3M88A

Crystal structure of the cysteine protease inhibitor, ehicp2, from entamoeba histolytica
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
110
structure length
110
Chain Sequence
PHMAIHILTEKEDHATLHISFNDLIKIQLRTNPSTGYAWNIEYPTDTFSLSQDTIKAEPHPSGMVGFPSIREIQLKPLKVGTTTIKLGYSRPWEKGKEPLRSLTYSVVIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amoebiasin-2
publication title Crystal structure of the cysteine protease inhibitor 2 from Entamoeba histolytica: functional convergence of a common protein fold.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Protein binding
total genus 22
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09394 Inhibitor_I42 Chagasin family peptidase inhibitor I42
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2020 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3m88A00
3PNRB 2C34A 2FO8A 3E1ZA 3CBKB 2NQDA 3CBJB 2OULB 2WGNB 2H7WA 3M88A 3M86A 2NNRA
chains in the Genus database with same CATH superfamily
3LIZH 2WQ8A 4Z7QE 1NAKH 3O6LH 5EOCJ 3EHBB 3GGWA 2JK5A 4ELMF 4ZX6A 1G4RA 2GSGA 5DEJA 4UIMA 4G8IA 4ZNEE 2PWFA 2R29A 1CCZA 3KLAB 4LPVA 3HN3A 1JCVA 1G7JA 2LU3A 2X4NA 3QQ4B 4JREB 5DEGB 3TBWA 1AR2A 1IILE 1YEKH 3B2PA 3MDJA 2WLIB 2EDRA 2XWEA 2PTTA 4PEEA 3QCVL 4N9GB 4RIRB 1QLRB 1LE5A 5TDNB 1OGAD 5KS9B 1RUPL 1KJ2A 3HZVB 3I9PA 2X2YA 3MRQB 1G6RA 4N8PA 1EEZA 3QHTC 5TD4A 4PPTA 4N2IA 5BV7L 3LZQA 3GF8A 3SOBL 1U3YA 5DLML 2NXZD 5FA4A 2NYZA 4NPYA 4FAAB 4FMFA 3C8KA 2Q76A 3PRZA 3N44B 4DUWA 1S2EA 4U49A 4PCKA 2H45A 4X6EB 5C0DA 3CN3A 4KHXH 3CDCA 4WTQA 1X5HA 3PWPA 1Y6MR 3PWPD 5T1LB 5F3FA 3RGVA 3RGVD 1MQ8A 4GJTB 4QTIH 4GIPD 1UVQA 5HYSG 3MLYH 2VLJB 2CLRA 3P3YA 2NZIA 3WFCH 1EMTL 3GXTA 4M7JH 3FHAA 1XO8A 3AT9A 3EGXA 3IF1A 1UJ3A 2F5AL 1FZKB 2YEZB 4AEHH 4F2FA 4Z7VF 5HDBE 4QKTA 3CQFA 5C0BE 3VXNB 5DJYB 4K71C 1RL1A 1S7QB 2X9ZA 1UXLA 1HSBB 2D4FA 3SCMA 2FO8A 4S1SL 4WWKA 1MVYA 3SCMD 5IR1A 3KWWA 1BQKA 1LEGA 5EU7E 3WS3A 1FL6B 4B7IA 1G1KA 1VADA 4H20L 4XVJL 1RZ7L 3MZTA 3NVQA 1PSKH 1R24B 2FEEI 3N1GC 3HE7C 1ZIAA 5ERWA 4ZZFA 1XCTB 3D50A 4IKLA 1NAML 1ZT7A 2JTDA 2OW6A 1T5KA 2ZOTA 3MREB 3NAAH 4OD1H 3V0VB 3MA9H 3SE3C 3UAJC 2MJWA 4PJIA 2H0PA 4KITB 1WRFA 1EO8L 1WTGT 4FG0A 5K9QI 4YQXL 1GOGA 2W60B 2BC4B 3GMRA 2WTRA 3RNQB 1Z3GH 3AY4C 4YSQA 2HFFB 1U8HB 2AK4B 2WVSA 3N43F 1XVSA 1FC2D 1M9SA 2N1TE 4PJCA 1BVLB 1TF4A 2QZQA 4J1UB 2QADB 2VGLM 4KZCA 4NEHB 2PMZA 2WB7A 2J71A 3BEVA 1RJYB 4W9EC 1XEUA 4EUPG 4Q56A 4POZC 5SWSE 2CO3A 2DYSB 4X4MA 1RPKA 2V17H 4G8FB 1BMWA 4XMXA 3UCRA 4R4BB 3O6KL 4IMLA 4OLUL 4P9HL 5TTRA 1UKTA 1HIML 5CSGA 2HRPL 5B3SB 1K6QL 2LAGB 3K5SA 3FMGH 2D73A 2VUKA 1NM9A 2W0PA 5DI8A 4HAFA 3V0JA 1E90A 3IDGA 5IVZA 4Z1PA 5D2NA 3K6IA 4ZMLA 1BM7A 4ZW3A 5F7EL 3SDCC 1S7UA 3TCLB 2DW5A 3L3KB 4M8VA 3AG4B 4UT7H 3N1FC 1FSKC 1S9XA 2H1PL 4TKWA 5FCUL 2V8LA 3A4AA 3MAWA 4JE0A 1HESA 4HWEH 3AB0B 2LQRA 2EXYD 2ZX9A 5HI5D 1AY1L 2CUMA 5JUEL 1O7DE 1R5VA 4M48H 1AGBB 1X7TA 3HI5H 5C6WH 4NKIL 2X70A 4DGYL 2D31A 4Y8AA 1JN6A 5GSVB 2ARJA 1GAFL 5C0RL 1NEZB 5E5LA 4RGND 1OP4A 2A6KB 3FQUA 3GTVA 2YQ2A 4XVUC 4BIKA 2CCWA 3H6JA 3NIFF 4P3CL 2IALB 4Y16A 4Y16D 4Z6AT 1MG2C 1TVBA 3EOAA 4LSTL 4X7SL 4FQCL 2FDBP 1PZSA 3NJMA 5DYFA 2ADYA 2YXFA 2P8MB 3WJMA 5FFOA 2MEJB 3P02A 5I1AA 4CRPA 1HZLA 1L9QA 1RZ8A 5E7FA 1P1ZB 3MA7A 4YK4B 3RZCD 3RWGB 1EFXD 1Y1UA 2DQUH 3QWQB 1FNGB 5CIPH 3CWGA 5IMMA 2P8PB 3LIZA 1E2ZA 2XN9E 4KK6D 5A16B 1YEJL 4I13B 3CK0L 3GTTA 1TJHH 3CFUA 3WELA 3FPYA 1U8KB 4GSXA 4H26A 3M1BB 5GRYA 1NM4A 2A9AA 4XNUL 3U2JA 5T1JA 3TS8A 1ZS8B 1MI5A 3NJKA 4HISA 1FFNA 4HJUA 4J3OG 4P8QA 5B8CB 4N0UB 3DPDA 4JDTH 1JDAA 3V4UH 4OZIA 2ZD0A 4JRXA 5DQJA 5I1JL 2G9HB 3HNVH 4JRXD 3QIWA 3N42F 3CMOL 1UD8A 3QIWD 4FYTA 4D7PA 2OMVA 4LXFA 4Y2DA 4Y2DD 3S36L 3LX9A 4POYA 5F8RC 5DJZA 3MKGA 3ES6A 3MGTB 3MOAH 4DKFH 3VD0A 4Z7AA 5DA0B 1HH6A 3LQMA 1HNGA 4PJ7F 1JZ6A 3RWJA 1P9MA 3QDGA 3QDGD 4NKQB 2JJTC 4BDVA 3IN0A 2IAAC 2G5UA 3S98A 3PAYA 4I3GA 4H25B 4JDEA 2MH4A 3IDNA 1JPST 4AOFA 5IROC 1ZHBB 2F53B 3L4CA 4GH7B 1MCCA 4H1LB 1UWFA 3POHA 1AJ7H 3GUTA 4FGMA 3KYAA 1QBBA 3O45B 4GKZA 4GT7A 2FH6A 2ITFA 4BEIA 3QXAA 3SKMA 2P8LA 4AQZA 3H42H 5ICUA 3ZDYF 4Q2ZA 5KG9B 3DSNB 3ZDWA 1A0QL 1E5UI 2Q5BA 1IAOA 3KVDD 3QS2A 2IMNA 2ZJSH 1YEEL 3AG1B 2IQ9L 2DEYX 3LQAH 3LZNA 4DP6X 1N6VA 4NQCE 3H3PL 2H32B 3E2HB 3RL2A 3NSDA 3H9HA 3U1PA 2FATL 4Y5VC 4O2EA 3VWKB 3LTVA 5T1KB 4PJEA 5JA8B 3ARZA 2DQDH 4ILDA 5C0FA 3FU9A 3DRQB 3P4OA 1ADWA 3MRHB 3FUIA 1QSEB 4LASL 1DN0A 4PJIF 5IB1A 1Q90A 1I3GH 3MRRA 4G1EB 4X8CA 4P5KB 4WRLA 1VFUA 3GBDA 3L2LA 5EA0L 3V6FA 4ZFOB 5BO0D 8FABB 2WYHA 2GFBB 3SDXE 3X1FA 4XXWC 3FHEA 3QQ3A 4YZFE 5H94A 3QWRA 5C09E 5C2UB 2GHWB 3QWRD 3A5VA 1CE1L 3DPBA 4PJCF 1BAWA 4H2AA 2J1ZA 3JZ7A 4JG0L 4HIHB 4PQXA 4N4YB 1OQOA 1TYRA 4PJAF 4LMQI 1AOHA 3HLAA 1HCFX 3M7FB 1AE6L 5HGDA 2AI0L 1UATA 1T7ZA 1MHPL 3B3IA 4XCEB 1K5NA 4U1HA 1TO5A 3WEXA 2F68X 5LQBH 1KPVA 2VW6A 2AJXH 2MRYA 2YA0A 4O58L 2BZ7A 4NZJA 2Y1ZA 3WN5B 2BSEA 3UTTA 1NGZA 2BSED 3OAWA 4JB9L 2J8OA 4TNVF 3UTTD 4K7FB 5IVXB 4J3TA 2TSBA 1FPTH 4DTGL 2P5WE 1HJCA 1EZVY 2EKSA 4PVBA 3NJXA 3MRBB 2V3FA 3S4SA 5FKAA 3TEZA 3A4EA 2W5PA 4N5EC 4BFGA 4WW1A 2JVUA 4MMXA 3HPJB 3QCTL 4FQHA 3Q5OA 1VFOA 2CKBB 3LKOA 4XP1H 3SQBB 3G6AA 5GGRB 2H0EA 1MUJA 2UWEA 4Q6KA 3WKYA 3L3HB 2XYBA 3AJ7A 4C59B 4Q4IA 3QO0A 4Q58C 1CXEA 4FXGC 2XRAL 1JV5B 3MR9A 3NT0A 5CIPA 5KVEH 4N0YH 4JZOA 5G4OA 4PY7B 4XZUA 4AVHA 4UYPA 5E8OA 4PJDB 2OW7A 3PQYB 4NJ9L 4NQEE 2DICA 5DJ8B 2KZBA 3UJTL 4BRJA 3GQFA 4A6YL 1J86A 3QIUD 4R0LC 4X7TA 2A0LD 3S48A 3BLPX 4NRXB 3MRJA 1MCDA 1P6AB 3VVVA 2FWOB 3GIZL 4E5XB 3WTTA 5AWNL 1KENH 1NCCL 4AV0A 2F2HA 4UV4H 1MFEL 1FV1B 2B15A 3GSQA 5IM7B 3S34L 1WFNA 3S8GB 5BXFA 1U3HB 5TF1L 2BX5A 3O6ML 4IM8A 1GW0A 3PUUA 4KZ0A 3QZWB 4Q6IA 3LPWA 1PKQA 5E24E 3NGBC 3ZRSA 5HVHB 4OZIF 2BW5A 5JLZA 4OBRA 5DHVB 3U9UB 1ZT1A 3H55A 4A7UA 4KQ3L 4DAGL 1GSKA 3ATAA 3LKRB 3O6FD 4F58H 5D1XA 1QFWL 1Z0MA 5D1XD 1UD6A 3NPSB 4HJJH 3VW3H 4Y4FD 4GMTL 4PJ8C 1B3IA 3H53A 2WP3T 3LS4H 3BPLB 4AITA 3X3GL 4G83A 2N0KA 3VB8A 1UM5H 1MRFL 4HKJA 3GSOB 2R0WH 1JF1B 4N8UA 4WUUA 4BZ1H 3ARDA 2DS4A 1K2DA 1EHKB 3ARDD 4UT6H 4ERSL 1L9PA 1QR1A 2C1PA 3WHXA 4NDMA 4YBLC 4HUWA 1HHGB 5C0JA 4OZ4B 1NDGB 1SFDA 3Q43A 2HPOA 2OV0A 4DNLA 3NIGF 1BECA 1M57B 3C9NB 4X4YB 4RLDA 3HS9A 2ZXEB 4JM2A 4M7ZB 1PTZA 1IQWH 4JM2D 1NC4B 1YEHH 1QFUH 4WTZA 1AIZA 1GW6A 2ZF9A 5FXCH 1A7QL 4PJHE 4OGYL 2X4RB 1F45A 3U0WH 1KB5B 4H8WH 1NUGA 1SUJA 1X4ZA 1F0LA 3QXWA 2R59A 5HGHA 1ZGLA 5BVPL 1E4XL 3KPRA 1TVHA 3KPRD 4HMDA 4X7EC 4NNXA 1G7IA 4AEFA 4WI7A 1U8CB 5I8OH 4I1NB 3V0DA 1RUMH 3LXAA 2OR9L 4LF3B 3FH7A 2OMUA 4PJEF 3EJRA 3H54A 1SQMA 1MJ8H 3RHWF 4MJ6B 4A39A 5DJXA 2FBJL 3VXQA 3WTUA 2BY2A 3MX0A 4HWBL 1DVTA 2XPGA 2D7QA 3B9EA 3GTNA 4Y89A 2XU9A 4R2GC 3WFDL 3IDMB 1ZHKA 5MENB 1T1YB 3IJYA 4LCWA 3D9AH 5DK2A 1M56B 2ADFH 4LCWD 5FB8B 4MQTB 3W9DB 2A5UA 2B3IA 5AW4B 4JHBA 4JFEE 1DVXA 5E99H 4ACTA 4TQIA 2QVTA 4A2GA 3TJHD 4BSJA 4ZFGL 5CLYA 3EADA 5B38A 2XBDA 3Q8AA 1P5VA 2BS71 4N0FA 2GI0A 3E1F1 3CSGA 3QP3A 3U7AA 5J6HA 3ESNA 4P4RA 2A9DA 1E4HA 3CJJA 5EDXA 2GT9B 3WOVA 1PX8A 4M4PA 2XZZA 3MRDB 3FT0A 3MNZB 4F9PA 3Q2WA 1YNTA 3OGCA 3IFPB 3P40A 4A7GF 2VLLA 3W38A 1PJWA 2P44B 2NY1B 3IE9A 4JO4L 4AJWA 1DJIA 4C83A 2KLRA 4EZLA 4XN9A 2J1KA 3V6OC 5KYXB 1ZLUK 4NQDE 1T1XB 4U4BA 4W6YB 4K8RL 5LAXB 4WHTA 5G5DB 4F20A 5DR5H 1KGXA 3BCDA 2TAAA 4JFDE 3AS3A 1GXEA 4KV5E 4XN4A 1Z0NA 4Y5YA 2H6OA 1I9RH 4M6NL 4Y2OA 4P04A 4CL7A 4H8PA 1CGUA 2P24B 1TPXC 2EABA 3Q8CA 2VMEA 4I8DA 3T1FB 1OSZB 1EVTC 2XV6B 5L7XH 1RJZB 5GQBA 1I75A 6PAZA 3GHEH 3X1EA 3EIFA 2AEPH 4LQFL 1AZZC 4LOFA 1KLGB 3GHBL 2X2IA 1ASQA 3D34A 3EGDB 5ESVA 1MDTA 3CXFA 2D7PA 1KEMH 4GAGH 1CL7I 3RUGB 2IAMD 1FFPA 2UWEF 1QSVA 4PLKC 4EKXA 2DQJH 4GO9A 2TRYA 5CCKL 1OW0A 1QHPA 4KX7A 4V33A 3QUYB 4G9FB 3LN4B 3Q2VA 2APFA 2ZG1A 4JKKA 1CGVA 2YIHA 4JO8A 1MQKL 3R1GH 4OU3A 4HK3N 1D7DA 1NPUA 1SDYA 2HRLA 4I0PC 2ENJA 1S8DB 3IDIB 4WV1A 4Y5XA 3IU3B 4ZMTA 3B9VA 3U30B 1L0YA 1NPJA 1EEUA 4BE5A 5EOCL 4MD0A 3R7RA 1A8ZA 1D6EA 3VFRA 2BIMA 2ATAA 2QMJA 2NSXA 3VFVA 1M6UA 2VLKE 4JPIA 3T2QA 3SGEH 1EEYB 3V9EA 4JPWL 1FVCB 2YLKA 1Q0YH 2R27A 3WXWL 2DPKA 3PWUB 2YPKA 2EIZB 1XAKA 4WY7L 1OPOA 3G9VA 4O2CB 4E2OA 5IT2H 1ZLVK 4TNVK 1ID5I 3NN8A 3T3MB 1UA6H 3S3SA 2AJ3A 1MLBB 1ECYA 3GMLA 4WHYG 1A3RL 2ICWA 4HV8A 3WKQA 1WG3A 5LHDA 4IDJL 1JPFA 1SQ2N 3FOLB 4FI6A 4QHLB 3N6YA 5GGTH 1LK2A 3BIBX 2R1YA 4LNRB 1Q94A 3NZUA 4ZNEA 2CO4A 4BZ1A 5F96L 4KJPD 2K4AA 4IRZL 3AT0A 3MRGA 4UT6A 1AI1H 4P2AA 2E7DA 3VXOB 5DVLA 3HN5A 3TJPA 4H8HA 4WGWB 2JCCB 2JB5L 1RD6A 1CVRA 2DJSA 3JXAA 3P2DA 4GMSH 3STZA 5KW9H 3AS2A 1B3JA 3TCTA 2ORBH 5GS2H 3CG8A 3VGAC 5AW7B 4NJAL 1UT9A 2H4EA 3AROA 2WO4A 3BE1H 3DTXB 2ICES 4CSSA 5K33A 2RGSA 5B7EA 4P23C 4GG6E 1GH7A 1K8IA 2IC2A 4JM2F 3TN0A 1VGEL 1U8JB 4ZT1A 3TN0D 4PLNC 1ECZA 4PSPA 3UGUA 2WJ7A 4MB1A 5EO1A 1MLCA 4JW3A 3WNOA 4HSQA 5GZNC 3GSUB 3VG0H 2PW2B 4OUUA 2A74B 2GJJA 2XIBA 1QBLL 3I3BA 3KH4A 3TV3L 5AVQB 3ZE0F 3ECUA 2O61A 4Y7OC 5AAPA 3QZPA 4MCZA 1JZ7A 3CZKA 3DYPA 4P3WA 3HRZC 1OB1B 4U7KA 4HS3A 3VXRE 2P49B 5BCAA 3OC8A 3TH3T 3C09B 4N2GA 4KZEL 2Z65C 4LCCA 2VC2L 1OAXH 2W80C 5E2WL 1KNOA 3ZL4H 3MCLL 1J1OH 5GS0H 5CD5C 2KBGA 1WUNT 3R06B 5INDB 1VKXB 3BO8A 3FYIB 4PHXA 3RBGA 3U4BH 4OI8A 4R7NB 1DBAL 5FM4A 4JHAL 2YD1A 4N85A 4M62H 2DLEA 2IANA 4OLVL 5IZ7A 2O26U 2DI8A 1HJBC 1T21A 3Q1SH 3TA3C 5FYKH 7FABH 1G9HA 1SVCP 1YYLH 2XIIA 4PGBB 1Q1PA 4R9HA 2AXHA 3L7EB 4M93C 1AGEB 3LN9A 1JNHB 4BFKA 4N20A 4XBGB 4Y4HC 1T22B 5C6TH 3WO4C 4UDUA 1IAKA 5DD0L 4ZO7A 2GTZB 1AD0A 4E5XG 4ZI8A 1J5OH 2YAFA 4LVEA 2GJZB 4NZFA 3V0IA 2E9WA 3TBCA 1JI2A 4P2OB 4Q8BA 4OFYD 3FB6B 3W1ZA 1CI3M 1DJSA 4FLOA 5SWSA 4KX8A 5SWSD 3WV0A 3C2AH 2R2BA 1EDQA 3SHSA 5ID0A 3UTQA 2HG5A 2HKHH 1E4WL 2DD8H 1R3LB 1OE3A 1T66D 4FFZH 3QXDA 5JOPE 2JF1A 5F89A 1MVUA 3PP4H 1IMHC 3SY0A 1KULA 2EC9T 4LARL 5I24A 4UM9D 1CU4H 2C1OA 3VXME 4BKLB 3MLWH 1IJ9A 4FNPA 4XCNA 4HBCL 3INOA 1TZHB 5TQ0L 5J06A 2R0LH 3IFNL 4I89A 3G5VB 2VDNH 1BWWA 3F7VA 5IW1A 4PGDA 5HHVH 4F3FA 3QWNA 3PXHA 4Z23A 1JJUA 4KDTC 4WZ9A 2XG5B 1MFBH 2RCSL 3JTTB 3PDOA 4M8QB 1AKJB 4XN7A 4FXKC 2CLVB 1S9YA 4UANA 4KMLB 3S97C 2W91A 1ACYL 4NYLB 2HTLC 1G9NC 1NGYA 1G5GA 4R7LA 2Q2EB 3QCUL 4HX1A 3SPHA 3LY6A 1OY3B 4KI1A 4JCLA 3TT3H 3GXDA 5HHMB 3U25A 4FQ1L 3ISWA 2Y2WA 4MAUH 5GGTA 3I02A 2OYKA 3X12B 3CBJB 2R4SH 5E1GA 2XN9D 5FEBA 2XWRA 1WFMA 2QFPA 3K4ZA 4GSDH 4P59L 1LYQA 2KLTA 3QJXA 1AIFA 3PJSB 2D7TH 2UVEA 4EI6A 4W9FC 4Z7QF 3L4VA 4YSAA 2DAVA 1TMQA 5IEHB 1JV2A 2AEWA 3WTWA 1RUKH 5I1IL 3ZMEA 1HDMB 2FIKB 1DBBL 1F18A 4W9LC 4G82A 1FAIH 1MJJB 5J6GB 5H35A 2O6DA 3U6XA 1NIDA 1MELA 2B9AA 2OTUB 2V4LA 2WVTA 2DLFH 1B0WA 3A6BL 5GS2D 3FTUA 4GI6A 3SKOA 4J3SA 5EIIB 3NSCA 5D7SL 4R26H 1JK8B 5SWQA 1F11A 1Y18A 3BP7B 4GQ9H 1U8LB 2OP4H 4JFQB 1KBVA 2Z92A 1O5PA 3HBQA 5F88A 3VD3A 4XVOA 1I8MB 2BS9A 4WJ5B 1MCIA 1OCCB 5LG1A 5DTFB 4HLJA 1C5BH 4AYFB 4WENB 3OR7B 1ORSA 4KJQC 2K9FB 3BFWA 4NXSA 5DJDA 2VISA 2DQIH 4APQB 3V79C 1N6QL 3DETD 1AQKH 3T77A 3PAZA 4L5FH 2UY7B 2OXGA 1RVFH 1BIIA 1JWMA 1VGKA 1E6JH 3NIFB 2IGFL 5I76B 4FFWD 5I28A 3TIEB 4DZBA 5DFWH 1XCQB 4PS4L 5D4HA 5A2KH 3JSSA 4KJWD 4YSRA 4FA6A 2WQSA 1CFSB 3N0AA 3GYRA 1O6SA 5AALA 2IADA 1HQRB 1NAMB 5LGKA 3WLBB 3OKMA 3MYZA 5D7LB 5IMLA 5FUZH 4E9TA 1N7ML 2AGJH 5GS0D 3SE8L 1F4XL 2H47C 3N5AA 3QZLA 3B7RL 3KR3H 4NQCA 4NQCD 3V52H 5I2IA 2KQNA 2Y22A 3BAEH 3CX5K 1LVEA 3CXHK 4MA8H 2Z34A 3NK4A 1S9VA 1GL4B 3NCEB 1CLYL 4AYID 5DQ9A 4ADGA 3EDEA 1R9FA 3I74A 2WINA 2C34A 3GBNH 4GBXA 4K5PA 3FAWA 4GBXD 1WICA 4WCYL 4YDLC 2HAZA 4NO0A 4ZW7A 2V5RA 2B7DT 4NO0D 4LCIL 1KGCE 4U1GB 5CILH 1HOCA 5ETUA 2X28A 1I8LC 2HUHA 5EZLA 1RIVH 3TBWB 3L5JA 1A6TB 4RMTA 2VLRB 3EJYC 3PG2A 4GS7B 4UV7L 3ZK0A 5KJ7E 2VOTA 4XRCA 5C09A 2BNUA 4LPTA 5C09D 2YRZA 2QGBA 3NQKA 4K3GA 1M53A 3DUUA 3J27A 4PJ7B 1E5ZA 4M6MH 3C8KB 5ENWB 4MMZA 4ZSOE 3KEDA 1DEEB 2BZCA 4TOYL 2VW4A 3CV5A 2FE0A 5L2KB 3IGAB 1D5BB 2CO1A 3HC3L 2C26A 1FN4A 3MLXH 5D1ZA 3OZ9H 3FU3A 5D1ZD 1SJXA 3RGVB 1QNZH 1A6AB 1PIGA 1IM3A 2X44D 1IM3D 4J3BA 4TMPA 1RY7B 2AAAA 5DZNA 2LOEA 1J8HE 4KFZC 3S36X 3APDA 3BKYL 5AUMB 3IF1B 4MCYA 4AE0A 1UJ3B 3ZMNA 5ADPL 2P5WA 2P5WD 3ZDYB 2J57A 2O5ZH 3UBXG 1FNAA 3UBGA 2CO6A 4N8VB 1E65A 2CCVA 2C3XA 3SDDC 1HHKB 1M2OA 3PF2A 4L9LB 4WWKB 4Z0BH 3V6OE 4DKEL 5IR1B 3S0PA 5E8EB 1GJIA 1P4IL 3BMWA 1NWOA 5K1JA 3ZZLA 4ANUA 1AC0A 2D9QB 3LKSB 3SO3C 3TZVA 5L88H 1W0VA 1A1NA 1A5FL 1F58H 3BP5B 3K0YA 1FG2B 4QXVA 4QCIB 4DQOH 3IK2A 5DS2A 1WGOA 4PJFB 1CD0A 1ZT7B 3MGOB 2AC0A 4PJBB 4GXVH 3MV7A 4PJIB 1U2CA 4CMMA 2Q8AL 4NQEA 3VVWA 2XWBB 1CG9B 4ZDHA 4NQED 5CBAA 2K0RA 1Q1JL 3H7BB 3QH3A 1T5WA 1J9CT 1D9KC 1YEIH 3TURA 2GEEA 2VABA 2ETWA 2HT4D 4CW1A 2B4CH 4JO2H 7TAAA 1DQJB 1GC1H 2JKTM 1YECL 3DUSB 5CNHA 5FHBH 4PJCB 4Z7NE 3BEVB 4GW4B 3CN4A 3HNSH 5F71A 4E9QA 1PYWA 4G43A 1NCHA 3Q2LA 4PJAB 4OV5B 1QRNB 4BFNA 3OKLB 4K23L 1QRKA 4NB7A 1P69B 1BBJA 3E8UL 1CTOA 3GO1L 5DD3H 3QUXB 3KJ6L 1AG6A 5FO7A 4G7SB 4CC4C 2WAQA 2APBA 4KQ4H 3DSFH 5D96C 3LB6D 3AU1B 3KZ8A 4GQQA 4QGYA 3IDGB 3HG1E 4S0SD 2NZ1A 2VKWA 5D2NB 2F5BH 5IVZB 5B7FA 3HI6L 3FO0H 1MJ7L 3ZE1F 5IUCA 1JAEA 4MXVE 4O00A 4LDOB 4UQEA 4D0DA 4KX9A 3SKJL 1PZCA 2F61A 2I26N 4IGBC 3F5WA 5DJ6A 3DDFA 4B9YA 4F7PA 3NTCL 3AAZA 5I8EB 3BW9A 4KKAC 3NP4A 4GW5A 1GYVA 3IDXL 1IAII 1JS4A 5LNEA 2OM5A 1DLFH 2D31B 3VSUA 3M88A 2Q3AA 4YXKH 1JN6B 3FU7A 1ESOA 1MIEH 2O30A 2WY3B 4M61A 3Q8FA 4I3RL 3FQUB 5TFSH 4NGHH 3MI6A 5C0AE 1FYHB 3ULVC 4KHTL 1FFTB 3EOAB 1A7RL 1KYFA 2XN1A 2VM9A 2OJZL 5ISZB 3O4OC 3WJMB 4PJHA 5EZIL 3SN6N 1RH8A 1KACB 2ZOUA 3CFDB 3VDCA 4JHUA 3QUKA 3SE6A 1RZ8B 2G2RB 3BI9X 3MA7B 1MY5A 3VWJB 4EQ3A 5BRPA 5MEOB 4KI5F 5HJGA 2GIXA 3QT2A 2Q2LA 3FYEB 1TQUA 3E3QC 2UZYB 4AXWB 1CLVA 5EU3B 3SBQA 4EN3B 3NZHL 2JB6A 5LCVL 1WHPA 4NBZB 2K7PA 2ZKYA 5DURD 1NCAH 4EPSA 5I74C 3QYNA 1B0RA 1MI5B 2JKXA 1CJYA 1M05A 4CKVX 1GYAA 4Z3IA 4BSWA 1XL4A 2AXGA 2E76C 4OZIB 3OZLA 2FECL 1D2PA 2O6PA 5IHUL 3LRKA 1INQA 1ETZA 2CIIB 3DNKA 1JXGA 2I85A 1OGPA 2OMVB 4JFEA 4AY0A 4JFED 2OA9A 1Q9KB 4W9IC 1X5JA 2F08A 3BVNA 5EF3A 3IJEA 3WNMA 5C0IB 12E8H 3CLEL 1PCSA 1B0GB 2HCZX 4N0CC 3RWJB 3RU8L 5DQDL 4QRTA 4HIJB 1ZAGA 3OKYA 4UQCA 1JPEA 4CC1A 4EMZA 3CFKB 5HVWA 4NQDA 1DVUA 3IDNB 1YYMH 3HE7A 4NQDD 3HE7D 4HC1H 1EA9C 4KUZH 2MKWA 4ETQB 3NIGB 1PAZA 1P84K 3GUTB 2EYRB 4JFDD 1INEL 4CU6A 3SE3A 3UAJA 4ZMWA 3UAJD 4EIZC 1GPOH 4BA0A 1FNLA 1T2XA 1TLKA 3ARBC 3F01A 4IBSA 2YD6A 2I25N 1DBMH 3QXAB 1HNYA 1OF2A 3QYCA 3TU6A 4FX5A 2A73A 4ZOCA 1I3RB 3AY4A 3NCJL 3KWUA 3D3VE 2GITA 1OVZA 2F7PA 2A6JA 3L45A 1A21A 3L1EA 1FFRA 2DQEL 2GY5A 4A6YB 1RULH 4W9JC 4XAKE 1RI8A 3H9HB 3M7OA 3TM6A 2CK0H 2FTAA 4POZD 3ZO9A 1NFDA 2CRZA 4O2EB 4PJ9C 4RZCA 3WEOA 4F8PA 4U0QB 2G60H 4PJEB 3I9GH 4N1HB 3FU6A 1SXCA 1GR7A 5L8JB 1GY2A 1JP5A 2QKIC 3OHXC 4HFWA 5DVKA 4I18B 1TLMA 5EUOA 2VIRB 2UXTA 3PHQB 2E9IA 3GK8L 4JLRA 1H8OA 3SDCA 1GHFL 1F2XK 3SDCD 3P11H 1BMZA 3QQ3B 4LLDA 4M7KL 1Z5HA 2K9UA 2TRHA 5HDQH 2FCBA 3SDAB 3LHPL 3DPBB 1DE4B 5DRZA 5CMAA 1IIIA 2WN3A 2X6MA 2YOAA 3PWVB 3SYQA 4WW2C 2ZXGA 5LB1A 2CGYA 4CC0A 3MRFA 5C8JB 1KYOK 2J20A 3FN3A 4ONHB 1J1XL 5HGDB 5AYQA 1E5CA 3F6LA 4XVUD 5JHLH 1K5NB 3QAZB 4ONOA 4GP4B 2PPFA 4GKOA 1I8KA 1OO2A 4MD4B 3WEXB 5ILTL 2EEBA 4XX5A 4HT1H 4KTEL 3SPVA 3VFTA 4K3DH 2J4WH 4LMQE 1XTMA 2D7OA 3EW3B 1NGZB 1AQHA 3GKWL 4MJIA 4NKOB 5IB2B 1SVBA 2WXQA 4LDCA 1BQRA 2ITDA 1ZA3B 2QPEB 4LIQL 4Y9CA 4WI6A 3S4SB 4O02L 1QEXA 4B96A 5IJDC 4N22A 2PNDA 4WW1B 3Q6GH 4OLWH 3D12B 4JO3L 4MMXB 5A2LH 4HG4J 4FQHB 3L3DA 2FRGP 3NSXA 1MJUH 1MUJB 2Q20A 2UWEB 4RBPK 3T6WA 4MNQE 4J3OC 5MP6H 3BZFA 3EKCA 2XA3A 3G04A 3NABH 5EOQH 2D4DA 3BRFA 1HN1A 3QO0B 3T3PB 1F4WL 4PJHF 3T0EB 2VR5A 2Z8WC 5CIPB 2OYMA 4JZOB 3KGRA 4RMUA 1VPOL 1M4KA 1UURA 4ZFZB 4U1JB 3CVHL 4WNJA 4X7TB 4KRLB 4ATWA 4DPCX 4AGMA 3RDTC 1MFVA 4LSQH 3DUHA 5DMJB 3DO4A 2ADGA 1XGYL 3MKKA 5I30L 4XBMA 1G94A 2H9GB 3N1PC 2JJTA 3IMSA 2PUQT 1KTLA 5JR1L 1XF5A 3VXRA 4LP4A 3PWNB 3VXRD 4F5CE 1UACL 4EZKA 4HGWB 5KBKA 3DHPA 5BOPA 5E2JA 2BNQB 5ACZB 1AGCA 1PKQB 5IROA 1HK6A 3I75B 3FRPA 43CAA 4N8VG 1F6LL 4L29B 1DSYA 4F27A 5AYUH 3GLDA 1OF0A 1IEBB 1ZT1B 4AJVA 1W15A 1ICTA 2IWKA 1UKQA 3MFGB 1YUHA 5D1XB 4JFXA 1JFQL 1NL0L 3HZYA 1JFHA 4HOZA 2BY0A 4JEGB 5L0QC 4TVSa 1KXTA 4FYSA 4NHCL 4P4KC 3BP4B 3KW8A 5KANG 3P1VA 1CLZL 4U1IB 5ES4B 3V10A 1K4DA 3QXUA 4WUUB 3U79A 4JVPA 5AZEH 1A14H 4NP4H 1K2DB 1QTSA 1VZIA 2J56A 3U9PL 4FA7B 2P9RA 3K2UL 3WHXB 4NDMB 4NO2A 1JZJA 2X4SA 1I9EA 4Y5VA 4KKPA 3QRBA 5C0JB 5CJBA 1IGML 3O0LA 4YHYC 5CEYA 5I0VA 1IGFL 1AXIB 4TNGA 1JXKA 4KV5F 1L5GB 4FD0A 4W9CC 4UQBA 2FJFB 3LRGA 5AVTB 1SYSA 3QQDA 4QRQB 4XXWA 4KZDH 1FH5L 3ECBA 4YDJA 4X98A 4JNXA 1NICA 4RFOL 4DK5A 1IARB 5JOPD 4PD4J 3LYRA 5L8LB 3QPQC 1Z5LB 4E9SA 1KTDA 1T7VA 5GGVH 4NNXB 1IC5L 2CKNA 4XCYA 3VXMA 5CEXB 1RAMA 3VXMD 3ZE0B 2X12A 4J12A 2WQWA 1NFDF 4OCYH 1ND0A 3M8OL 3KYMA 1WZLA 5D70L 1IFRA 3HHSB 2HX8A 5CHNA 3RX5A 4RISH 1SBSL 32C2A 1OZUA 3MX0B 3VUAA 1SJVA 4TSCH 1JPGA 3EFDL 5IQ7H 3OQRA 3QZMA 5EUOF 1ZHKB 1UOWA 3IJYB 5FV2A 1GYUA 2IDTA 4ENED 2EJ1A 3SKNB 3MLRH 2WBJB 2NDGA 3S35L 25C8H 4X4ZA 1LJMA 2F19H 1C8PA 1PAMA 1L7IH 3ZKMC 5TK4A 1V7MH 2R9HC 1P5VB 3GSRB 3IGUA 4NENB 3VYNA 1IM9B 4JG9A 4R7VA 2R23B 4KK8C 4CN1A 4CMHB 2XQYK 2P28B 5KYNA 5DXWA 4N5ED 1E7UA 4JREC 1C5CH 4WDIA 2KERA 1IKFH 3L5IA 5DA4A 4XGZB 4EOWH 3CHRA 4PCTA 1KPRA 1JRHL 4WHTB 1PEWA 3GPEA 1KGYE 4AE1A 1BQHB 4FXGA 4IBQA 5LKNA 1LXMA 3IDUA 3VXTA 2HVJB 1R5IA 2BPBA 3KPMB 4MYPA 1QQDA 1MZZA 4Y2OB 1KSRA 4GP5B 2H8PA 3GJEB 4ZRGA 3THML 2A4CA 2ZX8A 3MJWA 1BW8A 1CUOA 4R0LA 3QVAA 3QEQE 2YRBA 1JWSB 5CSBA 4FNLH 3X13B 1R46A 1HHIB 3IJ9A 4GO6B 2F74B 4XNXL 2DKUA 3U6RA 3OJVC 2C8NA 5AOKA 3N40P 5CLZA 1JDDA 4XO8A 3QDME 1G6RL 2O5XH 1R3HA 5ESVB 2YXMA 4IRJD 1FGNH 5GRVK 1IIKA 4AZ8A 3WE6A 4WI0A 2XG4A 3G9AB 4PLJC 2Y5TB 4PFEA 2AEQL 1PG7L 2YR3A 3QNZA 2ZWYA 5DVOA 1J0ZA 4IBUA 5DMIH 3K6OA 2JELH 4Z7UA 4IS6B 4RX4A 5AVSB 2WXFA 3Q06A 1JF6A 2JQZA 5KOMC 3U7WL 4PS8A 4PP2B 1GGBL 1IQDB 3VFRB 2HFGH 4L3CA 4MD0B 1D6EB 4PJ8A 5JDJA 2W0KA 2OTPA 4PJ8D 2CQVA 5DU7A 3QW9A 4GI8A 4ZUUA 4LPWA 5ANHA 4HPHA 3WEAA 2PXYB 5MI0B 2BY3A 3I3EA 1JZHA 2YQ3A 4WI2A 3R0MA 4X4XA 4B0MB 2D03L 2D3NA 4YUEL 1BZ7A 3VE0B 5A7BA 5KZCB 3NN8B 1N19A 4OCMC 3FUEA 5I5JA 3GMLB 2C9RA 3BLKA 2YXVA 3ULVE 4V2CB 1NLBH 1T3FB 2Y24A 3GS4A 5DFVC 1LK2B 2R1YB 4JE4B 2QADC 5IVNA 5IMOA 3IDYB 4DZ8A 5I8KH 1Q94B 2Y7QA 4JN1L 1LE9A 5CP3A 3EJTA 3B83A 3MRPA 5EBMA 4LCVA 5EORH 5FF6A 4MA3A 2V5MA 1JMXA 2J1WA 1E27A 1KGCD 4GXFA 3NJLA 3FUJA 4LLWB 2QHRL 3G6DL 5AB2A 4QRSB 5IGXL 2CR6A 4E41E 4FI7A 4U3CA 1KXQA 4U1SB 2BSRA 2RB8A 5D5MB 4X5QA 4B27A 3D85A 4M3KB 2XV3A 4ACPA 3QI9B 1WPCA 3OMAB 1L3NA 4KVCH 4AIEA 5I71B 2JJUA 3AB0C 4A66A 3SDYH 4ZSOA 3HC0B 1K8IB 1I1FB 3ARPA 3TN0B 4EDXA 2OCJA 3WENA 5J1TC 4YS4A 3EXJA 2UZXB 3MFFB 4R2GD 2BVUA 4OF6A 2PYFA 3I6KB 4OKVA 2VDKL 3UBXI 1MNNA 4PRNA 2IEPA 3VI3E 3S5ZA 4ZPTB 5HHPA 1H8NA 2ZWSA 1MLCB 3RWEB 3I6GA 5IJVA 1FLTX 3SZ6A 1A65A 5E9DE 4D0BA 1J8HD 1R75A 1OCWL 2WLLA 4JFSA 4HPOL 2O61B 3GI9H 5CFHA 4HIXH 4NQSA 3MV11 2ATPA 5TDOA 1QVOA 4DVRH 4ZXBB 4L3EE 5IUSA 2CO2A 5ABAA 2DLTA 2OL3H 2HFTA 4IBZA 1QLEH 1BVOA 3V6OA 3WMSA 5K9KA 5M94B 2C7UA 1CFQB 4OZGA 3TYFA 1EJOH 3NCWA 5E5MA 1MCKA 1KNOB 3LH2H 2NNCA 5IBUB 1CXLA 2A9MH 1HEZA 4WKXA 3VD1A 1F8TL 1GJUA 1TXKA 3BO8B 5TGBB 1DZBA 1JE6A 1OAZL 2IANB 4N8CL 3T65B 1JI1A 4UIKL 1YEFL 2YMOA 5AL8A 3OX8A 5CINL 2W07B 1F86A 4G8GE 3TEYA 5B8CC 3RJDA 4UMSA 1XGRB 4G6KL 1RP9A 3KGSA 3P77A 1NMBH 3WIAA 1NA8A 3IDJA 4U6HA 4PLKD 3ZW3A 4L8CA 2ERJB 1P7HL 1UWEH 1SOXA 3ML9A 5CJQH 1VB9A 1Q0XH 1CD1A 5AAMC 1YAZA 4DIXA 5T5NG 3C12A 2F1EA 4I0PA 4I0PD 2ENPA 1PLGL 4KMTH 4PBXA 2Y5EA 4XC3L 3UTQB 2HG5B 4QXWA 2HFEA 2NUPA 1J0YA 4HKBA 3EO1B 3BPOB 3MCKA 4N2NA 4NO5B 3U36A 1DQKA 4AL8L 3HG1A 3GSVA 5E8NA 3HG1D 3HC2A 4NQVB 4GLRI 2ZTBA 4I9XA 1KCKA 4WJKB 2C1OB 2R56H 3DARA 2VZTA 1W6WA 5TPWL 1N5YH 2NT1A 2QGEA 4ZW5A 4NX0A 4XP5H 4Z7UF 3NCFB 3NRFA 4YHNB 4JQXC 1OSYA 3OB8A 4G6JH 5LWYH 2NY3D 3LAFA 4PGDB 4F3FB 3WHE1 4XCCH 3LZFH 3R4RA 4LRIC 3WIHH 1KC5H 2WIIA 3E2HC 5GGUB 2VDMH 3PDOB 4FZEL 4R5TA 1BD2E 5C0AD 1FVEA 5EBWB 4KY1H 3VWKC 4LAQL 3WBDA 1PD1A 5B39B 4ZZKA 2BY1A 3WNKA 3MXVL 4JJHA 2NY4B 5IIEA 3Q3GA 4C54A 4UOZA 2FLBT 1JGLL 1THAA 1LWJA 1ADQH 2X42A 1Y7VA 1AGFB 1P6WA 1DBKH 1R4XA 2IDFA 4EAEA 3VH8A 5E8DL 1NTDA 4P23A 4XC1H 1KY7A 1AIFB 1S3RA 1YDPB 4M7LL 4P23D 1C12A 4NAJA 4TUJA 5DF0A 3P2BA 4JAMA 4K9JA 1RQ5A 1OM3L 4EI6B 4X9BA 4I77H 1D6VH 2HH0H 1IBHA 1YVLA 1DSFL 1JV2B 1TZOA 2FEEL 4HXBH 1UXSB 1A3QA 1ZJBA 3CFIC 4PB9H 3QUZB 5H35B 4FQPA 5GZNA 4JFFE 1I7RB 5DSCA 5GZND 3UMNA 1U92A 4M6OH 4DP5X 1BJ8A 2KKQA 1NCNA 4O2FB 3KPSE 1UD2A 2Q10A 2MMXA 3JV0A 4RCAA 1IC4H 3OAUL 4JJ5B 4Z8FH 1GGIH 4DF9A 3HRZA 3ZE1B 3WN5C 1QZ1A 3VXSB 5ICZB 2A3TA 3ALPA 1LD9A 1N12A 2IPKB 4UAOB 4U2YA 2CE6A 1ZCRA 4WNQA 4NI6A 1UM4H 1TDQA 2RMNA 3FF7A 5DJDB 1L9RA 4E42B 4Z7IA 2M1KA 3IU4H 4YJZL 2VISB 5CD5D 1JXDA 4EIBA 2AJYH 4BZ2L 4OR1A 3K4AA 3ULUC 2Y3AA 3T77B 5C6PB 4FQXB 1SZNA 3MLVL 4HJSA 4NM8H 4R8WL 2K1MA 1JWMB 3TFBA 3WYRA 1URLA 3D05A 1AD9B 2WLHA 2WZ0A 4LBEA 3TA3A 2JIXA 1D5ZA 3TA3D 4DZBB 2JIXD 1EH9A 1QG3A 1BQHG 2OL3A 5EO0A 3MV8B 4YC2C 1JK9A 2OMZB 4F8NA 3O9WB 4MB5A 4X6FA 2XIDA 4XNYH 4YPJA 4HJ1A 2FGZA 2IADB 3SGKC 1ZXQA 4PWGA 4Y4HA 3HOGA 4Y4HD 4L37A 1KV3A 7PCYA 5F7DB 2Q0ZX 3D3VD 1VFAA 4W6XB 1KIRA 4OZGF 3T2PA 1EAOA 4MD5B 5EFIA 4GOSA 4ODSH 1CLCA 1PIFA 1XGQB 1I8IB 3FUHA 3ZOAA 3EYUH 4XAKD 4XPFH 4YHPB 2XV0A 4W6WB 5AZ2H 1U3HC 3ZIYA 4IMKC 4V11A 3P9MB 3N06B 4YHKH 3I2CL 3DI3B 4CBPA 2WINB 3X1NA 2JWYA 4J4PD 2CGZA 4IOIB 5ETUB 3RA7L 5HVHC 2VH5L 4BSVB 3FCTB 3LXCA 5HDLA 2FR4A 4G80A 1LEIA 2WZ6A 1KIQB 1KJ3L 1G7HB 1RZQA 4XRCB 3U9WA 3SZKC 4L4JA 2XN0A 1W9XA 4GRMA 2H3NA 4I87A 3DO7A 4XHQA 1OZTG 3BPLC 1UJTA 3DUUB 4J8QA 1E6OL 2FX9L 3CFEB 3VD9A 3UABA 4GSRA 4YHML 2A6DB 2D3VA 2D7NA 5J3HC 4KDTA 5DMKA 3VQ1C 5IQNA 4HUUB 4UOW1 5D1ZB 3C5ZB 3LD8B 2AJZB 2E5EA 4FXKA 1IC7H 3KLQA 4OF3A 4F93B 1F3RB 3K3QA 3LXBA 4PB0H 3ETBJ 1YEDB 2HTLD 4M7ZC 1Q38A 2G4EA 4BXVA 4R3SB 4PIRF 3HMWL 4MCYB 1FA4A 1BFOB 3NJFA 1C7SA 3BD3A 2FUTA 5C2BL 1U6AL 5FYLE 4LRNH 1B4LA 2Y7LA 1N68A 2V2XA 1T7XA 1NMAH 3WIHA 1G7MB 5E6IB 2YAOA 4CNIA 5E2TH 4G59C 4YDVA 1KELL 3F85A 5KS9E 2GB2A 5LGHL 2R2CA 2VXSL 4ZPVA 3BH8A 3QA3A 5DVNA 5FA3A 4AG4H 2WKOA 3TZVB 1W0VB 2EVFA 4MNQA 4HQQL 4MNQD 4ENZA 3QAQA 4KK5C 1QNIA 4EN2A 4MA7H 1FJ1A 4UZUA 2WWNA 3CFBA 3DX3A 4FL4B 5F3HA 1ADQA 1UHVA 5BRZB 2PYEB 3MV7B 1SN0A 4CMMB 1BAGA 1LP9B 5JYMA 3GMPB 1THCA 2JFCA 3LIUA 4QYOB 5CBAB 2VLJE 1ZY9A 1MREL 5AKTA 3QH3B 1T5WB 1P7BA 4WO4B 3DJRA 3U6XS 2ZSWA 1BIHA 2VABB 1AZVA 4CW1B 1NMCC 1PQZA 1I7ZA 2X6AA 5DHDA 4FHKA 3MLTA 3KNBA 1ZA6B 1E0OB 4Q4EA 2MHAA 4F5CA 4KJQD 1XCWA 3FQNA 1MCWM 1PYWB 3ZQ9A 3IVKA 1NCWL 5FGCB 5L9DH 5CSZB 5IFAL 1EXGA 2WMPB 2A9NL 3TA4D 4CSPA 2NY1C 5DRWB 2WVVB 5EV7A 4OIIL 5FFLA 2R8SH 4D3CL 4ZG1A 2MNWA 2Z4QA 4KRMB 4TSAH 3P0YL 5CUSL 3IRCA 1KJMB 1BF8A 1QW9A 5IWLC 5IBUG 5E08L 3ULVH 1KWGA 4GIAA 2C3WA 4GINA 3ARVA 4H8QA 3VRLE 4Z3TA 3IMWA 3F5WB 5DJ6B 3K81A 2NCMA 3QUMA 4F7PB 2YPLB 35C8L 3BLBA 1EO5A 4JG5A 1GIGL 3WUWA 2AK4E 2OSWA 1EJ8A 4MS6A 3TTSA 2HKFL 1OAKL 5HGAA 1J0KA 1F90L 4M61B 4QXUL 5GHWH 3TBSB 2DQHL 4V1DA 1E8XA 3MV9B 1KFAL 4ZS6C 4FLQA 3RAJH 5JIHA 1DBJH 5FAAA 2YUWA 5KVFL 5HI3C 4E68A 3DBSA 4TTDC 4MRBA 3N0PB 2XZAL 1I8LA 4MRCA 1K5WA 4YSDA 4TQEL 5DZ9A 2DLGA 2XFGB 4R90L 4RAHA 1H6TA 1WWBX 2CMRH 3LEYL 3S2AA 2CIKA 4ZX3A 3U0PA 1FLRL 3GC3A 2NY0B 3HKFA 4GT0A 3VD7A 3EDKA 2K6WA 5DO2C 3W2DH 4DKDC 1BEYH 1HKLH 3LOWA 4PS3A 5KVGL 1OARH 3ZYOA 1EFQA 4JR9L 4BRVA 3QIBB 2XTLA 3DVGB 2NR6C 5KUMA 1UCBH 1IEHA 1J88A 4M29A 3B7SA 4ISVB 4XN2A 5AKSA 1XSOA 3P73A 4MDJB 2AXGB 1WEJL 4OFQA 1SY6H 1ET7A 4HWUA 1T2QL 1INQB 1VENA 2HKAA 2VERA 2GG1A 1M7XA 3MBXL 1HL9A 1OTUC 3I6LE 4JHVA 5D7JC 4B9PA 4UM8B 1X5GA 2HZHA 4GSQA 4TVPL 1KG0A 3JV4A 1DUZA 5EUKA 1S9KC 3U1SH 3EYFA 4QAWA 3BVNB 3BSGA 3RIFF 3AQYA 1GTNA 3FAXA 2FT8A 1I3VA 3WKPA 1H8SA 4NZDA 4LFHG 1YY9C 5B39G 3SDDA 3SDDD 4KTDL 4CJ0A 1N59B 1KN2H 1XMEB 3MRMB 1UG9A 3F58L 4PG2C 2QJDA 4YMPA 2D0GA 3BUYB 3BKCH 1XGPB 3ECWA 4FS0A 3UO1H 1W6LA 3WSQH 2D9CA 4FHBD 5EU5A 4O02B 2XHNA 3RPIA 2ENQA 4GIOA 4F15B 3CQQA 4FQLL 3FT1A 4L8BB 4EUPH 1RFDL 2VMDA 3L4XA 4D9QE 1T1ZA 2GHZA 2XNAA 4N0UE 2CBMA 4P48A 1WA1X 1AXSA 5FCSH 2OAAA 4CDGC 1D9KD 1E28A 2A73B 2AXFA 1ZE3H 2VMCA 4N2HA 4BGDA 1WZAA 4QUOA 2GITB 5EC1B 2XX0A 2A74C 2X4OB 3QDMD 3FRUA 2WKOF 4KXCA 5EOTA 4U4IA 1NFDB 4HZLB 5I66A 1CE6A 1WFOA 2B9BA 1WIUA 4OTXL 3DA0A 4CILA 3FSVA 3HCVA 4CC4A 3C09C 1MRCH 4JN2B 3APCA 2VDQH 1YAIA 3L5HA 4PRDA 1EZSA 4XPFL 4HIIA 5EUOB 5EEYA 2JI1A 1UQSA 5EBGA 1BZQK 4HBQA 3RVWC 1JUFB 2GSMB 2AZUA 4LLDB 1FSKB 5IOKA 4F8LA 2I9TA 4N5UA 4JPKL 1YHPA 2VDLH 2E9BA 1BQSA 3G5YB 4IGBA 2X40A 4IGBD 1YNKH 4FKEA 2Y06L 1FDLL 3T71A 1Z9MA 3T5WA 4AH2A 4UNIA 1UFGA 3NH7H 4KKAD 4LSUH 3BKJH 4LOVA 1NINA 4Q9QL 2A38A 3MRFB 1AR1C 1RU9L 3LZPA 2QZ5A 2FHFA 1OQXA 3B9AA 3C60B 4MTMA 3ULVD 3EO0B 1A66A 4PY8J 4KKCC 3SPVB 4XI5C 3GNML 2AABH 1NWPA 3P0VH 4NUJB 4P2OC 1GGCH 4F7MB 4M5ZH 2UYLB 1QSEE 4AUYA 4MJIB 4P2QA 3GBEA 4JRLA 3OR6A 5D7KD 3PHOB 3WXVH 4WTXA 5KVDL 1JZ2A 3NBNA 2OMXA 1TZGL 1I1AC 3JYCA 4E41A 5C92A 3TNNA 4E41D 1E50A 3QDJA 4DKTA 3GMOB 4ZYKA 1UYWH 3QDJD 4TNWF 4F7TB 3RZWA 3T4AB 4IBTA 2WLMA 1L0XA 1PZAA 1E9PA 3CSFA 1HL4A 3UJIH 2Q9OA 4UT9H 4GUQA 2VXQL 2Y1VA 5MEQB 3KYOA 2XWJB 3ET9F 4DPBX 4GI9A 4NZ8A 5HYSA 3GI8L 4P07A 1WIOA 4LE8A 3AQXA 2V3DA 1JTTA 5I19L 1RIHH 2FBRA 2ZKHH 1YY8A 4XODA 5BUGA 5I6XB 4AM0Q 3DECA 5E9DA 5E9DD 2PTVA 3SQOH 1G9MC 3MBWB 2XQYG 2VMFA 4MWFA 5ESQB 3HBGA 5IVXE 3STBA 1E4XI 5F1NA 2GEQA 4HG4K 4L3ED 3BOVA 1XF5B 4NWTH 1CL7L 2WBWB 4XHJC 4GFTB 3UJJL 3ESOA 5LBSH 5F97E 4DK6A 3S8WA 4MS8D 1FL5A 1PG7X 4KJYB 5K59E 5GGSA 1A2YA 1ZV9A 4HS6A 1BQLL 3BYYA 3O2WL 4WKZA 4LU5L 1E7VA 2R1XA 1FE8L 3G5ZB 5DD6B 2N7BA 4JFTA 4UU9B 3ERXA 4MQSB 3ABGA 3ARBA 5E00A 3ARBD 3DXAB 3KLSA 5HDOA 3G08A 5FPIA 2NRDA 3OG6B 4NN5C 4KK9C 4WK4B 4NZRL 5JOFA 3UYRL 2DMGA 3VFGL 1QKZL 2R8SL 4PJDE 3PQYE 3MBEB 1PNCA 2IPTH 3KS0H 1YJDL 1SJHA 2P5PA 1SXAA 2CA3A 4NO2B 2AJSL 2IH8A 1GZPB 1MF2H 2X4SB 4EUPA 2G0KA 3D25B 3V4VL 5TE4H 4X0KB 4PJ9D 5C97A 4QMEA 1KEGH 1O7VA 5CEYB 1RURL 3EYVB 4G42A 4ONGH 5GXBB 2QKIA 4HXAH 3OHXA 1SYSB 2IBGA 2J8UF 1L9MA 3ECBB 3F8UB 4APQC 1RZJL 4GW1A 2GBTA 5ALCH 4BH8B 3QRLA 4CBZA 4FJZA 4KGJA 2WUCL 4XCYB 1C1EH 3BVVA 3VJ6A 3EJQA 5C86A 2WSPA 3CC1A 3VTAA 5BQ7B 1J48A 1KGUA 2DL2A 4WW2A 2DOCA 2W0FB 1U93A 1E4JA 1QBMH 3BIKB 2IF7A 3MMEA 1N9PA 3KYMB 4I2XB 3ILQC 1AZCA 1A7BA 1T80A 4G7VL 4KKLC 1QWHA 5CHNB 5EULV 1ZLEA 2RD0A 3QG7H 4OGAC 5I17A 4X5LA 2OMWA 1VAHA 4QRFA 1BD2D 3GSNH 3UP1A 1DANT 3N85H 1V3LA 3JQOB 4ES9A 4F57H 4MKMA 1NKGA 3RX7A 3UTZB 2B1HH 3DV6B 4HF5L 2AV1A 2PTUA 2CK2A 3IKKA 3ISRA 4LEOA 5IREA 4BUGA 1AZUA 3TH2T 4U1GC 5A2BA 5G2NA 3WNJA 2EADA 2OZ4A 3IXAA 4BH7A 2N3JA 2NX5B 3DX9B 4NP9A 4NWUL 5DD5L 4K3JL 5E2VL 1T20B 5ICXB 4F2EA 3IFLH 2EDKA 3KLHC 4P9HC 2KZ1B 4K2UH 4ZMQA 3ULVF 2R69H 4XNQB 4J3OD 4K3EL 5CD3A 5HDWA 3FCSA 1TJGH 4OQTL 2IH3A 3QBTB 4ZTOL 2DQTH 4Q9QH 2Q7AA 3WIIH 3DROB 5EO9A 1DVQA 2F54B 2FSEB 4S1QH 3KDPB 5DUBA 1W72H 3ECVA 4JFFA 2X2JA 2BFGA 4JFFD 4R0LB 5MENE 4Y19B 3HZ3A 3RDTA 3RDTD 3KPSA 3FUNA 1CFTB 3KPSD 1LQSR 2VDKB 3ROOB 1E9OA 4UT9A 15C8L 2BVOA 2X3BA 1NGQL 1GZHC 1JWUA 1A64A 3BDYH 3CVIL 4X6CF 4YX2L 2Q8BL 4NIYE 4H88L 2VN7A 2CU9A 2EO9A 3EBGA 1TJIH 2XG4B 3FB5A 4NO3A 4AMKL 1KGWA 3CBKB 5AKVA 3S3PA 2YMXH 1YEWA 2LU5A 4ZS7H 5F9WB 3ZKQD 5AEAA 3IAPA 2F0CA 2C3VB 2UXGA 4Z7UB 2E0PA 1BREA 2ZAIA 1IGYA 3EYOA 4L9LC 2CO7A 1PFOA 4JY6A 4EO5A 1JTPA 4ODVL 3HKZA 2QLYA 5AVXB 3E7JA 3HHMA 4MCNA 4NRYA 5MHSE 3ZL1A 4L3CB 2FEJA 3FQ4A 4ELDA 1IBGH 5F3BA 4P4KA 1TENA 4P4KD 3RWDB 2LGNA 2VE6A 5LBSA 3WDJA 5DZPA 3WNPA 1CN4A 1DQVA 5CEZH 4TPRH 4FKKA 1IAIH 5SX5H 4ZQKA 1ZD6A 3ME0B 3VM7A 5A6LA 4AQEB 2L7JA 2FX8H 3FK3A 2Y7SA 1UZ6E 1GMEA 1D5XB 2FSDA 5FK9B 1H15A 5J56B 3ABLB 5D71H 3RUGE 3OV6A 1ASPA 1KGJA 2WUBL 2DDQL 2MQ3A 3OPZH 4MSWA 4TQ8A 4WU5A 3G6JB 4G9FE 3VTMA 1PJ9A 3PGDB 4RZKA 5D8JL 5IMOB 4TNWK 4DZ8B 4AUJA 2CBOA 2XWTA 4P5TB 3P4MA 2R51A 2E6JA 4DN3L 1YQVL 4K7PY 2OMTA 2YSTA 1BZOA 4U1KB 2X1WL 5DJAA 3QPQD 3W5NA 3QUXC 5EIQA 2UY6A 3NCCB 3ELQA 4L48A 3LMJH 4ODUB 3HS0B 5GRWA 2ZAHA 5JMOC 3FO1A 2EP6A 1T6BX 2BSRB 2IOMA 4PWHA 1G4MA 1PMYA 4FJYA 1AACA 2J55A 2O6FA 3D85B 1Z6JT 3ZE2B 3LH9A 4N25A 3B2VH 2Q7YB 4PWKA 4R84A 4HJIA 1BAFH 2Z7WA 3CTTA 3LEXB 3BHBB 4X8JA 4IU2B 4MGXA 5TE6H 4HFUL 3T3ME 3T4YA 3SO5A 1IGJB 2QQLH 4HCIA 5TK2A 3K46A 3TBVB 2PYFB 5JPMB 4E0RA 3B56A 3GB7A 1H5BB 1HQ4B 4BFBD 2AKRB 2BO0A 3N40F 4YE4H 1MFAL 4BK4A 4RDBA 1T7YA 4AQ1B 4RMSA 4N2BA 1KOAA 3EHBD 3ZKMD 5IJVB 2VXTH 2YKLL 5FW7A 3HI1A 3KLAA 4XMKH 5D72L 2BSBA 4KK8D 5BS0B 3SBWC 4M5YH 1JGVH 5L4MA 5K1VA 1MFCL 1SOQA 3QQ4A 4FQIH 4WW2F 5DEGA 5F8QC 2ATPB 2JCCE 1ETB1 5FYLD 5HGBB 3VWJC 1EHNA 1QLRA 2EIEA 5TDNA 1QYGH 5I1HL 5KS9A 4YLBA 3HZVA 5KOVC 4OZGB 3GSNA 1TQWA 3MRQA 4DGVL 4I3SL 2Q1EA 3QUHA 1PY0A 5KSUA 1Y6NR 1U8OB 2Y07L 3BEWA 3HB3C 3PREA 5B1KA 4YXHH 2PP7A 1JPSL 4EN3C 5IQOA 5FGBC 5DRNA 3TT1L 3KL3A 5AD0B 3MODH 4X6EA 5DDHA 1TPXB 4XPTH 4LL9A 3VFPA 3OM3B 3WAJA 4P2RB 4PI2A 2AJUH 5T1LA 3TEUA 3NSFA 3OX8B 1N64L 4OM1H 5T1LD 4LSPH 5FV1L 5FYJL 3E9TA 1R3JA 2VLJD 2R69A 1HL8A 3P77B 4P57B 1ZHNA 1T03L 1MWAL 4M9OA 4P49A 4BELD 2YEZA 1FZKA 4JFPB 4EBQH 3FO2B 3GRWH 1M42A 1QA9A 4XT1C 2R0ZL 3J8F7 1UWGH 3BAKA 1S3KL 2Q3XA 2ZQKA 5I75B 1OE1A 3IYLW 3QR2A 1FL6A 5L4IA 1GKOA 3DX8B 4PR5B 2BMKB 1ZK5A 1R24A 4AV4A 2I32A 2HFEB 2CLZB 3UAEA 4HUVB 1KZQA 5KVMC 1DZ0A 1XCTA 3MVSA 4QO1B 3CFNA 1PDKA 4OB5L 3GSVB 1JGUL 5E8NB 4ZUSB 3RURA 3DVIA 1QFPA 4XNZB 1QSZA 4XP6H 5F70A 4J8RB 2XBTA 1YLBB 1XBDA 2VDRH 5AVUB 3WL9B 3D48R 2W60A 4H2CA 5K9JH 2BC4A 1MIML 4OQ1A 4NZUL 3L3IB 1H6FA 3RNQA 1FNFA 5B21A 2HFFA 1U8HA 3D2TA 3WD5H 3X2QB 5AW0B 3HE6B 2HSIA 1BVLA 4HK0B 4XBEL 4J1UA 4NFBA 3X3FH 1XZWA 2AJVL 2QADD 3DGGB 2WIIB 4W1TA 4CVWA 3FQRB 3IWVA 3MRCB 5F1SA 4YXLH 2WZAA 5T3XH 3BAYA 3ABZA 1SMOA 1EBAA 4F80A 4C4UA 4IK7A 2FQEA 5LXGH 5J5EA 4OT1L 2UZIH 2IXQB 1GOFA 3KWVA 2XC8A 5JIQA 1WZ1L 1SEQH 2HWZH 4I18C 3V6BR 3IB4A 4NBYB 2PF6A 3TCLA 3ZU8A 4IKNA 3FFCB 3TH4T 3K4DA 1F4YL 2BVEA 5I6LA 4ANWA 3BSZA 1DQDH 4TUJB 3SDAC 2GUYA 4JAMB 2MPAL 1G7PA 3BGMB 4NQXB 1TOXA 5I9QB 1AGBA 1IBDA 3WU1A 5IVOA 3ZYIA 5CZVH 2DH3A 2R0KL 3HAEB 4O4YH 3LNIA 5GSVA 2CRIA 5CS7A 2A6KA 3UIYA 3D30A 4JG1L 5DSCB 4XMZA 4UB0H 4OCSL 4FQJL 3I6LD 3JTSB 1MCPH 3ULUH 2CKBH 4OJFH 1AQDB 4XMVA 2BFVL 2P8MA 3AWFA 3BFOA 5EC2B 1SDDB 2WAHA 4YFLF 5IB3A 5B1CA 2MCAA 1P1ZA 1EAJA 1RXLA 2FWUA 5FWRA 2H2SC 1RZGA 3KAAA 3RKDC 3VSVA 5KN5B 1LD9B 3WFEL 5I1DA 2EUWA 5HHME 1FNGA 2QDVA 3ZR5A 3KVQA 4WNQB 3HUJA 5A16A 4M1DH 3UG5A 5TE7L 1BLNB 3QJVB 2X4UB 4NOFA 3ZKNC 1F3DJ 2P1YA 4RAVA 3M1BA 2WC7A 3GXMA 5E2UH 1TKWB 1ZS8A 4XPGL 4QJ4B 4D9QD 4LBEB 5GJSH 1HHHB 1UM6H 3MO1B 4N0UA 5B8CA 2OL3B 3NSJA 2FD6H 3T04D 2G9HA 4WEBH 2E9GA 3T0EC 3HMXL 4X6FB 3O3DB 1SJEB 2OR8A 2EICA 1L9TA 4J3WA 5E1HB 3VX1A 5KS9F 1VFAB 1L7TH 1AQ8A 4QHUA 3CSPA 3OKEB 5EU6B 5AAMA 3B43A 3M07A 5AKRA 1H3XA 2ZG2A 1TQVA 1VDGA 3W0WB 4RAUB 4XB7A 3N44F 3AC0A 3Q0HA 5DC4B 2PPEA 4X8GA 4JO1H 3PXJA 2MQGA 3OHMB 3S37L 1RUAH 2ZOLA 4H25A 2MCPH 2Z93A 4KNSA 5DUPH 1SFHA 3T8XB 1LEKA 1A8JH 1ZHBA 2F53A 3VO0A 2F53D 2VXVH 2FR4B 1XD0A 3ESUF 3O8XB 4G80B 4FERA 3NIFE 5GGQL 2ZUXA 5DJ2B 3S3CB 3O45A 3GRWA 1S7RB 3ZDXF 2NLJA 3KPLB 1PD0A 4QEGA 4CUCA 5T1DH 1S7XB 1S5HB 3KBHE 1ED3B 2I69A 4K8RC 1TT6A 3DSNA 1RZFH 5KG9A 4GRMB 2IDUA 4H0GA 4F1ZA 4JQXA 5D7LE 3V5KB 4GUPB 1MW0A 1OT2A 3QDHA 3SB3A 1UEMA 1N0LB 1PF3A 3PNWA 4LRIA 4LVHB 5DMKB 2OPCA 3KGTA 1DVYA 3ZTNL 3VWKA 4FXKB 4JM4L 5T1KA 4OSUH 3VWKD 3QRGL 5T1KD 3BT2L 1IGTB 1KCSH 4HEPG 3DRQA 1N0XH 3MRHA 1QSEA 4Z7OF 1EO7A 1QSED 2Y23A 4WI8A 2WXGA 3LRHA 4P5KA 3D06A 8FABA 4ZFOA 2GFBA 1FGVH 3MUGB 2JE8A 2UXFA 2FJHA 4L3FA 4LSRH 4F8QA 4HZ1A 2MCG1 2XKSA 3E6HB 4HPYH 4OF7A 4C55A 5BW7A 4ODHH 3VSQA 2W88A 1E42A 4LLYB 5IMKB 1AS8A 4QXGH 3DX0A 3OMNB 3BH8B 3O11B 4PJ7E 4MCMA 2E6PA 5L2KE 3I84A 1FJ1B 1NBVL 2M2DA 3CFBB 2VZVA 2ISDA 4XCEA 3P54A 4M03A 4KROB 4XMPL 2EE3A 1JGEB 3QQNA 4RMWA 5H4ZA 3L4UA 4NLHA 3WN5A 1HZHH 3NA9H 4PV1C 5IV2A 2WBJC 3PXLA 4IIQB 3FTYA 2ZXBA 2CJUL 5IVXA 3WGUB 1PQZB 4KXZI 5BO1H 4AEIL 2V5TA 3KNBB 3ZDYE 4YHOL 3EFFA 2MHAB 4CMHC 4X2UA 4CVZB 3FQNB 3IVKB 2HJFA 4MDIB 4H5SB 3HPJA 4ODTL 4D9LL 1PVHA 4K5MA 5C0EB 3QFDB 2BS8A 3F64A 1HWGB 3TESA 3ULUD 2CKBA 4HCFA 4W70A 3SQBA 3KBPA 4P9MH 1TEYA 2ZUTA 2CJ3A 2XXGA 3M45A 2W65B 2DBLL 1P7QB 3MOBH 1Z2KA 2FECI 5B1BB 5IK3B 1M2VA 4PJFE 1KCRH 2ATKA 4PJBE 3SGKA 5FM8A 4PY7A 1OTSC 2EIDA 4PJIE 4U6VH 3VDAA 3ZTDC 3PQYD 2QEJA 3U4KA 1FORH 2Y7OA 4TUOB 5SX4I 5D2LB 2FWOA 4XXCC 3HUJF 4E5XA 5EU4A 2X1PA 1C5DB 2J6EL 5IM7A 2HLFC 4ICXA 4NUQA 4X8XA 1U3HA 1U3HD 3NCYS 4IMKA 4JDZB 4PJCE 1NJ9B 5AOMA 1WYJA 3IM1A 4YHLH 3CFCL 2YN3A 1HILB 4V1DB 1JDCA 2W59A 3RQ3A 4PJAE 2YAHA 1QRNE 4GPVA 5K9QG 5LNDA 1VLXA 3ZHFA 1J10A 3ZTJG 2ZKXA 1JHLL 2ZWKA 3KYKH 1A4JB 4K73A 5D55A 2L4OA 4Y9FA 1KCVH 3U9UA 1BX2A 5T3XL 2YGPA 2G9KA 1BEXA 3LKRA 1CFNB 1JZIA 4LLVB 5D2NE 4XN5A 4AK1A 2OK0L 1TMCB 3PWLA 1KBWA 2B39A 3HG5A 3MLZH 2WK2A 3CH1B 1JPTH 3GSOA 1JF1A 2PXYC 5IHLB 5EMYA 1U8IB 2XZQL 1ZEAL 4HJ0C 2FYYB 1ROWA 4LVOC 1U0QA 3GMQB 5CJXC 5J3HD 3GPSA 3V0HA 4FFVD 2FHBA 5C0BB 5A2AA 1HHGA 3RWIB 4OZ4A 2FK9A 3P73B 5I18L 5CP7B 4FFYH 1H8LA 1ZPLA 2JKIS 2QV4A 2VITB 5JDSA 3VDBA 1FAKT 3C9NA 4X4YA 1CO1A 3K1KC 4TULH 3ZZSA 1NC4A 4XWGL 4OLYL 1NC4D 3LPFA 1T04A 3JV4B 4PUBL 1DUZB 5ISZE 2FZ3A 3IDYC 2X4RA 4GXUN 4R97B 4ONFL 4ODXA 2Z31C 3MNVB 3WY4A 4PW3A 2YPVA 2XVLA 4IHOB 1DVFB 3TTYA 2OSXA 2LFEA 3SDDB 4HOXA 1BOYA 4BK5C 1IGCH 1AXTH 1ZPUA 2EYTB 4ODWA 3QJFB 4BUQA 4F92B 2FX7H 1HI6B 1U8CA 1ITCA 4MXWH 3IKCB 5M7QA 3HC4H 1ACXA 4KUCD 4OM0L 4LF3A 4XE0A 4KK5D 2BINA 2GJPA 4K15A 1F3DH 1RMFH 3QI9C 2HX9A 4MJ6A 1MI5E 2OR7A 5I71C 3BPNB 1CF8H 5C70A 4TVUA 4OZIE 2J8UB 5MENA 2EAEA 4Z77B 4K7PL 1DQQB 3BQUB 4D7BA 5MEND 3V0WH 3UEQA 2PR4L 1N18A 2EH8H 3HAEG 1E28B 3OLIA 4UNVA 3ARUA 4Z95H 3BN3B 2OXHB 1MCBA 4YPGA 3IE4A 1R3IL 2ZT9C 1KJVA 1B2WH 2VN4A 4FQ2H 4X6DF 3UMTA 2XPZA 3MRDA 2XKUA 3MNZA 2APXA 2RQEA 3N41B 4AQAB 1CE6B 2BIHA 1U8NB 3GBMH 2X05A 4ZXBC 5F9DC 3BIAX 3GEWB 1J5DA 2NY1D 3MUJA 4X7CC 4AIOA 1OAYH 2VR4A 5KYXA 1FYTB 4CN6A 5JQIB 1GSMA 2WXNA 3IRZA 5D96B 5DYOB 3T0AA 1A02N 5IWLA 3NIGE 3MXWL 3BWSA 3KHOA 5MHSD 1NGPH 4ZO8A 2LVEA 2QL1A 3AM8C 4CN4A 1J8RA 2NUTB 1KB9K 2XY2A 3BKMH 5IVXF 5FKPB 1CF1A 1OSZA 1RJZA 3JWOL 3CLFL 5FYKU 3PHSA 4I4WB 3L17A 2XA8L 3UERA 3HIZA 2BJML 1XBRA 4HU2A 4PP1C 1L9NA 3D0LA 4ZX5A 2F8OA 1KLGA 4LB8A 3VFMB 5K59F 3ULUF 3Q8EA 3BXNB 1A9BB 2A2QT 3RUGA 2J88H 2NMSA 4ZS6D 1G87A 2ZCLH 4KKBC 5HI3D 4TTDD 3LN4A 2Q86A 3QUYD 4G9FD 1U41A 4HUCA 4PJEE 3KL0A 3V4VB 4QXTB 1P7KB 4G6FB 2OCFD 2VRAA 2W9EL 1V7NH 2I60L 4HUNB 4P2QB 1S8DA 3IDIA 2ARJQ 3IU3A 1CD8A 5GISL 6FABH 3BSHA 1YPZA 2NW2B 5E4EB 5DO2D 5SX5K 1PZUB 1B4JL 2YGNA 2BP5M 2GSIB 3BD4A 1KV7A 4S10A 4ZMYA 4XCFH 3A67L 3BPOC 1EEYA 3L4ZA 2NR6A 1FVCA 1KLFB 2NR6D 2QSQA 5JW4N 4X6CB 2J6WA 4JZJB 1G9MH 5CLXA 4P05A 1WAAA 3FH5A 1E9PB 3BD5A 4MKTA 3P30L 4OKDA 4YFDB 4Q0XL 1MCJA 5E23A 3EYSL 4N2FA 3FT4B 2N4IA 1BGXL 3EDFA 1T0MA 4HJGB 2BP0B 3B7TA 3ILPB 1DEDA 1KIUB 3DVNB 4U33A 5D7JA 1OTUD 1Z9SB 3FOLA 5D7JD 4QHLA 5H4YA 4YR6B 1WBZB 4UINL 4XX1G 4N2LA 5IHZA 3L1FA 2X7LA 3FT9A 4AIZB 4OJYA 2E56A 4I9WE 3V6ZB 1Z5YD 3UTTE 3C5XA 3QCVH 3UBXA 3VXOA 1RUPH 1YY9D 1F00I 3EDDA 4MWFB 4KRPC 1ODAA 3RVUC 3EJCA 2JCCA 3AUVA 5BV7H 2NY4C 4PG2A 4P5RA 1INDL 3SOBH 4IBVA 4FFYA 5DLMH 3EJPA 4BQ8A 4Z9KB 5GGSY 3OKDB 4O9HL 1FL5B 5A3ID 1TNMA 2NY7L 4R4FL 4ZW8A 3T09A 1KPUA 1HU8A 2EQDA 4WKZB 1JL8A 2YAPA 1QASA 2UWEE 3KBFA 4Y9EA 3A24A 4HJEA 2WNXA 4YBHA 5T3ZL 1U8JA 2JXMB 2IFFL 3ATEA 1R3KB 3RY5A 1EMTH 4LCYB 1AMYA 4IU3B 1IBZA 2F5AH 1FCCA 2PPAA 3QUZC 3HA0A 1MW3A 2PW2A 3D33A 4UCFA 2A74A 3C5SA 3OB0H 1SJHB 4KY2A 2ITCB 2DQFA 1I9IL 4OGXL 4S1SH 3PGCA 2XICA 4B9KC 2HN7B 4W9KC 4H20H 4YDKL 4XVJH 4Q9CA 1OB1A 3MCYA 1RZ7H 2H6UA 2DIJA 4XR8C 3WN6A 4AYEC 3QO1A 4G8EB 2OULB 4YSPA 1C08B 2PO6B 3LRMA 5F0MB 1CK0L 1DDTA 4JFZL 4U1NB 2BNQE 1PKQE 2FQGA 4DERA 1UTDA 4B9CA 2PR9A 1NAMH 3ZKXC 3RVWD 1IEAB 1U3ZA 2BIQA 1MCOL 3R06A 5INDA 3KDMB 1EO8H 3BYTA 2B1OA 4GW1B 2B1AL 1VKXA 4R7NA 3ASNB 4YQXH 5D1XE 4FQXC 1NIBA 4L8SB 3VQMA 4DW2L 3WKML 3GSXB 2OQJB 3LKPA 2K3TA 3UIZA 4L1TA 3RX9A 1PX3A 2XCMC 3KPPB 4I48B 1H0DB 1K72A 4PGBA 4WW2B 4XP9L 1K4CA 1U93B 2XOTA 4L05A 4WUUE 3TEWA 3D07A 3MMEB 1AGEA 1FRGL 3O9WC 1JNHA 4XBGA 1CIDA 4KI5C 1T22A 4HD9A 1N8ZA 2IO5A 3E6FB 2ZNWA 2GTZA 1DJHA 2YA2A 5DHXB 1SHMA 5T5FL 4KKCD 4KPHL 3O6KH 4OLUH 3CSBA 3LXUX 4P9HH 2VDLB 1MAJA 4XI5D 1HIMH 2HRPH 2B0SL 2OMWB 4P2OA 4P2OD 5FGRA 1Q9WB 5IP4A 1XV8A 1ZDQA 4UQDA 4RMQA 5FFGA 1F3JA 4LHUB 5F7EH 4CDHA 2IMMA 4TLUA 4IBYA 4LEOB 1A4CA 5DD1L 1I1AA 1R3LA 2H1PH 1EAPB 5FCUH 4A37A 3WFHB 1VZGA 3FTWA 1A4KA 1AY1H 5JUEH 5EZOL 2ROXA 4YIQB 1JIBA 5DFAA 1BBDL 2ARWA 3OF6A 3OF6D 1JHTA 4NKIH 3WMPA 3ZE0E 2H6PB 2R15A 3RUGF 4DGYH 3TO2A 3ZHNA 2DB8A 2MWCA 1GAFH 4ORGB 5C0RH 1WJ3A 4AYDC 1B88A 1FNSL 2C9PA 1X4XA 3G5VA 1JGDB 2HRHA 2H3XC 4N90E 4P3CH 1M1SA 4X7SH 3AACA 4LSTH 1IX2A 4FQCH 1ZLUH 4NNPL 4C4BA 2NTSP 1CDHA 4DUXA 3L4WA 2Y2TA 1YPZF 1MAML 3ATDA 1AKJA 4IRSB 4M8QA 3IMBA 3N91A 1AKJD 1AH1A 1OAUL 2LE9A 3C5ZC 3LD8C 2F6AA 2CLVA 4G3YL 4OCWL 5CZXC 2JLPA 4X9HA 3ULSB 2V6HA 1LTXA 4BV1A 2W94A 4U2ZA 1S7TB 3CQPA 4NYLA 1YEJH 3CK0H 1SLUA 3OAZH 1WAAF 4DJMA 4GAJL 4XHJD 2EE2A 4NO3B 3UZQB 4PAZA 5HHMD 1YN7A 2MNUA 3T3MF 1XCXA 3FDWA 4XNUH 3X12A 5F1IB 4OJCA 5E6IC 1CR9L 3PJSA 2J72A 4JY6B 5I1JH 2PCXA 5IEHA 3CMOH 1EXUB 3HR6A 2IFGA 1HDMA 1G9NL 2FIKA 3KH3A 2D2CC 3S36H 3OBAA 4P4KB 4L1HA 3MJ9L 5J6GA 3HNTL 5J9PB 2WANA 5J12B 5C9KA 2OTUA 3TVMB 3VXPA 2JCCF 3HG3A 4FKHA 1IL1A 5FW6A 3BWZA 3DX6A 5KJRL 1B90A 3CLWA 1JK8A 4MMYB 4ZQKB 4BUHA 1BOGB 3AGVA 3D08A 1BVNT 4JFQA 4WO4C 2A6IB 2QGDA 4X7DC 2WB1A 1I8MA 3V4LA 1WD9A 1WP6A 2VERN 4WJ5A 1MWAB 3LS5L 5DEZA 2YRPA 3GSWB 5DTFA 4AYFA 3CVDA 2B20A 2XWTB 1LO4L 4MXQC 4APQA 1B4TA 4K07A 4APQD 3P4MB 2GCYB 2VB5A 4QF1B 1MEXL 4DEPB 2UY7A 3MHZA 1LNUB 5HD8C 1GRWA 3TF7C 2UY6B 2FJUB 4C4KT 1A0QH 5I76A 1SMAA 1CDIA 3SPCA 3NPZB 3TIEA 1XCQA 2WKGA 2F7OA 1LK3L 1YEEH 1GCFA 4DQAA 5J1AA 2IQ9H 1O75A 4PRBA 4Q7DA 4KNUA 4OV6F 1CFSA 3H3PH 3CMGA 3RTQC 1NFAA 3MOQA 1HQRA 1NAMA 4EDWL 2E74C 2JQMA 2FATH 5LJYH 4KKLD 4X8JB 1E67A 4BM7A 4AYGA 3RWCB 4OGAD 3T4YB 4N2MA 3RE0A 3L08A 4ZUWA 4LASH 2BSSA 2XTJC 4CSTA 2OSLA 5J0BA 5HVFB 3WEMA 5EA0H 4ZNCD 2ZICA 2FAUA 1QX1A 4OCNC 4RGOL 3VXUB 4YDZA 1XH1A 3HI1B 2ILLA 4OJDH 5K5YA 1OM9A 5I26A 5FHAL 1LHZA 2NY5L 1CE1H 2BOBB 2NY2B 3QUML 1A6TA 4IEFB 1A7NL 2VLRA 4JG0H 2VLRD 4OW6A 5E0QA 4HS8L 3KLHD 3VQ2C 4R83A 2NY0C 1AO7B 4N2KA 4X6BB 2EEDA 2X0WA 3GSNB 5D5ME 2FLMA 5D4QA 2YD7A 1CI5A 1AE6H 2AI0H 1M1XB 1MHPH 3UGXA 5KSUB 1OSPL 4PJ7A 3BEWB 3QIBC 1UH3A 1ET8A 5ENWA 5DRNB 4H8UA 4YL9A 1DEEA 2WCSA 1AZNA 5DDHB 5L2KA 3VFPB 5L2KD 3ALWA 3IGAA 4O58H 1UH2A 1UXWB 1D5BA 4J6RL 4JUTA 4JB9H 3ETTA 4Z7WA 1A6AA 3KJ4B 2XWXA 2QBWA 3OKNB 4ZQTA 1J0HA 3J07A 1RJLB 4DTGH 5EWIH 1R3JB 4Y7MA 1GZHA 5HVGB 1OSEA 3IJHB 1I82A 5BPPA 1ZHNB 3ZDXB 5AUMA 1YMHB 3L9RA 3QCTH 4RFEB 4N9OB 3FUFA 2E8YA 4NUGL 2ZXAA 4EI5B 2WN2A 2ZPKL 1EK3A 3RY6C 1QA9B 4GUCA 1EX0A 4LT7A 4N8VA 1W72B 1HH9A 1ZT4B 3OJDB 1HHKA 4L9LA 4WWKD 5E8EA 3ARGB 2LVCA 1G1YA 2XRAH 5F7WC 2BCMA 3S37X 1YC8A 3LKSA 2FHCA 3P3TA 3HJEA 1QSFB 3BP5A 3NZ8B 1FG2A 4NJ9H 2V0AA 3L54A 4QCIA 3UJTH 3NJHA 4A6YH 2CUAA 2B16A 4F15C 1PDKB 4PJFA 1V8HA 2IANE 3MGOA 4A68A 4L0YA 4PJBA 4FP8L 3RLSA 3GIZH 5CBEB 4MFHA 5AWNH 4AENB 1NCCH 1QD0A 4Z7OB 4X99B 1MFEH 1GMIA 2XWBA 1CG9A 4ZFQA 3S34H 2Y9RT 2C4FT 3H7BA 3AWGA 5TF1H 3CHPA 3UGEA 3FTGA 1F6FB 3D8MA 3O6MH 1EHXA 1FIEA 2W0LA 2BIIA 4P3DB 2MTAA 1DQJA 3DUSA 4OF5A 3LKNA 4GW4A 3ESVF 1O9VA 1AGDA 3K72A 2GJRA 4PJAA 4KQ3H 1QRNA 4OV5A 1L4IA 4DAGH 1QRND 3OKLA 1QFWH 5AG8A 4HK3J 4J6IA 3P69A 2V8MA 3QUXA 4GMTH 3QUXD 3X3GH 4DGWC 1JMZA 4W9GC 3UTSA 1MRFH 2XZCL 3AU1A 4ETYA 1FHNA 1ZVSB 4Q6YA 1BZ8A 2B4CC 4ERSH 5BQDA 1GC1C 4TRPL 5D7HA 5LGJB 3L81A 4WEMB 1SEBA 2R2EB 3TL5A 4QLRA 1G7PB 1QO3B 1X5LA 2P80A 2P80D 5I8EA 1SHSA 1ZANL 4X4KA 4Z3HA 3EUUA 4G5ZL 4G6ML 1LM8V 4OGQC 4YOKA 3V5DA 1I7UA 1X5IA 1M3JA 3DURA 2K7QA 1A7QH 4LAJH 4OGYH 5BRQA 2H2PC 3ZYZA 3IJ7A 2YBGA 4L1BA 1PBYA 1X3DA 2WQUA 2ZE0A 3UAFA 1RLBA 5F7KC 3C60C 5CLTA 3SBWA 4DEWA 1RZPA 2W9DL 1E4XH 5ISZA 5BVPH 2EDOA 5ISZD 3LVEA 2YUZA 3P3SA 3CFDA 5IB3B 1SYVA 2G2RA 5MEOA 3VWJA 3VWJD 4EJ1C 1RZGB 5KSVB 4J2XA 1WZKA 3EUDA 4LHUG 1LILA 2JV6A 2OR9H 3D51A 5I1DB 2EDQA 3O2VL 2FGWL 5DJ0B 2WZPA 4UTBL 2UZYA 2YK1L 4M1GL 2WZPD 3HUJB 4AXWA 4B9ZA 5CGTA 5F0JB 2QQNL 5EU3A 2FBJH 1X4YA 3A0OA 3IMVA 2EKJA 4HWBH 4PV8A 4EN3A 4EN3D 3NDYE 5FGBA 3T4AC 3WFDH 1T83C 2VWEC 1RUQL 4RAVB 4CVUA 2CR0A 1C7TA 1MI5D 4UF7C 3JV6A 4ZFGH 3IMRA 4DVBA 2YFOA 5I0YA 2EDJA 1J18A 1DFXA 2CIIA 1U91A 4MZ3A 5CFAA 3V5HB 5D4JA 3VU1A 4EEEA 2CALA 4UTCA 3UPCA 1Q9KA 5I6XC 5CM1A 1C9SA 3MJ8B 3ZE1E 4JO4H 1KDJA 1XGZA 3KLLA 4HH9B 4QHUB 3VXSE 1YMMB 3ZHKA 5C0IA 4X83A 1SBBA 3WDIA 2ZF8A 3AXLB 1B0GA 1JD9A 3WIFB 5MERB 4K8RH 1VACB 3ZT7A 1HHJA 5F93C 1PCXA 3PNRB 3RPBA 4HIJA 1DCLA 5DUML 1L0QA 4CA4A 1BM3L 4JGJA 2ZOLB 3CFKA 2Z93B 4M6NH 5FW8A 4Z7WF 2QGCA 4XOAA 1V5JA 4NHUB 1LEKB 3L9YA 4ETQA 4WHDA 4AGPA 2IH9A 1MHHA 4X9YA 3B2DC 1VEPA 5DC9B 2EYRA 5C3IA 3VRIB 3TP4A 2BRRL 4YO0B 1KB3A 3OZKA 4LQFH 2X5PA 5D1QB 4ZD3L 2NLJB 3V4PL 3MV8E 3GHBH 4MZ2A 3SSGA 4TS6A 5KBDA 3LNFA 1IV8A 4X9FA 5JIIA 1MWOA 3I9AA 5ACMA 1WAPA 4KI5E 1I3RA 3MBEC 1ZVHA 3QRFM 5CCKH 5H37G 4C57C 3W11C 3AITA 3PNWB 3MTRA 1MQKH 4A6YA 5ABDE 4G8AC 4XN8A 5KTEL 1U8MB 5I1GL 3VNZA 1OP9A 1U36A