 3S8FB 1C1EL 1DLHB 3ZHLA 1UM4L 1JIBA 1U3HC 4JRXD 3IRZA 4I2XA 4DJMA 4JL2A 4I13B 1FJ1A 5DZOA 1A1MB 4LKCA 3JXAA 5KANG 2OW7A 4F7CA 1AJ7H 1VPOH 4Z9KB 1EX0A 5C08D 3C75A 2V2TB 1BVLA 3DX6B 2YFOA 4LCCB 3D12B 3SHSA 1QHQA 5D7HA 4GB9A 3OGOE 3HCVA 3LNDA 4YDKL 1I7UA 3ES6B 2MCG1 3FH5A 3UDWC 4MQTB 2BCKA 4E9TA 1NCBH 4H13C 1QBLH 4I77L 3BAXA 3AG1B 3ZIYA 3AY4C 3L7EB 3J07A 2W0FB 4PPTA 5ICXA 3O6MH 2VSCA 3NFSL 4N2OA 3FCTB 4FI7A 2F1BA 4D0DA 1AGDA 1KJMA 1R3HB 1J5HA 3IAPA 2KPWA 5AOKA 5CN2A 3ZE1E 1BFVL 4ZO6A 2VRAA 4OQTH 5HY9A 4MJID 3B7TA 4MNHA 3DTUB 2YD1A 1H5BC 3V4VH 3I6LE 5CJOL 3F83A 5CEXB 5DI8A 4AIOA 2LLNA 1DP0A 3PU7A 2MNWA 3TZVB 3US0A 3VXRD 2CCVA 3EH1A 3A67H 4L37A 3GKZA 2OA9A 1DLFL 2QZQA 5B39G 2Y06L 1COBA 5FM5M 4HD9A 3PWNB 1AQ8A 3U0TB 1ONQA 4OZFH 3D8MA 1CLOH 2DS4A 4WU7B 3VI4F 3TESA 1XGYL 3DVFA 3RDTB 3DX9A 5DMGC 1A3QA 4TOYH 3I9IA 4NQEE 1O9WA 3BT2L 1SUJA 4PWEA 3ZRSA 2HTLC 2UXTA 4JM4L 1IBHA 2YPLA 1Q0YH 2V7HA 3WEXA 3S34L 4UV4L 5FIEA 2OW6A 4ZD3L 2AHIA 4Q0XL 1QACA 3ASOB 4UDTA 1NFIB 2D9QB 2NTSP 4ZMLA 3UO1H 1W72A 3DJ9A 3CZFA 3WGVB 3LXUX 4ADGA 3ZMRA 4JCLA 4GUQA 1KELL 1P2CB 3FUEA 4NZTL 3KPMB 5A2AA 3MLWH 2CD0A 4RMWA 2DQIL 3ZO9A 3H2QA 4TLTA 3HB3B 1A4CA 2B15A 3KPRD 2JWYA 4RMVA 3H6JA 4UQ3A 5CKGA 1JGVL 4UB0L 1ED3B 2HSIA 2VLME 2WLKA 5D1XB 3FOLA 2Q20A 5BRZA 5TK4A 4V1DE 5JOEA 4HMCA 4HUUA 1CLZL 3ZE0E 2DWXA 4P48A 3QWRA 3KBHE 1D5ZA 4WHYH 1URIA 1Z7JA 1C08A 3TBWA 1X5AA 1EHLH 3E3QE 4F7PA 3ATFA 3G6AA 7PCYA 3T2LA 3OX8A 1LK3L 3RP1A 1MF2L 4LASH 5L8LB 4Q74A 1HJCA 4LEXL 4EIBA 1BQRA 4CUCA 4FS0A 3FUKA 5ICYB 5AZ2H 4B27A 5EZOL 5IMKB 3FUJA 1GA2A 1MIML 2OYMA 4UIKL 4WSJA 5CS7A 3P0GB 4M62L 1CDHA 3WS3B 2WP3O 4KDTC 1MRCH 1ICTA 3BAJA 3VFRB 1T5XB 2ENYA 3L4UA 1P6FA 2VN6A 4KK8D 5IB3B 3MNWA 4BUQA 3WFBH 3L3JA 1I9RH 2BRQA 1DJGA 4P57A 2DW5A 2CPCA 1AS8A 2WO2B 4H26B 3UAFA 4UINL 3LB6C 4G6FD 1YQVH 3PQYD 2E4FA 2BVOB 2EE2A 2Z0UA 5F88B 4HK3N 4C54A 3O3UN 4KH2A 1FYTE 2BP0A 4MJHA 2V7NA 2W65A 3V6ZA 4YLQT 2DJ4A 3LQMA 2YQBA 2F5BH 4KJWD 3ZE2E 3ZRCC 3BWUF 1WCBA 3BT0A 1ZXQA 4JPWL 1UM6L 4HISA 4XN7A 4Z7OF 3O6FB 3CN0A 5FF6A 2DH3A 4ZTPL 3WMQA 1EWHA 2X4PA 3KNBB 4NZUH 1XGTB 4U1IA 2BNUB 5B22A 2LGNA 2OZ4H 3RYMA 3EGDB 3ESVF 5AVUB 2HFFA 3RI5F 1QFWL 5I1EL 4MHHG 2H0FA 1DVQA 4P2OC 4YSOA 4CMMA 3IPEA 1AQKH 2NZ9C 4L1TA 1J0KA 2QLVB 3QP3A 5TE4H 2NUPB 2OL3H 1ZA6B 3MDJA 3RPKA 2L3BA 4H0HB 4XBEL 1RZKH 3EYFA 4K9EH 2XTJD 1T22B 1T04B 4RSYA 3ROOB 5C1MB 2J88H 1BMZA 3D69A 2E7HA 3QHZH 4BWTA 4KHXL 5KJ7E 5DUML 5JA8B 4V2BA 2A74B 3CIAA 4JJ5B 2BP3A 4AEHL 2BC4B 4M6AA 1IL1A 2BY1A 4F2ME 4G83A 4YSQA 3AUWB 3FN0L 4H5SB 5HGAA 5DMKB 4RETB 1S3KL 3VXUA 2A99A 3QIBA 1GGBL 3KPTA 4HDIA 4TLUA 3AXLA 3L08A 3CDGB 3WIHL 1D7FA 1XCQB 5K59F 4QXTA 4JKKA 4Q6IB 1TEGA 2XG5B 1RU9L 1MAKA 3QDJA 5IGXH 5F7BA 1QNZL 3N55A 5JQHC 2BP8B 4KROB 5CILH 4L9LC 4R97C 1RZQA 1FV1B 3BH9A 1TITA 4ABVA 5EU4A 1I8AA 2EH8H 4MJ6A 3JUYA 5CP3A 1N70A 1FL3B 4DQOH 4DZ8A 1AMYA 2W07B 4G8EB 4LLAA 5E5UB 5LN8A 1JPEA 4EKXA 2BH0A 2GSMB 2VR9A 3MTRA 5EU3B 2F53D 3QCTL 3GIZH 2A9DA 1G94A 2HG0A 3C8DA 3KXFD 5B4MD 1HWHB 3HC4L 1KIRA 1O9VA 4MMYA 4M61B 3LHPH 1ZHLB 4ZW8A 3GS0A 1OARH 4M3JA 3NRQA 1QZ1A 5I1GL 3EDEA 2GTQA 2WBJC 2D2CC 3KYOA 1EPFA 4UU9B 2HX7A 5HP5A 5CLWA 3VRLF 1SRDA 1BZ7B 1OTSC 2DICA 3U2JA 3ULUC 3K6SA 4O00A 1S7UB 3F05A 2V3FA 2QKSA 4PBXA 3C5SB 4YHMH 2R59A 4LXFA 2GUOA 3D0LA 1X5IA 5I1AB 4JFQB 5KTEH 1ZTXH 2P24B 3N41B 3ESPA 5I1HL 4PHZA 4DUWA 2YEQA 5IF0A 3D09A 3ULVL 1CBJA 2P5PA 2B77A 4QD2E 1ET8A 2B8OT 1PDKA 1UGNA 3TBYA 5DWUH 3RU8L 3KH4A 2NR6C 3B9KA 3EJSA 4JFED 3MRIA 1PLBA 1NGWA 2OSLB 4RA0C 3BAIA 4ZO8A 2WSPA 2IQ9H 5AG8A 5JPMC 1AKJD 3FSAA 4YSDA 3S4SA 3OKDA 5D1ZI 3CX2A 4HZLA 1XIWD 3T09A 5JORA 2C9VA 5E8EA 3FB6B 1TVHB 5SWSB 3W9DB 5CHNA 5CSBA 4EZMA 3VWKD 3V9FA 5JOFB 3QEQA 1JYVA 3TCTA 4XOAA 4OQ1A 4KRMB 5C7XL 3GNML 4N6RB 5CCGE 4WUUB 3VXTA 4MMXA 1KV3A 4UWQB 4L4VE 1KYOK 3JWNH 2F68X 1P4BL 2R4SH 1HILB 2X4RA 4NO0D 3S98A 3LQZA 1XD1A 5D7JA 1D9KB 2ZX9A 5KYYA 5EA0H 4DPBX 1DO6A 1KIQA 1UM5H 3MRKB 4XXDB 5FYJE 4N8CH 1S9XB 1DVFA 3KPLB 4E41A 1FDLH 4DNLA 2ORBH 3OV6A 4FULA 5D2LA 5TK2A 3T6WA 1KACB 1K4CB 2X3CA 3AZUA 3ARDB 5DQJB 3SPHA 3TNMB 2RJMA 4KRLB 3V7AE 1KYOJ 4U6HB 4GAGL 4WJKB 3BKJH 4XX1G 1DBBH 4Y2DC 4ZT1A 3WTYA 4OCWH 1I8LC 4NI6A 4PJEF 3T4YA 1FNSH 2F58H 2F8IA 3OF6D 3VGAB 4DKAA 5JO5A 3IU3A 1G7JA 1MUJA 3H6AA 3TIEB 1GSKA 5EO9B 1HDMB 3S97C 2YJLA 4HT1H 1QLRB 1T03L 3AB0B 5IMOA 2AJYH 3RVXD 3IJEB 1NCTA 3I6LD 3WXVH 3CN1A 3QXDB 4Z5RB 2OSXA 2AQ1A 4TVUA 5DSCA 2K4WA 2KQNA 4OTXL 1FNAA 2YPVH 1DR9A 1Q4NX 1J11A 2Y07L 2CJSA 3VSUA 4ZW3A 4PJ8D 4D8PA 3NACH 5IB5A 3OHXC 4E5XG 4LRNH 3WNLA 1ZSDB 3PHAA 1CN4A 2V9UA 4M7LH 4G6MH 4HIHA 2WCGA 4NOBA 5E0FA 5FYKE 4YBQC 4LLVB 4BYHA 4F1SA 1J5IA 1X3DA 2F7IA 3NSXA 1ORQB 5C71A 3UADA 1F4XH 1JXKA 1ASOA 1KYFA 1F8TL 3ZKND 4BUHA 3A6CL 4Z3TA 1IAOB 3GDBA 3FO2B 1BPLB 3VYOA 4QOKA 3ESNA 2DIBA 5DU7A 4X6DA 1AY1L 3FQTB 5D1ZD 4K15A 5F1OB 4JG1L 3TPUA 4UTCA 1N67A 5EN3A 2C1PB 2IOOA 4LSRH 4G71B 5EZJA 3UTZA 1NANH 4Z7WA 4U3SA 4AV5A 3TNNA 5I75B 2G5RA 2WVVB 4EOWH 4NWTH 3ZJAA 1CU4L 2NY1D 3QUZA 5EC2B 5A2BA 3QJHA 1OPGL 2Q7YB 3U7WH 3J27A 2WKOA 5I76B 5GSVB 4IS6B 4GKOA 1Q0XL 2H32B 4PTUB 1EJ6A 4PIBA 3C60D 5KJ4A 5FECA 1JZFA 1J9CT 2V5TA 5EU6B 3QI9C 3DHJA 3QR0A 4V1DD 2Z93B 3F5WA 3GGWA 1QWUA 4HS6A 2ADIA 2CBMA 3DRTA 5TE7L 3T65B 5AUMA 4UQBA 2OMYB 2ZX6A 4H8QA 5J4MA 2D3LA 5DHMC 5IQ7L 3QQ3A 4FNLH 3SDDC 2DJSA 5AOLA 5F93C 5FHBL 2DAVA 3QZPA 3WY3A 4FQ2H 5D1QC 5DRXA 2CHZA 3FRUB 1S8DA 4QRPE 1MPAL 3ZL2A 5HVHC 1A4KB 3BISA 3MV8A 3LN5A 1AJ7L 2J44A 3FXIC 1VPOL 2IXQB 3NP4A 5E99H 1M53A 2DYPA 5DEFB 1RZIA 5CXPA 1CDCA 4AM0B 1UJ3A 5FO9B 5EU7C 1G7QA 1DJWA 1OGTA 1ACYH 4DP7X 4KZEH 5JHAA 5IR1B 4KNQA 3EGXA 4P23D 4R3SB 1NCBL 5INDB 3QORB 4YZFF 3LDBC 3T3ME 5ANME 1JWMA 3ZKSD 2HZHA 2EUVA 4I3GA 3U2SA 4AGPA 3WFHA 2OMVB 1ZE3H 4R5XA 4PCKA 4JRYB 2WTOA 2JIXA 3F6JA 4PLKC 3N40P 2PN5A 5DRZA 3DROB 4OQTL 4PMEA 3GF8A 4L4TB 4A7UA 5KS9B 3AAZA 2Y25A 2O30A 3FH8A 5GRYA 3V4VL 5HI5C 1GAFH 3B2UD 2ZXQA 3HI1B 3S5LA 4PJDE 1MKFA 1ESOA 5B1CA 3SDXA 2DWYA 2FJFB 4FGMA 4X4ME 4UDUB 3A67L 3FNKA 3OKNA 4OZIE 2ZOKB 1YEGH 1SVZA 4Y1SA 1Q72H 4F2EA 1C12A 1T1ZA 1QEWB 5J0BA 2E9BA 3L48A 5B38G 1ZHBB 2Y7QB 4X8JA 1PTZA 1CLOL 3QISA 4TOYL 4MLIA 3SCMC 4YDJA 4BCXA 3II1A 3BIBX 1FFRA 2BWQA 4HJ1A 3IB4A 1GGUA 5IBLD 4Y5VA 2H2SD 2Y4SA 1BZ9B 2KKQA 1ZVSA 1M7IA 2D03H 3DUHA 4ZMAT 3LVTA 2VB5A 2Y5QA 3UO1L 3TYGH 3BPLC 1QBMH 3M46A 1CD0A 5F6IC 5C0EA 4YHZL 3L5JA 3WI9A 2RBLA 3TX4A 4OJYA 3UACA 3G5ZB 3MBWA 3RL2A 1GL4B 3MLWL 2PXYB 5CEZE 5MEOB 1LEKB 1U8LB 2BM3A 1M7DA 1QSEA 3GIVB 4KI5E 4XXCC 5I17B 1IGTB 4ODXB 1IBBA 2V17L 2VR5A 1JTPA 3I9AA 3KBEA 3CZNA 3O4LE 5CBAA 5L2KD 5LBSH 1CWVA 1PPIA 2BZDA 3LS4H 1B0GA 2CM6A 4NLHA 1CL7H 1PZ2A 1R3KB 1ACZA 2X70A 2WIMA 1N5AB 3VAEA 4X6BB 3WXWL 5K9QI 3DLQR 1NFDA 3WS6C 2CDGA 3BEWA 5H35A 1V3MA 1CR9H 5DJAB 1EHLL 1XCWA 3M07A 1UOVA 1TVDA 3DHPA 3PHSA 5DJYB 1L6ZA 2MJWA 4KXBA 2MKLC 3VNYA 4LASL 5MEQA 3X1FA 3INUH 4IEFB 2DY2A 4YBHA 4PJFB 4TUKL 2ZKYA 2A4ZA 1BX2B 1RZJC 1OGAD 5AZ2L 4F27A 4X9FA 1D7CA 4DP8X 4HWEH 1GZQB 2AVFA 1R75A 1SXZA 2LT9A 4Q9BA 3S2AA 1MRCL 1ES0A 3MRCA 5B3JF 4GRWB 5JHLH 3B5GA 3UBFA 3RB5A 4G7SB 3G5YB 3WFBL 3QIUD 3HG5A 1JBJA 2F1AA 3EKCA 1SLUA 2KDGA 5FYLD 1MH5B 4PRHD 1UXWA 3GZQA 4GW5A 4IRJA 1NUDA 2D0FA 2GHZA 2Q3ZA 4TSCH 3ZDZF 3EBGA 1SN0A 1YQVL 5D96C 1UKTA 1BW8A 3I75B 3EOTH 3AY2A 1P4LB 1IARB 5J13C 3QUXC 5C9KA 2WNKA 4YXKH 1KXVC 3C8KB 4WDIB 1D7BA 2F5BL 3PPEA 1YYCA 3LSOB 3PAZA 4PG2A 3D18A 4FQQB 1G7IB 2OXGB 4ELME 5CU9A 1GJWA 1FFOA 2VDNH 4NZUL 3NIDE 1VFMA 1E4XI 1F6LL 1JZJA 1QVOA 2OZ4L 1CFQA 3GBMH 1E4KA 4L4VD 3RTQC 4U0RC 3VDAA 4MNGA 1YAZA 2ZNWA 3CVHB 3FFDA 1I9IL 1AQKL 2AGJH 3CFBA 3UZVA 4HWNA 4NUQA 4MA1B 5K9KB 4P2RE 1A6AB 1F2XK 5TE4L 4AL8C 3IXAA 4PEEA 4EN3D 3MJGX 4QKTA 4G82A 5FYJD 2BWIA 4MGXA 4OZFG 3LNEA 1RZKL 3SQRA 3QA3A 4K9EL 1CDYA 2R0ZH 4HJGA 2J88L 2NY2B 4IOIB 5DJZB 2R2HA 3DOHA 3BEVB 3VYPA 3D2UD 2G5BA 1M1XB 4XNYH 8FABA 5LQBH 3FMGH 2XFXA 1I7ZA 4BA8A 2XBZA 4X6EB 4QHLA 1AGFB 2Y5EA 5CCHE 4ZAKA 4HG4K 2WVSA 3D7PA 5C2BL 3FU3A 5HHNA 1IM9B 5KBLA 3ZK0A 3DSNA 4QRSA 4Y4KB 3X13B 2YUZA 3RDJA 4WJ5A 5I66B 3BYTA 3VG0H 4UOW1 5IGXL 3PLYA 5CILL 4YO0B 1U8HA 3GFUA 4PJAF 4RMQA 4ZPVB 3VO0A 1HHGA 2PLTA 3FHEA 4NQDE 4HG4J 2EH8L 4DPRA 4ZTEA 2I85A 3P54A 1W9XA 1QUNA 4OW6A 5EH1A 3AGWA 1IGJA 1LJMA 1XIWA 1U8QA 3K46A 2PWHA 4DQOL 3PWLA 5F1NA 3NFPB 1XXFC 4MAZA 4NAJA 4YK4C 5IMMA 1DN0B 4ZMQA 4XMVA 4QDGA 2UWEB 3KHOA 4KWUA 1PG7H 4OGQC 4GRLD 3GIZL 2G3NA 2F8OA 3F7PC 4HH9B 5JMOC 5FYKD 2EINB 3QZNA 1JPGA 3RWGA 2DLTA 5HHVL 4S1SL 6FABH 1E5CA 3F84A 2XQBH 3LHPL 2QGEA 3PWJB 1OARL 5IW3A 4KOBA 1GYWA 2ZP0T 4QCIB 3PP3H 1R46A 3V0WH 4BSJA 3NJJA 1JUFA 4HJUA 3SGJC 3STLA 5FM5O 3RJOA 3S35H 3P3TA 3GK8H 4EIZC 2HKAA 1IQWH 5D2LF 4WRLA 1BF5A 4YHML 4W9CC 1TZOA 1UUSA 2A6DB 3CC1A 2VLKB 2IPKB 3A6OA 4MNQB 5KTEL 1IEHA 1ZTXL 5FS5A 5EBLA 4WI5A 5H4ZA 2FH8A 1IEAA 3PG2A 1P9MA 4A2HA 3CV5A 3NBNA 1U8PA 4JGUA 5DWUL 1IKFH 4XGZB 4ONGL 5DJ0B 2YAOA 2CHXA 4WGVB 1C8PA 2IQ9L 4PRAA 2WWKT 4FQXA 3D4CA 2Z8VC 2VQUA 3FUFA 4P4KA 1FGNL 2Y7LA 4KJPC 1Y6MR 4B7IA 4RWYH 3UCQA 1OALA 5EUOB 4F3FA 2IPTH 1J87A 3UG4A 3IJ8A 2BRRH 3GMQA 5F9AC 3TJPA 1E3FA 3PDDA 5DS8A 2WCPA 2BJMH 3V5KA 3AWFA 5I1CH 4UAOB 5FV1L 2R4SL 3N0PB 1YC7A 4LHUD 4X4YB 1O7VA 2EDXA 1Q1JH 3CDYA 3ETBF 1SJXA 4L5FH 4M02A 4NQEA 5EA0L 1UM5L 3IGUA 1R3JB 2F74B 4GBXD 3HE7A 2P5WB 2E9WA 2Z91A 4N8CL 2GTZA 3KJ4B 1WFOA 2E9JA 1LD9B 4JM2F 3UBXB 3FQ2A 4NC0B 1FVDA 1QD0A 4OT1H 4X7TB 5E9NA 2VIRB 3B3IB 3PJSA 3R18A 4OKDA 4RIRB 4X5LA 3BKJL 4X6DF 5E6ZA 3MCYA 5GJSH 3HFFA 2R1YA 1Q1PA 3FU8A 1CF1A 5KVGH 1FNSL 2F58L 4MWFA 3PGFH 2WBKA 5HTSA 4H1LB 4RMUA 5DC9B 2R23B 3PGDA 1UWGL 3MFFA 5G4OA 2OCFD 5KUMA 2Z8SA 4IK6A 4UT9H 4WWKD 4ZOEA 1FGVH 2E7LA 2WKOF 1CT8B 2HP4A 3NCBB 4HT1L 4ZS6C 5GZOC 1SDDA 4XCYA 4N68A 2VDOH 4QF1A 1B88A 3P9MB 2AJYL 4GUPB 3MRBB 4L3ED 1HQ4A 1KY7A 2O5YH 5SX5H 3WXVL 2R0LH 1RK0B 2YD3A 5DJ8A 4MMZB 4V1DA 1MRDH 43CAA 1YEDA 5KVMC 4Z7NF 1HN1A 3O45A 3SKMA 1DSWA 1FQ9C 1T0OA 5FGRA 3U46A 4JO2H 2FD6H 1T7VA 2CIIB 2QQNH 2XOTA 3NACL 3KBFA 4AE0A 3TH3T 3SO3B 1S6NA 3OJVC 4LRNL 1K6QH 1RHHA 3D85D 5CM1A 5IKCA 4WO4C 4M7LL 4HHWA 5LDUA 4G6ML 3JV4B 4XHJD 1KYDA 2JLLA 3OJDB 2BZCA 3CSTA 2CO7A 5CD3A 4K5NA 1Y7VA 2AJ3B 4PBDA 4KRPC 1WHPA 2NQCA 3QVAA 3L2MA 4NS0A 1F4XL 3QUHA 2PYFB 4MCNA 1AFVH 1NIAA 4ZUVA 4PJGE 5LJYH 5KYXB 3U0PA 2NTFB 3SBWA 2W8CA 2XN9E 3IEAA 2NDFA 3HN5A 4GQZA 2IOIA 3UFIA 4MXVF 5I73C 3QRLA 3CH8A 3K2MC 3GMLA 4AVKA 4DK3A 5I16B 5EO0B 4EOWL 1U8KA 4NWTL 4YFLF 4IBLT 4AQ1B 2G2RB 5IW1A 5CJ5A 2FSDA 4NQCD 3EH2A 4WEEA 3U7WL 1E9QB 25C8H 3GBLA 1JNHB 2XBDA 3D07A 1N0LA 3H0TA 4FQIH 1FYTA 3Q2VA 3SDAC 1S2EA 2NY5H 5DD0H 3KPQB 3D9AH 4L05A 4W9GC 1DANT 1OM9A 1WZ1L 3TVMA 2D3NA 3V8OA 3VRIA 5D2NB 1LEIB 4LPWA 5AW1B 4OZHB 1B4JH 2VC2B 1F56A 4CSZA 2ZXWB 4DW2H 5ILTH 3O8XC 4GO8A 4ZTOH 2PTUA 5LNEA 3SDXF 4FNLL 1VHPA 4FQ2L 3PWVB 2OR9H 1P5UA 3Q2CA 3RL1A 1UUNA 4PCYA 2E76C 5H94B 2ED7A 2VT0A 4XMUA 3P3YA 3TBCA 5HI4C 1TZAA 4XP5H 4JFDB 3H9YA 3L6FB 2EIKB 3MA9H 1T89A 1HQRB 2BVPA 1RZKC 5E99L 3LQAH 3Q5YA 1XR8B 4ISVB 4PVLA 4TMPA 4X5XA 3IFOA 5GSRB 1HXYB 1ACYL 4KZEL 4YDLC 1TVBB 4F2MA 1NL0L 5DD1L 3VWJD 1IGFH 4JG9A 4BKSC 5DMYA 4Y4FA 2V3DA 4Z7UE 3VRJA 1J7VR 1JAEA 3P2TA 3QDGD 1OT2A 1W0WA 1J88A 3GSNA 4HUWB 3P11H 4M7ZB 3CC5B 3MV9E 4NPYB 2ED8A 1AXSA 1CE6A 1SPDA 4GS7B 4HEPA 4P46D 1TMCB 3DTXA 4IRSA 3FB5B 4ETQA 1KGCD 3MMEB 4IGBD 5JLZB 3IBOA 4YUEH 3NZUA 3MV7B 1PD0A 2ZWYA 3W0WB 1UQSB 1JF1B 1S7VA 4CVXB 4AITA 3SGDH 4AEEA 2YA1A 3BVWA 1CTNA 1S9YB 4I87A 2Z35A 2GY7B 2DQFA 3NIFB 4JO1H 1BGXH 5C70A 1I9JH 1JCKA 1YEGL 4K5LA 4G9FB 5F9OH 1NFDF 4LDOB 3BN9D 3R1GH 1VZIA 1ZK5A 1PIGA 4XRCA 1E28B 4LDLB 4GKZA 2VLLA 2AITA 1T5KA 5AFAA 4WWID 4G3YH 2UV3A 1TJMA 3B6SB 2LQRA 3T8XA 1UH3A 2JCCF 1QASA 4LZKA 4LLDA 4NIYE 2C1OB 2HT4C 1FVEB 4QTHB 3K6FA 1AR2A 3APCA 1WEJH 1VZHA 2D03L 2XZCH 2FJHA 1OL0A 3EYQC 4KVNH 5AAMA 5KG9A 3TF7C 3VD4A 3O9WA 2D3JA 5DFVD 1MI5E 4HIEB 4UQ2B 3TYGL 5BO1H 1QBML 2GC7C 4CDHA 2F7QA 1WC7A 2COQA 4F80A 1OK8A 1D6EA 2Z1KA 3E8UH 3JZ7A 3QIUA 5CLXA 5EC1B 1QO3B 1CXLA 1H8LA 1R3LB 3QR1A 3ZDYE 2VUOA 1J18A 4PR5A 3DYPA 1GGYA 1WFUA 2GCYA 3MCKA 1UJTA 3S5YA 1HZLA 2DQUH 4YAQA 5I8EB 3RVWC 1ACXA 3HKFA 4PB9L 3UTTE 1WFTA 2X05A 3GMRB 3D08A 3LS4L 1Z9SA 4LCWB 2W0LA 1CL7L 5GRUH 4YX2H 2ITDB 1KYUA 4HZAA 2OPCA 4J12A 1TPXC 4NUJB 3RGVB 3QNXB 4FJYA 4ZMOA 4Q56A 4K3JH 1IQDA 5TDPB 4HJEA 1CR9L 1X5YA 1EIBA 4L4VA 3ARUA 12E8L 1QFWM 2N0KA 4H0IA 4FC3E 3QS2A 4ENEC 3C6LA 3C87A 4EZJA 5KBDA 1Y0LA 2VCOA 3X1EA 3GSWB 2B7DT 3INUL 3Q05A 1RQ5A 1LP9B 5C0DB 1Q9OB 2J56A 2F0CA 1IKNA 1EEZB 3S3JA 4Q6YA 4HWEL 4JFXB 5D71H 1ZCRA 4MD0A 1L9MA 2PW1A 1WS8A 3RWHB 5JHLL 2PMZA 5C9JB 4RRPA 2OR8A 1A14H 1HFUA 4BWWA 5GRXG 2AK4E 1XSIA 3EJPA 1KN2H 1OW0A 3VFWA 4ODVL 4LLYB 1M2VB 3H1ZA 4J2QA 2H1XA 4FZEL 4M48H 4TSCL 5KSBB 3LKPB 3PXHA 4G8GB 2OYPA 4OCLC 4FA8A 5DTFA 4PREB 4WW2C 5I23A 2PETA 1OTUD 3EOTL 1MJJA 4YMPA 3CZUB 3FS9A 1UXSA 1RJYA 3HPJB 4MAYB 1BFOB 3GSUB 4YXKL 5J6GA 1G1CA 1IBGH 4LNVA 5IV2A 2IO5A 3MNVA 2N4IA 3FFCE 4RBPK 4TNWF 1RI8A 2IFGA 5EPMA 4N0UB 2QPSA 5EFIA 1ITCA 2VDNL 3QDMA 3WIIH 3BN3B 2BNRB 4YSEA 1HE7A 1NPNA 3OLIA 1AIFB 3GBML 3GHEH 3JTSB 4O4YH 5DEGB 3REVB 1JPTH 3MI6A 4NSKB 2AV7B 2OMZA 1XF5A 4IJ3C 4X9IA 4FG6D 1GZPB 1GTFA 2Y5TA 1RIHH 3Q8AA 1T4KB 4ZSOA 2R0ZL 1F13A 2C7FA 3HZMB 3MRPA 4GQRA 1D5XB 1SY6A 2DEWX 3II2A 4BQ8A 5DUBB 4KK5D 1FNFA 3O3DB 4FTVD 4PD4K 4YSPA 1YEHL 3FMGL 3ARXA 3OLEA 4XNQA 2G2PA 3B4NA 2YUWA 1OZTG 4JLRB 4WNQA 3EFOB 2OMWB 4EIUA 3DXAB 3LS5H 1AG0A 2NNCA 2OTWB 5IW6A 2JELH 1NC4A 3W81A 2FBOJ 5CD5C 4FA6A 4FLRA 3C9NA 5DZNA 2XZQH 3PS6A 2OTUA 5HJ3A 3ZE1F 5FKAB 2HX9A 4JDEA 5KBKA 1FN4A 3C6SA 5G5DA 5D7EA 5H8DA 3ZHFA 2CZNA 2NNAB 5EBMB 4HZ1A 3RY6A 4FNQA 4QHNA 2EXWC 4P07A 5C0GA 4GSXA 1AQMA 5KSAA 4ILDA 3K4AA 4JFPB 4KKZA 4RAUB 5FYLH 1PG7L 4QRPA 2FDBP 3ILQC 4PV1C 3SDCA 2D7TH 1HYSD 3B9KC 4L3CA 4ZX3A 1ZVYA 5LGHH 4X7SH 1Z1WA 1AXIB 4PJXA 1JWSB 4CW1A 6FABL 2Q6WB 3RFZA 5AB0A 2C9UA 1ODUA 4MQXD 2XQYK 2B1OA 3QQ9D 1K2DB 1V3LA 4KAQH 3KYNB 2GFBB 4NKDB 4PV9A 3S35L 3GK8L 2DYSB 1U93B 3GM0A 1IQWL 1P7KB 1JFQL 3CU1A 5E5MB 3NZ8A 3E9TA 1MJ7L 4WLCA 5KAQG 5JXAH 2Z65C 4OLYH 5ANMA 2XVBA 1EA9C 4PGBB 5D7JC 5E9DD 5I1KH 1C7TA 3HHMA 3K74B 1ZE3C 3JUZA 5GZNA 1DVFC 4NP9A 3GXIA 5L2JB 1NIFA 3EUDA 1PG7W 3UC0H 4M3KB 2DOCA 5JR1L 1XGPA 4JFYA 3CN3A 3G6DH 4DP2X 5HPMB 4QGYA 1FC1A 3IAQA 3LIZH 4KKAD 4NAQA 3T0WA 4PJDA 2H3XC 3FTUA 2BXZA 4QPEA 4UMGA 3IVKB 3GSVA 4M7JH 3MLYH 1G9NL 4PM1A 4X4MA 2ED6A 3VQ2C 3VFSA 2YZ1A 1LQSR 2DQTH 3ZE0F 2H6UA 2IPTL 1GY1A 1UB6B 3L95A 4PJ7F 4DFIA 4OZIA 1ROWA 2Q76B 2D7NA 3CFDB 3CFQA 4HKBB 3P4LA 4OZGE 3VXPA 4UOQA 5CKAA 1JTOA 2BJML 2AQNA 4WW1B 5BZXA 3KGSA 3PIQA 4U1KA 4IYKA 2OI9B 3LXAA 5E00B 4AEFA 5AD0A 5JA9A 1Q1JL 3ARGD 3AXHA 3HG1B 3IDNA 4L5FL 3P9LA 1RZ8A 4K5OA 4WI3A 4AMXA 3HS0B 1S7SA 1SEBB 4PWFA 2ETWA 5IMLA 1X6LA 1LLAA 3QFDA 3FSZA 3OKMB 1FPTH 3FZUD 3EGSA 3H9HB 4F7TB 4OT1L 4DTGH 4JFFB 2Z31D 2R8SH 4R2GB 3N1FC 4BZ1H 3I6GA 3Q6FA 2VERN 3FC8A 4JM2D 1TJHH 4C83A 5KVGL 4CKVX 1KBWA 1QLEL 4PRDA 4OU3A 3VI3B 1ZRUA 3NA4A 3PGFL 4AC2A 4JFTA 2C9RA 5B1BB 2IAAC 3I85A 4OLEA 2IQAB 3JVGC 3UCRA 3WJMB 1M6UA 2AXGB 4UT9L 3S96A 5BZDB 1XT5A 2DD8H 4PJ5A 1F3DH 1FGVL 2UVEA 3POHA 2YD8A 3QO0A 3WELA 1PFOA 4HIIA 3HE6D 4UTAA 1HCVA 2VDOL 2DZEA 5FA4A 5JNYA 3O4LA 2O5YL 5CIPH 2GTWA 1T83A 3S8WA 1OB1A 3ZE2F 4G7YH 4QRTA 1MRDL 5SV4A 4Y1AD 3MUUA 5IB2B 2MIZA 1HSBB 4P5RA 3X14B 4DP9X 2F61A 1XEUA 4JO2L 2FD6L 5IK3A 4AGNA 1RZGB 3C2AL 1HZKA 5LAXA 4E9WA 1K6QL 8PAZA