1HXYB

Crystal structure of staphylococcal enterotoxin h in complex with human mhc class ii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
188
structure length
180
Chain Sequence
TRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/toxin
molecule keywords HLA CLASS II HISTOCOMPATIBILITY ANTIGEN, DR ALPHA CHAIN
publication title Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 180
sequence length 188
ec nomenclature
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hxyB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1hxyB01
4JVUA 3S3SA 4YPGB 4MJID 4I48A 4WIQA 1K3IA 4QRRD 3ULUC 3HE7B 4ZPVA 4HCRL 4G6AC 5E8NA 4OLVH 4EI5B 3MRLB 2YD4A 1CZ8H 4K71B 5IIEA 5ELIA 5IB4A 1DQMH 4GQ9L 3SDXF 1GGIL 5ALCL 4OUUB 1UZ6F 2BERA 2Q3ZA 5E2JA 3QJHA 1U8IB 4TULH 5C0RL 4P2OC 5AUMA 1BFTA 4U6HA 2OK0L 1BAFL 4KK6C 1OHQA 2V2TB 3E6FB 4FZEL 1IGTB 3I2CL 3QUML 4AH2B 3QEQB 5J1TC 2HFFB 2SEBA 4Z76B 5L2JB 4ODWB 1FC2D 1G7HA 5DUMH 5D7KE 3IETB 3O3EA 1S9WA 2X2YA 4NQTA 4BH7A 3UTQB 1MFDL 3MXWH 5TDNB 2B7DT 1FGVH 3QDAA 3SDCB 1IFHH 4OCWL 4X4XB 1KLGB 4C54A 5F7EL 3MV9E 3LQMA 2CMRL 2EE9A 2F19L 1QG3A 5DMGD 2QQKH 1G9NC 3O2WH 4YR6A 1WCBB 5C0AD 3O2DL 2R69L 1P5UA 4CNIB 3I84A 1TZIA 2J12B 2VIRB 1GPOL 2V17L 3UDWC 1MFCH 4D3CH 2NMSA 3FT3A 2YPLB 5EU6B 5E8OA 3S35X 3DO7B 4MS8C 4XCCL 4KK9D 4R4BB 3FFCB 4XNMA 2Z93B 4LPVA 4YUEL 4C83B 1M05B 3WXWL 5C8JB 4UQ3A 5D70H 1EMTH 3MRRA 5EZIL 3VFVB 1H15A 4LBEA 4LCWB 2DQHH 1ZSDA 1AIFB 4BQCA 4L8BB 3M8OH 4Y4KA 3K46A 2V5RA 3AB0B 2AXFA 3TBYB 1G6RH 1U8OA 3PIQA 3KLHD 3ZYIA 2YD6A 5DMJB 5E08L 4RGNC 3OKEA 1S8DB 5IBTL 4TOYH 3UC0H 2WQ8A 3MRFA 4JCMA 4ZS6C 5E6IA 4Z7UA 2GT9A 5CJ5A 2FECL 4D9QD 3REWB 2VABA 3P77A 5DQ9A 1Z3GH 1OTTC 1VADA 3BQUB 5FCUH 3RNKA 3O3UN 4TQEH 1LEIA 4LCYB 3P4LA 4OF6A 3V9FA 1G6VK 4XCEA 2HLAA 2F8VA 4XP4L 4OUOA 5LGJB 3AU1B 3KG5A 3QDJD 1XF5A 3PDOB 1PYWB 1I3RA 3RDTB 4X6CF 4PGEA 5KVDH 4L8SB 2PXYA 3UO1H 3C5ZC 3F5WA 2J3SA 1D6EB 1HWHB 3P4MA 1PG7X 1CGUA 2NXZD 4MQ7B 2PYFA 3NZ8B 4FQHB 4AT6A 3BH9A 3VWJD 3X13A 3L5JA 4XPBL 2R1YB 3UMTA 4PJHE 5ITFB 1BECA 2QADC 4HXBL 2XN9A 2YD5A 2F5AH 5ANME 1S9XB 4MAYD 1FNSL 1EO8H 4LRIA 2VISA 3VD9A 5EU3A 4Z77A 1KN2L 1NLDH 1J0IA 4OIAA 1DANU 5KVMC 1HHKB 5DS8B 1PEWA 3QG6A 4PLJD 5TDPB 3QEUB 2EH7L 3QO0B 1INQB 2X1QA 4LCCB 3UJTL 4XB7A 5CD3B 2APXA 3LIZL 5GGUA 4M1DH 2V2WA 2DWDB 3WUWG 5C0CB 5FUOH 4OZGE 2XKSA 2IFGA 5HYFA 5IHZB 3LQZB 3DGCR 3L1OL 4F33B 4ZUSB 5ILTH 1MWAB 4U31A 1G9ML 2VXQL 3ZT7A 2BVQA 3AMLA 4PJXB 4RCAA 4UOW1 4Z0XB 2G60H 4CAGA 3VFMB 4QRPD 4ODTL 3MRGA 1CR9H 3ARTA 3EYOB 3O4LD 1QBLL 3EO0B 4HXAH 3BESR 2VDRH 1UYWH 1A9EA 2PTVA 3EHBC 4U3HA 5GSVB 3MR9B 4X7SL 3QNYB 5E2UH 5K9OA 2Z8SA 5JIHA 3SQOH 3F12A 5IB5B 4J3WA 4UDTA 5K59E 2FJHA 2MSPA 1FQ9C 3CIQA 3G6JB 3WIHH 3GIVB 1BZ9B 2A74A 4P3DA 4X6DF 3IAGC 4FFVD 5D1QD 4ISVB 5DD1H 4OT1L 1YDPB 4MQXD 1CIDA 1UJTA 4DAGH 5CUSH 2DQUH 1B0GA 4UINL 3H7LA 4XPHH 2R1WA 3ARRA 4EIGB 2BNRA 3T0EA 3L7EB 5CGMA 3SGKC 1SEBA 1MRDH 5CJOH 4HPOH 3OZ9H 3QCUH 1ZLWK 1I4FA 5FK9A 1TFHA 1I1FB 2YOCA 2VLJE 1WITA 1YQ2A 2BSRA 4K7PH 4RIRA 4XXDB 4K23L 1BIIB 2CJUL 1MRCH 4JG1L 2UVEA 3SKOA 1LE9B 4FXKB 1JRHL 4XHQA 4KK8C 5FGRA 4Y7MA 1NC4D 5F3HB 4HIHB 3AS0A 3GUTA 3JUZA 4GBXD 3BH8B 1DBBL 1FNEB 4JKPL 3ZE0E 2VMFA 4V1DB 1KXVC 1QR1A 4FMFA 1DP0A 5D2NC 3AREB 1XGRA 4HCRH 4NHUB 2PYEA 4AM0A 5DJAA 4GQ9H 4UBDD 1NFDE 1GGIH 2EC9T 2DMCA 5ALCH 1ZHKA 5DSCB 2EYSA 1P84K 2EIEA 5C0RH 2W91A 1IGCL 4CMHB 5I71B 2KZ1B 5I30L 2VLKB 4LP5A 2OK0H 4NQCE 4O2FA 3CCHB 4FQQB 1ZLUK 3BZEA 3RWHA 4WU7B 3W0WD 3BP7A 5BO1L 1HCVA 4YHYC 3KPMB 2NNAB 4QRTB 3QSKB 4FZEH 3G6AB 3I2CH 3QUMH 2B8OT 1OQOA 5JNYB 5CSZA 4YEFA 1QRNB 3O6LL 3U46B 2MJWA 2OR9L 3WV0A 1AKJB 1TZHB 4X7EC 4CU6A 1QHPA 1NAMA 4ONHB 3AVEA 2K7QA 1PVHA 1MFDH 4MA7L 2YUVA 5DJ0A 2OSLA 4OCWH 2A83B 1PEZA 3CU7A 5F7EH 2Q7YB 4X8XA 5EO0B 5I75B 3IVKB 1HDMA 2CMRH 3VXSE 2F19H 2C26A 2ZUWA 4NN5C 3DXAE 3O2DH 2R69H 2BVEA 2ZUQC 4NQDB 4CU8A 1DLHB 4HK0A 4GG6B 1GPOH 2V17H 4OZGF 1OPGL 5J13B 1IRAY 3O6FD 5EU7C 2DL9A 1OGAE 1BX2B 4XCCH 4NKIL 3SO5A 2A9NL 4ONFL 4BZ2L 4IS6A 5IESL 4YUEH 1I9EA 4IMLB 4L8CA 3WXWH 2DM7A 4MA8L 1UWGL 3V6OA 3ALXA 5EZIH 2C3HA 5DTFB 2X1OA 4P9ML 3SKJL 4NHCL 3VWKD 3B9EA 5HD8D 1HYSC 4WWKA 4FFYL 4I5BA 4WEUD 1A6VL 1CD0A 3HAEH 5AD0B 1X4XA 3PDDA 3LPWA 4XPGL 2RB8A 5I8KL 3DSNA 3R1GL 4LNRA 4YDIL 3KPSE 3EJYC 4Y2OA 5CJ8A 5E08H 3NCYP 2JB6B 5IBTH 4JZNA 2H45A 3MX0A 1GGTA 1EGJA 2CKBL 4CVXB 5BVPH 4NKDB 4Y1AD 3T65A 1HZHL 1T0PB 1QBAA 1HH6A 1D3CA 5EDXA 5C6TL 5EUOE 3PWPB 1MFEL 4EDXA 4PRIE 2UYLA 3RZWA 4XP4H 5FF6B 2ZCLL 2V9RA 3ZKXC 5FO9B 1FV1A 5C08E 3ARFA 5IJVA 4M43L 3BRFA 2DYPB 1RUAL 3B9DA 3MRNB 2ZSVA 3KPQB 4HWZA 4QRSA 5DJ6A 1FZJA 4MXVF 4LSTL 3G5XB 5I76A 4PJGB 2H26A 5HGGS 4QO1A 3DETC 2E7MA 3AAZA 1T4KA 3MNVA 5CINL 1NGPL 4XPBH 4R7DB 3HUJB 4HGMA 2X05A 3BKJL 4ENED 1H8NA 3L3DA 4D94A 4FZ8L 3HE7D 5J6HA 3TBSB 3ZE0F 4JPWL 3DMMC 4PJAE 5EO9B 1FNSH 4AIOA 3QDGA 1DN0B 3BN3B 1VERA 3B2VL 1KN2H 2BFVL 3BW9B 5GGSB 2PW1B 3DUUA 1NFDF 1EHLL 4BSWB 2OL3B 3HI5L 4LF3B 4QXTA 2QQLL 4GOSA 1BHGA 2CIKA 1N59B 3CH8A 4LLVB 3MRCA 2EH7H 1Q9KA 5K9QI 2AS5M 1RU9L 4WDIB 5JZ7C 2FJGA 3UJTH 4QRUB 3RU8L 4HAGA 5D1XC 3LIZH 4M4PA 5B3JE 3WFBL 1RHHB 4KY1L 5EWIL 3HZYA 5AZ2L 5DJCA 4WHYG 3QEQD 1JWUB 3TYFA 1YMMD 3IFPA 3KXFB 1F2QA 4EKXA 1U95B 2F53D 4Q2ZB 2APFA 4X6FA 5EU5A 5FAAA 3L1OH 4RA3A 4K9EC 3ULVC 1INEL 1G9MH 5IFAL 2VXQH 4NO5A 1HXMA 1CDGA 4KRPD 4WJ5A 3PL6B 1YY8A 5CSBA 3R06B 4OAWA 1W72A 2ESVE 1AR1C 4ODTH 3G9AB 4HLJA 5DD3L 1QBLH 3FB6A 3D1MC 5C09A 4TN9A 4YHLL 5DVLA 1UXSB 1PW3A 1U41A 5F9AC 4X7SH 3UTPE 2HJKB 4IRSA 4O4YL 3SDDC 1BREA 4OFPA 2IBBA 1R3KA 4LLUB 5JPNB 3D39E 5TJWK 1UB5B 5GXBB 5EBLB 3FFCD 3QIBD 4R7NA 2HP4A 3W39A 5HGDB 5ERWA 1EAPB 1OVZA 3VGEA 4QHLA 1E27A 3CXHJ 4UINH 4LCWD 4EN3A 1NFKA 5E03A 5C07D 1NGYB 1I1YA 4KI5D 5GGTL 2HT2C 1MRFL 2JK5B 1S7SB 1LEKA 1G0XA 2D9QB 4WEBL 3Q5TA 1Y6NR 1JPGB 4K23H 1QSED 2CJUH 4YHIA 5F89A 2G75A 1LGVA 2OMBA 4JG1H 4GS7C 2VL5A 5IMOB 1KG0A 4HKXB 3WLWC 2FEDD 4JM2F 1MIML 1RV6X 4OI9A 1JRHH 3TN0C 4O5LL 4KU1A 2CD0A 1DBBH 4JKPH 3PWVA 4RAUB 1H3UA 5DRZA 2JJVA 4NDMA 3QUXD 3BYYA 3LRSA 5KANI 3FN0L 2J1KA 1MIEL 3HE6D 4I2XB 5IWLA 1KCRL 5KSBA 1IEAA 2YA2A 3OKDA 4PRPD 4WFGD 3I85A 1RY7B 4KGLA 3PHQB 5HGAB 1D5XA 2GSGA 2GI7A 1ES0B 4MLSA 4X7TB 3TVMA 5D7SL 2K1MA 2MHAA 1IGCH 1N0LA 1XF2A 1DSFL 5I30H 3QUZC 4KJYA 3KPPA 3NTCL 1DQTA 5SX5K 2W07A 3LN5A 1AO7B 5BO1H 1S7VA 3O8XC 4PTTA 3EYVA 1SEQL 5HHMB 1GZQA 4G80B 3BGFC 5DEZA 3LKOA 3I6GB 3O6LH 2OR9H 4YAQA 3QFJD 3UBXA 3QEHB 3BRGC 1W8NA 4JHZA 4U0QB 4JFDA 5DRXB 3O81A 1JMZA 4O2CB 1MVUB 2DWEA 4MA7H 4HKJA 1RIHL 3QIWD 3IKCB 2A0LC 1RJYA 2I5YL 4ZO8A 4PGJA 5F1NA 3S8WA 4WO4D 2R2EB 2X4UB 5HDOA 5B3JF 1D5MA 3JV4B 1U8KA 2FWOB 3OKNB 5TE4L 1B9ZA 2WNGA 4P2OA 5JXED 1ETZB 1OPGH 1IL1B 4FXGA 1DQDL 4ZO7A 1HHHA 5D93B 4NKIH 4NJ9L 3CFIC 2A9NH 5C0EA 3K7UA 4BZ2H 5IESH 1K9TA 2CR3A 4LRNL 1BMGA 1DE4A 4MA8H 1UWGH 2AXGA 4HG4J 4P9MH 3SKJH 4NHCH 1KPVB 5CGTA 4DUVA 1KSRA 3BIBX 4FFYH 4UDUA 4HJJL 1A6VH 5CSGA 3V0VA 3KPOA 4XPGH 5FUZL 1FFRA 1JCKA 4NQSB 5I8KH 3R1GH 5IV2A 1Z9SA 3HMXA 4PJ5E 3BPNC 4JFPB 4MHHG 4YDIH 1R5VB 3QWOB 5FYKE 4X99A 3DURA 4O9HL 3QI9B 2CKBH 2GY7B 4M4RA 1HZHH 4MA1C 1TQBC 5DK2B 1FJ1B 5IOPB 1J8HB 5C6TH 1S7UB 1MFEH 1VGKB 4XNZC 4F9LC 2ZCLH 5FV1L 1YPZA 1CLZL 4H88L 3G04B 4M43H 1TVBA 5LCVL 1RUAH 2ICWJ 1CD1A 1A7OL 1A3RL 4LSTH 1Z9LA 2QADB 4NBXB 3OQ3B 2YS4A 4OZIB 4LLWA 4Y5XA 4KZEL 3OGCB 5CINH 4JRWA 5J11C 1NGPH 2B1AL 3MRBA 3L5HA 3QRFM 5D71L 1A2YB 2A1WL 3BKJH 1A6AA 4PRAA 3PGFL 2NY3D 4C4KT 2EE6A 4FZ8H 4MJIA 4ELMB 3TFKD 1MCCA 4QHMA 4JPWH 4J8RB 5CZXC 4POYA 4QRRA 2IPTL 2CLVA 4KMLB 4H1LB 2BFVH 4M93B 5E1AB 3EGSA 3L7FB 1EHLH 4F7TA 3EOBA 3HI5H 1AC0A 2QQLH 5FYJU 2ENYA 3HPJA 4QXGH 2KBGA 1RU9H 3WFCL 4XVUD 1D9KC 3RU8H 3WFBH 3RNQA 4KY1H 5EWIH 1CGTA 1UZ8A 5BV7C 3RWJB 5AZ2H 1G7PB 4N0UB 2UV3A 4AEIL 4KWUA 4BM7A 4EUPG 4ZFOA 2W65A 1AKJD 3SGEH 3PQYE 3KPNA 5IM7B 2UZIL 4GRMA 3TCLA 3FOLA 1INEH 1U0QA 1GC1C 5GS3A 4U0RC 4PJBF 5IFAH 1F4AA 3K1DA 2M26A 1CQKA 4G9FE 1FNGA 5KN5B 5DD3H 2Z8VC 4KGJA 3MUGA 4TUOA 4OKVA 3VXUB 5SWZD 3RFZC 4PJ7B 4YHLH 5C0AA 1KFAL 1FNFA 5L2KB 2ADGA 2APWA 4PJHB 2EDKA 3TNNB 3FO0L 3VRJA 1EXUA 4GXUM 5FOBB 4O4YH 4AEFA 2IBGA 1J1OL 2FGWL 2LU4A 3FOMB 4RMTA 2COQA 4Q7DA 2BHYA 1O7SA 3KPLB 5DHVH 4MXWL 3PUCA 5J6GB 5BRZB 4L4VD 4F37F 1T0MB 1TVDA 3WN5C 3VA2C 4MCZB 3K4AA 4HUUA 1AGDB 1KBGL 3QULB 2ADIA 5GGTH 1TETL 3V7AE 1OARL 1MRFH 4PB0L 1NCBL 3B2UC 3O3AA 4WEBH 3VDAA 1MEXL 3VXRE 3MFGB 1KT2B 3SCMC 2I9LA 5B39G 4H25B 2HLFD 1BQSA 2BC4A 3BZ4A 4IDJL 5I8EB 1CT8A 1MIMH 5IKCA 3U4EB 4DKEL 4JFFB 4MJ5B 1I1AC 4UAOC 2EICA 1G7MA 1T7WA 2AJ3B 4O5LH 4N0CC 1BOGB 2YK1L 5ICYA 3RIAF 5HYSA 5IK3B 1AGBA 4UUJA 2F74B 3BISA 3C5JB 4ZUVA 3FN0H 3MV8E 3CPLB 1WZLA 5IW1A 1MIEH 1LDSA 3GJFH 2W60B 3QDJA 1KCRH 2DYPD 1C08B 2DLHA 1VACB 3OJVC 3UPCA 2FX8L 2OX5A 4FFZL 3IJYB 3OXRA 3B43A 5CZVL 2X44D 3PHSA 2GTZB 3K4ZA 4X0KA 4YHYB 4JY5L 5D7SH 3THML 3LB6D 1XR9B 1DSFH 3T77A 3RKDC 3VWJA 1EAJA 3C8KB 1S7WB 1FYHB 2PKDA 3NTCH 3ZE2E 4U6XA 1FL6A 1WBXA 3JTTB 5GJTL 1SEQH 3HS0A 2DS4A 1QBML 4M1CD 2IMNA 3JWOC 1HI6A 5AYUL 1NJ9B 1CD9B 4OF7A 5DFWH 2CLZA 4XPAL 4YHNB 1UFUA 3ZHKA 2UY7A 2OBGA 4HWEL 2VLJB 4NN5B 3T4YA 2NY4D 1HH9B 1RIHH 5E70A 1TITA 2ZUQB 1SM3L 1OW0A 5D2NA 4YHPA 3RGHA 3G5ZA 2I5YH 1K2DA 4XCNB 5HHVL 4G9DB 1GHFL 2FJFA 1I1RA 2NXYC 2XFXB 2DRUA 2I07A 3GMNA 3CFJB 1NMCC 4P5MA 4J3SA 4RFEB 5TE4H 1MJJA 4MNGA 3OB0K 3LEYH 3NA4A 3QPQD 1QACA 1DQDH 2YD9A 3I75A 4H8WL 3GJFB 5KSAD 2XG4A 2XWBA 2EIZB 5F7DA 4KKCC 2QKIB 4NJ9H 4OCXL 5CBEA 2A6DB 5HGBA 3OKKB 5I9QC 4LRNH 4GW4B 2ZOLA 4QRPA 1ED3A 1AGEA 1VEMA 5D2LA 1C12A 2ZSWB 4KVCL 3JV6B 4HJJH 4QOKD 4LLMA 3WFZA 3E2HC 5FUZH 3TIEB 1WT5A 3D2UB 4D0DA 2V7HB 2NY0C 4I3RL 3UTSD 4U2ZA 3MNWA 5FYKL 4DN4L 4HBQA 4BQBA 1OL0A 4O9HH 4CN1A 5D1QA 1DLFH 5HHNB 4DKFL 4RMRA 4DVBA 3WHE1 1G84A 3ZKXB 4PJDA 4Z7NE 1JNHA 1YQVL 3OAZH 1MI5B 3L3KA 3G5YA 1MCPL 1CLZH 3BXNA 3OR6B 4H88H 3QDME 4RQQB 5DEFA 4JRYA 1TTUA 3L3IA 5LCVH 4DCQA 1A7OH 2XTJC 3MGOA 1A3RH 2XNAB 5T33L 2EC9U 4RX4D 3W9EB 5DO2C 4KZEH 4JKWA 2OTWB 5FECA 2B1AH 4LSPL 4XH2B 3L3HB 4ZO6A 5A2IH 1NC4A 5D71H 2QTEA 4O58L 1MCLA 4GBXA 3PGFH 4MGXA 4HZAA 3QHTC 3P4NB 3HZVA 2A6JB 3MYJB 3IDGA 2PUQT 2IPTH 4HGKC 5D1ZC 4JO3L 3MRMB 4XP9L 1N5AB 3C6SA 4Z9KB 4HDIB 3H7BA 3C87A 4D0BB 5EIVA 1IMHC 2W0FA 3TO2A 3JUYA 1NC2B 4N1HB 4POZC 3VI4E 1ZT4B 1L0YA 5ID1A 5CD5C 3WFCH 3NCEB 6CGTA 2AK4A 3ARZA 3C9NA 3U0PA 1UA6L 3ZE2F 3ALPA 4NQXB 4Y88A 1L7IL 5HHMD 4NZJA 3W0WA 3EKCA 2QBWA 4AEIH 3KLAB 3T2OA 1I8IA 5EC2B 1V3KA 2AQ3A 3S98A 3WFEL 1I7RB 2Q8BL 1OF2B 5GGVL 5DT1L 5C08B 2UZIH 5HYJD 5B8CC 3KHQA 4ZAKC 3RWDB 3BHBA 4NOFA 4Y8DC 3DMMA 1MJ8L 3NACL 1IZJA 2ERJC 3L6FA 3SDDB 3U9UB 3MJ9A 4OBRA 8FABA 4P4RB 2WM0A 4WW2F 1KFAH 3FO0H 1DUZA 4E41E 1JIBA 1J1OH 2FGWH 3CSPA 4PJAB 1HHIB 5I1AA 4J3OC 1ZGLB 1KN4L 4MXWH 4XVTL 3IGAA 3QO1B 1YJDL 2R0KH 2OQJA 1Q1JL 5EBMB 3ROLB 1KBGH 1RFDL 3VXMB 3VWKA 1TETH 3UTZB 1OARH 3UJJL 1FCCA 4PB0H 1ONQB 2Y5TA 4ZS6D 1NCBH 2ADJB 3SBWC 3ZKSD 3R8QA 4PRHE 1MEXH 4YDVA 4L9DA 3VMOA 1GVIA 3TN0B 1JWSB 5D7KD 1VKXA 5J0BA 1UEYA 4P5KB 1UWEL 3QI9D 5EO1A 4Y4FD 4IDJH 5IROC 4AEHL 2CRIA 3SKMA 2AKRA 4DKEH 4Y1AA 1J8HD 1MAML 2YK1H 5EB9A 1DQLL 7FABL 3E3QC 3CFDB 1H5BC 5IVZA 2CDFA 3MV9D 4Z7NF 5B38G 4XNYL 5HI4C 3MYZA 3DRTA 2CIIA 4PYGA 3MJ8A 1J88A 2J6EA 3FQTB 1DQJB 5JOFB 2HT3C 2FX8H 2VNCA 4FFZH 1R5WA 1YNKL 3QUZB 5CZVH 5AWNL 5DQJB 3HC0B 1HHJA 1I9RL 4JY5H 4PJCA 1N2RB 3THMH 2R1XA 1FL3A 3BGFB 2VZOA 1SBBA 1L0XA 3FQNB 3VGAC 2Y72A 1NANH 4FQ2L 5DJXA 3S4SB 3MUY1 3FB7A 5GJTH 1M1SA 3DJ9A 1KB9K 1M7XA 4ZDHA 2DM2A 1QBMH 3S96A 4Z7VB 1UM5L 5AYUH 4R96B 3HFML 1WJ3A 3EFDL 3L3JA 4KDTC 3DNKA 4XPAH 3PP3K 4HWEH 4Z5RB 3VG9C 4P23D 1DVFD 4KC3B 1SM3H 3OXSB 2IG2L 3VI4F 4EXKA 3F7YB 5HHVH 1GHFH 3BD5A 3QG7L 2MCPL 1CXFA 3RVUD 4EIZC 5C0JA 3F7QA 1JF1A 2K9UA 4NGHL 1XGPB 1J0JA 1YMMA 2VAJA 2GJ6B 4R2GB 2ORBH 1CGXA 4BA8A 3IETA 3VI3F 1WWCA 2EZ0D 2F53A 2CO6B 4XP6L 4OCXH 4OCRL 4WTXA 3KYAA 4U1NA 2BCKB 1A8JH 2A38A 4RRPA 5T1MB 4OM0L 1FE8L 1RMFL 4JFXB 1GZPB 1Y6KR 1AD9B 1ACZA 1FFNA 4D9RE 1XIWD 3BPNB 3BVNB 1T22B 4KVCH 4Z7WA 1NANI 5IUSA 3BWAB 3CH1A 4LP4A 3VFUA 3IDUA 4Q6IB 4PJFB 4JM4L 5EOTB 4I3RH 1KJ3L 1TQBB 1KACB 5FYKH 1BQUA 3VE0B 2WWKO 1BBJB 5EORL 4DN4H 2BNQB 1PX4A 1QO3A 4XNZB 2JJSC 4PLNC 2QL1A 3QIBA 4DKFH 4Q9BA 2FH8A 3D3VE 3LKPB 3HLAB 5EIQA 4ZUWB 1YQVH 1EEYA 1AIFA 3HNVL 1CXEA 5C07A 1YEFL 4V2BA 5DJ8B 2R4SL 1AGCB 1MCPH 4PP1D 2WBWB 2XPGA 1CWVA 5GRVK 4XCFL 4PGDB 4D0CA 4P2RB 3CK0L 1U92B 2B1HL 5J11B 1JGDB 2O61A 1QVOB 1T3FB 1T1YA 1QSEA 5T33H 3QQ9C 3CX2A 3CSYB 4L4TB 4Q0XL 1NEZB 1BVKB 5IBUB 1R3JA 2APBA 5E5MA 2VQ1B 1I75A 4LSPH 4R90L 4PP2B 1HQRB 4Q74A 3NZHL 4O58H 4Y16D 3P9LA 2A6KA 2FL5B 4KK5C 3QUXA 3PDOA 1TLKA 2DQIL 2DD8L 2J8UB 3HE6A 4XI5D 4DK6A 1M7IB 3BP4A 4JO3H 2Z31C 1NBYA 2V2XB 3FZUC 4XP9H 1D9KB 4PRPA 3GMOA 12E8L 5I6XC 4F9LA 4CVZA 5BV7B 4FQHA 5CIPB 4GG8A 3F62A 4RGMB 1U8PA 5KS9B 3I3EA 4KTEL 5EOCJ 1UA6H 4UT6L 3S6CA 3PXJA 1L7IH 3ARBC 1WAAA 3C60D 1TDQA 5SWSE 4IRJC 5C0IA 4U0RB 4Z7OE 3WFEH 4Y0GA 4MMXC 3TWCL 2R23B 2D31A 2Q8BH 3UTTE 1AQDA 5GGVH 5DT1H 3QFJA 2VLJD 3O2VL 2Q6WB 1G6RA 2G9HB 3JXAA 3BYTA 3GSUB 4XVSL 1ZHLA 5FYJD 4IOIB 1MJ8H 3QIWA 4CUCA 1I8MB 3NACH 1NCNA 3BIAX 4HUWB 5F97E 1KTLB 4JN2A 4WO4A 2W9DL 1T7ZA 1TCMA 4WU5A 3U4AA 3T1FA 2I26N 3L95A 5JXEA 1T6VN 4ZQKB 5SV4A 3WN5B 4XC3L 3RL2A 1KN4H 3S37L 4XVTH 3UPAA 4QTHB 2H3NA 2UWEF 3VFTA 2D7TL 5DQDL 1I8LC 3N50A 1ADQL 1YJDH 1BZ7B 2B4CL 2X4PA 1Q1JH 3SCMB 4NQCD 1RFDH 3DVGA 1MLCA 2YZ8A 3UJJH 1K8DA 5FO7B 3B3IB 5L8KB 1RVFL 3MACL 3QRGL 1X7QB 4UAOB 1I1AB 1TXKA 3LQAL 4ETQA 4AYFA 4JJ5A 4EZMA 2GSIB 3PXHA 1NKRA 1UWEH 2HA1A 4NIKB 4AEHH 3L9RA 2VLRB 3TLRA 5IFJB 3DX9B 3U0TA 3O9WC 1B6UA 3RWFA 1MAMH 4ODXB 1DQLH 4ZYKA 2DMBA 7FABH 2F8XC 1C8PA 2B20A 3E0GA 4NCC1 4XNYH 5F9JA 3VXSD 1W0YT 3WMSA 4G6FB 2L7JA 4GKNA 4L29A 3DXAD 4PYHA 4XBGA 2X1PA 2W0KA 3DX8A 4OZFH 3DETD 1KCVL 4G42B 1I1FA 2QSVA 3CFCL 1YNKH 2NPLX 4UU9B 5IMMA 4LKXB 5EC1B 5AWNH 3VMNA 5JO5A 1G1YA 1I9RH 1IGIH 2BSSA 1OGAD 1MUJA 1JJUA 2DTSA 4G8GE 2AP2A 4QHKI 4DKDC 4OLUL 3CNKA 1HYRC 1EZVX 4FQ2H 3MPCA 5F1IB 1CXKA 3RY5A 3O4OC 1S7RA 2HJFA 1P4LB 1UM5H 1S7QA 2GK0A 3HFMH 3EFDH 3TBWA 4PR5A 1FH5L 3TBTA 5C3TA 1LP9A 2G2RB 3B9KD 3KPSD 3WIHA 4I3SL 4X8JA 3Q3GA 1NMCB 1T1WB 3O45A 2IG2H 3N0PB 4KXZI 1KIQB 4PJ8C 3CCHA 4YNYA 2CPCA 3QG7H 2MCPH 2OZ4L 1CCZA 4MCYB 3RIFK 1XZ0B 1N64L 3OJMB 4PRID 4NGHH 3O3DB 3ESUF 4BH8B 4YLQT 1FN4B 1A1MA 3F7RA 5I9QB 3QXUA 4KV5E 4P2QB 1EFXB 4Z7OF 1AR1D 5C08D 4I0PD 4OZFB 1R3IL 3VFWA 3RI5K 1JPTL 5ICXA 2FZ3B 4O51A 4XP6H 2OP4L 1Q38A 4OCRH 1RK0A 3OKLA 5E6ZA 1GGYA 5F44A 1JWMA 1G0DA 3T4AA 1FYTB 4OM0H 1FE8H 1WISA 1F3DJ 3OJDB 1RMFH 3KJ4C 3E2HB 4N0FB 5JW4M 1MH5B 3A6CH 5SWZA 3BGMB 4HJ0D 4X4YB 5EZJA 3LKRB 1LK3L 5ITBL 4HF5L 3LDBB 3DV6B 3EOAB 5JW3L 4JM4H 4MNQA 1KJ3H 3MTRA 1HSAA 3TO4D 3RX7A 4HCRA 5IEHB 4YZFF 5EORH 3MGAA 43C9B 1PG7L 2YA0A 1BFOB 4P59L 4PJIB 5INDA 3F58L 2ATPA 4GKSA 3MRIA 3IAQA 3D25A 4L4VA 1KEGL 3SPVA 2OS7A 3HNVH 4NUGL 5F3BB 1YEFH 5I1LB 1G7LB 2R4SH 2XTJB 3PWUA 3RP1A 5DUPL 4R3SA 4XCFH 3O3BA 4CN4A 3CK0H 3QUMA 2B1HH 2HVJA 4RZCB 1HHGB 2P8PB 1F3JA 2JCCB 4Q0XH 4U6VL 1H9VA 1FIEA 4ZFGL 3WD5L 1EK3A 2HFEB 4P46D 1UH3A 5IEKA 4R90H 5F70A 4LHUG 5D1ZB 3NZHH 2ESVD 3RGVC 4HMDA 3N85L 3PDGA 1J0YA 2WBJD 2V7NB 1P6FA 4JM2C 2DQIH 4X98B 2DD8H 3O2DA 1JHKL 2R0LL 3UTPD 1VCAA 4L9LC 1GJIA 1JN6B 1C5BL 3SGJC 2LVCA 3T08A 3B9AA 1J1XL 1Q0YL 12E8H 3V5HB 5HPMA 3VCLB 2FIKA 4MZ2A 2YBRB 3D39D 5IMKB 1JUFB 3SDXB 1F02I 1OP3K 2VJXA 3H9SB 1DBJL 2P5WA 1Q72L 1PKQA 3EDDA 4KTEH 4N9GB 1I7UB 4UT6H 4R7DA 2BRQA 4YGAB 3QUYA 2G5BA 3BSZL 3UZVB 4ZAKB 1Z9MA 4G6KL 3LSOA 3V0AC 1M71A 3TWCH 3HAEA 5EPMA 3O2VH 1FZMB 4XVSH 4G7VL 5SWQA 2ED9A 3CSGA 1FFOB 4LGRB 3ZYZA 2W9DH 4OD2B 2EKSB 4XMKL 5CMAA 1OAUL 5FXCH 4R2GD 4I4WA 4X6BB 1FG2B 3TT3L 4LVHC 2Y1VA 3STLB 2F9BT 4JPVL 1FLRL 1OT2A 4WI8A 4MD4B 1UXWB 4XC3H 5KSAA 5CJQL 4ZXBB 2ICEA 3S37H 1K4CB 4RAVB 4LPUA 3DGGB 3L5IA 1T66D 2D7TH 4RWYL 5DQDH 1ADQH 2DQFB 4JAMA 3OAYH 1KYOK 2B4CH 4A6YL 1J0KA 2BVOB 1TZGL 3TGXA 2R2HB 1DL7L 5C0BA 3R4DA 5BVJB 5B8CA 3IKKA 1RVFH 4HKBB 4QOKA 3MACH 1JZ3A 3W11C 3FRUB 3LQAH 3UTSA 2BNQD 4HMCA 4GKZB 1H5BB 4GH7B 4E0RB 1WC7A 5HGDA 4CVWA 1EUTA 4JCLA 3VXNA 4NNXA 3QH3B 3UYRL 1UQSA 1C5CL 4OZHB 4ZPTA 5I1KL 5DJZA 3VJ6A 2V5SA 4NZRL 1OAXL 2PO6B 1S7SA 3KAAA 3FT4B 4OD3L 2FHBA 1NDMB 1NL0L 3CFCH 5EUKA 1J1PL 3PHOA 1F00I 4OQTL 2NLJB 3MBXL 3WNPA 1JHLL 2DLFL 3TNMB 1SJHA 4FTVE 3WUWB 3ZSSA 4AIZB 5C6PB 2NYYD 1M7DB 2OTUB 3ZKND 3BJ91 4HFWB 4RX4A 5EOCL 2A9ML 2D7QA 4PGCB 1QFPA 3SBWA 4OLUH 1KOAA 1DBML 3IJSB 4RBPH 3QYCA 4PREB 3SKNB 1X44A 4AG4L 5KSBF 5AAMA 1OTUD 1CBVL 3O6KL 4MB4A 3VG9B 5I1IH 4XPTL 5D6CA 2DN7A 5F21B 4QNPE 1FH5H 2NY6D 3T3PE 2GAZA 3C6LC 4KRMB 3PHQA 3HCVB 4PJ5D 4OF5A 4KRNA 3TPKA 4JZJC 2F54A 2VTFA 2LQRA 4I3SH 5EFIB 5FO8A 2AJSL 2F58L 2QJDA 1HKLL 1DFBL 5T5NF 3LMJL 2XWTA 4NN6C 5H8DA 1A14L 2OZ4H 4U1JA 4PJ9D 1N64H 3FCTB 4RA0C 1VFAA 4G80A 1L0QA 4HUMB 1T21B 1MQ8A 3TM6A 5ADOL 2VDQL 2VXTL 4LCUA 1TQCC 3MRQB 5GRYA 4X6CA 1JPTH 4LEOB 2OP4H 5HYJA 2PCPA 1H3TA 5FA3B 4BJLA 2R15A 3MRHB 4E5XA 3CVIL 5TDOB 3VG0L 1NGZA 4KH2A 4R6UA 5GGQL 4GMSL 2IPUK 5I0DA 3CDGA 3DUSA 2C1OA 2H32B 1IM9A 1P84J 3L5WA 4ZSOB 2Q1EA 2P8LB 1LK3H 2VQTA 5ITBH 1UEMA 3IDJB 2BSTA 3K4DA 1IL1A 5JW3H 3P4OB 4QRQB 3QT2A 1OGTA 5FKPB 4LVOC 3JTSB 5MENE 1PG7H 3D0VA 4LVNB 4P59H 1R3HB 4X6DB 3F58H 4Z18A 2C3VB 1T83C 5D7JD 4K3JL 3EOTL 3L5XL 5IB3B 3OX8A 3VFSB 3BEWA 2OI9C 4I13B 3UBXG 2DLEA 4NUGH 1KXQE 3ETBF 2WV3A 4IJ3B 3TJHD 4U6YA 1IEBB 5EZLA 2X9XA 3IFOA 5DUPH 1F4WL 3RUGB 4I18C 1JHTB 4NT6B 4JFPA 3G9VA 3QZWA 1E6JH 1XCTA 3PQYD 5CP7B 3EZJB 4PJEB 1QSFE 3NIFF 2VLRD 1LEGB 4U6VH 3R8BB 3UPRB 4TSBH 4Y4FA 4ZFGH 4OB5L 5IVXB 5F9WC 3WD5H 2VXUL 4JFYA 1CU4L 1HINL 2YMXL 2D0GA 2HFGL 3BEVA 4G9FD 1YPZF 1A4JB 2Z31B 1U91A 3OSKA 3MV9A 2NR6D 3N85H 1KCSL 3EDJA 4MAUL 5I6XB 1CFQB 4NQVB 3MV7E 2H2SD 4TNVK 5JDSB 2EE2A 1JHKH 2R0LH 5DHYB 2H6PA 3LKNB 1C5BH 3WDHA 1J1XH 1Q0YH 5IB2A 1S9YB 2NW2B 1XF3B 2DKMA 3NH7L 3ARBB 4K7FA 3P9MA 2ARJQ 1T80A 3IF1A 1GOFA 4IRJB 1DBJH 4K94C 4LLYB 1Q72H 3CAFA 1QKZL 3MBEC 2AJZB 4NQEE 1XCQB 4MJ6B 1CI5A 1VFBA 3BSZH 1N0XL 3ARWA 5ENWB 1EO7A 5BZDB 5IQ7L 4G6KH 3BP5A 2EDNA 3V8CA 4H26B 4NC1C 1LD9B 3VXRD 1X6LA 4QNPF 3T3PF 1ZE3C 1JF6A 4AY0A 5HPOA 1ZAGA 3NCYS 2PETA 4OFVA 4CL7A 4P23A 1DVFA 1KPUA 1MLBB 2ZUUA 4RNRB 1AC6A 4G7VH 4HWNA 3SE4C 3VFPB 3DHMA 2HTLD 2CKBA 4GW5A 3VH8A 3GSWB 3CFKA 3L3GB 2F5BL 2FX9L 2RBLA 1NGWA 5D7IE 5ESVB 5E8PB 4P2QD 3MV8D 3TT3H 1FVEB 4HGWB 3LEVL 4WHYH 4DGVL 5HHQA 4JPVH 1FLRH 1R0AL 4HUVA 4ZUTB 1PKOA 1SMAA 1QLFA 3DYPA 1MFAL 5CJQH 4TTDC 4JFEB 5JHDE 4E9LA 3U7AA 3WFHB 4LDLB 1FO0L 3O4LE 2HT4D 3MFFB 4RWYH 5E4IA 1TCRB 3U6RB 3OGOE 3NFPB 4A6YH 1BD2E 1TZGH 5E7FA 3H42L 1DL7H 3VW3L 5DJYB 4APQC 5EG6C 1E28B 1AHWA 1XIWA 1A0QL 4PJHA 4YC2B 5DFVC 4JO4L 1QZ1A 4GFTB 4JFQA 3UX9B 3MLXL 5ANMA 3O9WB 2RHEA 1IM3B 3VFRB 4O02L 3KPLA 4KROB 1HOCA 3IDIA 3QXTA 1XGTA 3UYRH 1T0MA 1C5CH 1N8ZB 3PWLB 5I1KH 3IJHA 2XICA 3WNLA 1J7VR 4NZRH 1J12A 2YRPA 3ARVA 1OAXH 3MLPA 1SYSB 4JPIB 4OD3H 5MEOA 1NL0H 4NOBA 5F7FA 2H2PC 3LEXA 3NPZB 5F6IC 3HI6L 4OZGA 1J1PH 3BFOA 4Y89A 4UQ2B 2QR0B 3PV6A 4FXLA 3MBXH 4HH9A 3MRKB 4OQTH 2DLFH 5EZOL 5K9KA 2EDRA 4AENA 1F90L 4OIBA 1SHMA 2A9MH 3MODL 3O4OB 3KGRA 5EOCH 4WI5A 5CLTA 1DBMH 1EFQA 5C0FA 5IJKC 1IAOA 4JO1L 1JGVL 3GSQA 4Y16A 4AG4H 3UZQA 1CBVH 2CQVA 3O6KH 2B2XL 5CS7A 4XPTH 4PJ8B 4NC2B 5J89A 5GS2H 2DMKA 2WBKA 3HG1A 2JJWA 2AJSH 2F58H 4K8RD 5GGRA 1JYVA 5DHVA 1HKLH 2A6IB 1DFBH 3QXDB 2FCBA 5J3HD 3I3DA 4GRLB 1ZA3A 3LMJH 3FB8B 3RX5A 5A3IC 1A14H 3BGAA 4Z7QE 3C60A 5BJTA 1FLTX 5BS0B 2I9TB 5HVGB 1Q9LB 1QEWB 1W0WA 3GMLB 4NO2B 3QHFL 5GGTA 5ADOH 2VDQH 2VXTH 1MHHB 1RZIA 3KJ4B 5LGHL 4N90E 1FVDA 3GI9L 1I3GL 2VLLB 3P73B 4C59B 3QNZA 3CVIH 1I8KB 2VITB 4MWFB 4OGYL 5EULV 5BW7C 3U2SB 5BZWB 5CGYC 3VG0H 1QD0A 3QISA 5GGQH 4GMSH 3MO1A 1CDBA 2P44B 4N68A 1N7ML 5TPWL 1D5BB 2FR4B 3BD4A 3K0WA 3GMRA 2OXGA 3HB3D 1ZA6A 4TUJA 4L3CA 3GJFA 5KZCD 3QUKB 3BZDA 4YFLF 4ZXBD 5BOPA 4LMQI 1Z5LA 2DDQL 1NFDA 4K3JH 3EOTH 4M00A 3L5XH 4M62L 5D2LF 1YEDB 4KJWC 4GRWF 1P1ZA 1AH1A 1KTDB 1GGCL 4NQCA 1SYVB 1UCBL 4JRXB 3QQ4B 4WNQA 1F4WH 1U8HA 4X9HA 3R0MA 5C9JA 4UIKL 4WUUE 4ZFFA 5MEPB 3RRQA 3QWQB 2CRYA 4U4BA 3FQWB 4LK4A 3RGVB 4PJDF 1FPTL 2R2BB 1G0YR 3WO4C 4OB5H 4QHNB 3KWWB 2VXUH 2W9LA 1CU4H 1HINH 2YMXH 4FA8A 1OSZB 4JM2B 4G43A 2HFGH 5D5MB 5DJ2B 3D9AL 4L9LB 4K3GA 4FRWA 1KCSH 2PO6D 2R0ZL 4MAUH 3VXSA 3OR6A 3QXWA 2Y06L 3DXAA 4NPYA 1JGUL 1A1OA 3ILQD 1F11B 3WL9B 4P5TB 3D85D 3LKSA 1GRWA 4E41D 1XF4B 2P8MB 4WHCA 1R6VA 4U1HB 1HEZA 5JA8B 3NH7H 4NUJB 2EYRA 3DROA 1OGAA 3X12A 2OTWA 4PY8I 1S5HA 1ZWIA 1AJ7L 1QKZH 4U1SA 2Q86B 4WHDA 3P4NA 5HHOB 2HRPL 1N0XH 4KZDL 1A7NL 3L3OA 5IQ7H 4BK5A 3D18A 2ITDB 3H9HB 3SDAD 2FRGP 4HFUL 5JTWA 3FONB 2JE8A 4NN7C 1GYAA 3LKQB 1I7TB 1CICC 1F3DH 3B9KA 3KPSA 2IEPA 5JORB 4GAYB 2GCYB 3STZB 6FABL 3V79C 1YN6B 4HC1L 5GS1A 4MHHI 4MDIB 4GJTB 2EDEA 4LVHB 2IALA 2F5BH 2FX9H 5FB8B 5EUOA 4Z7QF 4PRIA 2FEEL 3LEVH 5GZND 4DGVH 1WICA 3SJVB 1G7IB 1S7TB 4XWOD 2NZ9C 1Z6JT 3BPLC 1R0AH 5C08A 4I0PA 5J8OA 1T1XB 2XZQL 1ZKAA 1MFAH 3RVXD 1FO0H 1CFTA 3KDMA 3SDYL 3QIUC 1FZOB 2XG5A 4C56B 5CEYB 4YGVA 2WIIB 3IDXL 3H42H 4HIJA 4ZFZB 5EIIB 3VW3H 1A0QH 3D0LB 4MNHB 4HULB 3WIFA 3EDEA 3V5DA 4GXVL 2YPLE 4JO4H 5EU6E 4QHUB 1JI1A 4ACPA 3E6HB 3MLXH 3NIDF 4MD5A 3FFCE 3DX6B 4PJAA 3DX7B 3TO4A 1ZS8B 1ORQB 4U1KA 5TGBA 5HYEA 4O02H 1SMOA 1YECL 3CGTA 2X4TA 1Y18A 1QA9B 3VXQB 2O93L 4S10A 2Q8AL 4P9HC 4M8QA 1AGFB 5KJRL 3LN4B 4I0CC 5DMYA 3R0NA 3RAJL 4GT7A 4JE4B 1Q8MA 2CXGA 2XQBL 2X89D 3QFDB 2WP3T 3FO2A 3HI6H 1S78C 4Y4KC 3BMWA 1X6NA 2AGJL 5EZOH 5DD6A 1F90H 1I9IH 3FMGL 3CFEB 3MODH 4EUPB 4M9PA 4FQXC 3GMPA 1ND0B 4P46A 5E2VL 4B41A 1BLNB 5L88L 5DRWB 2ESVA 4JO1H 4GUPB 5E6IC 1JGVH 3RZCD 4QCIA 4D9RD 3WDIA 5ESQA 2WBJA 4JZJB 1U8MB 4EXPX 2B2XH 2X10A 3DTXA 3FQTA 4Y19B 5TQ2L 3GGWA 5KSUA 2HG5B 5F1SA 4L1HA 1QLRA 3VRLF 5KAQF 4PJCF 2MKLC 3DHJA 4NN6B 1KGCD 1UB6B 3RL1A 3G08B 1R5IB 5JLZB 1IAKB 1DEEA 5A16B 3D39A 3FAXA 3FO9B 2VAAB 4NKMB 3H6JA 1RJZB 2YN3A 3AMKA 3D3VD 4J3VA 5IMLB 1IGJA 3F7VA 1IAMA 1V3JA 4Q9CA 5C86A 1U3HD 4X5XB 3PWJA 3WHE0 5C0NC 3BPCB 1ORSA 3QHFH 5HTSA 5CEZD 4OSUL 2X70A 3IDMA 3GSNB 1A7RL 5JA9A 4P57B 3OKOA 4F7CB 5LGHH 1RZFL 2IADA 2R2CA 1C7TA 3GI9H 3T2NL 4UT7L 4FG6C 1UJ3A 4HIEB 4CW1B 4ORGB 2IPKB 2P5EB 4LRIC 4OGYH 5LWYL 4FTVB 4PJBB 4R0LC 1GOGA 1WBZA 5M94B 1T5XB 3M17B 5C0CE 5J1SC 4N5UA 3DIFB 3C6LA 2VDLL 4PV9B 1N7MH 4LVOB 5TPWH 3GRWL 4ONOA 1NKOA 2FGZA 4UIMA 2E6PA 2NY5C 4PJXE 2OI9B 4HHAB 4TVSa 2Z35B 1B2WL 3QA3A 4YO0A 5KG9A 3JBG7 3Q6FB 3VGGA 4IOFC 2DDQH 4Y4HB 3ARGD 3IXTA 1KPRA 4M62H 4ODSL 3WIIL 2BK8A 2NY1D 4YDJB 4I18B 3JV0A 1JV5B 3O41B 3VRIA 1G7QA 1GGCH 1IQDA 4BUGA 3SE9L 5EBWA 4H0HB 1RZJL 4MDJB 1UCBH 3G6JE 4NKOA 5DRNA 1RZKL 2FSEA 4PBWD 5FKAA 1K8IB 1IC5L 1OQXA 4UIKH 2YPKA 5F9WB 5ETUA 3N1QC 5IW6A 5I17B 2YEZA 2XZCL 3FTGB 5DVMA 3UTTD 4KROD 1FPTH 1JPST 3KPRB 1KJMA 2N7AA 3BP6B 3GJEA 3VD7A 3ARXA 5ID0B 1CG9A 3EYUL 4GSDL 4U33A 3D9AH 4OCNC 4NBZB 5LAXA 2ATKB 2R0ZH 4MVBC 3NPSC 1UKTA 2Y06H 4RRPG 1JGUH 1RJLA 5L6YL 1KNOA 3HPLA 3FT2A 2OJEA 5T1KB 3KS0J 2WAHA 5LG1A 3MBEB 2Z92A 1WTLA 3CZFB 1MCNA 5DMKB 2FYYA 2IANB 3LV3A 4LLAA 5CHNA 4PGBA 3QXAA 4Y2DD 5FIEA 1IZKA 4V1DE 1AJ7H 1LNUA 4HS8L 4WGVB 3AXLB 3OKMB 5I1GL 4IIQB 2HRPH 4KZDH 1A7NH 2LVEA 1JBJA 3FQUB 4P4KD 4NRXB 1AP2A 4QYOA 4RMVA 4HFUH 3UAJC 1NGQL 1SVZA 2XRAL 2ARJB 3QP3A 4WFFD 1Q0XL 3RWCA 2VLKE 4PJ5A 3U7YL 3GSXB 4L3EB 4IBLT 3GFUA 2FNBA 1MJUL 5I16B 6FABH 1AXSB 1HNFA 1OP5H 2WUBL 4HC1H 3V5KB 2Z4QA 4GRLD 1IEHA 3KYNB 1LE5B 2KDGA 4WRLA 2ZOKA 3GSVA 2EO9A 1QRNE 2HFTA 4HV8A 2EEAA 4PJ9A 5FGCB 3IXAB 4WUKL 1Y0LB 1ZLUH 2BY3A 2RFXB 4F7MB 4PV8B 4XVJL 3FB5A 4P49A 3W9DB 3FAWA 1HXYA 5GS0C 3GHEL 1XT5A 2D03L 1XGQA 2XZQH 4LSVL 5H37H 4APQB 4IOIA 4BKLB 3SDYH 1CE6B 1HN1A 3DBXA 4NQDE 3V6ZB 3I3BA 5C1MB 1R24A 4HUWA 3IDXH 1CDUA 5SV3A 1MCQA 4DEPC 2Y6SC 4GXVH 1C5DA 4LLQA 4ZMAT 3BRDA 1LILA 3MMEA 3RY6A 2VO5A 2LABA 4OGAC 5C92A 4PJXF 4E42A 1PD6A 2NW3B 4HJGA 1RD6A 2IH3B 3ZL4L 4UTBL 3PWNA 4M02A 1YECH 2P42B 4F9PA 3VDBA 1Q9OA 5D7JA 5GS2D 5DEGB 2XKNB 3CMOL 3OB8A 4NNYA 2Q8AH 4X7DC 5KJRH 3K74B 4U1IA 5F6IB 3ECBA 5JIPA 1NBZA 2YUZA 1DUYB 1OAKL 4XRCB 3RAJH 1T20A 4KJPC 2YWZA 3VXTB 4RMQA 3V6OC 4OV5B 3G6JF 2XQBH 5HDBE 1A4KB 4X6EA 1FFPB 5ICZA 2HH0L 4WWKC 2AGJH 4PLKC 3PQYA 2E6JA 3N1PC 2LAGB 3U79A 3FMGH 5FM5M 3PWPE 3OR7A 3G5VA 3B4NA 2GQHA 5B4MC 3DX9A 1A1NA 3OHXB 5E2VH 4JDZA 4AJ0A 4HWBL 5L88H 4G9FA 4N5EC 4QXUL 4NSKA 1C16A 5HI5D 1H0DA 2BOBB 4H5SA 1BD2B 2X4NB 1BQHA 3CVHB 4S1RL 3CZJA 5KTEL 4P5TD 1AD0A 2P47B 2C1PB 5TQ2H 5F9OL 4PJGE 5HGHA 1QNZH 1SQ2N 1XGUA 2WINB 5C0GB 4MYWB 1KJVB 1KXTB 4LDOB 3ARFC 4OD1L 2GITA 2GTWA 5FYLE 1FBIL 3T0WA 3HUJE 5CJXA 1MREH 1QR4A 1NFIA 3ABZA 1F6AB 3QPXL 3RWIB 5HHOD 1FDLL 3MRJA 1XF1A 1CYGA 3GBNH 1M6OA 4OLXL 1QSZA 2WWMC 3LD8C 3NABL 4OSUH 5ISZB 5DR5L 3TA3C 3VFNB 1A7RH 1KV3A 2ICWA 4PG2C 1TNMA 5I1HL 3VGHA 1IKNA 5TE6L 1A3LL 1RZFH 2I60L 3VXRA 3T2NH 4UT7H 1MPAL 3DSFL 4KRLB 5E9DA 5LWYH 3SY0B 1U3YA 3WEXB 5HYQB 5HVHC 4PBXA 2X6MA 3CX5K 4KTYA 4G8FB 4EOWL 3KXFE 2RQ8A 2CUHA 1CGYA 2VDLH 4TSAL 1YUHB 1PGRB 3NN8A 2QSTA 3AC0A 1MWAL 3SJVD 3MV8A 2A73A 5INCA 4DTGL 4OZFA 3N1GC 5B38B 1WV7T 3WE6A 1MAJA 1B2WH 5D7LE 4J3UA 3QAZC 3GB7B 5JQ6L 1KB5B 1TTFA 5JOPE 1KB9J 1JK8A 4S0SD 3MOQA 3PP4L 4ODSH 3WIIH 2GHWB 3MCLL 5E4EC 4WEMB 4XHJC 3VXPA 5C9KA 2E9IA 1ZVSB 4F2MA 1XH3A 5DGQA 2ZUXA 4ODUA 4PG9B 2EO1A 3A6BL 1I85A 4QT5A 4TUKL 3SE9H 3WHXA 3N1FC 4GG6F 1BJMA 1J9CT 1RZJH 2AV7A 2HVKB 2X5PA 1RZKH 3V6FA 1IC5H 3QB7C 3WO4B 4V2CB 5BW7A 2VKWA 3AUVA 2XZCH 3FQXB 4PRDB 3ZLQC 3OAZK 2N56A 4IRSC 1T2QL 1JE6A 3TPUA 4PB9L 4YFDB 2PW2A 1G1CA 2BVUA 3W5NA 1NDGB 2J88L 4M03A 4GSDH 4HKZA 3O6ML 2XOTA 4GAJL 4LSRL 4Z78B 4WW2A 4CMMA 4YH6A 1WTGT 4EN3C 3DARA 1R3LB 3O11A 5L6YH 1SJEA 1LWRA 4FQIL 4K3HA 5HDBF 1ZK9A 3ULUE 5DUBA 4NRYA 4XZUB 1CK0L 3KYMA 3HZMB 1ZHBA 2YXFA 5FDWB 5F88B 4HS8H 2KQNA 3PABA 5ESAA 4I2XE 1CFBA 5I1GH 4KUZL 1QPPA 4I48B 4NN7B 5I0ZA 3BIKA 4M5YL 4ZPVB 5DMIL 4PBVC 2DQJL 3JSSA 5E8NB 4Y19D 1SVCP 5TFSL 4RGOL 1NGQH 1OM3L 2XRAH 1IAIL 4PJGF 5IB4B 2K7PA 3MA7A 2R9HC 1Q0XH 2B5IC 5K93A 3VCLA 2YBRA 3U7YH 3QJHB 4X7CC 5IWLC 5AUMB 3BUYA 1O5DT 4QY8A 2GUOA 1MJUH 4U6HB 1AO7E 3ZKMC 2WUBH 3HUJF 1OTSD 5AAWA 5T1LD 3TVMC 2BOCA 4M61A 5IT2L 3NCBB 1FZKA 4XNQA 5F96L 5F71A 5IR1A 2DBLL 4GAFB 2SEBB 4WUKH 4YK4B 5SX5H 4EQ2A 1X5YA 1G7HB 1BJ1J 4XVJH 5DC4B 3QDMA 3O3EB 4BYHA 3GHEH 2D03H 5ACLA 4LSVH 1S9WB 5MEQA 3T8XA 4S0TD 4BH7B 2FBOJ 2P5ED 2GJJA 4FTVD 4U49A 3RVTC 2XA8L 4LPXA 1VPOL 4YR6B 1ZLVK 1CICA 2NTFA 1TZIB 1DQQA 3QNXA 1NCUA 4ALAL 3FT3B 1NGXA 5E8OB 5FGSA 2A77L 3I6KA 4XX1G 3ZL4H 3PGDA 4UTBH 4Y4HD 5FUCE 1FFQA 4KQ3L 4UQ3B 3DVNA 3CMOH 3MGTA 1QUNA 3MRRB 4NKQB 1H15B 4LBEB 3HAEG 1ZSDB 3C09C 5I66A 3I6LE 1F2XK 3GO1L 1OAKH 4Y4KB 1IBGL 1EHAA 4R4ND 1BWWA 1KIRA 1YYML 5HI3C 3QWRD 2AXFB 5K9QG 1U8OB 3PIQB 3QIUA 5ACZA 2HH0H 4YDKL 3OKEB 4GMTH 4G7YL 1OT1A 4XAKE 1J8HE 3MRFB 2OM5A 5J56B 4U05A 5E6IB 4Z7UB 2GT9B 5AZEL 5I1DA 2VABB 2PTTA 3P77B 5DQ9B 3GMQA 1VADB 3RNKB 3P2TA 5IG7A 1LEIB 5BXFA 4HWBH 4OIIL 4QXUH 1QLEL 5EU4B 4XCEB 2HLAB 4JFOA 5DYOA 1XF5B 4JREC 5E00A 4I0KA 1I3RB 4S1RH 4LCIL 4PGEB 5KTEH 2NTSP 1UM6L 2PXYB 5F9OH 3F5WB 3D85A 5T1KD 1L6ZA 5DZNA 4OZIE 2XWJA 3P4MB 4QKXB 4E41A 1WSST 3ULUF 1X3DA 2PYFB 1J8KA 4AT6B 3BH9B 4OD1H 1U9KA 5F1KC 3BN9C 5FYLL 5MEND 1FBIH 5E8DL 1FNLA 2J8HA 3EAKA 3X13B 1WUNT 1P2CA 3F7PC 4ELME 1QFUH 2JJUA 1ADQA 3MLRH 3DRQA 3QPXH 2XN9B 1FDLH 4XC1L 4Y5XC 4OLXH 1TVHA 1U8JA 3REVA 3NABH 3HC4H 4FQXA 2LTQC 3D87B 2VISB 2OL3L 5DR5H 1MOEA 5EU3B 3SDAA 4Z77B 5JW4R 5I1HH 4LLDA 1BJ8A 2IQAA 4PRHA 5TE6H 1ZEAL 1A3LH 5IVOA 2I60H 4UILL 2D0FA 1EIBA 1MPAH 2YD8A 4KVNL 4WTWA 1KIPA 1Z2KA 3DSFH 4PFEA 4I77L 3QG6B 4JQIL 2R39A 1PX3A 1QSFD 1CFSA 5E7BA 3PE9A 4N0UE 4R26L 4EOWH 4J23A 5GGUB 1WVZA 3I50L 4OF3A 2V2WB 4TSAH 1Y6MR 4WTZG 1MCBA 1YNTA 4CRPA 4CBPA 5L8LB 1MWAH 3MV7D 1BVLA 4F37K 4DTGH 1PQZB 5JW5A 3OTTA 5JQ6H 3U30C 2BVQB 3MRHA 3GKZA 4AZ8A 3PP4H 4HH8A 3VXUE 1YC7A 4PJ7E 1U93B 3MCLH 3MRGB 4LGSB 5DD0L 5L2KE 3ZSTA 3A6BH 4KJQD 1A9EB 3F8UB 3BKYL 4NQED 2AEQL 3WNNA 3EO1A 5K9OB 1OD7A 3F12B 3IDJA 4K7PY 2FJHB 1EVTC 4R0LA 1DR9A 5DMGC 2MNUA 4P3DB 3RIAK 2P24A 5BRZE 2YD3A 5CAYB 4PTUA 4XCYA 1T2QH 4PB9H 3FO1A 2WIMA 3NPSB 3ZTNL 1B0GB 4MX7A 5C0DB 2J88H 1RAMA 2R1WB 2BNRB 3T0EB 3O6MH 4CU7A 4KK9C 1SEBB 3ZE1E 5KSVA 4GAJH 4LSRH 2YSSA 5F8RC 1JTTA 1REIA 1I4FB 2OZ4A 3RVVD 4Q58C 1J05A 5FK9B 4YHML 3MLVL 1CN4A 4FQIH 2X89A 32C2A 4M3JA 2BSRB 2CDEA 4RIRB 1I3VA 3JWDC 3ULUL 3VGDA 4JFFE 4NYLA 3SKOB 2AJYL 1B4RA 1A6ZA 1LEGA 5JHDD 4CJ1A 1G7JA 1V7NL 2UWEA 3KLHC 1SJVA 2FO4A 3GUTB 4ELKA 4LSQL 2NCMA 2H8PA 1JYWA 4KUZH 1BD2D 1QR1B 3RZCA 4M5YH 5DMIH 2DQJH 4RAHA 5J1AA 2MCG1 5JDSA 5TFSH 4RGOH 2GFBA 2PYEB 1OM3H 2I25N 4AM0B 3DLQR 1IAIH 4NP4L 4NRZA 5DJDA 1ZHKB 4OZIF 1XF3A 5DC9B 1IJ9A 3A67L 3CXDL 4IHOA 1KLUA 4O2FB 3OG4B 3BZEB 3RWHB 3D3VA 3BP7B 1W0VA 4MJ6A 2HJLA 5IT2H 2NXZC 4M1GL 1P7QA 3RPIA 5F96H 3VWJC 2DBLH 1U3HA 5CSZB 4N1EA 1G9NL 4HG4K 2ZPKL 3ARDD 3S36X 1NAMB 2E9BA 5FYJE 2R8SL 3UYOD 3ZTJH 1EEUA 4ZO9A 2OR8A 5H94A 5DJ0B 3PF2A 1WZMA 2OSLB 3BUTA 4DEPB 5EU7E 2XA8H 3PJSA 3FFDB 3MSPA 4RISL 3ARYA 1HDMB 1VPOH 3DWTA 3SKUD 2EDFA 3KNBA 4ERSL 1P7KA 2ZJSL 2MOVA 1OW0C 4PLJC 4HK0B 5M7QA 3MREA 5E8PA 1YEGL 5CP3H 4LHUB 4KJWD 4ALAH 3MROA 3U36A 2A77H 3TESA 4YIQA 4CJ0A 1S7XA 5J9PA 4IS6B 1IAII 3OB0H 1RZGA 5TH2A 1IGYA 4KQ3H 4L8CB 3VDCA 4JFHD 1BAFH 3ARGA 4JKKA 4I9WD 3U6RA 4PJ7F 3OG6B 4PJHF 4WV1A 3GO1H 2E27L 1IBGH 4I5BB 4WWKB 4F7PA 1T1ZA 2VDML 2O26U 1NBQA 2IF7A 3HZKA 1YYMH 5GQBA 4MA3A 5SWSA 3KS0H 1VEPA 4LNRB 4NZTL 1J5OL 4YDKH 5CEXA 4S1DD 4G7YH 3VH8G 4JZNB 3TZVD 3UTTA 3K8MA 4N90D 4WW1A 1WT5C 2ZUVA 3T65B 3WJJA 5AZEH 4HS6A 3AS1A 1HH6B 1MI5E 3WS3A 3RTQD 3QJFA 1ZGLM 4OIIH 4FFVC 1QLEH 4EDXB 5D1QC 2UYLB 1FL5A 3VXOA 4MQXC 3ZE1F 2NY2D 2Q76B 1FV1B 2ITCA 3ARFB 3I02A 4LCIH 5IJVB 3OPZL 1UM6H 5HDLA 5D9SA 4MB3A 4L3AA 4HWZB 5DJ6B 4QRSB 4M6NL 1FZJB 3T3ME 5I76B 2HMID 2H26B 3I9GL 4XXCA 5FYLH 2CLRA 3AAZB 1T4KB 3MNVB 1UVQA 3LD8B 4Y2DA 3L3DB 4XC1H 3DV4A 5BCAA 5J6HB 4A6YA 5BOZG 4OV6F 3TF7C 4N8PA 4HZLA 2B0SL 3QDGB 4P4KA 5K59F 1H3VA 2OL3H 4FFWD 4GBXC 5I74C 4S11A 1ZEAH 2DQGL 3D48R 4WUUD 4UILH 3DUUB 4ODHL 4KVNH 4QXTB 4I77H 5J7CC 4JQIH 3MRCB 4S2SA 1Q9KB 1LO3L 5I19L 1QQDA 2FHCA 4UBDC 4R26H 3ULVE 3ARUA 1CLYL 3VFOA 3I50H 2PN5A 3HZYB 5DJCB 3TYFB 4U1LA 3HI1A 3QAZB 1A6PA 3MCG1 5JPMA 1DDHA 2YZ1A 2VR9A 4X6FB 5EU5B 3MC0A 2XIDA 4NO5B 3WLBA 4WJ5B 4OQTA 1YY8B 1MCRA 1IARB 1OY3B 4OAWB 1W72B 5DD0H 2EDBA 3FB6B 3TA3A 4G8GA 4HXBH 4PG2A 5C09B 4DQOL 3MV01 3C5SA 4F3FA 3BKYH 2AEQH 4LOUD 4EI5D 4IRSB 4I8DA 2VUYA 1R3KB 2C5DC 3Q5OA 4HS3A 4YBLC 4PRNA 1YN7A 4R7NB 3W39B 5ERWB 1C1EL 2KUTA 3ULSA 4QHLB 1E27B 3IDYB 3VXME 1HILA 3QEGL 3ZTNH 4EN3B 3O6FC 5HVWA 2L4OA 2JIXA 3EYFA 1PAMA 4YBQD 3X17A 1HWGB 1I1YB 1AXTL 1LEKB 4ZUUA 1BBDL 3CUPA 4YHMH 3MLVH 1K4DA 1O0VA 3VWKC 2W38A 3ULUH 4YHIB 2KKQA 4XGZA 5F89B 5HD8C 2GW5A 4J4PD 3GDBA 2EDOA 3SDCD 2VL5B 1KG0B 2AJYH 1MCIA 3K2UL 4JHBA 5D7LB 1RZJC 1V7NH 4XAWL 1RZKC 5KBNC 4LSQH 3MOBL 1T6WA 1HSBA 3PWVB 3NA9L 3Q5YA 4AEEA 4NDMB 3GEWB 3LRSB 1RZ7L 2B5IB 3CMGA 5E0QA 5EN2A 2ZCHL 3RBSA 2PXYD 5KSBB 2YC1A 2GJZA 1IEAB 2YPLD 5EU6D 3OKDB 3H0TA 1D5XB 2GSGB 1A5FL 1U8QA 1HK6A 3TVMB 3T3MF 1UWXH 4OT1H 2MHAB 1KTRL 1L4IA 3A67H 1XF2B 3CXDH 1DCLA 2NQCA 4KJYB 3KPPB 4URTB 4UV4L 2EDWA 1RIUL 2ILLA 4Z7VE 3S5LA 2XN9D 1S7VB 4L5FL 4PTTB 3EYVB 3CC5A 5KVEL 2V5MA 4G8EA 3MLZL 4M1GH 1GZQB 1EEZA 2Y23A 4O00A 3LKOB 1EO5A 4FNLL 1H3WM 3ORJA 1IC4L 1JYNA 4YAQB 2CK0L 1G9NH 3NGBC 3W82A 3UBXB 4ENEC 1Z0NA 5FYJL 3HE7C 4MSWA 2R8SH 2DWEB 4HKJB 3LRGA 1WZKA 3HRZA 3SOBL 2UZYB 3BQUD 4ZTOL 4RISH 2P7TA 1RJYB 4H0IA 5J57B 5F1NB 3ES6A 5EUOF 4TVPE 4ERSH 2ZJSH 1NSNL 1D5MB 2GJ6E 1U8KB 5E2WL 3RDTD 1RURL 1N6UA 4P2OB 3EDKA 1NMBL 1YEGH 1B0RA 4FXGB 4QWWC 1HHHB 3AM8A 3D69A 3UJIL 3OAYK 1A6WL 5GZOD 3WS6A 4W81A 3C09B 5C0EB 1WBYA 4OFKA 5IF0A 5GRZA 3TH2T 4JG0L 3ISWA 1CDCA 1DE4B 3CU1A 2AXGB 5IB1A 5I2IA 4F8TA 4KAQL 5GIRA 4PJFE 2AEWA 2E27H 3D0LA 4NC0B 4KRPC 4MD0B 4MQTB 4UDUB 3V0VB 2VDMH 3KPOB 2APTA 4PJAF 5IV2B 4WI3A 2BNQE 5MERA 3LPGA 4NZTH 2VWEC 1J5OH 5D6DA 1JNNL 4OZ4A 4X99B 1ZMYA 3DURB 1IE5A 4F7EA 4OCLC 2R29L 4JREB 4HUXA 4JY4A 1T2JA 3EYQD 2DIAA 2BNRD 3T0ED 1T0NA 4Y5YA 2EDQA 4NCC2 5C0CD 5F7HA 3QIBC 2PNDA 1YPZB 4P2RE 1WWBX 2X7LA 1NUNB 1X5GA 5DZOA 3V4UL 2CUMA 1FVCB 2QSQA 3OPZH 1TVBB 4L4TE 1CD1B 4M6NH 1P4IL 4KI5C 4JQVA 4LSUL 4ONFH 3AB0C 3I9GH 4RBPK 3WNOA 1LO0L 3CFEA 1TPXC 4LLWB 4Y5XB 1T5WA 3TP4A 5TE7L 1FO0A 2IAMA 1U8NA 3MRBB 1HNGA 3U82B 2Z8RA 2UVFA 2VC2L 1A6AB 4PRAB 2J8UE 4RGNB 4MJIB 1EA9C 3CLFL 2VXVL 2FEDC 4QHMB 5ACMA 4H1LH 1BJ1H 4QRRB 3RHWF 1KUMA 2AV1B 2B0SH 2CLVB 1MELA 2HG5A 2P1YA 3EGSB 2DQGH 1LMKA 4KKAD 4ODHH 3QUXC 1RIVL 3ZYJA 2DQEL 4F7TB 5KS9E 3EOBB 1QFWM 3HE6C 2O5XL 3PNWA 4LDEB 3HPJB 5E24E 3QR2A 1LO3H 3LOWA 4QHKJ 5I19H 3M45A 4P3CL 5C71A 4K9EL 4RWHA 5SX4I 3ULVL 3RNQB 2BXZA 4JANA 1N6VA 5T1LA 3C5ZB 1UZ8B 1WIUA 2DOCA 2XZZA 5GS0D 1ZT7A 4Z7VF 4FOMA 1PG7W 4K3DL 4U2YA 1CF8L 1D7FA 4ZFOB 1VFUA 3VA6A 2W65B 4QF1A 3MXVL 4Z0BL 3BZFB 3KPNB 5DVOA 5GGRY 4GRMB 3TCLB 4I1NB 2LV4A 4JKMA 5T5FL 3UEZA 1FNGB 4FTVA 1PSKL 4DGIL 3MNZA 1D5IL 3MUGB 4TUOB 4OKVB 5B39A 1FORL 3B83A 4DQOH 5DVNA 3F6IA 4V1DD 4P2YA 4QGYA 1K5NA 5C0AB 3ARED 2ADGB 3VRJB 1EXUB 2EXWD 3QIWC 5K9JL 4LHUD 2HAZA 3GIZL 3B2VH 3MLSL 4BFIA 1E4KA 4WO4C 3RVWD 1U58A 4CGTA 2VR4A 3EDFA 4XTRD 2X9YA 1F8TL 2VLKD 3ZO0A 5JXEC 1C1EH 2C3GA 2JELL 3KJ6L 3QEGH 2HN7A 3NFNB 4NZDA 1MSPA 2V6HA 4HUUB 2BNUA 2ADIB 1AXTH 4CADA 1QRND 1KTKE 1BBDH 3O3AB 3KYOA 1JYXA 1EPFA 2I9LB 2VLRE 4ZNEE 2H9GA 4B50A 3LCYA 1FGNL 2BC4B 1JFQL 1CT8B 3K2UH 1D5ZA 5IKCB 5AG9A 2EEDA 4XAWH 4LKCA 1G7MB 2EXYD 5ICYB 3AGVA 1BOYA 2Y9RT 5CILL 3MOBH 3OJ2C 1P9MA 3NA9H 1AGBB 4NQDD 1OB1A 1RZ7H 2MKWA 3IDNA 3ZDXE 4JY6A 5IW1B 3FJTA 1ZHNA 2ZCHH 4BK4A 1OLZA 4JR9L 4RFNC 2IH1A 1S9VA 3OXRB 3S3JA 3QQ3A 5E8EA 4OFDA 1A5FH 5GSRA 4X0KB 3JVGA 5CJBA 3OMZA 3T77B 5MENA 3VWJB 2VE6A 4U6XB 4UV4H 5C2BL 1FL6B 1WBXB 1RIUH 1VFMA 1ZT1A 4L5FH 1I7ZA 5J12C 5KVEH 3HS0B 3MLZH 4IIQA 1Q94A 1TTGA 1UC6A 3QDGD 4FNLH 1HI6B 1IC4H 2CR6A 3WUZA 5LBSL 2CK0H 1KCUL 4EJ1C 1LDPL 2CLZB 4B5EA 2NY3C 5FYJH 3TFKC 2UUDH 2CRZA 3T4YB 1A9BA 5D2NB 3SOBH 4OCSL 4YHPB 4ZTOH 1WWAX 3G5ZB 1QSFA 1K2DB 3PWPD 4JDTL 3WFDL 1K3ZA 3KYNA 4KKLD 3GNML 2FJFB 2W1NA 4TVPL 2Y7QA 2I07B 1NSNH 2JJTA 3GMNB 4P2QE 1FNHA 4P5MB 5E2WH 4YE4L 3SO3C 3IRZA 4CMHC 1MJJB 4MNGB 4PRBA 1RURH 4XVUC 1NCCL 1NMBH 2RFXA 1JGEA 3I75B 3MV7A 3UJIH 2E7LC 1T2XA 1A6WH 5BQ7A 1FYTE 4JB9L 1PFCA 2XWBB 2X42A 5CBEB 4DZBA 5HGBB 4JG0H 1RK1A 1ZVHA 2ZOLB 5FYLD 1WFTA 4QRPB 3MRDA 4HBCL 3CDYA 3MCKA 3V6ZA 4KDWA 1ED3B 1AGEB 1EDQA 2ZP0T 3E1F1 1C12B 5D2LB 5C09D 4GRWB 4KAQH 4OFIA 3RWEA 3HRPA 1WGOA 4NQEA 4LLMB 3B9VA 4MAYA 2XQYK 4D0DB 4P2CG 4MXQD 2C7UA 4PJIE 1JZ2A 1OOAA 1JNNH 3BO8A 2ID5A 2ZNXA 3T2QA 4M7KL 5D1QB 1LO5A 4DVBB 3VGFA 4KKBD 4QTIL 2R29H 1XR8A 4PJDB 4TSCL 2XTJE 4W70A 1JNHB 3FQRA 4HC1A 3L3KB 1XEDA 3G5YB 3KXFD 3ROOA 3BXNB 3V4UH 1MHCA 5CWSA 2EDJA 5DEFB 4IRZL 4JRYB 3L3IB 2JCCE 4Y5VA 4DCQB 1OWRM 3MLTA 1CFNA 5D7IA 1AXIB 1P4IH 3MGOB 5H2BA 4PY7A 1ERNA 3FRPG 3PL6D 4N8VA 5D7LD 4TYUA 1LO0H 5DK0B 4U1MA 5JOPD 5JHDA 5FECB 3GHBL 2QHRL 5TE7H 5I8CA 3BDYL 1NC4B 2VC2H 2ZCKL 3O4LA 5FM5O 5A2LH 2HLFC 4GBXB 3TBVA 1CIUA 3CLFH 2VXVH 3HZVB 3V0WL 9CGTA 1BD2A 3PGCA 1IC7L 1YY9D 5FM8A 2DIJA 3GMMA 3SDXE 5BV7L 3C6SB 1F6FB 3H9SE 3H7BB 4Y8AA 4U3XA 1AFVL 1T04A 3TVMD 1RIVH 2DQEH 5C2UB 4JZOA 2W0FB 3TO2B 5CCKL 2O5XH 5ID1B 3MRPA 1B90A 3KLSA 2AK4B 2DQCL 3U9PL 3C9NB 4P3CH 4K9EH 3ULVH 1BFVL 1GC1L 2VSDA 3W0WB 1F58L 1OP3H 4K3DH 3LB6C 1J87A 1CF8H 5AG8A 1I8IB 4JDVA 4NO3A 1UM4L 2HTKD 4Z0BH 3MXVH 3QUYC 4CVUA 5IQ9A 3T0VA 2Z91A 4N0YL 1A6TA 3ARDA 4M1CC 4EI6A 5FGBA 5T5FH 4ZOCA 3ULUD 1BQHG 3BHBB 3DMMB 4G6AD 2E3VA 1PSKH 4FQCL 4DGIH 5F7KC 4B53A 1D5IH 3L6FB 3UZEA 1J86A 3DECA 8FABB 4G8FA 2Q3AA 2A1WH 2MMXA 1FORH 1JPFA 2NY4C 3GM8A 4P2OD 4G8IA 5K9JH 3S7GA 1DUZB 3T1WA 3GIZH 4KK6D 3MLSH 5I1AB 2IQ9L 4JLRA 5D1XB 4Q6YA 3X14A 2AJUL 3NCJL 1XFPA 1F8TH 3AROA 3IGAB 2JELH 3KJ6H 3QPQC 2XY1A 5F7LB 1AO7D 1P53A 2AERT 2OQJB 5KSAC 4BSVB 3IU3A 3VWKB 43CAA 3RWGA 2Y5TB 3U7WL 5JIKA 4YDVB 3E3QE 5I1EL 1EX0A 3ILPA 3WIHL 4PJIF 1VKXB 1HQ4A 1FGNH 4RFOL 4OLEA 3UCRA 1JFQH 5EO1B 5DD1L 3SKMB 3TZVA 2WWKT 4OZHE 2AKRB 1JGLL 5HJ3A 4Y1AB 2N7BA 2J5LC 5HHPA 2DQUL 3OL2A 2DBJA 5CILH 3RTQA 4M6ML 2CDFB 1DJSA 5IVZB 1LK2A 1QFWL 4MS8D 5FA4A 3DRTB 3CFBA 2CIIB 3MJ8B 4JR9H 4D8PA 1R5WB 3O6FA 2JCCF 2WLYA 1HHJB 1Q9WA 2BMKB 5BMFL 3JWOL 1TJGL 4PJCB 1B88A 2R1XB 3GBLA 2X4QA 3HZMA 3SE3A 1FL3B 1PZ5A 2JLLA 4GW1A 4DOHB 5C2BH 5DJXB 1VSCA 3FB7B 3NGBB 4RGND 1YMHA 4ZDHB 3I6LD 3ET9F 2BVPA 2OYPA 3S96B 4GS7B 1G9MC 2X4SA 4X5WA 5LBSH 3L3JB 1KCUH 5JHLL 1OTTD 3GSOA 1LDPH 1GAFL 3MLYL 1N3NA 5AYQA 4WUUA 3TIDA 4HIIA 4JVWA 2N4IA 4G6ML 2XXCB 4XAKD 4OCSH 4HEPG 1C7SA 4XBPA 1S9KC 4JDTH 1NUDA 2DJ4A 3WFDH 2BVYA 4EBQL 3C5ZD 1RZ8B 3A0OA 3GNMH 5H35A 4TVPH 5C0JB 5GRUL 1MCWW 4YE4H 4O2EA 1JF1B 2X4RA 4XB8A 1YMMB 1NCCH 3GSRA 3EFFA 2F53B 4LFHG 4JB9H 2QADD 2ENSA 1A02N 3O8XB 2WK2A 4U1NB 3B6SA 4KRPB 4LQ1A 1KC5L 3N9GL 3M1BA 4HBCH 5K33A 4KQ4L 4YPGA 1FFNB 4ZSOE 4U6TA 1A47A 4Z7WB 15C8L 3HE7A 1KENL 3CH1B 3VFUB 3WJLA 3DVFA 4EI5A 3MRLA 3RBGA 2EECA 2ED7A 4X6DE 2XZAL 3CD4A 3HR5B 3LAFA 4OUUA 1QO3B 4M7KH 1U8IA 3OF6D 4LEXL 4YX2L 3QIBB 4LHJB 5IP4A 4QTIH 4R8WL 5D93C 4TSCH 2VKXA 4W6XB 5IBLC 1EEYB 2V2TA 3E6FA 5C07B 3RUGE 3AY4A 1IGTA 2PTUA 4AH2A 3QEQA 2HFFA 5FUCC 4IRZH 2XPGB 4I3GA 4Z76A 5L2JA 2RR3A 4ODWA 4NO0B 1TPXB 4D0CB 4X4ZA 4H8WH 4PJEE 2W0PA 4HK3N 2O61B 4HAFA 1T1YB 5IVXE 3T09A 1QSEB 2C4FT 3UTQA 4J4PA 2IBZY 3EHBD 5TDNA 3SDCA 3K1KC 3H3KA 5BVPL 4X4XA 1R3JB 5E5MB 1KLGA 3GHBH 4OZHF 2QHRH 3VXUD 3BDYH 2ZCKH 3HKFA 4F57L 2MQCA 1WCBA 3EJZC 5EU4A 5L2KD 3QI9C 4EEEA 3P9LB 4Y4FC 4CNIA 2A6KB 3V0WH 1GCFA 4XNUL 3QUXB 5E1HB 2DJUA 1NCDL 2AEIT 1IC7H 3KVQA 2VIRA 3HE6B 4YXKL 5GGVY 1ITBB 4MJ2A 3BP4B 4MA1B 1P4BL 4K3EL 1NBYB 5BV7H 1KGCE 2YPLA 5CIPH 5EU6A 3DO7A 1F5WA 4PRPB 1VHPA 3GMOB 1AFVH 5F6HJ 4R4BA 1T89A 3FFCA 4K8RL 2Z93A 4CVZB 5CCKH 4GG8B 3MOAL 5BRZD 4C83A 1M05A 5C8JA 1MAKA 1U8PB 2DQCH 3U9PH 1YEJL 1V3LA 3VFVA 4LCWA 2DL2A 1BFVH 4L8BA 1GC1H 1ACYL 1F58H 5CEZE 4YXLL 2VERN 5C0IB 4MMZC 3MUZ1 3TBYA 2OLDA 1UM4H 3JZ7A 4KK8D 4DWHA 1MCFA 2D31B 1AQDB 1S8DA 3QFJB 2J2ZA 4N0YH 1G6RB 3OKYA 3UTOA 4FS0A 3E8UL 1ZHLB 4JFFD 1F4XL 2DQDL 3REWA 1I3UA 4FQCH 3QIWB 5GISL 1BP3B 2FB4L 4M93C 3BQUA 4M7LT 5JMRA 2FX7L 3DUHA 3DPBA 4LCYA 3BDBA 4JN2B 4WO4B 5LGJA 3P30L 3HN3A 4P23C 1DVFC 3AU1A 4WU5B 4HWBA 1PYWA 3T1FB 3RDTA 2B39A 4L8SA 3L95B 4JFEE 2IQ9H 1D6EA 1PQZA 3RVUC 3ZMRA 4HPYL 3RL2B 1MHEB 8CGTA 4MQ7A 2AJUH 3NCJH 3NZ8A 3T2PA 2H3NB 3VFTB 3P3YA 1U93A 4JN1L 2R1YA 2RGSA 2X4PB 1KJ2L 2EZ0C 5ITFA 4J1UB 3DVGB 1MLCB 1H3XA 1K8DB 1UH4A 5FFLA 1IILE 3U7WH 5FOJA 1S9XA 1BM3L 5I1EH 2ZUYA 3X11B 4ETQB 1L7TL 1XIWC 1AHWC 1YZZA 3CX5J 4JJ5B 3G6DL 1CVSC 3HG1E 3K8KA 4RFOH 4ETYA 3BE1L 1QHOA 1HHKA 5DS8A 3L9RB 4PIRF 1EERB 5TDPA 1JGLH 3QEUA 1JVKA 3QO0A 1INQA 3U0TB 5CD3A 4LCCA 3RWFB 5C0DA 4RFNB 4ZYKB 2IC2A 4M6MH 1QFWH 2BX5A 5F9JB 2DWDA 4BQ9A 5C0CA 4GKNB 4L29B 4XBGB 3RUGF 1BIHA 3DX8B 4JRYD 1PLGL 5EOQL 5IHZA 4EVNB 5IMMB 3LQZA 3V6BR 4MXVE 1IC1A 1QFOA 4PJEF 4F33A 5JO5B 4ZUSA 1MWAA 4Z8FL 5BMFH 3JWOH 5IVXF 1HYSD 1TJGH 2BSSB 3C8HA 4PP1C 4PJXA 1TJHL 5J12B 4Z0XA 4K07A 1MUJB 3VFMA 1BVZA 3NIGE 3EYOA 1YNLL 3EO0A 3EJYD 4QGTA 5C7XL 5CZKA 5GSVA 2NY3B 3MR9A 1S7RB 2HJFB 3QNYA 4K2UL 3D2UD 1BZQK 3GKWL 5IB5A 2VZSA 1S7QB 4HLZH 2GK0B 4WFFE 1VDGA 3TBWB 4PR5B 5JHLH 3G6JA 2MWCA 1OP5K 3TBTB 3GIVA 1GAFH 3MLYH 4KHTL 1BZ9A 1LP9B 4Y16C 4ISVA 1L6XA 4KXZH 1YDPA 4G6MH 2P43B 4X8JB 2D4DA 4XI5C 3Q3GB 3SO3B 2AK4D 4PY8J 3O45B 1MY5A 1IGML 4FP8L 4YNYB 4EBQH 5BS0E 1PDKA 1MI5D 3L7EA 5JOEA 5GRUH 4UI2A 1QFWI 2Z8WC 1A1MB 4DGYL 1F97A 4DFHA 1X4ZA 3U4BL 4XXDA 3VFWB 1BIIA 5DGRA 5ICXB 4O51B 3C60C 5F1OB 1RK0B 3OKLB 1LE9A 1JWMB 3DMMD 2P4AB 3T4AB 5DK3A 2VN7A 4FXKA 2MPAL 1X5LA 1KC5H 3N9GH 3FFDA 2C9AA 5F3HA 4HIHA 1E0OB 4KQ4H 1MCKA 3BH8A 1FNEA 5SWZB 4V1DA 5A2KH 15C8H 1KENH 5EZJB 3AREA 4N9OB 1RUQL 4NHUA 1QSVA 4LMQE 5JZ7D 4MNQB 4LHUA 5D1XD 1B3JA 1HSAB 2XZAH 1BQLL 3OAUL 4TNWF 5DSCA 2LU3A 2NXYB 1NC2D 4JFZL 4LPCA 4LEXH 4YX2H 1GIGL 5INDB 3WO3B 2ATPB 2VLKA 4R8WH 4BQ8A 4GKSB 3MRIB 3D25B 4FQQA 4L4VB 4LARL 4WU7A 3SPVB 4JRXE 3KPMA 1FRGL 2IGFL 2NNAA 4QRTA 2E7LA 3ULVD 1MCDA 1A6UL 3G6AA 2R4RL 3PWUB 5JNYA 5A40E 1QRNA 3U46A 4R3SB 3O3BB 1AKJA 1TZHA 3QUMB 2HVJB 5FDYA 1UT9A 3ZDYE 4ONHA 1F3JB 4M8VA 1LO4L 5D5ME 5EA0L 3TH4T 2A83A 4OLYL 4OJFL 2LU7A 3SDDD 5IEKB 2Q7YA 5EO0A 3IVKA 2M8XA 2Q7NA 2CH8A 2NY0B 4F57H 1URLA 3ESVF 3WYRA 4XNUH 4NQDA 1DLHA 1NCDH 2Q76A 4GG6A 4AK1A 4YXKH 5JR1L 3OV6A 1P4BH 4K3EH 2C4XA 1H3PL 1BX2A 5DI8B 5HPMB 5CP3A 2FIKB 2I24N 4K8RH 2HT2D 1V3MA 3MOAH 4IMLA 5DFTA 4LSSL 1P6AB 3KR3L 2P5WB 1PKQB 1YEJH 4WI7A 1AQKL 5HHOE 3NIGF 5DTFA 2F8OA 3VXMD 2GIYA 1ACYH 1CGWA 3QUYB 1CVRA 1T7YA 1UH2A 2BJML 2G5BB 3K81A 5CEZL 4YXLH 5AD0A 3WLWD 4GO6B 3LSOB