1WFMA

The first c2 domain of human synaptotagmin xiii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSSGSSGSWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords synaptotagmin XIII
publication title The first C2 domain of human synaptotagmin XIII
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfmA00
4DK5A 4IQHA 3NSJA 4L23A 4PS8A 4ANUA 4HVBA 4URKA 2WXHA 4L2YA 4EZLA 1GMIA 2FK9A 2KI6A 4KZ0A 4FA6A 1DJYA 2WXKA 5CCJA 1E8YA 4A55A 1DJXA 4Y1TA 2D8KA 4TS6A 4J6IA 5EDSA 1E8XA 2WXPA 3ZVVA 4G11A 4F93B 2CHWA 4FHKA 4KZCA 1CJYA 2YOAA 3FBKA 2NSQA 4PS7A 3KWUA 2A5UA 4NPJA 4FULA 1E8ZA 2CHDA 4IHBA 4WAFA 2WXOA 2K3HA 1DJWA 2ENQA 3HN8A 4ANWA 2Q3XA 2FJUB 2WXIA 3M7FB 1WFMA 3F01A 3ENEA 3R7RA 2CM5A 4QAMB 4TUUA 2LHAA 4ANXA 4V11A 2ENJA 2R83A 1V27A 3TWYA 1BYNA 4WEEA 5H4ZA 3F05A 5JHAA 4LDCA 3JZYA 2B3RA 4BGDA 3S2AA 2QZ5A 3PFQA 3PREA 3TJPA 3L17A 1BCIA 4FJZA 4NP9A 3APCA 4Y1SA 3DBSA 1RH8A 3HIZA 4BFRA 2WXNA 1YRKA 2WXFA 3ML9A 4XX5A 5JHBA 2X38A 3OAWA 3W57A 3N5AA 1W16A 2CHZA 3NZSA 2JQZA 3SD5A 1RSYA 3T8MA 2CHXA 3IM1A 3KWTA 4AJWA 2Q0ZX 2DMGA 2NCEA 2WXLA 3QR1A 1WFJA 3RPBA 4EZJA 3B7YA 3GPEA 4L1LA 2A4ZA 1DJZA 2WXQA 1E7VA 2WXMA 4HLEA 3HHMA 4LCVA 1K5WA 2WXRA 3ML8A 2Z0UA 2V4LA 3FDWA 4OVVA 3QARA 3QK0A 1E8WA 1UOVA 2WXJA 3RDJA 4FJYA 4L1BA 3F04A 5G55A 5KJ7E 5G2NA 4NPKA 2UZPA 4FADA 2ENPA 1E90A 4AOFA 2EP6A 3PYCA 1HE8A 4ANVA 4NS0A 3L16A 3QR0A 3QJZA 1DJGA 3ZIMA 4OVUA 2K8MA 1TJXA 3APDA 1DJIA 3L13A 3L54A 2NQ3A 1DQVA 3APFA 4GNKB 4PS3A 1E7UA 5CCHE 3TL5A 4ICXA 2N1TE 4F92B 2ZKMX 3L08A 1UGKA 3PRZA 4XZ4A 1A25A 3R7QA 4FHJA 1QATA 1BDYA 4WWPA 2BWQA 4QJ3B 5CCGE 4XE0A 3L9BA 1RLWA 2QZQA 1DJHA 2CJTA 3LJ3A 1TJMA 2Y3AA 3CSFA 2WXGA 3OHMB 3QAQA 3NZUA 3W56A 4F91B 4MJJA 1QASA 1UOWA 2DMHA 3F00A 2K45A 5H4YA 2RD0A 4GB9A 3CSTA 4LT7A 4DNLA 1DSYA 4EZKA 4KITB 2CM6A 2K4AA 4WWNA 3MJWA 4QJ4B 1W15A 3P2BA 2CJSA 2YRBA 3PS6A 4TV3A 3ZW3A 3IBEA 4QJ5B 4WWOA 4JPSA 4F1SA 3DPDA 2ISDA 5T8IA 3L4CA 4FLHA 4ICWA
chains in the Genus database with same CATH superfamily
4N87A 4YHMH 4WV1B 3EYSH 4LLUB 3BWUF 1JRHI 1DJYA 3BAIA 4OD2A 5E8PB 2AJ3B 5AVWB 3JWOL 5I1JL 1RHHA 2WW8A 3X11B 2C7UB 2E4FA 4F1ZA 1KEML 5MHSD 4PS7A 2Z91B 3VXSA 3DHJA 5AOMA 1SEBA 1MREL 1YEJL 4G8GA 2MH4A 3P77A 4N4YB 3WI9A 1MWOA 2Q3XA 4HJTA 1GGUA 5C0NC 1H9DA 2W65A 4WW1A 1FHNA 3DX9B 2N1KA 1T5WA 4LNRB 5BO1H 1OSZB 3CX2A 4MZIA 4Q7DA 5DMIH 4FJ6A 3GKWL 2XYBA 3VYOA 3QUYD 2HT3D 4NUMA 3PFUA 3HLAA 4OLUL 3HNSL 4HH9B 4WJ5B 1KB3A 4NSKB 3NJGA 3KG5A 3FU5A 5HHVL 3RX7A 4Q74A 2DQHL 3HC0B 2V2XB 1FL5B 4UDUA 3IGFA 2WVVA 4PLNC 3U2IA 3BESR 3LRGA 2OMUA 4UV7L 3CFNA 4WQOA 2VWEC 4XN8A 2YRLA 3X1EA 2LGNA 4U4IA 1K9TA 3PDDA 1N0LB 4NIYE 3BEWA 1HDMA 3BE1L 3ILEA 3RL1A 4ZUVB 2XACC 5ALCH 5KBDA 1K8IB 3QNXA 5E4AA 1LWJA 5L4MA 1KIPA 4QEGA 4IMLA 4XMTA 5CBEB 5GS0H 1WWCA 1X5JA 1F00I 3BVDB 2O61B 4E9SA 2R2BA 4ECNA 2X3BA 3TPKA 4U2ZA 2NX5A 2XXGA 2Z31B 4AVIA 4L3ED 3VWKC 3VFRA 3S88L 4L0ZA 4LEBA 1ZY9A 1G4MA 2JELL 5IV2B 4JDEB 1DDHA 3KM2A 1VPOL 3QUXA 2V9QA 4N26A 3FQ4A 1S5HA 1MCOL 4XP5L 4U1GC 3NJVA 1CCZA 2YA0A 1U8PA 4MAUH 3UOAB 4UU9B 3W2DH 4Q6YA 4ZD3H 1YEWA 3F7VA 1OGAE 1J1PH 4LT7A 2DWSA 4QLRA 4N2NA 3CK0H 3O0LA 4YSRA 1V55B 1HAWA 4GSDL 4WFFE 5HHMB 3UG5A 4YK4C 1P1VA 4P5KA 5B3JF 3TV3L 3F7YB 3PGFL 4L8SA 1KCSH 4LCWB 5IB3A 1HNGA 3L3IB 5F7MC 5IP4A 4J27A 1A6VL 1KFAL 1Q72H 5CAYB 1ES0A 2NYYD 4WUUA 2BP8A 5JIPA 1I8AA 4KWUA 4UBDC 4JRLA 1G5AA 5HHOD 3C8DA 1GZPA 1QOKA 4WI5A 3WLBB 3MLXH 3QG6A 4PRPE 3U0PA 3L3OB 3QRFM 3UTTA 5AVUB 1OT2A 5TPWH 4XRCB 2WLHA 2YEZB 1J05A 3NJMA 1U8CA 4H0IA 1HAUA 1T22A 4DPRA 1U3JA 4A6YB 5E7BA 3D08A 1BGXH 1NL0H 3QEQE 1V3JA 3BP5A 3DV6A 1X4ZA 1JN6A 1MCRA 5EU6B 2QKIC 4NKIL 3AS3A 3CFCH 2DI9A 1JHKL 3WIHH 4OI8A 3NGBB 1MQ8A 3U1SH 4JMNA 4JY5L 2ZAIA 1LILA 5I16B 1MAKA 1Z2KA 3MV7E 4Y2DD 2OXGB 4L1DA 3WFEL 2FT6A 1KTDA 1GYVA 3NP4A 1FLRL 4NGHH 4XBEL 5GGSB 4AQEB 4F8TA 2BHFA 2VXUL 1QFHA 4KV5F 4G8EB 4GSXA 5EIIB 5I1IH 4LAJH 2XZQH 3CQQA 3D39A 3CFQA 4S1QH 1O6VA 5C9JB 4G43B 1CG9B 3TVMC 3GLZA 2DRUA 4HS6A 4L3CB 3VWKA 4ZUSA 2CA4A 4DP5X 1MPAL 1CBJA 4N2MA 5E4EB 3EGSB 5E4IA 2LAAA 1A4BA 4RIRB 5G55A 5AL8A 5L2KD 1L9MA 4AVKA 1F5WA 2VCOA 3ATAA 3HMXH 3ULUF 1M7XA 1HE8A 2C1OA 4JJOA 4TQEL 1YO4A 1N2RB 3GGWB 3LKPB 4B9CA 3EFFA 2V9UA 3CBRA 5HDQH 1DQLL 3EOTL 3ZGIA 2ZSVA 3RZWA 4OY9A 1HTYA 3R7QA 4OLXH 3A24A 1BAWA 4KI5C 1DCEA 1XWVA 2GC7C 2UXFA 5F93C 3GSXB 4NJAH 1EA9C 5LGYA 4D8PA 3C6SA 2X4OA 1OP4A 3EO1B 1MRCH 2EO7A 5DHYA 1HQ4B 3CZEA 4F2EA 3T3PE 4LFHG 1T6BX 4XZUA 1BFOA 5E8DH 4AVJA 1W0VB 1YMMD 3MJWA 4QJ4B 4LOEA 3ARPA 5A7BA 5ADOL 2ZYIA 4JCMA 3PF2A 1UZ6E 2YRBA 5IOPB 3MJ6A 1RK1B 1WFUA 3IFLL 4L48A 1BQLL 4MCYA 4OJDH 4AYBA 3UL4A 3TX4A 2VLME 4WVRA 5LVEA 2XV2A 1CU4L 4Z7VA 4UMSA 2F19H 3BCFA 1FHGA 4XWGH 3L45A 2J1KA 5T3XE 2BHZA 2WBKA 1D9KA 3PWLB 3E9UA 3KEDA 5JORA 1T0PB 4J6IA 1IM9A 2PO6A 2QKIA 2EVIA 2GIYA 3TZVD 3ARFB 1MCHA 2F0CA 2XPZA 4N86A 3U6RA 2GTWA 4YDMA 1VFUA 3B9KB 3O8XA 4ZTPH 8FABB 3AG2B 3MRFB 5I17B 4M29A 2AQQA 2WXOA 4OGXL 4QKTA 3FU8A 2D03H 4AZ8B 1UWEH 4RFOL 1T89C 3IXAA 4DP7X 2K78A 4PJIA 1BJ1H 3Q5OA 3QYMA 2HFEA 3QUMB 4Q8BA 3HKFA 2V17L 4JRXD 5ENWB 1O75A 2OSWA 3IU3B 4KH2A 5GJTH 1IKNC 3V0VA 3MOBH 3TVMA 2EIBA 4KZEL 2AJSH 3ZDYB 3VD2A 1CIDA 1A6AA 1M2VA 3ECVA 2JE8A 3LHAA 4NAMA 5B1AB 4BE6A 5BQDA 3PWNA 4ZNEA 1CDGA 4X7DC 3TN0B 3AADB 1J0ZA 3RURA 4CSSA 3QRGL 4UDTB 5AALA 1P6FA 4OZHF 3BWAB 1PZ5A 3AC0A 1RULL 1E4HA 2BY1A 4ADIA 1L0PA 1EGJH 4FFYA 1XF3B 3W11D 5CJBA 1JTPA 2MKWA 3GHBH 5T5NG 4YWGL 3W39B 4HD5A 1C12A 1GPOL 4ZPVA 3JWNH 4G5ZL 3BZ4B 3LIZL 3TNMB 4UM9A 1NIEA 4PUBH 1G1CA 4R9HA 5CEZD 3RL2B 3HNTL 3RQ3A 7CGTA 1WC7B 5JLZB 2PCPA 1WA1X 4XT1C 3UGXA 5J6SA 1WFOA 2MNJB 2ZXAA 4ZUUB 2GHWB 3MZGB 4KDTC 4I5BB 1P5VB 3D33A 4Z5RA 4J23A 3MUGB 5AKVA 3MVSA 3WBDA 4Q14A 5LJYH 2ED6A 1CS6A 1LL1A 4Q9BA 3EH2A 5IVZA 3QPXL 3LQAC 3DBXB 5FA3B 4Q6IA 5DUML 5BV7C 1S7QB 5EBMA 4K5PA 9PCYA 3SPIA 3GM8A 3VG0L 2OMVB 1S7VB 2IH1A 1GS6X 2IEPA 5FW7A 4S1SL 2GBTA 3G5YA 1DSWA 1WBZA 1AGEA 2Y7QB 3P4OA 3PCYA 3MPCA 4E9TA 4V1DE 4Z9KB 3EYVB 2CIIB 2WXKA 3HPLB 5JW5A 1SGKA 4GW1A 2X6VA 1J5DA 2XETA 5DJ0B 2CDGB 3ZDXB 1CGSL 5MERB 2GJ6B 4MCNA 1GCFA 3WJLA 2H26B 1T89A 1MCDA 4PJ9C 2VDML 1CZ8H 5CUSL 1MEXH 1RZKH 4JO5A 4QHPA 1IM3D 3QNFA 4PRAB 4OSUH 3P54A 4H0GA 4P57B 3VGAB 1IKNA 3E3QE 1I1AC 3OKLA 3VACA 2YWZA 3Q44A 1JERA 3CFTA 2F5AH 5ILTH 4JO2L 4K7PY 4X7CC 3QJOA 2C3VB 1LO2L 2GW5A 3U25A 4BFGA 3D2UB 4YQXH 5TF1L 4JZJB 1XAUA 5ITFA 3IPEA 1G9MH 1TIUA 1AOHA 5A2FA 1CXLA 1W8EA 4IHOB 4H8HA 4Y9CA 2C7FA 3EADA 4OCYL 1A9EA 5H37A 4RAHA 3ECWA 4MS8D 3FTUA 1FH5L 4OV5A 2ALWA 1T4KA 1E7VA 1KLFB 3FUJA 3PUUA 4WU7A 3QXWA 4JPVL 4C8XA 3NPSC 4FFZH 4WEBL 5FYLD 3BPOB 4OD1L 1HH6B 3CZLA 2XQBH 2WP3O 3T4AC 4KDTA 1AKJA 3N06B 1F8TL 1W0WA 4MJ5A 4JPIB 1SVBA 2UZIH 3WY4A 4OJEH 4JM0A 1JXFA 3BKYL 3NACL 1D7FA 1S7SA 2HN7A 4WTQA 5DD1L 5E1IA 2OTPA 3REVB 1CWVA 3HPJA 1XH3B 4XC3H 5IY5B 1IBFA 4QCIB 4BZ1L 5IM7A 1HHHA 4PJEB 4IRZL 3HS0B 4MX7B 5KYXB 4JB9L 5JIHA 4S0TD 2Y6TE 1I1YA 1XCQA 4JG9A 3OBAA 2YA2A 1QASA 1PBYA 1PIFA 1T83C 3I6GA 2ERJC 2PF6A 3KL0A 1TR7A 1OGTB 3MRBA 3DETD 2OI9C 4GINA 1YUKB 5EA0H 1YC7A 2Y69B 4WFHE 4KZDL 3JWDH 4GIAA 4B0MM 3SKJH 4M62H 1CLCA 5HHME 2B5IC 4KROC 4LLQB 1OPGH 2H6UA 4PRHB 3HAEA 4KRPD 4N5UA 1Z66A 3IK2A 2WC7A 4PJ9A 5EFIB 4LCWE 1ZLWH 5CEZL 1GYAA 2R0LH 5E2UH 4E5XB 1QO3B 3MBEC 3WY3A 4IJ3B 4JM2F 4Q2ZA 4PBXA 4TSAH 3RIFF 1F41A 2ITFA 3KCWA 3ULVE 1G7HB 1I1AA 3KGTA 1IKOP 1MFCL 3DSFL 4RISH 4HWEH 3LEYH 4PYHA 5I75C 1B4JH 4NFCA 2GITB 3CFIC 2EIZB 3MCYA 4MA7L 1ZLSL 5DS1A 4L8CB 1DHKA 1QI4A 2CBMA 5GZNC 4N0YL 4PJXB 3AWFA 4HWZB 2R0WL 3IRCA 1DTUA 5C3TA 5BS0B 3WXWL 4ZFQA 1BG9A 5EU6E 1IQDB 3X12A 2I25N 1QLEL 4K9EC 3MR9B 1F58L 2IQ9L 5C8JB 1F11B 3RNKA 4DKAA 1NGXA 1RZ7L 4N85A 3TO4D 1IGIL 1ZXQA 4KVPA 3D69A 1IBDA 1G9HA 2VXTH 2EDJA 3QXAB 5E6ZA 4AIXA 8PAZA 1AZVA 1WH0A 2HJKA 3KXFA 4NN5C 2DWDB 2OSXA 1TVHB 2F58H 1F4YL 3Q2NA 1QR1A 1A2YA 3T4AA 5JZ7D 3UC0H 2CRZA 4TUJB 4A38A 4NRZA 4DKDC 1MHEB 2M26A 3FQUA 4JFSA 3DRQA 3NA4A 2DQEL 4ONGL 2JWYA 1OM9A 3FBQA 4TLTA 2VLJB 4UQIM 1JWMB 4JK0D 1O9VA 3ARSA 2DM4A 2QHRH 5SWSA 5J12B 5EWIL 1U4FA 1XL4A 3H0TB 4X7TB 2CH8A 2CO7B 2DQDL 5F71A 3DK0A 3I02B 4OZ4A 5DI8A 5IHLB 2EP6A 1IQWL 4KVNL 4PVNA 4JO4H 3ZT6A 4JM4H 4NUPA 3OQ3B 3DXAB 4HSCX 3VFUA 2EUZA 5KVFL 3F2LA 3FQWB 2J20A 5IEKB 1T83A 2IBZX 4OD3H 3KE0A 1IAMA 2GJZB 5C0AE 3MRKA 1IBHA 4TQHA 4QJ3B 2FIKB 3D25B 5K1JA 3U4BL 3V5KA 4CADA 2G60L 2DMHA 2V7NA 4B3VA 1J5OL 1KT2B 4GT0A 4JL2A 4U6VH 4Z78A 3UZVA 4LIQH 2WM0A 3NIGB 3KPLA 3BVNA 2FEJA 4GBXB 2IVFC 4KK8D 1BYOA 1PS3A 2X4TB 4U2YA 5FKAA 5FYLL 3VXQA 1DBMH 2O5NA 3MBEA 5IIEA 1GVIA 3MRDA 4JO3L 2EDRA 5J9PB 4BK8A 5CEYB 2G9KA 3KL3A 3E7JA 3QQ9D 2VE6A 3TBWA 2XTJD 4HPYH 5JTWA 3S8FB 4FTVA 1C5DB 5DD6B 4Q9RH 1NCHA 1UG9A 1FUNA 4P5TC 4X2UA 3AJ7A 4KAQH 1CTOA 3BUDA 2BLFA 2F53B 5GZNA 3GZPA 3IAQA 5IK3B 4GXFA 5DQDH 2W07A 5GGVH 1UA7A 1Z9MA 5E1HB 4BKLB 2H47C 4WFGD 3NFSH 3U2SA 2WLYA 5AB1A 5FKPA 1MH5A 4OGAD 4ZUTB 3T0EB 6TAAA 1JWSA 2ICEC 3LV3A 1NCWL 4GP4B 4ZNCD 4MWFB 4BELD 5I6KA 1VAHA 4TNVF 5HDOA 2BW4A 3DJZA 2OMZB 3P11L 3VXPA 2W95A 1JGUL 4O2CA 1OSPL 4NNPH 3CN2A 2R2HB 1CMOA 3A5VA 3MCLH 3EJYD 4UOJA 5DD0H 3BD4A 4HAKA 4EO5A 3KBFA 5KYWB 4IU3B 5D6CA 3DOIA 3X3FH 3TO2B 1SPDA 2EEDA 3BGFB 1BOGB 3NIFE 4JFEB 5IQNA 4ZFZA 2QHLA 4NHUA 2EXWD 5JXEC 5DJYA 4IBVA 4C56A 1TXKA 4OCXH 4G9DA 4GW4A 2AI0L 1A21A 4GO9A 4K9JA 1ROCA 3ZDYE 4JHZA 2E8ZA 3HZKA 3LH2H 2XN2A 3OD3A 4IU2A 1R5VA 1KXVA 4X8XA 3DI2B 5CNHA 1A1OA 1P2CA 1PW3A 2YN3A 5B4MD 3VWJC 5HXMA 2NW2B 5HGAA 4HIIB 1G7JB 4DWHA 5DJ8B 1WE5A 1P7QB 2XVKA 4JVPA 4LSSL 2HVBA 4PB0L 1MHPH 2WYIA 3WIFA 4NM8L 3UTOA 4U0RC 1NKGA 3US0A 2DTSA 5LBVA 3LNFA 4NN6C 7FABL 3ABKB 1XSOA 1AXSA 1BBJA 1JF5A 4U1SA 4CC0A 3QUZD 2Y1VA 1FO0B 1UWXK 1YEHH 5TQ2L 1KC5H 5AW6B 5C2UB 2O6DA 2NXYC 2RJMA 3GRWL 4TQPA 4KX7A 5EEXA 3SYCA 4Z7WB 1U9KA 3OG6B 1TJMA 5EOQH 2FAUA 1MLBB 4BD4A 2VJ8A 3Q3GB 2IBBA 1TJIH 4H8QA 1TYRA 2YUWA 1XL6A 2RD0A 3RUGF 1G4RA 4BSWA 5FB8A 4BEIA 3RNQB 2AQ1A 3W1ZA 4PPTA 1FNEB 2CR6A 1RZGA 2Q9OA 3L3DA 5JDSA 2WANA 4U3CA 4H40A 5DUBA 3GTNA 4JO1H 4JFQB 1U58A 2R9HD 2HTLD 2N3JA 4NZRH 1D2PA 4ZQKA 4C54A 4XTRD 2QQLH 4X6CF 3TXAA 2Y22A 4NUQA 3BUYA 1GHFH 4DK5A 5BOJA 3MN8A 1IUZA 1AD9B 1T1YA 5AB0A 3O4OC 4QHKI 4N1CA 1E8YA 3HR6A 3V9CA 1FJ1B 2ICEA 1Q1JL 3TNNA 5AW3B 2H1PL 2Z35A 2G2RB 2M83A 4HHAB 5D71L 3QJTB 2IWEA 1H8NA 3HR5A 2W38A 4N8CL 5LN4A 1C5CL 3ZDXE 4X9GA 5I1CH 5F7EL 2GJ6E 1NEZB 3OKNA 5CP3A 2EDWA 4OZHA 5DVOA 4FULA 4FXKB 2ZYHA 4JG1L 1UM5H 2OK0H 4PWGA 3KR3H 4C55A 2APXA 1LDPL 5INDA 5DJCB 1JD9A 1PFCA 3ZT5A 2ZX8A 4YHIA 5ERWB 2ENJA 5JXEA 1R5IA 4ELMB 4OTXH 3SBQA 5I9QC 3FMGH 2YQBA 2VC2H 2PPEA 4ZTEA 4PGDA 3NJIA 1T7VA 2V5MA 4G1MA 2XOTA 1RZFH 3ZPDA 3VWJA 5I73C 2AK1L 3LXAA 4LLAA 1FGVL 1RHHB 2WCSA 4AYSA 3SEPA 3JV6A 3EOAA 3LXUX 1B2WH 1J0HA 5AZEH 3VXSB 1MCWW 3U7YH 1RURH 1SEBB 2P1YA 2NY6B 4G8GB 3S48A 4CJ0A 3P77B 3RU8H 4JCLA 1BF5A 2FNWA 4RMUA 1JOIA 5AAMC 4WW1B 1HCYA 2GC4C 5C08D 4M5YH 1QYGH 1PG7X 3X14A 5E99H 4ZMNA 4ZW6A 3M1CA 3WY1A 3AT0A 3IDNA 3OLGA 2DJMA 3EJTA 4L5FE 4BQCA 1NAKH 3GS4A 4IW4C 4F7EA 1FVEA 4BZ2H 3OJMB 3QI9C 4BKTC 4I9WE 1I8IA 4U6YA 5F7DB 4OGYL 1CDCA 1TTBA 1BJ1J 1R3IH 2EYRB 2QQNH 2ZUSA 2YAPA 4QMEA 2WVVB 4UDUB 3VSQA 4CJ1A 2OMUB 5IB1A 5I0VA 2C4FU 3BEWB 1HDMB 1S7RA 4PJEE 2XQYA 3TBTA 3RL1B 2CUHA 1A5FL 3QAZC 2WCGA 4JM2C 1KIPB 1FAIL 4IMLB 5SX4H 1HZHH 4DUWA 1X5GA 1M4KA 5JHLH 1BJMA 2X2YA 3ZTEA 3MLVH 5BUPA 5LNDA 3BSHA 4W6YB 3V4PA 4MXQC 2KDYA 2R2BB 4FD0A 2X6UA 4PD4K 1FV1B 4RFNC 4GXVH 2NX5B 3NOIA 3OGCA 1VFBA 3DVGA 3VFRB 3NFNA 4XNZB 4PSPA 1HINL 1DDHB 2YD1A 3QUXB 1EJ6A 1I3RA 1S5HB 3LVEA 4IDLA 5TH2B 3KPSD 4FHKA 4ZFOA 3O6FD 3RGHA 2JB6A 4YSSA 4M7JL 1U8PB 4BWWA 5DHEA 2JCWA 3QPKA 1MDAA 4HS8L 3STZA 4AX3A 1EAOA 1T6WA 4K3HA 3F7VB 3IXTA 1G0YR 1HIMH 1E9QA 1TZHA 2X10A 3WEAA 1DJWA 5FHAL 3I75A 2GPZA 4ZRGA 2AZAA 2IADA 1J8HD 1RUPH 3KWWB 3FQTA 2EVGA 4P5KB 5K1VA 3BGAA 3RY6A 3ZTDC 3HW7A 4L0YA 3TASA 1ZANL 4K73A 5ANME 4DW2H 3R8QA 2JTYA 5IB3B 3J07A 2P5WE 4WU5A 5E8OA 1PLCA 3PWPD 3UH8A 1ES0B 2OA9A 5A2KH 4WUUB 2BP8B 5EF1A 2P7TA 4ODWA 5DC4B 4K2UH 2CHZA 1SF5A 2H3NA 2AQ3A 1KLUA 2DIEA 3WN6A 3TJHD 5AAMA 3QG6B 3U0PB 1RAMA 3UTTB 4R0LC 2F8OA 4MB3A 3V5DA 3KLSA 1J05B 3FHQA 1U8CB 1D6VH 4XODA 1T22B 2BRRH 4LOUC 1RUAH 3L9RA 4B7LA 4LCVA 3RWGA 1R3KB 1U8LA 5CZXD 3BP5B 3DV6B 1AZNA 1JN6B 1IFRA 3QI9A 1UOVA 2WWKO 3EBAA 4UWQB 3T0VA 2OMBA 3JUZA 4G1EA 1MNUL 5D7JC 3U4KA 5MEOA 3QB7C 4IGBC 2VLJE 2IBZY 2QGEA 2UX6A 4JN2A 1DBBH 3ZQXA 2HMID 1IE5A 5AZ2H 1IJNA 1G6RL 1N0XH 4ANVA 4H1LA 1KTDB 3IMTA 2GYSA 1SYVA 3TF7C 4HJJH 2HFGL 5EN3A 2HX9A 2EE6A 2WOYA 4JM2A 4I1RA 2IDQA 3OJVC 4D0CB 2E9WA 3DXAE 3ARDD 2AGJH 3FT3A 5HP5A 4KDVA 5I19H 1QATA 4F3FB 4LEEA 4RA0C 1DBAL 1EVTC 4MDIA 3D39B 4WJKB 3KYKH 1CQYA 4GIOA 2K70A 3AWEA 2R69L 2XZCL 1XH0A 4P07A 4HS6B 2VL4A 3VWKB 4ZUSB 4R4ND 3ZUNC 1OTSD 1MCWM 3FHEA 5FUOL 1N3NB 4GAAA 3NIGE 1SY6H 1DQIA 1NBVL 4C4BA 2QDVA 3C6EA 3B2UD 5D4HA 4U1GB 3B34A 1U3HA 1FFOA 3O81A 1CF1A 2YAQA 2C1OB 4M6NL 1O7SA 1E4XL 4PAZA 1UJTA 4GRWB 3QIWD 3EFFB 2KI6A 3GTTA 1W72H 2HT2C 2ZSVB 4JFYA 2NZ1A 4JFFA 2F53E 5GRJL 2BFGA 4HQQH 4OCSL 1P84K 3E8UH 2WB1A 4YK4B 2VQTA 4D8PB 3F65A 2X4OB 1KPUA 5JOPE 3UIZA 1UM6H 5JQIB 3I9GH 4FKEA 5BV7H 2ZG3A 3QFJD 5DHYB 3RKPA 3F62A 4YFDB 5IB5A 4XZUB 1BFOB 2LHAA 2XRAL 3I50L 5F7YC 3KPOA 1YYCA 2EVHA 3HZMA 2VRKA 5KSBF 1HE7A 3PV7A 3Q6GL 4MCYB 4YBLC 3U36B 1TO4A 3BDYL 2CNYA 2DY2A 3SGEI 1EAQA 3K0WA 3HIZA 2WXFA 2WD0A 3ETTA 2FATL 3HAEH 1IIIA 4B27A 2HRPL 3HI5L 4JFEE 3U83A 1EFXD 3CX5K 4M7LH 5JORB 4LVHB 1GSKA 4FMFA 2PO6B 2QKIB 1IM9B 3D34A 2EO1A 1NH6A 1QA9A 4J3OC 4PRDA 5D7JA 3QDGD 5K93A 5CGMA 4HCFA 3X1BA 1TKWA 4IGBA 3U6RB 2GTWB 1N26A 2P48B 3FAWA 3KPRA 3O9WC 4NZJA 4XN1A 1Z3GL 3LPGA 4NO2A 4F24A 1N12A 5KVEL 1F6FB 3D2TA 4CC1A 1NBZA 2XSKA 1II4E 1JPTL 5KZCB 3RGVD 3B5HA 5J6HA 3IXAB 3FRUA 3V6OA 4Z0BH 3VNYA 4KQ4H 2HFEB 4MDRA 4IMKC 3MLRL 3N0PB 4ZMWA 3U0WL 3N85L 5C0BA 3SPJA 2GBVA 2XICA 4GAGL 3RB5A 4FFVC 1BWMA 2R15A 3WFDH 3APDA 1DJIA 3BAEL 3V0VB 1EJOL 3APFA 3TVMB 1CD1A 3SDCD 3HE6D 3R8BB 3PRZA 4CSZA 1A6AB 1M2VB 3EO0B 1PZDA 3V8OA 1REIA 3BN9D 3HFML 3OMIB 3PWNB 2WQSA 4PIRF 3OKYA 3D5OF 4N0UA 2L3BA 1PZ2A 1PZ5B 4P9HH 2FX7L 3N9GL 3WIIH 3SY0A 3MFGB 1RVFL 3L7FB 4ZMAT 4NIKB 1ACYL 2LTQC 1C12B 3BD3A 4FL4C 2H8PA 3C2AL 3QXUA 4ZPVB 5HDBB 2XNAA 2A4CA 3FS9A 2DQGL 3P4NA 4UM9B 3BP6A 2EH7L 1FVCA 2HLEB 2W0PA 3ELAT 4C58B 5HPOA 4KXBA 2PCPB 1NMCC 4N25A 2QELA 3A6CH 4LSPL 3D05A 3LMJL 1FZMA 3K46A 4XVOA 4OLEA 4Z5RB 4G83A 4JHUA 4K5NA 5DDHA 2ICWI 3CXDL 4F2MA 1DQDL 3LEVL 2ED8A 1A4KA 4Z3TA 1M05A 3OKDA 2OL3L 4KQ3L 3W5MA 4NUJA 4OKDA 1D5XA 1PSKL 1AQKL 1Q1PA 2P28B 4P23D 4K3GA 1AG0A 3JTSB 4WUKH 4JUTA 5IVZB 3PNRB 5C07D 1PAZA 2I7OA 2B08A 4Q6IB 2A9DA 4ABQA 5EBMB 4TXVB 4YDKL 4RWHA 1CR9H 2C3XA 3AQDA 2IH1B 4FX5A 3OZ9L 1RLBA 1TTUA 2XTSA 3G5YB 1WBZB 3P4OB 1AGEB 3A4EA 4K7FA 1UC6A 4AEIH 3F7LA 3QJHA 5C0FA 3AROA 5E4OA 5JW5B 4GW1B 4RFEA 3T3MF 1KTCA 1PPIA 3EH3B 3K1KC 4UIMA 5EEWA 2A9ML 1HEZA 3V4VL 1AZCA 4DGWC 4EBQH 2NMSA 2G2NA 4K94L 4YDLC 5KSAC 3QORD 1GGCL 2WKGA 4J6RL 4AIEA 5SV3A 2FQGA 4K4KA 4CVUA 2EVFA 3D30A 3FL7A 3H42L 4IMKA 5T3ZH 3VXSE 3RUGA 4XP1H 4DN3H 4O9HH 2OZ4A 2XYCA 4Z7QB 3AG4B 2X1WL 1S5IH 4G8GE 2IPTL 4HJIA 4K9EH 1AQ8A 4GJTB 3FO0L 2VKWA 2LVCA 4N2BA 3WKPA 1RPQA 4XB8A 1N5AA 3VFSA 1S7WA 4X6CA 4PGZA 1H6TA 4KKBC 3ULVH 4Y2DA 5GGQH 3L16A 2YBGA 1F6LL 4Z77A 2ZUTA 5ITFB 1FNGA 4I4WA 5C71A 2CXGA 2W92A 4N1HB 4U1HA 3RILA 1Q9OA 3HCVA 1A9EB 2DQMA 4KGLA 1FYTD 1BQKA 3B56A 2GY7B 4OV5B 3GK8H 1T4KB 4GKOA 4R4FL 2ZOUA 4WU7B 2DQCL 2B16A 3A4AA 3IJHA 3P4MB 4LHUG 3B7TA 4X0KA 2B9AA 3NSYA 5J1SC 3GSWA 1OGAD 1BVKA 3ILQD 2QL1A 3AREC 5L2KA 1AKJB 1NAML 1W0WB 3EHBD 4HFWA 1WQVT 3B9VA 1JDDA 1W72B 3MUJA 1RJLA 4B0MB 5A16A 5F0LB 4A2MA 5DHVH 1N8ZA 5M95B 3GIVA 2NX5E 1S7SB 3QW9A 2HN7B 4PJAF 1K5WA 5F9JA 4PWFA 3HPJB 4HWBL 4FQIH 4I0PC 3SYQA 1B3IA 5AVZB 4UILL 1HHHB 4QWWC 5BV7B 1NCBL 3X13A 2ZCHH 1LP9A 1I1YB 1XCQB 1XFPA 2BCMA 4PRPD 3MACH 4HK3N 3IKCB 3CD4A 3BKJH 4UQ3A 4CW1A 3T0BA 1S46A 3VTTA 3G08A 2FO8A 1F6AA 3HC4L 3I6GB 2TAAA 3P2DA 3MRBB 5L7XL 1YMMA 4JJHA 1MJ7H 3MGOA 4K5LA 3QEQD 4JKWA 3P73A 1A7OL 4TSCL 1PTZA 2WBWB 4XPHL 4CVWA 1GY1A 1BEYL 4HX1A 4WY7L 4UT9A 5IESL 2GJJA 5JW3L 1QW9A 2FEDD 5KSAA 3WKNA 4JQIH 3HAEB 3PAUA 2XA8H 1V7MH 2CMRH 1NCCH 3ESMA 4X5LA 1JHLL 4PJ9B 2MPVA 4FQ1L 3DBSA 2YK1H 4XX5A 2IQAA 3FCSA 3QNZA 1Q0YH 4CAGA 4Q2ZB 4HCRH 1UACH 4WUUE 3OPZH 3GS7A 4U1NA 1I1AB 1HNYA 1OAQL 2E9BA 3GINA 4GG6E 2EUVA 4EOWH 1YY8A 5T33H 1LHZA 2IDTA 4IDJH 4XVSH 3UTTE 3BUQA 3IU4L 1UT1A 1MIMH 2H3XC 3TBYB 1Z5LA 3TM6A 15C8H 5CP3H 2J43A 3QK0A 3Q8CA 5T1DL 1TENA 1ET5A 4JFPA 1GYWA 4Z6AT 1OGSA 3UTSA 4BQBA 3X12B 1OY3B 3LZNA 4J3BA 3HNVL 4ZO8A 3RNKB 1HSAA 1NGXB 3IPFA 3P1VA 3QR0A 5JYMA 1IEBA 3D69B 2VWEE 3CFEA 4JEGB 2JH2A 4IK7A 1EEYA 2HJKB 3KXFB 3NPSB 4XXWA 3DX7A 4IRZA 4XO5A 3VA2C 2VZUA 4OCWH 5AYUH 4ISVA 1A2YB 1Q9KA 4ZW8A 5IT2H 1BG1A 3AREA 4OF5A 3T4AB 3COOA 1BHGA 2EDTA 3CMOL 3D85D 4NRZB 3MODH 1VZHA 3BWSA 4MJJA 3D39E 4KHTH 1V5JA 2YR3A 3JYBA 2OULB 4N5EC 3TWCH 3IJEA 1KWKA 2RHEA 1H8LA 1SFDA 2FIRT 3NAAL 4IIZA 1CICD 4L3AA 2EYSA 2AABL 1UCTA 4X7SH 5SWSB 1HS6A 4ZS7L 3GBDA 5IVXA 4OFDA 1KJ2A 5IFAH 4OZ4B 5DI8B 1SHMA 2XV3A 5CLZA 3VH8B 4JRYD 2AKRB 1MI5D 3HMWH 4DVBA 1HCZA 3WCYA 3VFUB 2JJSA 8CGTA 4GRWE 1UYWL 4G7YL 1XR9A 3SB3A 2ERJB 2BNUA 2VXQL 4HT1H 5T3XD 3FUDA 4YHZL 2OI9B 2QGDA 5GSRA 5ALBL 2WSPA 3T2NH 3I9AA 2FTAA 3MLYL 2R0ZL 2B5IB 3FQ2A 4KROB 3V5KB 2PLTA 2V7NB 4CADB 4XCCH 1U2YA 4ZTOL 1KGCE 4Y19A 4GG8A 4HF5L 1OP5K 4R90L 4Z78B 3UZVB 2ROYA 3HUJF 1DBJL 3FU3A 3BLKA 3BVNB 3KPLB 1VFAA 3LOWA 2VMEA 4DZ8A 4Z3IA 2CK0L 5FKAB 3QQ3A 5DVLA 2EDXA 4YVNA 1A9VA 3MBEB 5IIEB 3MRDB 1ZPUA 3F84A 4NQXA 1OAUL 4UANA 4A04A 1XSIA 1SJVA 4P2RE 1CD9B 2VE6B 2WJ5A 3TBWB 2J12B 5FYKH 4ZJ9A 4FTVB 1JFQH 5DJDB 5I75B 1CGYA 1OLLA 1XCTA 3NCMA 3NJLA 4GKZA 4OM0L 1JAEA 1C9SA 1A7NH 4JR9H 4Z7VE 4H88H 1N70A 1IV8A 4F57H 2IH3A 3BVWA 2W07B 2B0SL 4RETB 2NCMA 3ZO9A 3IFNH 4Z3HA 2Q2EB 1WEJL 3QFGA 1TO5A 4R5XA 4DSYA 3U2SB 2PABA 2Y3NA 1M53A 3KYMA 2QQKL 3GSQA 4UT7H 5FKPB 4KRMB 4LPYA 5HPMA 2MQGA 1MH5B 4FRWA 4G6JH 1BZ7A 5LBSH 1IM3A 5CU9A 4GS7C 1NWPA 1JWSB 3NSDA 2DM3A 4JKMA 4OLWL 1KYAA 2WUBL 5D5MF 3NCWA 2MCPH 3NTCH 4A7TA 2IIJA 3EUUA 2C9XA 4NN5B 4O2CB 4LSVL 1OAYL 4HIJA 3U4AA 3VXPB 4DGVL 5DRZA 2DWEA 3DOHA 3A22A 4PJDA 1S7TA 1KB5A 3V7AG 5D6CB 4PJIE 3I2CL 4RZKA 2WUCH 3KCPA 3SJVA 4OF3A 4CBPA 4ZFZB 4CMHC 5GISL 2QGCA 2Y36H 4NHUB 5AZUA 5MI0C 5DJYB 2QSCH 5AW7B 1LWRA 4C56B 2X2IA 4G9DB 4GW4B 3WTVA 2DQJL 4P0DA 3TH2T 2C4FT 4A67A 1WCBA 3SGKC 1XZWA 3GJFA 4OBRA 1JK8A 2NUPA 3HZKB 4IU2B 1R5VB 3P9WB 5JOEA 5JUEH 3GC3A 4ZNEE 1PZBA 5E1GA 5AW9B 4DK6A 1A1OB 1P2CB 1SFHA 1ZV5A 1RUQH 5HGAB 2Y25A 1RUKH 4YE0A 1NCIA 1M1SA 1MRDL 2CM6A 3WIFB 3GMLA 1DVXA 4OFKA 3EJPA 1U8KA 5KSBA 5C7XL 4LSUL 1AXSB 5HDBE 2NY0D 5JPMC 1BBJB 4U1SB 1AGDB 4IQHA 4TF4A 1OALA 4KI5E 4NO3B 4AT6A 2YD6A 4F8LA 3AB0C 4NFBA 3DJSA 3RZCC 1DJXA 3T8VA 3BZDA 4HPHA 4V1DD 4B5EA 2WXPA 1SXCA 1N8OE 3S3SA 1OZTG 2E76C 1AANA 3SDYL 3E9TA 3WIAA 2J73A 2BW5A 2IOIA 3ZQWA 4Z23A 2X87A 5FOJA 4DPCX 3AS2A 4W9DC 4BSWB 1A4CA 5FB8B 4P5TB 1RZGB 3L3DB 3NZ8B 4FLRA 5FM4A 4ZPTA 4X4YA 5JDSB 4DGYH 4QXVA 2VDNH 4I1NB 3SYAA 3IRPX 1U58B 2PWGA 4ZQKB 5EOCH 3S2AA 3R06A 3WDHA 4AQZA 4OBSA 4FABL 1ZGLA 2ARJQ 3QCUH 1LEGB 4CMMA 3QSKB 1T1YB 1J0JA 1HZLA 2F7OA 3KPPA 1WZ1L 2D4FA 3N5AA 2ICEB 4P46C 4BCZA 3TNNB 5DD5L 1AY1L 2D7NA 2Z35B 5T3XL 5E08H 1E2ZA 3P69A 3LN4A 4E9WA 2BIHA 4HS3A 3HR5B 2RCSH 3V0WL 4GAFB 3SQBA 3BFQG 5I8OH 3NEEA 2HCZX 4OZHB 5C0GA 1ZDQA 3CFDA 4O5LH 4X4ZA 1K6QL 2VDKB 5EZOH 1T3FA 2QDWA 2P26A 3L7EB 1A1MA 4YX2L 5INDB 1EWHA 4Z76A 4Z7QE 4RMBA 1ZGLM 1WAAF 1R5IB 2BSTA 1A0QH 3PAZA 4PJ7E 4NPKA 3V0HA 3VCLA 4G3YH 3SGKA 1ETB1 3KD4A 3Q0HA 3VXNB 4PGDB 2YUZA 5LLIC 4G1MB 1YCSA 1QQDA 1R75A 5DZAA 1DUZA 3VWJB 3S5LA 2OBGA 4KMLB 2DMCA 3JV6B 3EOAB 2Z31D 1XGRA 4P49A 4U0RB 3ME0A 2ID5A 1E6JL 1PD6A 3K2UL 5CR1A 4HFUL 4NN6B 1QWHA 4UZSA 1CYXA 4Q97A 4AL8H 5JPMA 4N8VA 3CSTA 4O02A 2I69A 4NUGH 1PGRB 3BHBA 3IN0A 4NCC1 4RVBA 3RZCA 3X14B 4Z3EA 2EUXA 1IRAY 1RK0A 1ZVSA 2NXYB 4NPYA 4ACTA 4AVHA 5TE4L 5K33A 5KTEH 4PB9L 3IDNB 2EDOA 4P2AA 4WFHD 3UG4A 5KWYC 5I6LA 3IVKB 3TT1L 4F7EB 3IGLA 1FVEB 5HHMD 4U6XA 2O6EA 4MA8H 3V0GA 1OO2A 2Z64C 1I8IB 4U6YB 1H3UA 4WENB 4LARH 2QADD 5L88H 1N67A 4NWUH 3EF7A 4N24A 1TCMA 2WTPA 3MNZB 4K55A 5IB1B 3NSXA 4S11A 1S7RB 3TBTB 1BV8A 3H1ZA 3ATDA 3NESA 4LLYA 3NJFA 4KMQA 4LK4A 4UT6L 2ED9A 1JRHH 4XP4L 5D7SH 1KN4L 2OX5A 3O4OB 1KYUA 4IYKA 4KVCL 2ZUUA 3Q13A 1L5GA 2A9NL 4HXAL 3V4PB 2QTEA 3SE3C 1B0RA 1FA4A 3WLWC 1SUHA 5EU6D 1NCGA 5I1EL 3KVQA 1YDPA 3DI3B 2R1WA 3OGCB 2WVTA 1VFBB 3DVGB 3K2IA 3NFNB 3NDZE 1ZKAA 1KDIA 2AJVH 3UO1H 3GBNH 1GGIH 1YNLL 2R29L 4Q4IA 3W57A 4ZK8A 4L0PB 1I3RB 4RMWA 3AM8C 4ZFOB 4AYGA 2JB6B 3STZB 4HU2A 1JNJA 5I9QB 2DQFA 3IXTB 1TZHB 1E9QB 4LGRB 3I75B 1A02N 3QZBA 4JY6A 2IADB 4NQDA 5I73B 1EZLA 2C3WA 3FQTB 3WO4C 4Z3FA 2IFFH 2YAOA 1JYWA 1A6UL 4PS4L 5I1DA 5EU3A 1QEWA 3QZMA 1J7VR 2UWEF 2R2CA 5DGQA 1H6FA 3DA0A 2N0KA 4WU5B 5E8OB 4IS6A 2K8MA 4J3OH 4MNQD 4PJAA 5LDSA 3RP1A 3FUEA 3G6DH 2P7TB 4ODWB 2Q3AA 3FB7A 5CZVH 2H3NB 2PWHA 4MMXC 2OJ1A 1PG7H 1YEDA 3KXFE 1SJXA 1FNSH 2E5EA 2JXMA 3D1MC 5IF0A 3GI9H 1QHOA 4X5RA 3LZLA 3CSFA 1QUPA 1HKFA 4E0RA 2FQEA 4ALAH 4ETQB 5EF3A 3RWGB 1U8LB 1K72A 2IXQA 3E6FA 4PWEA 6CGTA 2AEQL 1BAGA 1M71A 3QI9B 5G5DA 4NRYB 4HJUA 5C0RL 4FQLL 5KW9L 1EEZA 1WZKA 5MEOB 3CVIH 3B4NA 2ZCZA 3MRCA 4Y89A 4YXKH 2DLFL 4W9GC 1AGBA 1FL6A 1OTUC 4JPSA 3BAJA 5EBWA 5SWSE 3MROA 3OAYK 4JN2B 4RMSA 3TJEH 5EHFA 4DIXA 4JDVA 5B3JE 5D7KE 3VXUA 5HYSA 3CVBA 5LHDA 1UFUA 4H1LB 2XZZA 5DURB 5TK2A 1IC5H 1SYVB 4N2EA 1GMIA 2W5PA 3QAZB 5EF2A 1UEMA 1U21A 4JM2B 3M1OA 3FT3B 5ICXA 1MCEA 1TU2A 2NSQA 4MDIB 2APTA 4H8PA 2A38A 4HYTB 5AQ0A 2ZKWA 1KCBA 3PJSA 3T2OA 4RFNB 3CFBA 1UKTA 1RFDL 3MC0A 2AXHA 4JZOA 2R39A 1R34A 2C3HA 2ZWYA 4A68A 2VLKA 1F90H 2B4CL 3B9KD 3PLYA 3LNGA 5E51A 1DFBL 2J5WA 4S2SA 4JG5A 2B3RA 1G7PA 1FFOB 1U3HB 1TLMA 1FDLL 3FQYA 3FSOA 1AIFA 4X6BA 7PCYA 3FT2B 1AXTH 4HEPG 2CZNA 3UERA 2NY1C 2AW2A 4FTVE 4X8CA 5IB2A 3M8OH 3BRFA 2EEBA 2YS4A 2JB5H 5HYJA 2JV6A 4JFYB 4JFFB 1HJCA 4ABUA 4KV5E 2DMGA 3ZKNC 5HGDA 2Y24A 1E6OL 3KJ4B 1QNZH 1KPUB 2O5YH 3RWDA 5C0IA 1PCXA 2WZPD 1YYML 2E8YA 4TUKL 1BM3H 1VEPA 5IB5B 1JZ6A 2LLNA 2RGSA 1WG3A 1NDGA 3TN0D 5K9JL 2CUAA 3FHAA 4M6ML 1OP9A 3KPOB 5DMJB 2A77L 3A67H 3HZMB 3MOQA 3U6XS 4A6YL 5F0JB 2FGWH 3IGKA 3FTZA 4WNJA 3S35X 1G6RA 4R0LB 4MJ2A 3QZLA 4IRSC 3ULUE 4B50A 2NR6D 1LEKA 3SQOL 2H45A 2JKIS 2G0KA 2AJYH 5E03A 1MCLA 1VADA 4RGOL 3V4LA 3A21A 4KK9D 1HYSD 1QA9B 4PRDB 2KPWA 3QC5X 1CFVL 2O6PA 5D7JB 1GGTA 4C56E 5HVWA 1TKWB 2IALA 3CVHH 3ZDZB 4IGBB 4APQC 3AFLA 4K3EH 5FYJH 1Y18A 3NZUA 1F4WL 1XGYL 3KPRB 4HJ0D 3HG2A 4GFXA 4NO2B 3W0WA 5A2IH 3HUJA 2FUTA 4L1TA 3L8QA 1UXSA 1NBZB 3OL2A 1T03L 3ZE1B 3KJ6L 4NQCA 4PWHA 1ZA3A 2PYED 1SJEA 5J6HB 5HVHC 3FRUB 4PJ5D 2R4RL 2JKJA 3OKKA 5C0BB 5DZJA 1MFMA 3GO1H 4FMVA 5J4MA 4RLDA 2A1WH 3ZBMA 4TTDC 2PYFB 1INQA 1CD1B 3AS1A 2ZNXA 3NMEA 3B37A 4HIEB 5HI3C 3OAUL 1L9SA 2DQTL 2XWZA 3WTUA 2F5BL 2H6PA 1H3PH 2YJQA 1LQSR 1NGQL 3NJJA 4RRPM 1AC0A 2Q2LA 5GGTH 1DVQA 1QBLL 2Q8AH 4LL1A 1A7PL 3EJRA 4AYFA 2IC2A 3WV0A 2NQCA 2WKLA 3TEWA 5IHUL 2F18A 3DC0A 3L4VA 3WHE1 3SY0B 3OX8A 3M45A 4TVPE 3GXFA 4JX0A 5TGBA 5D5MA 2WXIA 2DLHA 3CHQA 4G5AA 4LE8A 1DBKH 1EHKB 2H8PB 4KTYA 4D9RE 3RJDA 5CKAA 3FF7A 2OJZH 2XNAB 1PX3A 3KAAA 3P4NB 5A2JH 3BP6B 1FVCB 1NLDL 1OZUA 1MW1A 2V9TA 1VZIA 1KJ2H 2D7QA 2CCWA 4YHLL 5JHBA 3BISA 4KY1H 4BK4A 5ESVA 4M9OA 3DX2A 3O6KH 3V6ZA 1C16B 1RSYA 3KPSA 1FZMB 2LLLA 3O6FA 1ESOA 2VUOA 5C0DA 1JBJA 3NABH 5DDHB 4F2MB 4HJGA 4JZNA 4YBLB 4PGJA 1A4KB 1M05B 3OKDB 4XMZA 4NUJB 5FGRA 1BLIA 1D5XB 4OZHE 4ZMXA 2WQXA 1OCWL 3AMKA 4LOVA 4YDIL 1J8HA 1XF1A 3FNKA 3II1A 1T4WA 4XMPL 2EE2A 3NQKA 4L4VA 1TSRA 1SVZA 1OIOA 5T5FA 5F6IC 1QPKA 3VX1A 3MRNA 4PJ8C 4NOBA 3FPYA 5IFJA 1JF6A 5DMIL 4K7FB 3QJHB 3LZOA 3ARZA 5C0FB 3O9WB 4L18A 1TDQA 3FO2A 2ZE0A 3GXIA 4RFEB 4WHTA 4UIMB 3QUGA 1HEZB 4LF3A 3F8UB 2I60H 3QUML 1TQTA 4XN9A 1SXZA 1WGOA 3H9HA 3O2DH 4P99A 4S1RL 1U6AL 4D0DA 2EZ0C 1AXIB 1P4UA 1HK6A 2AV1A 3QAQA 4NQQA 3PP3H 2QPEB 1FF5A 3N1QC 4OU3A 1GZHC 3WDIA 5DRXA 3RUGB 4DJMA 4GB9A 4JNXA 2KZ1B 5KVDE 4J3TA 3L3GA 4EDWH 1XF4A 2NY5L 1QSEA 3L4WA 1F4XL 5I28A 4H2CA 2X2JA 4XPAL 1JPGA 1N5AB 4KK6D 3VFSB 4ES9A 1S7WB 4MZRA 4A2FA 4X6CB 2YGNA 4Y2DB 3W38A 1BQUA 2FD6H 1EPFA 1KELL 4Y4KD 1VGEH 4DO6A 3I74A 4Z77B 1DQTA 3FAXA 4UOQA 1FNGB 1ORQA 4TNWF 2YPKA 4I4WB 4WI6A 4G6AD 2XA3A 3A47A 4PRHD 5AVYB 4G2AA 4U1HB 1NM4A 1UADC 1CI3M 1Q9OB 3HCVB 1EXGA 2LTQB 3K4ZA 4FL4B 1NCAL 1Q38A 5ITBL 4AEEA 5HYFA 3LDBC 1U8IA 3IJHB 5FF6A 4Q89A 4X7EC 3HRZA 4N6QA 4ZD3L 3F7RA 4LASL 4X0KB 3MV8A 5TF0A 2EUWA 2E74C 1NMCB 1BVKB 3MUUA 1WAAA 1FRGH 5L2KB 5F21B 1DFXA 1PZUB 3JTBA 1AD0A 4HFWB 1RJLB 5A16B 1J9RA 3QIWA 3ZKMC 4Z8FH 5BS0D 1N8ZB 3GIVB 5EIVA 1RH8A 3MV9D 4FQCL 3S2CA 5F9JB 3EUDA 2H5UA 4ERSL 3MJGX 5GS2H 1LMIA 1T5XA 3X13B 1LP9B 1RIUL 4JE4B 4X0NA 4YXLH 4UQ3B 2C9RA 5TPWL 4CW1B 4PJ8A 1DYZA 2UYLA 3L5IA 4YBQC 1F6AB 1KZQA 4F20A 3CX5J 4IOFC 4RSYA 3ZYOA 4MCZA 1YMMB 1TJHL 1YPZF 5L8LB 3MGOB 3O2VH 3TCLA 4M8RA 3Q2LA 4CN1A 1AKPA 2X6MA 5IFJB 2ZXCA 4HX1B 4PY7B 4X80H 5HHXH 1A64A 1WTGT 5KSAB 4YDLB 3WIHL 1A7RH 3E1F1 5HVGB 3H7LA 2BSSA 1DUYA 5J0BA 4HHGA 1E4XI 2IQAB 4KTEL 5I8KH 3QNZB 4S0HA 3UAJD 3CVHB 3SD2A 3QRLA 5DVKA 1G9NC 3HB3C 4L2LA 5EOCJ 4U1NB 4NGHL 5IBTH 5C3LD 3MO1A 1VCAA 4ZS6D 1YY8B 3H3PL 3MNWA 3L9BA 3DXAD 4LDOB 1AACA 35C8L 1B3JA 1J5HA 3FK3A 1Z5LB 5ETUA 1AJ7H 1FCGA 1EHNA 4J3XA 4JFTA 1JVKA 4OCRH 4JFPB 5CGYD 3RGVA 1KULA 4JQVA 1OVZA 3UTSB 3ZE0F 5KS9A 5ACZA 3OKOA 5ID1B 2W1NA 5D8JL 5D4IA 3ATEA 1EZVY 4CU8A 4GBXD 1QFWM 2N4IA 1HSAB 5IHBA 4ZO7A 1IEBB 3CFEB 1EEYB 3SDCA 4KK5C 4C47A 1JGVH 4JPWH 4H20H 1DEDA 3S96A 3LY6A 1R0AH 3DX7B 3MA9H 1JZFA 1LK3H 4ISVB 3AREB 4PRNA 3W9EA 4B5ZA 3U79A 2F53D 3RKDC 3ARWA 1JPSH 3IJEB 3BZEA 5C2BL 5JOPD 1KJVA 1LNUA 2SEBA 5GQBA 4QAMB 4XMKH 5C09A 5CD5D 3T0ED 1OE1A 1FE8L 1LO0H 1RCYA 4HC1L 4JG0L 5CINL 2OCFD 5IVXB 1KJ2B 2UWEA 2I7SA 5BCAA 2D31A 2WHVA 1QKZH 2K7PA 3ASOB 2L7QA 3GIZL 4M5ZH 5SWZE 3T0DA 5D1QE 4P5MA 1IFHL 4I7ZC 4DVBB 5KVGH 1T1ZA 2G4EA 3O3DB 2F19L 2XQ0A 1XR9B 4MLSA 4BFIA 1I9IH 3WUWA 2RIKA 4E41A 2WJ7A 4OZFG 3TOPA 2DYRB 1J8RA 3KWTA 3MMEA 5GSRB 4JFFE 2OMXA 3F6LA 3MRJA 2WWMD 4PSRA 2IGTA 3WE6A 2ZOKA 3PV6A 4M43H 3FRPA 4Y19B 4GG8B 4MSWA 1V7NH 4FQXC 4RRPG 4DZ8B 1VFAB 5LUMA 1X5KA 4HA1A 3QQ3B 1NCUA 3WN5C 2MEJB 4NQXB 4X9BA 3IN2A 5B22A 4H2AA 1PF3A 5B1CA 4DP8X 2X9WA 1LD9A 1P7QD 4J8QA 1UM4L 3SKMA 3GUFA 3OAYH 1R3LA 4GAJL 4AKPA 4GKZB 2Y9RT 6FABL 1WF5A 5CLYA 2NQ3A 1NKOA 3R0MA 3V52L 2C9QA 2X09A 2YGVA 2IH3B 1QAWA 2WNXA 3CDGA 3L2MA 2IWKA 2FBOJ 4WTZA 1FFNB 4F9LC 4FG2A 5AOJA 5DZ9A 3K6OA 1IBZA 4H26A 3VVVA 3X1NA 4R7VA 1CT8A 4M5TA 1X5IA 3FSVA 5MHSE 3C08L 5I1HL 2ZTBA 4C83A 3OC8A 5HPMB 4NXSA 1F2XK 4F8QA 3VFGL 3FT4A 1BZ7B 2N0MA 4GQ9L 1IM3B 1EO5A 3FZUC 2GI0A 3GEFA 3OZKA 2ETWA 3KPRE 3ZL4H 3BAXA 4XOEA 4CVZB 3L9EA 3MBWB 2E7HA 4HIJB 5DRZB 1DVZA 2DWEB 4W9FC 1OWRM 1J1OH 4ENED 3F5WB 1SOSA 4PJDB 3DUUA 1S7TB 1KB5B 1NIAA 3WOVA 2W80C 3V6OE 1KV3A 3KCPB 3SJVB 1KCUH 3RWCA 4A1RA 1I8KB 2EXYC 4XVTH 1MG3C 3LKOA 5GS1C 5C0BE 4PUBL 2AZUA 3EH1A 3DJ9A 3OJ2C 3HC2A 1MJJA 2H32H 1N19A 3GSNA 1CL7H 2WLZA 3MRMA 1FYTA 1WCBB 5DFVD 5E95B 1J0KA 3GJFB 4XWOC 1JK8B 4IM8A 1X5AA 2BSRA 2NUPB 3FSAA 4PJBF 3V7MA 5EEZA 1X9RA 5F70A 4N0UE 4KNTA 2NZ9C 3WNJA 3ECQA 1U30A 2EE9A 2XWEA 1CLOL 1EMTH 2FJGB 3OAZK 3GMLB 4JKPL 5E8EA 3WEXA 4XHQA 1U8KB 4YIQA 2XWBA 5KSBB 2O30A 1OD7A 5JPNA 1FH2A 3KDPB 4BHUI 3FYIB 3NA9L 5BW7A 4NAJA 1CF8L 1SBSL 2PTTA 3TEXA 1BXVA 3NBNA 2UVEA 3TBVA 4AT6B 2YSSA 2CLRA 2JCCF 2GAZB 4JMXA 4NZ8A 2FR4A 3MSPA 4FQXA 3S4SG 3VXRA 1EV2E 5DEJA 4UIKH 1OK8A 5DSCA 3WN5A 1QFWI 1CLZL 3WFZA 5F7FA 1FFRA 2WXQA 3QT2A 5A2AA 4F2ME 4H7VA 1CZ8L 5IEHA 3E80A 3EBHA 4XPGH 4X4YB 2O1AA 1SHSA 4ZPTB 1W0YT 3VXSD 2JJWA 2EINB 4U31A 4OSUL 5DFWH 2NY6D 4G8GD 3BT2H 3B7SA 1JWUA 4PBVC 1SN2A 4F9LA 3R06B 2GTZA 1ZGLB 2CALA 2XZAH 2VDQB 3L5JA 4AC4A 4OKVA 4M8UA 4CMMB 2KERA 4XAWL 4HSAC 3RWFA 5EIQA 4KXZI 2V37A 3P0YL 2F2HA 3KPPB 4GS7B 5EULV 1IVLA 1TETL 3WO3B 4AUYA 3LN4B 3O3BB 1MWAH 4HS3B 3GXMA 3SQBB 3ALWA 4HWNA 4J3VA 5C0GB 1QHPA 3CFDB 1E9PA 4AE1A 3N44B 4PM1A 1T3FB 1A1MB 1BVNT 4MKTA 4DZBA 3RUGE 4Z76B 4FXLA 4CMHB 1NGPL 5GS1A 5MI0B 3VI3A 2OR7A 1EUUA 4UV4L 1XGUA 2BSTB 4NKMA 5EC2A 1YEFL 1NUGA 3ELQA 3VCLB 3RIFK 5F88A 1DLFL 1F1AA 1QZ1A 4PV1C 3ZZSA 4KBPA 5IBLD 4M7KH 4X6CE 1ADQL 2XWCA 1QQDB 4DEUA 2CQVA 4OUOA 2EDMA 2Y07L 1DUZB 3S5LB 4W93A 3VD9A 2EE3A 2KH2B 4EIGB 1ROWA 2A6IA 2NX5D 1J18A 2PPFA 4XNXL 1XGRB 5E5LA 1ULVA 4XC3L 3ME0B 4M1CC 1FO0L 4MMYA 3VMOA 3T6ZA 3S3CB 3US1A 3QUXD 2CDFA 1BBDH 1F97A 5F96H 1UCBL 2YMXH 5JPMB 3KLLA 4N8VB 4O02B 3SE8L 3IJ8A 1L7TH 3BHBB 2VN5A 1OV8A 4TULH 3DMMC 3RZCB 5DCCA 2WOBA 3DYOA 1RK0B 4NP4H 1ZVSB 2BO0A 4NPYB 1SN0A 4DF9A 4RDQF 1MVUA 4MVBC 2YEQA 5L2KE 1P5UC 3AGVA 1ASQA 1XO8A 1O7DE 2AVGA 3UPCA 1FGNH 3ARBC 1MI5A 4MHHI 3U9WA 1JYXA 4U6XB 2HUHA 2J88H 3CZNA 3L1OH 3EXLA 3IFOA 2I26N 5E2UL 2KMWA 2A6JA 4CL7A 2X4PA 3A0OA 5T1MA 5FCUH 5D1ZC 2BDNL 2FLMA 2Z3FA 2E7DA 3LN5B 1HQRA 4HWEL 4B60A 4DQOL 3AY2A 4LLYB 1M6UA 3ZZQA 1B4JL 1VRSA 5C0ND 3CXHJ 4W4NA 1E4JA 3OB0H 1K8DA 4OQTH 2F7PA 3CFJA 3UTTD 5FHBL 4EN3C 2OX5B 4LEXH 2WXJA 3BH4A 5FOBA 5GGUA 1YMME 3MTRA 1L5GB 1DO6A 3RVWC 5I5IA 3B3IB 1Z6JT 1B0RB 2V0AA 1EO8H 1HL9A 3UAEA 1BQRA 4UQEA 3WTSA 1YDPB 1IT9H 2R1WB 5LB1A 5A2BA 3C75A 5JHDB 2D73A 1ZEAL 1DQVA 2JFCA 4A2DA 2IG2H 2N1TE 3QUKA 5L9DH 2VXTL 3NFPA 1KPRA 3BKCH 5J13C 4HAFA 3EH5B 2E7BA 3GMQA 3BMWA 4HJSA 2X9XA 4S10A 4V2BA 2IAAC 4RX4A 5T1KA 3VM7A 2HFFA 4CGTA 2AAAA 5GPRA 3UCQA 4JY6B 3D39D 3K0YA 4GFTB 2PCYA 4NQDB 5K5YA 4YDNA 2K4WA 4X42A 1VESA 4Q52A 5I1DB 5EU3B 1QEWB 3UTSE 3VWKD 2AEPL 1O7VA 2Z7ZA 3QJVB 3E8VA 2VDPB 3QIUC 2OPCA 2YGPA 4IS6B 3A6BL 3KLQA 4PJAB 1A3QA 3HHRB 1E3XA 1U42A 3MA7A 1S7UA 4CKQA 3QDMD 2M1KA 2KZKA 4U1MA 1A7QL 2YAEA 5IF0B 2JXMB 3LZQA 4OV6F 2B14A 1JGEA 3ZYZA 4E0RB 3RBGA 4POYA 1SMOA 1P5UA 1IZJA 1LVEA 1XF5A 1IAIH 2IXQB 2O6CA 2YPVA 3E6FB 4MGXA 4UNTA 3O3AA 2WLNA 1M71B 4OM1H 1YPZA 4YUEL 1JNLH 4U6VL 5G5DB 2D4DA 4NQVB 1FAKT 4HU8A 5EZIH 1EEZB 1YJDL 4LIQL 5C6TL 1PVHA 3MRCB 4XBGA 4OZGA 1AGBB 1FL6B 1N59A 3JZYA 5EBWB 3V4UH 5KSVA 3MROB 5HYSB 1S3KH 3VXUB 4KKZA 3N40P 2ZF9A 5IVXE 4UTBH 5CIPH 1NGWA 5D1ZA 4UBDD 4UTAH 4HPYL 4AW7A 1ND0A 3QCVL 2DKUA 4PRID 4LU5L 5F3HA 2BNRA 1W16A 4P4KC 4WW2F 2E4TA 3KEHA 4QRBA 5ICXB 4EN3A 2DIBA 1TU2B 1C7SA 3QZWG 5D96B 4LCYA 4HEMA 4L4JA 5B3NA 3GPEA 3V5HA 3PJSB 3NFSL 3EYUH 1YEKL 3L4ZA 3CFBB 4G7RB 1IM9D 2HB0A 4Y19E 2Z91A 3KYOA 1V54B 4JZOB 5D4QA 3WTWA 2RBLA 1INEL 2IGFL 1WTLA 2VLKB 2KL6A 2MCMA 4F7PA 4S2SB 2XIBA 1U92A 4LSQH 4RMVA 1G7PB 3MCKA 1AIFB 2VGLM 2ZONA 4X6BB 3PYCA 2CJUL 5IROC 4P3WA 1J9CT 3K71A 5IB2B 1BZOA 2APFA 2TSBA 4J3SA 3QH3A 3THML 5HYJB 1F13A 1NMAL 4JANA 2CSPA 2NYZA 2K1MA 3IMVA 3NSFA 5HGDB 3WO4B 3TVMD 3FH7A 2NTSP 3VGBA 1F56A 2BSDA 1PU0A 5C0IB 3RWDB 1A3RL 5J57B 2Q7AA 5MEQB 4K3JL 2VUKA 1G7MA 1C1EL 1NDGB 4NEHB 1BQHG 4R6UA 5IVNA 1OAKH 4XP9H 3CVCA 4ONFL 4LKCB 1OSEA 3GI8H 1C8PA 2C34A 3UG3A 4PJXF 1V10A 4X6DA 2Q5BA 5CLWA 1ZCRA 5SV4A 4ZMTA 2WXHA 4TVSa 2WMPA 5DUPH 5SWQA 3BC9A 3SJVE 4UOZA 2VXVH 3E38A 3G9VA 2IWGA 5KVFE 1VADB 5DMKB 4KI5D 2CGRL 1XIWC 4F8NA 2KLTA 4OUUA 4A7UA 1KC5L 3UBXG 3GHEL 1J5CA 2IALB 1MFUA 3RI5F 1Y18B 1H6UA 1FZKA 5JR1L 1P0SE 4PVBA 2YXMA 2JKRM 3W0WB 1Q8MA 5DYFA 2C26A 4FEMA 1BM7A 1UXSB 4JRFA 2YLHA 4J4PC 4NC1C 3B5GA 3U82B 4NQCB 3VQ1C 1ZA3B 3OG4B 3TWYA 1SJEB 2VM3A 4P4KA 4F37F 1NWOA 3ZHLA 5KSBE 1VHPA 1Y6MR 2AAVA 3X3GL 3KWXA 2YZ8A 2YUXA 1Y1DA 2VDOB 1INQB 3WXVH 4YL9A 4ZOAA 1Q0XH 2MHAB 4BXVA 2NY7H 2H6PB 4KO5A 3SPVA 2B59A 2EADA 3NH7H 4EUPG 2YUVA 3WJMB 5KAQG 1IBYA 4X4KA 4G6MH 4YSTA 1CFBA 4XPFH 3KPNB 3BSZA 2YEVB 1JNNL 4PEEA 3OX8B 3SGEH 2NY1B 5TGBB 5D5MB 4TNEA 4A6YA 2FQDA 3L4UA 4PYGA 4AV4A 5IHHA 5KG9A 4R96A 1WZAA 3NIGF 2DF3A 4PCYA 2YGQA 4EAEA 1G9EA 4QGTA 2XVBA 3QJUB 4OTXL 5EZJA 4C4UA 4I9XA 1GSMA 3SY6A 1UD2A 2DLIA 2K9UA 3FMGL 3L5WA 1AI1L 4L1HA 2IDFA 4HXBL 3RVTC 5ESVB 2EAEA 1CURA 1RJZB 3MJ9A 3V6ZB 3KPSB 1UWGL 5IQLA 3W5NA 1N64L 3O6FB 3QWOA 5C0DB 4RA3A 5HYEA 2KHAA 1MCCA 1NFIA 4PJBA 1RI8A 3V0AC 4HJGB 4JZNB 2DN7A 3MLUH 2ZJSH 1H5BC 1BFTA 2OSLB 1R17A 1QWNA 5CLXA 5EBGA 3IF1A 3B8SA 3IMSA 1J8HB 4I85A 2DJ4A 4MJIA 3NCYP 4LAQL 3VTMA 4L4VB 1CG9A 2E7CA 2OCJA 3OAZH 3U46A 3PXHA 4WTWA 1XIWA 3ZT7A 3FT0A 2X12A 1QYGL 3JWOH 3MRNB 5I1JH 5B21A 5T8IA 4JDTL 4APQB 1O5DT 4HZ1A 2QVIA 1KEMH 3EGSA 3A23A 2YAMA 4MNQA 4EI6A 5DTFA 2ZOOA 4P3CL 2JCCA 2PXYC 3FO2B 1NAKL 2AXJA 3PY9A 4WHTB 5GS0C 1MREH 1YEJH 4LF3B 5DEFA 4JJ5A 1F4AA 3LKPA 4EKJA 3SKUD 1E8XA 3VSTA 3H9HB 3VW3L 3PPSA 1R3IL 4OFQA 5KBMA 4D0DB 5HVHB 4FCHA 4KDWA 2AV1B 5DRXB 4ODVL 5CSGA 3GKWH 2HJFA 3L3GB 1XF4B 3BMVA 1QSEB 4OLUH 4XNMA 3HNSH 1JPGB 3T0WA 4FQJL 3RFZC 3FOMA 5HHVH 2QMJA 2GY5A 4AITA 4HJ0C 2DQHH 3LZFL 3Q48A 4FFYL 2B1OA 2WO4A 2WLIA 4YNYA 1OKEA 5IOPA 4GXVL 1F45A 2ZUWA 1XQ4A 3BE1H 1ORQB 2YPKB 1JZIA 4CDGC 2X4UA 3WHE0 5IMKA 2CK2A 4CVXA 4PJ9D 4N0FA 2R23A 1NIFA 2Q7NA 4IOSD 2HJLA 1CGWA 4P2OC 1GAFL 5JYLA 3J27A 1U8IB 1TQCC 1ZRUA 5FF6B 1NOLA 3HHMA 1I1AD 1XH1A 1XAKA 3EGDA 3HRZB 4KH9A 4KXDA 4RSVA 3MV8B 3O4LA 4XGZA 4Z7WF 1JGIA 1E2VA 3KNBA 4UUJA 4PP1C 1E3ZA 2IAMC 1L3WA 4LDEB 1ZLUH 3H9YA 3S88H 2ITCA 3WL9A 3L2NA 1X4XA 1RUPL 3FFCA 1MFNA 1XHHA 1AD0B 2JELH 4KTDL 4DN4H 4DP2X 4OZIF 1VPOH 1QTYT 4Y0GA 4XP5H 2XG5A 3QIWB 2KLRA 4WNSA 3PXJA 1KYOK 1TUPA 4TNFA 3ZL2A 3V6FA 4K8RC 4QTIL 1T5XB 1MLCA 5F6IB 1GGYA 1UUNA 3ERXA 1FYHB 4GSDH 3T8XA 2DBLL 3VU1A 1S9VA 4H0LC 5E2WL 4CN4A 3I9PA 4PJ8B 2UYLB 2VL5A 3DPBA 1I3UA 3TV3H 4AM0Q 3PGFH 1UD6A 2FYYA 5GRYA 3U30C 4MCZB 2IPUK 4PW4A 1TTGA 2PXYA 4OT1L 1A6VH 3TCLB 1KFAH 4DH2A 5FO8A 5I6XC 1X5ZA 3U4EA 3DHPA 4NQDE 1WO2A 2EDYA 3Q8BA 3WEOA 1R3HA 4K7PL 1RIVL 4NO5B 5DZNA 5GSVA 2G5RA 4ZSOA 3D0AA 1YEIL 3GJFK 3GBML 2BSSB 4NFDA 5SWSD 4L2YA 1DUYB 4ELMF 1PY4A 1UEYA 4PJAE 4HJJL 2NNFA 5ANHA 3MO1B 3R0NA 3MNWB 4PV9B 4FQPA 4U6TA 4NKIH 3KWUA 1JHKH 3D9AL 4UQ9A 3WD5H 4W9KC 4JY5H 4ONHA 5ICYA 5D7LA 5EEUA 3ASNB 5ETUB 4WW2C 4ZX6A 2BFVH 2PYEA 4CGUB 3WFEH 1NTDA 4WIQA 4D7BA 4KROD 5KS9B 3AUWB 5ACZB 5B38A 3OKOB 4PJ5A 1FLRH 4XBEH 4X5QA 5IVOA 2BIMA 1SY6L 1JZHA 2L04A 3BP4A 4EDXB 2VXUH 2QZ5A 3LQMA 4P2OA 3F12B 1A9BA 1S7QA 3MBED 3LDBB 1DEEA 1UD5A 1P4LA 4H25A 3B8YA 3DUSA 3VXUE 2OMVA 5ABAA 1JGLL 1S7VA 5HSFA 3EZ8A 3RDTC 3Q8EA 3S96B 3PL6C 4XB3A 1HL8A 1ZT1A 2X9ZA 3A6OA 4FTVD 2CR3A 1W72L 3DJRA 2IAMA 4MKMA 4UTCA 4PRNB 3W9EB 4GI8A 3MLSL 5ABDE 4W6WB 4MYWB 3H4HA 1VEOA 5DJ0A 3K74B 1MPAH 3M7OA 5GZND 1CGTA 2A4ZA 3E8UL 4BKSC 5MERA 1VLXA 1W8OA 2VW7A 1UM6L 4E9LA 5GRUL 5T3ZD 3BZEB 3EJZC 2P46B 1U36A 3LQAL 5BV7L 1KJVB 5L0QC 2SEBB 2VDLB 4NC0B 4Y16C 5C09B 4FOMA 2GT9A 1SBBA 2VLKE 4KRLB 3JSSA 1MFAL 3EOTH 1SN5A 3P4LA 2UWEB 2D31B 12E8L 1BIIA 2WO3B 1YNTA 43CAA 4TQIA 1TITA 3N1PC 4P5MB 1JP5A 1YQ2A 4QHKJ 5M94B 1KDJA 1T1ZB 1Z9LA 4GNKB 4JW3A 2JKWA 1SQMA 4BFIB 5JW4R 4ICXA 4E41B 4F8PA 5CCKL 5D7IF 3FONA 4I88A 3B3BA 3NCJL 4UNVA 3MMEB 2F1BA 1RZIA 4I8DA 5HYJE 2XX1A 2OMXB 3MRJB 4JFOA 4AGMA 3ARGC 1GH7A 5DC0A 5ADOH 2EILB 2ZOKB 4C56D 3PV6B 3FRPB 3P3YA 2NW3A 4MSWB 1WVZA 1PYWA 3IFLH 1BQLH 4PR5A 1BXXA 2R56L 2ILLA 1CU4H 2ATAA 4PLKC 4PJCA 1JXJA 3HB3B 2W0LA 1FFPA 1LD9B 2D7TL 3SKMB 2VTFA 3HMXA 1R3LB 2J5LC 4AJVA 5E9NA 4Z0BL 3FN3A 3K5SA 4LP5A 3VM5A 2NUTA 4WK0B 1JL8A 1IBBA 4R4BB 4N9GA 4XI5C 2HXAA 4WW2A 3CDGB 3CC1A 3WFDL 5I23A 1H3VA 2NXZC 4H26B 4OGXH 1CT8B 1BD2A 1KPVA 3FBKA 2HKHL 4FNLH 4C83B 1SJHA 3FT4B 2IAND 2ZKYA 5TE6L 4GRLC 2BY2A 1KCKA 3AVEA 2HSIA 3L48A 2YD5A 4AKQA 2V17H 3HUJE 4HSQA 1H9VA 1JZJA 3RDTA 4HUXA 4TVPD 4NQCE 3PL6A 5C08E 2Y7MA 3QR2A 5FDYA 3S5ZA 3DUUB 5EUOA 4P5TD 1NC4A 4XXDA 4Y4KA 5BNXD 3RWCB 3T6XA 2VR8A 4JQXC 3HE7C 5ES4B 3LKOB 2A9CA 2FWOA 3TH3T 3ROLA 3QRGH 4PRHA 1YC8A 2VOTA 1MJJB 3ZLQC 1RULH 3GSNB 2XKSA 3MRMB 5DQJA 1FYTB 2L7JA 5ECJE 3IT8D 1IC4L 5EFIA 1NGYA 4MNGA 4Y16A 4E5XA 2ATKA 3A6CL 2BSRB 4HG4K 4MQ7A 1WAEA 3ARVA 3ARRA 1RERA 5E6YA 1HT6A 5D2NC 2X5PA 1GPOH 2V3EA 1G7HA 4D0BA 3KZ8A 4G5ZH 1VERA 1KCWA 2XTLA 2AQNA 1XGTA 2Y5TA 1BECA 3EJQA 3LIZH 5EIIG 3VFOA 1QUNA 2QVKA 3QFDA 3BIBX 4WUKL 3S0PA 3QA3A 5E8EB 3WEXB 4ODHL 5D5ME 4YIQB 2XWBB 1IKFL 2XKUA 3EYFB 2UZPA 3NZHL 2EACA 4PJXA 4PBWD 2PR9A 1JPEA 3ZHNA 1RZKC 5BS0A 1BMGA 5JXED 3ARGA 2IH8A 2PTTB 3FUMA 1AP2A 3MV9A 3TBVB 2YSSB 4MD5A 2CLRB 3U1QA 3L5HA 1E7UA 4FQXB 3VXRB 5C8JA 2E9JA 3L08A 4LLWA 4OF0A 3N43F 5ELIA 1S9XA 5DSCB 3WN5B 1N4XL 5I26A 3ALPA 4R26L 1ML0A 3O3UN 4NN7C 1RK7A 3KPSE 2FUQA 3VWJD 1TMQA 3RTQC 5IMLA 1MFDL 5DUMH 1RY7B 5CMAA 4B9JA 2AANA 1ZS2A 4LP8A 3VG0H 3P3TA 3TCXA 1DVYA 5IEHB 5KVEE 1XXFC 1G9MC 3QQXA 3B2VL 4S1SH 1EGJA 4XP1L 3ZE2F 1J8HE 2A74C 2CJSA 3TESA 1JWUB 5EV7A 2GTZB 5GRWA 1TVBA 4JHVA 3DGDA 1CGSH 4LSTL 2ZCKL 1T1WB 4KHXL 4OKVB 1AO7A 5DFTA 3RWFB 2NXYD 2CO7A 5AEAA 4GRLA 2VDMH 1CGXA 5CUSH 4LLMA 2XN0A 3QWRA 4LCIL 3RBSA 2JNZA 2Y1AA 4HZLA 3JVGC 2WTOA 4FI8A 1E9PB 2C9UA 2J1WA 3F7KA 4WGVB 2XJLA 5A7EA 5AENA 1DJSA 4NDMA 2IO5A 3PUCA 2I5YL 4JO2H 2CD0A 1PJ9A 4DZBB 1YAIA 4NKDA 4JQXA 5EN2A 1LO2H 2YZ1A 3HE7A 2Z7UA 4EVNA 1GYCA 3D0VA 5GS1B 3BPLC 5FGCE 3VI3B 1RU9L 5TF1H 1XGUB 5EC2B 4NKMB 4QTHA 3II2A 2Q7YA 3G6JF 3BQUC 2X4TA 5F88B 5DJZA 4PWIA 4B96A 4OCYH 4X9YA 1EXUA 4ZDHA 3KWVA 3F7QA 4M6OL 1QSFA 1UVQA 2YKKA 5IFHL 1FH5H 3MKKA 4N2FA 4P04A 2F8VA 3V0DA 2A6IB 3JWDC 4JPVH 4XP6L 1KB9J 4BFEA 4QI3A 4WEBH 2H2PC 1WFJA 1FIGL 2OR8A 4YN3A 4OD1H 5JIQA 3B7YA 4MMYB 1AHWC 3BJ91 4G72B 2CDFB 4POUB 1F8TH 4BKLA 5D1XC 5CJOL 3MACL 1SRDA 1HKLL 4AY0A 4C4KO 3BKYH 3NACH 3CHSA 3MV8E 4N2LA 3T0EA 4TVPL 3O3EA 1WAAE 5BPPA 4O2FA 3D8MA 1A6WL 3WJJC 1MVUB 1CLYL 4BZ1H 3NEOA 4B7IA 3RTQA 4XO8A 4P3DB 5GIRA 4DP6X 2XA8L 4JB9H 5CJ8A 3WE1A 3IFOB 3UTQA 4HAGA 5KYWA 2AERT 4JBSA 4RGMC 4YZFF 1NICA 1Q90A 2A6JB 1Z3RA 3LEXA 1F1GA 1BDYA 2X4PB 2A74A 2E86A 5T1MB 1HQRB 2BZ7A 4FQHA 3ZIYA 4G59C 1G1KA 2EEAA 3HBQA 3WFCL 2CCLA 3VGHA 1K8DB 1JDCA 1LE5B 3CFJB 3FJTA 4FFZA 1HL5A 3PNWB 5FOBB 15C8L 5CEZH 2RAMA 5GGUB 2NW2A 2VDKL 5ABZA 5DJ8A 3JT0A 1WBXA 4NO0B 2CKBH 3QI9D 3JVGA 2P4AB 1T2JA 3MJ7A 2FT7A 3O6ML 1MFCH 1NSNL 3DSFH 4LCUA 4XN5A 5F6HI 2NPLX 3RVXC 4M48L 4MA7H 3AGWA 3QUKB 3CU7A 3BDXA 5AOIA 4XMXA 1UASA 2H0PA 3NFPB 5F7KC 1KPRB 1N5YL 1X9QA 4N90D 4N0YH 1MY7A 5DURD 5HHQA 1V05A 1UXMA 1OCCB 2R0WH 4JDZA 2CO3A 2W8CA 4OCWL 3GMQB 5AYUL 3NYKA 4JM2D 3S9DB 3WXWH 1CO1A 3TGXA 4TRPL 5T1KB 4KNQA 1E8ZA 2XFGB 2YO3A 4UZUA 1R3JA 2DWYA 2IQ9H 3TWCL 1KENL 1EHLL 1RZ7H 4MXQD 5KVDL 2JI2A 2DDQL 1ED3A 5ESQA 5G4NA 4X7SL 4OZIA 2BVUA 4W68A 1F4YH 1I8LC 2BOLA 4U7KA 1AHWA 1XCWA 3HG1A 2VSMB 3VDBA 2C8NA 3MA7B 1S7UB 1ZLDA 2FH8A 3OHXC 4P59L 9CGTA 5D1XA 4MQSB 2ADJB 2J21A 4U1MB 3TYGL 3NCXA 3IMUA 4OFVA 5AVXB 5HY9B 3QHFL 2DQEH 1JGEB 4NNXA 2HKAA 4AMKH 3WJJA 2FYVA 5EWIH 1P5UB 2ZOLA 1AIZA 1XF5B 1TEFA 4JFFD 1CTMA 2DQDH 3O3AB 2R1XB 3VD4A 1YPZB 1O6TA 1B6DA 1IQWH 1KIQA 3D3VB 4PCTA 4BUQA 2APVA 3VE0A 4P9MH 1SXAA 2HX7A 2VMCA 4KKCC 5MEPA 4XBGB 2J8HA 4OZGB 2J6EA 1N59B 3CTTA 5DJCA 5C09E 5KSVB 5MP6L 2VZTA 2NY0B 4FXGC 1U33A 4YLQT 2VISA 4QHMA 1OHZA 2DEXX 1NGWB 2UWEE 1JJUA 2LE9A 5D1ZB 5EG6C 3C8HA 4ELMA 1ND0B 3B6SA 1S7XB 4WWKC 2VITA 3BRGC 3U4BH 1FPTL 5F3HB 2BNRB 4O4YH 2W0FA 2G60H 1A7NL 2MCAA 3B43A 3V4PL 2GJPA 3O2WL 3C87A 2I07A 1HWWA 2ZSWA 4EN3B 2E6PA 4KI1A 4DTGL 4E41E 2ADFH 1VEMA 4ZODA 2Y6SC 4LOUD 4LCYB 1EQWA 1QRKA 5FYLH 3IFNL 3FULA 3V5HB 4JO3H 2ZAGA 1G1OA 3T08A 2FQFA 5DK3A 1PZCA 2PKDA 25C8H 3NP3A 2K3TA 2ZUXA 32C2A 5D7JD 4NZDA 3KYOB 4Y2OA 3C8KA 4ZFOL 4IGBD 2DI8A 1UD3A 4F7PB 3CBJB 5C07E 3DGCR 1WIPA 3ZE0B 3KPRD 1U92B 5J13B 1RSFA 3NTCL 4F1SA 3MCKB 1L9RA 5I76B 1KYDA 3MQIA 4YHKH 2UV3A 4Y4FC 4KO6A 3SE9L 5C9KA 3K71B 2A83A 5KANI 4OH2A 4X4XA 1UWFA 1CD8A 1BZ8A 4KKLC 2H9GA 5JXAH 4X5WB 3QH3B 3B9AA 3EDJA 2DLTA 5E6SB 3LPPA 1HWGB 5C0BD 5EDSA 5I15L 5IUSA 2XIDA 4JANB 3ATBA 1EZSA 4EF3A 4JCWA 1NCWH 2BNQD 4FQ2H 1KBWA 3F58L 5F7DA 3P11H 2EYRA 3FCUB 4J7RA 1JGUH 3IS0X 1G7MB 1I8LA 5I1LA 2M2DA 3QIUB 3IDXH 4K23L 1F0LA 1COBA 1ZVYA 1A1NB 1IEHA 4AEFA 1D5RA 5L2JA 1QBAA 3OHXA 4PG9B 3H2PA 5CM1A 3ZRSA 3ETBJ 5CFHA 4X6DB 2AI0H 3BCDA 4B9IA 4IBTA 4E9VA 3S8GB 3IEAA 4ZMLA 2HT2D 2WMPB 5SWQB 4A7GF 4JPKH 4CC4A 2J3SA 1FV1A 3SZ6A 5D7IA 4FZ8L 2D3VA 2G3MA 5I71C 1PMYA 4OUUB 1Z0NA 4O2EA 2E7LC 3I6SA 1E3FA 1ZTXE 2AJZA 1B0GA 3QG7L 4LSSH 2V5SA 4PB0H 1FYTE 5DZVA 1FZKB 2WK2A 1HHIA 4FXGA 4JPQA 5TH2A 3RWHA 3RVUC 3WNNA 4JN1L 7FABH 4JY4A 2I32A 5GGVY 3ZTJG 3K6DA 1ZSHA 4PW9A 4WWKA 3HC3L 3EFOA 4JGNA 3VG9C 4P4KB 5ICZA 4I48A 5I30L 1EDHA 2VZ1A 4DGYL 5I1KL 2VNCA 3GRWH 2G3XA 3KWWA 3MOAL 5EOCL 2VR9A 4FF9A 3WNPA 4N0CC 5F9WB 2VMFA 5I6PA 3L1EA 1NA8A 2QADB 1Z9OA 4J3OD 1S4IA 2Y7OA 1A25A 4TPRL 3SPVB 2B59B 2HPTA 3VXRE 4WWPA 1DP0A 3O9WD 5F9OL 1DVTA 5IGXH 1KACB 5LNGA 2JKTM 3SYPA 1BEXA 5D70L 1QPPA 4KXCA 4R97C 5F7AA 5IJVA 3IJSA 2J2ZA 2AXGA 2CKBB 4X4MA 3MLWL 1W8NA 4XCNB 3JUYA 5KG9B 4R96B 1BPLB 1R3KA 3TLRA 2VQUA 4J5VA 4ODTL 1UA6L 1P4BL 4FFVD 1Q1JH