3M88A

Crystal structure of the cysteine protease inhibitor, ehicp2, from entamoeba histolytica
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
PHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEPHPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cysteine protease inhibitor 2 from Entamoeba histolytica: functional convergence of a common protein fold.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
molecule keywords Amoebiasin-2
total genus 22
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m88A00
3E1ZA 3M86A 2NNRA 3M88A 3PNRB 2C34A 2OULB 2NQDA 2WGNB 2FO8A 3CBJB 2H7WA 3CBKB
chains in the Genus database with same CATH superfamily
5H37G 4TNFA 1P7QD 1T20A 4XWOC 3X2QB 3PWVA 1LE9B 1I3UA 3O8XB 1NCDL 5LDSA 4JPIB 3PJNA 4ZS6D 5IEKB 1HWHB 1JP5A 3FW6A 4PJ5A 4Z7IA 1A1MA 5GRJL 3VO0A 3BD5A 1L9QA 1GS8A 5D7LA 3O2WL 4PJ7F 4KKAC 4JRXD 1FV1B 5AAPA 1CQKA 4WJ5A 1E2ZA 3E0GA 4OZGA 5DQJB 4ZFZB 1DO5A 3LV3B 1AIZA 1MVUA 2WM0A 3FQ1A 3CDGB 4JDZA 1A6AA 2H5UA 1M6UA 4Z7UB 4N5UA 1U8LB 3SSGA 2DI7A 3TV3H 4W9KC 2AABL 3BGFB 3PS6A 5DVPA 2PCPB 2WWKT 1G0YR 1BQ5A 1N70A 2MKWA 3B6SB 3NFSL 2EIZB 5J9PA 2HRPL 3CSYA 5FYLE 4LPUA 5FW6A 1JBJA 3CFQA 1MRDH 3O8XD 4LPVA 4DESA 1L5GA 2AVGA 5JTWA 3BKJH 4FXGB 3D39B 2AQTA 5JDSB 2R0WH 4LPXA 4W9JC 4OJEH 1KCUL 5I0VA 4L1DA 3MX0A 2Y6TE 4L4VD 2OBGA 1Y7VA 1HILB 1DBJL 4ZZKA 2DLIA 2WN2A 2AP2A 2P44B 4H88L 1BLNA 3K2UL 1J8KA 2D9QB 3BPNB 1TZHA 3ULVL 4LEXL 2X0WA 1HSAA 2GBTA 1FBIH 2FWOA 1DQQA 4GAGL 4WI4A 2GI7A 4NKOA 1H0DB 5DJXA 3GRWL 12E8L 1GPOL 3PCYA 2ZUQC 3QIUA 4DAGH 4GUCA 2BCKA 5F1NB 3OKDB 2MOGA 1Q9KA 2GSGB 1C7SA 3T0DA 2WQRA 4L1SA 5ILTL 1RZGA 1ACCA 1NGQH 5AVVB 3VRIB 3AGWA 1UZ6E 5A40E 2XX0A 2NXYC 3MBEA 3AADB 4Y2DA 4B6ZA 1WT5A 5BUAA 5CSZB 1OW0C 4JKMA 1UT9A 3IDMA 3KS0J 4MD4A 4XHJC 2VDNB 3K5RA 3QEQB 4B9FA 1RLBA 1AGBB 4G1EB 4JKPL 3VXUA 2HTLC 2B0SH 3TEZA 1NCBL 1OGAB 4Q89A 3R4DA 2V2XB 2A74B 5EIIB 4YWGH 3BKML 1CI3M 1AR1C 5EUKB 1YEEH 3LAFA 1UB6B 3C5SB 5ACZB 2OL3H 3CZGA 1MHEB 2FZ3B 3P2TA 1JD9A 1NFDB 3VNZA 3IDJA 7FABH 3K6NA 1BW8A 3TWYA 3UPRA 2ENQA 2RCSH 3CBKB 2VR5A 5CHNA 5AAWC 1JDAA 4JFQB 3WI9A 1N12A 2ZOLA 1I3VA 2P5WA 5EC1A 1PFCA 1KYAA 1FYTE 3ARYA 2WCPA 1CR9H 3U83A 2E9IA 2Z34A 4PJGB 2FO1A 1BF2A 4QI3A 1GSKA 3L3OC 3KBHE 3ZKSD 3W0WE 5E94A 3BFQG 5LB1A 3FB5B 3NPZB 4X6BB 4CJ0A 1AFVL 4XNYH 1U58B 4M4RA 2VDLL 4PRPB 4NM8H 2JLPA 4YNYA 5TK2A 3VI4E 5E1AB 2WVVA 1YYCA 2NY1C 2ZUQB 4MRBA 4J6RL 4Y0GA 2BIPA 2FBJL 3QUMA 1T2XA 5JW4M 1DQIA 5EU7C 3KL3A 5LAXB 1D5XB 3DKHA 3B5TA 4OCSH 4OFPA 2DEYX 4AEHH 2GITA 1T2QH 3IETA 3KPMA 3NK3A 3QJHB 3PABB 3VFMA 2DQDH 2R7EA 5E1GA 4HWNA 2XWJA 1PKQE 4F58L 3PJLA 1WHOA 1H15B 3PPEA 2X05A 3N44B 2DM2A 5HDQL 5K9KB 1JYNA 1WWCA 2FT6A 1OSZB 1I8MA 5CN3A 1FC1A 4L9LB 2N7SA 3AQXA 2QV2A 3H6JA 5BVPL 4W9GC 4Y19D 4JKWA 2A74C 3V6BR 4MHHG 4OF8A 1J8HA 5AW1B 1FZOA 4ZW8A 4L5FH 3OPZH 1AHKA 1JPEA 1J88A 4F15B 2VJ0A 4BH8B 4U6HB 3HG5A 4QGYA 4F37F 3IU3B 4QJ5B 1UJ3B 5LGHL 4G8IA 3VWJA 4AQ8A 3JV0A 2OMTA 2VDRB 1YEDB 4E41D 1NCCL 2CRMA 4HA1A 3BRFA 5AVZB 4L3FA 3WUWG 4X5LA 5E5LA 3R8QA 3LXUX 3NPSB 4D3CL 4EBQH 3MLYL 3PV6A 3ARDB 3O45B 5KYWA 1CFNA 1I9IL 2ATKA 2RTTA 4WWKA 3MO1A 3F04A 5ISZE 2YQBA 3QZLA 5DK0A 2C9AA 3HMXA 4L37B 4Y9FA 5LGJA 1F6LL 3NBNA 1YNTF 2HKFL 5DGRA 3OL2A 2DQFB 1VJSA 2AQ1A 2ZUWA 3GMPA 1DQVA 2COVD 3LNDA 3MZTA 3K74B 2IH3B 4AQEA 3RKDD 1B9KA 3I50L 3TBTA 1RZQA 3G5VB 1MHPL 3MOBH 4OTXH 1LK2A 2CA4A 1QSEA 3WL9B 2FX9H 2PYEE 3VXRE 1I7TB 4IRZL 1DYZA 3KLAB 4JKPH 3WY4A 2GI0A 4ODHH 5EWIH 4F9PC 2BFGA 5EEYA 2BNUB 2W9DH 4N2HA 5D1XB 2A1WH 3A4EA 1NJ9B 1DJSA 1I1AB 3BSZA 4XPHH 4ZPVA 5IBUG 3MRNB 4DH2A 4L9LC 3L1OL 2HJFB 1XR8A 2AVFA 3WELA 3LXCA 4AG4H 5TE6L 1XL4A 4KNTA 3ARXA 4DAGL 1HESA 1IGCL 2YS4A 3QQ9D 4ISVA 4KK5C 1EHXA 3IAGC 4PLOB 2ZXEB 2Z4QA 4DP2X 3T2OA 3W0WA 3UTTA 2WXNA 1KIRA 2NY1D 4GSQA 4P23A 5I71C 1OCWH 4GBXA 3BKJL 5AL8A 3HN8A 3X12B 5FDWA 4FEIA 4G9FB 1FNSH 2JF1A 1A6VL 2OR9H 3MJ7A 1CF1A 2H9GA 3MN8A 4D2NA 1UGNA 5BNXD 2A6DA 5LGHH 1E5AA 1JTOA 1UZ8B 3OLGA 4OB5L 1NEPA 1JZEA 1TITA 1DVSA 1V3MA 3FRPG 5G55A 4OF3A 5T3ZL 4PRDB 4N2EA 1AKJB 2APFA 2OI9B 4E9WA 2FSEB 1E5CA 5D71L 2N7AA 5DS1A 1KJ2A 3SDXB 3H54A 3T1WA 4AH2A 1LNUB 25C8L 3QNXB 4MSWA 1X3DA 5HI5C 3RDTA 5IB2B 2VKWA 4GRWB 4ZT1A 4NXKA 1YNTA 4JANB 4JZOA 4FP8L 3IE4A 3B7SA 5L9DH 5ERWA 4ZXBB 3PREA 5D7JA 5KAQG 3ET9F 4HHWA 1KZYA 2VLLA 4PTUA 4DHLA 4K94H 2JCCB 4NT6B 4Y2DB 3D39E 2FATL 4OCLC 3X14B 2NY2C 1YPZA 3IDMB 3DV4B 4IU2B 4JR9L 4F24A 3D33A 5F7FA 4GUPB 4JO8A 3IBEA 1DVYA 3FB7A 2FT7A 3K72B 1I7UB 5IVZA 5E6ID 4XMKL 3RKDC 4N28A 4M1CC 5JHDA 1PCXA 4KRPD 1KNOB 3HE7A 1L0QA 4BBWA 6FABH 4I3SL 5F3HB 3WHXA 3MRCB 2NR6C 4ZOAA 4H1LA 3KYNB 3RJOA 4M6MH 4DJMA 4IDLA 1NFIA 1GOGA 2JFCA 5C3IA 3OAYH 1MF2L 4MMXC 4YHOH 3V0VA 5BZDB 4U0QB 3IMBA 4KBPA 1FNSL 2A77H 3R7QA 4MCZB 5DZJA 1JPSH 1AE6L 1T66D 5C0AA 2NY7H 1MKFA 3H7LA 3GK8L 2BZDA 3PWPD 3Q5TA 4LSPH 1Y18B 3WY3A 3RL1A 1T21A 4MJJA 4PV8A 5C9JB 3TVMD 2RQEA 4J2XA 1P5UA 3AB0B 1RKRA 3EO9H 3MFFB 4MWFA 4WEBH 4O9HL 3C09C 3D18A 1NEZA 1PU0A 4RFEA 2V7NB 3DBXB 3FU9A 4PMEA 3S5LB 5I66A 4ONHB 1DEDA 4NO5A 4HUWA 2EKSA 3BAEH 4OJFH 4RMQA 3BSZH 5EF3A 1BCIA 5EU3B 1E65A 3ZR5A 4MDJA 3QQ4A 2WK2A 1JZIA 4RSVA 2A9MH 1MCSA 4XCYA 2EKJA 2BHZA 3LXBA 3RHWF 5AWNH 3VDAA 1RHFA 3B5HA 1WZ1L 3ZE0E 3AAZA 4NQCB 3BHBA 3NRFA 2F7RA 2J88L 3BJ91 1IL1A 3LPPA 1C5BH 1UB6A 5DJ6B 3K6FA 2FH8A 3ZTDC 3OZ9H 1RU9H 4JY6A 5FOBB 2XCMC 3EYOB 4RQQB 4O2FA 2GJ6B 2NLJB 3IDJB 5EU4B 1HHKA 3D48R 5KN5B 3UMNA 3OTTA 3V5DA 1NMCB 2XFXB 5EPMA 3GF8A 4IBYA 5FFOA 3V9FA 5C2BH 4U3XA 5EUOA 3RA7H 1EHLL 4FI8A 1E5YA 4MMXB 4JPVL 3WLWC 2XDHA 5IUSA 1I9RL 4YXHL 5JHMA 2CXKA 3KBEA 3QNFA 4RGMB 4D9LH 5C0CA 1YN6A 1G4MA 3FF7A 1W8NA 4AZ8B 1V7MH 4ZMZA 2QADD 2RFXB 4LDCA 1E27B 4KV5F 3UTQB 5PAZA 3V4LA 3WJLC 2H26A 2CCLA 5JMRA 5TE4L 3OKKB 3B2UC 3O45A 3GZOA 4QRRB 1CVSC 2ZP8A 1J5IA 4WW2F 3IKCA 2DJSA 4X4XA 3U9PH 2XN9B 4PY8J 3CN1A 4F2EA 5C0CE 3ULUL 2ARJQ 1LE5B 5FO7A 2YAMA 3CVIH 5HYEA 4Z7NF 1FNEA 2RJMA 3DTUB 5E2VH 2HTLD 3ISWA 1BZ8A 2R56L 1J48A 4ODXA 1BQHA 1FQ9C 2EIMB 4MAUH 3MCLH 3CLWA 5CD5C 4N9GA 3MRHA 5FYKD 3ZE2E 3CVBA 1KN2L 2BNUA 4LOUD 5D1XA 1PZ5B 3SDCB 3SDDD 3T0XA 2CDFB 2WXHA 3BVTA 4U1MB 5BV7B 1YEJL 4PI0A 3K6SA 4JS7A 3A6CL 3DRTA 2X4RA 4WI3A 3FQRA 1O0VA 3R0MA 4IRSA 2LT9A 2NDFA 2EINB 3EZJB 2FGWH 4OF5A 4QUOA 1B90A 4M5YL 3S3JA 4IJTA 2FL5A 1FFNA 3B4NA 3HG0A 3O8XC 4PBXA 3V4PB 4JFZL 4I77L 3DVNA 4HUXB 3MUGB 1T6VN 1ZK9A 4K9EC 2Z8VC 4G6JL 4ZNEE 1ND0B 4XGZB 3CFEB 3HZMB 4NQTA 1KBBA 3INUH 2DQIH 4S0SD 2DDQL 3KYAA 3EJZC 3QPKA 4BE6A 2D3VA 4NQEB 2D0HA 4R96B 4B7IA 4UTAA 4YFDB 2OMYB 5DYOA 2HVKB 1Q1JL 3ATBA 4XMTA 2ZWZA 4O5LH 1GS7A 1Q0EA 1Q0YH 3ROLA 3UGXA 4OLZH 1AKJA 5L4JA 2C1OA 1B2WL 5IJDC 5LUMA 4BIKA 3ROOA 1HZLA 5DURB 3F6IA 1Y6MR 4PM1A 3U0WL 4XNDA 3EJPA 5CILL 1KLUA 4NRXB 3P3UA 1QBML 7PCYA 1ZCRA 4X0NA 2W9DL 3GINA 5DEFB 4QXVA 3A47A 4PCYA 1RVFH 4XN9A 5I1GH 3ZGIA 1FCGA 3MRQA 1UCBL 4CVUA 3IJHA 2EDMA 1UHVA 4NCC2 3BX7C 3TF7C 4PD4J 4JG1L 1PIFA 4JFYA 3MODH 1PZCA 4M48L 2VN6A 4GUPA 4AUJA 3POCA 2A7BA 1IM9D 3KVPA 4IW4C 1U92A 2YC1B 4K3HA 1EK3A 4X5PA 3SODB 1EUTA 3K2KA 1G7JA 3N55A 2FWSA 4PRPE 1OE1A 1FHNA 4DKDC 2WKGA 2J8UB 2DEXX 4KKQA 3FOLA 3Q43A 3BVXA 4QHLA 5AW9B 4QAMB 3MAWA 4LSTL 1JHTB 1NZRA 3ASWA 3HA0A 3MJ7B 4LVNC 4NKIH 3JWOH 4XHJD 3L5HA 3TGXA 1BG9A 3O3DB 3SPIA 1IEBB 4C83B 2HFGL 1BAFH 2H7WA 4Z6AT 2GK0A 1YPZF 2KUTA 4HGWB 3IN0A 2D3NA 5DA4A 4CW1A 2YPLD 4J4PA 2XNAB 2VSKB 1PBYA 5DD5L 3ZHFA 1SRDA 4F93B 3GMPB 4OZHB 1R17A 3C08L 1DSYA 4NO0A 3S88L 4OZGE 2VUYA 3WG7B 5KYYB 4JW3A 4PFEA 5DVKA 4YSAA 3CDZB 5BPPA 1YC8A 4KZCA 5G4NA 1LK3H 3RWJB 5H37A 4N85A 4ZSOA 3RDTB 5IB2A 5ADOL 4PVMA 4G1MA 4OT1L 3MA9L 1EGJA 3GDBA 5F8QC 1K5WA 1QFUL 1KCKA 4E9RA 4M7JL 4K3JH 1XH1A 4FXTA 1BVKA 5DFTA 2Y5TB 1HQRA 4GG6A 3P1VA 3BN3B 4OIIH 2UY6A 4LOEA 4AQAB 3CGTA 5KVDH 1KFGA 1KTJA 1OTUC 3ZT7A 5E7BA 2IFFL 3CWGA 2BP5M 2HWZH 4G8FA 4PJ8D 1NMBL 5FGSA 5FO9A 5AW2B 2WBJC 4N2OA 3AY2A 3AAZB 4PS4H 2RAMA 3EAKA 3II1A 4XXWA 3QZPA 3G9VA 3HRPA 2EC8A 4IU3B 5JHLL 1KULA 3DGGA 1T89A 4QTFA 4BJLA 4FLRA 1OF2B 3X12A 1MCKA 1CD8A 1B0GA 1JXJA 1SJVA 1Z7JA 2ED6A 4CAGA 5KUMA 3Q8AA 4M7ZB 3DX8B 2H9GB 3QQ3B 3FN3A 3MACL 3QW9A 1BG1A 3V0VB 3VXRA 1QI5A 1ZRUA 2NXZB 1RCYA 1G7QB 1NAMB 3HI6H 3RWHA 3ULUE 1MIMH 3RI5F 5H2BB 4WUUD 3T0ED 4MGXA 4IRJD 3CHOA 3H3PH 1CTOA 3DROB 1E27A 2QQNL 3TBSB 3UTQA 2Y7QA 3WFBL 4MRCA 4LKXB 2FSEA 4UOJA 1S7XA 3SIKA 1OAUL 4ETQB 1OXYA 4FQ1H 3QRGL 4C56A 3ZHKA 3IKCB 5DJ8A 5E2UL 2VLKD 2X2YA 3EJYD 5FX3A 4Q9RH 2DKUA 4G71B 4OT1H 4E9YA 5F70A 4FFYL 2CHXA 2M83A 3AMLA 4NIYE 1EV2E 4NJ9H 1JYWA 4GAJL 4PTUB 2R15A 2UWEA 1JXGA 4XZUA 3X11B 8CGTA 5FK9B 5F8RC 4ZO7A 1ZVNA 4HLZH 3MXWH 2Z31B 5G5DA 4X4YB 2XTJC 1P7QA 1GGBH 3UTPD 3L7EB 2VC2H 3TC9A 3HNTH 4XP9L 1NM4A 4IK6A 5CINL 4DW2H 4NQVA 3SDDC 2JSFA 2XJLA 1OE2A 4N24A 2DIEA 4K5LA 4LZKA 4H88H 3EYOA 1NCGA 1HKLH 4X80L 3QGVA 1JNHB 3QXDB 1FRGH 3DYOA 2JJSC 4MD5A 2FBOJ 2ZYIA 5BW7A 5KN5A 3QK0A 4PRHB 5F7DA 3INUL 5D1XC 4PJHA 4AYGA 4HUXA 4PEEA 1XF5B 1CE6B 3COOA 4HXAH 6PAZA 1E8YA 5CINH 1FO0L 4DW2L 2FX8L 2EDFA 2H8PB 1A3RH 4JFZH 5JW3L 1JF1A 4L3EA 4LLYA 3O2DL 1AO7E 4Y5VB 5IGXL 4KC3B 3VSUA 3Q2VA 2O5XH 3OHXC 3HHSB 4LDLB 2QJDA 3TCXA 5DJAB 5J3HD 4LSUH 3MJGX 3HI5H 1ZT7A 2Q6WB 3BSHA 4X4XB 1KF9B 2GT9A 2VXQA 3LH8A 3S5LA 5M7QA 2CRZA 1A9BA 2ZXAA 2Q8AH 5D70L 3C8KB 3W39B 1IMHC 5B39G 5D5MA 1BOYA 1BD2E 5HHNB 1NCHA 2P4AB 2XT1B 1E4XI 1PY4A 4N8UA 2CK0H 3MCLL 1KLUB 1D6EA 1A3LL 2KDGA 3DHUA 4HS8H 3WDJA 4AJ0A 3UYRH 5IKCB 1W72H 5E6YA 4GIAA 3OKNA 1SZNA 1IEAA 2WW8A 5A7BA 1K3ZA 2DTMH 2Q10A 2F7IA 4PW3A 1N64H 2ODHA 4U2ZA 2IJ0C 4XCNA 3AGVA 1A6TA 3U4AA 2QSVA 5A3IC 3HNSL 4ELDA 3K6SB 2BIQA 2OMZB 2OSXA 1DQMH 2JH2A 4XP5H 2QHLA 4TNVF 4G8AC 3ZKMC 2E4TA 1CE1H 2ZWNA 3PGDB 1WPCA 2XA8L 4X7SL 4B0MB 4N2BA 3UCRA 4BHUA 2ERJB 3IXTB 2EYSA 1A5FH 2DQGH 2ZX7A 1XX9C 3HE6D 3CFKB 3BZEA 1EJFA 2NYYC 3V4UL 1Q1PA 2FX7H 3L16A 5IJKA 1CWVA 4CVXA 4G6JH 3MUJA 3MRIB 2HT3D 1ILSA 3FOLB 1TJGL 2BSED 1H9VA 2YSSB 1ZS2A 1XGQB 4TMPA 4YLQT 5JIMA 3MOQA 3QORA 4WNQA 5I0WA 2Y7LA 3N44F 3QUYB 3B8SA 1HIMH 3MOAH 3OHXA 2GK0B 4EZMA 3FFDB 1T66C 1OZUA 3MNZA 1EQWA 2BVOA 2R9HD 2Q2LA 3EYUL 4KZDL 43C9A 2F9BT 3KPPA 3LQZB 5CGTA 3VWKA 3SOTA 3W11D 4AENA 1LXMA 2WKOF 5HYSB 4M8RA 1U3HA 3DSNB 2I24N 3RRQA 1NOAA 4Y19A 3VXSB 1VERA 5BV7H 3EXJA 1VLXA 3CQPA 3KLHC 3FCSA 3ABZA 5DQJA 3E3QC 4Z7UF 3G7TA 4U05A 3RILA 2HT2D 3KWTA 2BNRB 2FB4H 2QBWA 4ZAKD 2DYSB 4OZFA 3FULA 5F96H 2LABA 5D70H 3CVIL 2EYTA 2OTWA 4L3CA 1PNDA 3CLFL 2LFEA 4CJ1A 1JWMA 4PRAA 4HS6A 2NY0D 1T7XA 3DX9A 4M7LL 2C9XA 1OZTG 3GRWA 4IRSB 1BX2B 2K8QA 2QSTA 2UY6B 1CF8L 4HUCA 3FUDA 1V3LA 3QCTH 1NC2A 3E1F1 1WIUA 4BSWB 4KRLB 4RDBA 2NSMA 4KTEH 1BZ9A 2ITCB 5JHLA 4OLUL 1WK0A 2VDMH 4F8PA 3BWUC 1YN7B 4KOBA 3GEWB 3WIHH 3NEXA 1OSPH 4MNQE 1NLDH 2NNFA 1WZLA 4NFDA 4BZ2A 3OKEB 5C0RH 1FO0A 1X5FA 2X6UA 2F53A 3CZKA 1DZBA 2ZOTA 4IOSA 3MCKA 1CXHA 3QARA 4LMQI 1E43A 4JZNA 4I3SH 3HNVL 1P53A 1NCUA 3KGUA 3C8DA 4ZMAT 3GJFK 3TEWA 3LQAL 4OZIF 1Z2KA 1WZ1H 2AJ3B 4JO2H 4JPIA 4LPCA 4HKBA 4FQLH 2F53E 3GKWL 3UDWA 4UTBA 5D96C 2ZX5A 3N1PC 1O9ZA 1M05A 4R7NA 3CFDA 3AT8A 5SWZD 5IW6B 3GMQB 5MERB 3RWJA 1FZMA 1H6UA 1NBQA 3VRIA 4PB9L 4G80B 4ZFZA 2CBTA 3W11C 4APQD 2ZWYA 4WHYH 2YQGA 3IXAB 4UZGA 4ANWA 2VERA 1JDCA 3T3PE 2XY1A 2Y3AA 3X1GA 4R7XA 1QW9A 2HA1A 2HXAA 4JRXE 5CILH 4XPBH 1I8LC 2P8PA 4FTDA 4IRSC 2F74A 1OB1A 4YBQC 3IJ9A 5DRZA 1GGIL 3ZDZF 2HPOA 3QPXL 4E68A 1GAFH 4C54A 2QHRH 4P3WA 4EIZC 5KTEH 5IB1A 1L5GB 3KE0A 5C08D 3F7VA 4FNTA 3UBXA 5F6IB 1NPUA 4FQJL 5E4IA 2EVJA 4XP4H 3EUDA 1FRGL 2Z7ZA 5J1TC 2YN3A 4P46D 5A6LA 1LD9B 4BGDA 3LHPH 3STLB 2F8IA 2UZYA 1RJLA 2VZVA 1FSKB 1J1PH 1MH5B 2QVMA 3VSTA 1F58H 4N6RB 4NB7A 3WO4C 4LHUG 4WIQA 4GS7C 4NO3B 3NSYA 4QWWC 5KBDA 2BVPB 1T0MA 4PRPA 2AQRA 3WS6C 5SWQB 3QIUB 4DERA 5C0FA 4OI9A 5I5MA 5J06A 1CGUA 1NCAH 4LKXA 3IJSB 3QH3B 2VXQL 3QUMB 1NC4D 3IFPA 3FO2B 1CLOL 3H4FA 2VAAA 2R51A 5EU5A 3PUUA 3FTGB 3S37L 1ETB1 3NCFB 4C56B 1JWUB 1PS3A 1G7PB 2CK2A 3QQXA 4PYGA 4A2HA 3VXUD 1LYQA 2VSDA 3NEOA 5IESH 4MQXC 4J6IA 1WAAE 2Q8BL 3NJKA 4NI6A 4UNIA 4ZUWA 5IFHL 4C8XA 3CN4A 3ASOB 3CHXA 2NOYA 1CQYA 2V2XA 4Q8BA 1DUZA 1N9PA 2B59A 2VDMB 3QUYD 3TP4A 2XYCA 5AVQB 1UFGA 4XVJH 4PJBE 4OAWA 3BWSA 2C9UA 3UCQA 3UEQA 1RZIB 5FO9B 4AOFA 4R8WL 3WJJC 5I8KH 4UIKL 2H1PH 2NYKA 4GG8B 1EAOA 2XWEA 4YR6B 1JZ7A 2P7TA 3OLIA 3PGFH 4WO0A 5F6IC 1L7IL 3O6FC 4KK9D 2A6IA 2WTPA 1TU2B 1B0GB 2Y2YA 4LHJB 1WS8A 5LG1A 3L3IA 1QSFA 5IR1A 2WAQA 4O51B 3KCPB 2BCMA 5FF6A 5FGBC 1SJEA 3VD4A 4TQIA 3IDXH 1QNZL 1WDAA 3VXQA 3WO4B 3V4VL 2BOCA 5MENE 4LVEA 1M3JA 3RAJL 4N5EC 1ODUA 5K9OA 1IFHL 4LSRH 4PD4K 4PTTA 4KK8C 4L3EB 3U7YH 4BQ9A 1NDMB 1INQB 2GABA 4MA8L 4R0LB 3N1FC 4ETQA 1MFEL 2OJEB 1JPFB 3HHSA 4AQEB 3EJJX 2X4TB 3X13B 2XZCL 2D7NA 1KCSL 1PIGA 4M7JH 1T1YA 5E9NA 2XV3A 4OH2A 1I7TA 4XPHL 3B37A 4GW4B 1EHKB 1HHIB 1BOGB 3LDBC 3LZFH 2PW2A 2JI2A 1UM5L 1NCNA 1XCQA 3RTQD 4X9BA 5KBLA 1NJ9A 1COBA 3RU8H 3SQOL 3DYPA 4G6KL 4GRLD 2ATAA 3X1EA 4LP5A 2XETA 2XWBB 3QO1A 4ENZA 5T1DH 2QKIB 3MJ8A 2E86A 1KGYE 2WOYA 3KJ4B 3P4OA 3P9LB 4ZZFA 1PVHA 3LD8C 3ULVD 1HU8A 4ONFH 4A63A 5KYUB 1A02N 3HHMA 2D0GA 3DVGA 2O30A 3QIWA 5EZOH 4M6OL 1NLBL 3JTTB 5DRWB 1PAMA 2JJTC 3UJJL 3DIFB 1WICA 3V95A 3N6YA 5AD0B 3V7AE 1TJHL 4RFNC 3QDME 4UAOB 1NC2B 1A8ZA 1GL4B 4XB7A 3HVNA 1BIIA 1KCWA 2SODB 4K7FB 3RDTC 1BZ9B 1S46A 2ITCA 4P49A 5CZXD 2QSQA 2XBDA 4K9EL 2EAEA 4DPCX 3AXHA 3ZO9A 3B2VL 1LJMA 5DA0B 4BFJA 1KGCE 5HPMA 3D05A 3F6JA 3RVTC 5KVFH 1U2HA 4TLKA 5C3LD 4JZJB 3QORB 3IU4L 3CSFA 4XPGH 4JHUA 4OIIL 1OTUD 4NM4H 3LRKA 4O2EA 5FUOL 5T3XH 4CUCA 5HHPB 1LK2B 2AXFB 4QT5A 5D7IF 5DMGC 3II3A 4JPQA 3LN9A 5KJ7E 4MZ2A 2IADA 4M5SA 1WAPA 2ZG2A 3GI9L 4HKZB 2NW2A 2Y2WA 4TULL 4M7ZC 3UP1A 5MERA 3D52A 1M7IA 1RK1A 1CLZH 1NGZB 2N59A 4WTXA 3QUXB 4O4YL 4HJIA 2JCCA 4NT6A 3VD7A 3X14A 4S1SL 5HVHC 2E59A 1YEGL 4OZFG 2L8AA 1OKEA 3LZNA 4FCAA 3W5MA 3SGJA 1KIPB 1WA2X 2QVFB 4Q97A 5INCB 3B3BA 1UZ6F 3QDGD 3WN5C 1A7PL 2ZKWA 4QHKI 4PJFB 4WWKD 4LARH 1BBJB 3KPQB 3KDPB 3B83A 3TIDA 4RFNB 2XWXA 1L0YA 5IB4B 4BSWA 2XV0A 2EQDA 1RZPA 3P3RA 3PP4H 1MF2H 3QUKB 5TGBB 1YN7A 2G60H 4DUWA 2G2NA 4NYLA 1FAKT 5JOFA 1KEGL 1IGCH 4DGYH 2VQ4A 4D94A 1A6VH 2B5IC 4LBEA 4ONGL 3P2DA 2OL3L 1E9QA 4R7DA 5IROD 5ICXA 1JYXA 4TTDD 1DBBL 4XCFH 3RL1B 5I6OA 4UILL 2EIEA 3MNZB 4NC1C 4QXGH 2P80D 4WQOA 2EE6A 5C0ND 2EUWA 3GSNH 43C9B 4FERA 3ZBMA 2DYRB 5C3TA 1JERA 1GOHA 2GG1A 4HUWB 1U95A 4JGUA 1KTKE 3IFOA 3QYMA 1FGNL 5M94B 1XB8A 5E8EB 1DDHA 1OCOB 3QJXA 2WLZA 4DO4A 2EILB 4ZK8A 5KVGH 1TKWA 5IROA 3T0WA 1RK0B 1TLMA 3RGVC 4GRWE 3IXAA 1OSEA 4XCYB 2XN9D 3RGBA 4GQ9L 1JZ8A 4JK0D 1OVZA 3AT0A 4XC3L 2FBRA 3O11A 2BSDA 3HCVB 3ZZSA 4DPAX 1UH3A 1LP9B 4JQVC 3VUAA 3ECBB 2MSPA 2VDLB 2P43B 1LVEA 4I4WA 1J9RA 4G6FD 2VDOL 3EKCA 5F72S 2TAAA 1QEXA 5GHWH 1EEZB 1WS7A 1JGLL 3GLZA 2P5PA 4UM8B 2EDXA 1VF5C 2R0KL 3UBXG 4YS4A 5LG6A 1Z9LA 2IXQA 4RMUA 4U1JB 3TT3H 5L2JA 4FHKA 4BH7A 5F21B 3AS2A 3ZTNL 2FUQA 3WTUA 3LZPA 3GXIA 5JW5B 1H5BB 4IBWA 3CU1A 1HSBA 2ID5A 4Z0XB 1T21B 4PV8B 4DPBX 1DVZA 4JY4A 4QHMB 4AW7A 3ZGHA 1KB5B 5C9JA 3KWWA 2E9GA 3GC3A 3MCYA 5AWNL 5SWQA 3ESNA 2AV7A 3ARRA 4POZC 3MRKA 2YRZA 5D72H 1B6DA 1BECA 3V0IA 1HK6A 2P80A 5JUEH 3RFZC 2XQYG 5F89B 2Y4SA 1JL8A 3RX9A 5CD3A 1RIHH 3PG2A 2EKSB 1FGVH 2FATH 3U4KA 3ORJA 4UT9A 4Z3FA 2HLAA 1BQHB 5K33A 2BP3A 4IIZA 4PJDE 1OPGH 3FAXA 2R8SH 2NMSA 4JNXA 4J3UA 4MDJB 1EGJH 2YD1A 1NDGB 2L4OA 5D1XE 1JGDA 1CK0H 4E36A 4MNQB 4ODUA 5CLYA 4J3OD 1UCTA 2MQCA 3GD1C 4J3WA 4JRYA 1S78C 4WUKL 3RY6C 4NM8L 2VKXA 4UQ2A 5SWSB 1JNJA 1MFBL 2NY0B 5D7SH 3RTQC 1X4XA 5BMFL 3E8UH 4PP2B 2X4NA 4PREB 3B9KB 4N86A 4PUBH 5FWRA 4HJGA 4X6FB 5KBMA 3KZ8A 1UURA 1QYGL 5CJXC 2FECI 4LRIA 3N0PB 2IDQA 2VZUA 2XFXA 5EPMB 4NI3A 1L6ZA 5DJ0A 1A3QA 3O3AA 3E9UA 4A7TA 2UX6A 5KANI 4FJZA 2W0FA 4FXGC 4IEFA 3P4MA 4IBZA 4ODBD 4DEWA 2GJ6E 4LFHG 4XMUA 2Y1AA 3SBQA 2BRRH 1EO7A 4N8CH 4ABWA 5ID1A 5K9OB 4GRLA 5TQ2L 2A99A 1HINL 1G5GA 2F5AH 2OJZH 3C60C 3QXVA 2JKRM 2V8LA 5AZEL 2UWEF 1CFVH 4JN1L 4XVOA 3OR6A 2FO4A 4BFIB 4CU6A 4ZMVA 1EPFA 3DUSA 2VAAB 1D7BA 4LEEA 1IJNA 5DXWA 2QDVA 3MHZA 4YDJB 2B14A 5JDJA 2YQ2A 3BPLB 3IGLA 3VGBA 4X6CB 3MRHB 1SY6A 3MV9E 3O6LH 4JJ5B 3OGCB 1DJWA 5DMYA 4YL4A 2MPAH 3FUMA 1VAHA 3TESA 4NRYB 3NT0A 2XLLA 5D7LB 2X0VA 1XV8A 2NXYB 3A5VA 3BQUC 4KHXH 2X4RB 2J6EL 2PR4H 3SPVA 1DBBH 1AQMA 1I7RB 2WD0A 3K3QA 4ZUTA 4FTVE 4LEXH 1KENL 3ZZQA 4F7KA 3D06A 1OTSC 4LIQH 3RFZA 2Y7OA 3VA2C 1QLFB 1PEZA 5DUBA 3F7KA 4M8VA 1T6WA 4QXGL 4BM7A 3FQYA 1OCRB 5B4MD 1SXCA 4X8JB 5DLLA 1F6AA 1CLCA 2AJVL 3QCVH 2A6IB 3LKNB 5GRZA 2DQIL 4YMPA 1M42A 2BSBA 3L3JA 4X99A 1P4LA 2NR6D 3WIFB 2VM9A 1H3TA 4L8CA 1ECYA 4C56E 3KVDD 3N2JA 2IO5A 2OCJA 2DYPD 2Y07L 1OSYA 2IWFA 2ZCLL 4P2CG 1DCLA 4WSJA 2UVEA 3H2PA 1LGVA 2CO1A 3C60B 4H8UA 3U30B 4P2AA 4KKBC 5HYJB 4EDXB 5I18H 1J5OL 2YSTA 1P4UA 4X7EC 2BWQA 3BDYL 2MQ3A 4IJ3B 1RIVL 3CDZA 4PJCA 4K3EL 1HHIA 1EEQA 4OCRL 4P59L 3RUGE 3FONB 1CD0A 3ZXAC 4DGVL 3P2BA 1I8KB 4TVPL 3D4CA 3OB0K 3VXMD 3RGVA 1T3FA 1U8HA 1WAEA 1OCZB 2C5DC 1E4KA 1V55B 2ODIA 4P2RE 5GRXG 1TTFA 3A6BH 1LO5B 1FSKC 1JMXA 1NFDE 2F7PA 4L8BB 4QO1B 1ZE3C 1XGUA 3RURA 4URTB 4GMTL 1MJ8H 1GPOH 1U8LA 1HCFX 4P46A 1U92B 1USQA 2UXTA 3F7PC 3GMRB 3JZYA 3UZEC 1S9XB 1T2JA 1XTMA 2K7QA 2WQWA 3C5JA 4KZ0A 3RI5K 5EV7A 3N85H 4KJWD 5IT2H 4Q7DA 4KHTH 3AM8C 3OKLB 3ZMEA 2HRGA 4AM0A 5E2JA 4G9FE 3KLLA 1UJ3C 5B39B 3HR5A 3N04A 4KKRA 1KXTB 2B39A 4NYLB 2WO4A 4RGND 1FNHA 3QQ9C 4KK5D 5DI8B 4BH7B 1Z0MA 3OV6A 3NJJA 2XNAA 5AW3B 3SCMD 3TLRA 1FG9C 3U30C 1H5BA 4K71B 4XNZC 1A9VA 2WQSA 4W81A 4XC1L 2CIKB 2XVKA 4HOZA 1KACB 1HCZA 5HDBF 5AB2A 3RBSA 5FHAH 4GBXC 2NUPB 4H1LG 2EE9A 3DJTA 3LNEA 1W0VB 3HS0B 2VH5H 3GHEH 2FTAA 3BISA 2K6ZA 35C8H 2ZCKH 1MFVA 3UACA 5DHVH 2IVFC 3MLWH 3O9WA 1W6LA 3G6DL 3X11A 4OKVB 5D2NA 1SLXA 2HT2C 1IAII 2W0PA 3GHPA 3TH3T 3WFHB 5DT1H 2Y36H 4F33A 5IHWA 4G8GD 1SN0A 1NBVH 1P7QB 4E9SA 1V7NH 3H9SB 1DJGA 3LPOA 3LH2H 5DZAA 2AJUL 5EUKA 4X7FC 1A7OL 3I3BA 4GAGH 4L3AA 1F5WA 1QNZH 1BBJA 3KPQA 3GSRB 2DMKA 3HPLB 4GRMB 1BYNA 1WWBX 5HI3D 4S0TD 1ZT1A 4QJ3B 3STBA 5EN2A 3QQ3A 5I71B 2Z3FA 3R18A 4JDVB 4P2RB 5EC2B 5FEBA 3RPBA 3UX9B 4MNGA 2BW4A 4I5BB 2JLLA 3HC4L 5J1SC 2G4EA 2PKDA 4UOW0 4IIQB 4QR7A 4BKSC 4GKSA 3Q6GH 5ICXB 6FABL 1S7XB 3CFJB 4DN4L 1I8UA 4XNZB 5A2CA 5ID1B 2EH8L 2X6AA 3TS8A 2ADYA 5C0DA 1N8OE 2BWIA 1BBDH 4YHPA 2ZG3A 3QWRD 2AV7B 5B3NA 1SDDB 2JI1A 4NZFA 3KYKH 2GK2A 3BW9B 3FF8A 1YYLH 3VD9A 1ZLUH 1ES0B 2NCEA 4OCYH 5DQDL 1BVNT 4IGBC 1RZGB 4WCYL 4GQZA 5JOPD 4ILDA 2AEQH 2IGTA 4QOKA 2DIJA 3V52H 2IH8A 2EDHA 3EJCA 3BXNB 1FIEA 4P48A 5HI4D 3LN5B 5DD0H 4LB8A 5ACMA 1XMEB 3ZT6A 4PJ9D 1ZGLM 3NFPB 1U8MA 5HGDB 3GI8H 1FAIL 1A6AB 1OGPA 2E3VA 2Z31D 4YBHA 2UZIL 3UO1L 4YQXL 1KEML 2J8UE 1AGBA 4G1EA 1OSZA 1IE5A 3DXAE 1FBIL 2KS0A 1FGNH 4ODSL 4YHYB 2KH2B 4HK3J 3MDJA 4PJHF 5KVEE 3ULVH 1YECH 2Z4TA 2J2ZA 3CSYB 5AVWB 2XX1A 1CC3A 3DDFA 4DCQA 1FNGB 4KDTC 2NY3D 3FUEA 2H0EA 5D2LB 1IM3A 3UAAA 4WI9A 1P1ZB 1CDBA 5H4YA 3UZVA 1DQJA 2VLKB 1ZA3B 4WTZG 4XPTL 1DQTA 3BUTA 4PV9B 2EDTA 4HXAL 4F8TA 5I6KA 1SEQL 1YYMH 2XC8A 3Q9QA 1C5DB 2WYIA 3LKNA 1BVNP 3WNLA 5I23A 3EDKA 4UV4L 4RZCA 3SKNB 4LCVA 3HAEG 4WNQB 1HCYA 3KD4A 1NGPL 3ATDA 1BZ7B 1E4HA 1TJHH 2XVLA 1R33A 4X6BA 4XNMB 5KYWB 4RIRA 5L6YL 1F1DA 2W0LA 3MC0A 3MO1B 3QJUB 4XP1L 2PTUA 5FW7A 2Q3AA 3U79A 3EH2A 4CC4A 5EZIH 3NIGF 4LHUD 4K8RC 2FNWA 3WN5B 5LVEA 4OLWL 3WJJA 2KQMA 4F15C 1NUFA 2OQJA 2XKSA 2Z64C 4LASH 2X1PA 1Q4NX 4LESA 4P2QA 1P7HL 4Y9EA 2Y1ZA 1ULVA 5LWYL 1ZTMA 2DI9A 3VNYA 1ZHLB 2GITB 1BVLA 1QHQA 3IETB 2DQHH 3PWLA 4POZD 1J9TA 2PCYA 3VFMB 5A1AA 5F7KC 4KX9A 1V3JA 4XCCL 4YDLC 1KYOK 4MSWB 4DP6X 3DETD 4TQ8A 4XBPA 4D0BB 3VGDA 3BCDA 4DO6A 3CQQA 4ZXBA 1RUPH 1F4WH 1R4XA 1INDH 5IOKA 5TDPA 4HS6B 1X9QA 4ZO6A 3ZSSA 4JUTA 2CO2A 1MI5B 1AI1H 4WI7A 4OV5A 4XVUC 1T0OA 4JPWL 1CFVL 1FZOB 2HLEB 3B9KA 4TNGA 1O75A 3R7RA 3WIIH 3R0NA 2FT8A 1D7FA 3K72A 3I02A 2A3TA 2JV6A 4YXLL 1N6QH 5E2TH 2AJZA 4NDMB 2DWSA 4DOHE 4F7TA 1KFAH 1A2YA 3JBG7 1R46A 1VGKB 1KNOA 3HE7B 2P5WB 3VRJB 4XPGL 1XGPB 1RXLA 1MLCB 2J8HA 1BPVA 3RIFK 3L3JB 2FJSA 1RSFA 3VGFA 2I25N 5CGYD 5AW6B 2VW7A 4PJDB 1CGTA 1MPAH 3UTSB 4PGBB 4KVNL 4NKMA 3VXPA 1KTBA 4GW1B 1KWKA 5EU6A 5TPWH 1TZAA 2O5YL 2Y25A 4R90H 5LKNA 3FFDA 5FLUA 2ZPKL 1XEUA 1I1AD 1TJIL 2YMTA 4XMPL 4F2MB 3RTQA 3SDYH 5E8DL 1S7TA 3PIQA 2PO6D 4YE4H 1U8QB 3TJHC 5JA8B 3WTWA 3MRPA 2EE3A 2VN7A 1D5XA 4Y4FC 3TJEH 4UU9B 3LZQA 4JMXA 5F0PB 3U6XA 3MGAA 4JO3H 4ODTH 1N59A 5A3ID 1WVZA 4MA7H 4MDIB 2Z8RA 3EIFA 4UZUA 1RUAH 4BHUI 4UINH 5AZ2L 4YDLB 4A68A 2G9KA 3MA9H 1UADC 4KZDH 4ZPVB 1G84A 5GS1C 3VGAC 1PLGL 1MAML 2N4IA 1G1YA 4HLJA 4ZTOH 2J55A 4GW5A 4DGUA 5EU3A 5D7HA 5FYKU 3VXSD 4EE2A 4YHMH 1HEZB 1RH8A 2WLMA 1LDPH 3EOTH 1RZKL 3DV4A 3EBIA 1PY0A 5G4OA 2X2HA 2XXGA 1SF5A 2BP8B 4Q52A 2ZAHA 1WRFA 2AERT 1KBGH 1KXHA 2XUWA 4WK2B 3NJHA 1WA0X 4MJ6B 4M62H 3EO1A 3QAQA 1NMAL 4WKZB 2D7TL 2CJUL 4OCWL 4CSPA 2ZJSL 4M56A 4BUQA 3BVVA 3INOA 1WFOA 2W95A 2WXLA 4P2RA 5EC2A 3DUUB 1JVKA 1KFAL 5BZDA 3SHSA 4MMXA 4O02B 4R26H 2GVYA 4TNEA 3AWEA 5AG8A 1GZHC 2DBLL 2A2QT 3HBZA 2V7HA 1BZQK 1GKOA 1YEEL 1MIEH 3IFPB 2J57A 3O3BA 1M71B 1L6PA 3EYSL 3B9KC 3VFVB 1NIAA 4HG4K 2VISA 3DTXB 4L2YA 2FCBA 2Q8BH 3CLFH 3VQMA 2D2CC 4DP7X 4GQ9H 5DMGD 5KS9F 4PG9B 3SPHA 5I66B 3F12A 3TURA 1QX1A 3BUIA 1SFDA 3Q3GA 5GGUA 3EHBC 3EF4A 2H6UA 3HG2A 4B96A 4ZFFB 1PSKH 3KW7A 3EYFB 4FL4C 1ORSA 4G6ML 1BHGA 1N0XL 3FTSA 1JJUA 2XVBA 3NFPA 1T4KB 4Z8FH 5EF0A 1WBZA 3RUGF 2APBA 4I48B 3D51A 4XNQA 2OK0L 3HLAA 4XCFL 3B1TA 2GJJA 1E90A 2DIAA 4TXVB 1KIRB 2FJHB 2J2ZB 4P04A 1MHHB 1MUJB 1AZNA 1UT1A 1MCRA 1DBJH 4PJEE 5GGSY 4DETA 1DJZA 2XY2A 3W9DB 5IR1B 3TN0A 2A9NH 1IFHH 4LSRL 1IGTA 4Y4FD 1DQJB 2VLKA 4K2UH 4N6RA 1KCUH 5EFIA 3RP1A 1QRNB 1FVEB 2VDRH 3QULB 4PP1D 4PRHD 4PRBB 4B3EA 4GMSH 1FL5A 2GSIA 3IEAA 1I8AA 1D5ZA 4PMFA 3MV01 2JNZA 1OAKH 3US0A 3OKKA 1PCSA 3FO2A 2YBRA 4M3KB 1EAJA 4FQCH 3CX5K 3SDXA 1CBVH 2GC4C 5T1LA 1FORH 4NPYB 5C2UB 2ZCZA 3DO7B 3CFBA 6CGTA 4RX4D 5CMAB 3W82A 4GSUA 4K3GA 3FCBA 3LKOB 3PHQA 4G7VL 1SXBA 5ICZB 3EHBB 1QKZL 3L2MA 3PJSA 2AEQL 5IEHA 4HWUA 1KTCA 2FEEL 3ZL4H 1GZQA 4FL4B 4QHNA 1J11A 5CP7A 2VM4A 3L5IA 3LTVA 4QYAA 5K39A 2CBMA 1UD6A 4M6NL 3FCGA 3TYFA 1DDTA 5IQ9B 3S34L 3L95B 5E4AA 5T3ZE 4HFWB 4XBGB 2CCWA 4UOZA 5J6HA 1EA9C 2CDEA 1HXYA 1NIEA 4BZ1H 3VXRD 1X44A 4O2CB 3UROR 4YSPA 3F62A 3BQVA 2EH7L 2PF6A 3D39D 3NSFA 5MI0B 1Z9SA 2R1WB 2VDOB 4Q0XH 5ITFA 3P77A 1YUKB 4UB0H 4MQSB 4NXSA 3ATFA 5IUCA 4IRJB 3PWUB 1B4JH 3QA3B 1HXMA 2A9CA 3ECVA 4BZYA 3QWNA 1ZA3A 3VX0A 1SJEB 3N43B 1JGUL 2AJZB 4NDMA 4FA8A 4A2LA 4JQIA 5EUOB 1A2YB 1OAQL 2CLVA 4MNGB 4NKDA 5CEYB 3AITA 3FFCE 3VXTB 2JJSA 1WSST 4R96A 4JY5H 3WIHL 3HAEB 1YEFH 1C08A 3QJOA 4GW1A 2CJSA 4XMZA 1E4JA 3HB3B 4TTDC 3NA9H 1A14H 4HJTA 2QKSA 3TT1H 4QTIL 1AR1B 1SFHA 1T1XA 2JE8A 3ZVVA 3D25B 4JHWH 4TLSA 5GRYA 4N90D 1T22A 3OG6B 4NLAA 1N0XH 4OBRA 1UWEL 1YUHB 2AITA 2FDBP 2NNXA 1A1NB 3QZWB 3PNWA 1RUAL 1MEXH 2R29A 4KRPB 5I1JH 1BF5A 2YZ1A 2HUHA 3O4LA 4M7LH 3B9VA 4G6KH 3UTZB 1N19A 4JREC 5F1OB 5CU5A 2EDOA 4R5VA 4F92B 3T09A 5LBSA 1S9YB 3P9MA 3CMOL 3CMGA 3CQFA 1Q9WA 1XCTB 5F96L 3RVVD 2GUYA 3NZUA 1DFXA 4JRLA 1EFXB 4EN3C 1F4AA 3JQOB 3UABA 1BVKB 4GW5B 3SE4C 4N3TA 3HB3D 4LLDA 3LRGA 4RESB 3TA4D 5CSBA 2HG5A 3JTTA 3VH8G 5DMIH 1NDTA 1WFUA 2JK5B 2NY6B 2AF2A 3CK0L 2ZUTA 2AZUA 1KGWA 3WTVA 4W9ZA 2GSMB 2QPDB 2XV2A 2OS7A 4HH9B 3MV8E 4AL8L 4YSOA 4EUPH 2I60L 1R1CA 1Y1DA 3VRJA 1T83C 4JMNA 4XMLH 3MRBA 5I2IB 2N56A 4OGXL 4FQXB 3I6GB 1N67A 1HJCA 4NQDE 3WKMH 4XMVA 4X6DE 3GSQB 4RMSA 2DQTL 2P48B 3ZIYA 3HB3C 3JV4A 3KYMA 5DRNB 4AC2A 5GGTL 4F2MA 4Y4HC 1Z6JT 2VC2L 3EDEA 5L8KB 5JPMA 3IWVA 5ID0A 3ROOB 5AUMA 1IC5L 3OB8A 4NC0B 3O0RL 4WGVB 5AENA 1GZPA 2VISB 2WKOA 2DWXA 4F7CA 1FNFA 2E6QA 3VSQA 1A6WL 1UB5A 2CO3A 2MPVA 5C0AD 1NGXB 3CHPA 1CLVA 4YLCA 4PRNA 1HOCB 2Y5TA 1D5IH 1TXKA 2V4LA 2NNRA 4W9EC 3JWNE 8PAZA 4I0PC 2GCYA 1HE7A 3KPNB 1F4YL 3GWJA 5LXVA 2CJTA 2N7BA 5IHZA 3POHA 2ZCLH 2BSRB 3T6XA 1IAIM 4OI7A 2PABA 3U7WH 3VYOA 4JFDE 1S78D 1MCBA 1WYJA 4L1TA 1WBXB 1UD2A 3UZQB 2JELH 3DO3A 2V5MA 1OK0A 2FNBA 4TSCL 1BM7A 2IAND 4NUGL 4KXZI 3NJGA 1KPRB 3EGXA 1MRFL 4PJHB 2YXWA 1J1OH 1BM3L 2MQGA 2Y0SA 2WNKA 4FGMA 3UADA 5AOIA 2DH3A 4UV7L 5I30L 1IGFL 1L0PA 2EDYA 1HN1A 4QJ4B 3MXWL 4FLHA 1D5ZB 4B9IA 1O5PA 4L4TD 4KGJA 1SDYA 1I8LA 1I85A 2G4GA 4APXB 1G5AA 2EIKB 4X0KB 2FAUA 3OXRA 2R9HC 3DTXA 3F5WB 1KN4H 4WI8A 5EDSA 2A6JA 3MBEB 5M95B 1A6WH 4HG4J 2VL4A 3W39A 2Z9TA 4NZUH 2MPAL 3S96B 1MCEA 4ONOA 4Y2DD 4KZEL 3KWUA 1FH5H 1IILE 4M43L 3Q06A 3ERXA 3GJEA 2B1OA 2VZ3A 2GIXA 2O6PA 4QHNB 1HEZA 1PG7L 2Y69B 1A64A 4MASA 4ZS7L 2CLZA 1WBYB 5HJDA 2ZYHA 3QYCA 3KPOA 5GGSB 1WBZB 1IGIL 2YFOA 4XO4A 1S7SB 2TSBA 1MHEA 4S1RH 1A7QH 4ODVH 1BXXA 3HC4H 4FQ2L 2FUTA 3FHEA 4PP1C 4XN1A 2PNDA 3T2NL 4E42A 3NJIA 1MHHA 5ITFB 1N3NB 2NTFA 3O3AB 4H8VA 4QNPE 2P28B 3IDNA 4AIEA 3QXDA 1WD8A 3S8FB 2OP4H 3RTLA 3RNKA 3QWRA 4E9TA 3ZT5A 3SKOB 5DS8B 4E9VA 5JHAA 4QYOB 1EJ8A 4AYFB 1L9TA 3T6ZA 4FA6A 2DWYA 3GFUA 4P3CL 4HX1B 2V7HB 1FIGH 2D7TH 4JVPA 4Q9CA 5C6PB 1OP4A 1OAXL 5BZXA 1VFUA 4DUXA 3ARZA 3ULSB 2PWFA 4L3ED 4HUVB 2DZEA 2YEZB 3CLEH 5DJAA 4Z7OB 3UBHA 1PLGH 3BT2H 1FN4B 1K4CB 5DJ8B 2AJUH 1AKPA 1UCBH 1IIKA 5CZVH 3EGSA 3ILDA 5J13C 1A4AA 5FIEA 4Z7NB 3BAEL 1BMWA 3LRHA 2BNRE 4X6EB 3H2WA 4E2OA 4NCDA 2WVUA 3Q3GB 2IAAC 3VG0L 5MHSE 3C6LC 1Q94B 5D4QA 5K1JA 1PKQA 1UA7A 4CSTA 4ZMOA 4XAWH 1OPGL 5CBAB 4MCYA 4XVTH 3UTZA 4I0KA 1C16A 3FSWA 3MBXH 1OTSD 1SHXA 2Q7AA 4OM0L 2X1OA 2PO6B 3FN0L 5DC4B 1ZS8A 5G5DB 4MVBC 3D2UB 3TYFB 2F1BA 1KUMA 4I2XE 5I5IA 4J2QA 5DUBB 2VXVH 3VXOA 2OMUB 5L7XL 5I6NA 4EN2A 4YHOL 3EO9L 4TSBH 2VN5A 3DX7A 3ARBB 1OAUH 4YE4L 4ZFOA 1MWAA 1KDIA 1REIA 2OMTB 4QRBA 2LLNA 4D9LL 4DPRA 5DHDA 1G6RH 5IW1B 3T4YB 2AI0L 5D1QE 3U46A 3ESUF 3L54A 4G43B 4ELKB 4YEEA 5C2BL 1D7CA 1SJHB 4H5SB 4DTGL 5E9DD 4QRUA 5E95B 4C56D 4UI2A 4KJWC 1CMOA 3DROA 3TBSA 3PXJA 1FFPA 3OR6B 1JGVH 3E1ZA 5D4JA 5L2KE 4RRPA 5A16B 1C08B 2JIXD 1QFPA 2XPYA 3WL9A 1A4KA 1U93A 5E6IB 3VD5A 4YDNA 1FFRA 3FT2A 4AKOA 4ZRGA 5A2JH 1ZSDA 2VCOA 4GH7B 3GXTA 1I4FB 1G1OA 2CM5A 4L4TB 1MJ8L 1PDKB 3E6HA 1YUHA 2X09A 5IBLD 4S1DC 3ESVF 2WCSA 1YO4A 3N5AA 5TTRA 5GGVY 4Y19B 3VXSA 3PJSB 5IEHB 1G6VK 4Z7VF 5HHMD 2ICWI 4JQIL 3X17A 5CP7B 2AJXH 4MLSA 4FQQB 4OZFB 3CIQA 2PO6C 2AAVA 4N8PA 2F7QA 4N2IA 1OGTA 4PR5A 3GJFA 4ADJA 4YEFA 2IH9A 4GKZB 4JCMA 1NBCA 3KDMB 4NAQA 3SN6N 4MFHA 1IQDA 1PX8A 3BD4A 5D7EA 5BJTB 4UTBL 3QUMH 5DRZB 4D7BA 2JKJA 1ZT4A 3MV7E 1PEWA 3O2VH 4FMVA 1U8IA 3NQKA 1AG6A 4G9FA 3T2QA 3VU2A 4X99B 3LMJH 1H19A 5E24E 4MXWL 4F57L 3FO0L 3GXNA 4CC1A 2XICA 2OSLA 4JFUA 1QOKA 3TPUA 4WO4C 5I6LA 2ZWKA 1MG3C 4JPKH 5AKVA 3SDAA 1UD5A 3VFRB 1IC1A 4FNLL 3VTAA 1XBDA 2JCCF 4I0PA 3SE9L 3UO8B 2ZXDA 3QXAB 2ZD0A 5KSAB 3GIZH 4TNVK 3QPQC 3EG9A 2DQMA 4RWYH 1UACH 2CIKA 4KMTL 5TD4A 1GJIA 2BM3A 3GT6A 5KSUA 2DWEA 3VGEA 3KWVA 1H8SA 5T1MA 1KJMB 1DBAL 1T3FB 1U8HB 1TQVA 3A6CH 2VR6A 4HUUB 1OGAD 3WTXA 2I27N 4W4OC 3L7FA 1EXUB 3D2TA 3CFTA 4NZRL 5LLIC 5D8JH 1YPZB 5D1XD 2BERA 3ZKMD 3OWEA 4LEOB 4P46B 4YDVB 4Z7VA 1JVLA 1HFUA 1EBPA 2QKIC 3FT4B 2WQAA 1L0XA 3J7HA 4MJ5B 4HQQL 1L9MA 2LHAA 2XTLA 2TRYA 3C5JB 5DQ9A 5FUOH 4D0CB 5F3HA 5FR3A 4H20L 2CR6A 1OARH 3IPBA 2IV8A 3ZTNH 2A4CA 4KO9A 3H7BA 2XYBA 4Y16B 5CF3A 1JSYA 3V8OA 1FJ1A 3VXME 1JPSL 2P5WD 3BH8A 1IBBA 5PCYA 1U21A 1FZJA 3QO0B 4JDVA 1CI5A 2J7LA 1MW1A 3MUY1 4ANVA 2YRPA 4HV8A 2C9VA 3SKUD 1HHHB 3IRPX 1W16A 2W59A 4LHQB 1OP3H 1P6FA 5FF6B 3BWZA 4JPVH 2A9BA 5FKPB 4ETYA 1XF3B 1T0PB 5KW9L 1ACXA 2DKSA 3TV8A 4PJIB 4Z1PA 2VR9A 5BVPH 2OR8A 4YGVB 2FR4A 2XWDA 2G0LA 2QMKA 3LOWA 5L7XH 1RZ7L 1A0QL 1SM3H 1RUKH 3K1KC 3OXSA 3QUHA 2GC7C 1HH6A 1IKNA 3QIBB 4MJID 1OEZW 4ONHA 5MI0C 4APXA 4IBUA 3U0PB 3A3YB 5IFJA 2I85A 1S7RA 1PJ9A 1DLHB 4E9QA 4UF7C 3GXDA 4NUJB 3DI3B 1BPLB 1ZOXA 3FSOA 4GW4A 4F8OA 2UX7A 3HTLX 5CN1A 5C0EA 2HJKA 1OAZH 4HT1H 5E1HB 1Q94A 1P9MC 4YSCA 3GUTB 1MSPA 2V5SA 3EJZD 1Q8MA 1BQRA 1THAA 2OMVA 4HZLA 1T2QL 4X9YA 4XAKD 3V79C 4FKEA 4MZ3A 5I1DB 3CHRA 2XZCH 3OLDA 3V8CA 4LCCB 3BEVB 2G5UA 5EBWA 2GJ6A 3F00A 3MBED 1KJ2H 3BT0A 3TF4A 3B43A 4X5WB 5FYJL 3TZVB 1JV5B 2HFGH 4QAWA 2L3BA 2FIRT 2VGLM 5E9DA 4AK2A 2LU4A 1M1XA 3IDGA 4JM2F 5FDYA 4CBPA 2JIXB 2ICWA 1NEZG 3V7MA 3SJVE 4JFXB 1S7VB 1FO0B 3NCXA 1R9FA 3K6IA 3ZTJG 2RFXA 4HIEA 1XWVA 2WZ5A 4RGMC 4Z7NE 1L9PA 4NO3A 1WC7B 2BDNL 3GKZA 2JWYA 2WBWB 4HZAA 3ZKXB 1KCVL 4LAJH 5C0DB 4PLKD 3VFOB 1NCTA 1OD7A 2MNJB 3FBKA 1NKGA 4X50A 4N2CA 2Q86B 1SYVA 3BI9X 1MG2C 1TQBC 2EIDA 1AOZA 4PGEB 4K7PL 1T5WB 1ZPLA 2XN9A 4LCWE 5AVSB 3WE1A 3CXDL 4UTCA 1UASA 3UH8A 2PLTA 2DQEH 2MQ0A 3STZA 3OXRB 2OMBA 5CNHA 2JKNA 3H9ZA 3S36H 3RVUD 4QT5B 4BA8A 4JRXA 1D5RA 1BVLB 1JF5A 4KHXL 4ZPTB 5DWPA 1D9KC 4X7TA 2HFEA 2HVJA 4XBPB 4KJPC 3B2UD 4HC1H 4U1MA 2WUBH 4AQZA 2HG0A 4LCYB 2WWNA 1E4WH 1C16B 4K5PA 2HFTA 3WTTA 2FH6A 5BV7C 4DVBA 3GBNL 3CCHA 3MRDA 4NOFA 1BFOB 4WV1B 2NXZC 4ZUUB 1OB1B 5T3XL 2ZOKA 4FXLA 3PHAA 1UXSB 4JL2A 4U1HA 1CBJA 1JPTL 1NANH 5BOPA 2CA3A 4N0RA 5GSRB 1KELL 1GCYA 1OGTB 4PR5B 3ZUNC 4Q6IC 2V3FA 4MXQD 2L0DA 4PV9A 2WIMA 5DRWA 4HEPG 3T2PA 4NLHA 4Q58C 3TN0C 1VGKA 1RJYA 1NH6A 2WSKA 1QWNA 4NWTL 5IW3A 3F01A 4OD3H 3SYAA 1QPXA 4AMWA 4PWJA 4YHNB 3UAEA 1F13A 3SKOA 4BK4A 3BP5A 3SD2A 1YMMA 3N41B 4ZW6A 3PP3K 5HXMA 1AYRA 5E5UB 1AXSB 4PHXA 3VFTA 2DPKA 3IJSA 4R0LA 4I0PB 1ZVSA 4L5FL 4LLVA 2HT4C 4WW1A 2P24A 4U4IA 2DIBA 2F0CA 3MRPB 2WO3B 3D4ZA 3FBQA 3DSFH 4U1KA 5TF0A 3SKJH 3ZDXE 3T3ME 2Q9OA 3Q48A 2MHAB 3QDAA 2VC2B 4OJCA 4Z76A 2E9JA 4M1DH 1KEMH 2C1PA 5H35B 4UAOC 2AABH 1Q9LA 3NOIA 4ZFOL 1FYTB 3F64A 4JE4B 1UVQB 3D5OF 4XNAA 1A1MB 1ADQL 1BYPA 2IADB 1MLBA 2KZKA 2VLRA 3LNGA 3LZOA 2EO1A 2WJ7A 5I16A 5I19L 3VD3A 3GTTA 1L4IA 3UC2A 3B7YA 1RD6A 2VXSL 5EIQA 4V33A 3JVGC 1QVOB 4LDEB 2IPUG 1MVUB 2PPFA 4WNSA 1LO2L 4EQ2A 4MYWB 3G5YA 2WZPD 5EULV 1JUFB 4HVBA 3OC8A 1P7KA 1RUKL 2OMUA 3DVGB 3QIWB 1IIIA 4JO2L 4PCKA 5INCA 5EU6D 2PETA 3QDHA 4AXWB 3B7RL 1T80A 3ECBA 2X2JA 4H13C 4F7MA 2IDFA 3EFOA 2BY0A 1TEYA 1A4CA 2H6OA 1B4LA 3HNVH 3QI9C 4NQDA 1T04B 4KI5E 3H9SE 3BAWA 3HHRB 1JGVL 4EF3A 4O51A 2AANA 3DMMB 3RDTD 3U46B 4ZMXA 1VADA 5DK3A 1TFHA 2DOCA 3L9YA 3SJVA 3LS4H 1B2YA 3KL0A 4HKXA 5AQ0A 3DNKA 2P46B 1KXQE 1J9SA 1JPGB 2F5BH 4OFVA 2EDQA 2NSXA 3PGCA 5B4MC 1PG7W 4MCNA 5F93C 1OL0A 3HRZA 1RU9L 5J1AA 4ONFL 4Z3EA 3LCYA 5T5FH 4HFUH 1XF3A 3NGBC 2GFBB 2PWEA 4ICWA 3A0OA 3ARBD 2F18A 2FWOB 4RWHA 1MHCB 1KXQA 1SHWA 4HWBL 5DHEA 2B3IA 3QEHB 2PTVA 2BIIA 1X9RA 2HKAA 1U8CB 3RY4A 5CGBA 1QSFD 1I4FA 3Q2LA 5AOZA 3H2QA 3APNA 4HCIA 3D2UD 3F12B 5D2NE 5F1NA 1XCQB 1Z5HA 5B7EA 3BAJA 4GBXD 5J5EA 2VABA 4HKZA 1L7TH 5E8EA 4HUUA 2HLAB 1CYWA 2C7UB 3O2WH 1GMIA 1A4JB 4WJ5B 2IOMA 3ESOA 1FI8C 3GRGA 4LFHD 3TYGL 4OZGF 3WMQA 1CB4A 1ED3A 4NNXB 3S4SB 1XGYL 3SYPA 5FYJE 3FQNB 4JFPB 4K8RH 1U8OB 2O1AA 1OF0A 3VWJD 3BVNB 2GJRA 1HZHL 5K9QG 1AFVH 4XNYL 2EADA 2HRLA 1UACL 3KDMA 2Q5BA 4KMTH 5BJTA 5JQHC 2QT6A 3I50H 4LGRB 4APQC 2B1AH 4OU3A 3OMZA 2CIIB 1A8JH 4HCRL 1HAWA 3CVHB 1HNGA 1PMYA 4MA8H 5DLML 4ZDHA 3RL2A 3D0VA 1BD2D 1OLLA 3AXLB 1IGFH 1MREL 1HL5A 1OQXA 1OGSA 2IOOA 3QHZH 1Y6NR 5LCVH 3D0LA 1G9NL 4S1QH 5DJ0B 3CFCH 3PHOB 3QULA 4UT6L 4EOWH 1R0AH 2GEQA 1MRFH 2JJUA 3SE3C 1A47A 4QRQB 2IALB 5BOZG 1AJ7L 1LEGA 2B1HH 1Q72H 4G6FB 4NNPH 4RDQF 5J3HC 5LQBL 2H6PB 4UQ3B 2LU7A 1UH4A 4K5OA 1M71A 5CFHA 5D2NC 3MRRA 2RCSL 3SDXE 1A7PH 2P45B 1KELH 2CKBH 3IFNL 1N6VA 2QELA 2VN3A 1LE9A 2H1PL 3RY5A 3OR7A 1FE8L 1NSNL 4BE5A 3ARBC 3SKMB 1AD9B 1MXDA 4WWPA 3V6OA 4ATTA 2X1XR 1ZVYA 1ADQA 4G2AA 4PN6A 2V3EA 4JAMB 1TTUA 4HS8L 3HKFA 1PLBA 4HC1L 1GZQB 3L5XH 2G3ZA 4NSKA 5L4MA 5FAAA 4DN3L 3L4UA 3MRGA 1IC4H 2COQA 4FFZL 1H5BC 1ZTXH 4JKKA 4U7SA 2H32B 4ZUVA 3LKQA 4ZMPA 3O2DA 3O11B 3VQLA 3L7EA 2JKWA 2Z6FA 2HTKD 3NSCA 1LP9A 4IKNA 4UQ2B 1M56B 4JGJA 2DW5A 2QTVA 1R3JB 5E8PA 1XMWA 1E6OL 3FB8B 4P2QD 1J5OH 2R83A 2G5RA 1ACYH 2VOTA 1EHNA 2FBJH 2XJKA 4JO1H 2QVIA 3RFZB 5E6IC 3ETTA 2IAMA 3LHPL 4PGJA 1THCA 4OZFH 3IJEB 4X6DB 2G30A 2OTUB 1UD4A 2XKUA 3W81A 4YPGB 3K0YA 3PL6B 3LNIA 2Z1PA 4HV8B 5D9SA 5BS0B 3BFOA 3V4VB 4JFXA 1HILA 4URKA 1F58L 3T6VA 2VITB 1BGXH 1BIHA 1CR9L 4BA0A 5FLVA 3DIDA 3C6LA 3IMWA 3Q2CA 4F5CE 4CL7A 4OGXH 4I85A 1S5IH 1G9EA 1RZJL 2WLKA 2YJLA 5D7IE 3IMTA 5KSBE 4P5TD 2QSCL 1TJXA 1KB5A 3GTNA 4YGVA 2P5EE 3K2MC 2ZUXA 4R4BB 4HS3B 3TBCA 4MQ7A 3CVDA 1T1XB 5FCUH 3TTYA 4N0CD 5AL0A 3FOMB 4ABVA 1Q9KB 1KTDA 2GSGA 5FM4A 5C7XH 3LKOA 3PHQB 2CO6A 4ALAL 5CXPA 3IFOB 3N40F 4PV1C 2OYMA 1NCBH 4XRCA 3WYRA 4B3VA 2CNYA 5IVXE 2C1PB 4XP6L 4I2XA 5IKCA 3ZSTA 5IVOA 1FFOA 2X3CA 3LZLA 5FFGA 1S9YA 3A22A 3MV11 1MLBB 3IE9A 1Q9WB 1XCTA 3HUJF 2WVTA 1KYDA 3SZKC 2HJLB 2J56A 4M1CD 4HFWA 1JGEA 2ZWSA 3I6KB 5SWSA 3T71A 1VKXB 2DQEL 1XFPA 1BA9A 1Z9SB 2R1WA 4H8WL 4P57A 4HH8A 3WFDH 3D8MA 4E5XG 1SMDA 3ARFA 4FQIL 4NGHH 1R5IA 2WXIA 2YGQA 12E8H 5L88L 4JO4H 1XGZA 5GGVH 1LWRA 1ORQB 1MFDH 5G4MA 4AXWA 1NFDF 4GY4A 4BKLA 1RZFH 1S7WA 2AEIT 4OZIE 5SWSE 1RJYB 1XDTT 1BD2A 1AACA 2AI0H 3HIZA 1EZLA 2V9RA 3CC1A 1OOWA 1YEDA 3PL6C 4KTEL 4NQUA 4Q2ZA 4UUJA 2IBZX 4HEME 3UIYA 3S5LG 3EBHA 4PJ6A 1NUGA 1PG7X 5B3SB 5F1SA 1CURA 5B39A 5E6SB 3TNNA 1O9WA 1JOIA 2WTRA 4YIQA 5ESVA 1TZIA 2KZBA 2CHZA 5G2NA 3BP5B 1NPNA 1QFWH 3FQ2A 3NN8A 3OBAA 4IIQC 1LTXA 4DT2A 3BQUA 2EUXA 1U2YA 3ME0A 2EABA 1K3IA 1CJYA 3VFNA 1ZE3H 4LLVB 5JPMB 3GM0A 3REVB 1AMYA 15C8H 3H9YA 2WPGA 4LVOC 2R1YA 3LEYL 4GIOA 3CK0H 4LSQL 4W70A 1L6XA 3BE1H 3JUYA 4FX5A 5EBGA 5T1KB 1S9KC 1D5IL 4MBRA 2DLTA 3EJQA 3ARSA 4X7TB 4UBDC 4U1IB 1EFXD 4B9KC 4FI7A 4HIXH 4N8VB 4G82A 1TCRB 2Q8AL 5EORL 3FUNA 2W60A 2OA9A 3A24A 2QL1A 3MQIA 3EYVB 5JW4N 4LU5L 2JKLA 2YN5A 4PRNB 5CKGA 3J2PA 4NPJA 5CSGA 3DX9B 4UQEA 5MEPB 3L5JA 1DJYA 3EOBB 2XSKA 2XXMB 3AT9A 3MNMA 3Q05A 3QFDA 1XH3A 2YXMA 4JN2B 3EBAA 4U1HB 5GRVK 2PN5A 5EOQH 3ZLQC 5K69A 3P0GB 1U8OA 1U30A 4LAQH 3OKOA 4XT1C 5E2WL 3FXIC 3U25A 2FYVA 1QHPA 4U3SB 1KY6A 1EERB 1AANA 1ZLSH 5ICYB 1ROWA 3WHXB 2O26U 3DX4A 2VQUA 4G3YH 1PY9A 2QGCA 5JOEA 1P4LB 1IFGA 4LHUB 2JTYA 3VM5A 1OHQA 1CFNB 2ATKB 2N3JA 1SLVA 4WWKB 4ES9A 5BVJA 4WU5B 5C0IA 4GT0A 2DD8L 4YXLH 4K2UL 2AK4E 1EJOH 5GZNC 1K2DA 4HU8A 3FRPB 4PI2A 1EX0A 2LU3A 2Q1EA 2X7LB 3NP4A 5I73B 1RV6X 1X5MA 5DRXB 2D3JA 2HH0L 5JPMC 3A4FA 2KZWA 4B27A 1TZGL 4LCCC 3LIUA 5FYJD 2APTA 1T7WA 2VE6B 3P11L 3HS8A 3O41B 1KXVA 5IW6A 2A9DA 4OIFA 1SDDA 1XF2B 4I89A 1IARB 3TZVC 2C9RA 1X5IA 4QHUA 1I8KA 4B5EA 5IESL 3KNBA 1YJDH 3DJ9A 3QI9D 4IBTA 4R2GD 1ZY9A 3ZDZB 1PG7H 3SO5A 3ARGB 3ZRSA 3NFNB 4JG0H 5D7JB 3DX2A 2L7EA 5IFHH 1VCAA 4AEIL 2YD4A 1ZDSA 3EHBD 3P3SA 3SPVB 3D30A 2IDCA 4OKVA 1FL6B 3VXMA 4G6AD 2WHVA 2A9AA 3U7AA 4PH8A 4WEEA 4Q6YA 4JFSA 4LNVA 3U9UA 1F1AA 4YH6A 4NENB 5FCUL 4PYHA 2BSRA 2JJWA 3JT2A 3QCUH 4ZFGH 4QXTB 1UOLA 4PCSA 4H26A 3N43F 3HI5L 2QPFA 3E80A 4LP4A 3TA3B 1XCWA 1E9PA 4GBXB 5D7KE 1X6NA 2AKRB 3QSKB 4DCQB 1LD9A 1VFBA 3DMMA 4N87A 5JR1L 1D9KB 1IRAY 5ACZA 3VFGH 3D0VB 1KEGH 5DD1L 3MNVB 1BJ1H 1KXTA 4A7QA 1NPJA 2OTUA 1RL1A 3U82B 5LAPA 1AGEA 2YD7A 1MCIA 2VDRL 5CHNB 3ARQA 2X70B 4B9PA 1C5DA 2DV6A 1B4JL 4GI6A 4XP9H 4JLRA 4NHCL 1B0WA 1YN6B 3LEXA 4JG5A 1FDLH 2XA8H 2DLFL 4X7SH 5C0FB 4AYDC 1QQDB 4PJFE 4YK4B 3U1PA 1YG9A 4XP4L 2YA1A 3ES6B 3BESR 1LEIB 3FTGA 3FHQA 3FTXA 1CXLA 1LNUA 3CVCA 2Z7UA 1MWAL 2J3SA 3KHQA 4KWUA 4EI0A 4NP4L 5KTEL 3P3TA 3OC5A 4PJ7A 4OGYH 1EZUA 4X6EA 4PJXE 4Y5XB 3K46A 4NO5B 2OQJB 1LO0L 4PJBF 5TF1H 3FTUA 5L2KB 3RZWA 4MQXD 4HJ1A 3UG5A 1KYUA 1PKQB 3W2DH 3L2LA 3K8KA 3SYOA 2FGZA 3L4XA 4WNJA 3WEBA 4WO4D 3BXNA 1DUZB 2B59B 4L4VE 1XGUB 2YAOA 1RZIA 2X6VA 2H32A 4ZUVB 1ET5A 1VB9A 1Y0LB 4IDJH 4WGWB 4WUUA 4OD1H 5TDPB 1Y07A 4BINA 3VXOB 1ID2A 3T0EA 3QDMB 4HMDA 5I1EH 1SBSL 5DJDA 1GGTA 3HN5A 3FB8A 1QWUA 3IT8D 3LRMA 3HKZA 4J3OG 3L13A 4LKCB 3U6RB 1N5YH 1J8HB 1VRSA 2B3RA 4HIQA 2A6KA 4ZX5A 2AJSL 1Q72L 4LCUB 1VEPA 3EFDL 3LYRA 4TUOA 4HF5H 4BH8A 1KIUA 1MFAL 3FO9B 3OAZK 1EHLH 4QRUB 4PVNA 3CFEA 2OP4L 1G9MH 4X5XA 3S5YA 5F9JB 4HX1A 3Q2WA 3R8BB 1F00I 4R5TA 2H6PA 3TONA 1CXIA 4XMLL 3RIFF 3PWPE 4UT7H 3T08A 2I60H 1MCFA 4UANA 3QJFB 1USZA 1NUNB 3VD2A 5A43C 2ZOOA 3APDA 3KG5A 4OV6F 2BS9A 2Y23A 5I1GL 2PR9A 1MJUL 3HAEH 3N1GC 3VFNB 3LSOB 3QCTL 3ENEA 2Y36L 3A4DA 2XG4A 4ATWA 2XZAH 3CFUA 3K7UA 3QZWG 4YHZL 1YMME 2IV9A 3UYPB 5C6WH 5L4FA 5CIPA 4GSDH 4OM1H 2OV0A 1CFQA 2I9LB 1HXKA 1QRNE 5CAYB 2BNQB 4TYUA 4XPFH 1QG3A 2ICWJ 4U1IA 2BP0B 3SCMA 1U8MB 3B1UA 3DK0A 5DEFA 3MJ8B 2XPGB 1MJUH 4NRZB 2DM3A 4D0BA 5TF1L 4PJ9B 4LF3A 5IVNA 2ITDB 1YEIL 4H25B 3BGMB 5BV7L 1W9XA 1VZGA 1IBHA 2KLSA 4JO3L 4ODTL 1FLTX 2HH0H 1NWPA 1NKRA 1UATA 2NY2D 4GI9A 3JWOL 4JM2C 1ZVHA 3K8LA 5C0JA 5BRZE 1ZT4B 5KEZA 3OWRA 2FLRT 5E8DH 4KJQD 1YRKA 1ZD6A 2WO2B 4ACTA 4OLWH 1GC1L 1IBYA 3GHBH 3I02B 4WWID 5AG9A 4I8DA 3T4YA 4K3DH 2W81C 4NHCH 5DHVB 3TEYA 4OCNC 4YVUA 2WYTA 3DVNB 1MFAH 2DQCH 3DVFA 4FZEL 5C08B 1LO3L 4EN3A 3RZCD 2ESVB 5GIRB 4N0YL 1OP3K 5CWSA 3OF6D 1U4FA 2GKIA 2I07A 1QEWA 4A7UA 2K7PA 4FF9A 4DQAA 4UIMA 4YO0A 2OXHB 4L1BA 4OY9A 4DZBB 5IWLA 3LY6A 2FJFB 3IMSA 1DQML 1KC5H 2X4OA 1JGUH 3MV8A 3V6FA 5LN8A 1KB9J 2X9ZA 1NMBH 2W94A 3RTQB 3FOMA 1LWJA 2VDNH 2ZCHH 4YQXH 3UO1H 4BRJA 4APQB 4YDMA 1ZKAA 3WIIL 1JCKA 1AZCA 1MW0A 2J43A 4R2GC 2R2EB 4NBZB 4JDTL 4ODXB 4WKXA 1QACA 5IREA 4DGWC 4NP9A 3ETSA 1ZV9A 4IDJL 5D93B 5GRVL 1RY7B 3C75A 4JHAL 2GIMA 2Z93B 1FFOB 1NAKH 8FABA 3UG3A 3VI4F 4PGDB 4UM9B 2JQMA 1YNTB 4JANA 4PGCB 4YDVA 2MCAA 1S5HB 2R2BA 1XGTA 1HQRB 4JBSA 4GG6B 1DLFH 2XIDA 3CD4A 1CU4H 2OZ4L 3QFDB 4QWWD 4F8LA 5DQ9B 4WHDA 1I75A 3EYSH 4JFYB 1QR1B 4KX7A 1I7ZA 4XMPH 2UYLB 4RAHA 4G8FB 3BFWA 3AABA 4IU2A 4J7RA 3ZQXA 5JNYB 1Z66A 2Y07H 4QXTA 1NEUA 2RMNA 2X9YA 3L3HA 4BKLB 5F9OL 3ZK0A 5SX4I 2WAHA 2UZPA 5AKRA 5ICYA 2AS5M 3TPUB 2NYYD 3FYIB 1ZGLA 1BMGA 3P9WB 5CJQL 1RPQA 1AHWC 1DUYB 3G08A 1IGTB 1FC2D 4MTMA 2B1AL 5KSAA 1CGSL 1EH9A 2HVKA 1K4DA 4IRSD 2L7QA 3QDGE 4PJIA 1MCPH 2WTOA 5EBLA 5C09E 4F91B 3BQUB 5CLZA 1ICTA 5ENWB 5HI3C 1A7NL 1YCSA 1NBZA 3Q6FA 2DWEB 5KOVC 4MNHA 3MODL 5KYXA 2HWZL 4HETA 1S7TB 4AVJA 2BNRD 4CMMB 3O3BB 4ZMYA 4POYA 4F9LC 1J0JA 5TH2A 3TYGH 2VE6A 5T1LB 1OGAE 2X10A 3Q44A 4P06A 4KXAA 1DZ0A 3CPUA 5EZLB 1E5UI 1GGBL 4U1SB 4XCEA 1WP6A 5DZLA 1V7NL 4KRPC 2ADJA 2W60B 3QJZA 1EJ6A 5DMJB 3DXAD 1IGJA 2WN3A 2HTKC 3QXTA 1NIBA 1MQ8A 2ARJA 1QFWM 5AVRB 2NZ9D 2WXJA 4NHUB 3RIAK 5EOCJ 3GSNB 3FQTA 4AQAA 3GGWB 3WENA 4M61A 3QWOB 2Z31A 3QQ4B 4U7KA 1J9QA 5IQ9A 2EUZA 2BP8A 4WUUB 3T0EB 3LQAH 3TT1L 1OPOA 2QADC 3T6QC 5DEJA 3TZVA 3BYYA 3E2HC 4R90L 4YDZA 3RA7L 4Z3IA 4HWBH 3ZMNA 1FLRL 3I9GL 5JW4Q 4UYPA 1ML0A 5HDWA 4G9DA 4OGQC 1VFBB 1BJ1J 2EO9A 4M02A 5F7HA 5ECGA 4R4FH 2APWA 4MD5B 3KPRB 2LLLA 3ARVA 3VXPB 3BUYB 3QS2A 2FYYA 3WMSA 2RHEA 4JY4B 5DTFA 4CW1B 1TSRA 4KAQH 1X5ZA 1SYVB 1DL7H 3FRPA 2CCVA 2WZPA 5B1JC 2Z91A 3FCTB 1WQVT 1U8QA 1YZZA 4AQ1A 2G9HB 3EDDA 1FG2A 2VIRB 4JG1H 4H8WH 3VFVA 4J3XA 1S7RB 1UOWA 1CYXA 4K3JL 1RUML 3RG1C 3ZL1A 1MJJA 1UXWA 3GXPA 4U0RB 3IVKA 3KPLB 1RUPL 5F1IA 4K7PY 5C0EB 4AKPA 4NQXB 4Y4KB 1HH9A 2VWEE 2X4QB 2K1MA 1GYAA 1TTCA 4FZ8H 4KY1H 2MOVA 4G8GE 3U0TA 3D1MC 1P84K 3BZ4A 2H4EA 3J27A 1RIVH 5HJ3A 4OFQA 1T7YA 3FDWA 2B4CH 4XXCA 5LBSL 4L29B 5I6XC 1RIHL 3OJDA 2ZOKB 4KQ3L 4XI5D 2XPGA 4NRZA 1VFOA 4I3RH 4PRID 4TVPH 1S2EA 5T3ZH 3WEMA 1HDMA 4NP4H 2UV3A 4WI5A 1QASA 1TETL 4AVIA 4F9LA 1WEJL 5H94B 4NQQA 4YZFF 2EVIA 2HT3C 2O61B 2FWLB 4LVOB 4AT6B 3DGGB 1E9PB 3PU7A 3FU6A 2K4AA 3FCUB 4LKCA 3U6RA 3BUQA 2Y5QA 2WBKA 4KOCA 5BO1H 3IDIB 5D7IA 1TVDA 3VFWB 3HE6C 1D9KA 5CR1A 5KSBF 4OFIA 2PPAA 5LCVA 2O5ZH 2R39A 3KPSD 3MLXH 3WU1A 1N18A 2MIZA 1MCWM 2YD8A 3KGTA 5IF0B 4HU2A 1XGQA 5ALBL 4FQXA 4LSDA 2NY4B 5CIPH 5E99L 4JR9H 1OAYH 4MA3B 4KUCD 2VT0A 4YC2B 1KBKA 2BNQD 2D7MA 4Y1AA 4YDJA 5KOMC 3QJFA 3N42F 3BGAA 2BJMH 2O5NA 1ZT7B 2Q6WA 2V8MA 2X9XA 1SHMA 1JNNH 3PXHA 5JHDE 3TOPA 2OM5A 3ZL2A 5JYMA 3FU7B 3K1DA 2P1YA 2MEJB 1SOQA 3M1BA 5H35A 4AJYV 5E08L 4P2OA 4OLEA 9PCYA 4APQA 4MJ2A 3C8KA 2MFNA 1FAIH 4D8PA 3QZWA 4X9FA 5BS0E 4Y4KC 5C7ZA 3AZUA 1TVBB 3G6AB 1NICA 3BSZL 3HC2A 1CVRA 3MBEC 3V52L 2R59A 4MAUL 4CVZA 1D2OA 4XZUB 4B5ZA 2DM7A 4JCWA 2JMRA 1AS7A 8FABB 4X98B 4WW2A 1PLAA 4M00A 1BVZA 1JZFA 1ADWA 3RWEB 1ZLWK 4Z7WF 3EGDA 3APMA 5IB5B 1C5CH 4BSJA 3FPXA 1EVUA 2OJZL 3I6LD 4PWKA 3NCBB 1SHSA 2QSCH 2VR3A 4MLIA 4HYTB 2GCYB 1G7LA 4H8WC 4WRLA 4AI7A 1U91B 4HWBA 5EUOF 4GEIA 5ANME 4FI6A 3K2UH 3Q6GL 3MLTB 5B38G 1V7ML 2ZUYA 2QGBA 5JNYA 4HLZG 1RHHA 4RNRB 5F9AC 2DYPB 3Q5YA 1CE6A 2YAQA 4I77H 4IGBB 3WSQL 1QRNA 2HX7A 4NKDB 2P8MA 2X4UA 32C2B 5LBGA 5F9JA 3P40A 2YKKA 4NO0D 4UV4H 5DHYB 3N1QC 5HYJA 4X6CE 5D1ZD 4G6AC 4P07A 4WW1B 4IK7A 1BVOA 2VMJA 3HUJA 3GNMH 2AMUA 3QNZA 4YC2C 1XR9A 5CBEB 5I1IH 1LP9E 4IOIB 4L48A 1CDCA 4WEUD 3E8VA 1A7BA 4MDRA 3H9SD 3Q5OA 4C4UA 2NQ3A 3LQAC 4PIBA 4NNYB 4JVUA 5EH1A 1FYTA 2XG4B 3NDYE 3PWJA 1OE3A 3K2IA 2DTSA 4LO9A 1VGEH 5TH2B 1U3HB 3DSNA 1CGXA 3O4LB 3T77A 1GZPB 3F5WA 1BQHG 3G5XB 4KXZH 5E2VL 4ZTPL 4FFYH 3N42B 1B4TA 2N0MA 3LHAA 5HHOE 1HHJA 1WO2A 4QRFA 3JVGA 4MB4A 4I1RA 4B9ZA 3HPJB 3G3LA 4K3EH 1JUFA 3O6LL 5FM5O 3DX3A 2OMZA 4CMHB 3P3YA 2ZZUT 4WCYH 5HHVL 4YK4C 3L45A 1OALA 3MV9D 3KPNA 1MIEL 3EW3B 2EYRB 3PGDA 1MHPH 3FMGH 3MOBL 1T6BX 3RVWC 3NZ8B 3BIBX 3K91A 3NACH 5DEGB 3RQ3A 3U9PL 5JUEL 1DP0A 5IHZB 3HI6L 1IVTA 3UJIH 4BDVA 3QHZL 4MKMA 4HIIA 3H3BC 1ZDQ