1WFMA

The first c2 domain of human synaptotagmin xiii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
b'GSSGSSGSWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords synaptotagmin XIII
publication title The first C2 domain of human synaptotagmin XIII
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfmA00
4HVBA 3TWYA 5CCHE 1E8WA 2CJTA 3QR0A 2FJUB 4QJ3B 1DJWA 2CJSA 3W57A 3F01A 4PS8A 5CCJA 4ANWA 2CHDA 2WXIA 3APFA 2BWQA 3FDWA 2WXNA 1UGKA 4LCVA 3QR1A 2ZKMX 4XX5A 4F91B 3F05A 1K5WA 3SD5A 2Q0ZX 3HN8A 4WWOA 3IM1A 3L54A 2A4ZA 2CHZA 2DMHA 4KZ0A 4F93B 2CM5A 3RPBA 3PFQA 4ANUA 5T8IA 1BYNA 1DSYA 3L17A 1DJZA 2NSQA 1YRKA 4WWPA 4BGDA 3M7FB 4FADA 4XE0A 2ENPA 2D8KA 3ENEA 4EZLA 1DQVA 4NPKA 2RD0A 4V11A 2CM6A 3S2AA 3FBKA 2N1TE 4LDCA 1W15A 4BFRA 2FK9A 2QZQA 4GNKB 3W56A 2NCEA 4NS0A 4JPSA 4Y1TA 3OAWA 3ML9A 3TJPA 3QAQA 4FLHA 4IQHA 4DK5A 4GB9A 5JHBA 2YRBA 1V27A 1QATA 4HLEA 2WXOA 5H4ZA 1RLWA 3L9BA 4AJWA 3T8MA 3F04A 2WXQA 3PRZA 4ICXA 1DJIA 2WXRA 2KI6A 3ZW3A 4QJ5B 3ML8A 3RDJA 4TS6A 3LJ3A 4QJ4B 2JQZA 4KZCA 4OVUA 1DJGA 1GMIA 2K4AA 3QARA 3DBSA 2ENQA 3NZUA 3F00A 2Q3XA 4NPJA 4EZKA 3DPDA 3PYCA 3HIZA 4ICWA 3APCA 3B7YA 2NQ3A 3OHMB 3ZIMA 3QJZA 2UZPA 4PS7A 1BCIA 2WXPA 4TV3A 4ANXA 3CSTA 2WXFA 4WEEA 1TJMA 3NZSA 4MJJA 4L2YA 2K45A 2WXHA 3L13A 4AOFA 2V4LA 2Y3AA 3KWTA 3TL5A 4L23A 1DJHA 2LHAA 4A55A 1BDYA 5CCGE 1UOVA 4FJYA 3GPEA 2X38A 1E8ZA 1A25A 2CHXA 4J6IA 3L4CA 3L08A 1UOWA 3IBEA 4XZ4A 5G55A 2QZ5A 3NSJA 1WFJA 4F1SA 5KJ7E 3CSFA 2ISDA 2R83A 1RH8A 3QK0A 5G2NA 3PS6A 4DNLA 4TUUA 4OVVA 4NP9A 1E8XA 4EZJA 2ENJA 4QAMB 4LT7A 4URKA 4WAFA 2K3HA 2WXMA 2DMGA 1DJYA 4IHBA 4F92B 2WXLA 3N5AA 4G11A 4FULA 1HE8A 1E7UA 5EDSA 2EP6A 3PREA 4WWNA 4ANVA 1W16A 3APDA 4FHKA 3HHMA 3KWUA 3MJWA 2WXJA 4PS3A 3R7RA 5H4YA 2YOAA 4FHJA 2WXKA 3JZYA 4L1BA 3R7QA 2Z0UA 1WFMA 1E8YA 1TJXA 3L16A 2CHWA 2WXGA 1QASA 4L1LA 4KITB 1E7VA 1RSYA 2A5UA 4Y1SA 3P2BA 2B3RA 2K8MA 4FA6A 1DJXA 4FJZA 5JHAA 1E90A 1CJYA 3ZVVA
chains in the Genus database with same CATH superfamily
1QLRA 1F1GA 1RK7A 3EH1A 1O7DC 1K8IB 3KW7A 1NC2A 2XWBB 5AEAA 2J1ZA 4DGVH 5IT2L 2FQFA 4NIKB 4XBGA 2ATKB 2NRDA 3BFWA 4MD5A 4UMSA 4GI9A 3BN9D 1Q9OB 4R4BA 4G80B 5LCVH 5SWSE 4WU7B 1DYZA 1DJZA 2LTQC 4QO1B 6PAZA 4GKNA 4P2QA 4K7PX 3NIFE 1ZANH 1VFOA 3C8HA 4PJHA 1H0DB 1BJ1J 3RPKA 2IG2L 2EXWC 4FG0A 4WU5B 5AW1B 4GKZB 3KZ8A 1EHNA 4AGOA 1EO8L 4LLMB 1CG9A 1MCHA 4DK5A 1Q72L 3P73A 1LP9F 2XETA 1DQDH 1PDKA 2XSKA 3U0WH 4TUJA 4HCRH 2VDMH 3R1GL 5C2BL 3S3SA 5JTWA 5GGUA 4AQ8C 3ZT7A 4BE6A 1X6LA 3CVCA 5BJTB 3N9GL 4KK8C 3VVWA 1OTSC 4AI7A 5D6CB 3UC0L 2R15A 4B96A 2JVUA 3QUKB 4LEBA 3GJEB 3OLEA 2IAMC 3IFNL 4X9FA 4F57L 4FFTA 4LOUD 2YEVB 3PJLA 3ARFB 1NFKA 4AW7A 3AQYA 2GJ6A 1XGTB 3VXQA 5GGVL 1AO7B 1VAHA 4R7LA 3IVKB 3ZY7A 4ETQB 3QQ4A 3SO3B 1B6UA 3O8XB 1CXEA 3JV4B 3ZDZB 1T1WB 1IFHL 3P4OA 3TU6A 1TF4A 1Z3RA 3RTQD 3T65A 4MJ2A 4RX4A 5FYKH 4JGUA 4HXAH 1B2WH 2CGRL 3U9UA 1KLUB 2HMID 1CE6A 5F7DB 2H6PA 4NP9A 4ODSH 5KTEH 2ZSVB 1FZOB 3W0WD 1ZEAL 3SQOL 3IDGB 3ZE0B 5SWSD 1PZBA 4JFQB 2RA1A 5DGQA 4UTAA 2BZ7A 5GHWL 4ABWA 5D1ZD 5FYKE 2XWRA 3KPSB 3TA3D 5CU9A 4QXVA 2D9QB 4KXCA 3G5VA 2PMZA 4EJ1C 3UAFA 5ITFA 1ITBB 1TTCA 4JFEE 4M8VA 3RWIA 2NNAA 4HYTB 1GJUA 4KC3B 5HY9A 1A6AB 3ALPA 3WUWB 8FABB 2B2XL 3OKOB 1CD1B 3KLAB 3AS0A 2AJZA 4HJJL 2VLMD 4TNWF 5JIQA 4RAVA 3V52H 4BKTC 1TPXB 1YCSA 3IJ7A 4BCXA 3N43B 2CLZA 1FCGA 3MMEB 4ZPVB 4AQ8A 2IH8A 3VCLB 4LLAA 2VL5B 4M48H 2EICA 1KGIA 4I88A 4HOXA 1CMOA 5E2UH 3DWTA 4M29A 3MX0A 2IAMA 2F7PA 2OYPA 4D8PA 2EABA 1WAPA 3Q8AA 2XVLA 4G7RB 4GP5B 4PWIA 1AKJB 2AKRB 4MNQA 4NRYA 4OT1H 2OZ4A 2OTWA 1S9YB 4NZJA 4KZDL 4Z7VF 4O5LH 3PWPA 2BVQA 1ZD6A 2HWZL 3MACL 3QIWC 5DHYB 2X89D 2OL3B 3CDGB 4WENB 3DVFA 2XTJB 3FO2B 5EFIA 2Y2TA 2XN2A 3ZTDC 3T0VA 1UD4A 1S5HA 4FQLL 5EU5B 4UM8A 3HG4A 1OY3B 3BPOC 5HYQA 1A6ZA 3MRBB 1I1FB 2ZIDA 4LCIL 4AIEA 1E9QB 2VZSA 3ZIMA 3MCLH 4X0NA 1P4UA 2EVFA 4I77L 3UYOD 1O5PA 4JFED 3MRCA 3N91A 1AQKH 2YPVH 1TJIL 4WNQB 5EA0L 4D9RE 3KPMA 1MI5E 2EILB 2Q10A 1PJ9A 2F6AA 3SQRA 2CQVA 2AZAA 3IFLH 2HKHL 3GRWL 4GJTB 1E27B 1QPPA 2A6KA 5AWNL 3NZ8B 4PJHF 1TQBB 5G2NA 3MFFB 1L9MA 4IOSD 5F7BA 5FKPA 5KSUB 3KYMA 1XH3B 5IJVB 2QFPA 2Y07H 3QXAB 5HVGB 4RBPK 5CILH 5AOZA 4Z78A 1GPOL 3SDDC 3F84A 1W0WA 5CP7B 1NCAL 3RFRA 4BHUA 3VFVA 4F92B 1NPUA 3EH5B 4JANB 1GRWA 4JUSA 1KLFA 3CZFA 1F8TL 3NJMA 1OM3H 2WB1A 1HWWA 1KPUB 1N59A 1HXKA 2L7UA 2DQHL 4GT7A 4JDVA 5TF1H 1G9MC 1M42A 4PI0A 4ZMVA 4ODHL 5D1XD 2PYFA 2F53B 1ZIAA 3NAAH 1FFQA 2YUWA 3LV3B 4ZSOA 2A4EA 4HKXB 4WO4C 5D1QE 4KFMA 5FM4A 3QIWA 1UJTA 1DQIA 1KCLA 3RL2B 3PHOA 1D5XB 2F74A 3FDWA 1RURL 4XZUA 2FH6A 1U8KB 4BCYA 1S7RB 5ITBH 5LN8A 2X40A 2DOCA 4MJ6B 2BFVH 2D2CC 3MRLA 4IMLA 1KFAL 3SN6N 3WNLA 4LIQH 4X80H 4H0IA 4WTQA 5CD5D 4GLRH 3HUJB 1SJXA 3NFPA 4UNVA 1JGEA 5HVHC 1IGFH 1UENA 3B9KD 5KVGH 1DBJH 4R3SB 4FABH 4PJFB 3E6FB 1IBYA 2NXYC 3R4DA 4PGBA 5ETUA 1AD9A 4YHZL 2AANA 3FQ2A 4DKEL 1JGIA 3HMXL 5ID1B 2D7PA 2FLMA 3FOLB 1INDL 4KMTH 4YHYC 5K9OA 4LIQE 4D9RD 1I31A 1KCRH 4NLHA 3FB6B 4JO2L 1ZE3C 5J56B 2VW4A 2MIZA 3VVVA 3H1ZA 3M17A 5LNEA 2E56A 1U33A 3QUXC 2AC0A 5FW6A 4YHKL 4PJEE 1OAJA 3R0NA 2JJTC 4ENED 1KEGH 3I74A 1IILE 1XTLA 3DRQB 4M5ZH 1OF2A 5I5MA 4Z7WE 2ZX8A 1Q8MA 3TVMB 2JWYA 5EBWA 1FAIL 3QNXB 2WLHA 5H37A 1ZS8A 4JPIB 1TYEB 4A6YL 4FQCL 3I9GL 4MSWB 1NWOA 4WEEA 5BNXD 1AYRA 3C6LD 3QUMA 1J1XH 4PV8B 4AZUA 1HHGB 5L4MA 2MSPA 4W9HC 2IWGA 2BIHA 4NGHL 1M7XA 5J6GA 1XL6A 2JB6B 2JJVA 5C0CE 2K3TA 3NCXA 1LK3H 4HIEA 3RWCB 1V7ML 4XMKL 5DMKB 4WO4A 5CGBA 5IEKA 1HHHB 1KBKA 4I48B 1C5CH 1BFOA 1JPSL 1PIFA 3JT2A 4LSVL 3V9CA 4NM4L 4GW4B 3LX9A 3CD4A 3VA6A 1DDHB 5C08A 4HWEL 2VM9A 3ARPA 3EO0A 4PYHA 2GIMA 2FB4L 2YK1H 5E2WL 3TO4D 3BMVA 3MBEC 3UERA 1IE4A 5I1DA 3MR9B 4C55A 4TVPL 3AXLB 4HMEA 2MCG1 1EEZB 5AUMB 2VT0A 2UY7A 3PJSB 5LGHL 4ODUB 3FCBA 4FNQA 3ALWA 1LEIB 5FM8A 3JZ7A 2J1XA 1M7DA 4WWID 3S36L 5T1LD 5HHNB 4R0LA 5J06A 4OIIH 1VHPA 3X1NA 1DJWA 4NOFA 1DL7L 2VJXA 3QUXA 2APSA 2DQEH 4AQ1B 5DZNA 4AGMA 1EJOL 2DL9A 3O3BB 3N85L 1AXSA 3SYQA 2JJTA 3LZFL 5EWIL 4LHUA 3O6KL 3NTCH 4PM1A 1WZ1H 5JA8B 5DZVA 5H2BA 5IW3A 1T03H 5JW5A 3CVIH 3ASNB 3GLDA 4Y2DD 4NPKA 3CN0A 2DQJL 1O0VA 3MROB 2QSTA 4IU2B 3C5ZC 2FQEA 2YFOA 1KN2L 3T4YA 4ALAL 5C9KA 5TPWL 4KTEL 1N6UA 3O0RL 2VR3A 2ZG3A 3RIAK 5LQBL 4N26A 1TXKA 2LLLA 3MV8B 4LLUA 1L3NA 4UQCA 4FLHA 1HXMB 2OMXA 4XP4L 2AEIT 2QVFB 5E8OA 5H8DA 2ZAGA 5ABAA 2X6AA 1UWEH 4QCIB 4ERSL 2ZJSL 4ODTL 1MHEB 1XZ0A 1GL4B 1ADQH 4X6CB 3BT2H 4CMMB 1SQ2N 1ZVHA 1JHTB 2GHWB 4UU9B 3CLEL 2XWDA 2I9TA 3L45A 4I7ZC 4ABUA 4P57B 2G3XA 5FHAH 1NMAH 1MVUA 1RIVH 3KJ6H 3MBEA 5L8KB 3K74B 2WBKA 1DHKA 4XB3A 2ESVE 1YJDL 5PCYA 1JE6A 1AG6A 1FYTB 2D4DA 4X4XB 3GK8L 3AGVA 2BJML 5INCA 4ZPTB 2VDNL 4LEEA 3CCHA 4G6KL 3JTBA 3HKZA 1AQDB 2O6DA 4NNYA 5DUMH 4JRXD 3ZKQD 3ULUF 1VEMA 4IKNA 3M1BB 2CPCA 2CXGA 3OPUA 1GGCL 3AQXA 2R56L 1SLVA 1TJGL 5DJCA 5AOMA 1ZT7A 5SV4A 4XMVA 4F7MB 3SPCA 4JPVL 5EOTA 1QYGL 3BAJA 4LCWD 4IRJD 4X42A 2QR0B 4R97B 3GZPA 3TCLA 2BP8B 1D5IL 1FUNA 1QUPA 3UZEC 3IF1A 3FFCA 4RMSA 1RHHB 1HHIB 3CFBA 2GITA 5H4YA 2CIIB 2F5AH 3MYZA 1OHZA 4KBPA 2CHWA 1LO4L 3BUQA 5JW4R 7FABL 2Y7MA 1MZYA 1BVZA 1S3KH 4H8VA 4Q0XL 1ES0A 4GP4B 5HHMB 4N28A 4A7TA 4P2OB 4TVPD 1A3RH 1E4WH 1W6LA 1F56A 4K5NA 4LKXA 4QRPA 3TXAA 3AWEA 4Z5RB 4U1KB 1PX3A 3FZUC 2YGVA 3Q8CA 2CCVA 3LHAA 4DKDC 1JFQH 1UM6L 1E9OB 3HB3C 4JGMA 4OZIA 3T3ME 3WGUB 5IK3B 3KR3L 3WYRA 5BO1L 1CLOH 4TLKA 1W0VB 1YMME 4DGIH 5KS9B 4Y2OB 2EIJB 4JG1H 2IDCA 5IG7B 3IGFA 5H35A 5JOPD 3X3GL 43C9B 1AKPA 5DUJA 4WW2A 2H6UA 3I84A 1OV8A 4XE5B 3I2CH 4RA3A 2EDYA 2FK9A 1KJMB 2AGJH 5B39G 1JZ6A 5IB4B 2WTPA 5D5MA 1MIEL 1G5AA 3VSVA 2XRAL 3ML9A 3BMWA 4YR6B 1BZEA 5ENWB 2WY3B 1MH5A 5CFHA 4CN1A 4APQD 5FECB 3QUZC 1P7KB 1ED3B 3JQOB 5EEXA 3WKML 2VKWA 3NEEA 4GO9A 1RPQA 2VLKA 4MA8L 1EH9A 5E70A 1F00I 1E4JA 1U4FA 1PD0A 3PG2A 5TFSH 1WLHA 4K8RL 4Y4KA 2WINB 3ML8A 3LEYH 2WYZA 4P07A 1DJGA 4YEFA 4NENA 1Z9MA 4WV1B 3KWVA 2FGWL 3UCQA 3AZUA 1BOGB 3UZEA 1O9WA 1K72A 3NN8B 4G1MB 3IMBA 5DJ2A 3TPKA 4MD0A 3QNZA 4FGMA 4J23A 2DWSA 1E4KA 2QPEB 1F02I 4MJ4A 5C0BA 5D1ZI 5DRNB 4YSUA 3QDMA 5SWZA 1N5AA 4KVNL 2AERT 1MCLA 5A43C 3VXMB 4OTXH 1QQDB 5KSBA 3FOMA 2CKBH 4Y4FC 1QLEB 4NO5B 1M2OA 1XH2A 2SEBA 4AWJC 1VADB 2YQGA 1D5ZA 3W3BA 5I16B 4GKSA 2WMPB 2JK5B 3B2PA 3FC8A 2FWLB 5D6DC 2HX9A 3BP7A 4ZMZA 3FRPA 3HPLB 4PTTA 1FGVL 4AIOA 1YMMD 2N01B 3CPLA 3O4OC 1Y0LA 4L8CB 2WVVB 3BAEH 3LN9A 4ZOEA 1LP9B 1I8IB 5E1HB 1B9KA 1MFDH 4PJ8D 3MOAH 1WFMA 4IRZH 3WJMB 2NCMA 4LHQB 3WFEL 2C4FU 1Q0YL 3GO1L 4HPOH 1J48A 1QUNA 3VGEA 2GHZA 4HFUL 1I9JH 1YSOA 3QJHB 3QNFA 5BCAA 2QGBA 3UTTB 2QADC 3ZO9A 4S1QH 1WJ3A 1TVHB 2A9ML 4HWUA 1E8WA 1CI5A 5LNGA 3MLUH 3K6DA 4HQQH 4ZFOL 2XPZA 4TNEA 2ADIA 2BWQA 3ZL4H 1GH7A 3A6BL 2ICEC 1E5ZA 1NBVH 3C2SA 1D9KB 1FC2D 1QBLL 3CFIC 2HX7A 1LK2A 3QO1A 2V33A 2H0JA 2X44D 4S1RH 2DMHA 4F58L 4ZD3H 4BELD 3RGVB 3JWDC 1WT5C 5DD6A 5I18L 1PSKL 4C56B 2JH2A 4YXHL 3RWDB 4XBPB 1LXMA 5DI8B 4ELMA 1F41A 1IX2A 2Z35A 1CK0H 4TRPL 5C7XL 3EFFB 1EZVX 3IB4A 1EANA 4AC4A 3FHQA 2BRRL 2OYKA 2FR4B 1UZ8A 2WYHA 3GHBL 1GW0A 1QBAA 1GJIA 4PR5A 5EBLA 3VJ6B 2ORBL 1OANA 5DQDL 3POHA 4LAJH 2HFGL 3IT8D 4U7SA 2RJMA 3LCYA 1KTBA 3M46A 3D25B 3QZWA 4TNWK 4EUPB 5C0ND 3GLEA 4GP8B 4EDXB 1AJ7L 1JAEA 3BGMB 3IEAA 2J8OA 2BW4A 3IDJA 2DL2A 1D5BB 2Z92A 4LVHB 5D6DA 4PFEA 5BMFL 2P1YA 5CAYB 2BPBA 1Y6KR 2Q3XA 4Z0BL 3ROLA 1QA9B 3LN4B 3BN9C 1RZFH 1FRGH 5E6IB 1FNFA 1MF2L 3GB7A 5J6HB 4RDBA 3ECVA 1AMXA 4OZIF 5AOIA 5E9DB 3WFBL 2P45B 2NY0D 2A9NH 4FQXB 4GBXA 3KCWA 4P2RA 3A6CL 3C60D 2NY4D 1YEHL 3E8UH 4RH4A 3QDHA 4RMTA 1KYAA 4L1DA 4QMEA 3GBEA 3OHXC 1JNHB 4P4KD 5HDQH 4WW2F 3C6SA 1A14L 1VFAB 4OCSL 1W8OA 5DURB 1T0NB 4W9CC 3MRDB 5D5MF 2KLRA 2ICEA 1IC7L 1PX8A 4AENB 4NRXB 1S7TA 5BVPH 3V4PB 2IQ9L 4FN0A 3NGBC 4JFFA 1SY6A 3EUUA 4Z7VB 4QNPE 1YN6B 1WT5A 2VE6B 5HGBB 2YMOA 2ZXCA 1QVOB 4UQAA 4XNQA 2XVBA 3FTWA 2ZWSA 2IFFL 4X7DC 1I3GH 5GGTA 1HNYA 4ZMPA 3D69B 1F4YH 5EU4A 1B4JH 2HN7A 1OT4A 4LOUC 1NIFA 4W4OC 4J1UA 3RB7A 4LSTH 4NCDA 1V3LA 1RZKH 1ZRUA 3C08L 1MUJB 2WYTA 1SRDA 4E5XB 3T6QC 5IB3B 1DLHA 3OMAB 4CGTA 4Y19E 5BV7C 4JVUA 4PSRA 1WE5A 2XXMB 1GR7A 43CAA 3CN2A 4BZ2A 4A04A 4MD5B 4TSAL 4WI0A 1P1VA 5L8LB 3L54A 4R4BB 1M6OB 5TDOA 5KSBF 3X3FL 4KH2A 3BPCA 4AGNA 4CDGC 2EEDA 1ZAGA 4RGOH 2HMIC 1OAYL 3EGDA 3PE9A 1IQWH 4GKNB 1RU9H 4MA7L 1FNSL 1HAWA 1I3RA 4P2QB 5F0JB 3NRFA 4CSTA 1L0XA 3EHBB 4PJHB 4Z77A 2RCSH 4TOYL 5EB9A 4H7VA 5D1ZC 5FO8A 2HG0A 3TA3C 3H8NA 3N2JA 5EEYA 1JZGA 1CG9B 1KT2A 4DQOL 3EIFA 1SLUA 3JWNH 3P73B 3SBRA 1F97A 4FG6D 1R3KA 3OHXA 3N42F 4TUJB 3Q1SL 4RESB 4G71B 4XP6H 3ZR5A 5K59F 3EXJA 1BZ8A 5GGUB 2XQBH 2ED8A 2C34A 3EUDA 3US0A 4X2UA 3HZ3A 5T33H 3P9LB 3UYRH 4E9QA 4FXLA 1FIGH 3DJRA 3BSGA 3JWNE 3WTYA 4NO3A 4YUEH 1MWAL 3IBOA 3VACA 4ZTOL 3MA9L 3KYNB 3UPRA 1HS6A 1MJ8H 4TV3A 5FPIA 3HNVH 4L2YA 4P5KA 2AK1L 1M2VA 2ICWI 3AY2A 3HZKB 2GJ6B 3H9HA 2BW5A 2YAEA 2CO1A 2WKLA 4M7JH 3VXQB 3WIIL 4DHLA 4GUOA 4JDEA 1WAAA 2H8PA 3GFUA 3IRPX 4LSPH 3QQ4B 4M6OH 1TZ8A 1LGVA 2OXHA 3L4YA 4K7FA 5T1MA 3ULAB 3SGEH 4P3CL 4GLRI 1QRKA 4GRWB 2L0DA 3P4OB 4BQCA 4ELMF 4Y19D 1KJ3H 2W59A 3CVHA 3DJ9A 3R19A 5E2VH 3T65B 3KBPA 5CGTA 3VQ2C 1DVFD 1TJHH 1Z1WA 3NQKA 5F1OB 4ZZFA 2H6PB 1SF5A 2RIKA 3QZBA 5AKVA 4XMLL 4B41A 5M7QA 5CEYA 3GBDA 3LRSB 3OAZK 4F7PA 2BHFA 3LH9A 4H26A 1H9VA 5F93C 3ARXA 2VN6A 2B39A 4YDVA 1O6SA 4IW4C 2BIIA 4QXGH 5ITFB 1CN4A 3G5VB 3QAZB 2J57A 1F6AA 3QBTB 1YNLL 3QFGA 4L37B 4N0RA 3RWIB 2R0WL 1SM3H 5D1ZA 4FKHA 3AT0A 4HUNB 3TA3A 2BSTA 4AITA 2AJZB 5D71L 5FEBA 4U3CA 1DBKL 1RP9A 3GHEH 5JR1L 3OSVA 2A7BA 5FUCE 2VJ8A 3EYVA 3GTTA 5I2IA 5JQIB 3F6LA 1RUMH 5LCVA 2P42B 4PJ5E 5DMIH 4DO6A 5AOKA 4I0KA 4NP4L 3DGGA 3I6LE 1J5HA 3VGFA 3U7YH 2VR7A 1E65A 2PWDA 1BAFL 3CZKA 3TWCH 2FQDA 3RU8L 4ZFZA 5JHDE 2IAMB 4P06A 4G7VL 4YBQD 4OF3A 4XN1A 1CFQA 5HBBA 1A4JB 4KKRA 1X5ZA 3DX3A 4MNQB 4NRYB 3TJPA 5JHLL 4GFXA 1X9LA 4MWFA 4BRVA 3ZE2F 4HCRA 2DKUA 1IT9H 4OLXH 3NJIA 1U92A 4KTDL 2P48B 3PWPB 3E3QE 2BVQB 3GIZL 3LZOA 3L3KB 2O61A 5D1XC 1A6UL 1HDMB 3CXDH 4G7YH 4JJOA 3WNMA 4I4WA 5C1MB 1J9CT 4QY8B 3IMWA 1YY8A 1ERNA 1AHMA 1S5HB 3IS0X 2RAMA 3DBSA 4WRLA 4XNDA 4QRFA 4UM8B 3HLAA 3T0XA 1BAGA 5FW7A 1OTTD 1WSST 3MLTA 2MOVA 5HYQB 5I1HH 3KNBA 3ZUNC 5I5JA 5CD5C 5FUZH 2BY0A 1JWUA 1OP5K 1OGAE 1CXLA 2X3BA 2X4PA 3II3A 4RZKA 4A55A 3VI3B 2FUTA 4B3VA 2YIHA 5DJ8A 1E8ZA 2N7BA 4QT5A 2EE0A 3HE6D 1SEQH 1BQ5A 5GXBB 2BFGA 4DERA 1CFTA 1UCBL 5A2IH 2VDRH 2R8SH 3LRKA 4ZMOA 4JFEA 2A77L 2XT1B 4Y1AE 2A6KB 5JW3H 4PCKA 2DLEA 4M7ZC 1T6WA 3VFGL 3B7RL 4PJ5D 1K4DA 1E5UI 1N7ML 3MV7B 4LRNH 3KYMB 1RXLA 1DJYA 3LRHA 3M86A 4AJYV 1O7VA 4Z78B 2N7SA 3O6MH 4GRLD 1W0WB 4G6JL 3S37L 3F64A 2VZ3A 4S1DD 3S9DB 2E3VA 4ENEC 1KLFB 4IOSA 4KK6D 4KI5E 4PGDA 3QPXH 1I1RA 4LSRH 3V0HA 4XPTL 5DQ9B 5KANI 4JDVB 3FFDA 5E5UB 5EZOH 1N18A 2PYFB 4LMQE 3T2PA 5IGXH 1X5JA 4OI7A 2YD5A 2WP3O 4OY9A 3QHFH 5LXGH 1GZHC 4UV7H 4ZI8A 5ANME 3QEGH 1R33A 4A7QA 1SN2A 4XZUB 1MRCL 1VENA 4AUUA 4IRSC 1USQA 2R51A 3V10A 2VXQL 3MRLB 1WAAF 1FFOA 4IMLB 5M94B 4F7EA 3RL1A 5HPMB 1CI3M 4G72B 2NY3B 1WUZA 3ENEA 4L48A 2NDFA 3OWEA 3RPIA 2X4QA 4CAGA 3WMPA 4OGZA 2O6EA 4Z6AT 3BPOB 1A0QL 3VG9B 3QP3A 2H45A 5TE6L 2OJ1A 5DVKA 2N7AA 1AD9B 4KFZC 2XG4A 3BUYA 1Z3GL 3QEQB 2D7TH 3TO4C 5J6SA 2WZPA 5HTSA 5IHZA 3BQVA 3LMJH 1ZK5A 5CINH 2AEWA 3U4EA 1PX4A 4R4FL 4XGZA 4N3UA 3M17B 3VGGA 1U8OA 3IGAA 1EHXA 4Y1AD 2Y7QA 1MI5A 5FYKU 2WBWB 1OZTG 2V0AA 4TNGA 4RRPA 5CEZL 1OF2B 2QDWA 1G7IA 4KKBD 3PGFH 1KBBA 3NIFF 4PIBA 2WQWA 3SDXA 1JIBA 2Y4SA 4HJTA 5EBWB 2YPVA 4ADJA 2O30A 2R1XA 3DROA 2HRPL 4N5UA 5C07B 1Z7JA 2BIQA 2YBGA 1WTGT 1ZS8B 5DS2A 3NG5A 4BQ9A 1YPZB 2QQQA 4HT1H 1OGPA 2DBJA 2H5UA 2KPWA 4FXKA 3BSZL 1A3ZA 3QUMB 4KQ4H 4Y2DC 4HIXH 2QSVA 4J6IA 3QJFA 4PG9B 1IARB 3IBEA 3D85A 1WFTA 4MB3A 4OF6A 3ZKMD 1MXGA 1G7PA 2QHLA 4HIEB 5C0RL 2QKSA 4WO4B 1WHPA 1EO5A 1BFOB 5CLZA 5DJXA 3QG6A 2VDQH 1PL3A 3DUUA 4IRSA 4LARL 3FUFA 4BFBD 5C08B 5D1QA 3HJEA 2H32H 1AG0A 1MCPH 1D6EA 3CDCA 4PJ7B 1J5OH 1PY0A 1LD9A 5ALBL 4TNVK 4IDJL 4Z7NE 5LGYA 4XO8A 4FZEL 2XWJB 1KB3A 3UJIL 2Y5TA 1ACZA 3WTWA 2UY7B 3SHSA 3P11H 1MCCA 3QHZL 3UBXI 2ICWA 3TO4A 1V7NH 2H1PH 1LYQA 4IBTA 1M7DB 2ADGA 4R0LB 2ZNWA 3RLSA 3FHEA 1NAML 3QUXB 2Y6SC 2F1AA 2JKRM 3L7EB 3QFJD 4OFQA 4E9TA 2J3SA 4LHUB 2MCPH 4Z9KB 1F86A 4NZ8A 1OAKL 1GZPA 3Q7JA 4BSWB 2CIKA 1DQVA 4BFFA 3EOBB 4PJEA 5H2BB 1AI1H 4IRJC 4YZFE 3T3PE 5JW5B 3WTXA 5HYSG 2ZUQC 4N3TA 1HZKA 5DZ9A 3H3PL 4Z7WA 2LU5A 4YDIL 4JRFA 4UZGA 1Q0XH 3T4YB 2A38A 4Q74A 3SKNA 3WNJA 2XZCH 4Y2DA 2VDKB 3CZSA 4NQQA 2B08A 2OMXB 5IWLC 1AC6A 4PJ9D 4PWHA 1OGSA 4Z95L 1L7IL 4ZZKA 4B6ZA 2BZCA 3VW3L 3L3HA 3KWWA 1JXDA 4JUTA 2F5BH 4N0UE 4RRPM 4BRJA 5I1JH 2Y69B 1XZ0B 5ILTH 4PJ6A 5C0CA 4GAGH 2FJFA 4H8WL 2FIKA 4PBWD 4HUCA 5D70L 5DC2A 3MLWL 1X5YA 1BD2E 2FYYA 5CEZD 4BQBA 3LS4H 2K9FB 3CFQA 1UXSA 5EU6D 1QR1A 1KCUL 1R1CA 1XCTA 3GZQA 3O4LE 2XA8L 4OGXL 1Q9LA 2WVTA 5GRUL 3D2TA 2DM3A 1GZQA 3NCWA 2HZHA 3HNSH 3ILDA 3W11D 4LFHG 3TBYA 2PUQT 5E2TL 5BQ7A 4X4ZA 1ILUA 3CCHB 3NJJA 3SOBL 4NNYB 2APXA 3L2LA 5AOLA 5FA4B 5DJCB 1MFBL 2CNZA 2WUBH 4APQC 2C7FA 4ALAC 4QXUL 3KJ4B 1C8PA 4WAFA 4HALA 5EOCL 3VFUB 1DDTA 3FKUS 2NY5H 1QSZA 1E7UA 1KIUB 3P54A 3F7YA 3TCLB 3KMDA 1KBWA 1E3ZA 4KUZL 2F7RA 1FFNA 3IF1B 4CA4A 4GEIA 2WANA 3FFCB 1IFRA 3JBG7 3CFBB 4OKVA 5TDNA 3TV3L 5IMLA 3RVVD 4V2CB 4A2FA 5FYLH 1B90A 3W5MA 1NLBH 1NGPL 1D7DA 1S9KC 1DBAL 1ES0B 4A2HA 3HAEH 1OF0A 3QA3B 5DC0A 2AI0L 4DZ8A 2BY3A 3SDXF 2ZUWA 3U4BH 3OKKB 5HP5A 2B5IC 4LXFA 2AQTA 1WCQA 4IKLA 4LKXB 3O9WB 5IWLA 1JF1A 5DVMA 2R0LH 5FYLE 1ZLEA 3TGXA 4HAGA 1YJDC 5DJZA 5IW1B 2RB8A 1LNUB 1FE8L 3QUYA 4GSXA 4XVUD 2XPGA 3U30C 1Y18A 4XAWL 4OZIB 1EHLH 2GG1A 4ADIA 1R0AH 4G8EA 3S8FB 5HHXL 3STZA 4M5YL 1RFDL 4U6HA 1B4RA 1GY1A 3O0LA 4N0FA 3GXDA 1LMIA 1GC1L 5H35B 5AG8A 2V2TA 3FBKA 4HG4J 4WW2B 3VM5A 4R2GC 1AGDA 4MXVE 4ILDA 2EH8L 4KY1L 3VDAA 2D4FA 4MYWB 3K5SA 3V0IA 5ID0A 1SEBB 2B0SH 2Z1PA 1ZLWK 3BT0A 1P84J 2HT4C 2G0KA 5D5MB 4DH2A 3PAYA 5BO0D 4L9LC 5I1CH 4PW9A 1XX9C 3CHPA 3ATEA 1MH5B 2GJPA 2OMWA 3BZ5A 4AMKH 4XNZC 2XN1A 2BXYA 2XN9E 2ZWYA 3DIFB 1NKGA 3TZVA 1CE1H 2ESVA 5EEUA 3TNNB 1KY7A 1ZV5A 3G5YB 3KBEA 2NW2B 3LIUA 4O2CB 4ZUWA 1P4LA 4Y4KB 4APQA 3BH4A 1ZHKB 5F7HA 1QSFD 1C5BH 2D3VA 3VFPB 3T6XA 1FLRH 5AB2A 1GXEA 4NENB 1IJ9A 2JQAA 4BWTA 4YSOA 4DUVA 1X44A 2OFQA 5DD5H 5AB0A 2ZKHL 3QNZB 5C0BB 1W8EA 2DI9A 5IQ9B 3K8LA 4J12A 2IFGA 3QDMB 5SWZB 4AYMC 2ZOKA 4NKMA 3RY6C 2F8OA 2KL6A 2P3YA 3LN5A 3QSKB 5HGHA 1MFMA 1OB1A 3CHXA 2ADJA 3WXWL 5KSBB 3FOMB 4PJEF 2R83A 1QEWA 2FZ3A 3AUWB 2SEBB 5CCKH 1JYVA 2VM3A 3NFNA 5DQJA 5FYLD 5D96C 3VD4A 2E8YA 1D5ZB 1RUKL 4GKSB 2WZAA 1QZ1A 4Z7WF 5KJ4A 5HJGA 2ERJC 3WAJA 3QWQB 1VGKA 3FO1A 2EH7H 1FVDA 2HJLB 3FMGH 4WUUE 4R97C 4KNSA 3PXJA 4XRCA 1AYOA 3CLFH 3KPPA 3QB7C 1XGUA 1GGIH 3L3OC 1RUQH 4NO0D 4PTTB 5C0NC 3NPSB 3CPLB 3MRMA 5EIQA 5HDOA 2WXKA 4WI5A 1FPTL 5HDWA 3V0VA 4AVKA 1JF5A 3N42B 1MLBA 1EV2E 1GS7A 2VLRE 4MTMA 1IM9A 3NK4A 2B3RA 5EDXA 1YMMA 4GOSA 1QO3A 4JFWA 5I6XC 3W2DH 3L4UA 1QUNB 4BSVB 3CH1A 2PPAA 1C7TA 1TZGL 2Z91B 5I19H 3OF6D 1YVLA 5C0AD 5D7IE 2XN9D 1PAMA 4LAQL 2NY0C 5DWPA 3JWOL 1AE6L 2WXNA 2QQLH 3GC3A 5A1AA 2WLIB 3ETTA 3O45A 2VXUL 3C60C 1MCEA 1Q72H 1SJMA 4RZCA 2JIXA 3WAKA 3MRPB 3QO1B 1LK2B 4FL4B 4ONGL 3IDNA 1ITCA 1BM3H 5E08H 4IEFA 5EEVA 1A1MA 4IKIA 3TP4A 2VO5A 4YK4C 1A6TB 5DD6B 3EYOA 4BA0A 1BAWA 5D7JC 3SGEI 4ELMB 1JPTL 3NJXA 1CFBA 1RZJL 1F13A 4F57H 2HVKA 3Q06A 4X7EC 4QYAA 4G7QB 4NKQB 2FT6A 2DLFL 4K3DH 5EORL 5KW9L 4JE0A 1Z2KA 1UZ8B 3RY6A 2WHVA 4PRIE 4PR5B 1U95B 4XNMA 3VFSB 5C8JB 1XMEB 3AT9A 4MKMA 3UBXA 2YD9A 1TCMA 3OKMB 2JELH 2VDOB 5JMOC 3QZWB 5JDJA 3NP4A 3NRPA 4K2UL 2CO6A 2N1KA 5F6HI 1QI5A 1UH3A 1TQSA 2OMNA 3BLKA 5T3XH 1WCBA 1IC1A 3HI6H 1KTCA 2XOTA 1IAOA 4WUUD 1ZS2A 4ICWA 1ZA3A 3C5XA 3KGUA 3ROLB 1UM4L 2BERA 5JPNC 3P0VL 3O4OB 3X2QB 4AEIH 1TZIB 4ZUSA 4L3ED 3GBML 4EIBA 2EADA 3GB7B 5T3XE 3OR6A 3SDAA 5GS1C 5K33A 5HHPA 1RZGB 3ZBMA 2CKBA 1A8ZA 4GBXB 1UD5A 4XCEA 3SJVD 3D3VD 1ACXA 4P2RB 4DCQB 4XZ4A 3H3KA 1U21A 3UCRA 1A4CA 2QADB 1YYMH 3WOVA 4LF3A 4OLWH 4M5TA 1G6VK 3NESA 1CGSH 3QZOA 2MKWA 4XO5A 4NX0A 3ZMEA 2DMGA 3QCVL 3JTTB 3O3UN 5FM5M 4FG6C 4FQ1L 3BRFA 1CU4L 3DGDA 1U93A 1YLBB 1S7TB 1CDJA 2E7DA 1F3DJ 4ZAKD 4JNXA 2B59A 3ZE2B 4IRZA 1BEYL 1CDCA 1UD8A 4PMEA 3D18A 4BDVA 2UZYA 4JFFB 4ZG1A 3TBVA 2ODIA 4YVUA 4N9GA 3ZKNC 2VQ4A 3CSPA 4ZDHA 1J8RA 3SDCD 4P49A 5D7JA 3BJ91 1KDIA 1JGUH 1V10A 1GGBL 4UDUA 2NNRA 5EU4B 3E80A 2HN7B 4J1UB 4MAUL 4PRID 1UJ3A 1EAPB 2NY1D 3SODB 4ODVH 1DLHB 5ECJE 2H47C 1M3JA 1LO0H 4Q9QH 4JKPH 5C09D 3GSNH 3TNMA 2WTOA 4H25A 43CAB 4HJ0D 2EIMB 2XV3A 4FFVC 4WI0B 1K6QL 3ARRA 3GI8L 4J28A 1KEML 3AS1A 2N3JA 1PEWA 4LVOB 5TDOB 4N2NA 3BPCB 2EQDA 2BH0A 3GXFA 3I3BA 2FCBA 4FQLH 1MREH 1OPGL 4PRDA 4NJAH 3EDFA 3Q2VA 4Q9RL 3GMQB 3FBQA 1JDDA 2QJDA 5GS1A 1P4BL 4PWFA 3OR7B 3Q5YA 1DQMH 5KAQF 3FXIC 5FO8B 4LPCA 3EADA 1GOFA 4HPYH 4KTYA 3Q8BA 1KT2B 5C3IA 1J1PL 1QD0A 3T3MF 2AJXL 1GA2A 1L9SA 1LTXA 1EGJH 1R3KB 2ARWA 3OHXB 4LMQI 1JHLL 5K39A 3RWJA 4A1RA 1QRNE 1ET5A 1L9QA 4JRLA 4P2CG 4OVUA 1PGRB 35C8H 3ZDXE 3QUHA 4OLYL 1T21A 4NPJA 4YPGA 4HOWA 5CN2A 4PJAE 3H4FA 5L8JB 2DD8L 4N2CA 3T08A 4NO3B 1B0IA 2EO1A 2VXVL 3UPRB 1OCRB 2IQAB 4AH2A 4P5KB 2CWRA 4QWWD 1M2VB 4NNPL 3JWNC 1JGVH 4GINA 2EE9A 3H9HB 1AGCA 3VGAC 3MXVH 4TL4A 3N44F 1Z9PA 4JDEB 4XR8C 4YBQC 2H8PB 1JJUA 4LDLB 2OXHB 3QK0A 1HCVA 1XEDA 4K7FB 3S98A 5T1MB 2YPLD 5F6IB 1KN4H 1F3RB 1FO0B 2WIMA 3AMKA 4PI2A 1A7OL 3CVHB 4XCCH 3BXNA 2O5ZH 4LT7A 6FABL 5T1DL 4S0HA 1MHHB 4JFDE 2WWKT 4YEEA 2ITCA 5AG9A 5M95B 3DKHA 2Q3ZA 3RYMA 4Y19A 4AX3A 4WJ5A 1JPST 1CYXA 2WC7A 2DTSA 2V9RA 1KFAH 1MCBA 3D39E 2G4EA 4AK1A 3RG1C 2R29H 1O6SB 3GSUA 4B9ZA 1JV5A 3CGTA 2VSCA 1OTTC 5I1IL 2KYIA 3VXPA 3Q48A 1T7VA 4FI6A 5EG6C 2DIBA 4YVNA 2BSTB 3LD8C 4G6FB 3WO3B 3HOGA 3SKJL 2Y7LA 4ONFL 2XIIA 5I2IB 4L4VE 1F3JA 1CC3A 1QRND 2ALAA 3EYVB 3LDBB 2Q0ZX 2K9UA 2YKLH 3VYOA 1G0YR 1BQKA 3DGGB 4NOBA 3TOPA 4LASH 1OCZB 4KHTL 4XE0A 5EC1A 3ILEA 2QL1A 3S8WA 3R18A 3PGCA 3TJEL 2X4TA 1Z9LA 4BFOA 4Y5XC 4OD3L 2AMGA 4ZFZB 3V0GA 4D9LL 4GRLC 4QD2E 1YEEL 3X17A 1CFQB 1WWCA 3JXAA 4TQEL 4MASA 4S1DC 3HS0C 4MGXA 5HHVH 2HPTA 2W94A 4KK6C 1WVZA 2G9KA 4JKNA 4MWFB 2MOGA 2VDMB 4WFED 1H8NA 3ATBA 1P4IL 3EFOA 3TESA 4B97A 1U92B 1FH5L 3UO1L 4Q58C 4DP4X 2XVGA 5GZOD 1J9SA 3QPKA 4I4WB 3CZJA 4N87A 1EA9C 1UH2A 1V7MH 4FI8A 1HAUA 2R69H 1A7BA 1F90L 1COBA 3E3QC 4JFDD 4K07A 4EMZA 3RJOA 1IL1A 5AVQB 3BIKA 1E4XL 1P5UC 3MRGB 4GMTL 4PS4H 5EZLA 3QXUA 3WE1A 4JM4L 3MLTB 5F3HA 4GXUN 3D39D 3PAVA 3L13A 4QHLA 4LU5H 1CICD 3KNBB 1YNTB 1AGFA 1G4RA 5IVZA 1DTUA 2X4PB 3AREA 4X8CA 3VXRD 2AJYL 4NQED 5DJ8B 4RGNE 4QT5B 2Y22A 2Q86A 4NRZB 1D3CA 2I32A 2YD8A 4JFEB 4P4RB 3MLYL 1JRHL 1RY7B 4L4VD 4UQ3B 2WXMA 4PGCA 3BVTA 4GAFB 1K4DB 5LVEA 1OSPL 5JQ6H 2GIYA 3BZFB 4HULB 3T2NH 5LBSH 4TLTA 4PPTA 3CLWA 3FCSA 4H1LG 3MZTA 4MQ7A 3STLB 4ESKA 3NJHA 4PJ5A 2I9LB 4LPXA 5K9JL 4Y5XA 1J0KA 1YEWA 4KKBC 4K3HA 4LEXH 4PGDB 3MKGA 3SKUD 5A2AA 3UOAB 4GRLA 1CFMA 2IADA 3KG5A 1C5DA 2F19H 5JIIA 4PV9A 2Z7WA 4OU3A 3TASA 3FFDB 3FT2A 3HS0A 3UACA 4MNHA 5CCHE 2G9HA 3PHAA 3WMSA 5JHDA 3O0RH 3WFDL 3HLKA 4NQDD 2J21A 3S8GB 4TVSa 3D4GA 1FJ1A 5J11B 4XP4H 3S3BB 4BH7A 3N0AA 3ZKMC 1P69B 1WZKA 2E9BA 4CC1A 2QVIA 3EYQD 1QSEE 5DHMC 4F93B 3G5ZA 5ACZA 4QNPF 1U91A 3AXIA 2YQ2A 2CA4A 4ENZA 4F7EB 3FAWA 3RL1B 1FIEA 1MCQA 3ESOA 2X5PA 5CWSA 3UP6A 3RPIB 2X4QB 1P5UA 3RY4A 2DQUH 2CBPA 1UFGA 4MB1A 1KJ2H 3U0TA 2XG4B 4PSPA 1EAOA 1HZHL 3D9AH 4K4KA 3T4AC 2FO4A 1QFUH 3Q5OA 3E6HA 3FT4B 5IHZB 1XB8A 3U4EB 1GHFH 3DPBA 4XCNA 1ZSHA 3VQMA 1IC5H 4CC4C 4EKXA 4X9GA 1OGAA 1U8OB 2EE2A 3AFLA 2Y7QB 3RFZB 1MI5B 2PCXA 1IM3D 3EO9L 4M7ZB 4YXLH 3WGVB 5LO7A 4JREC 1AO7E 3TT1H 4IU3B 1G7IB 4HFWA 4XNXH 4HS6B 3WN5C 1JPFB 3SDXB 1MRDH 5IHUH 5F6HJ 2VAAA 2EAEA 4UTBH 3ABMB 3K4ZA 5GJTL 1A47A 1DSFH 1UA6L 1F1AA 2R1XB 3DROB 3V9EA 5E8EA 4D94A 2E9WA 1MJ7L 2WWKO 3WI9A 4IBWA 1Q9KA 4I13B 2K4WA 4FXKB 1G7MA 5GGQL 1A02N 5EOQH 3AG4B 5I26A 3QJFB 4K94H 3W39A 2E75C 4Q0XH 3V79C 3D85B 3EJJX 4H0GA 4JN1L 2W0FA 3M6DA 4YFDB 2PO6A 3ESMA 3HG1B 1DBBL 1JDAA 2CUAA 5F7WC 4PTUA 4WCYL 1ORSA 1URZA 3J8F7 5HYIA 2MMXA 3FCUB 4JFOA 4PJ9C 3DX9B 3QG6B 1HSAB 1S7UA 4L4JA 2PPDA 3DUUB 4IRSB 3HHRB 2FWUA 3UZQA 5D1QB 4Y8AA 5GS2H 1OGTA 5ANMA 1D6EB 1ESOA 2HH0L 1WFUA 2GTZA 4HC1H 4PGEA 2ED9A 1LD9B 3OV6A 4U6VL 2XNAB 4LK4A 3RWGA 1C9SA 1JZJA 4NAJA 2WTRA 2HFEA 3QQ9D 2Y5TB 3FQWA 3HS8A 1S9XA 3C9NA 4M7LH 3TBCA 1IBGL 2DI8A 2ICWB 5EIIG 2MEJB 4UMGA 1DEEB 2KLSA 2XRAH 1XTMA 2X9ZA 3E0GA 4JR9L 2ADGB 4Q89A 4LCVA 1G6RH 1NGQL 3W11C 1LLAA 3C87A 5J7CC 2I69A 2GJJA 1Q94A 4BKLA 3I02A 4W9ZA 5I71C 2A9BA 3OLGA 3MRNA 2AQSA 5DJ6A 5CJOH 2K7QA 1AO7D 2FL5A 1CBVL 4LPVA 1XR9A 3FB8A 4MX7A 3ZKXC 2RD0A 1GZPB 3O8XD 1HX0A 1R34A 2CIKB 4BXVA 3QR2A 3VX1A 5DFWH 4NCC2 1T5XA 1A6PA 3OPZL 5CD3A 2VMEA 1ONQB 2EUWA 1NIAA 1QW9A 4Y4HB 5HJ3A 3S0PA 3WJJA 1URLA 2TAAA 4Z7WB 4X9HA 1WICA 3KGRA 3RVVC 3SKNB 5DJ0B 2A6IB 3ZTEA 3H42H 2HTLD 2G2NA 4YIQA 1LO2L 2FEJA 1QLFA 3HG2A 3SE6A 2PW2A 4FA8A 3KPSD 2NZIA 4HG4K 5DC9B 2BCMA 1MAMH 3L3HB 2Z8RA 1HNFA 3KWWB 4E0RA 4FFZH 2DS4A 3WTSA 3SY0A 4XVSL 1P84K 4AKPA 4EZKA 5C0CB 2FJFB 4HBCH 5E00A 2FIKB 4QHMA 4DFHA 1GAFL 3VFMB 2EVHA 1F58H 1LMKA 4MDRA 2X2HA 4XVUC 4FCHA 4G3YL 2I85A 4AOFA 3BUTA 4YSEA 3BDXA 4LQFH 1R24A 1QR1B 1XCTB 1Q9LB 1JXGA 4I85A 2FBOJ 3WXVH 1N6QL 4ZS7H 1B2YA 1UXWB 3TBYB 4HPHA 1QMUA 4R5XA 4QHUA 4PGJA 1GSMA 2DQ6A 4HIQA 2DICA 4YHMH 3VYPA 1KPRA 1HEHC 2DMCA 3ALXA 4A2GA 5AVXB 5ABDE 1RJCA 2LLNA 2ED6A 4H0HB 2H32A 4JFHE 1AKJD 4J2XA 1H3PL 5LAXA 3RX8A 1W8NA 5JO5B 5E7BA 1ACYL 4XI5D 3ECQA 1FVEA 1DZBA 2TRHA 2P8PB 3BUDA 1IAMA 5EF0A 1FFNB 1OQXA 1U8MB 1THAA 2A4CA 3WIAA 3CQPA 5TDNB 1M71A 1NCDL 4OKVB 5IMLB 4FAAB 3SGDH 1BQHA 4PWGA 1OT2A 5BZWA 1KGCE 3VFTA 3SDYH 3OXSB 4YXHH 4FKKA 1SBBA 1TMQA 1IGIL 4NN5B 3IAGC 2P5WB 4DZ8B 4FQJL 1PLAA 1Z0NA 3HUJE 3F01A 1QSVA 5DSCB 2O5XL 4XOEA 2NY5C 3CX2A 1JF1B 3DO4A 4XVTL 2VABA 3SD5A 4J3OG 2VLJB 4TVUA 1HK6A 2HFGH 1T2QH 5DJZB 5KVFH 4OI8A 4XPAH 3QUYB 4P5TA 2XPGB 1Y18B 1EFQA 5FIEA 4G8EB 4KI5F 1IEHA 3STZB 2CD0A 3H9SE 4U6HB 2YEZA 1J5DA 4LDEB 1I7ZA 4CKQA 5GRYA 4N0FB 1U8LA 4A7GA 4YSCA 4N0UA 4JHWH 1AGDB 5KVFE 1EJFA 2BIOA 1KELL 3CFEA 2F58H 5F7EH 4O00A 1CLZH 4MJIE 4P9ML 5ID0B 1UKQA 5IQMA 5ADOL 4UTCA 1BD2A 1LHZA 2QPFA 4XXDB 3PHSA 1R75A 5DCCA 3O4LA 5F71A 4MNGE 4BZ1L 2FECI 3FUNA 5KSAA 2EEXA 4TUOA 3TZVB 2AV7A 2ESVB 4J3XA 4NI6A 7CGTA 1OOWA 4YDKH 2NW3A 3O2DL 1P4LB 4UT7H 4APQB 3L1OL 3QT2A 12E8L 4FHBD 4FE9A 5CJQL 2F53D 5D72L 3FUEA 3L1FA 4B0MM 4EN3C 4I3SL 5L9DL 1FN4B 3K1KC 3NZSA 4LCCC 5DA0B 2WLJA 4M3KB 4KJYA 4CW1A 4EI0A 3HJ0A 4U1MA 4OFIA 4LSDA 2V9QA 4B9PA 1ND0A 3ARTA 4M1DL 2W07B 4WKZA 1QX1A 5ICXA 2ZOKB 3NSJA 4NKMB 1MCWW 3WTUA 3LN5B 5HGHB 5JOFA 1OB1B 1MQKL 2ADJB 4R90H 1QEWB 2FZ3B 4JHAL 5DQJB 4JFUA 5TE4H 3N1MC 4HKZB 5IOKA 3G08A 1A6WH 2W8CA 1VGKB 3FO1B 1SHSA 1C7SA 4Q2ZB 3VRIB 2GJRA 2VZ1A 4XRCB 1XSJA 3P0YH 4JRWA 3KPPB 3H9SD 1XGUB 3INUH 2WIIA 3JZYA 4TPRH 5L4IA 1GCYA 4V1DB 1EHAA 3RVTC 3LTVA 2YGOA 3BN3B 5FS5A 1F6FB 3ZJAA 3NCJH 4HETA 3PP3K 3HAEA 5J9PA 1YECL 3OLDA 3T3MB 3V0VB 1MLBB 4R2GB 4KUCD 1IM9B 4LCUB 1C16A 4R5VA 4XPGL 4BA8A 1YMMB 1QO3B 1IKFL 2E5EA 3GSVA 3CH1B 2XX0A 3QR0A 4XT1C 3QS2A 5I66A 3PL6A 5IM7B 3P1VA 2DDQH 3TVMD 1HTYA 4I0CC 5AAMA 4DPBX 3VO0A 5I0ZA 3SGKC 4MMZC 1IAIL 3O45B 5MEQA 2ITDB 4DP1X 2JKJA 3GXPA 2PR4H 2ZCZA 3BKCH 2JIXB 4RZCB 5SWQA 4XWGL 3WKPA 3ATDA 2DI7A 3Q1SH 2XN9A 3IDNB 1VFBA 3SPHA 4KGLA 2B14A 2BHZA 4FQIL 5I6KA 2WVSA 2Y1YA 3F8UB 3N44B 1A1MB 4I87A 4Z7NF 3VD2A 1M56B 5FO2A 3HZVA 4D0DA 1PLGL 1RIHL 4EN3A 4LCYB 3CMOL 1K5NA 3EYOB 4LCCA 4O58L 4Q9CA 3V6OE 4G8FA 4PY8J 1PZCA 4ZAKC 5L7XH 5CUSH 2HVKB 1SF3A 5KYXB 3L4VA 4DOHB 2NDGA 4AE0A 1N5YH 4JG9A 3WIHH 3ZHNA 2VXSH 3SDCC 4XNMB 3WIIH 2YAFA 3PDDA 3QCTL 5TD4A 4D3CL 4L9DA 5I6LA 3UBXB 1IZJA 2A6DA 4UT9H 4WUKH 3MFGB 3F3HA 1CB4A 4OSUH 3EO1B 4NZUH 1FYTE 3S35H 2B3IA 1LE9B 2NY1C 2IIJA 2BOBA 3TX4A 2ERJB 1BX2A 1NSNL 4NZRH 3T3PF 3WJLC 4YZFF 1IAOB 1INEH 3PIQA 3NA4A 3NOIA 3PNWA 1NCCL 5I6PA 1INQA 1ZA3B 2WXFA 3BWSA 4HJ0C 4UNIA 5IMMA 3RKDD 3QDJE 2UYLA 2VSDA 1ODUA 3ILQD 4ZUSB 3FL7A 4NPYA 2LHAA 1BF8A 4WUUA 3GPEA 3OR6B 3SDAB 4B7LA 4WGWB 3U0PA 1PG7W 3TONA 3L4CA 2CKBB 5JUEL 2ZCHH 1JXFA 5EOCJ 1MCKA 3DSFH 2FX7L 1YNLH 5F88A 2OP4H 3U2SA 3EOTH 1P7BA 2Z31A 4A7GF 4I3RH 1H8OA 2HUEA 2VLRA 3OLIA 3BW9A 1CGVA 5FK9A 3MLRL 5DD3H 1RZJC 3D50A 1TTFA 1KIPA 1ORQB 1TSRA 2IGLA 1MDAA 1MIMH 2Q7AA 4F7CA 5CJXC 1ZVYA 5ABZA 3FUMA 5D7IA 1Y6MR 4U1JA 3EYUH 3MV8D 2ZXEB 4YOKA 1U93B 3SSGA 2HVJA 2B59B 2OJZL 1E8YA 4P46A 4E42B 3D18B 1GTNA 2UZYB 1EFXA 5L6YH 1BAFH 1YEFH 4N9GB 4ZDHB 3FJTA 5F7YC 2G3NA 5D7JB 3RRQA 2YA0A 4GH7B 2OMZB 1H6TA 4G7VH 3H7LA 3OQRA 2H6OA 4UDUB 1L7TL 1HHKA 2VXTL 1UJ3B 2CO3A 1GCFA 2YN5A 4JDTH 1EEQA 1JWMA 1MCRA 3SDCA 3WEAA 2XWZA 5AAWA 4QDGA 1U8CA 2NYYD 1CGWA 3KPQA 4MCYB 4GMSL 4AEEA 4ZFGL 4JG5A 3WNNA 1FYTD 4JZJB 4PRIA 2DWDA 3VG0L 2EZ0D 4FKEA 32C2A 3HVDA 1YRKA 1QLEL 4PVBA 2ICES 4XN2A 3WJLA 2D0FA 3DTXA 2BC4A 1PYWB 3AMLA 3QE5A 3OMNB 3FSZA 1J0HA 4PRDB 2EC8A 5JZ7D 4NHCL 4G83A 1LQSR 4F27A 1JZHA 1P6WA 3KDPB 2YD2A 3J7HA 2FHBA 3OZLA 5DR5H 4N6RA 3GMNA 1CGTA 2E6JA 3EBIA 5GGRA 4WVRA 1MFAL 5JXED 3EG9A 2OSLA 4JN2B 5ICZA 4MCMA 3TA4D 2Y06H 2D9CA 1QNZH 3RWJB 4NN7C 3NACL 5K39B 2AK4E 4IS6A 4UWQB 4UAOC 1R5WB 5DS1A 3HZYA 2GTWB 4TTDC 2LU3A 2WUCH 3ES6B 5HHMD 5F7KC 2DM7A 1T21B 1NH6A 4P2OD 3ESPA 4ZMAT 3VXME 1F11A 1AGEA 1QBMH 2WD0A 2HLFC 2ZX6A 4MXVF 4XNYL 5AD0A 1SLWA 4X5PA 1FLTX 2ZCKL 3GRGA 4BKSC 3LS5H 3PABB 3UIZA 1HILA 2GJZA 2HJFA 2R4RH 1N67A 2ZAIA 1EMTH 1HL4A 5DA4A 5ESQA 4AH2B 6TAAA 4OGYL 4LOEA 3DJSA 4TXVB 5IR1B 2CK0H 1AGCB 4NNXA 3ARZA 3VUAA 5IFAH 1IUZA 4DN3L 2CJ3A 1HJBC 1WD9A 3RJQB 4PG2C 4YBLC 3RB5A 4HCFA 1NGYA 4L1TA 4PP2A 4RQQA 4GPVA 2X10A 2JB5H 4W6YB 3V0EA 1CL7L 4QRRB 3BXNB 3K4AA 5I0VA 2AEOA 1EAQA 4OIAA 4OM0H 4NHUA 2OCCB 4ABQA 4XMZA 5HGDA 1JZEA 1R3JA 2ITCB 5IMKA 3O3DB 3A4FA 3SGJC 4PMFA 1YEDB 3QCUL 2Q76B 4WJ5B 2E27H 2PP9A 3ABLB 3IU3B 4IBQA 4NUGH 4H2CA 3LZNA 3LNDA 5B7FA 4HKBA 3GSUB 5I8CA 3S5LG 1E5YA 4U0RB 3GDBA 1D6VL 1JV5B 3WTVA 2ZG2A 3VXPB 3KYKH 2CDEA 5E6RB 1CICC 5DMJB 4KKPA 4W9DC 3ZDWA 3GSNA 2EDXA 3OC8A 1KB9J 1MJUH 5F3FA 3NCBB 3I9IA 4QTHA 3MBWA 2EJ1A 1LWJA 3EAKA 2A4ZA 1JV2A 1IEAA 1RJZA 1TENA 3DNKA 1BYNA 4Y89A 5ADPH 1OAQH 1OLZA 1JK9B 4L8BA 1U6AL 2ENPA 2C9SA 1F45A 3VXMD 1G9NC 1HWHB 3M1OA 1TQUA 3MLVH 4U1NB 3PGCB 1QRNA 2X4TB 5DRXB 3KH3A 1BG9A 3BOVA 1NMCC 2EEAA 3D34A 3IWVA 5J57B 5E4AA 4PW3A 2EC9U 3NCEB 3IJSB 4PJAA 3V4PL 2LOEA 1SUJA 2C3VA 2HRPH 1XGQB 3BC9A 4Z7UB 5D7IF 3VD5A 5I6NA 1EGJA 4BWUA 4RFEB 3TBWB 2N59A 4RETB 4XP9H 3EFOB 5IFJB 1O9VA 1DSWA 2I5YL 3N3EA 1IGTA 4PG2A 5KG9A 4XNUL 3LXCA 3EYFA 3HMWL 3S3DB 4M1CD 4FFYL 5E9DE 1JNNL 2IWKA 3EJCA 3M1CA 1KBGL 4ECNA 1IVTA 5GSRA 3B7YA 1DLFL 1T4KB 4K3EL 4G9FE 3UTTD 4FP8H 2YR3A 3CPUA 2D0HA 1IL1B 3SGJA 3BIKB 1UWGL 2PWFA 5EZLB 1MAKA 2NUTA 3EYQC 4BFGA 1B0WA 4QHLB 3LEVL 4JFDA 4OCWL 4XBMA 3RA7L 1S5IL 1EXUA 1D9KD 2QEJA 1AGFB 1G1CA 4LBAA 3B2MA 2GSGA 3AREB 1XWVA 5D8JH 1R47A 4F8PA 4MZRA 5BZDA 1CDYA 2Y72A 2YQ3A 3D39A 3KPNA 3N1PC 3L7FA 1CICA 3LKSA 3RGVD 2Q86B 3GIVA 4C56D 3BUPA 3I75A 1BV8A 1OALA 3P3YA 4JKLA 5EV7A 3K71A 1NCTA 3NIGE 3LY6A 4RGNC 3PREA 2DTML 3T0AA 3ZHLA 3QDGB 1BVOA 4JO3L 1IBZA 2R29A 1NA8A 2ADFH 3FCSB 3QPQC 4L4VA 4MQ7B 4J7RA 1AFVH 2E59A 4PJ5B 5IIEB 4N0YL 3UTZA 3PP4L 3NDZE 4Y5XB 1OO2A 1WFNA 3D5OF 5CO1A 5I1LA 2SODB 2I60L 3DX4A 5TE7L 5ESAA 2IADB 1C5DB 1J8HE 1U2HA 4PV9B 3FT2B 3HS0B 5CKGA 4MNHB 2G9HB 1OHQA 1WA0X 3VI4E 3QXWA 5J3HD 2GY5A 5JHDB 1QKZL 2BX5A 1CZ8H 2E4FA 3GUFA 4X6DE 4BM7A 4DZBA 1OE3A 2VQUA 5E6ID 4DTGH 4I9XA 1FJ1B 4BH7B 5E9DD 4P9HH 5F96L 3QZPA 3OAUH 2MCAA 1P7HL 1NUFA 1DO6A 4YNYA 4FQXD 5CLYA 1DUZA 1JD7A 1ZT1A 3G5ZB 3T04D 1U91B 2DWXA 3UAAA 5ACZB 4XP1H 4X83A 4HJUA 5D7SL 4Q7DA 4O4YL 2FX9H 3N1QC 4NWUL 5CWSB 4K7PH 1P5UB 5DK0A 3V4UL 3A4DA 4OJYA 3OKEA 2BHUA 4KOBA 5DURD 1NEZA 3IS1X 3U0TB 2PXYB 1G5GA 1BLIA 2CR6A 2XFGB 4G5ZH 5FGCE 1JZ3A 5GRUH 4UTAL 5J89A 1AH1A 2FO4B 2JCWA 3E6HB 3A67L 3BAWA 3AJ7A 5IFHL 4AIZA 3US1A 3MLXL 4KROB 4ZRGA 2Z8WC 1IGJA 2R69A 3HPJA 4O02H 1OGAB 3MBXH 3VD1A 2WK2A 4QRUA 4AQEB 5ISZE 3FT9A 4IDLA 1CXKA 3SGDI 4XBEL 4YHLL 4PVMA 3IDXL 2XZAH 2X1QA 1BQRA 5EULV 4NKIL 1G1YA 3EOYG 4K0OA 3AC0A 5E6UB 3NJVA 2E0PA 2JLPA 2UZXA 3FU7A 1T0PB 4GRWE 1F1DA 4A38A 4NZTL 4LLDA 3TIDA 1UM5L 3GSWA 2Y0SA 3SO3C 4G7SB 3O8XC 1Q9KB 3NJGA 2DBLL 2QPSA 2Q8BH 1TTBA 2VDRB 5JDSA 3Q43A 4X5WB 1K8IA 4TUUA 3W39B 3W38A 2G2RB 3M88A 2WGNB 3OM3B 2W0FB 2DQDL 1BF2A 2PO6B 3ZQXA 2RQ8A 3ZDXF 5LBSA 1Z32X 1MKFA 1Q9OA 3EHBD 4PTUB 4QLRA 4PJAF 5GRVL 2OZ4L 2IPTH 3I50H 3VH8G 4DAGL 1ORSB 2HTLC 4WWNA 4JFOB 4GY4A 3APMA 1NCBH 1S7UB 1QFPA 2WJ7A 4Z3JA 4JO8A 2R2HA 3UZQB 1CDGA 4GT0A 4NQSB 1H0DA 2D73A 5ANMB 1CGUA 4GG6E 1NTDA 2YRLA 4WU5A 5D4HA 1QSEA 4PGEB 4OFVA 4K94C 4DP0X 1ZLDA 1GC1H 4MXQC 3RWGB 3SKOA 5AW2B 2HFEB 2WTRB 5IESH 2HX8A 4DUXA 4E68A 3FQWB 5CNHA 1S9XB 3C9NB 2ZE0A 2O26U 4HEPG 4JL1A 3RIFF 1UACH 5GJSH 2C9RA 1MHCB 3POCA 4IIQC 3BDBA 1BXAA 4WDIB 4LVNC 4JQVC 1I9EA 1Q94B 3GLZA 3I02B 1VDGA 4MAYB 3MRNB 5DJ6B 2YEQA 1U3ZA 2D8KA 4M6MH 3VWKA 4MDJB 2IV9A 1XR9B 3FB8B 4Y9FA 4I0PA 4HCGA 4UQ9A 3TEWA 1KJ2A 5F1NB 4NT6A 1XGTA 3AU1A 3VQLA 1AO7A 4HLJA 4MDIB 4XI5C 3ZX1A 3IVKA 4L4TB 3AWFA 4N90D 4JY5H 1KC5H 3UPCA 2WXOA 3ZDYB 4APXA 2O6PA 2ADYA 2EIDA 4WY7L 4YIQB 1SBSH 2RFXA 3QEUA 1JZDC 4L8DA 5SX4H 3BAKA 1KLUA 4H20L 5F7DA 1QLFB 1PQZB 2ZSVA 3BP5A 3KLQA 4N4YB 2NOYA 2GT9B 3NCMA 3O6FC 3IDGA 1A1OB 1UXMA 2CBOA 4PB0H 2QQKL 3SY0B 3VSUA 4UTBA 3VI3E 3BD5A 3IU4H 1GIGH 4TULL 4R8WH 1A6VH 3N06B 1EZSA 1UFUA 1MFEH 5DVNA 1QFOA 2WB7A 3FONB 5AVWB 5A2KH 4B0MB 1X5LA 1CF8H 4W1TA 5DLLA 8FABA 4UBDD 3UAJD 2V8LA 2AABL 3OKOA 1CD1A 4S11A 4UYQA 3MV7E 2ATPA 5F9JA 3VA2C 4B9CA 4Y7MA 2B1HL 1YNKH 3ULUL 3GS4A 4KK8D 1TQBC 4GUPB 1OTSD 5GGRY 4XCFL 4Z7NB 3MMEA 1KPRB 4ZPVA 1HC1A 4ADGA 1PVHA 3SYAA 2VDQB 5HPOA 2IAMD 2WXLA 3VCLA 4IIQA 3GD1C 5AALA 3SPIA 2A74A 4G6MH 2EDTA 2H32B 1UH4A 4MNQD 5IQNA 2BSSA 3V0AC 5LAXB 4GSDH 3VFWB 5CZVL 1GYCA 3GEWB 5I8KH 1IAKA 2IV8A 4HC1A 1L9PA 1FVEB 2QMKA 3WELA 2DWEA 2J56A 4C4KT 3P2BA 1XCXA 3DIVA 2CSPA 2CNYA 1BQHB 5ALCH 3VFTB 2A1WH 1S9YA 1DP0A 1JDCA 4DEWA 1NFDE 1PU0A 3DTUB 1G6RA 1JPTH 5DHYA 1TLKA 3T3PB 2OL3A 4HGWB 1CFSA 1HEZB 3G3LA 4OCRH 2GK0A 4NO2B 1RMFL 5I1KH 4JG0H 4AK2A 2DLFH 3ELAT 2ZF9A 1AY1L 3QUML 5IBTH 2VABB 1OTUD 1IQDA 3REVB 1G9ML 5EU5A 1SOKA 3O6FA 2VC2B 4GI8A 5LGJB 4P5TB 3QEQE 2EDLA 3EJPA 2XBZA 2FEEI 3KPRE 3GJFK 1R3LA 1XIWA 1UWFA 2YEZB 2Z65C 4WJG3 3W56A 1I7ZB 4XPHH 1O6VA 4DKAA 2O5YH 1U8LB 2OW6A 4I18B 1ZLVK 2ZONA 2JCCE 1NPNA 2CLRB 3CFEB 3FH8A 5FAAA 2OLDA 2IBBA 5KVEL 3MV7D 2W9DL 3NSXA 4JHBA 4K23L 3TJHD 1JNLL 4B9IA 1BD2B 3VAEA 2ZX9A 4RMWA 1E27A 3L9BA 5GS0H 5I8OL 5GRXG 3PRZA 3O4LB 3SE9H 4FFZA 5F44A 5KSAB 1CDIA 3BIBX 4TUOB 4TS6A 2AV7B 2MJWA 2FX8L 4IJ3B 5A2FA 4YLQT 5C07E 2D0GA 1IGMH 2DW5A 4L3CA 5HVWA 1BXXA 2DWTA 2NW3B 3W1ZA 1YPZE 3NH7L 4OJFL 3TVMC 5T5NG 4KAQH 4JANA 3EYSH 1TIUA 5E7FA 2WOYA 4EI5A 3ARWA 3NCYS 4OFDA 3EDEA 2VZTA 4DW2L 3QG7H 1XCQA 1ZV9A 4CW1B 4ONHA 1HN1A 1VB9A 3LZPA 4U1MB 1CXHA 3NZHL 4X6FA 4FYTA 2YSTA 4KHXH 2J44A 2PWHA 3R8QA 1ND0B 2XCMC 2XWCA 3V95A 5FR3A 3LH2H 4WKZB 5IG7A 4B9FA 2WJ5A 1NIEA 4B9GA 1A3LH 4XPFH 5CSGA 5JOFB 1R3IL 3CBJB 2NY3D 5AENA 4PJ7E 3M8OL 3S5YA 3ULUD 5BUPA 1MEXH 4MAUH 5KYUA 1PY4A 2QHRL 4XH2A 1CFNA 3OSKA 4X9IA 4X9BA 1I8LC 3G08B 3D1MC 3HUJA 4FQ2L 4JO1L 2X12A 3QEQD 1GYAA 1FNAA 3MUY1 4PRAB 4G8IB 2WIIB 3TYGL 5AYUH 2EE6A 4YQXL 4QKTA 3HAEB 2CO7B 2YMXH 2CZNA 5J9PB 1VF5C 3S34L 1UEMA 3H9SA 1C16B 2CBTA 4HSAC 3RKDC 3GSVB 3ILQC 4IGBA 5DVLA 1UADC 1HOCA 5I66B 4AQ1C 1B3JA 3PL6B 2F61A 1IBDA 2VDKH 4KZEH 3ZTNL 5DLMH 4YE4H 4MJIA 5IP4A 5C07D 4XC1L 4MD4B 3OZ9L 5DWUH 5SWQB 2F9BT 5B1CA 4W93A 4MNGA 1SHWA 2Z7ZA 4OM1H 1H5BC 1VFBB 3PY9A 2CDGA 4OB5L 5FW8A 4Z76A 1NBZA 1OZUA 2WKGA 3HZVB 4JMNA 4MSWA 4EN3B 3WSQL 1M3IA 3EXLA 2GKIA 2DMKA 1PFCA 3OAWA 3OGOE 4PV8A 4WO4D 5DJDB 4NUQA 1UEYA 2DQTH 4O51A 5DK2A 3WNPA 2QDVA 1SVCP 4HLEA 2J25A 1P5VA 2JB6A 3UJJH 3WD5H 1BVNP 4WI3A 1KENH 5C08D 5B3SB 5H4ZA 3DHMA 3V6OC 2VN3A 1OK0A 2OR9H 2X2UA 2QFRA 4AQOA 4QJ4B 2VMDA 2EIEA 3PXLA 1WWWX 2X4OB 2ENQA 4Y7OC 1HH6B 2C9AA 1WV7T 2BP0B 4U1LA 2BOBB 3D09A 1I8LA 3VFOA 1CDBA 1BX2B 1ZLSH 1TZOA 3PWNA 2NYYC 5F3BA 1YEGH 3PIQB 5TTRA 4CADB 1XSOA 3QDAA 4LGRB 4FMKA 4MXWL 4NQCE 1INQB 3AXLA 5AVYB 2EZ0C 5IMMB 3V55A 2UYLB 3KS0J 5AAPA 3P69A 4NPYB 4QF1A 2OULB 3QUXD 3MODL 1UXLA 1SNRA 1UOKA 5I73B 1SOQA 4N20A 4DVRH 1E6JL 3LKQA 1LEIA 3KLLA 3BKMH 2FJGB 5JZ7C 4R83A 3MXWL 4LHUD 3VWJA 4HIIA 2VW7A 1OL0A 5F88B 4M61B 2Z31B 4HD9A 2IPUK 1OD7A 2VLRB 5BUAA 1KJVA 3BW9B 3FN0L 3MNVA 2O72A 4HK3J 3C2AL 4WK0B 4MBOA 5JXEC 5EUKA 1KIPB 4FYRA 2ROYA 4PRPE 2BP3A 2LQRA 3IGUA 2YOAA 5D7LE 3SYCA 5D7IB 2YFNA 2WNXA 1NCWL 3K46A 2VGLM 3ETBF 4IHOA 1H5BA 3T6ZA 2HVJB 1XF4B 1L6PA 1FL3B 4P46B 2OPCA 4HK3N 2BIPA 3BX7C 4NUPA 4P2OC 1EFXB 5F9OH 5LG1A 2IO5A 2WSDA 2VNCA 3W9DA 1HXMA 2WQUA 3AT8A 5E99L 1BQLL 1DN0A 2VUYA 2WLLA 1J5IA 1AZBA 1I82A 1NBQA 5J5EA 1HE7A 4KKLD 1V54B 3V6OA 1JWMB 4HW6A 4TUKL 1KCBA 3KPQB 1JHTA 4UU9A 4PRIB 2DWDB 3CIAA 1PY9A 1S2EA 32C2B 4V11A 4PHXA 2X70A 2ZWZA 5FYJL 5AW7B 2VERN 5IY5B 4HS8L 3ZL2A 1MRFH 5FKAB 3DTXB 4GNKB 2CR0A 3T6VA 1KB9K 1FYTA 3C5JB 3WU1A 4QRSA 4ZPTA 2YD6A 1E4XH 3U4AA 4WFGD 3WIHA 1WEJH 2D7QA 2WBXA 3HUJF 2ZXGA 4M1GL 4UB0H 5F7AA 5ACLA 1V27A 1AQDA 3D12B 1UASA 3GMNB 5GGRB 4JPWH 5B8CB 4UT9A 4HP5A 3QDJA 5FOBB 3JUYA 1BZDA 5C0JA 3FFCD 4KQ3L 3H3BC 3OB0K 4LOVA 2YO3A 1MHPL 1G7JA 2QR0A 4IS6B 1SFDA 4WV1C 5JXEA 3FPYA 5A2CA 4YLBA 4NC0B 1JRHH 1KZYA 4LFHD 2WLNA 2CMRL 3JSSA 4QHKJ 3VTMA 1MW3A 3U1SH 2CIIA 5AD0B 2Y3AA 5CS7A 5TH2A 2Q5BA 3O9WD 5F0LB 5CZXD 1HILB 1VZGA 2GJZB 4DPRA 1NANH 1N4XL 2HJFB 4MVBD 5C0EA 2UXFA 3L9RB 2CHXA 4P2OA 5ESQB 4DP9X 4FD0A 4LSQL 3CBKB 4KXZH 4AMWA 4FXTA 4Z5RA 2AJVH 2PTUA 1FFRA 1A7PL 1IRAY 1FBIH 1JS4A 1ZOXA 3J2PA 2AJSL 1E3XA 2NY7L 5C86A 2VOTA 1E9OA 1NGYB 4XN7A 3U9PH 3QYCA 4OBRA 2KZKA 3HRPA 4PP2B 4RQQB 3WFDH 1QEXA 4JM0A 4ANVA 4XC3L 2XFXB 2IBZY 3OQ3B 3AS3A 3RWEA 4NHUB 4M7LT 2RGSA 2WCGA 3NFSL 5IMKB 3CAFA 4PJIB 2VDOL 3KBFA 2QGDA 4M1CC 1EPFA 3D2UB 3JV0A 1KTDA 3OTTA 3BRGC 2HFFA 3FRUA 5F89B 3MOBH 4HKBB 2L7QA 4HVBA 5ENWA 5I8CB 2YD4A 1XCWA 4QI3A 4Y4KD 5F9WC 7TAAA 5JPMC 4RWYL 3OKLB 1WISA 1OAZL 5JOEA 2X2YA 1AZCA 2V7HA 3HNTH 2F68X 3TEZA 5HD8D 2BNRB 5INDA 1BWMA 3MBWB 3HC3H 5CP3H 3UO8B 1DSYA 3KLSA 5E6SB 1JV2B 3QJUB 1J8SA 1CYGA 1IEAB 1RJZB 3RGVC 5EZIH 4AEHH 1UA7A 2XWEA 4UQDA 3QDMD 4G1MA 4WTZG 3A4AA 3ECUA 3H56A 4R9HA 1DUYB 3BCFA 1FNHA 1CF1A 4MZ3A 2XKNA 3S37X 3K6IA 2AK4A 2ZP8A 4Y5YA 4DEUA 3CZUB 1ZGLP 1HL8A 3T8VA 2QSCH 5B39A 2EDQA 1BZ9B 3ZDXB 3B7TA 4PJAB 3E7JA 3VXMA 2EDJA 4AQZA 4U3XA 1XL4A 2R59A 1ETB1 3TURA 4M43L 4AV4A 1MJ7H 1SY6L 3JWDL 4M93B 3RDTB 1VPOL 1F5WA 3QFDA 4I9WE 2EKSA 1FORH 1BP3B 4PLJC 4YXKH 1TCRA 5GGTL 5KG9B 1I1AA 4X4ME 2P7TA 1SOSA 2PYEE 3EYFB 4LVHC 2P8MA 2F08A 5J3HC 4FG2A 4KRNA 4ZT1A 4AVHA 5J13B 4OKDA 4FNLL 3IETA 4L8CA 3DX6A 2WVVA 3MCG1 2BSBA 4OCXL 5FGSA 5GSRB 5E6IC 2KDYA 4E9LA 4ZO9A 3WJMA 3CDYA 4QKXB 2NUTB 4FQXC 4BZ2L 2HAZA 3Q1EA 3BD3A 1EXUB 5I15H 3D33A 5DJAA 5JPMA 2GSGB 3CXFA 2AHIA 4K9JA 5BZDB 3QS3A 3MDJA 3L7FB 3LKSB 4KXDA 2Q8AL 1P1ZA 1SZNA 3GIVB 2W9EL 5MP6L 2ZQKA 3BFOA 3BDYL 1SDDA 1S7XA 4GIAA 2YBRA 1JCVA 1MFCH 1UT1A 2DQGH 3KE0A 4DKTA 2WAQA 3BAYA 3PDOA 3K71B 2FD6L 2IDUA 3RURA 3F58L 3AY4C 4RGMB 3OD3A 4WWKB 4M62L 4AG4H 4XBPA 5DI8A 5JLZA 1MAJA 4LP5A 2DLHA 2OV0A 3UABA 1G9HA 4JY6A 1SXZA 4AYEC 2M26A 4FERA 4PEEA 3UTZB 3ORJA 3GI9L 5SX4I 1C08A 4K5OA 4M4RB 3GSXA 1IGCL 3K5RA 5ESAB 4NYLA 2FATH 4YLCA 4KX7A 2R0ZH 3TEYA 3EJYC 4I9WD 2HT2D 1A21A 1ZKAA 1ASOA 2KPNA 2CHZA 4AXWA 4DZBB 1D5BA 2JJSA 1BFVH 4W9KC 4RBPH 2K0RA 2QPDB 4GBXD 4F20A 1DUZB 1ZT1B 2QQNL 3LN4A 2FLBT 3EHBC 3ABKB 3CVHL 1ODAA 5BV7L 2QADD 3L9EA 4JFZL 1H3TA 5I9QC 4WHYG 5DK0B 1NLDL 2IWEA 4FFWD 3ZQ9A 2G60L 3OKEB 1PG7L 4J6RL 1NEZB 4G9FA 2LU4A 1AR2A 1A9VA 1WTLA 4J2QA 1B88A 3QJXA 3FF8A 4HUMB 2VDPL 2AFNA 4R7XA 1A7QL 3LPGA 4FYSA 4P9HC 4AIZB 4E9VA 4PLKD 2R4SL 4KVPA 5AW5B 1MCSA 3WN6A 1T0NA 3DYOA 4JFFD 4AENA 1IGJB 3HPJB 4NRXA 4JFPA 4LOFA 1FO0H 4QRUB 5L88H 5DZJA 5KVDH 3QI9C 3T0WA 4DGVL 4RGNB 1WFIA 2LFGA 3MN8A 2ZT9C 1MZZA 2AVFA 5CM1A 1YN6A 4FEIA 3GWJA 3QJTB 5HGBA 5IZ7A 4BEIA 1QVOA 2V3DA 3MUHL 5IW6A 2UZXB 4NLAA 4W9EC 5LCVL 1N0XH 1A5FL 4HHAA 3ME0A 5KVDE 4H8PA 3TIDB 4EPSA 3GSWB 3G5XB 3CC5A 3MJ8A 4PRHE 1R5VA 3BGFB 1ZANL 3GXMA 1L4IA 4RVBA 4MMYB 2X1XR 1V55B 3WEBA 5HJDA 5JDSB 2Y25A 3NA9H 4X5LA 3S96A 1RZ7L 2H0EA 3CFJA 1E8XA 4CVWA 2V2XB 5F0PB 1OE2A 1RJLA 3SE8L 2YD1A 4HH8A 1ZPUA 1RUAH 3H9ZA 1J8HA 1DQDL 1NIDA 2O1AA 3U0WL 4B3EA 4FLRA 1M6OA 4KDTC 1TTAA 4HCRL 2VDML 3VI4A 4JKWA 2HLAA 3D6GA 3PGDA 4X6DA 1F6LL 2R2HB 5FWQA 2R1WA 3QAZC 2NZ1A 3L2NA 3WCYA 4UAHA 3T09A 4EDWH 2B4CH 4JE4B 1IB5A 2ZUSA 2UV3A 1QSEB 1QW8A 2GI7A 2EYSA 3DV4B 4X7TA 4XX1G 4ZMTA 3W81A 5CBAA 3OMZA 3SKOB 1XHHA 1KELH 4LL4A 4Z7OB 2P47B 1YEIH 3IXTA 3QORA 1SYVA 1T1ZA 4UBDC 1BYPA 1FVCA 3MGTB 1PZAA 2IF7A 1NCJA 4UF7C 3GNMH 3UAJC 3WIFB 4F3FA 4OAWA 3KCPA 4ANUA 2AV1A 3DX8A 1RZIA 4OIFA 4A68A 1KXQE 5GQBA 2ENSA 5I75B 3P9LA 1BLNA 2HRHA 3QI9A 5FYKL 2UUDK 3KPOA 1B2WL 3KM1A 4QGYA 4CJ0A 1VCAA 2DKMA 4KKNA 4P8QA 3VWKB 4ODSL 2DQCH 4HXBH 5KTEL 2DQFA 2V5MA 1WDAA 3C12A 1X5XA 3KYNA 4GRMA 3BVUA 4I0PB 2EUZA 1IEBA 5EU3A 1KJ2B 5ISZA 2WN3A 4NT6B 3LB6D 3OGCA 2VSMB 2RH0A 1T20B 3MC0A 5FXCH 3HZKA 1M57B 3PPSA 2NYZA 2CE6A 3AU1B 2P26A 2XWTA 1I1YA 1TEYA 2X9YA 1DVTA 3DX2A 5F21B 4ZXBA 3I6GA 1N64H 1QNIA 2GC7C 4K71C 4O02A 1E2ZA 1SN5A 4APXB 4M00A 2RFXB 3QEUB 3ARGC 4L8DB 3ISRA 5BVJA 1GMIA 1YMHA 3BP5B 3D06A 3V52L 4LSUH 4R96A 5E56A 3LRSA 4HJGA 4KDTA 3U6XS 3EJSA 4Y16A 1TJMA 1U8JA 4PJXE 1FWXA 4R7DA 1OTUC 3LQAH 5T1KA 3U9WA 4M48L 4G6FD 2FT7A 3QO0A 4L37A 4UQ2A 5JIHA 5I82A 1RJYB 5D2NE 5E2UL 4HJIA 4QEGA 5HI3D 1TYJA 4L3FA 3TEUA 3QJSB 4FA7B 2FBJH 2QGCA 2ATPB 3GKWH 3BP4B 4H0LC 5F9JB 1XB6A 2HG5B 1XSKA 4GG6A 3CX5J 5A6MA 1ZLUK 5K5YA 4YH6A 2VH5H 4OT1L 4AYBA 3UAJA 1WPCA 3O2WH 3ARDD 5HHQA 1GTFA 2WGXA 3N1FC 3TJHC 4IIQB 4B9KC 3RGBA 2A74B 3HHMA 4LVNB 3TBSA 2CJUH 4E9XA 5DHVH 2BSSB 3DMMB 5AVZB 3X13A 3H7BB 3L16A 1IAKB 4GXVH 2XTLA 4UQBA 2DIAA 1YEKH 3QWRA 5C0IB 3KL5A 3MV01 4O2FA 3RZWA 4XMTA 3S7GA 4JQXC 5DYFA 3L5XH 1A4JA 1UOLA 2DWEB 2MNWA 4H1LH 5C6WH 5I0YA 5B3JE 4DN4H 2GIXA 2E46A 4IK7A 1UD2A 3L8QA 5EEWA 3OX8B 2LVCA 3RUGB 3K1DA 4C4BA 1HVXA 1G6RB 1AQKL 2YPVL 3L3KA 2ZKMX 2AXHA 2HKAA 5ANHA 1CFSB 1HDMA 2GK0B 3V6BR 2X09A 3NIGF 5E8DH 4QY8A 3AUVA 3ARGA 2CRIA 3BH9B 3IFLL 4NZFA 4U4IA 4D9QE 4PCSA 2NSQA 2HYMA 3S3CB 2TSAA 1IQDB 1J1OH 4FADA 5DD0H 1JZ5A 3I85A 1HNGA 3O6FB 2NY3C 3T0EB 5C9JB 4EBQH 4P0DA 1S8DA 3FTVA 3ULUC 3JTSB 3VG9C 3REWB 5IHWA 1A7RH 2Y07L 5CILL 1R3LB 5FYKD 2Y24A 1REIA 4Y1TA 1XIWB 2W81C 3ROOA 1G94A 3DI3B 4F5CE 1PJWA 2D2OA 3K72B 4LBEA 1ID5I 3VI3A 1OM3L 3VI4F 4AL8C 4ACTA 1A2YA 3A23A 2ZXDA 4PD4J 4X6DF 5F7NC 1P9MA 2PWEA 4OCYH 5TF1L 3SDXE 4KV5E 1JZ7A 3Q6GH 2UXVA 3IAPA 3NAAL 5FUOL 2WNKA 3MV7A 4W4NA 2VMFA 2GCYA 2ZUXA