1WFMA

The first c2 domain of human synaptotagmin xiii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSSGSSGSWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords synaptotagmin XIII
publication title The first C2 domain of human synaptotagmin XIII
rcsb
source organism Homo sapiens
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfmA00
2FJUB 3QR1A 2KI6A 4OVUA 3L17A 3ML8A 3DBSA 1E7UA 2WXGA 3NZSA 3PRZA 2WXIA 3RDJA 4ANUA 1E8XA 4NPJA 3W57A 2CM6A 1E8YA 3TWYA 2A5UA 2R83A 2CHDA 1WFJA 3MJWA 1BYNA 4EZJA 4FADA 5CCJA 2EP6A 1HE8A 3HHMA 3TL5A 1YRKA 1DJIA 1W16A 4DK5A 2K4AA 3FDWA 5JHAA 3L13A 4F91B 1GMIA 2FK9A 4L1BA 1UGKA 3HN8A 3KWUA 5JHBA 2D8KA 3FBKA 2CJSA 1DJZA 4PS7A 4URKA 3F01A 4WWOA 4L1LA 2UZPA 4L2YA 4A55A 4F1SA 4AOFA 2K8MA 3ENEA 1BDYA 4LDCA 4HVBA 1DJWA 2ZKMX 1QASA 1E8ZA 2V4LA 4FJYA 2CJTA 4FA6A 4F93B 3PS6A 1DJGA 3L08A 2CM5A 2WXLA 2CHWA 4LT7A 4KZ0A 5H4YA 5G55A 4FULA 2WXQA 3CSFA 3NSJA 4IQHA 4HLEA 1DJYA 4XZ4A 4WAFA 2NSQA 3QJZA 2YRBA 2WXOA 2WXPA 3PFQA 4L23A 1BCIA 2NCEA 3R7QA 2WXJA 4QJ4B 4BFRA 2JQZA 5CCGE 1RH8A 2ENQA 3HIZA 2Q0ZX 4NS0A 2ENPA 3QR0A 4XX5A 4ANVA 4EZLA 5T8IA 3L4CA 3LJ3A 4XE0A 4PS8A 3OHMB 2QZ5A 4QAMB 2WXRA 3RPBA 2LHAA 2RD0A 3NZUA 4LCVA 4V11A 2BWQA 4Y1SA 4ANXA 3N5AA 4TS6A 4IHBA 2WXHA 4WWNA 2DMGA 3PYCA 4KITB 4ANWA 5KJ7E 1DQVA 4QJ5B 4BGDA 4NP9A 1E8WA 4OVVA 3ZW3A 3L54A 1CJYA 3R7RA 3F05A 3JZYA 3APFA 4FHJA 2CHXA 5CCHE 1K5WA 3APDA 1TJMA 2Y3AA 2N1TE 3APCA 3P2BA 3L16A 3QK0A 4EZKA 4F92B 1DJHA 2CHZA 3ML9A 3KWTA 4WEEA 3W56A 2B3RA 3ZIMA 4FLHA 3ZVVA 4ICXA 2ENJA 2YOAA 5EDSA 4JPSA 4GNKB 3B7YA 4PS3A 2WXKA 4TV3A 1DJXA 3GPEA 4Y1TA 4DNLA 4AJWA 3QAQA 1UOWA 1WFMA 1V27A 1UOVA 4MJJA 4NPKA 4ICWA 2Z0UA 4FHKA 5H4ZA 4KZCA 3PREA 4GB9A 4QJ3B 3S2AA 2QZQA 1W15A 3L9BA 2K45A 2DMHA 3M7FB 1A25A 2X38A 1RLWA 3T8MA 2K3HA 2WXFA 4FJZA 1E90A 1E7VA 1DSYA 3CSTA 3QARA 3OAWA 2WXNA 3IM1A 3F04A 1RSYA 2WXMA 3IBEA 4G11A 3SD5A 1QATA 2NQ3A 2A4ZA 4WWPA 2ISDA 1TJXA 3F00A 4TUUA 3TJPA 3DPDA 5G2NA 4J6IA 2Q3XA
chains in the Genus database with same CATH superfamily
5KBNC 1DO5A 1UCTA 1Z32X 2VLLA 3C6SA 1LHZA 5EHFA 1NAMH 3HC4L 4IBYA 1SMAA 2KBGA 1K72A 3AITA 2OMZA 5SWZA 2DWXA 4F20A 1OQXA 1UKSA 4M6AA 4EAEA 5DMIH 5B1JA 2GG1A 3RAJL 3UEQA 1A14L 2BOBB 1YEFL 5IT2L 1OVZA 2R29A 4N26A 4R4BA 3C8KB 1LGVA 4C83A 5GGRB 4GW4A 4DKEL 3AGWA 3V55A 2B4CL 5C9JA 4JFZH 1IRAY 2QSCH 2PXYA 1HU8A 3DURB 3X11A 2VAAA 2D3LA 2WLLA 3CVIL 4KHTH 3STZB 2O93L 3L95A 1GW0A 3LIZL 4NLAA 3RFZA 4HIPA 4WWID 2EH8H 1MF2H 1DJGA 2E9GA 2APXA 4R7DB 4NO2A 2E0PA 1WD8A 3NSJA 2DLFH 2DYSB 2NSQA 1UM6H 3GXFA 4GOSA 5GJTL 1EHXA 4HIEB 4DO6A 4PBXA 2V7NA 5H2BA 4AEHL 1ZRUA 5HYSG 4N2MA 3TN0B 2IPKB 2XYBA 4JVPA 1I75A 1NGWB 2AEPL 3QXAA 5F3BB 5F7UA 4R83A 3BUDA 2FECI 4GW1A 2X0WA 4JM0A 5T1JA 1S9WB 1B9KA 2EDJA 2X41A 4J3OD 2WO3B 3WTYA 2V37A 2Y3NA 7PCYA 4H8HA 3T2NL 3BPOB 4PJXF 3T3MB 4AENB 2G9HA 4MCNA 4K8RL 4WI3A 1XR8B 1XIWA 5I8OL 4PV8A 1YEIL 4EUPA 4U1JB 1RQ5A 3QDME 1LQSR 4KX8A 5DXWA 5AALA 4PJGB 1UWFA 2CRYA 3ISRA 5E2UL 2XETA 4XP1H 2MNUA 2X1XR 3BI9X 3PV7A 3WJLA 5IROD 4PN6A 4NCC1 2CDFA 1SVCP 1ITCA 1G9HA 1DBAL 2XKNA 3MJGX 5L0QC 4OFKA 3VMNA 2D4FA 2ITCA 1A3LH 3MLZH 4NKMB 2PPEA 3IMSA 3U9PL 3WL9B 2CMRH 3UMTA 4Z3GA 4LF3B 3QNXA 3QDMD 5DFVD 3OGCB 2Z31A 2H0EA 4JY4B 5AB9A 1SQMA 2QR0B 4CW1B 1TJXA 2G3ZA 2V5TA 3RKDD 1E4XL 1VGEL 3JTTA 1M3JA 3OKOA 1IBGH 4UIKH 4HUWA 4X8CA 3TOPA 3DC0A 3RDJA 3MODL 2DWDB 2H2SD 4NBYB 1D5MA 1DBKH 3CHSA 3LKSA 5AVUB 1BF2A 4ODVL 3WD5H 1JVOA 4P5TB 1I7TB 2XN0A 3PGCA 4G1MA 4AVKA 1T89C 2LLGA 3ARFA 3QB7C 4KK6D 1KBVA 4N1CA 3ULAB 5C2BH 3VI4F 4Y88A 2HKFL 5CO1A 2B8OT 4PJEB 1JDCA 2QGCA 2TRHA 4PW9A 1NMCC 4EDXA 1P6WA 4F2MA 3MX0B 3QEQB 4JLRA 5DHVA 2NYYD 2ZNXA 3HBPA 4XVJL 1DSFL 1QG3A 2VKWA 5T1LA 3RWHA 3L3DA 5KSVA 4Z7VE 3UBFA 1R17A 3D2UD 4N28A 4WDIB 2WINA 4M8QA 4PJDF 4ZX3A 3SGDI 4J2XA 5DYOA 3KM2A 4KDWA 4XPHH 4NKIH 1T5XA 4I13B 5IJDC 3WXWL 5I6KA 5HJBA 3D85A 5HTSA 4F7PA 5ADOH 1I8KB 3MRIB 3MGTB 1FNEB 4OJDH 4PB0H 5D7LB 4D7BA 4TL4A 2C9VA 4QJ4B 3IPEA 3LS5H 3RVXC 3PDDA 4FQIL 3FT4B 4APQB 3RP1A 2KLTA 4YX2L 3UTOA 2DQDL 4LSVH 4AGMA 3UTPE 2KYIA 4YSSA 1H3WM 4KI1A 1DBJL 3A6CL 4A63A 4NQSB 4N3UA 3EGXB 1QPXA 4KROC 4F7TB 2F54B 4K71B 1JFHA 5F7YC 3E1ZA 4OD2A 1OM3L 4BSWB 5JR1L 4JAMA 1IZKA 3AS3A 1CO1A 5JOFA 3S9DB 3IU3A 4FG4A 4HYTB 4U33A 3MACL 3REWA 3ULUL 4A6YL 4XPGL 1BQHG 4IRSA 1DN0A 2VDOB 4RFEA 4ONHB 4X6FB 1ZSDA 1SBSH 4HWBL 4KDVA 5DK3A 3H9HA 4GXUN 1AQ8A 1Z5LB 1A6WH 4RGNB 4X4MA 5HYQB 1AZCA 2FQGA 2NNRA 1E4KC 2OX5B 4OQTH 4XH2A 4WO4B 4BDVB 4EOWH 3IFOA 3L48A 3HEIB 4NHCH 4KQ3L 3LSOA 4CC4A 2EZ0D 1HJBC 3E2HC 2YA0A 1P7KA 2G60H 1EFXB 3FOLB 4WHTA 3TO2A 3TA3D 3LS4H 1FLRH 4ZD3H 3HI1A 1N68A 1JGEA 4PLKD 2OCCB 2AK1H 3US9A 4P5KA 2D2OA 5B22A 2EEFA 3WTUA 2YXMA 5I1HL 4KKAD 2DQGH 1EJ6A 2YA2A 5CU9A 1T66D 4WI7A 4GXUM 2HLAA 1CD0A 4JPVH 1OB1A 3HR5A 4XB7A 3DO7A 2A6JB 3B4NA 1KF9B 3HG0A 5DURB 4DOHB 4BSJA 4WIQA 4H0GA 1XH3B 2Y72A 2FLMA 3OKDA 4Z9KB 3EXJA 4NBZB 1M7DA 1M53A 2OMTB 3KXFB 2FNBA 1F3RB 1ZY9A 5DRWB 3KYNA 3ZKMD 4CGUB 1SDYA 1RMFL 2R0WL 1TENA 5I15L 3CMGA 3GO1H 4ZK8A 3OAZK 1HNGA 1VZGA 4JFSA 3VXUB 3SHSA 2VYRE 3JWDL 3ZHLA 5JOEA 1WFIA 2A9DA 4ZFFA 2VDMH 4ONGL 5IQLA 3EFDH 5DZNA 2UUDH 1R5WA 4TVUA 3HRZA 2EIBA 3MRDB 4BWWA 2IFGA 3IBOA 3IFNH 3K4ZA 3MLUL 3L3IB 3MA9H 3VM7A 1GC1C 2VDQH 3FTZA 1NPNA 5AD0A 3QWRA 1LE9B 2IVFC 3CSFA 1DLHB 3WNMA 4F33B 3OR6B 3O4LD 3FMGL 1UOKA 3WFCH 2FSEA 3MLXL 3OLDA 2P26A 3IFLH 1MJ7H 4YK4C 3TIEB 1KLUA 1U92B 2DMKA 2C4FT 4C56E 2Q8AH 4XVSH 5EZJA 4QHUB 4OD1L 4JVWA 2VLRE 1OARL 4H8WC 4N0CC 1KJMB 5L2KA 2UYLA 1LD9A 1TSRA 3VFGH 2DLHA 4I18A 3EAKA 3VI3F 3IJEB 2WXHA 4CJ0A 5EEZA 2DJ4A 3PY9A 3CV5A 4FQPA 1BF5A 4JHVA 1MFBL 2VSDA 5DRNB 1CJYA 2EXWC 3GMNA 3GMQB 2DL9A 3X2QB 3BP7A 4DPCX 4C56D 1DJHA 1H3PH 1OAJA 4IOSA 2YBGA 5CILH 2CO3A 3ZGIA 2H0FA 5B39B 3T6ZA 2CIIA 3N40P 4GAAA 4KJYA 5HGDB 4KZEL 4NPKA 4ZTOH 3MGOA 2C9AA 4HWNA 1BXUA 2Z0UA 4TL5A 3MI6A 4Z7WA 1GZPA 2WLYA 3V10A 3HAEA 3MOBH 4G8AC 3UMNA 1H0DB 2NDFA 1BREA 1BZ7A 5KYYB 2VC2L 1FZJA 1FZMB 2AEWA 2ATKA 2UWEB 4NRXB 3TBYA 4JFXA 2ITDA 2IG2L 3D87B 1C5DB 3OAYK 1RPQA 6PCYA 1MAJA 5LNGA 5FB8A 1UFUA 2DQIL 4ZO8A 1FNFA 3L5JA 4NM4H 5GS0H 2ETWA 1NC4A 5HHOA 1OAYL 1JGUH 1U2HA 2ITFA 5EU5A 3S0PA 4AH2B 3MRKA 3EUUA 3KYMB 1BVNT 3ULVH 1KJ3L 5B3JF 2Y4SA 3SCMB 3RTQB 2LQRA 4NWTL 4Y16B 2OCFD 3UO1L 2Y5TA 3GYRA 4MX7A 3U7AA 4GBXB 1NFDA 4Q97A 1CI3M 3TH2T 4LLUB 2XZAL 2HTLC 1ACYL 4HJ1A 4J39A 5I1JL 3A67H 2GBVA 5D1ZI 1LO4H 3VI4B 3MV8A 3WV0A 5E2JA 2I9TB 3PWNA 4MXWL 5IY5B 2QPFA 2WCPA 3IDJA 4L8CB 4LEOB 4CC1A 4R9HA 5CFHA 5C0ND 4LCCA 5FO8B 1YQ2A 1XF3A 2N56A 1IC4H 3O6ML 5T1KD 4LPXA 4G8EB 5I0ZA 3DGDA 5E94B 2YOCA 2IPTL 3T0EB 5HY9A 3EGDB 4CU6A 3HBZA 4LHQB 1ZVYA 2IANB 3GJEB 4P2OD 4NFCA 5DFTA 3X1FA 3LN4B 3TTYA 1G7PB 3UZVB 1RZPA 4UQEA 3QZOA 4GUOA 2HRLA 2ZCKH 1AP2B 5ISZA 5LUMA 1H8OA 5CSBA 4Q7DA 3WS6C 3CZKA 3PL6A 1M7UA 5AQ0A 2K6ZA 3D39E 1GTNA 3QFJB 5E8NB 4NWUH 2Z92A 4UQBA 1KOAA 1M56B 3OVUB 5LKNA 1Y18A 5TPWH 1A4JA 4HSAC 5C86A 1N6VA 2CO7B 1GKOA 3ESMA 1Q0YH 1TJGL 1NCOA 5CR8A 1WISA 3ZXAC 4AZ8B 5DA4A 3L9YA 5C0GB 5GQBA 2X6UA 3BX7C 4OSUL 4Y4KA 3WXVL 4EQ3A 1J88A 1UCBL 2R51A 2CRZA 3L45A 4Y5YA 4ZS6D 3UJJL 2VLJB 2FBJH 3NJFA 4YBLB 3WEXB 1ZPLA 3HMXH 4RDQF 5IG7A 1CU4H 4IRJA 3QXVA 4XC3L 4JKKA 1UXSA 3D39D 1MIMH 4DETA 5LLIC 4I7ZC 2O6CA 2ZT9C 1BFVL 4MDIB 1I3VA 3F7VA 3QUXA 3BVUA 3IDGA 5I9QC 2K45A 4JFFE 4WCYH 1BVZA 4PG9A 1BBDL 3UTTB 3FQTB 1QHOA 3VFSA 3OB0H 5FOBB 1HXKA 2ZKHL 4JKPH 1T1WA 3B7TA 1EMTH 5DD5L 5K9JL 3O3AB 1IFHH 2EYTA 5F7EL 5HHNB 1QATA 2HYMA 2R4SH 1AKJD 3QORA 5DUPH 1YO4A 3K6FA 4LBAA 1H6TA 1MCOL 2XXCB 1G6RH 2LV4A 2BNQA 2C1PB 3OXRB 3WE6A 4ZPTA 1KCVH 3RIFK 3BH8B 2XQ0A 4BZ1L 5IV2A 1MW1A 3FJTA 5EV7A 4PJ9C 3ME0B 4L1TA 2HFFB 4L9LA 2DQFB 4JPKH 1UXWB 1ZVSB 1LLAA 2GT9A 4GPVA 4UV4H 5CGYD 2AW2A 4AL8H 1A7RL 1QLRA 3QIWA 2PTVA 3D0LB 1KEML 5HI5D 3RWEA 4BE5A 4DW2H 3EYUL 4DGVH 1Q9KB 5EOCH 1I7ZB 5BS0B 4OIIH 4G6FD 4ZQKA 3FQYA 2JKXA 2M8XA 1QP1A 1HIML 1Q94B 2DWEA 3SDDC 3OKKA 4MAUL 4P4KD 3U7WH 5C1MB 2WZAA 1BDYA 4ZT1A 3UTSE 2FATL 3K2IA 5T33L 3E80A 5KSAC 1YEDB 1SXCA 5EOQH 4UTBH 3VFRA 2C9QA 2WYHA 1J0IA 4WTQA 3HJEA 1E5AA 1SXZA 5GPRA 3VWKA 4CMHB 3QIUC 4GKNB 3FTSA 4GKOA 3CFEB 4JGJA 5LCVA 3BZFB 2G9KA 1BQLH 1HZHL 1AO7E 4UT6H 1KT2B 3SGKA 2HJLA 1K5NB 1OGAD 4GSUA 4B3VA 3BLBA 5A2JH 1A9BB 3X14A 3VI3B 1AI1L 3JBG7 3DPBB 1H6EA 1E4JA 1CL7L 2MTPA 4MNGB 5GRUH 3U0TB 1DVFC 4OLVL 1A6AA 1MVFA 5ICYB 1YLBB 1U8JA 4BKLA 2P80A 5DEGB 3V52H 1G9EA 2IOIA 4JANA 4LBEA 5D7EA 2E7HA 3KL0A 3LXUX 3GLDA 5D2LF 5EIIB 5L88H 1S9KC 3PWPD 3U2IA 3SGJA 1MHEB 5B1JC 4TTDD 3SQOL 1K8DA 5CP7A 4J27A 1WWWX 4NM8H 3ARXA 1E9OA 4O5LH 1WTGT 1PZ5B 4X5XA 1RERA 4N87A 1O7SA 2YGOA 4H26B 1FNSL 2ZAIA 1FRGL 2EACA 4MYWB 5E8PB 1TZIA 3G6AA 1RSYA 3BQUD 5I1LB 1FAIH 4JPIA 4LHUB 4NUQA 1QRND 2V7HA 3I6LE 4M8UA 3RFZC 4MQXC 4WF7A 4JJ5A 1DUZA 1DVTA 3BP4A 4KXZH 2J57A 1MFMA 2YSTA 4LCIH 3UTQA 2H7WA 4UIMB 1B2WL 1OANA 4APXA 3BSZH 3VXSE 5IHBA 1AKPA 4ODWA 3T04D 1IX2A 2QKIA 2P24A 1PKOA 3RPIB 1CFVH 3GXNA 4NQXA 3KPRE 1HDMB 2CO1A 1EHKB 4NO0A 3IJSA 1B0RB 3BIBX 2ZUYA 2H41A 3P4NB 1PD6A 4PUBL 1U8KB 2NY2C 3I6LD 2WVVA 1XCTB 3EYOB 1M4KA 3PE9A 4TUKH 3JWNC 3MJ7B 4RISL 2XZQH 3F6JA 1SEQH 3T8XA 3VXSD 4AK2A 4FFYA 3QO0A 1XL6A 2X42A 4RX4A 2QHRL 4JZNA 4CRPA 2VZTA 3KPRD 1WCQA 2AK4E 4GKZA 3ZL2A 1Q1PA 1HI6A 4XMPL 1XIWC 8PAZA 2R39A 2VDKB 4KWUA 1HWGB 3A5VA 4HIXH 4K9JA 3VH8B 3BUTA 1QUNA 4IQHA 1NLDH 3S96A 1HSBA 3AQYA 3LRHA 4K8RD 1ROCA 4HBQA 4MA8H 1AR1B 2F58L 1RPKA 3ZKXC 3WJLC 3MCYA 4JZJA 4OLYH 1AQHA 4X83A 2ENQA 1SLVA 3MRFB 1KCBA 2XWEA 4YQXH 4YHZH 1NCGA 3VXTA 5AFAA 5I8KL 2OJEA 3O8XA 1K4DA 5LN8A 2AK4D 2LFEA 3QCVL 5HHXH 2X6MA 2D31B 5CINL 1KDIA 3G3LA 1T2QH 1NWOA 2XOTA 1SMDA 1XX9C 3Q8AA 1RSFA 2OXGA 3WY1A 3TEYA 1WA2X 4HJEA 4QJ5B 1UZ8B 2Z31C 4LCUA 2APSA 1J5DA 1MVUA 5TE7H 4CKVX 3DBXB 1QOKA 1ZHNB 2ENSA 3OC5A 5EUKB 5G4MA 4F57H 1MFCL 4H0HB 1I1FA 3H56A 5AAPA 1KLFA 2CR6A 4FERA 1JFQH 2FIKB 3VFVA 1ZS2A 3G5XA 3QDGE 3IJYB 2X4RA 5E7BA 5K9KB 2HVJB 3ARFC 5FWRA 1WFTA 1T1YA 4YDIH 1N19A 4XOCA 3S2AA 4IDLA 3GM0A 4U1MB 4YVUA 4FXGA 1L6XA 2IAMA 2J1KA 1WITA 3DUUB 4X6CB 4DKFL 4KC3B 1C12A 1TQUA 2PR9A 3Q8CA 2QSQA 3BLKA 3GSVA 4HUUB 2C4XA 4U1NA 1QFPA 2NY3C 3K2UL 4MNQB 4UNUA 1CF8H 4WWPA 1NEZA 2JNZA 2V2XB 4NOBA 1ODUA 2I9LB 2CK2A 5L7XL 2YAPA 1OALA 4L8DA 1IVTA 4JJHA 4M7KH 4RAVA 1BX2A 1KN2L 5C3IA 1NGYB 4R4ND 3WS3A 2F1BA 2HX9A 5GGSY 3X1NA 1MRFL 1N2RB 3VXRD 4LPTA 2X4UA 3VXME 4X9YA 3TBVA 2FUQA 4J4PA 2BW4A 5F1NB 5B1BB 3CFDA 2FGWL 4U6XB 3FT1A 1ZT4A 2DJSA 3N0PB 4D9LH 4R7NA 3KCPB 4MYPA 5GZNA 1T2JA 2LVEA 3CCHA 5A2BA 4HUCA 2TSAA 3LRKA 5FW8A 3MNVA 4KKNA 2QV2A 1A5FL 2BSCA 4FFZA 1EXUA 3UZQB 1AOZA 2NRDA 4I0PB 1HESA 4YZFE 3UCRA 4BQ6A 4QXTA 3WTVA 3VFPA 2DM2A 1A02N 2YS4A 5DWUH 2JXMA 4IRSC 4E42B 3BUYB 4HU8A 3F5WA 4I48B 2A6KB 2GQHA 4JFDB 4LLMA 4HALA 3FFCD 1INQA 4R97C 4NBXB 2AANA 1M1SA 4KI5F 2GCYB 3ULUD 1XF5B 3BLPX 1I1YA 1X6LA 2W38A 3MBED 3LKNB 3GHEL 4GW5A 5HDBF 4CC4C 5F7WC 4PJBF 1ZT7B 3LRSB 5DD3H 1DQJB 4G6AC 1KCSL 1UGNA 1OF2B 1E28A 2EIZB 3N5AA 4DP5X 3U9UA 3E38A 3F58L 3PWJA 3H8NA 1HXYA 2ADFH 4OFQA 2VR4A 4OCXH 2DY2A 4JFOA 4K94L 1IGJA 1E0OB 3P2BA 1WWCA 3IPBA 3WTSA 4OCYH 5DJ6A 2DYPB 2WKOF 1JWUA 1L4IA 3SYPA 4LQ1A 3QO1A 4BZYA 5AZEH 2EUXA 1G9ML 2ZKWA 5LNDA 4YDLB 4GI8A 4UV7L 3NPSC 5CJBA 5FYKH 1OAXH 2ERJB 4HF5H 1A7QH 3N41F 3QDMA 5D2LB 5CP3H 2J1YA 1F4WL 4MA3B 4XT1C 5ETUB 3IMVA 1BVNP 3S34L 4NC0B 1MCHA 1TTFA 5LQBL 4QF1A 4E0RA 2XWBA 1L0QA 3ARGB 4NZRH 4JQIL 2E27L 5IVZA 2L7UA 5LB1A 3O45B 4TQIA 1T04A 3E8VA 4FYRA 3GZQA 5T1MB 2YD9A 1I7RB 2BXYA 2FHFA 4B60A 1RJZB 1UEMA 3TBWB 4LCWD 3GIVB 3HRZC 1HL4A 3GUTB 2OSLA 1GH7A 4FCAA 3TBCA 1L0XA 2ZG3A 4UMSA 4JFPB 4G82A 4XE5B 1N5YL 5DO8A 1AFVL 3ZKND 3NDZE 3ARSA 5LHDA 1MHHB 4PLNC 1TVHA 3QCUL 1PY4A 4ELMF 5I8EB 1SBBA 3IDMA 3PNRB 3P11L 1AHWA 3DGGA 1G1OA 3HE7B 5GGRY 5IESL 5F7FA 3D2UA 1B4JL 1Q90A 1BD2B 15C8H 5GRYA 3WG7B 2NY4D 1GJIA 2JJSA 1JZ8A 1W16A 3M7OA 4MRBA 2EDXA 1EV2E 4I18C 4JDVA 3UAAA 4MVBD 1IM9A 5H37A 1SEBB 2WTOA 1EGJL 4OIBA 3APMA 5FKAA 1AGDB 1MWAL 3X17A 1S7WB 1DN2A 1EAQA 3Q13A 3ARBA 4Q14A 1AS8A 4ODUA 3VSTA 5I1GH 4IIQB 1RUKH 3NIDF 3WUZA 2AXHA 2DTSA 4Z7VA 5EZPA 1EO7A 4KO6A 1HFUA 4O9HL 3SDYH 3T3PE 4M3HA 4MMZB 5FK9A 1UA7A 3DV6B 4YJZL 3DRTA 1FLTX 2KUTA 3GTVA 3QUKB 1KV3A 1LNUB 4GSQA 5G55A 5F1OB 4MJ4A 2GABA 1WCBB 4ZMYA 1QI3A 1MOEA 4QKTA 5L6YL 3RL2A 5IIEA 4HLEA 2AJZB 4POZC 3TZVB 4I87A 4HZLA 3FQWB 5FFGA 4ABVA 4HWZA 3LXCA 4ZUVB 3WAKA 3E8UL 4PVNA 2QLVB 4XE0A 4EDWH 4N0RA 2CXGA 3ZTJG 2ZUQB 4XCFL 5DK2A 5AW4B 5KSUB 4XNZC 5DQ9B 3HJ0A 4OLZL 4QHLA 2FH8A 2JIXA 1KJVB 4QRPE 3P3UA 2VXUH 1J5OL 1IGIL 4PRNA 4Z95H 2R69A 4KTGA 3UPCA 1PZ3A 3C60D 4OI9A 5DS8A 3TEXA 5GRJL 4WFGE 1AANA 5J3HC 5EZLB 5F93C 4ZMQA 1I1AD 2NTSP 1F42A 3VD2A 3GS0A 3B9AA 2F7IA 3TA3A 1WA0X 4JPSA 1PZUB 2WCSA 2G60L 4UQDA 1BPVA 3L4TA 1EJ8A 3DRQB 4N6QA 4QRPD 5ERWA 5F72S 1IC7H 3V2AR 1KCRH 1JRHH 1NEUA 5JORA 2MNWA 6FABH 4WFGD 1XZWA 3FSWA 1ZGLB 1S7SA 1R3IH 5ACLA 3T8MA 1LO3H 3C08H 2R56L 1NJ9B 1OV8A 2KHAA 3MNDA 4JUTA 3WIHH 3IETB 4HHWA 2NZ9D 5JHLA 3SPHA 1HNYA 3MROA 1X5YA 3T09A 2QQNL 4ONFL 3RGVB 4NKQB 5E2VL 4F7MB 4LCCC 3VXNB 2ZKYA 5INDB 2VXSL 1NICA 2JJVA 1IT9H 4OAWB 4PREB 2IEPA 2OK0H 2HJKB 4MZ2A 2M83A 4KUCF 5B38B 1YEKL 1Q38A 2K1MA 2WXIA 4ZS7H 1R6VA 2MCPH 4YDZA 3VXPA 4AGPA 2EVIA 2V17L 5ANME 1HCZA 3MV7E 2DM3A 4H8WH 4OM0L 3F84A 1YMMB 3SPIA 1X5GA 4LCYB 1P7QA 2ZYIA 4XMXA 4HXBH 5CAYB 2Y25A 4L05A 4AQ8A 3ZOAA 3RGBA 1YEGH 1WS7A 2QL1A 3KPQA 4Y5VB 2GTWB 3PL6C 2PTUA 3CTTA 1HL9A 1D5ZA 1NGQH 1UATA 3BKMH 4KNSA 4DN4H 2DQTH 2OMNA 1CS6A 2IDQA 1GSKA 1J05B 1H3XA 3UJTH 3MV7D 4TSAL 2ESVD 2IGFH 3U6RA 5K59F 1KB9J 5FUCC 5CJXA 5IQ9B 4R2GC 3ES6B 4BA0A 2GC7C 3HBQA 2FR4A 5C6PB 2LU4A 4NUJB 4Y4KC 3QRGH 4C8XA 4DVBA 4Y5YC 2ZP8A 3LN5A 3G08A 3K74B 1IU1A 2RR3A 1INEH 2WOBA 3ROLA 1R3HB 4IRJC 3VFGL 2D7OA 2BLFA 2YFNA 1AYOA 4M1CC 3N50A 2VZOA 3P4OB 3HHSA 1SNRA 5DYFA 1NFIA 3B43A 3MCLL 3QUXC 2VMEA 3C5SA 4C56A 4PS8A 2ARJQ 5I28A 4ZBJA 3OAZH 2VLRA 4MA1C 2GJPA 2XSKA 5HDBB 4FCHA 1DHKA 4PJBB 3PCYA 4BQ8A 1XSOA 1X4XA 1YJDC 3W0WB 2A74A 1C9SA 4KZDL 3QORC 4BINA 5KVFH 2NY1D 5CJOL 4G70B 4R26L 3FOMA 1T0NA 4KX9A 3RYMA 3GS4A 3MBXH 1MJ8L 3EJPA 1S5IH 2FE0A 2BP0B 3F12B 4JREC 4QEGA 4WY7L 2Q87A 5I23A 5JW4Q 2O26U 1FFPA 2BRRH 1YQVH 5SWSB 4L9LC 4HX1A 2WJ5A 4R90L 1KTLA 5C9KA 1C16B 4I89A 1MUJA 3KYOA 1AGFA 4AX3A 3QIWC 5EU4B 5ILTL 4Z6AT 1PAZA 3HFML 2AQQA 3N41B 3C6LB 4NLHA 5D2NE 3KCWA 2YZ8A 5LGJB 1KDJA 1UH4A 4ENZA 4QRAA 4M93C 1K6QH 2BNRE 2G2RB 1N64H 1RLWA 4WRLA 1J9SA 4OGAC 4KO9A 2GW5A 4TPRL 1E42A 1PZ2A 4YHKH 4OCLC 1SYSA 2MKLC 3EYQD 3LD8B 1XBDA 3WHXB 4X4KA 3DIVA 2ZX7A 2A9BA 3MNMA 1OP3K 1EXGA 1J0JA 5PCYA 2BINA 2JJTA 2GTZA 3VWKC 1H8LA 2DM4A 1RJYB 4NUMA 2XRAH 1A1MA 1QYGH 4MDJB 4ELMB 3KH4A 2VABB 4FADA 4X7TA 1FC1A 1W0WA 3MJ9A 2YAMA 4N0YH 1I3GH 4EJ1C 1MZZA 2VDOL 3B5GA 3GRWL 3MV9E 3EHBC 2Q6WB 3SGKC 2FB4H 2PYFB 3FCTB 1FVEB 5KAQF 2YAFA 3OAYH 1TCRB 5I73B 3FBKA 4YDVA 2IIJA 3II2A 1QLEH 4QXUH 5D70H 2XT1B 3LKPA 2LTQB 5IWLA 1FNGA 1MZYA 4XBGB 4FAAB 2JELL 1DJWA 4M4RA 5DGRA 3RZCB 4AGQA 3ETBJ 2CK0L 3QULB 5IMKB 3QZWG 3MV9D 4OCSL 4PY7A 5TDNA 2A83B 4P06A 2XWDA 2YR3A 4ODHL 4WJ5A 4XBEH 3SGJC 3QHTC 1OAZL 2AGJL 2FX9L 1JIBA 2Q9OA 4JFTA 3ZE2F 3ILQC 3K7UA 3TGXA 2OJZH 3MBWB 5F9JB 3PFQA 3IRPX 2NW2A 1FDLL 3SJVB 3AU1B 3NRFA 1MI5B 3SBQA 2QPEB 3K80A 2J88L 2VQ1A 5C07D 3KYKH 3AUVA 2JTYA 3QHFH 2FLRT 2E6PA 4RIRA 3A22A 5LBSL 4DVRL 5HHMB 4HOMA 4V1DB 3D39A 4HC1H 2Z4TA 3U46B 5DT1H 4NC1E 3GRGA 4KK9C 3VYPA 5EOCJ 2UZXA 3Q3GA 4S11A 3QW9A 2QKIC 4X8JA 1CXIA 4GRWH 1ADQL 4WGKA 3HE6B 1BYPA 1V27A 3AS0A 1A3RL 2DQCH 3LRLA 2IMMA 5GS1B 1AKJA 3RNKA 2HLFC 2X40A 5SV4A 1V7NL 4U2YA 4RWHA 1ZHKB 1JZHA 4UM9B 2TAAA 2VR5A 3WJMB 3IMBA 1NKGA 4JFFA 4MS6A 2QSVA 3AU0A 3PGDB 2ZQKA 1OGPA 3IDXL 3DHPA 4LAJH 1NCWL 1PLGH 4IHOA 1ASOA 4TVSa 5IVOA 2X05A 1I9RL 1Q9LA 3JTSA 2FDBP 3QQ9D 3BO8A 5KANI 4Z7OE 3I2CL 3ZUCA 1CXHA 2AEOA 1J8RA 4Y2LA 4PJ7F 3TWCH 4GAJL 5K69A 2DV6A 4HUXA 1LYQA 2WQVA 1O5PA 3NZSA 3EOAB 3U83A 4DGVL 4EI5D 2F5AH 4AWJC 3N85L 4JZJC 5IQ7H 1DQIA 1JF1A 4P4KA 2YD6A 2R9HC 3PJSB 3KPNB 4UCFA 3O8XC 5IM7B 3KW8A 1M6OA 4PRPE 2J4WH 5GS3A 2W0FB 2DI9A 1CT8B 1OCCB 1ZTXH 1FN4A 3I50L 1CICB 2BSTA 3N43F 4U2ZA 3NEEA 3HUJF 3A24A 4JL2A 2IV8A 1ZLUK 1L7IH 1UWEL 3FQNB 1ETJA 3ZZSA 2UZPA 4DAGH 2Y7QB 3CHXA 1DVXA 4N5EC 1M2VA 1MCNA 3I6KA 4N8CH 4LOVA 4QPEA 4DWHA 5IQOA 1U8IA 1WG3A 1XO8A 4PRPD 1VPOH 3UFIA 2EVGA 3UTSA 1JZ7A 4MJHA 5CUSH 3C5ZB 2Y23A 2KZ1B 4O2FB 2R29H 4GAYB 1FZKB 3H1ZA 4KUZH 1BBJA 2PETA 1FPTH 4JHZA 4YBQD 1HQ4B 5CCGE 5JQ6L 2D7PA 2DPKA 4MSWA 2HT2D 2Z7YA 3MV01 1L6PA 3PWLB 2IAMC 4BXSV 5D4IA 5D6DC 1GL4B 6PAZA 3NRQA 2HTKD 1AO7A 3WTWA 4GG6F 3GUFA 4DCQA 4S1RH 5DK0B 1F1DA 3FO9B 3B1UA 4FYQA 2EXTA 3KPLA 2IV9A 2QADB 2H8PA 1G43A 3FU7A 1E6JH 5E6IB 4HP5A 3O81A 4F92B 4Z7AA 1NCDH 4FXKB 4RAUB 1IAIH 2ENYA 2YWYA 4PGEA 5I0WA 1WK0A 1JPFB 4OCRH 4HQQH 5IQNA 3NCJH 3T77A 5GGTL 3WMPA 4PHXA 4ETQB 1DEEB 4OJFL 3QAQA 1REIA 4J4PC 2R2BA 3BQUA 4YLCA 2IH1A 4A7GA 3NJMA 2XN2A 3ZSSA 1NM9A 4KHXH 3WFDL 3JWNH 1I8IA 3PQYB 1JRHI 1MFEL 3HNSH 5KBKA 1XR9B 3LKRB 1U36A 2X4PB 3U0WL 3LIZA 4OUUA 4DSYA 4AGNA 4IOIB 1OOAA 4KDTA 5E0FA 3UJIH 5C0BD 2AJVL 4LSQH 4Z0BL 5HYJB 4ELKA 1CE1L 3CPLB 4K5NA 35C8L 3H6AA 2H0JA 1ZLWH 1MREL 3T1WA 1JZJA 3BD3A 3F00A 4TUUA 1E9PB 1RJLB 5EZOH 4GUQA 4UILH 2Q7YB 1H8SA 5C2UB 5J13C 3H2QA 5EBWB 1C8PA 3B2DC 2J7LA 4CNIA 2AXGA 1V7ML 3BT2L 3ZT5A 4TLSA 1KLGA 4S0SD 3WMQA 1JP5A 2PTTB 1MFUA 5A6MA 3VXSA 4J3OC 1DE4B 1PIGA 1NBYA 4PJHB 1HTYA 3TNMB 3AACA 3KPRA 2P8MB 3S8WA 2A38A 1UWXH 3FTUA 4KY1L 4IJTA 5HPMA 4PV9A 1KJ2B 3P40A 3P3SA 1RZFL 3VTMA 4XVTH 4O2EB 1MG3C 1YEEL 4Y1AB 4MJ5A 2OL3B 5FFOA 5KUMA 5AOIA 2A9AA 3SDXE 2AAVA 5EO1A 3P54A 2CDEA 5F7DA 1V3KA 5IROC 4R0LA 4WI0B 5HGBA 1OSPL 1WBZB 2AK4A 2R2HA 4OLYL 1VFBB 3MOAL 1FYTE 2QEJA 2BSSA 4UNTA 4QRUB 4HDIA 2ZKXA 5DFVC 2BNUA 2X89A 3FO0H 1FQ9C 2FIRT 4X99B 3T65B 3IWUA 1CXFA 3ZE2B 1AE6L 2YXWA 4XHQA 4LVOC 2A0LC 5IHUL 5DHVH 4AQ1B 5F6HI 3AXLA 1XQ4A 3PP3H 4KRLB 2W9EL 1JPTH 4HS6B 4LP5A 3HMWL 1LILA 5DZ9A 1FYTD 2H4EA 2XLLA 43CAA 3NJVA 3GIZH 4M7JL 3JT2A 2DMGA 4ADGA 1GAFL 3QG6B 5BXFB 5IB1B 1UD3A 5AAWC 1EERB 1A8JH 3CN3A 3JXAA 5CBEA 3I75A 3ZIMA 3NH7H 5FDWA 4MJIE 4HG4K 3TNNA 2IWFA 5LGHH 5EDSA 2NYYC 5T3XH 5I5IA 1AHWC 2XV0A 4Z3HA 3ALWA 3CXDH 2NYZA 1NLBH 3PXJA 3QDGA 1ZXQA 2JJSC 2NSXA 3P0VL 3O0LA 2CO6A 3Q2WA 3PXLA 5AYTA 4MBRA 5AZUA 1EANA 4MB5A 3REVA 1E2WA 3BGFC 4BFBD 1BGXL 1DSYA 3ARBC 4PVLA 2WXNA 3TLRA 4ZTPL 3FK3A 2H6PA 5HHVH 2NQ3A 2K6WA 3CQQA 5DJ0A 5AKTA 5F3HA 2D03H 1P84K 3VXQA 4AEIH 4AY0A 1SY6A 4FMKA 3UPRA 4HCRA 2WP3T 1S7VA 4ODTL 3GDBA 4OLUL 1ZKAA 4U1IA 5CMAA 3WN5B 1L7TL 1WSST 1OGTA 2BVPB 4RMQA 4GINA 1IE5A 3V6ZB 1UZ6F 2WYZA 4U6HB 4OV5B 3WNNA 3L2LA 4TLKA 3P69A 5F8QC 2ZOKB 3T4YA 3VXMA 4TRPL 3D4ZA 3VFNA 4OZFB 4Z0XB 2J12B 3U25A 2DH3A 3UYRH 1RZJC 1FBIH 1ZEAH 4AM0A 4QGYA 4FQHB 5TQ0H 1OP9A 2UXFA 4FMFA 4XX1E 3IEAA 4WU7B 2WWMC 1DL7H 3US1A 4A6YA 3OKMB 5HHPB 3N43B 2DQHH 3HUJB 3MBEA 4XPAH 5F2FA 4AC2A 1TQCC 4S1QH 1ZA6A 1OB0A 2EZ0C 1K8IA 3OHXB 4IU2A 3S98A 5CCKL 2Z8VC 3L08A 1AACA 1UYWH 3A6BH 4Y9EA 1MHCB 4PLKC 3TA3C 2YPVH 4IM8A 4XI5D 1XB6A 4KKAC 4LARL 5GGUA 4X8XA 32C2A 3OKNA 1ND0B 1T66C 4PB9L 4U1KB 4EMZA 4HBCL 3QVAA 5E4EB 1INDL 3RWDB 3PABA 5EORL 4CVWA 4EI0A 5JPNA 5DJCB 1KGYE 3K2KA 3L5XL 4FP8L 5MERA 3P4LA 4ZG1A 2GJZA 4M62H 4NQVA 1IJ9A 4PH8A 5LNEA 4LEEA 3RX7A 4DH2A 3ZKMC 3BDXA 2B08A 4GG6B 5DC9B 3K8LA 1EJOL 3GT6A 3APFA 3EJJX 5KYWB 3QAZC 1BZEA 3RWIB 4CBPA 1VKXA 2H5UA 2FWLB 5FHBL 2A1WL 3T3ME 4Y7OC 1PGRB 3HVNA 5DS1A 3X12A 2MWCA 3CFCL 2BFVL 5CZVL 3TCXA 2FHCA 3CSYB 4XMKL 1NOFA 2XWJB 1GKEA 3BMWA 4RFOL 1LWJA 1TU2A 1JXDA 4A04A 2D73A 5MEPA 4OZIE 2P8LB 2AS5M 1ESOA 1X5FA 3HB3D 5HHXL 4AQ8C 3IGAB 2FJGB 2VDKL 3TYFA 2BIMA 1WEJL 3QUYB 4QNPF 2H6UA 3F6LA 2AXJA 2P3YA 3CZUB 2OP4L 3A21A 1WC7A 3LKOA 5GGVH 4NRYB 5DGQA 4DP1X 2FWSA 4A68A 4W6YB 3GSXA 2QQKH 3MUGA 4GUPB 2ORBL 3SYQA 4PCTA 4PJCF 3BWAB 5KANG 5JIPA 1XWVA 5CJXC 4XMZA 4O4YL 1HXMA 3AW5A 5EU3A 4N5UA 3DX9A 3VGDA 5EBGA 3BRDA 1SYVB 1CFNB 2BOCB 3J2PA 4E41D 4J3OF 2O5NA 3MFFA 1FL5A 4B7LA 2VIRB 3V4PB 2OYLA 5L8JB 3L1EA 4J3TA 1CPUA 4LSPL 3K6NA 5C92A 1LK2B 5MEOA 1TSHA 4L3CA 3WNPA 2W0PA 1FGNL 2HN7A 4H0LC 3U4BH 4MD0B 5I6MA 5DSCB 2FEEL 1PD0A 2WKLA 3RVUD 1CR9H 2CD0A 5IMLB 3E3QE 4K3GA 3H0TB 4KMTH 1A9VA 5B8CA 4PJEE 2WBXA 3M1BA 2A74C 1BIHA 4BGLA 2G0LA 5TH2B 4JO4H 1WS8A 2W94A 2I07A 5I18L 3OWRA 5DQDL 5INCB 1AD9A 4P5TD 2VGLM 1MCWW 3H9SB 3NEOA 5FA3B 4JE0A 5KW9H 4WI9A 1X5LA 3Q8FA 5AVTB 1KEGL 5I1KL 3QIBB 1BZ9A 2VO8A 3C60A 2BY0A 2FQEA 2JQZA 3PDGA 5D7LE 1RY7B 5H35B 3QEQD 2GFBA 4WKZB 3P9LB 3KBEA 2W88A 3LQMA 3MO1A 1I1AA 3LPFA 4RGOH 4TQPA 1L9NA 3MHZA 4HJIA 5G4OA 5I1CL 1RURH 1XHHA 1JNHA 5AB2A 4ZZFA 3RZCA 4HJTA 4QRPA 3QJRB 4K3DL 1UB5B 4ORGA 5TD4A 5FOJA 2F54E 3PAVA 2BY3A 5DMGD 1M05A 2BY1A 5D7LD 4HKJB 3SOBH 1N6UA 3BCFA 2XBTA 4YHMH 2JJTC 5KJRL 3NJIA 3VFOA 3HZKA 3F65A 3QQ4A 4RRPA 1IAII 4APQD 4U3XA 2AJ3B 4FA8A 2PCFA 2QTEA 1BFTA 5HHQA 1M9WA 4Y4FA 4LLAA 1LMKA 1SDDB 5DI8B 3U1SL 4G43A 4RGNE 2Y0SA 2JKNA 3Q7JA 1I8MA 4FNLL 2ICEB 4R7VA 1T7VA 3BOVA 3GMOA 4XC1H 2F54D 5DHYB 1F11A 5CHNA 2NNCA 2Q20A 1M71A 1CFQB 4O00A 3OSVA 4RQQB 1GVIA 3BRGC 1P5UA 3B3BA 3IGLA 2HH0L 4XAKD 4P2OC 2B1HL 5TQ2L 4CVXB 5IWLC 3NQIA 4N85A 4PWIA 4YHNB 3K72B 1X5IA 5F6HJ 4JVUA 3VJ6B 2VM9A 1F0LA 2Q1EA 3AADB 5FYKU 3QPQD 1V3MA 4RGND 5H94B 4NKOA 3JWOL 4DP8X 1S5HA 3LDBB 5E9DB 1G9NL 3G6DH 3AZUA 2EYRB 4MCYA 2ZCHH 5HJGA 1A7OH 4WFEE 1J18A 1DQDL 1TPXC 5FS5A 2BSBA 5CLXA 5AG8A 1N4XL 1EFXD 3BC9A 2EYSB 5ANMA 3MV7A 1QVOA 3KXFE 4H1LA 1RHHB 4L37A 1PTZA 2JTDA 2K4AA 2XBDA 5EFIB 5KJ4A 4M5TA 5FGCE 1YJDH 4B41A 2WBJB 2Z91B 4YHPA 1QFWH 1R3JA 3NGBC 5JHBA 3VXUE 3O6FB 5DURD 2WUBH 3B37A 1IMHC 5IFJB 4FTVB 1OKEA 2XN9E 3WYRA 5A2LH 2K7QA 4L1LA 1I9JL 2F1AA 1RI8A 1E8ZA 1A7NH 1CXKA 3KXFD 3GB7A 4QO1B 1N8ZA 4I0KA 4JW3A 5AW5B 2K70A 3GMPB 1GGYA 3K5RA 4EXKA 2HVKA 1OWRM 2ZAHA 4PLOB 5EBMB 5BJTA 1IGFL 3TBBA 2QQLL 5IB3B 4FZ8L 1CFBA 3ARDA 4BH8A 3VXUD 5KVDH 3AFLA 3RNQB 2XWXA 4EZLA 4QRRB 1YUHA 2XY1A 1Q72L 4KGLA 5ID0B 3OHMB 1AGEA 1KTDA 1P1ZB 2FBOJ 1TO4A 1KIRA 2IADB 3T0BA 1S7XA 3DNKA 4KMQA 4MS8D 1EJFA 5IK3B 5E5UB 1O5DT 5LDSA 5CGYC 4BV1A 4LFHG 2ROYA 4F24A 4BZ1A 4AQAB 2R4RL 4NQQA 2MMXA 3HZYA 5HI5C 3LVEA 3VDCA 4PCYA 3L7EA 3OZLA 1J1XH 1THAA 2Q7AA 4ZSOB 5F9WB 3CFNA 2WLMA 4DGIH 4NQCB 5LCVH 4PJXE 2A7BA 1E5ZA 1JE6A 1AQKH 4P4KC 4QY8B 3DSNB 1CURA 4HWEL 2L04A 2PWEA 1QACA 2VH5L 4G7YH 3L5IA 3F7RA 3VD5A 1PG7W 1UQSB 2IF7A 2VITA 3BDYL 4RSYA 2EVFA 3HG3A 4LMQI 4XN9A 4YZWA 1NGXB 1OLLA 4IRZL 1A25A 2ADJB 5D2NA 1KG0B 4I2XB 1D5XA 5T5FL 3N40F 1TTAA 2HCZX 2BSDA 2BNRA 3T0XA 2AV7A 1RVFL 3HG5A 1FUNA 3VGEA 1CVSC 3B2XA 1UB6A 4JQVA 2FNWA 2WWNA 1EEYB 3QISA 4HPYL 1HHKA 3NQKA 4OF7A 4XOAA 4YSUA 1RULH 1NFKA 5FCUH 1YY9D 4PJCB 1CG9A 2WUCL 4CADB 4DERA 2HMIC 2WC7A 1IQWH 1L0YA 3HI5L 2B5IB 1S78D 3DO4A 3QZLA 4XRCA 4B96A 4YXKL 3KS0H 3NABL 4UDUB 2IQ9H 1NAKL 4NO3A 5CZKA 2VDRH 4XXCA 4AKPA 1Q1JH 3CZEA 4X7SH 5ALCH 5CEYA 1X5ZA 1VENA 7FABL 5ITFB 3DVNB 2QBWA 3MV9A 2VE6A 3QDJB 4NQDB 3MCKA 5BCAA 2YA1A 3D9AH 1G7IB 3VI4E 3W9DB 1FNHA 1MFAH 3SCMD 5AG9A 3FHEA 1A64A 4FQXB 4QDGA 5F7LB 3RTQD 4Y16D 4F37K 1URLA 3VUAA 5E5MA 1OP3H 5CEXB 3PP4L 3RY6A 1YPZF 3MLRH 4GBXD 1S4IA 3KBHE 3T6WA 1B0WA 3QI9B 4PJDE 4YHOH 5ABAA 1TOXA 3BQUC 3CFBA 3S36H 1AQDB 3AS1A 3QRLA 1GYVA 3T0EE 1SUJA 5BVPL 4AG4L 4EN3A 4NNPL 2IANE 2ZONA 1DUYB 2AABH 4JHWL 4JR9H 2J1XA 1KFAH 2JKLA 3FT2A 3UABA 1II4E 2IWGA 5IJVA 4KDTC 1YA5A 2BZ7A 4TULL 1HE7A 5B3SB 1T1XB 1WF5A 3P9WB 4U31A 3QFJE 2YUXA 3F05A 4WNSA 3EYFB 1YN6A 2OMXA 5AWNH 3T0ED 5BRZB 2CHZA 2ZUXA 3NVQA 3WEBA 3VD4A 3GMMA 2IAND 4FE9A 4HEPG 5D93C 5C0DA 25C8L 5ALBL 3ARPA 4WNQB 3VNYA 6CGTA 3RQ3A 1BFOB 5DJ2A 4Q9RH 4M43H 5D72L 5IFAH 1QBML 3IF1B 4NRZA 1QPKA 2VLJE 3AJ7A 5DRZB 5HD8C 1NL0L 5CLWA 5H4ZA 3L3KB 4YR6A 5DDHB 2GSIA 2R1XB 2A77H 1A0QL 1LDPL 5EB9A 1OAQL 3QFJD 4Q0XH 3POHA 4M6ML 4MQ7A 2N4IA 1VDGA 4MMXB 4DO5A 4PJIF 3V5DA 4PGBB 4UTCA 2X2UA 1S9XA 3UTTE 4B0MM 4K8RC 4EI5A 3KZ8A 3AXHA 4MJ6A 1SDAB 5I6XC 1SHMA 3AWGA 1P7HL 1G7MB 2VLJD 5GSRB 2DIAA 3HZVA 3QXDB 3HC0B 3GXDA 3IAPA 2XBZA 3LQAH 5J57B 1E2ZA 1GSMA 1QLFA 2NY5C 4OM1H 1NM4A 4TXVB 4YDMA 3RDTB 1F86A 2XA8H 2WN3A 4PP1D 4YC2B 1G94A 1ZWIA 5IOPA 1NDMB 5K93A 2XTLA 1JN6A 1ZHBB 4WEUD 1TVDA 4R84A 3UTTD 3ZDZF 2F1EA 4HS8H 2O30A 4KROB 1HH9B 5A2IH 4IGBB 5EF2A 3TL5A 5D96C 2Z93B 4KKRA 2OXHB 2EH7L 4FG2A 4G59C 4JG1L 4NT6B 1A9EA 1XF4A 2CGRH 1FV1A 3K91A 2KQMA 4GAFB 4PRPA 5HDLA 4C47A 1N59A 4QYAA 4YXHH 1F41A 2QDWA 2J5WA 1MLBA 3QUGA 5IB5A 4JM2A 3ATFA 4MA7L 3S35H 1KB5B 5BZWA 3ZMEA 3EJZC 5BS0E 5ABDE 1A1NA 2OQJA 3C09B 3U4EA 1S8DA 4U1HB 4ATTA 4D3CH 3ZN6A 3AM8A 4XZUA 3F6IA 1DDTA 4NUGH 3HCVA 4PD4K 3HC3L 2EEBA 2R7EA 1AIZA 1UM4H 4HZAA 4RMUA 4X6BB 4XCCH 5LWYH 3V6FB 5GRWA 4OCWL 2J21A 4H5SA 3AB0C 1HNFA 4FULA 4X80H 2CA3A 4NPYA 4XPFH 2HT4D 4PPTA 4WW2A 3CX5K 3AT8A 1JGDB 1R47A 3I6GB 1G0DA 4AXWB 5J11B 3BH9A 5BS0D 3S4SB 2GY7B 3MRRA 1IQDA 1U91A 5IBTH 4K9EC 5DHDA 4HHAA 4Y9CA 1YHPA 4KQ4L 2RD0A 2Y1YA 4RCAA 4WEMB 3EXLA 1WZLA 2XJLA 3VMPA 2GEQA 4WFFE 3ATEA 3QFDA 5DUJA 3VX0A 2VLKB 5JW3H 2A4CA 4O02B 1NTDA 5A6LA 1IARB 1KENH 2K8QA 3WKQA 4DP0X 3VI3E 1MQKH 4W93A 5TFSH 3B2MA 3PU7A 1JD9A 2PCPA 3EDEA 4UAOB 4MNGE 4CUCA 4J3OH 1ONQA 2F74B 1BIIB 1ZMYA 4G9FA 1PS3A 4LU5L 1FIGL 2BDNH 3T4AB 2Y36L 4G2AA 2BM3A 5MP6H 3HVDA 3TM6A 3CZFA 4Q6YA 1XGUB 3QUMB 1HHGB 1A66A 2C9SA 5L2JA 1T20A 3JWNG 3LN9A 3ATBA 3M17A 2F7RA 4X5RA 1U58A 1BAGA 3CFQA 4IBQA 2VRKA 1F3JA 3ULUC 2XUWA 2CIKA 2Q2LA 4UNVA 1U8OB 3LQZA 3MBEC 5GZOD 3D18A 2HP4A 4KVNH 4TUJB 4J6RH 2NW3B 3HG1B 1DCLA 2ISDA 3D0VA 4EUPG 5EZIH 4LPVA 5G2NA 3G6JF 3K6SB 1N18A 2R2EB 2Z65C 4NFDA 2GVYA 1OSZA 4YFLF 3N1FC 4NOFA 2AI0L 1PZSA 3KPSB 2IALB 5TDOB 1CGSH 5B3JE 5DCCA 4QTIL 5JPNC 1A6TB 1GCYA 3KWWB 1ZT1B 2UX6A 2QSTA 1OPOA 5E8DL 5DQJB 1WFNA 4QHNA 5TE4H 3S2CA 4E9LA 1OCWH 1MFDH 1WUNT 5FYKE 4LHUD 4YDKL 1SOSA 4XAWH 3BEWB 4CGTA 4QRSA 5GGSA 3Q9PA 4XMVA 2APFA 1KN4L 1CD9B 1CDGA 1QFWI 4YIQA 3IPFA 3LZQA 3SDXA 2ARWA 1S9VB 3NCEB 4JDTL 1XGYL 2Y6SD 1ETB1 3WKMH 4GI9A 4N0UE 3TYGH 5IGXH 4X8GA 1HT6A 1AOHA 1FYTA 1QKZH 3CVHB 3DOSB 5IZ7A 3S5LA 1WAPA 5F0PB 1U3HA 3NCCB 5IHWA 5H37H 4HCIA 1ERNA 4JQIA 1NMAL 1RFDL 1S7QA 1YEHL 3JWDC 4KU1A 4X9BA 1X7SA 4HEME 4JBSA 1C5CL 2DDQL 1KIQA 3ZQWA 4P07A 5D1XB 3SN6N 1JZ5A 3SO5A 4WWNA 4TF4A 4DF9A 1NBQA 4KK5C 4LLWA 4MCZB 1HHHB 2D2CC 4DN3H 1A6VL 4B50A 2WY3B 2NY4C 1SM3H 3CLFL 3QYCA 1MIEH 4DZBA 5EEVA 4PTTB 3C5JA 2NUPB 2ED6A 3MU3A 1AR1D 1IKFL 3LEVL 4MVBC 4FLHA 4MAZA 1UA6L 3CDYA 3PUCA 3CBRA 3QEGH 2PWGA 3VE0A 4MJIA 4NJAH 4Z8FL 3DIFA 4DP6X 1J1OH 1UOWA 3VFUA 3U0PB 3INUL 3CDCA 3AMLA 2NX5E 3IDNA 3NFPA 3HS0A 3ASOB 5JXEA 1DQKA 4RAHA 2PR4H 4GEIA 1O6TA 2VN5A 1MCEA 1MWAA 1CXLA 2FO4A 4GAGH 4IBSA 4K3JH 4S1SL 3DROA 1KB5H 3BAEH 5T1KB 5B8CC 2KERA 5K9OA 1FZOA 3MDJA 4GS7C 4BWTA 2ZYHA 2DBLL 4GG8A 3OAWA 1XV8A 4PJIB 2DTMH 5ITBH 4QTHA 4MXVF 4RMBA 4XGZA 5D4QA 4MNQE 1DQTA 1U8HA 4P3DB 3MNZB 3CVBA 4YS4A 4G83A 3BZEA 1XXDC 1OEZW 1Z1WA 4X6EA 4R3SA 5FF6B 3KLAA 2VUKA 3G5ZB 5AZ2L 5TF1H 2PO6A 4BFIA 4CVUA 1MAKA 5HDQL 4HFWB 4NN5B 3T1FB 4OF6A 1BQUA 1TTGA 4WV1B 3BGMB 3C60C 1JK8B 1URIA 2X3CA 4XCYA 2J72A 4UTAL 4PRHE 3IXTB 4WUUB 1I1AC 4F2FA 3ZDZB 2WJ7A 2E7LA 1D7BA 4MNQD 4JPQA 4DGYL 1S6NA 5JHLH 4ZMAT 2CDGB 1DVYA 2FWUA 4PJ8B 2Y7MA 1TETH 3MRJB 3PGFH 3RZCC 4UT9L 3SD2A 1M7XA 1B2YA 4DK3A 3MRNA 2B2XL 4PS7A 4AVJA 2V33A 3C8KA 3V0IA 1F4HA 1CBVL 3EF7A 5GGRA 2EDMA 4A67A 4QTFA 2Z7ZA 2X3BA 1KMGA 1R3KA 1P53A 4AVHA 2ZYSA 3DURA 3STZA 1DVSA 2CHWA 3EGSB 2HFGL 4G6JL 4G6ML 2YAOA 4XCEA 2DL2A 3L3HA 3PDOB 1MY7A 2DQJH 3HNTH 3U82B 5FA4B 4RBPK 4R7DA 4KJQC 3TT3L 5E6ZA 3LXAA 4G8GD 4YSPA 3D0AA 2A99A 3OMZA 1J9TA 2IDUA 1SZNA 4Y4HB 1RU9H 4QAMB 2CUMA 4NERA 5DD1L 1IEAB 1EFQA 4HIEA 3R8QA 4HLZG 1HILA 5J9PB 5DJDA 1P5UC 4KY2A 3TN0A 2IPKA 2XU9A 3VA2C 1Q8MA 1NGWA 2E9BA 4P3CH 1ETZB 4Y19E 1UTDA 4JFDD 5F3BA 4PEEA 5C08B 1OCRB 4I3SH 3IXAB 1S9WA 4MBOA 1KJ2L 2ADIB 1OTSD 4GH7B 1RCYA 4IMKA 5EDXA 3TO4D 1ICTA 4Z7UA 2OL3L 2R0ZL 2HG0A 4AENA 1PY9A 3EKCA 3R8BB 2XNAB 4LSUH 5C7XL 1JWSB 3CC5A 1XR8A 3A23A 3T8VA 3AG1B 4L8SA 3V0WH 2WLJA 4U1JA 5KN5A 4KQ0A 3E7JA 5HYEA 5D2LE 3W9EB 1T22B 4Z18A 3JV0A 4Q89A 4OZIA 3PHQB 3M7FB 1TYEB 4JZOA 3ULUF 1EHLH 3OBAA 4XP4H 1VEPA 1P4UA 2DYPD 5E8OB 4AKOA 3RVWD 3SBPA 2AFNA 3EOYG 3C87A 1QD0A 3QIUB 4CN1A 1NKOA 1PNDA 3LNEA 3IKCA 4DK6A 4OIAA 4M00A 2C3VB 1MCPH 1UASA 5C0CB 1JV2B 3WL9A 3QQ3A 4LF3A 1W72B 4P49A 3SKOB 3OGCA 3CXHK 3EJTA 2JQMA 1PJWA 3NACH 1JNNL 2DW5A 3K5SA 4JY4A 1ET5A 3AT9A 2QR0A 4CW1A 4EF3A 3G6JB 5KVFE 3FAWA 1ZLVH 5BNXD 3ARDC 3VCLB 1T5KA 1CYGA 3ARGD 4FJ6A 2DWDA 5E4IA 1CQKA 4GQ9L 3BD4A 3MXWH 4GXVH 4WK2B 2E5EA 2YPLB 5LXVA 3LB6D 3C2AL 1I7TA 3MRGB 1BZQK 1DVFB 1X7QB 3WSQH 5A16A 4FNSA 1GW6A 5KBMA 3SKJL 3L9RB 3IJ7A 4YE0A 1XGTB 2YBRB 3BPLC 5KUKA 2VDLH 4PJEA 4A2EA 4A2FA 1QBLL 2OMZB 2V9UA 1BQKA 3MX0A 2GJRA 1IGYB 3HE7D 4JKNA 4LQFL 3THMH 4ATWA 4WDIA 1T7XA 1TJHH 1BD2D 1Z9PA 4R8WH 2P5WB 1FJ1B 4H4NA 1OHQA 3IDUA 4E9TA 3QWOA 3EYQC 3QZPA 3X3FL 2Q7NA 2PNDA 1A6ZB 2PXYB 5L9DL 1QRNB 4EIUA 1N7ML 4RMWA 2WLLB 1I8KA 2APTA 3MGTA 1FNEA 1L9SA 3MRIA 4ODBD 5EG6C 3V0HA 1S3KL 4WUKH 5D7LA 4FL4B 4YXLL 1FSKC 2EO7A 3QP3A 3FU3A 1ETA1 3F85A 1QSEB 3W2DH 3FT4A 4APQA 3QC6X 3V6BR 4XPBH 1J9RA 2COQA 5KJ7E 4URTB 3VRJB 1F4XH 4LKCB 4QLRA 3CIAA 4JQVC 3UBHA 2M26A 1Z5YD 4NQSA 3T0DA 1TZHA 2GIXA 5K1VA 3KLHD 2F54A 5H2BB 4BSWA 1R34A 1F02I 2WWKT 1RUAH 4PS3A 4DQOH 1AD0B 5DUBB 4X6FA 3GRWA 4ONHA 3ZE1F 5CGMA 1MQ8A 4PJ5E 2N7BA 3ARUA 1J8HD 1OTUD 1DR9A 4XXCC 2UXGA 5E1IA 1Z5LA 3FZUD 1XSIA 2G9HB 2BP8B 1OP5H 4BDVA 2OX5A 4WO4A 1SJHA 4KJWD 3QFGA 2RGSA 2WN2A 4KXAA 4PV8B 2WXFA 1NMBH 1WD9A 1SLUA 5EA0L 5HI3D 3GI8L 3MQIA 4BCYA 4OD3H 4EUPB 3ARQA 3PNWB 1FE8H 2FWOA 4PIBA 1GOGA 2JI1A 4X0NA 3FL7A 1TNMA 5E6RB 2HG5A 1JVKA 3BUBA 1TR7A 3RHWK 5E2WH 4ZMXA 2X70A 5I6LA 3IAQA 2A6JA 2OTUB 2ROXA 3GM8A 4L8BB 4ZOEA 1XH3A 4D0BA 3F7YB 1NGPL 1YMME 2NPLX 4N1EA 3FSAA 4GRLB 4JY5L 4OT1L 2Q76A 2OMTA 3KXFA 4FC3E 5DRWA 5LBSA 1YNLL 3JTTB 1LO0H 1EZUA 4W9CC 3RGVD 4YHLH 3HMXA 3NCMA 4IDJH 2J55A 3RA7L 4B9FA 3VD0A 1L5GB 3VXUA 3QZBA 1CVRA 2PABA 3HKZA 3OJVC 3Q1SL 2DQUH 1VJSA 2IWEA 2XN9A 3Q6GH 4NC1C 2CJTA 1A6PA 1YMMD 5AOMA 1CGTA 4U1SA 3WTTA 2K9FB 1VAHA 1BMGA 3MRDA 3QR2A 5JW4R 2B59B 3DMMD 2G0KA 4KPHH 3TEZA 3L3IA 1JYXA 4UINL 3DJTA 3CUPB 3F64A 5AL8A 3QQ9C 5E99L 3S35X 5KSVB 1TQTA 4O58L 3HN5A 1G6RA 5LXGH 2NY3B 4F33A 3OR6A 1JZGA 2AJSH 3KJ6L 5GISL 4FZEH 4XMWA 4KI5E 3GLAA 4WFHD 3X13A 1TZGH 4M1DH 5B21A 1U92A 1CGVA 1U33A 3B2PA 4QXGH 4QHUA 3S3BB 3V4PL 4EI5C 1KJMA 1SN0A 5HDBE 3VXRB 2GPZA 3NCWA 4AEFA 1IM3D 1ZDQA 2EE6A 4PJBE 2VXVL 2EVJA 2FZ3A 4M5ZL 4ZFQA 3U4AA 1KGWA 4LRNH 3RIAF 1AQKL 4PTUB 1WZMA 1FG2B 3FAXA 5KS9F 4E9YA 4KVCL 5DFAA 4HIIA 3S5YA 2VL4A 3GMQA 2GAZA 4J8RA 3O9WA 1A47A 5SWSE 4ZFOA 4DEWA 2YFOA 2B7DT 4PJXA 4JFVA 5EU6D 5BZXA 4AMKH 5B39A 3GK8H 1KELH 4MXQD 5D55A 1HCFX 4HH9A 1BPLB 5I1DB 3DECA 1AAJA 5JOFB 5HGDA 3KVQA 3W0WD 3L8QA 1JWMA 3O2DL 2E8ZA 4FX5A 1NH6A 4ZXBB 1JUFB 3HC4H 1ZSDB 4JM2C 3DX7B 1H0DA 3CSTA 4XTRD 5KYYA 1FZMA 3MRCB 4KFZC 3AM8C 5SWSD 3O6LL 2HT2C 3RAJH 3UC2A 4XO5A 4AQEA 4WLCA 4YL4A 1A14H 3EZJB 3IFOB 3ZRFC 3GBNL 1YEFH 3CFKB 3QR1A 4UT6A 5IT2H 3B7UX 1EZVX 2HTKC 4TQEL 4E9RA 4G7QB 4TM9A 1E7UA 2J56A 4WW2C 3TO2B 4AH2A 3SGEH 1ECZA 4KXBA 4DKEH 3C6LD 3HI1B 1JGEB 4FYSA 1BEYL 2B4CH 4RGMC 4ZX6A 3QJOA 4I88A 3SCMA 1XF2B 2FQFA 3RTQA 3CVIH 1CDIA 2HLAB 4ELME 3ARTA 3PXHA 3LIZH 4BQ9A 2HRPL 4XCNA 4GBXA 5F8RC 3KG5A 4MZRA 3WCYA 1Y6NR 5CN2A 3H2PA 1DBBL 2DH2A 1U8CB 3PF2A 4N8VA 4P8QA 1U3JA 1UGKA 3NAAL 4O51B 3IS0X 4HPOL 1ES0B 4MAYB 4TSBL 3OKDB 4XP6L 3JWNE 4BEIA 1QSZA 5GJTH 3AT0A 4D8OA 3NPSB 3BVWA 3WGVB 3UGEA 3RVVC 1WWBX 1YVLA 5GGTA 4FKHA 4AEHH 2UXVA 5LWYL 4L8CA 1T7WA 3RX9A 4LEOA 1EUTA 2AEPH 3NSCA 2AABL 2GHWB 3NIDE 3P2TA 2VSCA 3Q6FB 5A2CA 4OFPA 5FO8A 4XZ4A 5EEXA 3OJMB 4FDWA 2JLPA 4PJDA 5E1AA 3OM3B 4BFRA 4G8EA 3NCYS 3T2NH 1PMYA 5E94A 4F7KA 3T0EA 4IJ3C 2XFGB 1I1RA 4K8RH 2IANA 3ROOB 1MI5E 3GJEA 2ZOLB 5DZLA 4JO2L 4LLQB 3BE1L 4N90D 5I8OH 5J12B 4YEFA 5IBUB 1YEIH 1G7PA 3UZVA 5AD0B 5JW4M 3KVPA 1BAFL 2NOYA 3B7RL 2YC1B 1AP2A 1BQRA 5E2UH 1AZUA 5HHME 3FQRA 3NSYA 4HSQA 2F68X 3QFJA 5E8NA 2OZ4L 2SEBB 3MKGA 3C8DA 3PJNA 1NCCL 2G75A 4ZO9A 2UYLB 4V33A 3VB9A 1T03L 1DBAH 3SJVD 1GCFA 1OCOB 4GNKB 3GWJA 4PJFF 4AZ8A 5C0GA 1I82A 2CUIA 4AUJA 3GXTA 3U9PH 1E43A 1HOCB 3IDIA 3WNLA 4HGWA 3BAXA 4M4PA 3WEXA 4NP4L 3ZE1B 2J73A 5HHMD 4V1DD 2DMHA 1E4XH 1VGEH 2IDFA 3H3PL 3IMUA 3NCBB 4Y0GA 3RWGB 4K94C 1IV8A 1JMXA 4H44C 4FG6D 4JO3L 4I1NB 4GSXA 3MODH 5J1SC 4CSSA 1VADA 5T5NF 2DLGA 4P2QA 2G5UA 4YSEA 4U7MA 2CIIB 4ODVH 1A65A 4Q8BA 3UTTA 1KSRA 3FQTA 1G9MC 4NQEE 1G1CA 2VXTL 4IEFB 5FOBA 4D7PA 5AOKA 1F97A 3HE6D 1GGTA 1GZPB 1GYUA 3O3AA 2IGTA 3HAEB 2HKFH 5HHNA 3MREB 3ML8A 4WTXA 1EPFA 3U2SB 3TBYB 2EDDA 1TTBA 2C1PA 3OXRA 5K33A 4DIXA 2YN3A 4AGLA 1E3ZA 1U3HC 1DSFH 4XVJH 4UM9D 4XMUA 1JGVL 1HKLL 1AY1L 1EZVY 1NUGA 3FTWA 1UD6A 1GGBL 2W95A 2J5LC 2IGLA 2FHBA 1MJJB 3ME0A 5D8JL 2HFFA 2MCMA 4ABWA 3PLYA 2DQFA 4UB0L 1PD1A 5T3XE 3IE9A 2PCYA 1UXWA 1ZVSA 3MRKB 4OKDA 2FJHB 2XIBA 3WXWH 1NEZG 1O75A 1WAAF 3KBFA 1BEXA 4OF0A 3RL1B 5I6PA 3CXFA 1I7ZA 4X5WB 5BS0A 3IU4H 4KUCD 3IMTA 4FQIH 4G5ZH 1VZIA 2X53A 1HINL 4ZX5A 3SBRA 5EU7E 4YX2H 2IJ0C 3FPYA 2DQDH 3S7GA 1J7VR 4YSOA 3FUEA 1AHKA 5PAZA 5K59E 1DBJH 3A6CH 3ECWA 4DGUA 4PU2A 1YEDA 1VSCA 2ZF9A 2F19L 3KGUA 5JR1H 1OM3H 1RH8A 2XZCH 3IDJB 1IBYA 3L6FB 4OLWL 4BCZA 4GKNA 1XSJA 1T1ZB 3MACH 3W37A 3ULUH 4A6YH 4XPGH 4B9JA 3CFEA 2YMOA 1IKOP 1XF3B 3BZFA 3LMJL 4KNTA 3UBXB 3W5MA 4HWBH 2E9JA 3FUNA 4MD4A 4IK7A 2YGPA 1JHLL 5JO5B 5ESQB 2WV3A 3B2UD 1FYHB 2BDNL 2N3JA 1A9BA 1PF3A 1U6AL 3VI3A 2F15A 4AT6B 5BO0D 3W56A 4PGJA 4KQ3H 4FTDA 1KTCA 3DPBA 4F1ZA 4J3OG 2PO6C 1U8NB 2UUDK 4MNGA 3U0TA 3SDAD 1TQBC 4IYKA 1RZIB 4S10A 1JYWA 4JHBA 3LEYL 5ICYA 2F08A 3FN0L 4B5ZA 5I1HH 3IRCA 2ESVB 4KZCA 1IC5L 5EIIA 4ZUWB 3BAWA 2E7LC 1E2VA 1A4JB 1JVLA 1S9YB 2QADD 3T0VA 2LGNA 4R2GB 5E6ID 3QJUB 4ACPA 3DVIA 1IBDA 1ROWA 5BUPA 3W1ZA 4H26A 4UOQA 3TEWA 1UZGA 1UEYA 4ZOCA 5E8PA 2PCXA 2YO3A 4IRJB 4FLRA 1UXLA 4ZUSB 2MCG1 3AGVA 1RMFH 2R0WH 1XTLA 5I15H 1A4AA 3CFIC 4M48L 3QUXB 5I74B 1XH0A 4LHUA 4XODA 2E46A 2UV3A 4ZMVA 1D7FA 4KO5A 3PQYD 3JWDH 3V0JA 2MNJB 2VJXA 4N2GA 4UIMA 1D5IL 1EX0A 3EJRA 4PCKA 3CZGA 1GIGL 2QPSA 4ONGH 4FXLA 1ET8A 3RJOA 4B95C 1HDMA 5HYJD 5LG6A 2EINB 3MLUH 1B0RA 5HJ3B 1ZD6A 3FSOA 1T89A 2GITB 3P4NA 4ZPTB 3TN0C 4A37A 1U8KA 2P7TB 3ZTNL 2CJSA 3EYOA 3FMGH 4Y1AE 5CP3A 2N01B 4WKXA 3MLXH 4NN7B 3TU6A 2WGNB 3H4FA 3II1A 3MJ7A 5B4MC 3ZMNA 5HJDA 3AQZA 3SE8L 2GT9B 4OD1H 4RZCB 1OARH 3VAEA 4IMKC 2HLEB 1KGCE 1QLRB 3BPOC 3ZKSD 4L48A 4N0UA 4W70A 3KAAA 2JJWA 4QRTB 4YBHA 2CO2A 4CL7A 3EBAA 1N0XL 4Y2OB 2DWEB 3NP3A 1JD7A 1VESA 1MFBH 4Y1AD 3VH8A 5H37G 5CSZB 3E6FA 1EQWA 3ZE2E 1QSFE 3O0RL 2H2PD 2WM0A 4MRCA 1QWNA 4HG4J 1B6UA 3HLAB 2EILB 3MRFA 4HEMA 1KGCD 1XFPA 3B83A 1G1KA 4BHUA 5FDYA 1G7LA 4KITB 2AQ1A 3UAFA 3RWFB 4KZEH 4N2KA 2P46B 4U1LA 1QFHA 2FVNA 2XPYA 4M61B 2MPVA 4XN4A 2EDEA 2DN7A 4LLYA 1UZ8A 4TKWA 5ESVB 3RVUC 2AQNA 4B7IA 1M9SA 2ADGA 2BC4B 4JB9L 5AW6B 5DJZB 4F7EB 1MNNA 2VC2H 2VRQA 1YC8A 4HS3B 3KYAA 3DBXA 5A6IA 2IG2H 1ZHNA 2BJML 5EUKA 2CG9X 1D9KD 4OTXL 3FTGB 2DQIH 3QEHB 4PJFB 2H9GB 1P84J 2FIKA 5J1AB 2VR9A 1OAYH 2NX5A 2OYMA 4FHBD 4V2CB 3IJYA 5K9KA 3K6IA 2HVJA 5DO2D 1CD1B 4M3JA 4UBDD 1A6AB 4MLIA 4BKLB 2APVA 1KJ3H 3E3QC 2X6BA 2FBRA 4U1MA 4NWTH 1OT2A 3RI5K 3UO1H 4AYGA 3KPMA 3TPUB 3DUUA 1CK0L 3B3IB 3T6XA 3GSNB 1FFTB 5BUGA 2OMBA 5KSBF 5CP7B 3D30A 4MNQA 2BS9A 2XZAH 1RIVL 1ACYH 2I9LA 5I1JH 2D7QA 5GS0C 1TZIB 4O02L 3U30B 3SGEI 1GS7A 3G6AB 2P5EE 4MXWH 4ZOAA 2OCJA 1N2RA 1PJ9A 3HHMA 3OV6A 4LDEB 1SOKA 4ONOA 5IFHH 2F2HA 4KJPD 3W39B 4PRHA 4JJ5B 1DUZB 5EWIL 1XVSA 3FUMA 3KWXA 5DWPA 3B2VL 2N59A 4M7LL 4Y9GA 5F1NA 4APQC 3O6MH 2CR3A 1ADWA 4U6XA 3K71B 4X6DF 3TJHC 2QKIB 3SPJA 2IPTH 4IBLT 3QUML 3OB0K 2NY6B 1QFOA 4NAMA 1KFGA 4NO0B 1MNUL 3HUJE 2X4TA 4K71C 5C6WH 4N9GB 3UZQA 5C6TL 4I0PA 2WVVB 3KGSA 2RAMA 1GC1L 4H1LH 4E42A 3BUYA 2YD2A 2RJMA 4I48A 2A6KA 1AJ7L 2OTWB 1AGCB 3QO0B 1UC6A 2IH9A 1U3NA 4RGNC 3MKKA 4OGXL 2GCYA 3J7HA 2FYYB 2IC2A 1XF5A 1TJGH 2UZIH 4OJAA 4WO4C 3BAJA 1CI5A 4N1HB 2OMUB 4OSUH 3WXVH 1FI8C 1UCBH 3UJJH 2BZCA 2GIMA 1ZT7A 1P2CB 3LRSA 4R4FL 1DQJA 1HSBB 3WDHA 4XC3H 3T2PA 2WVTA 1CTMA 1OF2A 1BHGA 4PBVC 2EIZA 4Y19A 1LMIA 5I6OA 4GG6E 3QQNA 1ZCRA 3JYBA 3P02A 5SX4H 4UT7L 1BFVH 4E9WA 3MXVL 3ARYA 2G4EA 5FYLL 3UAJA 1VFAB 2E74C 2PP7A 1BBDH 2YOAA 1SQ2N 3QJFA 4KXCA 2ZKHH 4OI8A 1U2YA 1D6EA 3V0FA 2VDPB 5K9JH 4LGRB 1D7DA 5F7EH 1KTJA 4IW4C 1EAPA 1AZZC 1H5BA 4FG0A 1MCOH 3L9BA 1KIPA 1HEJC 3FTVA 4C55A 5D2LA 1OP4A 5ETUA 1RUML 2V5MA 3CVHL 1I1FB 5FUZL 4BZ1H 4L3FA 1I53A 5KVDE 2O61A 4PRBB 4L3EE 1KB3A 2Y2YA 3VFVB 5BRPA 3D5OF 3O45A 3RPKA 1WLHA 3BUPA 4TSCL 1I7RA 1A7RH 1MAML 3FKUS 2NZ1A 1MXGA 1RJZA 1V3LA 1KEMH 4G6KL 3TBWA 1E27A 2WLKA 3DTDA 3EYUH 3GIVA 3NOIA 4FXGB 2XQYA 3GUTA 4MS8C 1E4WL 1KY6A 4F3FB 4JFPA 4OR1A 4Z7IA 1DO6A 1VHPA 1YYCA 3QUYD 4HWUA 3U2JA 1HIMH 1W8EA 3F62A 1MHHA 5F1SA 3F7QA 4MAUH 4BE6A 1BXXA 5D5MF 5I8EA 2BRQA 1QZ1A 2NTFB 1HCYA 1NEZB 2MOGA 4L1DA 4PY8I 4UQIM 4X50A 1USQA 3P9MA 4FN0A 3BKCL 4BKSC 2FATH 2VZUA 5T33H 2YXVA 4RAVB 1KXHA 1EAJA 1EWHA 2BS71 2WGXA 1F4AA 4CC0A 2ZSWB 1SEBA 2ZAGA 1AGDA 4IMLB 2XA3A 1S7WA 4ZZKA 4B9ZA 3CFDB 4BSVB 5JDJA 1HZHH 3FYIB 4IIQA 1KYAA 4ZYKA 3FUFA 4PGCB 1KYFA 3DX8B 5MEQB 3VD1A 1DTUA 2PKDA 2LVCA 3CCHB 1EEUA 3GXIA 5TDPB 2YHGA 5ANHA 1LK3L 1FO0L 3MNVB 3QUKA 3ZZQA 1LNUA 4PJGF 4OF8A 1AI1H 5FLUA 1WCBA 1YY9C 1CL7H 5T5FA 3TZVA 4OLVH 1G7HA 1CN4A 2QZ5A 3S8FB 5EEWA 4HOZA 3FQWA 1JXFA 2L7JA 3F5WB 2Z7UA 3RX8A 5E1QA 3MLTB 1INQB 2EABA 2EIDA 4FFVC 3H9SD 3LV3B 5J56B 5KSUA 3SQOH 5AUMB 1N26A 1EVUA 1KJVA 2Y3AA 4MCMA 1XBRA 3TASA 1LP9F 1AYRA 3QIBD 1NCJA 1LEGB 3BHBB 1FNSH 4RVBA 4ICXA 3OL2A 1FRGH 1NPUA 4OF5A 3WIAA 2L7QA 4HV8A 1E28B 1WBYB 3ABMB 4MWFA 3SCMC 3RTQC 1HXYB 3D69B 2OFQA 1NMBL 3MRMA 4PJ5A 5I30L 4QJ3B 2X9XA 1IGJB 4GBXC 2D7TL 2QMKA 4R5TA 2NLJB 4FLOA 2WNKA 1B2WH 1I31A 1JWUB 3QH3B 2Y5EA 4RFNB 5ICZB 3EYVB 2B1OA 4OU3A 1QI5A 3EJYD 4LASL 2ZIDA 3HC2A 4N2DA 1ZGLA 1B90A 3DSFL 4EBQL 5D1QB 2WZPA 3IETA 2F8OA 4PUBH 1CFTA 5KSBB 3GGWA 5HGAB 2WHVA 3RGVA 4F7MA 3VXNA 4PRDB 4QF1B 2XWBB 4RISH 5E9DE 4ZNCD 4PREA 1T04B 2HJKA 3EDFA 3LH9A 5B38A 4HC1A 2E6QA 5C09B 1RK7A 2QHRH 4AYFA 2VERN 4OZGF 3T0EC 5E6SB 2MKWA 4XMPH 2KDGA 1UZ6E 1YMMA 2BHUA 2VO5A 3FONA 2MEJB 3NFNA 2CAKA 4LCYA 4AIXA 2F53B 2WVUA 2EDOA 5KBDA 1KPUB 4IKNA 3IDMB 2YQBA 3DK0A 5E9DD 3NIGF 2F58H 1XDTT 2ZICA 4PI0A 4OJYA 4X6DB 5FEBA 5C0AD 4FTVE 1XL4A 4Q9CA 5I8KH 3QCVH 1J05A 3SDDA 5CINH 8FABA 2ZXQA 4N2NA 5IKCB 3LX9A 3ES6A 2YSSB 2XTJB 2LAGB 4J3UA 3T0AA 2E56A 1JXKA 2D3NA 4NUJA 5DEJA 4J7RA 5E1HB 1B3JA 3VGFA 5DJ8B 2DB8A 4YBLC 4ODSL 2WBJD 4BELD 4JG5A 1R3HA 4R7LA 1W72L 2E47A 3O6FD 3N0AA 4QRRE 2X88A 4FTVD 3P4OA 4G8IA 1KTBA 1GHFL 1MFCH 3MAWA 1SJXA 3FNKA 2GK0B 4KV5F 4HW6A 4KRMB 4X2UA 3UGXA 5IIEB 3O3DB 1RK1B 2K7PA 3CLEL 4PJBA 4BK4A 2CHXA 4HZLB 5ESAA 4K07A 2AF2A 3VU2A 4C54A 4EZKA 2NXYB 3QA3A 4YHIB 4LDLB 1UH2A 3P0YL 2W59A 4DKFH 2QKSA 2OPCA 4WWKB 2BFGA 2HT3D 2ED9A 3F12A 2JIXB 3BESR 2VL5B 3K2UH 5SWSA 2RCSL 1EEZB 3HI6L 3GS7A 2WKOA 1XMEB 5L7XH 5CR1A 1CGXA 2AXFB 4Q52A 1TQCB 1KN2H 3ZIYA 2HT4C 2X9YA 3QS2A 5EU4A 2J2ZB 4FKKA 3TIDA 3ZZ1A 2K3HA 5CZXC 4AITA 1MRFH 3C6LA 5LGJA 3EG9B 1LTXA 4I2XE 9CGTA 1PX3A 1KGIA 4JS7A 4PWFA 4D8PA 4ZUUA 4QNPE 2AHIA 2AAAA 1SHXA 4NQCD 3TBTB 2FGWH 4J6IA 4ILDA 3R1GL 3MRLA 3UXFA 2ZWNA 4TLUA 3FRPB 1ZAGA 4PJCE 2OI9B 1UKTA 2XG4B 3WHXA 2AQPA 3P30L 3MTRA 2BK8A 3K1KC 4P99A 4AZUA 3QUZB 4RMRA 4DKDC 1OAUL 1U8PA 2C34A 3WUWB 3L81A 3OKLB 1BF8A 5I1AB 1M7IB 1A5FH 5F9DC 3V4UL 3O6KL 4CMHC 5J8OA 1RJYA 1IAKB 2V5RA 4MDJA 4DHLA 3MLSH 3C6EA 2VABA 4ELMA 5D5MB 4CSZA 3ULSA 4L29A 3V7AE 4F8NA 3HPJA 1B3IA 2D8KA 2G3MA 2V2TB 4I3RL 2Q6WA 3F01A 3MLYL 5GGQL 2B16A 3RJDA 1RUPL 1ZOXA 3N1GC 3NCYP 2KZBA 4PLJD 1FVEA 2CKBB 3HB3B 3A47A 3GHEH 5GSVA 3ZT6A 2E8YA 4KZ0A 1BQSA 1KCSH 2H0PA 4XBGA 4NI6A 4DKAA 1PAMA 1FGVL 3F58H 2VJ0A 3QULA 3FT3B 1QHQA 2A83A 3QDJD 4NQDD 3BFOA 4ZFZA 4K94H 3SZKC 3MRPA 3IT8D 5FECB 5E2TH 5F9JA 5C7ZA 4AC4A 4E41B 4ZPVB 4FQXD 4DVBB 1CIDA 1G9MH 1MI5A 2UWEF 2IOMA 1VFOA 2X4OB 5DEZA 4UV7H 3G08B 2F6AA 4Y7MA 5L4MA 1ZK9A 3VW3H 1S7RA 3NMEA 3KLDA 4PY8J 4CDGC 3OMNB 1PZBA 1R5VA 4MDRA 3QI9D 1F4WH 1UURA 2VZSA 3II3A 5DVNA 3S34H 3JUZA 1MW2A 3BJ91 3C5SB 1XEDA 4JRWA 4P23B 5LQBH 1ZXKA 2OS7A 4OJCA 5BRZE 4XNDA 1WZ1L 4JQIH 2E27H 1LP9B 3ILPA 1MDTA 3D52A 4AUYA 4Z3EA 4MASA 3F7KA 4MJJA 2UVFA 3VRLF 5CIPB 1U8LA 4ZFGL 2Y6SC 3IK2A 1GY2A 4ISVA 4TVPL 2IBGA 3FOMB 3GJFB 3GHBL 3TV3L 4W9EC 2DZEA 4FQJL 3QSKB 2R27A 2PWHA 4K3HA 1WGOA 1AFVH 1N5YH 3QCUH 5BRZD 1FFPB 1EAOA 2BZDA 1AZVA 4PI2A 1ZHKA 1NEPA 3P11H 4HX1B 4UM9A 5IESH 3RRQA 1W2KT 2NQDA 3Q5TA 4L5FL 1B4JH 1MCDA 5ADPL 4NQEA 5HBBA 4KKPA 2PW2B 3JVFC 1DQML 1PW3A 4JMNA 4KKZA 4JO1L 3IFPB 4PRID 5IW6A 3BWSA 3CVDA 2EQDA 1EGJH 2CM6A 2OBGA 1MWAH 5FAAA