3M88A

Crystal structure of the cysteine protease inhibitor, ehicp2, from entamoeba histolytica
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
PHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEPHPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Amoebiasin-2
publication title Crystal structure of the cysteine protease inhibitor 2 from Entamoeba histolytica: functional convergence of a common protein fold.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 22
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m88A00
2NNRA 2WGNB 3E1ZA 2H7WA 3PNRB 2FO8A 3CBJB 2NQDA 2OULB 3M86A 3M88A 2C34A 3CBKB
chains in the Genus database with same CATH superfamily
1MCDA 2NX5E 2A9NL 3O2WL 3BVVA 3N85L 4DVRL 2ZXGA 5DYOA 4JFUA 2AQSA 3NEEA 4H8QA 3BP4A 4NO0D 4F7KA 2G5BB 3MLTB 4O2CB 3S3SA 4E41D 4GRWF 2H32H 1YRKA 4KZEH 2G9HB 5E03A 4DP9X 4E9RA 3A6CH 3KPPA 1ZLUH 3IETB 2G2RB 5DJDB 2CIKA 3N1GC 4G83A 3UO1L 3DRTB 2VQTA 3ASWA 2XFXA 5F0JB 1E4XH 3UAFA 4LCYA 4ZMLA 1G84A 3BKML 2BC4B 4DKDC 4Z7QB 4XH2B 4LKCB 3WMPA 1WTLA 5DR5H 1UM4L 3ISRA 3ZZQA 4F7MB 3C8DA 1FCCA 3ZTNL 4RZKA 1P7HL 2ZSVA 3DROB 2J4WH 4IKLA 3KEDA 1GJWA 3GM0A 4HOXA 1KBPA 2PO6A 4JPWH 5IQ7L 2KBGA 2PP8A 2IPUK 3N9GL 4HSCX 1VLXA 4PB9H 1XSIA 3BT2L 4U0RB 4PRAA 4YLQT 4DPCX 1ILUA 3GMMA 5A3ID 1RZPA 1QWUA 3ZE0B 1E42A 1X5ZA 3Q01A 4KUCD 4ZFOL 2VXTL 4FTDA 4OJYA 4H7VA 5H37A 3S2AA 5J7CC 4WV1B 3GC3A 2YOAA 3RZCA 5FGCB 3WEMA 5IBTH 2W38A 4W9JC 3V0WH 4W6YB 1UFUA 1ZKAA 1T66D 4JY4B 1UXMA 3C8HA 2BXZA 1F6LL 2QPEB 4Z7AA 3S6CA 1SZNA 1ZWIB 3I2CH 1PW3A 4WJG3 3WE6B 3ZY7A 1GPOL 4OCNC 5I5MA 3T3ME 3UTTB 3KR3H 3D34A 4Y4HA 5SWSA 4I48A 2F5BL 3CFDB 4JQXC 1JHKH 2BNQD 4PRHA 4MXVF 4PCSA 5BZWA 4LSPH 2GQHA 4Y7MA 4LLVA 3U7WL 4POZC 3QORA 4OLWH 2F74B 2Y06L 1S9WA 3SHSA 1XX9C 4M5YL 1HQRB 2VL4A 4ZO9A 3K72B 1IC4H 1XD0A 1FZMA 3WENA 2CO2A 3UPRB 2DL9A 4R2GC 5KJRH 4HK0A 4M43L 3GWJA 1JZDC 5AYQA 1QSFE 3CXDH 4X6EB 4JW3A 5EN3A 2ZUTA 3UTSD 4A68A 1QATA 4KNSA 3VDAA 1FZOB 2F1EA 3EFDH 4KVNL 2B0SH 4MJID 3B9AA 3T0AA 2YA2A 4YR6A 1PQZB 1ZVYA 2HH0L 1NCNA 4HG4J 5EEUA 3FZUC 3SKJH 4P4KA 1KYOJ 1NEPA 3EYQD 4MWFA 4XC3L 1YC7A 1YMHB 3CSYA 1T3FB 5CEZD 2AJSH 3APMA 4N0UA 2EVJA 4QHUA 2LTQC 3BMVA 4HJTA 5IMOA 3LXUX 4J3OF 3LZLA 1NC2D 1UXWB 3PHOB 3VWJC 1U8NB 2Z34A 4XN7A 4NHCH 1UEYA 4ZOCA 3MGOB 1OARL 5C6TL 3WE1A 4EIUA 4F8TA 4IOIB 1RIUH 3OB0K 1CICB 1QQDA 1JYXA 1NC4B 1KMGA 2YMOA 3VXNA 2ZXWB 3WG7B 1GMEA 4KGJA 4IU2B 5F7EL 3K8KA 3V4PB 5GJSL 1CT8A 3SDCD 1L6PA 3DV6A 2FHCA 4LNRB 4FNLL 2BRQA 3HG3A 3BGMB 4GQ9L 1INQA 5EUOF 4I8DA 3PWJB 1MCRA 2ICWA 4QOKE 1EVTC 2ETWA 4I4WA 1TYRA 4K3EL 2VSCA 1HAWA 3I9PA 5CZXD 1F6FB 5GRVK 5A2KH 3KM2A 1I3GH 1EFXD 4HIIA 5IB5B 1T7VA 4OIAA 5DQJB 3TT3L 5L4MA 2BOBA 3MAWA 4N5EC 5E6SB 1YMME 2W65A 4AC4A 5EUKA 4IJTA 2IH3B 5E8EA 4JFEB 1U33A 4U1JA 2OL3B 1B4JL 1CG9A 2Z31D 4PJXE 4ZBJA 3VTAA 4PJAF 3OHXA 3BXNB 4KX8A 1U4EA 4GRLB 5I19H 4XXDA 2EEAA 2VXSH 5ITBL 4XPBL 4GW5B 2A38A 4N9GB 4YSSA 3DPBB 5A40E 3TO4D 5F1NB 3EH5B 4RMVA 3GBLA 4XNUH 3VG9C 4HGWB 3AG2B 4NZ8A 4LLWB 4PJGF 1I31A 3BLKA 4Y89A 1DHKA 3VGEA 1C12A 4OR1A 1S3KH 4XPHH 4YIQB 3TNMB 3WN6A 1HNYA 4WCYL 2A6IB 2CM6A 1CGWA 2RACA 1KJVA 1H15B 5F44A 5HI4C 4DK6A 4ZPVB 1YJDL 4OCRL 1JZJA 1PIFA 4Z7WA 1PZUB 4F58H 3GS0A 5IJDC 4XOAA 5DHEA 4ZFFA 2VQUA 4WFEE 4XNYH 5IB1B 1TEYA 2WQUA 1E4WL 3WKYA 4DP4X 2ITDA 1PJ9A 1BWWA 3HHSB 2WP3O 3VFRB 1WZLA 3T2LA 3H1ZA 1J9RA 2I5YH 1ETZB 3LSOB 3OKEB 3SPVA 4KRLB 2FT7A 1KULA 3BKCL 3S3BB 5CILL 3PABB 2VDPH 4WEMB 3O3EB 3VFUB 3O2VL 5GRZA 5B3JE 1F11B 4K94L 3TGXA 4H8HA 4X98A 5HGAB 5ANMA 3OJVC 1UKTA 4YE4H 4ZAKD 4NQSA 3QEGL 3LKPB 3EYUH 3VD7A 1YECH 4I77L 2CU9A 2HRHA 1RJZA 3SO3C 4NWUL 2ZUVA 1UB6B 2YN5A 1TPXB 5DHYB 4NGHL 4RWYH 1OAYH 3NZ8B 5GGQL 4M7KL 2R56H 1AGEA 1HEHC 4QPEA 1BQUA 2CO7A 4HS3B 1DQKA 1WFUA 3C5XA 5E4OA 2VN4A 4NO3A 3TBYA 4C56D 1LEIB 4N8VG 3MLWH 4PV1C 3Q2WA 1UATA 7TAAA 1UUNA 4B96A 4JFZH 4QNPE 4PS4H 1ZV9A 1GIGL 4ZMPA 5FKAB 1NCGA 2OFQA 2YD3A 3U46A 2FATL 4H5SB 2V8LA 3ETBJ 4ZUUA 3VFWA 3G6JE 2DB8A 4NLHA 1FFPB 2CUIA 2KLTA 2CRMA 1XGYH 2C3VB 4DK5A 2WLNA 1O5PA 2YXFA 3QEQA 2UXFA 2IF7A 4XAKD 3CFKA 3FQNA 3BUIA 3OAWA 3QZMA 2EKSA 1HHHA 3BAWA 3QFJD 4Z8FL 2PWEA 4ZS6C 3UYRH 3ZKQD 1LP9F 4XMKL 2DKMA 2MQ0A 3FQRA 3R8BB 1JGVH 4APQB 4MNGA 5CCHE 2KT6A 5LGKA 1KWGA 1AOZA 4N8CH 1A9BB 4Z77A 4YGAB 4DP8X 1JZ5A 3KNBA 4FI8A 3RWDA 5I82A 3AJ7A 3PGDB 4N24A 5LB1A 1HZHH 5JW4R 1N67A 3OR7A 4BFKA 3ZIYA 3BAEL 3VFOA 4DKFL 5FUZL 2RCSL 2IIJA 1JPGA 3ARPA 4N2MA 4OFYA 1DVXA 1BF8A 1ZTXE 1I7TA 3IF1B 4DZBA 4CC4A 1G94A 5FO2A 5BRZB 4UI2A 4BA0A 1RZFH 3N91A 3SBWC 1ZT1A 3Q2LA 5HHNA 1JNJA 3D09A 4BHUA 5BUGA 4JY5L 5FF6A 4E5XB 1BEYH 1VFAA 1S7VB 1E27B 2HT4C 1AY1H 4FZEH 1G43A 3FO9A 2AC0A 3ETTA 5AVUB 2YSSB 1FH5H 1PYWB 1MRCL 4XPFL 1KYDA 1P7QA 1EFQA 1TETL 1X3DA 2MKLC 1MLBB 4GXFA 3KPRE 1TUPA 5GJTH 1AZVA 1HQ4A 4BD4A 4AT6A 3OKKA 2X05A 1CGYA 3GB7A 3U83A 5E6IA 1CYXA 4DGVL 4JDVA 1L0YA 1ES0B 1WH0A 2MOVA 4P2AA 3MVSA 1TTUA 2R23A 1NGWB 4PFEA 4QTHB 4AIOA 4PTTB 1P2CA 3BT0A 3BZFB 4X7CC 1G7JB 3VNZA 5EZIL 1LO3H 3UGUA 4NOBA 1QLRA 3D3VB 3GJFB 2FWLB 5J13C 4DEWA 2A4EA 4OB5L 3HVNA 2XV6B 2P5EE 3QPQC 1QBML 5EU7E 2HFTA 3DO4A 4KKQA 1QR4A 4LIQE 4Y9EA 1N0LA 1ZE3H 4OD2A 2VZSA 5IHHA 5ESQB 4N2DA 5EEYA 2B1HH 2E6JA 1L7TH 3MV9B 3N1QC 4DVBA 2HJLB 2V9TA 2AV1A 3D06A 4NUMA 3T0BA 1ZPUA 1WFOA 1T0NB 3S35X 5AZEH 2WBWB 5FDWB 4PJFB 1J5OH 2ESVE 3D7PA 4F7TA 3SYCA 1VGKA 4RAVA 4G9FE 3PF2A 2BWDA 1G5GA 2DQCL 3U0TB 1EAOA 2E9BA 2I07B 4M8UA 5I6KA 3F12B 4LASH 2V7HB 1KB3A 1J8KA 3BFOA 1KENL 1EDYA 1TR7A 1YYLH 5T33H 2VDQB 4ADGA 3K80A 2AQNA 1RVFH 4FXKA 3U4KA 5ILTH 1DQLH 4FEMA 3UZVB 1LDSA 3OX8B 4G6JH 4JG1H 4QF1A 4POUB 4Y1AD 3TIEA 2AGJH 1JAEA 2BZ7A 2PW2A 3FSOA 3RWCB 3QPKA 5CEYA 3GM8A 2APTA 1RAMA 3V4VL 3WXWL 5D96C 2KERA 4C83A 2A73A 4QRRA 3DYOA 3NGBC 4OFKA 3F8UB 3SQOH 2JKSA 4M1CC 6FABH 5D5ME 4YDLB 4S1QL 3ZQWA 4K71C 4DPBX 3QYNA 1R34A 1LMKA 4YUEH 1I85C 3MN8A 5AVZB 1CE6A 4R90L 5DD0L 4RAUA 3AW5A 3MACL 4M6OL 3ZYOA 1FORL 1MCQA 3S36L 1T1WA 3DI3B 4GKLA 1JRHI 2GITA 4KJWC 3L5WB 4LESA 5B21A 3UPAA 3CFCH 3C6LB 1OP4A 2ED8A 3PL6C 3VFVB 4LF3B 3ESOA 3V9FA 3NCBB 2AEOA 1V5JA 1SF3A 4IMKA 3UX9B 1DE4B 4XZUA 4F9LA 1OCWH 4JHZA 4JPSA 2ZP0T 5DYOB 5C3LD 3JVGC 5E5RB 1UD6A 5G4OA 3GTTA 3U30C 1QLEH 1OK8A 4OZGB 1V7NL 1WBZA 3E7JA 3FTZA 1R9FA 4HCIA 3C60C 2J2ZB 2ADYA 3KPPB 2NY5C 4Y4KD 3QUZA 3APDA 3DO7A 3LXCA 2CIKB 5CJQL 1IC5H 3D51A 1QG3A 3HZKA 4JM2A 4N3UA 2XZCH 4Q8BA 2H26A 4P23A 2VSDA 4P9HC 1JSYA 4PCYA 3HBQA 4PY8I 4IOFC 2V9QA 3EZ8A 4BFBD 2Z8RA 3HRZB 4FD0A 3N06B 3L13A 2AJZB 3SYOA 1CLZH 1MFDH 3DECA 3RY5A 2RFXA 2FBRA 4P2RA 1U3HA 5TQ0H 4PJIF 1U9KA 2PO6B 4ZMXA 1GOFA 5IQLA 3ARFB 2X41A 1T89A 4Z7OE 2R2BA 4N0YH 4PRAB 4UCFA 4OD3H 2NY2C 1HL8A 1T83A 2PWDA 3GMMB 2ERJC 4G6AD 2XQYK 4HV8A 4F2EA 3GS7A 2YMTA 2B1AL 1RUML 2D0GA 2CH8A 4LLUA 1EV2E 4HIEA 1VFMA 3P4NA 4XP9H 3WNMA 1P5VA 4JCLA 4KY2A 3A67L 5F2FA 5DMIH 2MCG1 2FBJL 4JRXD 4LLDB 4OM1L 4X80L 3RI5F 3K6NA 4GO9A 2O5YL 3KPLB 3M6DA 3IDYC 2HYMA 1QHQA 4N2IA 4DEPB 2JFCA 2R69L 1U8MB 2XXGA 5EU7C 4ONFH 1XF1A 2AK1L 4I48B 5KUMA 4PRHB 1E9QA 5ALBH 5DFAA 5FKPA 5BZWB 4LLVB 1CMOA 2ZSWA 1A0QH 3FO1B 4HG4K 3QORB 4WWKC 2IAAC 1HILA 1KYOK 1J1OL 1KXTA 2EDNA 1DL7L 1DBML 2NY7H 3LNFA 1GSKA 3NCJH 3OMZA 1CGVA 4XVUD 3NFSL 4LEBA 3QIWD 3JWDC 4Y19E 2O6EA 3OGCB 3S34H 5HYSA 3VACA 3UBXG 3CFUA 5I0DA 2AFNA 3SPCA 1R5VA 4HFWA 1LO0H 2XBTA 2WQ8A 3G6DH 3L3HB 4QYAA 4PQXA 1GYUA 4F9PA 3G6AA 1IGCH 4FERA 2P5PA 1GMIA 4RGMB 4YR6B 3T9WA 4Q9QH 4Z5RA 3TEZA 2C26A 4PUBH 5BW7A 2J8UA 4LXFA 4P4KB 4MWFB 4U7KA 3KPSA 1MCCA 3V7MA 4KRPD 5IESH 2WQSA 1IAIM 1WCBA 2C9QA 4IRJB 3BP5A 4JG5A 4N0UB 3PDOA 2WXGA 2H1XA 2YPKA 1YEFH 3M17A 4ADJA 1Y18B 2D8KA 2YLKA 3X11A 4BFRA 5IMOB 2W88A 4XRCA 4N8PA 5AOKA 3H6AA 1BJ1J 1KIUA 4KNTA 4R7VA 4YC2C 4DUVA 2IBGA 1DN0A 1LWJA 3OR6A 1H3XA 4HEMA 3TA4D 2JJTC 1XD1A 1OTSC 2JKJA 3FONA 5KSBE 2PYEE 4WUKH 3VXNB 1XGUA 1UFGA 3U2JA 1RURL 4L5FH 1QPXA 3VXSA 3DV6B 3D6GA 1TTCA 5ISZD 2HN7A 4W9EC 5J1TC 4FFTA 1TJIL 2ICWB 2XDHA 2YZ1A 4WTQA 5BV7C 1DQDL 1EO8H 3MJGX 2UWEE 5C07D 3ZK0A 3EDDA 4C59B 3VWKA 3QZPA 4HJUA 3MBXL 2YHGA 2LV4A 3H9SB 4HIIB 4MHHG 2VDMH 2CKBH 3UG4A 2NTSP 3HVDA 3VXRB 4E41E 3KWTA 1ORQB 2BOBB 5HGDA 2JCCE 3KM1A 3LB6D 4FG6D 2O4EA 2W65B 4OGYL 5EUKB 1JGUH 2J5WA 1MFAL 4K5OA 5E8EB 5A7BA 4FZ8L 4U1JB 4Y9FA 3P2TA 1TQBB 4H2AA 1CG9B 3MOAH 3WU1A 4CU6A 3F6IA 2H1PH 3WLWC 3OHXB 1TTBA 3HC2A 3DUSB 1IQDA 2EIZB 5I0YA 4CADA 1MFBH 1A6VL 3BCFA 3LD8C 4X4KA 5IW6B 1R5WB 1JGDA 2FHFA 3C8KA 3PP4H 4ICXA 2AJUH 2QHRH 5G2NA 1J9QA 1UOWA 2K45A 2YUXA 3FOLA 4GB9A 2H45A 2CK0H 1C12B 1BFVL 4KO9A 5AOZA 1XMEB 1AGCB 4HHWA 5L6YL 3C5ZA 3FF7A 5L8JB 3B43A 4PJEE 2Y1AA 4FQQA 1ZS2A 3PGFH 1KJVB 2F61A 3QO1A 4ODHH 1OPGL 3VXQA 3SY0A 3KLQA 3US1A 3K8LA 3UFIA 3ZE1B 5DUPH 3FT1A 4ZFFB 2ZWSA 4EIZC 3PIQA 5I71B 1I8LA 1ND0A 3L08A 1KPUA 2ITDB 3PJSA 4YBHA 1UACL 1JE6A 1XAKA 4G7YH 1JPTH 2Z1PA 3IMTA 1D9KC 4KKLD 2FWOB 1TZGH 5DZJA 3WEXA 4OZHA 4RX4A 5DT1L 4IBWA 3KL5A 4MVBC 3SPVB 3NABH 1GGYA 4YXKH 2JVUA 3EO0A 2BNQE 3PQYB 3HE7A 4W4OA 3ZDXE 4DHLA 4IK7A 1PZ5B 4NKDA 5I66B 2G4EA 5AVTB 4X98B 4BCXA 4EKXA 1ICTA 4A2DA 1PD1A 2EUXA 4NQSB 3O2DL 2ZQKA 4R4NC 5I1HH 5EPMA 1L9RA 2AQ3A 2X70A 2GK0A 5FUCE 1RJZB 1UWXH 2L7QA 1EJ8A 1KGWA 4YHYB 3UTSE 4JL2A 1AGEB 1EZVY 5EC2B 2D0FA 3GF8A 4EJ1C 2CO7B 2BNRB 2VLJA 1URZA 5CR8A 5D9SB 4M7JH 4UT6L 3TBYB 4CNIB 7FABL 2NZIA 1RZ7L 2F5AH 1QABA 4LSRL 2YMXL 3ZGHA 4Z7NF 2X87A 3CVHA 2G0KA 1NFDA 2IADA 4JO3H 3U46B 4OT1L 4ZUUB 4HWBL 3VFWB 5EF0A 1WDAA 3EJQA 5HHOE 4PG2C 4RLDA 3QIUD 1A6PA 3QEQB 4GO8A 1PEWA 2VW4A 2BSDA 3CFKB 3AC0A 3V2AR 1BZ8A 3GPEA 2ARJA 2NCMA 4GI8A 5DS8B 3IPBA 4P99A 2CHXA 1QW9A 2EKSB 1HHHB 4ODVH 1IB5A 1UA3A 3FQRB 3QXWA 4G8IA 1KYAA 3KBPA 4MNGB 4KKAD 1MCIA 2F54B 3S3PA 4Z77B 4Z7UF 1YPZF 4ZFGH 3QNFA 1JWUA 5HTSA 4X6FA 1NJ9B 3KNBB 3RWDB 1A6ZA 5I9QC 2CQVA 4AITA 3RBGA 4CDGC 3OR7B 4NP4H 1J8RA 3D39D 1OE1A 4NUGH 3US9A 3D0AA 1JPGB 1AG6A 1INDL 2E7LC 4GKNA 2EE9A 3T65B 5E8PB 5INDA 1XXFC 2YKKA 5TPWH 1NPJA 3GLZA 2QVFB 2NY5L 3SE9L 3UTTD 1ZT1B 2VR6A 1U8PA 1JHTA 5FF6B 5ALCL 2WN2A 3V52L 2ZUQB 2L3BA 2J1KA 4GG6F 1N4XH 2ZOKB 3FO9B 1ZTXL 3AACA 1NCJA 4PPTA 4EI6A 3D48R 4F20A 5DXWA 1HQ4B 4CKVX 1IEAA 2P45B 2P8PA 4AT6B 3GB7B 1JS4A 3QCVL 3SYQA 1KCVH 1AGFA 4AYDC 2K7QA 2R23B 3VQLA 2Q8BL 3QDMA 2MRYA 4KKBD 1OL0A 1OE3A 5TQ2L 4HC1A 4OTXH 5A3IC 1T2QH 1OD9A 1XSOA 3I84A 3I6SA 4KVCH 2K4WA 1OK0A 5DTFA 3AREA 3H56A 4DFIA 1SHSA 3QEHA 2HX7A 3AS1A 1HJCA 4PJDE 3CN1A 1AG0A 1N0LB 4J3UA 4OD2B 4IIZA 3KBFA 2DQIH 3FFCA 1T66C 2GJRA 3K81A 3IFLH 3MXVH 4F57L 4J3XA 4UB0L 1ECYA 1OALA 3U0PA 4PD4J 2AV1B 2FX8L 4WTXA 5TFSL 5AAWC 2AF2A 3C9NA 3MOBH 3MUZ1 3R06A 1CFQA 2CD0A 1EZLA 3V6ZA 3P3RA 2EC9T 4MTMA 3K4ZA 2X4QB 3HI6H 4QKTA 2ZXBA 4JMNA 4F7TB 2BERA 2Z65C 3SQBA 1VGKB 1ZK5A 1CICD 5DQ9A 3HOGA 4AYID 1FE8H 1NC4D 4JKLA 1VZGA 3KXFA 3QHZH 4NQCA 1HAUA 2DD8H 2K0RA 4ORZC 3W9EA 4OD1L 2VLMD 5FUCC 4KPHH 1FGNH 4A39A 3H8NA 4DGYL 4LVOB 3HA0A 3OHMB 3JWDL 4LP4A 5B1JC 4ZT1A 1CFNB 1FG2A 4V2BA 1TOXA 4PW4A 4KV5E 5F7LB 2PW2B 5ID1A 4J3OH 1U8LA 4FXTA 5JOFA 4PSPA 2XRAL 1WAPA 3G04A 3TJEH 1D7FA 3HC0A 1X5XA 2EQDA 4XVTH 4QRRB 4C56E 4FNSA 4M93C 4Y5YC 3EYQC 2OP4L 5TDPA 2JIXD 1GTFA 4JM0A 4GSUA 2B15A 3BUPA 3HR5B 4YHLH 1S9VA 2GJ6D 3HUJA 2Q7YA 1JWMB 4XBEL 1S8DA 5E2UL 3QG7H 5F0LB 4NLAA 2HLEB 3EBIA 4UT9A 2Z8SA 1A3QA 3ASOB 4GRLD 3TV8A 5K93A 4RAUB 1W15A 2CHWA 4U6HB 5I5IA 4PBWD 1T1WB 1A7PL 4M48H 4MA7H 4TSAL 2E4TA 2PW1A 1GY2A 2DMBA 1B3IA 3A4AA 4B97A 3EO1A 4Z3TA 4XAKE 3ETBF 4XZUB 3P73A 1XR8A 2C3WA 1CIDA 3TEXA 4A6YH 4ZO7A 5BUPA 1YN7A 3MJ9H 5K1VA 1JNNH 3SDCC 2CUHA 3S48A 1WBZB 1D5IH 2Y07L 3NP4A 1PLGL 3IKCB 5HVHC 2YD0A 1JZGA 3IM1A 1MW2A 4GP4B 4HT1H 1CGSL 4MX7A 5KOMC 3DO7B 4R4BB 5CZXC 5J1AA 1Q0XH 2UYLA 3HZKB 5KYUA 3MA9L 2GTWA 4P23B 3ZR5A 1DJXA 3E3QE 1QWHA 4BFIA 4W4NA 4KKRA 2Q1EA 3FHEA 2X0WA 3I3DA 3L4UA 4GMSH 2BDNL 2PP9A 4NBXB 1GH7A 2RFXB 1NFIA 4P2RB 4BZ1H 1U3HB 2Z31C 3KJ6H 3PLYA 4K9EH 1BXXA 4BCYA 4KJQD 2QSTA 4U1MA 2IV8A 3HLAB 4FKEA 2R2BB 3BZ5A 3K6FA 1M7XA 3S5LB 4URTB 4TRPL 4X6DF 3SDYH 4TULH 4QI3A 3TO4C 1T22B 3FQXA 4HV8B 3QE5A 4J3TA 5CP3H 1CDJA 4AUJA 4LLUB 4HIEB 2HKAA 4KGLA 3P4NB 3HNTL 3OF6D 4AIZA 1P5VB 1BYPA 4AMXA 4JNXA 4K07A 3VSTA 2G60L 4UV4H 3H2PA 1REIA 3F01A 3FRUB 1SXBA 2FUTA 1UVQA 4DERA 3BZEA 1D5MB 1A9VA 1LILA 4WK4B 2CLZA 3ZKXC 4ORGB 1PPIA 3M1CA 5DLML 2A6DB 5CFAA 3A24A 3MTXA 3OKMB 1KB9J 3VVWA 2WWOA 3QHFH 3DARA 2ZWYA 4NQTA 1FVEA 1YEHH 2YK1L 4DKEL 1FC2D 5AAMC 4IRZL 1OTUD 2BW5A 4OSUL 3GMLA 4JE4B 1R75A 1HILB 5AZ2L 1TQUA 4PJXF 3MUUA 4CMHB 4KQ3L 1I9JL 4RMRA 5AVSB 1N64L 5HHMB 4WW2C 4LEXH 1ML0A 1AKJA 3WKML 4ZFZB 2A1WH 5D7LD 1JHLH 5B38A 4S0TD 4L37A 1GAFL 2WW8A 2F58L 4HZLB 1ZA3B 2RJMA 4UWQB 3GXFA 1R5VB 4ZAKC 1JPEA 3MJ8B 1JZ2A 2NT1A 1H9VA 3I75A 4LSUH 1A21A 4YE0A 3ATBA 4APQD 3FYEB 3DO3A 4M7ZC 1BQLL 4NNPL 4KI5D 3VGAB 4U3HA 2F8VA 3VI4E 4Z5RB 3D8MA 5IVXB 2J8UB 5DK2B 2IPTH 2W8CA 2XZQL 4PRBA 1CXIA 2BO0A 3H7LA 3KPSB 2ZZUT 4PRNA 4HULB 5CMAB 4E42A 4EZLA 2OR9H 3FT4B 1N3NA 2IWFA 4IDJH 3EO9L 2W9DH 4L4TD 4LDEB 4ZODA 1BBDL 4KKPA 2YPKB 2FGZA 4G2AA 5T3XH 4M1DL 4NRYA 4WKXA 1SN5A 3QRBA 4AEIH 5KSAD 5BMFL 5JPMA 2VN3A 3GHBH 5GZOD 4UNIA 3QR2A 4AGOA 1KIUB 1PSKL 2ZAHA 4WTWA 3US0A 4YSRA 1DN0B 1ILSA 2O6PA 1GCFA 3NTCL 3FONB 3IDIA 3QAZC 1FYHB 3ME0A 1IGFL 1BBJB 5JHLA 1Z9PA 3FN9A 1XGUB 1EAQA 4FKKA 4AQEA 2GSGB 3VXSB 3GRWL 2NMSA 3DOIA 4NQDA 2P44B 3GHPA 4EVNB 8PAZA 4J3BA 3W5MA 3K5RA 5IY5B 1A47A 1NANH 2PXYA 4ONOA 3F84A 2NNAA 2AHIA 1T7WA 1D5RA 3MV7D 3GRGA 1QMUA 3BDXA 5CJOH 1GW6A 2XNAA 3VWKB 4PCKA 1IQWL 5DRZB 3CBKB 4FABL 1NBYB 1KB5H 3D3VD 3PY9A 5HGDB 1OCRB 1KDIA 4L9LC 3ZR6A 5C71A 1CGTA 3OB0H 1F4YH 1AD9A 3OKOA 1U91B 4DAGH 4UTAH 2FR4B 4TUKH 3P4MA 5CJQH 4CRPA 2OCFD 3SJVD 2A9NH 3E3QC 3O2WH 3N85H 4JDTL 5JHDD 1WC7A 4DVRH 2FT8A 3QULB 4MA3B 1Z0NA 1MNNA 5HGBA 3L9BA 1RUKL 1IQDB 1SOKA 1ZTMA 1JF5A 3INUH 5H2BB 4B9YA 4CADB 1RH8A 1XGPA 2BVOA 3QQ4A 4UDUA 1M57B 3RVXD 2XG4A 3UBHA 2UXTA 1DUZA 1XH0A 3C8KB 3QNYA 4OFDA 5AVXB 4MD4A 1NOLA 1A1NA 3FOLB 1RSFA 4PWEA 3TOPA 2YC1A 4HS8L 4X7TB 3TH4T 3UO1H 3DV4A 5GS0D 1AHWA 3GMRA 3C5ZB 1W0VA 1QZNA 3BKMH 2EDYA 3PWNB 4FQQB 5GGRA 5D7IB 5FECB 4MQSB 1UM4H 4PTUB 4JO8A 1ADQA 1HTYA 1S3RA 3D18B 3QO1B 3ZTNH 3VXQB 3SY0B 2LE9A 3MRNB 1M71A 2OLDA 1GGBL 5IQ7H 5JORA 1KFGA 3HPLB 3N9GH 4Q2ZA 3WAKA 1CUOA 3BT2H 3D08A 1ND0B 4JRXE 4QO1A 2ZUYA 3OWRA 3PRZA 4L8DA 3NQIA 3PJSB 5GSRA 2GBAA 1TVDA 5EG6C 5BNXD 3RPIA 2Z4TA 4Y5XA 1NDMA 2V33A 4E5XG 1TO4A 2HUEA 3WEXB 2VXTH 4OZHB 4AIEA 1PLBA 1DANT 3D69B 1P7KA 3WUWG 1HFUA 3EO0B 2KDYA 3VXUD 3OAUL 4N87A 3WFHA 4F92B 5AW2B 4M6AA 5GRXG 4JFFA 1TJHL 4JQIL 2UZXB 4IHOA 3HC3H 5CSZA 5CZVL 1U21A 5FIEA 1CC3A 1H6EA 3UBFA 1IBBA 3NCWA 5EPMB 1GJUA 3CDYA 1ED3B 2GK0B 1GPOH 4NIYE 3GJEA 2QKIA 5KBKA 4EIBA 1OCZB 2F5BH 3JUZA 4UT7L 3SSGA 4XWOD 2X7LA 3U7WH 3FS9A 3SPGA 1MHPH 4MB5A 3L3DA 1I82A 2H0PA 2BSRB 2OMVA 2OXGA 2VLJB 3EH4B 4LDOB 4AW7A 1F97A 2HCZX 4M5YH 4MA1B 1NICA 4F93B 2RHEA 4CJ1A 4TUJB 1FYTB 1OY3B 5IMLA 4M43H 4A7UA 4BZYA 4BXVA 2VJXA 2CBTA 3CVHB 1DJGA 3DJRA 4MXWL 5ELIA 1NFDB 2IADB 3CUPB 3L9RB 3S3DB 3Q8BA 1HX0A 4KVNH 4L2LA 1DFXA 3ULUE 2HH0H 4DIXA 1KYUA 2QMJA 3WLBA 5CEZL 3KYMA 4XC3H 2PO6D 2LAGB 2ARJB 3LKNA 1P69B 1PMYA 4A7GA 3BYYA 2CO3A 5E9DA 5I8EA 3FSAA 1X5IA 1NGQL 1KIPA 1N8ZA 2BP5M 4EMZA 4G8IB 5C0GA 3BAYA 3CDZA 1AP2A 4U1IB 1SEQL 4JVPA 2WV3A 3B9KB 1KJMA 2F53B 2FJHA 2QPSA 4X6FB 1A6ZB 3OVUB 1OARH 3MRIA 3RZCD 3RGVA 2N7AA 2DKUA 5AG8A 3VI3E 5C07E 4PS3A 2OJEA 1D5BB 1EBAA 4QRPD 2QQKL 4L3EB 1FFNB 5AVWB 3MRHB 1J1XL 1IGYA 3FQUA 4GKNB 3JZYA 5F7EH 4HUVA 5GJSH 4UQ2A 2LQRA 1I8KB 4Y4KC 4FNLH 4MLSA 1AD0A 1YUHB 4GQ9H 1U8PB 4Y4HD 5SWSD 1JHTB 3ESNA 3OAZK 2E7DA 4K3EH 4B7LA 2FEEL 3QORD 4UMGA 4WEEA 4KO5A 2ZAIA 3Q9PA 3WIFB 4OKDA 3OQ3B 4NM8L 1DEEB 3CU1A 4ZK8A 2J88L 3TT3H 1MHHA 4EI6B 1P4UA 4PLJD 4X6BA 2P8PB 4OZIA 3QI9B 3ISWA 4U33A 4LCWA 4LCUA 3IVKA 1AGFB 4KHXL 4G59C 3R0MA 1NSNL 1B4JH 2WO4A 4PD4K 3BWZA 4KQ4L 4ZSOA 3PUUA 2VW6A 1P84J 4KXAA 5EO0B 1I1YA 3H9ZA 3L8QA 3QFDB 4G6AC 4P2YA 1MCLA 3UTPD 4XPBH 5ITBH 5DFWH 3M88A 4G71B 1SUJA 4MNQA 4BQ9A 3HS8A 1CBVH 1X5YA 3QEHB 4GT7A 2IGFL 4BKSC 6CGTA 2OMBA 1F5WA 3NUKA 3FFCB 4YEEA 3QJQB 4Z18A 3UIYA 1DLFL 2QDVA 3NIGE 3PFUA 4HDIA 5IOPA 1K3IA 2WQRA 2IANA 4WCYH 5HY9A 3O6FA 4AI7A 4K7FA 3C9NB 3W81A 4YLCA 3DOSB 1YJDH 4OCRH 3V6ZB 5I6MA 3GINA 2H47C 4PJ5E 1M2VA 3EFOB 1J5DA 4EO5A 2Z91B 4AG4L 1MFNA 3VYPA 1E4WH 3L5JA 3SD5A 1CFSA 4NQCB 3W9EB 5H37G 4ZFQA 4XVUC 1SBSL 2EH7L 2JWYA 3QIWC 1I1AB 2YA0A 4N2EA 4NHUA 3FUKA 1FG2B 3BKCH 5CILH 1PGRB 4FNPA 3UC0L 1BVZA 1U8LB 3G5VB 1U93A 3O2VH 4ZMZA 5JOFB 1LHZA 4K94H 3FAWA 4LL1A 4A2LA 4S0SD 1E2VA 1X9UA 3G04B 3QEGH 1TJXA 4KH9A 3V4LA 5DJYA 2NLJA 5CD3B 4L8SC 1KIRA 3L1OL 1JFQL 4I77H 3QA3A 5TDPB 4NWUH 5SWZA 3DUUA 4NGHH 4KRPC 1S9VB 3IJ8A 3QUYB 3L17A 1S8DB 1NMCB 2WLIA 4M00A 5J5EA 5GGQH 4M7KH 2Y72A 4AXWA 4HWZA 4Z7QE 4AUYA 1FO0B 4WFHD 5EEWA 4U49A 5T1JA 3K2IA 3DX4A 2PW1B 5GGSY 3R18A 3EO1B 4ZQKA 1KTRL 1XGRA 2F8XC 4HXBL 5FYJE 3TA3D 5CBEA 1BIHA 2FX9L 5DO8A 3DOHA 1GIGH 1O6TA 1XR8B 1IM3A 4XX5A 2GJZA 1EUUA 4WJ5A 1DQQA 1MREL 1YN7B 4HH9A 5D2LB 2H41A 3MBEA 3VG0L 4B9IA 2Z4QA 4ZW7A 4DEUA 1BVNT 3ZE0E 2O5XL 4G6FB 3I02A 3REVA 4KDTA 4PBDA 2F7RA 2HTLD 1AC6A 4MX7B 2DMHA 3CG8A 5FGCE 5J1AB 2UYLB 4N2HA 5IVZA 3WFEL 2GTWB 4I89A 2OSXA 2YKLL 4BFIB 4XMKH 1U8HA 2IDTA 1A8JH 4MYWB 3FQ4A 2FIRT 4FG6C 3LB6C 4K3HA 5EZPA 2A3TA 1MCJA 2Y7SA 2ROXA 4OZFB 1IGTB 2NX5A 2UZIL 4OU3A 3UTTE 4OI8A 2YUWA 3OKYA 3T6XA 1NFIB 2H8PB 4PJ8A 3U4EA 4D94A 4ALAC 2VDLL 1KGUA 3GZKA 4LVNB 4RQQA 3CVDA 2YEZB 3MFGB 3BAEH 4DKFH 5FUZH 4ZMNA 2RCSH 4U1MB 1M53A 3D2UD 3QJOA 2DQFA 2JKNA 3E9TA 5DD1L 1C1EL 1Q9KB 5E95B 3TT1L 3FQXB 2HMID 3S37L 1TJGL 3ESUF 5B1BB 1E7VA 4AENA 4JY5H 2G2PA 1BLNB 2ZP9A 2WY3B 2JF1A 1XZ0A 2WVSA 2XYCA 1SQMA 3GXNA 1MRCH 4LGPB 4MB4A 4XPFH 1UVQB 4NO5A 3HG4A 3TBCA 3QK0A 1TETH 2YIHA 4MJ6A 3TS8A 3BZEB 1IBFA 1OZUA 3LJ3A 4XNMB 3I74A 3T1FB 2IJ0C 3U79A 1Q9WA 2CJTA 1TQCB 2EDEA 1FNHA 1J9TA 1AXSA 1WUZA 4DGVH 2HLAA 3B7TA 3X13A 4L18A 1O7DC 1FVEB 2ZP8A 3NN8A 4Z7VA 1QI4A 1QTSA 5BOPA 5BO0D 3S5ZA 1WF5A 3GMLB 1B4TA 3DJZA 4ZPTB 5E4EC 3FU9A 4KKLC 5EZIH 5GGVL 4CC1A 2HAZA 2QQNL 4U3SA 2X6CA 1AKJB 4PJHA 4OB5H 2DWDA 3DTXA 3QEQD 4L1BA 3C09B 1PNDA 5B38B 1UZ6F 4GXVL 4L37B 3DX8A 3OKNA 4E0RA 1SJMA 5FO9A 3MLRL 5E00A 1R4XA 1NCBL 1SMDA 3CPUA 4GAAA 1EEZA 1IJNA 5IJBC 2C4XA 4YHOL 2DLTA 1YN6A 2VLME 1QSEA 3GRBA 2PPCA 3ORJA 1N59A 2Q10A 4KUCF 4PRBB 3TX4A 1OO2A 4OKVA 4PRNB 2EO9A 2MNUA 4E42B 1XGZA 2IMMA 1I1FB 2ZNWA 7PAZA 1N3NB 1AVAA 3UGEA 2EIJB 2YR3A 2FLMA 4MAUL 4OFYD 1P7BA 5FHAL 5HYJA 3QQ3B 4Y1TA 3BESR 1J86A 3U6XS 3VXTA 1T0MB 5CU9A 3WS6C 3FB8B 3KWXA 9PCYA 4E9WA 1KENH 5I75C 5G5DA 2FVNA 3VD2A 5JPMB 1TDQA 4I3SL 3APCA 1T4KA 4FXLA 4JFEE 1NIAA 2YZ8A 5BZXA 3T0DA 2P7TA 1J0IA 1Q0EA 4X99A 5D7EA 2DYPA 4CVXB 4JQVC 2FCBA 4X5QA 3LNHA 3V4VH 1P7QD 3ME0B 4XOEA 4JVWA 3RWIB 2XFGB 3WXWH 4U6YB 4JGUA 3L7FB 1QPKA 35C8L 4AQEB 3QIUC 2APSA 5CGTA 1Q0YL 5E6ID 5AWNL 3MZTA 2KZBA 4WI0A 4S1QH 4N4YB 3HR6A 3JTTA 1OSEA 2PXYB 5FWQA 4DUWA 2NNAB 4M56A 4Y5VA 2YAMA 3CZUB 4KO7A 3Q5TA 4KQ0A 4K7PX 4JREC 2XNAB 4R90H 1MWAA 5IB2B 3MACH 4M6OH 1FORH 3S36H 5I30L 2YBRA 2WUCL 1AD9B 1MZYA 5FOBA 5IMKB 3WI9A 1JFHA 5K59E 1OW0A 1WC7B 3QDGA 4OVVA 1QSVA 2VCOA 5HGBB 3GHEL 4GXUM 1ZLEA 5DD6A 4FCAA 1BD2D 1DBJL 1S7TB 1V7NH 2FSEA 2P46B 4Q74A 1XGPB 2BVOB 4UDUB 2VDRB 1FL3A 1DUZB 1U58A 3QNYB 4HEPG 5AENA 2G30A 4GLRH 1FWXA 4MD4B 3LZRA 1OF2A 1A1NB 3GMQA 2HLFD 1KCWA 2ICEC 2YC1B 2X9YA 1YDPB 3DV4B 3JWNE 3LQAC 4HZAA 4XCNA 4XE5B 1AHWB 3GMRB 1W0VB 4XNQA 3QXUA 1OEZW 1X9QA 4HKXB 3BPNC 5GGRB 5F1SA 1DCEA 3FK3A 4EI5A 5A2IH 1NPUA 2HKFL 3DBXA 1M71B 1XL4A 4TSBL 4MFHA 2FJSA 2E4FA 3NFPB 4JLRA 4WU7A 2WPGA 4KKBC 4LSDA 4Q2ZB 4QO1B 3P02A 1RZQA 2AW2A 2XWXA 3KPQB 5GSRB 5JHBA 4WF7A 4PGCA 1P5UA 4QRRD 4G7VL 1IT9L 4UIMB 4NSKB 1NDMB 4O4YL 4HIQA 3FU6A 1RUMH 2VMJA 4DPRA 4ZMQA 4G80A 4BWTA 4JM4L 1OSZB 4UOQA 4N6QA 5I26A 2D3JA 1A65A 2FBJH 3CHQA 4LQ1A 4X80H 4IHOB 4OM1H 4YZFF 5J6SA 5CSZB 1OM3H 4DUXA 2ZX7A 1OANA 3QUML 5TH2A 1DVFD 2HG0A 3B5GA 4U7MA 4P2CG 5IWLA 2R69H 1DLHB 1QVOA 2IQ9H 4LAJH 4BE6A 3RTQA 1AS6A 4ELMA 4G5ZL 1MLCA 3GJEB 2QKIB 3U1SL 2AK1H 4YSQA 2Q76A 1CICC 3D4GA 2QZQA 4KK8D 1EO7A 1TZAA 2CDEA 2OMVB 1J1OH 4GFXA 1DL7H 5CN2A 1DBMH 4RAHA 2LLNA 4KI5E 4XBPB 3MLZL 3RQ3A 4DK3A 2ITEA 2CJ3A 5G55A 4AJYV 1GYVA 3NFSH 3QUZD 3RZWA 4AZUA 1S46A 2XV3A 4JM2D 2JB5L 4P23D 3VFTA 3HMXL 4K3GA 5HYEA 1BX2B 2EVFA 1FLRL 5C09B 2UZPA 2IWEA 4L4TE 5GGUA 4H2CA 2ZG2A 4WFGE 4WTZA 5F7WC 4HIHA 4PJBA 3C2SA 1HHKA 5BRZE 1W2KT 2DF3A 4KMLB 5JW4N 4LPCA 5DCCA 1JTPA 1U3HD 4P57A 3WLBB 3KYMB 3ATEA 2VGLM 3HS9A 3MNWA 3VU2A 1XFPA 4Q89A 4UILH 4F8QA 5E9DB 5I8EB 2OX5A 1U95A 3BDYL 3SCMA 3SDXF 4FLSA 3B2VL 1C5BL 1KIPB 4PGZA 5IB4A 2BMKA 3CDZB 4PJ9D 1AP2B 4B5EA 2A4CA 2LGNA 1XH3B 3R19A 5HDBB 5D71L 1OAUL 3CN3A 4WUUB 5HPMB 1VACA 3L7EA 2H0EA 1PFOA 4BH7B 3MRIB 1N5AA 2DICA 3RGVB 5HVGB 3MV7E 3D30A 3CZJA 3STLA 2OJEB 2D4FA 2VDKB 4WEBL 1IGYB 3FQUB 2DIBA 3L48A 4WHDA 1WITA 3VQ2C 1RURH 3D3VE 1WSST 5F7YC 4HUVB 4UQ2B 2DS4A 3IWVA 1O75A 4XNDA 1BVKA 1IUZA 1P84K 1TJIH 5K5YA 4TL4A 1NGYA 3STZA 2XWZA 4PR5A 2RTTA 4GP5B 1DQDH 4ODXB 3SJVE 1V3MA 3PAZA 3L54A 3MV9E 3D0LA 4I18A 3MBXH 4NPYA 2ZUSA 2QSVA 5FYJU 1CS6A 3ILEA 1QHOA 1UD8A 1FSKB 5F7MC 1MCNA 2QDWA 3MNZA 4QT5B 4X6BB 2Z8VC 2FBOJ 4OZIB 1XF3A 3GTNA 4OGYH 4LCUB 2B9BA 4PJFE 4W93A 5EORL 3IVKB 2JKRM 4ALAL 2VZUA 1GZPA 4FZ8H 3JWNC 4J1UA 5IFAL 3JT0A 4KJQC 1EEYA 3GS4A 4BA8A 1HCVA 2M83A 1CBJA 2HVKA 2AQ1A 4X5WA 1A6VH 3QG6A 1CIUA 3QYMA 4A7VA 3SGEH 2WXNA 2WKLA 4MNQB 1SXCA 4GFTB 4MMXB 1NEZB 4OH2A 3KPSD 1ET8A 2BFVL 4MJ4A 1BFVH 3MLSL 5L4IA 1VZHA 1IARB 2BWIA 2W91A 3T8XA 5L6YH 2OZ4A 1KG0A 1UB5B 4PS8A 5DVLA 5IOPB 2K6YA 2DMCA 5DHVH 2CHNA 4JJHA 5HY9B 1A8ZA 3SPIA 3LN5A 3O6FB 3U36A 4K7FB 5CAYB 2HKHL 3H85A 4H1LH 1OPGH 4ODTL 1P9MA 4GBXB 4Y8DC 5LAPA 3AAZA 3ULVF 3QUKA 5DUBA 3S5LG 4R4FL 1M2VB 1OTUC 7PCYA 5T1LA 2V2XA 3NJNA 4J8QA 2Y3AA 2YN3A 4QGTA 1F0LA 2IAMA 2WXPA 3ARWA 1UACH 3ARYA 4TQHA 3OG4B 3OZLA 4WLCA 1BG9A 3QUXD 1W0WA 2WLLB 1FNAA 3PWLA 2WNWA 5DT1H 3H9HA 1EHAA 4A55A 1PY4A 1G0XA 1T7ZA 2I9LA 2VDPB 3ZVVA 1U93B 3JTBA 3LN4B 1NKGA 3V5HB 2ZWKA 4APQC 3S4SB 3K6SA 1SHXA 5TD4A 4KI5C 4JFWA 4OZGE 3O2DH 4G7QB 3BQUA 4JPQA 3L9EA 2ESVA 3ZE2F 5FGSA 3AQYA 1LEKB 2XXCB 4YSUA 5SWZB 3RU8L 4G9FA 2QVTA 2R0KL 4ZUVA 4K2UL 2CCVA 4KXBA 5BOZG 4CGTA 2WLIB 5FLUA 2B59A 4AXWB 1GZHA 4FTVA 1QP1A 1YNLL 3T6QC 5H35A 1DQML 5KSAC 3IJHB 3NJHA 3Q8FA 3BH8A 4PLOB 5GZOC 4UT6H 2V0AA 3I85A 2YPLA 5DK0A 7FABH 1V05A 4AUUA 4ZQKB 1RZ7H 3N40P 1XGRB 2NXZD 5CBEB 2R59A 4LSRH 4QAWA 2YMXH 3NIFE 4HKZB 3QS3A 4IKKA 1C8PA 5I17A 2GJZB 3AQXA 4WJ5B 3V6BR 1DQQB 4OT1H 9CGTA 1JL8A 4HH9B 2R29L 3MBEB 3LZNA 3L4CA 4HWBH 2EDXA 2Z4QB 2OQJB 4GIAA 2EUVA 1BFSA 5FX3A 3MROA 3RRQA 1U8CB 3UBXI 3WTXA 4UANA 3G5ZA 3SGJA 2BVTA 2WKOF 5FYJL 3I02B 5GS2H 1RK0A 3REVB 5D7JC 4BQCA 5CS7A 1T6VN 1VCAA 5DVOA 1H8NA 1JZ3A 2J25A 4HMEA 1QW8A 5TF1L 1XGTA 1NGXB 4ZMTA 4NN7B 3L1EA 2Q6WA 5CCJA 5E6ZA 3RUGB 1PL3A 2IOIA 3T4AB 4ZZFA 1JGLL 2CMRL 4AQ1A 3MRLA 4RX4D 4GIPD 2QL1A 1G1CA 4X5RA 3TC9A 3LHPL 4PRHE 2RIKA 3HE7D 4DTGL 1H0DB 4RQQB 2KC0A 2NYKA 3LEVL 4JFDA 1B0RA 4XCFL 2DQFB 3CFIC 4I7ZC 1INDH 2WTOA 2XWEA 4WU5B 3RVXC 5BZZA 3DLQR 1Y0LB 2XV0A 4O58L 2NY5H 1SXNA 2FB4L 3SE9H 4R26L 2W9EL 1A64A 4WGKA 1TCMA 1YSOA 3MA7A 3NSXA 5ALCH 5GS0C 3V52H 3LQAL 1MAML 4GAGL 1XZ0B 1G6RA 1ZDSA 1QASA 4LSSL 4S0HA 1ZTXH 4FULA 5DJZB 2VLJD 2CA4A 4NO5B 4MJ6B 3UTPE 4L0ZA 2IC2A 4ANVA 2H4EA 1KXVA 3CTTA 1Z9SB 3QCVH 2GFBA 2HLAB 4MD0A 5CD5D 3CSGA 1YEKL 4QKXB 4V1DD 4MHHI 2D4DA 2GJJA 5HYQB 3NN8B 2Q8BH 3T0EA 4N0UE 2XV2A 1Q94A 2VLRA 2YQ3A 5TQ2H 4OJCA 4BM7A 5HBBA 3QQNA 3V10A 3QUHA 4U3SB 3O3DB 3CPLA 4YDLC 1WYJA 4PJHB 2VR4A 2DWDB 3DTXB 3WEOA 1AMYA 4N0CD 4XMWA 2ZAGA 3Q1EA 4M6ML 3DX8B 3OKNB 5EO1A 4E0RB 5FO9B 4H13C 4YO0A 3FU8A 2XN9B 5E5LA 1MCSA 4AL8H 3DYPA 2YEVB 3QWRA 4HAGA 4F57H 4UB0H 5DD3H 3DX0A 1YN6B 3AT9A 2FX8H 5TFSH 2OW6A 4AV4A 2VAAA 1QSEB 4LIQH 1TIUA 4UYQA 3ZRSA 3NJXA 2JTYA 4LOFA 1AZBA 4IKNA 5D7HA 4EN3A 3MCG1 4LSTL 5HDLA 1OWRM 4XWOC 4D0CA 1KV7A 3FOMA 4OKVB 1ACCA 4UQDA 3V4PL 2N7BA 5CLWA 4O5LH 4AMWA 4DSYA 3H9SE 5HYJB 4MMYA 3VXRE 5G4MA 1TU2A 5FEBA 5G5DB 4OD1H 1A1MB 3I6KA 2G4GA 3T8MA 3FW6A 4DGYH 2MQ3A 3BC9A 3JWDH 4JFXA 1T4KB 1MAJA 3N41F 1JCVA 5GGVY 2FSDA 5EC1A 1OT1A 1OQOA 1Z5HA 4QMEA 3OJMB 4X99B 2JKIS 2DYPB 3D5OF 1MFMA 3U9WA 1XO8A 4JDZB 2XRAH 4ZTPH 1OAZL 1N5YL 3O6ML 1XEDA 3L3OB 4EPSA 3RFZA 4ANUA 2OP4H 2PO6C 4WSJA 2CUMA 4ATTA 3JTTB 4XBEH 5E2UH 1YEDA 3QDMD 5JIMA 4W68A 2DI8A 1YYML 4AQZA 1MWAB 5EUOA 3CX2A 3PAVA 3H6JA 4BZ2A 2XTJD 1A7PH 5I0ZA 1QUPA 4TSAH 3ARED 5BS0D 3KG5A 2I9TA 3ZE1E 2PWGA 3QW9A 3RZCC 1AQDB 1GS7A 5FOBB 3KDMA 4K3JL 2I32A 5ABZA 4AK1A 3QDGB 5EEZA 4O9HL 3V0EA 5DD5L 3TBSB 2DOCA 3F7PC 5D7IF 3RA7L 5E5UB 5FM5M 2XA8L 2Y07H 4Y4HC 1PLGH 4R0LA 1COBA 1XR9A 4X5XB 4PJAA 1CGSH 1TVHA 3DI2B 3EF4A 4WHYH 3PQYE 1J05A 3QORC 1EHLL 3MA9H 3WN5B 2ZPKL 3RY4A 3LZPA 3I3BA 4XNQB 1EPFA 1R5IA 2JCCA 1KF9B 3D85A 3KXFD 4G6MH 3F2LA 4NQCD 4PLJC 4PJGA 3C08L 3OQRA 4TUOA 2BDNH 1TEFA 3SOTA 4EI5B 2Z3FA 4HUUA 1I3RA 2FJFA 3DBXB 1W0YT 1U2HA 4WWOA 1HCFX 4LCIL 1II4E 4PRID 5FS5A 3E2HC 4JLRB 4MQ7A 4IU3A 2I60L 2XIIA 5T3XD 4S1RL 1I9RL 3IMSA 4AYFB 1FFOA 5H4ZA 4TRPH 3PWVB 1P5UB 3I6GA 5JPNB 4LAQL 3X3FL 4C4BA 2DJUA 4FFWD 5K39A 4NOFA 3MX0A 1ZJBA 4NQQA 4JGNA 1G5AA 3HNTH 5IMMB 4FA8A 3NEOA 3WY4A 1ZPLA 4J8RB 2G60H 5L4FA 2APWA 1M7IB 5KS9B 2FDBP 4M62L 3HAEH 1FAIH 1BOYA 2DQUL 2GHWB 4M02A 4V11A 1RJYA 5DLMH 3QEQE 1QVOB 2VSMB 4JJ5B 3LRKA 4ELMB 3RTQB 4BFFA 3GGWB 2ATAA 1MLCB 1I3UA 5EU6B 4GW4A 2EABA 3ILPA 2YK1H 4DKEH 4IRZH 4UTBA 4OSUH 1HL9A 4RDQG 5AZ2H 1OM9A 2PCPA 4MNGE 4KQ3H 1EAPA 3Q2VA 1I9JH 4G6FD 1A7RL 1N64H 3LIZA 5CEXB 3WKMH 3KW8A 3WNLA 2MCPL 2J5LB 3LNGA 1ITBB 1GAFH 1I8AA 2YFOA 3KPMB 3QC5X 1T1XB 3QNXA 4HA1A 2F58H 4NO2B 3ZL4L 4L23A 4AMKL 5GGTA 3A4EA 5B8CA 1AIZA 2C7UA 3K0YA 2QADB 5E1AA 2Z0BA 4DN4L 4BSWB 1QOKA 2F19L 4HIHB 4PJBB 1HHKB 2WP3T 2ZX9A 1BQLH 3ZDZF 4ANWA 4JZJA 5DC9B 2X53A 1EGJH 4IGBA 5T3ZD 2XZQH 3EDKA 3LPFA 4LOVA 1X5AA 2OX5B 1U95B 5BPPA 3PU7A 4W9CC 3EO9H 3S97C 2W0KA 5BVPH 5EF3A 1J5CA 1BBDH 3F64A 3CBRA 5D6CA 4BELD 5IB4B 1JCKA 4M1DH 5TDOB 4JPWL 1XF2B 5BMFH 4PB9L 3TA3C 1GVIA 2YPVA 2ZKYA 2DYSB 4QLRA 1PSKH 4BWUA 1Q4NX 1KY6A 1LP9A 3SKMA 2XY1A 1KOAA 2GYSA 3NTCH 3STLB 2EDRA 4AJWA 5IHWA 2OR8A 1IGFH 4A2EA 3RHWK 3VSVA 3VYOA 3ALPA 4UNUA 3RKPA 3EGDB 3T1WA 4FYTA 3GRWH 1J5HA 1P4IH 2HTLC 5MHSD 4ES9A 3IS0X 3ZDYF 3AB0B 4WI2A 2Y5TA 4URKA 3QJHB 1NGYB 2W60B 2WQXA 3BUYA 1FH2A 1ROWA 4PIBA 3P69A 3D0LB 4I18B 4XR8C 3PAUA 1IQWH 4NPYB 4Q52A 2WMPB 4FABH 2D2CC 5JHAA 1BFOA 1JHKL 4P2OB 3MNZB 4K0OA 5I76A 5KEZA 1XF3B 3MRGB 4JG9A 1OAJA 4M5SA 1NM9A 3X1NA 5DLLA 2AXJA 1GZPB 1IKFL 1EEYB 4OGAD 4JDTH 1KEML 5C3IA 1IC4L 3OXRB 5LWYL 4HGMA 2HVKB 1NIEA 2D7PA 1J8HA 4C57C 1UD5A 3OKDB 2Z93A 3MNDA 3OAZH 2HMIC 4N8VA 3NJMA 4LDCA 4P04A 4DP5X 1EQWA 2A7BA 2FEDD 2ICCA 4G11A 5GS0L 1JIBA 5HHXL 4HS8H 2FYVA 4XN8A 1NMAL 1BSIA 2CO6B 4F7EB 3P4OA 2HFFB 1QEWA 2VDQL 4PMFA 2J3SA 4OZFG 4QRRE 3LN5B 1EERB 2NW2A 2ZOWA 1EHKB 3HS0A 1OKEA 5D55A 2AJSL 3T4YB 4Y0GA 1GGBH 1RCYA 1E5CA 5DUBB 3REWA 1A4JA 2IQAB 3HNVL 4KO6A 3WCYA 2YSTA 2V2XB 3ARGA 3HKFA 1KGXA 4C58B 4M5TA 5DJAB 1PG7W 5AKSA 5F88B 5I73C 4NQDD 2ZICA 1NCTA 4R5VA 4B5ZA 2EDKA 3PWLB 4UOZA 4MRBA 3H9HB 2PXYD 2MNJB 3P3YA 4XN4A 2D0HA 3OAUH 4KTEL 4Y4FA 3B83A 2OYMA 4CVUA 2Y36L 3KVDD 3U4AA 1TJHH 4JQIH 4FLQA 1SJEA 5CZVH 3AXIA 4PB0L 2AJ3B 2BY0A 3BQUB 1L0PA 3U9UB 3F65A 5JMRA 1C5CL 1MDAA 2C3XA 3EYOA 3Q6GL 4U1HB 3V0FA 3HB3D 3KJ4B 3KBHE 4U7SA 3KGSA 3QCUL 4RMTA 3MRFA 3W3BA 4EAEA 4UT7H 1WG3A 3CVIL 3ZX1A 2B59B 5D2LF 4FTVB 3IU4H 5I0XA 4CC4C 2ZWZA 1HH9A 5H35B 2YUZA 4H8PA 1CK0L 5B38G 3BH8B 2UY7A 2YPLB 4P2RE 4WO4A 1LO4L 4EZKA 1IVTA 3X1EA 5I1DB 4IIQC 2X1PA 4MXWH 5I17B 1AHMA 4XNZC 1NUFA 5MEOA 4PRPA 3QXDA 3N40F 3BVDB 5E6IC 3TBWB 2YD5A 5IEHB 3G5ZB 5F1IB 3H4FA 2ZE0A 1S3KL 5I0WA 2WZPA 2VE6B 3GMNA 5A2JH 3BDBA 4ELDA 4AOFA 2L7UA 1NBQA 1RZJC 5EU5A 3K8MA 1XGTB 3IGAA 1HCZA 2IH9A 2Q6WB 2NQ3A 1NGQH 1IAKA 5JIDA 1LE5A 4PVMA 4PS7A 4N1CA 1J48A 5ERWA 4AQ1B 2I25N 1M1SA 1SEQH 2OJ1A 3LY6A 3MRLB 3EJYD 2WO3B 3GJFK 4HSQA 4XNYL 5IHZA 3ZPDA 3D07A 5DFTA 5C0JA 4JKMA 4QHMA 3CN2A 1NQBA 4AM0Q 4JFFD 4JFDB 3HTLX 2NY3B 2QQKH 3B2MA 1MIML 1R1CA 3FTXA 1J1XH 3WEBA 1RPKA 1QHPA 5FCUL 5HHME 1VZIA 1MHCA 1WGVA 3VDBA 2A74B 3Q0HA 2HLFC 3G08A 4F80A 5C0CA 3CLEL 3MA7B 4BQ8A 4IRSD 2V3FA 1G6RB 4FN0A 2OXHB 2LR4A 3F5WA 1BQ5A 4NM8H 4KMTL 2J88H 4JO1L 1KBGH 4LVOC 1UM6L 4FXKC 4ETYA 5FA4A 4WI6A 2J8UE 3UOAB 5FK9A 2EIMB 4OCMC 3SPHA 2GFBB 4AC2A 1GYWA 3KPSE 2BSSB 4Q4IA 4KHXH 4MD0B 3ALWA 1HK6A 1NSNH 3GEFA 3LIUA 5ESAA 3T0EB 3GMOA 3LAFA 4YFDB 3BH9A 4KQ4H 5T5NG 4UUJB 3DX7A 1H8LA 3FRPA 4KFZC 1O9WA 2BP0B 5ABAA 2XC8A 3NIDB 2J56A 2IBZX 3N43F 2X4UB 3W5NA 3ZT7A 5A7EA 5EO1B 3FCUB 2VZOA 2Y1VA 4HEME 2IGFH 4L1HA 4YO0B 4UQIM 5BXFB 4PLKD 1MJ7L 2R1WB 3IJSA 1DLFH 5T1MA 2DEYX 1UCBH 2WWKT 1DVFC 3PG2A 1IKNA 1JERA 3VXSE 3RL1A 4DP6X 1LK3L 2VAAB 2Y6SD 3EBHA 3IXAA 1W8OA 1G0DA 1TEGA 3BPCB 4UZUA 3ZMRA 4IMKC 3QDJA 4EN3B 3RGVD 4KK8C 3R0NA 4D0CB 3FOMB 2V3EA 4GUQA 4AG4H 5CIPA 5LN4A 3VX1A 3S98A 4HUCA 1MELA 4FS0A 2FRGP 2NXYB 1HH6A 3BHBA 2W0LA 3QUZC 1SBSH 2EH7H 4O02A 4KMQA 3VFSA 4DOHB 15C8L 4QHNA 1A6AA 1GYCA 3SDDB 4JM2C 4P23C 1YYCA 3NCXA 3G5XB 4DGWC 2GAZA 2A5UA 3LTVA 2IOOA 4Q4EA 1MJ8H 1RKRA 5T5FA 2EXWD 5IM7A 1AANA 4GG8A 1SVZA 4OLXL 1TLMA 4YFEA 2PLTA 4ODWB 1U3HC 3L1OH 3RFZB 1JFQH 4LCWD 1AY1L 4XHQA 4XXCA 4J2QA 3IN0A 4FFZA 1OTTD 1FNEA 1T89C 2GCYA 3RX9A 3O6KH 4ODSL 4OV6F 4NQEA 1TZIB 1YEDB 4YWGL 5C0DA 5I8CA 1H3VA 1T83C 5DZ9A 5BQ7B 1A3ZA 1B9KA 4PJ9C 4O2FA 5EUOB 3G5WA 1OLLA 4NN5B 4P3CL 4EDXA 3BKYL 1UJ3B 4NFDA 4MNQD 2VC2B 3FT2B 2ZWLT 4HXBH 2X1XR 3WAJA 2FX9H 4D8PA 3V6FA 3WY3A 2BOCA 5D4IA 4XO5A 4FQHA 2J43A 1MREH 3VG0H 2IAND 2EECA 2VOTA 3CZEA 3O6FD 3FUIA 2C1PB 3UERA 2PCFA 1ZHBA 2O5XH 4MASA 1CF8H 4OZHE 3W57A 4EZJA 1JD7A 4R0LB 5F7KC 1EBPA 2WNXA 2F6AA 2OMWB 4PJAB 1TVHB 4K4KA 3UBXA 1X6LA 1J05B 1RU9L 3WDJA 3GZQA 3WFEH 4NT6A 4BGLA 2XACC 3HG1B 1R5IB 4OV5A 1SY6A 4ZO8A 3DK2A 1J5OL 3EGSA 5CSBA 4PJGB 5E70A 2GI0A 5LQBL 5FHBL 2B39A 4N2FA 1OHZA 2UZIH 1I3RB 2BCKB 4NFCA 5GRWA 3NQKA 4M9OA 5SV4A 2AEIT 4PJ6A 3HHRB 2CPUA 5EIIB 3AU1A 2VDLH 1YYLL 1V55B 4MQ7B 4P2QA 3DIFA 4F9PC 2VLJE 4HU8A 1FFOB 3B34A 1M56B 5DD1H 1C1EH 1S7WB 5BW7C 3IPEA 4TNVK 1NTDA 4TM9A 3TT1H 3O45B 1WAEA 1FYTE 5ABDE 4L0PB 2WLKA 3EW3B 5K39B 1TJGH 5SWZD 3S37H 4BK5A 4BK4A 1V54B 2NNRA 3SGDH 1E65A 5I1GL 1NFDE 1ZVHA 4XBMA 3GO1L 1W91A 3ETSA 3NJIA 4D3CL 4LDLB 5E1IA 4R8WL 2DL2A 5A2BA 1UGNA 5K33A 6FABL 4Y9GA 3GSNA 2LLGA 1ODAA 3BSZA 3FQ1A 3INOA 4PBVC 4F37K 4M8QA 1JDAA 3WHXA 3DHMA 1RJYB 1K9TA 2WAQA 3O4OC 4LO9A 5EN2A 4ZW5A 4YUEL 3RY6C 2Z9TA 3II2A 4B9FA 4LFHD 2NUPB 2EC9U 1IM3D 1AQKL 4R7DA 4OVUA 2Q7AA 2PCPB 2C9VA 2K8QA 2C9RA 1NEZG 3QUXC 5GGVH 3CSBA 1N19A 4PLNC 2F53E 2WXHA 1LO2L 1IEBA 4GXVH 3JUYA 3EXLA 3QNXB 3RIFK 1Z66A 1F1GA 3MLRH 1QKZH 5GS1A 1B0GA 1NCBH 3B1UA 4L3EE 5E1AB 4RNRB 3GI8L 1QBLL 3WMSA 3SDAA 4YHOH 4D0DA 3WNNA 4JZJB 1RPQA 3QEUB 2NX5D 2BHZA 1LDPL 2GY7B 2VKXA 4I9WD 5HJGA 3X17A 4IGBB 4PJ8D 3ARUA 2AQRA 2OZNA 3DHUA 4X42A 2J20A 4WKZA 4JQXA 1DO6A 2QLVB 3CX5K 4X83A 1UZGA 3OC5A 2EJ1A 3ARDA 4RGNB 4UM9A 5FHAH 1XQ4A 4MAUH 5F9DC 5I74B 1A6TA 3NZHL 1B90A 5D6CB 2WTPA 5BZDB 4FHKA 1CURA 2CJSA 3BZ4A 3MR9A 4I3SH 2NXZC 3K71A 4R83A 1SPDA 4LCCA 1WHPA 3GZOA 4RIRA 3MLUH 5FM5O 1MN4A 3S4SG 1LP9B 4NZJA 3W0WA 5BRQA 3AMKA 1BMWA 4DO4A 4JCWA 1U36A 3N50A 2XTJE 3VNYA 1BA9A 35C8H 4HP5A 1SVCP 4HPYL 4PREA 2QSCH 1Q0YH 2PYFA 5IG7A 3KLSA 5AWNH 1BQSA 2VLLA 3ABKB 5KZCB 1IBHA 1WZAA 2N1TE 2J57A 2Y5TB 2LU4A 1I8LC 1RZJL 2W5PA 3BUYB 3FFCE 4I1PA 1SUHA 1AZRA 4XCYB 1BQHB 1LEGA 1KPVA 3MXWL 5I30H 5DRNB 1F58L 2D7MA 1KB5B 4FYRA 4LFHG 5I76B 4KROD 2WUCH 4XGZA 3KYNA 5AKRA 5B1AB 4I85A 3VWJA 4GG6A 2UVFA 2Q3ZA 3HE7C 4W4OC 3K4DA 4X7EC 3X14A 1HZKA 4B0MB 1PX8A 5EBMB 4BRJA 2VLKA 1KXHA 3VFPA 4I5BB 3QUGA 3EDJA 3NIFF 2NYYD 3GHEH 1J8HB 3NPSB 4NQCE 1KC5L 2DTML 1DBJH 2Z93B 1HKFA 1QSED 1IJ9A 1CLCA 4PJ7F 2BZCA 1PIGA 2XVBA 2YLHA 2EE2A 3K7UA 5D1XC 1XSJA 4QRUA 5PAZA 2XLLA 4DP2X 3KHQA 4FQ2L 1ZLVH 4I87A 4KWUA 1QEWB 5HYJD 1X5MA 3GBML 1R3IL 2VUKA 1RZIA 1ROCA 3NSJA 3QXAA 4K5PA 3IDUA 1QSFD 5D2NC 3RNQB 4EOWL 2NW2B 2IG2H 2WYHA 1DVQA 1U92B 3CLWA 3DVGA 4GI9A 3HS0B 1XL6A 4Y88A 1PFCA 3QBTB 2HKFH 2LAAA 5CD5C 2E3VA 4OY9A 4TSBH 1A4JB 1BZ9A 2DYPD 4M3JA 2G75A 2CE6A 5CGBA 1FJ1A 4M1GL 3A23A 2PTVA 3ARGB 1FNGA 2NYZA 1KZQA 1UD3A 1MI5A 1NGZA 1XVSA 3TFKD 4G7VH 3QXVA 4JN1L 1HZLA 3VD4A 4O4YH 4N0CC 4LVHB 1B2YA 1KLUA 3LN9A 2VSKB 4OBSA 4ZFOB 2BSBA 3L3IA 4F15B 3MRCB 3VH8B 4ILDA 3NJLA 3EZJB 2DIEA 4XBGA 4BH8A 4ODUA 4NX0A 4Y4FB 2UXVA 1NIFA 3VAEA 2KZ1B 4HWUA 3MRQA 3SZ6A 3RX8A 1SJEB 4GSRA 5TF0A 5B4MD 4G8GB 4YNYB 3QUMH 1ETJA 5HHVH 3K6OA 1L0QA 2C4FT 2RGSA 5DUJA 5E2VL 1BHGA 2AXFB 2XWBA 4G5ZH 5EZOL 3U1SH 1JZ6A 1D5ZA 3H3BC 3MRFB 2VDML 5EIQA 4ZX5A 3VXMA 5J1SC 3QDGD 4I0KA 1W6WA 2WUBL 2HT3C 3IDJA 2RH0A 1YNKL 4WW1A 5LDSA 1U8IA 4GOSA 4OF7A 3E1F1 3BUBA 4Z3IA 1ZEAL 3FU3A 2UY7B 1EHNA 3MLZH 2PTTA 4K9EC 3QQDB 3FSWA 4WO4B 1D2OA 3A6BL 2JB5H 3V5KA 4JK0D 3GXIA 3HMXH 1FLRH 1MFBL 2DLFL 2DEWX 2XJKA 4KXCA 4CSSA 1Z1WA 3PP4L 2AJUL 2QHRL 4PRPB 3IETA 1FNLA 2G2RA 2ZJSL 3QXDB 2A6JA 5DEJA 4EI5D 4ES8A 2APVA 2MIZA 2X3AA 1JVOA 2HWZL 3KH4A 3LKOA 2BC4A 3NAAL 2BOLA 4XH2A 4LKCA 1HSBA 3M7FB 1EZUA 3IGAB 3PGFL 3BDYH 3LH2L 3KPOA 1AXTL 2ZCKL 3B2VH 2XTJC 1C5BH 1EO5A 4M5ZL 3AREC 1UWGL 1ANUA 5ERWB 4AKOA 1FQ9C 2JQAA 1WV7T 5MHSE 3EDFA 1F90L 5IHZB 5D71H 1OAUH 1Q72L 3FO0L 1HSAA 2EDHA 1ZGLM 4FEIA 2UX7A 4XN2A 5C0JB 4QHMB 1JPTL 4L05A 3VD9A 1SF5A 3L5IA 4XVJL 4WEBH 1JNHA 4X7SH 12E8L 4WV1A 4PJIB 1MHCB 1QSZA 4Y2DD 2YQGA 4WFED 4IEFB 4JHVA 5C0CB 5HGGS 1IC0A 5CM1A 1NGPL 3BIKB 1WE5A 4JDEB 5DEFA 4UQBA 1E2WA 3AG1B 4CW1A 1CLYL 4MCZB 1LO5B 2JQMA 3F5WB 3WNOA 5C0AB 2XI9A 3RWFA 4Z7IA 5FW8A 2EZ0D 1K85A 1EMTL 1RSYA 5I24A 1FNSL 1PZSA 4Z78B 2B3RA 5F7DA 5FK9B 1SLUA 1SHMA 2IO5A 3FUJA 4B41A 4MZ2A 5EORH 2NR6A 4ALAH 2F74A 4U4IA 5IFAH 4Z7WF 5ESAB 5F0PB 5M7QA 3WDIA 1NWPA 3K72A 3BH9B 4Y16A 2AVFA 1HNGA 3PGCA 2ZG1A 2X88A 3DX7B 3FRPB 1K4DB 1L9MA 2I85A 4FLOA 1R3LB 3WYRA 4FFWC 3UBGA 4NN6C 3RVUD 2P5WB 2BFVH 1DANU 1O6SA 2O26U 3MLSH 4D0BA 1IU1A 3SCMD 3IJSB 5T1MB 1NDTA 4KK6D 1UH4A 3P3SA 3RL1B 4K5NA 5AVYB 4NQDE 1AACA 2IWGA 5FUOL 3A22A 2HKHH 2WOBA 1VPOH 2XXMB 3DA0A 4KZ0A 3QDJB 4B27A 1Y7VA 4R4FH 4BKLA 5B22A 3P30L 1KFAL 5CIPB 1UXWA 2FECI 2G5RA 3TV3L 1HH6B 1ZIAA 3RDTD 2AQ2A 5KG9B 4QHNB 1A6AB 3KL0A 1LD9B 4PGEB 3RAJL 5DMYA 5KVFL 5DGRA 3U9PH 1KCLA 3QQ9D 4ZOEA 1AR1C 3BGMA 5IM7B 4EUPA 5KSUA 3LRLA 1HEZB 3OXSA 4GG8B 2OTUA 2HP4A 4FFVD 4U2YA 4R9HA 1OLZA 4WZ9A 2A4ZA 2XA3A 4LVNC 3DK0A 3RU8H 4KNUA 4KKNA 2R0KH 4K2UH 1FNEB 1MSPA 2BJMH 2GCYB 2RR3A 4NQEB 3CH8A 3OAYK 3VRJA 5C0DB 5I8CB 5F7FA 1KCKA 3LZOA 1YNLH 4O2FB 3CQQA 1KCVL 1DQMH 2IH3A 6PCYA 2KZWA 5FM8A 2WBJD 2OL3A 2YXVA 4KKZA 2J6EA 3CWGA 4UDTA 1L9NA 4NC1C 4DO6A 1AGDB 3BXNA 3LS4L 2IDUA 3FUEA 5EZJB 4OTXL 4WTZG 4B50A 5K1NA 4D8PB 4HLZH 5GZNA 2HFEB 5I5RA 1AIFA 4GW5A 3KPRD 3ESPA 2CSPA 1GHFL 1PVHA 4YBLC 4LAQH 3U2SA 2R29H 1G7HA 5F1NA 4K8RD 2AZUA 4HGWA 1TQCC 1NFAA 5AOJA 4BSJA 5IJKA 4LLWA 2PCFB 4AVHA 5ICXA 2O93L 5FYJH 3AY4A 2I24N 4BRVA 4JZNB 3U0WL 3UBXB 4L8BA 2A6IA 3F83A 1ASQA 4OJAA 5T1LD 5TF1H 4JFFE 2YFNA 2IAMD 2VYRE 4ZPVA 2MSPA 4U1SA 2ENSA 1JGLH 2CMRH 3C09C 5HHQA 4X5PA 5HP5A 5CLTA 1U2CA 1Q8MA 4NEHB 4A67A 2B5IC 2Y25A 5IB1A 5KBPA 3CK0L 1YVLA 3LHPH 4HETA 1J11A 1J12A 3AU1B 4NB7A 4DTGH 4P2QB 3LEVH 1EVUA 5AFAA 3DIFB 2X9XA 4XCFH 5GXBB 3JVGA 1NCOA 3MI6A 5E94A 1UT1A 3BQUD 3IMRA 3OKEA 5IHUL 3JXAA 2NY0B 4MDIB 2ESVD 4UZGA 3W37A 4H40A 4M8RA 1BOGB 1NBVL 2FEDC 1SJHA 4O58H 2FB4H 1JBJA 4G9FD 4R26H 2P8LA 2Q8AL 4CSZA 4K73A 4JPKL 2OMUA 1FHGA 3LKPA 3LQAH 1MAMH 4GAGH 4JHWL 5C09E 3EHBD 4AYSA 4LSSH 4FTVD 1OD7A 2DH3A 3B6SB 3GSNB 5DHYA 3GIZL 3RKDC 4M8QB 3T3PF 3SE3A 5I1IL 3FH7A 1ULVA 3UEQA 3BGAA 3AUWB 4N9OB 2M26A 1YEKH 5F9WB 5E9DE 2P42B 4QHKJ 3S8FB 3BP6B 1KUMA 4UAOC 1FRGL 1QFWL 3FTGA 3WO3B 4U0QB 4KHTL 1S2EA 1A7NL 3NEXA 5T8IA 1SNRA 2NZ9D 4FG0A 3D4YA 3GQFA 4XO8A 5JR1L 4TTDD 2RQEA 5PCYA 2CNYA 5HDBE 4A7SA 1RK7A 4WUUE 2PXYC 1UA6L 4H5SA 2Y7LA 3CDGB 4M6MH 5CKGA 4G7SB 4L4VA 1JDDA 2LOEA 1AO7B 1B0GB 4P5TD 3WJJA 3JV5A 1D5IL 3KAAA 2OM5A 5AKTA 2EADA 3TP4A 4AYBA 3CU7A 1UD2A 5DQDL 2TAAA 4HT1L 4H4NA 5CJBA 3SDAB 2ZD0A 2V3DA 1A4BA 3WKNA 1ZY9A 1L9QA 2FO8A 3HB3C 4Z7NB 1C16A 5I6XC 4J7RA 4LSTH 4OJFL 5ECGA 1QFOA 3IDMB 5FAAA 3H3KA 1JI2A 5KJ4A 3T0WA 3UDWA 5TJWK 1X5JA 2AJVL 4BE5A 1IM9B 1GCYA 3V4PH 3ARDB 3L2NA 2X6VA 5HDOA 2R1YB 5GGSA 5ICYB 1O7SA 4BZ1L 5JOPD 1N10A 1PG7L 1GGUA 4XPGL 3CSPA 4K9EL 4OZIE 5INCB 3K71B 2YGOA 4R2GB 2Z35A 4LCCB 2GB2A 3Q8EA 1AHWC 3VMNA 3HZYA 3ZTCC 3W0WB 4XNXL 3IRCA 1ODUA 4CC0A 2XICA 1OAZH 4Z7UB 1YPZB 1CPUA 3UL4A 1OGAA 3AADB 1N5YH 2WLJA 3O6MH 3V4VB 3Q7JA 4EBQL 4PREB 2PYFB 1KPRA 4MNQE 1E27A 2B2XH 2F2HA 4NKQB 5D1ZI 5IG7B 2VLLB 2O5NA 3WUWA 1PYWA 4QXUL 1UENA 1XT5A 5C0EA 4MNHA 1OPOA 3T0ED 4HC1L 5DSCB 4FOMA 3T8VA 2VLRD 1VF5C 3AMLA 4YFLF 1YYMH 4JM2F 5D72L 1ACYL 4Y5XC 3BE1L 3CDCA 2Z7YA 4JFVA 2WGNB 3EJYC 4ONGH 4KK5D 2X10A 2FO4B 4GG6B 2IFGA 3BCDA 3KYNB 1JPST 4XWGL 4ZUTA 3VWJB 3X14B 4Q56A 2V17L 1KTLA 1RLWA 3FO2A 5I6OA 4K3JH 4OF3A 2VLKB 4GW1B 3SD2A 3B7YA 2DWTA 3TONA 3GSWA 1RUQL 4JCMA 4O9HH 3P3UA 2EDFA 1VFUA 5JLZA 3QWRD 4JKWA 3CC1A 5DD5H 3WELA 4FQPA 4WNQA 3RA7H 4A2FA 2BK8A 3PREA 2QKIC 2X0UA 2XA8H 4P46D 1T03L 2N4IA 4EN3D 4MQXD 3M07A 1XH2A 1AI1L 5GQBA 1FZJA 4IRSC 4QRUB 4X9GA 1EHLH 3ARVA 1S78D 2ZPKH 4TPRL 3VGBA 3QB7C 5SX5K 3F7VA 4OQTA 3BOVA 5GIRB 3BPOC 5FDWA 2OTWB 3C08H 1IGIL 3DVGB 5EFIB 3VFOB 5SWZE 3MSPA 3JVFC 4NUPA 4AK2A 3U0TA 3JWNH 1V27A 2ZT9C 3HIZA 4P5KA 2I07A 4LCIH 1BZ9B 2V7HA 5AOLA 4U3CA 2G75B 2I60H 4WIQA 3F7QA 1FNGB 1VJSA 3OJ2C 3N0PB 4S1RH 1I9RH 1KCRL 2VJ0A 1GC1L 1I7ZB 1MI5B 2NTFB 3LVTA 3L4TA 4KX7A 4PWJA 2YA1A 3RWCA 2E6QA 3CFBA 1KLUB 3X3FH 1TTRA 4OJDH 2AAAA 4TSCL 4U31A 4UT9L 3L3IB 3VG9B 2XKNA 4PLKC 2KUTA 5C7ZA 4FYSA 3B1TA 5DZLA 4TQEL 4BH8B 4J4PA 4ODUB 1EZVX 3VRIA 4UINL 2AJYL 4UQ3B 2OK0L 2QTVA 1MAKA 3MRQB 4Q9BA 1CVSC 5TTRA 4GI6A 4M62H 1EXUB 2Y6SC 3MLYL 4XTRD 2DQUH 4DZ8A 3RGVC 2LU5A 4HCRA 5TE6L 2ODHA 4HOWA 1D5ZB 2D03L 4XMPL 2BHFA 2DI7A 1A66A 3VXMB 4BJLA 5E7BA 3GK8L 3IDJB 3BUQA 2FIKA 1UEMA 3JT2A 3LRSA 3O41A 2VR3A 1S9KC 3C6LA 3RUGE 2ZUUA 2L04A 2XSKA 4TUKL 1A7RH 2FGWL 1D9KA 1CXEA 4I9WE 2MCPH 2ZOUA 5F96L 5HXMA 4AYEC 5I1AB 1N2RA 3V5KB 5CJ8A 3MCLL 3ZL4H 2YGNA 2XU9A 4AMKH 3INUL 4OZGA 3JBG7 4LPVA 2EXWC 5FW7A 3D85D 4DESA 4DN4H 1E0OB 1KJ2A 2F19H 2J2ZA 5GRVL 1U0QA 4D9LL 2A6JB 5H8DA 1AQ8A 2FQGA 5T3ZL 1V3JA 4HK3N 4OFQA 1OTTC 2GIXA 4J3SA 3SO3B 1YCSA 3LKOB 2XYBA 3RWJB 1FNFA 1HSBB 3TBVA 5DS1A 3UJJH 3HRZA 4JR9L 2AJZA 2JI3A 3KPOB 2R2EA 2VMFA 5BOJA 2FAUA 2YUVA 4JFOB 1IGJA 3ZZSA 3VQ1C 3CMOL 3ARFA 3K1DA 5FO8A 5C08A 1HSAB 4J3OG 4Z7VE 3U4BL 2HT2D 4FI7A 1WZ1L 3VRLF 2X40A 4ZYKA 2Z92A 1UGKA 1UOKA 3O6FC 3F6LA 1JNHB 3BIAX 1CFBA 2OMYA 2VIRB 3FF8A 1ZLWK 5LKNA 1R24A 1WA1X 4PJHE 2HSIA 4PG2A 3CSTA 2ADGB 2ITCA 4LLDA 4S1DD 3HC3L 1MW3A 3P0VL 2D9CA 1SEBB 1U41A 2APBA 3KPLA 5DEFB 4X6DB 4E9QA 4YHIB 4CW1B 3GJFH 1U8MA 4KX9A 3ATAA 2ORBH 3RWFB 5GRUL 3L3GA 1QSEE 3R7RA 4I1NB 3NIDF 1OHQA 5G4NA 5F7DB 1KBKA 3FO1A 4OF6A 1TQVA 4QOKB 5CLZA 1MHPL 5ACLA 1QAWA 4FG2A 4HSAC 1IKFH 4KXDA 4ANXA 1KEMH 5HYJE 4Y16B 5LWYH 2BP8A 3PGCB 3AS2A 4U3XA 1OOAA 4MS8D 3UP1A 2XIBA 3OGCA 1M6OB 2NNFA 4KH2A 2D9QB 4BWWA 2JJSC 2AS5M 1DDHA 4JFQB 4IGBD 2APXA 3KCPA 5GS0H 5HHXH 3L3HA 1O6SB 4PJXB 1NMAH 4D0BB 4GSQA 2BVUA 2VDQH 3LVEA 1XIWD 3VA2C 1WAAF 2G5UA 4GS7C 5DJ8A 1WIUA 4GUPA 4K5MA 4WVRA 3SZKC 4X0KA 5EIIG 2VXQA 3TEWA 3D1MC 4IRJA 1IAOB 2G3NA 2N56A 4H1LB 3AXLB 2EEFA 1XTLA 3CZSA 3KWVA 5AW1B 5J9PA 5EBGA 2EYRA 2GG1A 3HNVH 5J6HA 4NQXA 4BKLB 5JHLL 1Y18A 2DPKA 2Y7MA 3I3EA 4JKNA 5I1CL 5HHOD 3DVIA 1MCBA 1GTNA 1K5WA 4OBRA 3IWUA 4P5SA 4P06A 3SN6N 3V0VB 4KDTC 5LXGL 4P05A 1A3LL 5I1EH 5J13B 5LHDA 4HW6A 3VM7A 3E6HB 1I1CA 1PKQA 1CN4A 4BV1A 4NN7C 3MLPA 2ZKMX 3QDGE 4QYOA 4KTEH 2EXTA 1BXAA 2DJ4A 5D4HA 2NY4D 2Y36H 5GISL 5CINL 4EUPB 4A37A 1K72A 4HK3J 1R3JA 4PB0H 3OXSB 5KSUB 1PZ3A 3O3BA 4B0MM 2OTUB 1JRHL 4PJ8C 1C5CH 3E1ZA 5F6IC 3Q6GH 2NY1D 3WIHA 3QCUH 1MCFA 3H9SA 3VXRA 1T2JA 4NDMB 2TSBA 5E1HB 3VRJB 3CVIH 1ORQA 3IGUA 1BM3L 4OI7A 1J8HD 4M3HA 2VDRL 1D2PA 5AOMA 4A04A 1CK0H 1BGXL 3ARSA 3ZDWA 4QY8B 2BIOA 2W0FB 3KE0A 4UDTB 4HMCA 1LO4H 3WGVB 3MZGB 5B1JA 4RCAA 3VFNB 4D7PA 1JF1B 3DUSA 2EIZA 1AIFB 2KDGA 4Z95H 2IBBA 5IW6A 3U2SB 1R5WA 1G7HB 4ZMAT 5IKCA 5KBLA 4MJIA 2WXQA 5D96B 1CBVL 1Z0MA 3H42L 4KZCA 5ICXB 2HJKB 4LLMA 1AGCA 3E80A 2X9ZA 5C86A 3UEZA 4ONHB 3BP7B 2XXFA 4L8BB 4K71B 5LGHL 4E2OA 2KPNA 3ARGD 4P48A 4LHUB 1NZRA 4A2GA 5CJ5A 5KS9E 5FLVA 1BIIA 3KLAA 5DWPA 5AALA 2QBWA 4U1SB 2N59A 1U3ZA 2VM9A 3POCA 4WAFA 4KROC 5HHQB 5H37H 3CLFH 4ELME 1G4MA 1BWMA 1INEH 5EU6E 1UWYA 2EE3A 2YGQA 1THCA 2NY6D 2RA1A 3PL6B 2CM5A 3QWQB 3TPUA 1AE6L 3RPKA 3RWHB 2HUHA 3LRMA 1OAKH 4HJIA 4MSWB 2NYYC 1G1YA 2FWOA 4PGBA 1MIMH 1E7UA 5E94B 4I0PD 3B3BA 3D4CA 5FCUH 1V7ML 4Q58C 3L5HA 4FC3E 3IXTB 2NCEA 4BGDA 4CILA 3AWEA 3QZBA 5FM4A