1HXYB

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
180
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 40
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxyB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hxyB01
1XGRA 4PFEA 4QXGL 5EB9A 4MB3A 5JHDA 4P5TC 1OSZB 4UV7L 4JPKH 3GBMH 3GSVB 2C3GA 3W9EB 5JLZB 3C60D 5DEZA 4FQXA 3P0VL 4NNXA 2YRPA 1HH9A 3HZMA 4JFEE 4HG4J 5A16A 3ULVF 3O2DL 3KXFD 5IQ9B 2R9HD 1KLFA 1S8DB 4LSDA 3MLWH 3VW3L 2CLVA 5BS0A 1WT5C 4TNWK 4WI2A 2YD9A 4Q6IB 1PGRB 5GRJL 3VE0B 2PO6B 3KPQB 4FZEL 3IDMA 3CDGB 4IMLB 3HZKB 3MGAA 4LCUA 3GKZA 3TBWB 1FZJB 3OQ3B 4PLNC 1M05A 5IW6B 4XHJD 4NBXB 5DMKA 1WBYB 1K3ZA 3O9WA 1P4LA 3RI5F 5LWYL 1M7IA 1NANI 1CL7I 5EU6E 1DLHA 4KZEL 1TJHH 1K4DB 3RVXC 3U82B 2Z91A 1CD0A 1FC1A 1Q1JH 2BJMH 3GMLB 4Z95H 4FXGA 5D1XC 1CFTB 1VACA 3TH4T 1HOCA 5IHZA 2RBLA 3BPNC 3QCTL 5E6ID 1JK8A 4G6ML 1RZJL 3L5WB 2FR4A 3ARBD 4JLRB 4QTIL 3O4OB 1AD9B 4XXCC 2BVYA 5KAQF 4DUWA 4EIGB 1EO7A 5EOTB 5FM8A 4HIXL 3LQZB 1D5BB 4ZUTA 1FIEA 4CJ1A 4HFWA 1EEYB 2CK2A 5IBLD 3AUVA 1R5IA 2ORBH 2XICA 3B9AA 3HE6B 3CXDL 5IB1B 3RVTD 2FEEL 3E8UH 3CMGA 3O41A 5C2UB 1DQLL 3O4LA 3QDHA 2FX8H 5CZXC 1KPVA 1S5IL 3PJSB 5J8OA 4OFYD 1MCJA 4X7EC 4APQD 4BKLB 1S9WA 2JIXA 1YYLL 4PD4K 1JZ2A 1A3RL 1M71A 2B7DT 2BNQE 5DRXA 4MD0B 1BGXL 1E6JL 3OKEB 4L3EB 3Q48A 1V7MH 5IMOA 3MJ6A 1DUYB 2VNCA 4U3XA 1NC4D 1FZKB 3WE6A 3C60A 3THMH 3F7VA 1ZVHA 3UAJC 3KPNA 1TZIB 3U0TB 1DL7L 4JG0H 1IAOB 3ZSSA 1O7VA 3KXFA 3LKRA 3RFZC 2LTQC 4BSWB 1DJSA 5HHQB 3VFTB 4M1DH 4OKVA 4WNQB 1IVLA 3H7BB 3HFML 5CKGA 5IMMA 5EZIL 5HI4D 3IDGB 4MB5A 2DTML 1I8IB 4LCWB 2FGWH 1KB9K 4JHWH 3KLHC 2C3VB 3Q6GL 5D5ME 4Z76A 3QCUL 3O0RH 4OLYH 4XXDB 5IIEB 1QQDB 4K3JL 3FAWA 5GGSB 4OD3H 1UWEL 4NJ9H 4Q9CA 4YGVB 2R23B 4M7LL 1DFBH 5ICZA 1K8DA 4J3OC 25C8L 4Z78B 4OBSA 4O58H 2XWTB 3NTCL 4GH7B 1GC1H 1C5DA 3R0MA 4K7PL 3OGOE 2HN7B 1OL0A 4IOFD 2CD0A 3BIAX 3OAZK 2MQ0A 3QEQB 2HG5B 2APFA 1KXVC 4AT6A 3ILQC 3W81A 3BHBB 4XAKD 4LNRA 4EI5C 2CDEA 3PHQB 3ZE1F 3IDYC 2XFXB 2CGRH 2H26A 5CINL 2EEDA 3DV4A 4D8PA 4UIMB 1U92B 1S3KH 3QEUA 3BPLC 3DJ9A 5FUCC 4LGRB 3GSXA 3T09A 2GFBB 3ARWA 2J88H 3UZVB 1DQML 5KVDL 4HMEA 4KJQC 2BOBB 5GRYA 3D2UB 3QFDA 5CCKL 4OZIA 2EYRA 3OAYH 3QAZC 4WU7A 4Q97A 4PJFE 5E5MA 2NY2D 3LEVH 4OFYA 3E2HC 4OIIL 3VXRE 5DJ6B 4BSVA 5CGYC 4WRLA 3DNKA 3T2QA 3D0LB 1SBSL 4MJ6B 3G5XA 4XP5L 3NCCB 4OCSL 5IJVA 2Y07L 2P5ED 4MXVE 1YEKL 2YEZB 4UT9H 3RVVC 4LBEA 4KRNA 5I8OH 4Z7UE 3G6AA 3FO0L 5HHMB 3NFPB 5C9JA 1XCQA 2Z31B 4NQED 1G7IB 1UJ3C 4PR5B 4WV1B 1Q0XH 4WEMB 1HHHA 4H8WH 4E42A 3WS6A 4LIQH 5HPOA 2FL5B 5T5FL 4OCXL 1MQ8A 2HFTA 4OZHF 1LP9F 3VXUB 2DQCH 1UZ6F 2DBLL 2APVA 4G8GD 4S1DC 5GRZA 2NY1B 3BW9B 3GEWB 5JXED 5DHYA 4EDXB 3ARPA 1JBJA 1TENA 3KPMA 4M5ZL 3KGRA 3SO5A 4BQ8A 3QDJB 4WVRA 1UH3A 1L7IH 1ZHKA 5L2KE 2DQGH 3N1MC 4CDGC 1IBGH 1YMHB 3QEQE 3GJEB 3FQTA 1BD2A 2WBJD 2MHAA 2C9AA 2UWEB 1OAXH 3NCJL 5GS2H 1C7SA 2WWKO 3TCLB 3CX5J 4H1LB 2AJXH 2XKNA 2OS7A 1LE9A 4FQ1H 1SJEB 5IB2A 2IAMD 43C9A 1TZHA 3DXAA 3TA3C 1CZ8H 5F1OB 1BBDL 3CDCA 3NZHH 2WUBH 1EHXA 2ZUQC 2X44D 2IEPA 3LKSA 1FCGA 1MCEA 3B2UC 3RY6A 2GSIB 1Y6KR 5CJXC 5F9JB 5T3ZE 3P9MA 3H3PH 4DZBA 4N9OB 4PJCB 4Y4KC 4FXKB 4JRYE 1CU4L 1I75A 1T6WA 4M8QA 5EUOE 1XR9A 1QLEL 4MDIA 3SEPA 2H6PB 5C0BA 1Z9SA 3T1WA 1DANT 1CCZA 2DIJA 2YD1A 5GGUB 1C08A 4NP4H 2VITA 3QEHB 3MCLH 3X11B 4ZUSA 3MJ8A 1C12B 4Z0BL 5EO9A 5GSVA 5HHME 3V4PH 4JFFB 5IOPB 2QSQA 1JNHA 5I9QB 5DI8A 1EHLH 3A6BH 1JHKL 3LS5H 1GGUA 1CDBA 3RGVC 2ZOKB 5C0DB 2YUZA 3P77B 1EFXB 1P7KA 3CSBA 4TRPH 4WWID 4NZTH 5D7SL 2VAJA 2W60A 2G75A 2VXTL 2HFEB 1NSNL 1IAIL 1PQZB 1ZVSA 1KGCE 1MHPH 4CVXB 3SOBH 1L9MA 5KSUB 4IRSB 2OP4H 1IC4H 2ESVB 5DLMH 5DD0H 1KB5B 5C0IA 3WNLA 5T3XD 1LEGB 4Q9QH 3AM8C 1HDMB 5ADOL 3UTTA 4ZD3L 3O45B 1KIQA 3DX8B 1VB9A 1K9TA 2WIMA 2H3NB 3WDHA 1XGRB 4NO0A 4OUUA 5JUEH 4M61A 5J6GA 5JHDB 1ETZA 2NY4C 1WISA 1JI1A 5B8CC 4BH7A 4G3YL 4RNRB 1XT5A 1YY9D 2I9TA 3T0WA 1BF8A 4FQXB 2HJLA 4NNXB 1T1YA 1HH9B 3HZMB 5A16B 1H9VA 3SE8L 1ACZA 2V17H 4NZUL 2M8XA 4JHBA 3QUYB 1CQKA 4XPGL 5D7LD 5E2JA 3VFRA 2P24A 2CLVB 4HJGA 4WEUD 3T3ME 4G80A 3WD5L 5BS0B 3PQYA 4LHQB 3QDMA 4NGHH 4AQ1B 3IDMB 1JMZA 4LCUB 1LVEA 1TZGL 3KYMA 1IGML 3JWNC 3VXSE 3KWWA 1PG7L 2AJ3A 5C6PB 2YBRA 3QIWA 1M05B 4P5TD 3VGEA 1Y0LA 5CP3A 5TE6H 5DMKB 5C7XL 1JNNL 4YQXH 5C0CD 3O9WB 4HEME 1EZVY 1RUQH 3ZYJA 3OJVC 1M7IB 2AJSL 4XWOC 5I1CL 2APWA 3OBAA 4MAUL 1DLHB 5C92A 2Z91B 5FKPA 3MLYL 2AK4A 5JZ7C 4JFFE 2APXA 3QUML 3SQOL 3P40A 3L5XH 4FXGB 4HSQA 4TYUA 4YK4C 1VACB 2HT4C 4J2XA 1HOCB 1QZ1A 4CMHB 5DVKA 1BQLL 1H5BA 3U4BL 1JK8B 3QXTA 2FR4B 5DJCA 3QFJA 1G0DA 2C3XA 3J7HA 4ODVL 5I1GH 1OAQL 5EO0A 2ICWI 3ULUC 4ZUTB 2NLJA 4QY8A 4HFWB 5AUMA 4PV9A 3UTSA 4NHCH 1S7RA 1R5IB 2QADC 1IGCH 4YBLC 4MA8H 3TC9A 4GOSA 3O41B 4J3WA 5DVNA 3O4LB 3WLBB 1JNJA 1KPVB 3WNMA 5EU4A 1YNKH 1S9WB 4XI5D 5EPMA 2JIXB 2J8OA 5D1XD 4MHHG 1M71B 5EOCL 4HD9A 1ZK9A 1GYAA 5DRXB 4HKZA 2E8YA 3MZGB 1ZLVK 3SGEH 5IMOB 5I19H 5JHLH 5LQBH 1QFWL 4LPYA 3WE6B 3C60B 3Q0HA 1T0MB 3KPNB 1CK0L 3FOLA 3ORJA 5TE4L 4GRWB 2WWKT 5DHVA 5IROA 4YDKH 3KXFB 3BPOC 3SDXA 5IEHA 1PZUB 2DQHL 5BS0E 4OKVB 1NUFA 4OKDA 4U6HA 4PRHA 4MYWB 3RPIA 4YXHH 5IMMB 1KTKE 2Z8RA 4Z76B 5I1LA 3GGWA 1I8LC 2Y36H 4GAGL 4LSQH 3V2AR 4HZLA 4DJMA 4DUXA 4PB9H 4PIRF 3GMPA 1J8HA 1LO4L 1NGPL 1QTYT 2FO4A 3S36L 5ICZB 1K8DB 1JYXA 3VWKC 3EYOB 4K23H 5D6DC 2EDOA 1QLFA 2KQMA 1RHHA 4HWBA 4I3SH 1VFBA 3UTOA 1C5DB 4JPKL 2F8XC 1NKOA 4MA1C 3WO3B 3VMPA 2EC9U 2J12B 5L0QB 1CI5A 5DQ9B 1ACYH 4AT6B 3L5IA 1QNZH 1RZKC 4LNRB 2BOCA 2ED9A 5KN5A 3VD9A 2CDEB 5D2NB 1WBXA 2F53A 4IOSD 3KLHD 2EDWA 4HWEH 3TT3L 2H26B 3D18A 2BX5A 2DWEB 2RQ8A 3DV4B 1TJIH 1E4XL 4D8PB 3QEUB 4W4NA 3U0WL 5BV7C 5HVHB 3GSXB 1HHJA 1A0QH 1CBVH 3RZCC 4KKCC 5SX4H 3C6LD 1MCPL 1G7HA 4G6KL 3QFDB 4OZIB 2EYRB 3PWPD 3BP4A 4WU7B 1Q9KA 3MOAH 4QHUB 2R0WH 5FYKD 5E5MB 4DQOL 1RAMA 4KVNL 4NOFA 4BSVB 3ILQD 1T7ZA 1WBZA 4EI5D 1G9MH 3G5XB 4M03A 1FGNL 2AW2A 1FVCA 5DR5H 5IJVB 4LBEB 4GRWE 3S97C 3G6AB 3GMOA 5C9JB 4L4VD 2GIYA 2B1HL 3K2UL 3VDAA 2ZUSA 3ESVF 4FNLL 1YQVH 1BIIA 2NY7H 4H26A 3LEYH 4MNGA 1N0LA 4E42B 5DUBB 4YHIA 1A22B 4UT6H 2D0HA 4U6YA 4EIZC 2JCCA 3BE1H 1CDGA 4N0UA 3E1F1 2CUIA 1LEKA 3ZDXE 5CGYD 2CKBL 1YYMH 5E94A 3LDBC 4JQVA 2BVPA 1VGEL 5DHYB 3E8UL 3WNOA 2H1PL 2OLDA 2EIEA 3ROLA 4F7CA 1ZT7A 1MPAH 3NIGF 5IWLC 4PRPE 3KPMB 1L6ZA 1QR4A 2CDFA 2DLFH 3RVVD 3INUH 4NQDA 4NWUH 1BWWA 2NQCA 1KENH 1ZHKB 3FT4A 4YDIH 3QO0A 4G43B 2R0KL 3CVHH 1OAKL 3FQTB 4P3CH 1BD2B 4U7MA 4WFGD 2MHAB 4HT1H 4Y5XA 5IHBA 1R24A 4Y5VC 5F9WB 2EEAA 1KJ3H 5BVPL 2XKNB 3CJJA 2I60H 1LE9B 1A7OL 4AQOA 4BZ1L 4S1DD 43C9B 1TZHB 1NCAH 3DXAB 2DJSA 1EUTA 2NY3C 5I75B 3BEWA 3LKSB 4CU7A 3MLVL 2X1QA 1NMBL 4EBQL 3C6LA 4OZIE 4ODBD 2QJDA 4ZFOL 4LVNC 3P9MB 4WCYL 4S1RH 4DZBB 4F2MA 1UG9A 1ND0A 1JZ4A 4W6XB 2DS4A 1AGFA 4WIQA 2BP3A 3H7LA 3QNZA 4M8QB 5JNYA 4MDIB 3MV9E 5C0BB 4JQIL 2R1YA 1QD0A 4JO3H 4JO2L 1CR9H 2VITB 1XF2A 4ODUA 4F9LA 5F21B 1JHLH 3AS2A 4ZUSB 5GRWA 3MJ8B 3TA3D 5EO9B 4KK8D 5GSVB 4F7MA 3C5ZA 4YAQA 2B39A 1JNHB 2CUHA 5DI8B 5SV4A 5K9JL 3B2UD 3W39A 2VISA 2Z92A 1BF2A 4DOHE 2OZ4H 2Q3ZA 1P7KB 6FABH 3N85H 1QRND 4GQ9L 4NKMA 2W60B 2G75B 3B9KA 2B4CH 4TNWF 4Y4KD 1NGYA 5LAXB 5GGSY 1ZVSB 5J57B 5C0AD 1F4WH 4JDTL 3JV4A 5FYJU 5C0IB 4JGUA 4PS4L 1QYGL 3UTTB 4CMMB 3LEVL 4BM7A 1KIQB 2D7QA 3EYVA 1J1PH 2B1AL 1DEDA 1MRCL 4NO0B 4OUUB 4M61B 1OAZH 5J6GB 5KOMC 1ETZB 3QT2A 5D1QC 1BD2E 2OBGA 3L5JA 2EICA 4PUBL 3FN0H 4BH7B 3RGVD 3UJTL 2BFVH 2I9TB 4HF5H 2NY5C 2IH3A 2HJLB 1T1YB 4JO1H 1RIUH 1UCTA 1RUPH 3DXAE 4S1QH 5FF6A 2ZUWA 4Z18A 4LPWA 4YWGL 3VFRB 1GPOH 4JN2A 3VFVB 2P24B 4HJGB 1JZ8A 4G80B 5ALBL 3T77A 3PQYB 4HCRL 4IIQA 2BY1A 2DQCL 1B0RA 1FNFA 3QULA 1UM6H 5F1KC 3KYMB 4M6MH 4HFUL 4GMTH 1O0VA 1BWMA 3KWWB 5I1DA 4J3XA 4XBGA 2AJ3B 5F7LB 4XBPA 2YBRB 3QIWB 2HFGL 2NY4D 3WBDA 4PJ9A 1WWWX 3O6FA 2D4FA 1IM9A 1Y0LB 5DYOA 1NMAL 3G6DL 1UB5A 5DQDL 5GS0H 1D5IL 4OLZH 3JWOC 4YUEH 3TZVA 2L7JA 3K2MC 3UYRL 3GNMH 4M6NL 4QRPE 2BK8A 1SMOA 5FKPB 2AK4B 5I18L 3QXUA 1RURL 4UQ3A 1TJGH 4WI5A 4LLMA 4KROC 4P9MH 5KVEH 5EBWA 1OM3H 4XB7A 3OSKA 1AI1L 3L3DA 3ZL4L 2GEEA 1MFCL 3V0AC 1H5BB 3WHE0 3RAJH 2E7LA 5DJCB 3S36X 3QFJB 1CZ8L 3O6LL 1FYHB 3JV6A 4ETQA 4NN7B 4QHNA 1FGVH 5EO0B 1OARH 4YX2H 1IARB 2A6DA 3MRKA 3PE9A 2NLJB 4PPTA 3G9AB 5AUMB 4PV9B 3UTSB 1W8OA 2XTJB 3TH3T 4XWOD 5CJQH 4NZJA 2ZSVA 3HLAA 3Q6FA 3OB8A 4GKNA 3GSQA 4YFLI 3BIBX 4LCCC 4M7ZC 5GQBA 5DJ8A 1F3JA 5FDWA 5JZ7D 2X6MA 2XZZA 5K9OB 2VZUA 4XPBH 5T1LA 1AIFA 3IAPA 3NPSC 5EU4B 5FB8B 5EPMB 4M48L 2HT4D 2EECA 1DBBH 1U8OA 2HYMA 4I77H 3MCLL 4HKZB 4OIAA 3BP7B 4ODHL 3NFSL 4X7TA 4MGXA 1LNUA 3I6KA 4N0YL 3FOLB 3QUZA 3ULUD 1PSKH 5DHVB 4DAGH 1KLUA 15C8L 5IEHB 4RRPA 4U6VH 1IEHA 4QT5A 1TVHA 3Q1SH 3CCHA 1G9NL 1ZHNA 4R0LC 3PQYE 2CJUH 2QADD 3LZFL 3QDME 4U6HB 4PRHB 4UDTA 3H42L 1YEFL 2VLKD 3RPIB 2K3TA 2QQQA 1RZ8A 3BT2L 3O3UN 1OAUL 3ZTNH 3SE9L 5I1LB 4NC2B 3S35L 3GGWB 2J4WL 1LILA 3VXNA 4JAMA 1FNSL 1U42A 3H9ZA 3LQAL 7FABH 1O5DT 3ZKSD 3GMPB 1J8HB 3IAGC 2FO4B 1F42A 1RZJC 4Z7VB 1IKNA 5BXFB 1CFBA 1MEXL 3GI8L 3EO0A 1RHHB 4Z6AT 4IOIA 4KMTH 1W0WB 1VFBB 5GJSL 2DDQH 3NZ8A 5FGBA 3QG7L 2A38A 4OUOA 4PY8I 3JZ7A 3LY6A 1IL1A 1FNGA 5FCUL 1MCWW 1RQ5A 1Z9OA 4LSSL 4D3CL 5KN5B 2BOCB 3A6CL 1WBXB 1X5YA 2F53B 4JZOA 4WW2C 1OGTA 3MRGA 4LAQH 4GRMB 1QHPA 1YUHA 5FYJL 3D18B 3IFOA 4OI8A 1UWXK 1U8LA 2G60H 5EIVA 3E3QC 4QHMA 5E24E 2XTJE 2ED7A 4WO4A 3VWKD 4ZFGH 1HHJB 2X4PB 2GK2A 2APBA 2MCPL 1NBZB 1G7HB 1SEQH 1EFQA 4OV5A 3TV3H 3BP4B 4LIQE 1Q9KB 1RUQL 5C0RH 1KN2L 1UWGH 4KGLA 4LP5A 2VXVH 4P49A 4MXWH 5GIRA 3NAAL 1G6RA 4LSPL 3IU3A 1WBZB 3TLRA 2BNRA 3MNWA 1T4KA 3OJDA 4X8XA 5KSBF 4ISVA 1UB6A 1FVCB 2EDXA 4FP8L 1NBVL 4JPWH 3ARSA 4EN3C 3F58L 4XNXH 4H88L 2Y1VA 5DMGC 3SDXE 1JZ5A 1MLCA 3GMOB 1SVZA 1DBJH 2FCBA 1MF2H 5DGQA 2BVQA 3RZCD 1BIIB 2ATPA 2GCYA 4KKCD 4H26B 4PRHE 4YHNA 4MNGB 4AL8L 5DRZA 1CWVA 4AJ0A 4EJ1C 4YHIB 2KH2B 5FYLL 2LAGB 4U6YB 2Z8SA 2JCCB 4V1DA 1P1ZA 4N0UB 1RVFL 4DN3H 2AABL 5E94B 3F62A 1IGCL 3WDIA 4N8VG 1N5YL 3SBWC 3V7AG 3ROLB 3TJEL 2XPGB 5I15L 1I9JL 2QHRL 4RA3A 4DK3A 3WFDL 4NQDB 2X9YA 4OFPA 1B6DA 3FT4B 1B4JL 1ADQA 1F58H 4EOWL 2MOVA 2X5PA 4KC3B 5IFAH 4Y5XB 2E6QA 5CS7A 1R24B 2R2EA 1ZOXA 1ZSDA 4OCRH 4IHOA 3VDCA 1E4KC 1D5ZA 5F72S 5IFJA 3A67H 1GGBL 1JHTB 5TQ2H 1A4KA 3BDYH 4YXHL 4S0SD 3BEWB 1X5FA 4LSRL 5IB3A 1AXSA 2AV1A 3QIUC 1OQOA 4NZRH 3P9WB 5M7QA 5IKCA 3C6LB 4NIKB 1INQA 3LN4A 4R9HA 4F2MB 1ND0B 2YMXL 1X7QA 3QPQC 3T3PF 2R4SL 3QNZB 5JNYB 4P9HH 2MQ3A 4MD5A 1CICC 2R1YB 3E0GA 4YHZL 5DJXA 3U0PA 2X1XR 2Y5TA 1XF2B 4ODUB 4MNQA 3SDCC 2FBJH 2EDKA 4HK3J 1GOHA 1BJ1H 5IHUL 2MKWA 3QQ9C 4F7MB 1ZGLP 2HKHL 4N0RA 2NY3D 4BA8A 4YAQB 4DK6A 4X6EA 2CLZA 5DVMA 3W39B 2VISB 1RI8A 3C09C 2Z92B 3NPZB 5DRNA 3DO7A 4FTVD 1WIPA 1EHNA 1G7MB 4NKMB 3FMGL 3B9KB 1NGYB 2IJ0C 2JCCE 2DL9A 4N0UE 1T1ZA 2WQ8A 4I1NB 2AGJL 3K4ZA 2GJZA 1EMTH 3FO2A 4JRXA 1EAPB 3GJFH 3JV4B 4LGSB 3RVUC 3RUGE 2R0WL 2FZ3A 5I1JH 3BH9A 4NQDE 2WNGA 3EYVB 5TF1L 4WFFD 1JWSA 3GKWH 1U91A 4LFHG 1WWBX 2DLGA 1MJJA 3W11C 3OL2A 4YHYB 2N56A 1IGTA 2EC8A 2MTPA 2PKDA 3IFNH 1CVRA 4GSDL 2IH3B 4XRCA 3CFBA 3C2AH 3BD3A 4XAWL 3QUXA 1HINH 3BZEA 3Q5OA 5FF6B 2XQBL 1AQKL 1KCVL 3K46A 4DKFL 3HNVH 1OSPH 4BELD 3OJMB 1TCMA 4ZSOE 4JN2B 3KAAA 3P0YH 1II4E 3T77B 4IIQB 4OLXL 1F4AA 4MJID 1LMKA 1B0RB 4X6DF 1V05A 3QULB 3ULVE 1Z0NA 4XB8A 3NGBB 1ZVYA 5SWSD 4TPRH 4K8RH 5I1DB 1OTSC 2I25N 3HNTL 2VXQH 4XBPB 4F3FB 5DYOB 3O6FB 5D1QD 1CLOL 3ZDZE 5GGTH 1F4XH 4LPVA 3V0WL 1GAFL 1UB5B 1OT2A 2VAAA 2GJ6D 2X4OA 1MNUH 3TZVB 1YECH 3TIDA 4GO6B 4P57A 3VH8G 3HB3C 4JANA 4Y0GA 4UQ3B 2CLRA 2WBKA 1RMFL 4RMRA 5EBWB 3KPRD 1XR8A 4XX1G 3L3DB 1DTUA 1ZA3A 4UT7H 3FN9A 4B50A 2EE2A 1T83C 2VABA 4HAFA 4WFEE 3JV6B 1DN2A 3T0EE 4ETQB 4QHNB 4K3DL 4Y4KB 4WI7A 2YS4A 2A6DB 3MRKB 1QSVA 4UNUA 5CEZL 1U58A 2KZ1B 4XNQA 2D7OA 2VERN 4LEXH 3NA4A 2ZSVB 1N7ML 3HLAB 3Q6FB 4GKNB 2NYYC 3GSQB 3JV0A 5DJ8B 1F3JB 2BHYA 5FDWB 4K3HA 2OI9C 5EU3A 1PDKA 1LK2B 1AIFB 3QQ3A 1WZLA 3T2NH 1QFPA 4V2CB 4KROD 5C6TH 4KQ3H 1MCIA 1DQQA 4HJ0C 2IQ9H 1DLFL 3VFSA 1U8OB 2DQDL 4UINL 1I1FA 1LNUB 3ETBF 3I6KB 1D9KD 1AHWA 2WANA 2DBJA 2RB8A 3KPPA 5D6CA 5I74C 3M1BB 5L8KB 4G42A 2W38A 1KLUB 3MLUH 4QT5B 1BFTA 1TVHB 4LSUL 3CCHB 6FABL 1ZHNB 2N7AA 4XNUL 2XZQL 4Y19A 2W65A 5KSAC 4UDTB 3WJLC 5F44A 1KCRL 4L8CA 3W5MA 3NA9H 3UROR 5KANG 5L6YL 2RAMA 3CLFH 4J4PA 1ITCA 2CXKA 4RFEA 5E8DH 5ADPL 4I48A 3U9PH 3VXNB 3VU2A 4JAMB 4N8CL 4ONGH 4F7TA 5HHXL 5EOQH 4A6YA 3BD4A 4PGDA 5TF0A 2AJZA 4IRZL 3FO1A 1FV1B 4NCC1 3QHTC 3EO0B 2MNUA 5F70A 4IOIB 1KCUH 2WWMC 3QZWG 1UM5H 3NZ8B 3WS3A 1IL1B 1FNGB 2Q7YA 2DN7A 4HF5L 2IFFL 1JUFA 1TFHA 5C70A 1RIUL 3VFGH 4MVBC 1GGIL 4RWYH 5KVFH 1MWAH 1QACA 3WJJC 3OAZH 4S1QL 3MODL 4DN4H 3LD8C 3D69A 4JZOB 1OGTB 1OPGH 3MRGB 5L2JA 4ZDHA 3ARFC 1YUHB 4ALAL 5T3XH 2VDKL 2IPUG 3IFOB 1UKSA 1U8LB 5EOCJ 4QHMB 2D03H 3WFEL 4J8RA 2QEJA 2ZP0T 4JY4A 2Y4SA 4ZPTA 1J0IA 3ZE1E 4HC1H 1UM4H 3F6IA 4OV5B 3EO9L 5JO5A 3QHFH 2DQJL 5T1MA 5BW7C 1YJDH 4X99A 5IVXF 3ROOA 2ZCKH 3MREA 3MV8D 2ZG1A 5HJ3A 4TVPL 3I75A 4YK4B 1G6RB 3IU3B 1J1XH 5IT2L 3NOIA 3MNWB 1T4KB 3OJDB 1PYWA 1UB6B 4BQ9A 1EO8L 5C0EB 1D9KA 2JELL 1TJGL 4KRPC 5E8NA 2I9LA 2CH8A 1N6QH 5IVNA 1MLCB 5J13B 1A7PL 4KI5D 5GGVH 5DO2C 1QP1A 2BVQB 1F4YL 5LGKA 1KB5L 2ATPB 1R0AH 3MXVH 4LDOB 4YHNB 3WUWA 2MCG1 1P53A 5DRZB 1PEZA 3CLEH 4Z5RA 1AKJD 1GJIA 1K5NA 1P1ZB 4V1DB 2OR8A 5B39A 4X6CF 3VFPA 3SDDC 1WLHA 1FDLL 4UIKL 3V5HA 4NUGL 8CGTA 4FZ8H 3ULUF 3JV5A 4OGAC 4FXLA 2IPTH 2I07A 4HHAA 4EN3D 1LP9E 1GGYA 5DMGD 5FECA 5GGRA 3FRPG 2P8PA 1LD9A 1BVLB 5MI0C 2H32H 5H94A 1JNLH 3S7GA 1BMGA 4ZYKA 3NCFB 3SKUD 1RZGA 1C7TA 2Z8VC 1CGSH 1ZSDB 4IHOB 2RJMA 1DVFC 1D5ZB 5HDBF 2XG4A 5HHVH 5IFJB 1BLNA 1NCUA 1S7SA 3OKNA 1FFOA 1A4KB 4NM4H 2WK2A 1TETH 3LRGA 4XPAL 2EEBA 5D96C 1EV2E 4GLRI 2HLFC 4F58H 5INDA 5IB3B 3PIQA 3RA7H 2AV1B 1FE8L 2JJSA 1INQB 2YK1H 1DBAH 3LN4B 3RP1A 1BFSA 4P4KC 1X7QB 3HAEA 4I4WA 3VWJA 5IQ7H 4MD5B 1UGNA 4XPHH 1Z3GL 2BNRE 3ULSA 5DJXB 3U0PB 1FNLA 2DOCA 5ITBL 4JFQA 5D8JH 1YMMD 5T1KA 4MNQB 4GQPH 1MCRA 1KJMB 1WF5A 1V7NH 4PGBA 3FZUC 2UZIH 5BVJA 4JFZL 5HHOD 2OTWA 2BXZA 1T2QH 1Q9OA 3MRLA 1BZ7A 3DO7B 3OAUL 3S5LG 3QIUD 5D1ZC 1IC7H 3RBGA 1PZ5A 2YZ8A 2DICA 4PG2A 35C8H 4V1DE 2VJXA 1UCBH 5C07A 2GJZB 1CICD 3FO2B 4M43H 3MV01 4NO5A 4JRXB 2VLRD 1FBIH 4P2OA 1FFPA 5AD0A 5I1EH 1CLYL 1RZ7L 3BH9B 3SDCD 5BOZG 5F7YC 4NO2A 5FDYA 1DANU 3QQ9D 1JWSB 5MHSE 1W0VA 1U91B 3WHXA 3OMZA 1MJJB 4LDLB 5GHWL 1I9EA 1V5JA 2O5YL 4W81A 3B2VH 5J12B 1V3KA 3QJFA 1IGTB 3MV7D 2QR0B 4XRCB 1W72A 1H3UA 2NXZC 3CFBB 4CUCA 4BJLA 5HYSA 3QUXB 3BZEB 1KNOA 5K9KB 1MF2L 3DBXB 1EDQA 4KMLB 3KLAA 1J18A 4Z9KB 4Y4FA 1U8IA 2R56H 2YD4A 2AI0H 4XT1C 1WZKA 3RVUD 3ALPA 4HUXB 1L9NA 3GRWH 3RY5A 5FYKH 4JZJA 1KEGL 4OM0H 1HHIA 4FABH 4Z8FL 2FEDC 4N1HB 4YLQT 1LDPL 5E5RB 1TCRA 5KVGH 3I50L 4W68A 3EAKA 2VSCA 1YEHL 1CD9B 3W11D 3V52L 4NM8H 4N1EA 5EBGA 4RFOH 3CUPA 1WZ1L 5KS9F 4PJ7F 2X4OB 5E5UB 3REWA 3SO3C 4QRRD 4HK3N 4OFIA 3TIDB 2VDLL 4OT1H 2V5YA 4MNQE 2VB5A 4JANB 4HC1A 3G5YA 3MNZA 1I85A 2CLRB 3DSNA 4K2UH 1XR8B 2RCSL 2VH5L 2KUTA 2X70A 1ZA3B 2BHUA 2P1YA 1A3LH 2VN4A 2BRQA 3EYSL 3KR3L 4QOKA 5IGXL 2VABB 3M45A 4JM2F 2AVGA 4QKXB 4XCFL 1NCNA 4AENA 1OTSD 4LSVH 4WWKA 4W70A 1U58B 4LMQE 4XNQB 4KRMB 3D39D 4JRXE 2D0GA 5ERWA 3BDXA 4N90D 3I85A 5DZLA 5JOFA 2FJFA 2VXUL 3HB3D 4FFYL 1EHAA 5MENE 5CJOL 4PJGF 5EU3B 2V6HA 1FVDA 3QQ3B 5E08H 2F74A 3CFCH 1DQQB 3S98A 3F12A 4XPTH 5KJRL 2IANE 4B0MM 3VFSB 3STZA 2CDGA 4P2QE 1I1FB 4TSBH 2FBJL 2OL3H 5L88L 2E9IA 2EZ0D 1AHWB 4KUCD 5EZLA 3PF2A 4O00A 3KPPB 5D6CB 1Z5LA 2D9CA 4LHUD 5DJZA 1YEIL 4G42B 4Z7OF 3VGFA 3QDGA 1IC5L 1RZFL 1MFEL 4DGYL 5E9DD 2R69H 4Y19B 2W65B 2NYYD 4JQXC 1EH9A 5KSBA 1JGDA 4L8CB 4KK9C 4XC3H 3G6JF 1MY7A 1BJ8A 2EO9A 2ED8A 3BKJH 2Z93A 5C08A 2J8UF 4KWUA 3D3VD 3K4DA 2WUCH 1C1EH 4I48B 4HJ0D 1CE1H 4C58B 3AREC 1UA6H 1G6VK 2YPKA 2YPVL 4A6YB 5D7JC 2MFNA 3T0BA 4PGDB 4I13B 1T22A 3FO1B 4Y4HC 1BFVH 2V7NA 3DX7A 4AZ8A 1OGAD 3WS3B 2Q7YB 1L6XA 1J8KA 2FHBA 1JUFB 4ZTOH 4Y7MA 4G7VL 1GRWA 4ORZC 1HWHB 2EE9A 5KSAD 1RJYB 4LPTA 2FB4L 5DD6A 3KYKL 3D69B 2CK0L 3DSFH 1G7PA 5L2JB 2Z8WC 4ZDHB 3K4AA 1UFUA 4W4OC 4L3CA 4XP6H 5EFIA 2ZOLA 1F8TL 4OTXH 2XY2A 1FFNA 2AAVA 3F7QA 4J8RB 4KHXH 4JY4B 4ZPTB 4MS8C 1A5FH 5CP7A 4HWZB 4M6OL 2WWMD 2YUWA 3QXVA 5J11B 1G7QA 5JO5B 5D7IF 3I6LE 5T1MB 4X99B 3U6RA 3ROOB 5DURB 3MREB 5HJ3B 2PYFA 1X5KA 3I75B 1G9NC 4MVBD 5HYJD 4FQJH 1S7UA 4OCLC 1NCWH 3FAXA 4UNTA 3VA2C 1PYWB 4PJ8C 1LWRA 5J89A 3WSQL 1D9KB 3Q5TA 3ARFD 1TPXC 2H45A 3I3EA 4HXAL 5E8NB 2I9LB 5CWSA 1SEBB 5EWIH 1DCLA 1CXEA 3ZKMC 3PHSA 3R4DA 5D7KE 3SQBA 3LQAC 4OLWL 1DEEA 3MRIA 2VSDA 3MRCA 3MR9A 5FV2A 4R97B 4Y19E 5ABDE 2IALA 1Q38A 4D9RE 1VENA 3LH2L 1A6VH 4LL9A 3HI6L 2XNAA 3LKQA 5DQJA 1MH5A 2VLMD 3HPJA 5ISZA 4LEXL 1K5NB 2O61A 2YWZA 2G5BA 5B39B 1KIRA 4HS3A 4OLUL 3VFPB 3WN5A 1MHCA 4OF6A 3V5HB 4Q9RH 2EH8H 2X2YA 4KRPD 4X9FA 2I07B 4HHAB 1A1MA 3UBXG 5FECB 5GGRB 1HN1A 5DO2D 1W2KT 2P8PB 3EOTL 1LD9B 1OGAA 4WFHD 1B4RA 3FO9A 5H94B 1QO3A 1CF8H 2LV4A 3GHEL 4ZYKB 4U33A 3NIGE 4ZTPH 2NY6C 5I1AA 1RZGB 2Z35A 2IBZX 2EDYA 1MAML 3JWDL 4QNPF 1AY1H 4EXPX 2D31A 4YHOL 1S7SB 3OKNB 1U8KA 1FFOB 4RZCA 3SDDD 2IH1A 4H0GA 4ZUUA 3CSGA 2XZAL 3UCRA 1KCSL 1DQDH 1KBGH 5INDB 3CLFL 3PIQB 4OGAD 5SWZD 5E8DL 4PREA 4L1DA 5F6HI 3HAEB 4I4WB 3VWJB 4RBPK 2BY3A 1HKLL 3ES6A 4AMKL 2J6EA 4GBXC 2CMRL 4YXKL 4G9DA 4TSAH 1J1OH 3ULUH 1N6VA 3ULSB 2IG2H 1PJ9A 3TN0C 4DTGL 1U3YA 5E00A 4JFQB 4X6DA 1S7VA 4AEEA 1DVFD 4Y5YC 3RWJA 1XGUA 4KPHL 1FHGA 5T1KB 4WW2B 1QLRA 4OD2A 4WI3A 3QEGL 1NC2A 1P9MC 5DUPL 4GRLC 4PGBB 5AAWA 5BVJB 1WGOA 2XQYG 4M6AA 1MWAL 4XGZA 4CU6A 2LFGA 2OTWB 5E2VH 2NX5A 1ZANH 1HIMH 4DN4L 5JW4Q 1Q9OB 5K93A 3MRLB 2HLFD 4F8QA 2R0ZH 2FBOJ 5T3XL 1ZLSH 5EZOL 3TP4A 3BGMA 1FZOA 1PZ5B 1QPXA 4RGMB 1MRDL 1BQHA 4PGJA 3RDTA 1JPTL 2DQEH 4BQBA 4XP9L 4P4KD 3HS0A 4XP4H 1NCTA 1AO7A 4PJ5D 1T5WA 5GRVL 2Z9TA 3V0VA 4NO5B 3EFDH 4HBQA 4Q6IC 4B41A 3TGXA 2PO6C 4P2OB 1CE6A 4OB5L 1FFPB 5AD0B 1VHPA 3UX9B 3O3DA 4X8JA 1WUNT 2A77H 2HT2C 1KULA 2GTWA 3DHJA 4NO3B 3FZUD 3MLTA 4KQ4H 3RBSA 5JTWA 1U2CA 4LFHD 2AK1H 1W0VB 1BAFL 2IPUK 1S7XA 3WHXB 1NKRA 1RFDL 4OZFA 3MRNB 4MA7L 4ONHA 1XGPA 2BDNH 1EEZA 1T03L 2P5EE 3QJFB 5D1ZD 3HC0A 4HQQH 1W72B 4NQCD 5LCVH 5ECJE 2C1PB 4EUPA 5ACMA 1X5ZA 5HYSB 1KNOB 5LVEA 4ESKA 2DI8A 3KLAB 3OGCA 4Y4FB 5DUML 1U8IB 3IJHA 4I2XA 2JB6B 1EVTC 3NCMA 1UXWA 3VG0H 4PJDA 1T1XA 1QR1A 3VXTA 1J5OL 1FRGL 1HHIB 4PJHB 4G8GE 4HWBL 3VGAB 1MLBA 1TCRB 3MXWH 1BVZA 1E6OH 1RZKH 1D7FA 3QR2A 4MJ5A 2DB8A 4NRZB 2NXZD 2WW8A 4PGZA 2VDMH 4AIZA 5BV7H 1TITA 4GAYA 3REWB 4FMKA 2QQLH 5DD1L 4DGVL 4JPIB 1U6AL 3DECA 3SJVA 1YMMB 2PXYA 1F3RB 4WHCA 1V3MA 3G5YB 3D9AL 3MNZB 5HY9A 4J6RH 4WTWA 4YXLL 4UILH 2OR9L 2X70B 1GHFH 4MCYA 2ADFH 3IT8D 2FEDD 1X5GA 4QOKB 4QXUL 4K3EH 1A1OA 3BAEL 4AENB 3U83A 3GBNH 4O51A 4ELMA 4WWKB 3VMNA 2Y7QA 3NIDF 2HJKA 4IJ3B 2PNDA 4ERSH 5C07E 2ZUUA 1RIHH 3QG6A 1JRHI 3OV6A 1REIA 3LHPH 4X7SL 1RUAH 2D9QB 1FAIL 1DBAL 2YK1L 5ERWB 4NPYA 5JOFB 4J23A 3REVA 1BECA 3MRJA 2FJFB 4NYLA 3GIZL 4LASL 1FVDB 2DQTL 3U7AA 4PBVC 4OCYL 1DUZA 1KSRA 3WXWH 4CVUA 2AEPL 2F74B 4JDZA 3F12B 3WIHA 5TH2A 3W2DL 3STZB 2CDGB 2F5AL 3MCG1 2IGFL 1S9XA 4Z7WA 4QXWA 3CGTA 3M8OL 4CKVX 1P69B 5EZLB 4UTAH 1Z5LB 2IF7A 4HKXA 5DJZB 5DT1L 1EXUB 5FM5O 1RPQA 4YPJA 3QDGB 5IVXA 1NL0L 5IK3A 2R1WA 4WGVB 4XMKL 5BCAA 2R29L 3ZKXB 3S4SA 1ODAA 4KDTA 3LEXA 3QPXH 3RGHA 3V6OE 3PDOA 3DROA 5KSBB 3C8HA 5EDXA 1JGDB 4X4YA 4JFHD 2DIAA 2Z93B 2AV7B 5C08B 1AE6H 3DX6A 1IFHH 1FC2D 2HVKA 4GKZA 2YPKB 3UPRA 4WUKH 1YEGH 4ZO7A 2EO1A 3DX7B 1GH7A 5H8DA 2DF3A 4LRIC 3OPZH 4QGTA 1A7BA 1LK3H 4X80L 5C8JA 4TULL 1F02I 2R8SH 3BKMH 4I8DA 5HDOA 4X6CA 2AEWA 4NSKA 4PGCA 1EGJA 5DD6B 4KK9D 4UUJA 4QOKE 2AJVH 1RV6X 1MVUB 1LO3H 4HEPG 1G7PB 3S88H 1MI5A 5DEFA 5J0BA 3BGFB 2D7NA 4L3CB 3O6MH 2UY7A 4IRJA 2ILLA 5EFIB 5ENWA 3EJJX 3ARED 3VXMD 2Z31C 3MLRL 4FQQB 5D7JD 2LU4A 3CDFA 2ZOLB 1UWXH 4WV1C 1FFNB 2OTPA 2OMBA 4Y4HD 3MOBH 4GG6F 5CP7B 4XVSH 3KHQA 3CC5A 4NM8L 1G7QB 2EIBA 3SKNA 1R6VA 3U6RB 3PWUB 3F5WA 4PB0H 5DS8B 2Q76A 2NY1C 2PYFB 4X6BA 1VGKA 4OT1L 1S7UB 2AXJA 4YHPA 3IETA 2QKIA 4LLVA 3VXOA 4O9HH 5JQ6L 2VDRH 5CWSB 2VLJA 4PRID 1OOAA 4LHUB 3EBAA 2MSPA 4MJ2A 1I3GL 4UB0H 3P11H 2AJUH 1DEEB 3MRIB 3MRCB 4J12A 1XFPA 5FUZL 2IALB 5FGSA 4MS8D 3VCLA 5KSBE 3RWIA 1OW0A 1QG3A 3TO2A 2XNAB 2BVEA 5C08E 5D70H 2MPAH 1FIGH 5DQJB 1MH5B 2NY5H 3OR7A 3HPJB 5ISZB 5F7UA 1T21A 5IV2A 3U7YH 2O61B 2G5BB 4HS3B 1QUNA 3WN5B 1MHCB 2SEBB 4QO1A 4YHMH 2EDRA 1IT9H 2Q86A 4KUZL 4PJ8D 4NKIL 1CGYA 1JGLL 4KV5E 1A1MB 4XPTL 1N0XH 5I74B 2QSCL 1Q9WA 3ZKMD 1OGAB 1RUML 3FO9B 1JWUA 4GG8A 1CXIA 1QO3B 5F3HA 1D6VH 3HMWL 2EDQA 5F7NC 2UVEA 3O8XA 5I1AB 4XMPH 2Z35B 4LLWA 4L4TD 4JQXA 2NY0C 3EHBC 2YN5A 1LO5A 5J9PA 4TUJB 3RL2A 3DV6A 4LPUA 3N0PB 3JWOH 2A73A 2D31B 3R1GH 5DMIH 1ES0A 4XVTH 4LPXA 3B3IA 1CL7H 4RZCB 3VXMA 5I9QC 3ARUA 4ZUUB 4OCWL 5CFHA 4LLQA 3SGEI 1QBML 3NACH 2NTFA 1FFQA 3HUJA 1IQDA 3HI5H 3WIFA 5DFTA 3GSNH 2XN9A 4PREB 3WMSA 3TBVA 2DAVA 3BKCL 1X4ZA 1MCOH 1MUJA 2FECL 1CYGA 3HMXA 3ES6B 4JKMA 1VSCA 2FNBA 4IRSC 5FUOL 3QEGH 2NY6D 4G9DB 1CFVL 4QXGH 2ITCA 3FFCD 2E27L 5E00B 5EU6D 4X6DB 3KYOA 4UV7H 2W9EL 1D5XA 3RWJB 1XGUB 1H0DB 3BSZL 4OAWA 1WV7T 4XTRC 1QLRB 3MACL 4OD2B 1NC2B 3V5KA 4NKDA 3P0VH 4KJPC 3T3PE 3DWTA 2P8LA 4XGZB 3O2DH 2NX5B 1ZLUK 5J3HC 3BMVA 5I8KL 4LRNH 1AD0A 4DVBA 5F9AC 4P2RA 5DA0B 4PJ7A 5C6WH 3I84A 4FQXC 5KS9A 3BGMB 1FZOB 5H2BA 3TPUA 3VW3H 1BQHB 3RDTB 5A3IC 5GRJH 4FZEH 3HS0B 4XNZB 3MRPA 4FQ2L 1Z6JT 4LVEA 4GBXD 4NC1C 3V0VB 3FB8A 1WWAX 1B0GB 3CMOL 5J06A 3TN0D 3BVNA 3PWPE 4YE4L 1CE6B 2CR3A 3MTRA 3O3DB 4X8JB 5FYKE 5FYLD 2GTWB 3PL6A 4GRLD 5LWYH 4FQJL 4JPVL 4KZEH 4OZFB 5ELIA 5JW5A 4ONHB 4R4FL 5GS1A 1XGPB 4ENEC 2JJVA 4CADA 3KPTA 3O9WC 3HC3L 1EEZB 5I66A 5J6HB 1UKTA 3HC0B 5SX4I 4M9OA 2GHWB 2D7PA 3QCTH 1CTNA 4EUPB 1F5WA 4JFEA 5FUCE 3SKMB 4G6MH 1RZJH 4QTIH 2RR3A 3OGCB 4N0CC 3IJHB 4I2XB 1UXWB 1T66C 4PJDB 4RCAA 1T1XB 4CMHC 2RIKA 4AH2A 4HIXH 1QR1B 2PO6D 2BCKA 3VXTB 3I2CL 1IGJA 3BJ91 4U6TA 1MCSA 1VEOA 5I8EA 2HT2D 5IP4A 1NLBL 3RWDA 2NW2A 3CXDH 4FHBD 2EDDA 2KPNA 1FNEA 1N8ZA 1WFNA 4HBCL 1DQLH 3BQUA 4MJ5B 4XNYL 1S9YA 4P59L 1S5IH 4UNVA 4C57C 5EBLA 2DYPA 2AS5M 3KPOA 1I9RL 3PGFL 4GW5A 5A2FA 1GOGA 1YYLH 4AIZB 4CJ0A 4X6DE 1A3RH 5EU6A 3G6JA 2X05A 1E6JH 3SJVB 2DI7A 2PXYB 1CF8L 3RIFF 5ID1A 2A9NL 2P46B 3FT2A 3JVGA 4G8IA 5FHAL 1ZA6A 5HY9B 2NX5E 3WFCL 2AQ1A 5EIIA 1DL7H 1J0ZA 2HRLA 2NZ9C 4MCYB 1IGFL 1BJMA 4PLJC 1LQSR 2N1KA 3C60C 4LQFH 5IVZA 2AKRA 4C4KO 4HUVA 1A1OB 3G04A 4FRWA 2ZSWB 4MQXC 4O51B 4ELMB 3HFMH 1AO7E 2HJKB 4P4KB 5E2WL 5EZIH 5FA3A 1BM3L 2DTMH 1KBGL 3EYFA 5SX5K 1EERB 3QG6B 2QBWA 4PJ5B 4UV4L 5CBAA 3Q6GH 2ATKB 3QCUH 1G6RL 4DGIL 1TMCB 4K3JH 4NPYB 1UWEH 3REVB 4XCNA 4NYLB 3SCMA 4NWTL 4CRPA 4M7LH 2VKXA 3O6KL 2LVCA 4HH8A 25C8H 1F6AA 5GGRY 2VDNL 1DE4A 1A9EA 4PY7A 1SBBA 1DUZB 3NTCH 4JDZB 1XF5A 1XGYL 5F9DC 1UC6A 4L3ED 4MWFA 4K7PH 2BNQA 3MA9L 1S9XB 4Z7WB 4GKSA 4P0DA 2X9XA 4HKXB 1ZT1A 1ZANL 5F3BA 4E41A 5IVXB 5I1HL 4F7PA 5IK3B 2R1WB 3QXWA 3FQWA 5L0QC 3H9SA 5C09A 5CINH 3S4SB 2ADJA 1QRNE 2DQEL 3LEXB 1ZE3C 3L9RA 2X4RA 3IGAA 3PDOB 5IG7A 1WEJL 3DROB 4X4YB 5FO7A 1DQJA 4UOW1 5D5MA 1DQMH 5KVDH 4R26L 4X83A 1ADQL 2GKIA 2VR5A 1NAMA 5CCKH 3DX6B 2XQYK 1R3IL 3TESA 2HVKB 5HVHC 4GKZB 4U1SA 3UPRB 3GMRA 4LCYA 4OIIH 3V4VL 1KUMA 1KC5L 3SJVE 1CIDA 3GUTA 1JYNA 4CU8A 3AMKA 3STLA 1H8OA 1Q9LA 4XP5H 4MA3A 4E5XA 2P44B 5C8JB 3RRQA 4OCSH 2Y07H 3QEQD 1YEKH 3KVQA 1FSKB 4WEBL 4X6CB 3LRHA 1RD6A 4NSKB 4R90L 3FO0H 4TQEL 4PGCB 5E8PB 2E7MA 2YD6A 4UUJB 5TFSH 4BK5A 5DF0A 4GAFB 2E8ZA 1MI5B 5DEFB 4C83A 1JI2A 4EKXA 4ELME 4M7JL 1JYWA 5ENWB 3TF7C 1OY3B 1U3HD 5T5FH 1OAYL 4OCXH 1ZTXL 1BREA 2VZ1A 3A6OA 5L9DL 5E1AA 2DBLH 5JA8B 1F90L 1BJ1J 1JFQL 1VEPA 2B0SL 3D2UD 4FFZL 3CFIC 3WS6C 4HIIA 1SJVA 3IS1X 4K9EL 5CSGA 3CC5B 2N4IA 1EO5A 3FOMA 4JRYD 3SKNB 5F89A 5CEZD 4M5ZH 4PJFA 3F5WB 4DVRL 3P30H 2Q76B 5FHBL 4X6BB 1VGKB 3N1PC 3VXRA 4YZFE 4YHPB 5TDPA 3IETB 3PWVA 2BZDA 5IW1A 2FX7L 4KK5C 4LLVB 3VXOB 2HTKC 3ZHDA 3RU8L 1T89A 1MRFL 3NCJH 2Y6SC 2GYSA 2VLJB 4L4JA 4P2YA 5HHMD 4DKAA 5IVXE 2Z31D 5DC0A 4QRSA 4KXZH 3V5DA 4JJ5A 1T0PB 1KJ2L 1BBDH 5DJ2A 5F9WC 3VCLB 4X9GA 1IE5A 2Y9RT 5D2LA 4U49A 3PGCA 3RWIB 5ESVA 3TO2B 3VXUD 2VOTA 2Z4QA 4RX4D 4WENB 2DM3A 3O11A 3OR7B 4CN1A 1FL5A 2NY1D 1T21B 4MCZA 5IV2B 5I75C 2AEQL 5LG1A 1CU4H 3MLPA 4K7FA 2Q86B 3GBLA 5INCA 3RY6C 3UJIL 1QLEH 1F6FB 2IWGA 3QDJD 4PJXA 1HCFX 3KS0J 1FPTL 1H3TA 3U30B 1Q9WB 4XWGL 3D85A 5L2KA 2A6JA 4M1GL 2C26A 3EDJA 1JWUB 4GG8B 5F3HB 4X6CE 2FSEA 3WXVL 4Z0BH 1CG9A 1T7YA 1YNTA 3O8XB 3T04D 4LLWB 3ULUE 3BZFB 1LO5B 3OXSA 2ZG2A 5F7EL 2YC1A 1JHKH 3H3KA 3RL2B 3DV6B 1MI5E 5J9PB 4BYHA 3BWUC 3I3DA 2A73B 1ES0B 4YBQC 4C4KT 3QPXL 3B3IB 5D7SH 3VXMB 5HTSA 1U3HA 2VXTH 1E27A 3DMMA 3EGSA 1IAIH 4LLQB 4MX7A 3HUJB 5E8OA 1IQDB 1QPPA 2XN9B 3VXSD 3P73A 2Q6WA 5HDBE 3TBVB 2ZJSL 4LMQI 1RIVL 4JRYA 1D6EA 2VLLA 5ADOH 2XA8L 4ZD3H 1MUJB 5HVGB 3O81A 1Z9MA 5EUOA 2NY0D 3EHBD 4FQIL 3WL9B 2ITCB 3KYOB 1XIWA 4OAWB 3EOYG 2UVFA 3BKML 4G3YH 3VRLF 5ESQA 3NCYP 4NKDB 4JFFD 3QWRA 3LPWA 4U1NA 3K8KA 5EBMA 2P8LB 3SE8H 2ZPKL 1PBYA 3MBXL 1KCKA 4NZUH 4LCIL 1AD0B 3DUUA 3MUZ1 4DVBB 4XPGH 5CBEA 1WAAF 4P2RB 1EFXD 4PJ7B 3GI9L 5KS9B 1YEEL 5H2BB 3TPUB 1EX0A 5EORL 3WD5H 3KLSA 2J5LB 1B90A 3K3QA 1GC1C 1IC1A 3OKYA 5C1MB 2JJUA 1TZGH 3MRPB 1X44A 2C4XA 4IRSD 3RTQA 4CAGA 3VA6A 3OR6A 1B6UA 3FB8B 1PG7H 3CSYA 3BVNB 4AK1A 1CIUA 1OWRM 5C7XH 4PJ8B 1JNNH 4XTRD 4YO0A 4M7KL 4PB0L 5DJAA 3ZTJG 4G9FA 3PL6B 4KTEL 5DVOA 3JWDC 3N1FC 4KJPD 2AJSH 5I1CH 3G08A 5JHDD 3QIWC 1XMWA 4MAUH 3UPCA 5J3HD 5D72L 3K8LA 5JW5B 5GS1B 3MLYH 4CADB 2WBWB 5I66B 1P4BL 4O9HL 4BUHA 4OZGF 3QUMH 3SQOH 3RJQB 1KB9J 5A3ID 4JFEB 1BQLH 3U4BH 3OKLA 5HGDB 2AJUL 2H8PA 5CZKA 4ODVH 5BS0D 1BOGA 1OAQH 4S0TD 5LJYH 4A6YL 4AH2B 1H5BC 2BCKB 1DR9A 1IGJB 4HIHA 5K9QI 1B88A 2ZCLL 3KLDA 2XN9E 5I8EB 3ZE0F 1INDL 3RWDB 2NW2B 4NN7C 3VXSA 4X7DC 3ZYOA 1N8ZB 4ZO9A 2F54A 2Y72A 4ENED 5JIHA 3O9WD 3BQUB 1S9YB 1XAUA 2IMNA 2XTJC 2DYPB 3KPOB 4GW5B 2ZG3A 2XZCL 3WYRA 3X13A 5ESAB 2EDEA 5EOCH 5GISL 5IW3A 2VUYA 3G6JB 4TN9A 5EU6B 1MFNA 5FFLA 2ENSA 1QFWH 3FT2B 4G8IB 1Q94B 1ZA6B 2J3SA 4N0CD 5HVFB 4BFIA 1T66D 3LS4L 3L1OL 1CK0H 1NFDA 5EIIB 5TE4H 5KS9E 4PJ7E 5CUSL 5ACZA 5C0JA 5IVZB 1RK1A 3W0WA 2AKRB 3HZYA 3OHXA 1KN4H 4HUVB 3G04B 4ZMAT 3BZ4A 1PX3A 2FJGB 5IROC 5FA3B 2QSVA 5EU7E 3EYFB 4ODTL 2FO1A 5IJKC 5CBAB 1NCBL 4GAGH 3ARRA 3P4LA 4XCNB 4IDJL 3MLZL 1KJVA 1XGTA 5FGCE 1LO4H 1NGPH 3S36H 3TWCL 2ZUYA 2O5ZL 1F6AB 2JIXD 4I0PA 5DD5L 1A9EB 4PY7B 3MMEA 3D5OF 4C54A 2I26N 2H2SC 2NZ9D 4MWFB 2XI9A 2BNQB 3TPKA 3FB5A 4PLJD 2GITA 2IPKA 4OGZA 3EZJB 2VRAA 1NCCL 1FCCA 5I1IH 4G7YL 4GKSB 4MQXD 1ZT1B 2ZKHL 2KQNA 5F3BB 4M5YL 4LRNL 3X3GL 4E41B 2X1WL 1GOFA 4RRPG 4F7PB 1JMXA 5E70A 1FO0A 2ICEA 3LCYA 3H9SB 3TT3H 2ADJB 4U1JA 3BRGC 1E4XH 3EKCA 1NGWB 3L9RB 4ZG1A 3U0WH 3IGAB 5IG7B 1U9KA 2HMIC 5FO7B 4KRLB 1DQJB 4JKKA 1X4YA 1P5UA 3TT1L 2FYYA 3W5NA 3UPAA 4Z7OE 5D5MB 1MCPH 1NAMB 1AGCB 4G6KH 4OD1L 4TSCL 2X42A 1IAKA 4JN1L 3GMRB 4DQOH 4RAVA 4LCYB 1MIEL 1QBBA 2PUQT 4KVNH 4KHTL 3G6JE 3OF6A 4HUNB 4LKCA 3GUTB 4CNIA 3STLB 2J8UE 1Q9LB 4MA3B 4E5XB 4ZNEE 1FGNH 3NCYS 3LV3A 4XI5C 1K85A 1FYTA 5C2BL 4XNMA 4LARL 1J88A 3L5HA 2B1HH 5A40E 3K2UH 5BMFH 3RPKA 5JW3L 5CIPH 4FNLH 5TPWL 3QB7C 2V2XA 4C83B 2PW1A 4U1LA 3GSUB 5F9OL 1GGCL 3L3KA 3VRIA 1BIHA 5E1AB 4QXTA 2CKBH 4F15B 4GW4A 1F3DJ 4HIIB 1I7TA 1VGEH 2XG5A 2H1PH 1MFBL 5JMRA 5DK3A 4FFWC 3FOMB 5F89B 4DEPC 3LVEA 4PJFB 2GJ6E 1EIBA 1M1SA 2PYEE 3QIBA 4ODSL 4X9BA 3HA0A 4JQVC 3VXRB 2FH8A 4LVOB 1LDSA 4N68A 5TDPB 1CDJA 1G7JA 2FX9L 2R0KH 3PWVB 5IW1B 1OAKH 1JPST 5C3LD 5D7IE 2AXHA 3KPRE 3P3YA 3MNVA 4E41E 2M2DA 4Z7UB 2DMCA 5BVPH 4QRSB 3H9SE 1A7OH 4BZ1H 4LQFL 3V5DB 5C09E 3K1KC 4Y5XC 3MYZA 4POUB 3C5JA 3MUGA 4R96A 5DJ2B 2Y06L 5D2LB 3OZ9L 4O4YL 3PGCB 3IYLW 5ESVB 3MLVH 3AVEA 1NMBH 3O11B 1FL5B 4P48A 4EBQH 3N9GL 4MCZB 4GW1A 4OF7A 2R1XA 3H3BC 4WCYH 1KXQE 4MXVF 4K7FB 3I9GL 5INCB 3FT3A 1QFOA 6CGTA 1W72L 4KK5D 3RIAK 4PRPA 1AJ7L 1A14L 2HTKD 3C6LC 1I4FA 3MJ9A 4JQIH 4PJXB 2Y6SD 1RULL 1HEZA 2GUOA 3PWLA 3ULVC 5FOBA 4X7FC 1WVZA 4JO2H 5FA4A 3D85B 5L2KB 2A6JB 3DVGA 3ISWA 1BD2D 1LO2L 3G5ZA 1I9IH 2FSEB 3B5TA 5ICXA 1CG9B 4AM0A 1YNTB 3HC4L 1HXYA 5L8LB 2V2TA 5K9JH 4F9LC 4Y8AA 1A4JA 3DXAD 5E99L 4ZPVA 3QJHA 4OLVL 2P42B 3SGJA 1DZBA 4HW6A 4HIEA 3C5ZC 4GQ9H 1XCTA 2YPLE 3R8BB 2VN7A 5GRVK 1U3HB 1E27B 4NHUA 2X1OA 3DMMB 4QRQA 3EGSB 4MX7B 5EUKA 3JTSA 1J0KA 2IFGA 3TFKC 5E8OB 5ITFA 1PW3A 3QUKA 4JDTH 4NNPH 3P73B 4FQLL 2Q6WB 3B9KC 3T0EC 4N8VA 4PS4H 4QNPE 5DXWA 3MROA 1QYGH 4JRYB 1X9QA 5HYFA 1D6EB 2VLLB 4OBRA 3ARGA 4Y2DA 5C0BD 5EUOB 4NOBA 2B1AH 1BZ9A 1MRCH 3MV9A 3IFPA 4RBPH 1HXMA 2VIRA 4PUBH 5FM5M 1XIWB 3UJTH 3U36A 2X4UA 1MREL 1XZ0A 5ESQB 1HKFA 2XTLA 4YBQD 4U1NB 2P4AB 5EBMB 4XMLL 3X3FL 2HVJA 5TFSL 2NCMA 2FIRT 4OQTL 2HTLC 4YHYC 3DUUB 5T33L 5CBEB 5EC2A 1Q0YL 1OCWL 5D2LE 4YWGH 1JP5A 3RY4A 5ALBH 4HCRH 1OD7A 3BIKA 1I1CA 1DBKL 1ZT4B 2VZVA 2BC4B 4UI2A 3MJ7A 1QVOA 4FMFA 4OGXL 1MVFA 4HFUH 2JJWA 3OR6B 3SGDI 3CFDA 4F8TA 4IIQC 3CZJA 2HFGH 3CSYB 1AXTL 4N8PA 1NLDL 5F7KC 3UTTD 1NMAH 4PJXE 3G6DH 4YO0B 3DLQR 3NGBC 3P30L 3G9VA 5DJAB 5DQDH 4G9FB 1D5IH 2VQ1A 4NO0D 1FH5L 2CO6B 3GSWA 3G08B 3UYRH 4PJ9C 3O6FC 4OF0A 4Q0XL 4M6NH 5KTEL 5IMLA 5DK2A 5I18H 4JZNA 2YD7A 3MLXH 1RURH 4ZODA 3MX0A 3TZVC 1ED3A 4OFVA 1AI1H 3ZL4H 3E3QE 3B5HA 4HS8L 1MFCH 3ZYIA 1PX4A 3OKLB 1V3LA 3BUYA 5L7XH 2FLRT 2H8PB 3O6LH 2V5RA 4KK8C 3S34L 3ALXA 5IB4A 3FQNA 1GVIA 3PQYD 1MY5A 3QDMD 5AAMA 4NDMA 2E7LC 4HIHB 4DW2L 3TBTA 1G9MC 3VDBA 1JTOA 3VXSB 1Z2KA 3QIWD 3OG4B 5I8CB 3FJTA 2UWEF 1N4XL 2F54B 3IJYA 5A1AA 3IAQA 1MAKA 5DRWA 3T4AA 2CIKA 4M48H 3X13B 3B83A 2NY0B 2DQUL 2AK4D 4QRPA 4ODHH 3NFSH 2DJ4A 4PJBF 1A6TA 4N0YH 1P5VA 4YIQA 4HWUA 1NFDB 2OJZL 3QFJD 15C8H 4PJCF 4U4BA 3NMEA 5ACZB 5C0JB 1MHEA 3W0WB 1G9NH 3HZYB 1DDHA 3BZ4B 3EYQC 3LZFH 3V4UL 3QUZC 1A6ZA 3KNBA 3H42H 5CEXB 1YEFH 4WUUE 3AFLA 3BT2H 3UTSD 3MBEA 2JLLA 2XTJD 1OAUH 3MUHL 3DHMA 12E8L 3MLSL 5E4IA 1RZIA 3SE9H 3ZSTA 3S35H 3RX5A 3DYMA 2J4WH 1FNSH 1JIBA 5FAAA 3SKJL 1JPGA 3LQAH 1BX2A 1K2DA 1KJVB 1L0QA 1XGTB 3F7PC 4P99A 4G9FE 3IDUA 3NIDE 1WWCA 4XPFL 4I0PB 1GZQA 3GI8H 1MEXH 2APTA 3MMEB 4G6JL 5GJSH 3QG7H 3FQUA 3H2WA 4EDWL 3FB5B 1SHMA 2GITB 3FFDA 5FCUH 3IXAA 4H20L 2X1PA 1J0HA 1IKNC 2A9ML 1IILE 5CAYB 4LSSH 5HHOE 4D3CH 2BY0A 5FGBC 3A6CH 3TVMA 1EJOL 2Q8BL 5EIQA 3E6HA 3FCTA 2JKXA 1CDUA 1FO0B 2ICEB 5HI3C 5FYJH 3MZTA 4K94L 4PYHA 4U1JB 4PRHD 2P43B 5JDSA 4PRDA 3C08L 2EKSA 2ERJB 2FYYB 4P23A 1NCDL 1CD8A 2MCPH 2VL4A 5KBNC 2F54E 4LEOA 4M62L 4OF3A 2H2SD 1EEQA 1J8HD 5F93C 3CFJA 1IAKB 2GW5A 4WO4C 1P4LB 3QHZL 1CDHA 4TVSa 4RAVB 4D0DA 1KN2H 3DRQA 5F7DA 5LBSL 1LE5A 4QHKJ 1URLA 3NAAH 4LKCB 2C3WA 4LSPH 4PJIA 3SHSA 1QEWA 4I3RL 4HAGA 4CNIB 5LXGL 1SY6H 3ILPA 4QLRA 5AWNL 5A2JH 1GSMA 4FP8H 3LV3B 1NBVH 1NFDE 5IHZB 1FYTB 1A47A 3F58H 4XNMB 4H88H 4OJFL 3B9DA 2F53D 2HMID 3W0WE 2VDOL 4MAYA 2V2XB 2PW1B 4P5MA 3VGHA 2VO5A 4U1LB 1KPRA 4AL8H 5J13C 3PG2A 2UV3A 1JF1A 4K7PX 1Q8MA 1YNLL 4M93C 3L3KB 1YN7A 3VRIB 4I9WD 5FYLH 1FP5A 2J6EL 3T4YA 1RVFH 4QXTB 2AABH 1NAKL 1SM3L 4GW4B 3BXNA 1N5YH 1I7TB 1OLZA 1CLZL 5LGHH 2Q8AL 3TJEH 3CFEA 5I15H 1I9JH 2DQIH 2QHRH 3QIBB 3FB7A 3WFDH 1KELL 4F37K 1B4JH 1G7JB 4EOWH 2VR4A 1HSAA 4GG6E 1T2JA 2BSTA 1KFAL 1NGQH 4JFXA 3F7VB 2Q3AA 2X09A 3UEZA 3MNVB 3VG9B 3NH7L 3LKRB 2WV3A 5IJKA 3CX2A 4Y89A 1YPZF 4WHDA 3SE3A 1KN4L 1GGBH 1UH4A 2OXGA 1ZEAL 3HG1A 3C5JB 3MUGB 5CSZA 4R96B 1FZMA 4YHLL 4P46A 5GS0C 1KTDA 1ONQA 4FFWD 1P4IL 4D94A 4LSRH 4MLSA 4Q7DA 3DVNA 5CILL 4LGPB 5B39G 4GW1B 3Q5YA 1CGWA 4BZ2H 2R1XB 1JWMA 4JY6A 2YMXH 2R4SH 5KW9L 3FT3B 4GRWF 3T2OA 4PRPB 2ZCHH 1I4FB 4NQDD 4TUKL 2GUOB 3PWLB 3WCYA 4NQUA 4YHZH 5FOBB 5FA4B 2Q1EA 3DVGB 4OIBA 3IVKA 5I1IL 4FN0A 3G5ZB 1E4WL 1FYTE 4RMSA 3OB0H 1N59A 1LO0L 2P49B 3EUUA 5IHUH 5ICXB 4AM0B 2HKHH 4JHAL 5I73B 1HXYB 4FA8A 3ARDA 2V2TB 2HAZA 4K9EC 4JCMA 1A4JB 4ONFL 4ZPVB 5BOPA 3BRFA 5IM7A 5E9DE 3QJHB 3IDIA 3PDDA 1MCNA 2E6PA 5IBTL 4Z0XA 3FMGH 4N0FA 3RZWA 4NHUB 4QRQB 4UBDC 3VI3F 4AEIL 4CN4A 3JTSB 2ADGA 2AGJH 1A8JH 1YEJL 3ULVD 5ITFB 3D3VE 1X5HA 3HPLA 1QSFA 4N8VB 1HQRA 1I1RA 3HAEG 3MROB 4JM4H 4L5FL 1ROWA 5D4QA 3ARGB 7CGTA 2BSED 1CGXA 5TF1H 3FONA 1BZ9B 3MV9B 3IFPB 4RMUA 4JR9L 4KY1L 5ILTL 3H6JA 1HXMB 4ZAKA 4YFEA 5DJ0A 1C5BL 3B4NA 3FRPA 2VIRB 3U36B 4ZQKA 2X4UB 1XZ0B 4GSDH 3KJ6L 4LQ1A 3C5ZD 3L3OA 4XAWH 1XCQB 2HVJB 2HT3C 5BMFL 4HPOL 5GJTL 4K71C 3KDMA 1M6OA 5J12C 2XQBH 1AQKH 1KCVH 4WTZA 5D93B 4DKFH 3TFKD 5EC2B 1ZLUH 1B9ZA 1QSEA 4PRBA 1HHHB 1AP2A 1JF6A 4DOHB 4WFED 3ARXA 2YN3A 3B9KD 3T0ED 3QUXC 3RNQA 1DSFL 3BIKB 4OLXH 1J12A 4JFDA 1MJUL 3QDAA 1E28A 3MJ7B 4XVJL 3LN5A 1Y18A 3AY4A 5JIIA 2WAHA 4BSJA 1CGTA 2EDBA 3CFDB 3HNTH 4Y16A 1CLOH 2X89A 3RUGA 3V0WH 1GAFH 3OKMA 1VADA 2GT9A 5HD8C 3PGDA 2VQ1B 2IBBA 4WJ5A 4POZC 5TQ0L 3GO1L 8FABA 4F9PA 3GSWB 4RWHA 3DRTA 5DDHA 2O93L 4IMKA 3L3GA 3MRRA 32C2A 3WUZA 4YGAB 1I1YA 1RUKL 2HTLD 5IMLB 5DK2B 2ADIA 4JZNB 2DD8L 4OGYL 1S5HA 4QF1A 1RMFH 3WKMH 5GRUL 1ED3B 4WDIA 3ME0A 2BRRL 3AMLA 4JVPA 5IB2B 3BUYB 1ZHLA 2V7HA 1N64L 1AC0A 3BMWA 5IB4B 4D9QE 3FQNB 4K3DH 4ZSOA 3B9EA 4NDMB 5CEZH 3KJ4C 5I0DA 1A6WL 2VLME 3KPSA 4FS0A 3TBTB 3RHWF 4HUWA 2EDLA 4HJJL 1N7MH 3O6FD 4PJ9D 1IM9D 1HILA 3IJYB 1CFQA 2BY2A 3B6SA 3VGBA 1MFAL 1XR9B 1TTGA 5DRWB 3T4AB 2CIKB 3TZVD 1EGJL 3SE4A 1C08B 4HX1A 1DLFH 2DQDH 4UINH 4QRPB 1I9IL 3L3JA 1AH1A 1A6TB 1BOYA 3BDBA 2V9QA 3SGKA 4YIQB 1PG7X 1UACL 1MHHA 2QL1A 2R2CA 4WI6A 1AHWC 1MHEB 4LSUH 4XC1L 1NUDA 4XNUH 1DDHB 2BVOA 2XZQH 3TNNA 3T0EA 3KNBB 3ZHLA 4AEHH 1JGVL 1KCRH 1NMCB 1JVKA 5L6YH 1SYVA 2E3VA 5SWZE 3HZKA 4NNPL 1RZIB 5SX5H 3LSOA 3QRGL 5ADPH 2A2QT 4YBHA 4WI4A 4N8CH 1BX2B 5HHXH 1K2DB 5T1LD 4J4PC 4IRZH 5SV3A 1QBLL 1R3JA 2N7BA 1GZQB 4H1LH 4UQ2A 2NPLX 4GXVL 3U1SL 2GAZA 2M26A 3FQUB 4M4PA 4WHYG 4UZGA 4RFNB 3IXAB 2IFFH 3GDBA 1K8IA 3EYQD 3QUZD 1GGIH 1CFTA 3TVMB 3MODH 3VFOA 3E6HB 1KYOK 3UMTA 3FCTB 5DD3L 3HTLX 4ALAH 2VDKH 3QDMB 5EOTA 5JDSB 4PRDB 2PN5A 3ZKNC 1ORSA 2EKSB 5ACLA 3WFEH 3BPCA 4P23B 3GK8L 2NZIA 4LEOB 3HE6A 5BRZA 3D87B 3EO9H 2DQJH 3CFJB 2NXYD 5BO1H 3FB6A 4D0DB 3KG5A 3DRQB 5F7DB 5HGAA 4PTUA 4TVPH 1VA9A 1LE5B 4PJIB 2EDTA 3CZFA 1QEWB 5J11C 5MP6L 2W0KA 4D9LH 5AZ2L 5IT2H 5B4MC 4GLRH 3ILPB 3MLXL 1EO8H 2JELH 5HI3D 4NJAL 4YNYA 3AAZA 3DVFA 4KH2A 3PP3K 2E5EA 1NEUA 4C59B 1A7PH 1YQ2A 3GHBL 5L7XL 1IQWL 5HGGS 3X14A 1D9KC 1F4YH 1KB5H 3UTPE 1WCBA 4P5MB 4WNQA 3ZE2F 5F6IB 4RDQG 2JJTA 2EE3A 1KPRB 3H7BA 4OV6F 3V6ZA 1JF1B 1I3UA 3HMXL 4QY8B 4R3SA 3STBA 1YN7B 4WO4D 2R39A 4OFDA 3T4YB 4I0KA 4HPYL 1S7RB 4R97C 2WP3O 4PLKC 3BXNB 1CXFA 2AJYL 3ZZ1A 4HMCA 1MJ7L 5SWQA 3T0XA 1FDLH 5E6YA 1A7RL 2E7BA 2B5IB 1P7QA 4UIKH 5AZEL 3DYPA 1OD9A 3FKUS 1HSBA 3CFEB 4M8VA 4NUGH 4YGVA 5F96L 1CXLA 1MSPA 5EG6C 3RIAF 1U8HA 3FB7B 1XGQA 3QSKB 3IFLL 1TQBB 2BNRD 5IFHL 4MMZC 1HSAB 1PEWA 2C3HA 2BSTB 1IGIL 1QFUL 4CVZA 4EZMA 1WCQA 5CGTA 4XX1E 4LHUG 2MMXA 4K8RC 3SDXB 3OWEA 3K1DA 4E0RA 2X4TA 2UUDK 3CVHA 3HG1B 4ZS7L 5IESL 2EDFA 5CSZB 1FZMB 1NGXA 4KJWC 1U8JA 4P46B 1H3WM 1KTDB 4XPAH 3NBNA 1ONQB 5C71A 1UZ8A 1N26A 4V1DD 4NNYA 4MLIA 3DVNB 1FE8H 3WNPA 4YC2B 4HZLB 2H41A 4JY6B 4X5LA 1P7HL 5BZWA 3WO4B 3NCEB 3RWHA 2P5WA 1TXKA 4PJIE 1NDMA 4JFYA 1QLFB 2JJSC 1Z3GH 5DJ6A 3IB4A 4OZHA 1LP9A 5ITBH 5MHSD 3VWJC 3UC0L 4ODWA 3IVKB 4S2SA 5B3JF 2P8MA 1U8PA 2I5YL 1X4XA 2BXYA 1N3NA 1N59B 5IMKA 3HHRB 3MA7A 4JFZH 5GS0D 5HDQL 3ARDB 4HKJA 3TYGL 3OAUH 3DX9A 3IDIB 4QWWD 3GMNA 4Z7VF 4PV8A 4Z0XB 3IU4L 4KI5C 4N0FB 4KKNA 4JFHE 4D0BA 4KKLC 2ADGB 1GZPA 3R06A 4RGMC 4Q6YA 3HPLB 5DEGA 4PG2C 2VUOA 1QSFB 2OZ4A 3S37L 5DC9B 2EIZA 1HQRB 3ELAT 3I6GA 4H0HB 4KKBC 2W9DL 5HDLA 1CLYH 2PCPA 1RZ7H 4JFOA 4LHJB 3ABZA 3HE7A 5KZCB 4GRWH 4P2OC 1SY6L 3F7RA 4K07A 4ZO6A 3UBXA 4ZAKB 2PTUA 5DJ0B 5GHWH 4MNQD 1NEZA 2O5YH 2ZUTA 5CJ8A 3L3OB 4CVWA 1VDGA 4UBDD 3KDMB 1M6OB 4KTDL 3HG1E 3W9DA 5E2UL 1QSEB 1T7VA 4PRBB 3TO4A 1AP2B 1TDQA 4J1UA 1BQHG 3LMJL 3RNQB 1SMAA 3VRLE 2XRAL 4JFDB 5IBUB 1KEGH 2L4OA 3DUSA 4DEPB 1E28B 4Z8FH 4PJBA 1LEKB 3LN5B 4Y4FC 1Y18B 3ZDYF 5F1NA 1LDPH 4JRXD 3I50H 3CFKA 2BVPB 3PHOA 5F9JA 1JGUL 3CNKA 1YEHH 3PWJA 5LGHL 1DBML 4F7CB 1ZT7B 4Y16B 1WAAE 2NNAA 2UZXB 4JZJC 3F8UB 3RKDC 3RUGB 3V52H 3KYNA 1B0WA 2CQVA 2OCFD 3OKMB 1WZ1H 2CDFB 2DQIL 2GT9B 3VGAC 5MEND 1MAJA 3PGDB 4LF3A 4WJ5B 5CLWA 8FABB 1QKZL 1BZQK 3DRTB 5DDHB 3QO0B 2HT3D 2VDLH 3MRRB 32C2B 5LKNA 2IAND 1I1YB 1NGQL 2ADIB 3C9NA 1S5HB 4QF1B 2FH6A 3UO1H 4PRIE 3DVIA 1UH2A 3QUXD 1BEYL 2RCSH 2VH5H 1CXKA 4WDIB 4EUPG 1AXIB 3QI9A 3UJJL 2DLIA 2VTFA 3BEVA 4KZDH 1A6PA 3EYSH 3KR3H 1I85C 1ZHLB 2V7HB 1NAML 3RWCA 2ZOKA 5IGXH 4LSTH 1YJDC 3DPBA 4R8WL 4XCFH 1ZMYA 1Y6MR 4ZSOB 5I30H 5T5NG 4CL7A 5HD8D 1VKXA 4U0RB 1QSFE 4POZD 3WHE1 4HUWB 4B7IA 2WP3T 4BZ2L 4WWKC 2ESVA 4IJ3C 1Q72L 1HILB 4LK4A 1AGFB 1CFQB 4DCQA 2VXUH 3AS1A 4FFYH 9CGTA 4XHQA 2ZCHL 5CJOH 4N9GA 5E6ZA 5IVOA 3O45A 2DJUA 3DIFA 3DX8A 1B2WL 3BN9C 4EXKA 3UDWA 4HX1B 3QXAA 5KJRH 5KVMC 3ZE0E 4MNHA 3IXTA 5L88H 2PR4L 1U0QA 3L3JB 2XT1B 4RNRA 3C5ZB 1MIML 4URTB 4L4TE 1YEIH 4RA0C 3U46A 1MHHB 4UAOB 4KDVA 4A2LA 2IQAA 1QSEE 1IC5H 3H0TA 1RZFH 4Y1AA 2E7CA 2LQRA 3QUYA 3ECBA 1MFEH 4DGYH 4JB9L 4OLEA 3ZDZF 2PTVA 1I1AC 2BVOB 3K74B 4JFDE 3TNNB 3T0EB 3U9UA 4BFEA 1ZV5A 4ZFFA 1SYVB 4RQQA 4Z77A 4NBZB 2V5MA 2FATL 1CGUA 3ZKXC 4C56A 1U8MA 3LSOB 1HHKA 5FYJE 3VJ6A 1IRAY 1OLLA 1MCBA 1T7WA 4JM4L 2YPVH 4P4RA 4ZXBA 3I6LD 5MENA 4RISL 1R3JB 4UQ2B 3OG6B 3TJHD 3FFCE 2IANA 2R0LL 2GAZB 5DA4A 5HYIA 4P2QA 5GGQL 5JR1H 1A02N 3VFWA 4K55A 3BP5A 4OCMC 4MHHI 1EZVX 4G7VH 5HVWA 1K8IB 5JDJA 3RJDA 4XBEL 1H3PL 3WKNA 2FB4H 4GT7A 2VXSL 2OJEA 2VZOA 1BHGA 2FDBP 2FHCA 4LLYA 5D7KD 3KYKH 3VFOB 3CVIH 2CK0H 3RWEA 3KS0H 3WNKA 2LVEA 4FFVC 1KEML 3TM6A 3S4SG 4Y19D 3AXLA 4D9RD 4M00A 3KPSE 4TNVK 1F8TH 1ORSB 5B38G 4J4PD 3BPCB 3BGFC 2XKUA 2HH0L 4XBGB 4PJ9B 1IM9B 4M6OH 5BRZB 1HZHL 5JPMA 2V9RA 1OHQA 1YPZA 3QISA 4JREB 1SJXA 3FB6B 3WLBA 3ZMRA 5JQHC 5FYLE 2D7TH 5HGAB 1FL6A 4PTUB 3T1FA 2NR6C 3CZFB 1FORL 4F37F 5ALCL 2M1KA 4X98A 2VQTA 5F7FA 3HNSL 3WSQH 2OX5A 3WKML 4LLMB 4HXAH 3S35X 1JZ7A 4YNYB 3AAZB 4U1GB 4JKLA 1EJ6A 1T0MA 3BKYL 5TE7L 3ZKND 5FK9A 4OLWH 3X14B 1LHZA 2EZ0C 1TQCC 5T3ZL 1WCBB 1NQBA 3LH2H 3V6ZB 3HI6H 3ZT5A 1X5IA 4R3SB 2ICWJ 1MFDL 3L3HA 4O5LL 1K6QL 3O2WL 4OLUH 5SWQB 5B4MD 1P7QB 2XACC 1HSBB 5DURD 5T1LB 2ARWA 1MELA 3EYOA 5D71L 4GUPA 1U8HB 1AQDA 3WN5C 1XGQB 4K94C 5F7WC 4P5KA 5L8JB 2VE6A 3EOTH 4KAQL 4X7TB 4CVZB 1F6LL 5FM4A 3GHEH 2A6KA 3QUZB 5DQ9A 1MAMH 2FEEI 5E4EB 3S37X 4BFBD 2Y23A 3NFNA 5E6IA 5D2NA 4E0RB 5FO8A 3JWDH 2X4TB 3ARBA 4IEFB 3MO1A 3BYYA 4YHOH 3CVHB 2QQNL 5CP3H 4YDLB 4PLKD 1NGXB 4AEHL 2DWEA 1U8JB 1UZ8B 1RZ8B 2XZAH 1KCSH 5CMAA 4NNYB 4FQCH 3BISA 4HUUA 1EAJA 2JK5A 5BRZE 1MJ8L 5CZVH 3AU1A 5BZWB 2X40A 2NXYB 1HKLH 4QHUA 2P5WB 3RWHB 3DGCR 4G5ZL 1HK6A 1NDMB 4JFYB 4AMKH 4YXKH 4HLZG 2CMRH 4APQA 3UYPA 4OZHB 1LP9B 3EFFA 3SDYL 4K8RD 2EKJA 4DTGH 4OI7A 4L3EE 4D0CA 4KPHH 4ODWB 4S2SB 4F33A 2YXMA 2P8MB 1U8PB 2WMPA 4DKEL 1NC4A 1N3NB 5DUPH 5IMKB 2CKNA 3O2VL 3QCVH 3MA7B 4KJWD 4NQSA 3WIIL 3HKFA 3H9YA 2YSSA 1KT2A 2AXGA 4HKJB 5EZOH 3DX9B 4DKDC 1MRDH 3GMNB 4IS6A 3K0WA 2VZ3A 1JPTH 4PV8B 4XP9H 5DUBA 4WGWB 4LCWE 3QO1A 2CPCA 4WO4B 4HG4K 3BYTA 4D0BB 2BSSA 1GZPB 3R06B 1FG2A 5DEGB 3RDTC 1J0JA 3VWJD 2EIZB 4OB5H 3I6GB 5BO1L 5GZOC 4XNZC 1VFOA 4JVUA 2PCPB 4JFOB 3HE7B 5DZNA 2VDPL 4G8EA 5GIRB 5DHVH 1ZHBA 2QQKL 1BAFH 3UBXB 3HRZA 2BNRB 4D9LL 1RFDH 5JOPD 4MA7H 1WIOA 3GJFA 4ISVB 4G43A 5T1KD 3SDAD 1NEZB 1T03H 1JRHH 3QH3A 5EH1A 2V5SA 3U48A 2F19L 3PWNA 4NRXA 4M93B 4KKLD 2GCYB 3W9DB 3M07A 5DUMH 1W8NA 5GS3A 3TO4B 4XCEA 4J1UB 3T2PA 3ZYZA 2LE9A 4JCLA 5DWUL 1EPFA 3WFHA 1NFIA 4GAJL 4KKBD 1J5OH 1FRGH 1UVQA 3DUSB 5C07D 4PJBB 5I1KL 1EEUA 5F1NB 4HWBH 3DI2B 3CFKB 3PHOB 2BNUA 2EIDA 3O3EA 5M95B 4P2OD 3PWJB 2NNAB 2P5WE 1IGYA 3KYNB 5CEZE 4PRAA 2IC2A 4OZHE 1WK0A 4LF3B 2VYRE 5B3NA 4G6FB 1UZ6E 2QLVB 2EH7L 1FLRL 3LIZL 5DD1H 4CBPA 4DGVH 1OB1A 1U6AH 4WY7L 1AFVL 1FO0L 2VZSA 3LB6C 3D9AH 4MSWA 3C9NB 5GGTA 3U7WL 1I3VA 2P5EA 5AYUH 4YXLH 2R2EB 2ZNXA 4F57L 2OR9H 3QI9B 2IBGA 2PXYC 3BEVB 2RHEA 4NQEA 4LVHB 4Y4FD 3WV0A 3PNWA 4NUJA 3RWCB 4QXUH 3P0GB 2DIBA 3BAEH 1YC8A 3P2TA 1NBYA 1G7LA 3VXUE 5LAXA 3RKDD 5JXAL 2VC2L 1AXSB 1MCCA 1VKXB 5AYQA 5IKCB 4G8GA 4XH2A 2O26U 4X7SH 1J86A 1FAIH 4R7NA 3MV11 5JXEA 1OF2A 4DCQB 3GIZH 3WFBL 4KXZI 4N9GB 4LASH 4CMMA 5AG8A 2DQTH 3QDJE 3DIFB 1TLKA 4OCYH 5FO9A 1C5CL 2AEPH 4G6AC 3QXAB 2Y5TB 4D2NA 3W2DH 4MNHB 3SDAA 2F5AH 3IXTB 2IGFH 2UWEE 3M8OH 5EO1A 2WBJA 1F3DH 1BFOA 1MCHA 5DT1H 1A7QL 4XP1L 5E95B 5F8QC 4X6EB 3U46B 2CLZB 5DRNB 2IQAB 1NL0H 3H0TB 2B2XH 4Y1AB 4QOKD 3ECBB 3EIFA 4XMKH 2IAMA 2R29H 4WWKD 3VFVA 3U9UB 4NN6B 4OF5A 4PJBE 4ZFFB 1T1ZB 3EYUL 2K1MA 3HR6A 4RQQB 4Z77B 1ERNA 1KIUA 4C56B 1U8MB 4KDTC 4JO4L