1WFMA

The first c2 domain of human synaptotagmin xiii
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
138
structure length
138
Chain Sequence
GSSGSSGSWNQAPKLHYCLDYDCQKAELFVTRLEAVTSNHDGGCDCYVQGSVANRTGSVEAQTALKKRQLHTTWEEGLVLPLAEEELPTATLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The first C2 domain of human synaptotagmin XIII
rcsb
source organism Homo sapiens
molecule tags Endocytosis/exocytosis
molecule keywords synaptotagmin XIII
total genus 15
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1wfmA00
3RDJA 3ZVVA 3DPDA 4FJZA 4BGDA 3L54A 2B3RA 1DJZA 2RD0A 1W16A 2N1TE 2WXIA 4IQHA 2NCEA 1CJYA 4XX5A 3ZIMA 5T8IA 3T8MA 1DJIA 2CHWA 2A4ZA 1QASA 4FLHA 1E8WA 2X38A 4HLEA 2EP6A 2CHXA 5JHAA 5CCGE 1DSYA 3OAWA 4QAMB 1UOVA 3R7RA 4URKA 4EZJA 3ZW3A 4EZKA 1WFJA 2YRBA 1E8YA 4NPKA 2DMHA 4L23A 3NSJA 4FJYA 3TWYA 4QJ5B 2K8MA 4WWPA 3L17A 2CM5A 3DBSA 4WWOA 2LHAA 4EZLA 2WXFA 4ANUA 4FHJA 3PS6A 4NPJA 3N5AA 1DQVA 1RH8A 3CSTA 4NP9A 4TUUA 4WAFA 4QJ3B 3QARA 3ML8A 2CJTA 3M7FB 1RSYA 2R83A 2WXKA 4F93B 3SD5A 4F92B 4LCVA 1DJGA 4DNLA 4LDCA 2JQZA 4FULA 4ANWA 4BFRA 4KZ0A 2FJUB 1E8ZA 1DJWA 2YOAA 4TV3A 4ANXA 4L2YA 5CCJA 4LT7A 5G55A 3W57A 2Q0ZX 3RPBA 1K5WA 3PYCA 3IM1A 3PRZA 3R7QA 2V4LA 2FK9A 3APCA 3APFA 3HIZA 1E7VA 1E8XA 3F01A 4ICWA 4A55A 4HVBA 2WXMA 2CHDA 4GB9A 4FA6A 1DJHA 3W56A 1WFMA 3KWUA 1UGKA 3L13A 4F91B 3P2BA 2WXJA 2WXHA 3PREA 3F05A 3L16A 4F1SA 4PS8A 4KITB 1QATA 1GMIA 3KWTA 4PS7A 2Y3AA 3F04A 1HE8A 3PFQA 1A25A 1TJXA 2ENPA 3GPEA 1BDYA 3B7YA 2A5UA 3ML9A 4IHBA 4WWNA 3NZSA 4XE0A 2ENQA 2WXQA 3QR1A 4XZ4A 2DMGA 3ENEA 3QR0A 4ANVA 5H4ZA 4PS3A 3HHMA 2QZQA 3MJWA 2CHZA 4GNKB 3F00A 3FDWA 2WXPA 4KZCA 2ZKMX 4TS6A 3FBKA 2NQ3A 2WXGA 5JHBA 1W15A 1UOWA 1YRKA 4ICXA 4AOFA 2CM6A 3NZUA 5CCHE 2D8KA 2WXLA 2WXOA 3APDA 1E7UA 3LJ3A 1DJXA 4JPSA 1E90A 3TL5A 1RLWA 2BWQA 3OHMB 5H4YA 2CJSA 2WXRA 4MJJA 4QJ4B 4L1LA 2QZ5A 2UZPA 3QK0A 1DJYA 3HN8A 1BCIA 3JZYA 4G11A 4FHKA 3L9BA 2K3HA 2K4AA 1V27A 3L4CA 3QJZA 4WEEA 4FADA 5EDSA 3TJPA 1BYNA 4V11A 2ENJA 2KI6A 4J6IA 4OVUA 2Q3XA 2WXNA 3L08A 1TJMA 4NS0A 3IBEA 4Y1SA 2NSQA 5KJ7E 4Y1TA 5G2NA 4L1BA 2Z0UA 2ISDA 3QAQA 4AJWA 3S2AA 4OVVA 4DK5A 3CSFA 2K45A
chains in the Genus database with same CATH superfamily
3IDJB 4PJ7B 3L3JA 1XF5A 3C09C 4FQXC 4ZW7A 1YJDH 3H6AA 3B5GA 2AABL 1CJYA 2MIZA 5FO2A 2XIIA 1RIUL 4O2EA 3RI5K 4A7GA 1J1PH 3JWDC 3MLXH 4XBGB 2PYFB 1S5HA 5E5MA 1NFDF 4HHGA 5LGJA 3UBGA 5LXGL 4N85A 5LXGH 4OZIA 2DQTH 2E4TA 4UAOB 4G9DB 1L9RA 1IC5H 4QRSA 4L3EA 5I2IB 1Z32X 2I07A 4AH2B 1BG1A 4L18A 3K7UA 1PLCA 2C7FA 5TQ2H 4CC4C 3BPCB 2A6DA 3OSVA 5GZND 2O61B 5JA8B 2VMCA 4UDUA 1T2XA 1ECYA 2BSCA 4BFBD 2HKFL 2FD6L 4FQQB 1G1OA 5CBAB 5D7JC 4L3AA 4U1SB 4F3FB 2XUWA 4D0DB 1XCWA 2B59A 4OT1H 3GSNL 2V7HA 4AVIA 1PG7H 2L7UA 3L6FA 4O51B 4X6CE 5FGCB 3NQKA 3LQMA 1U6AL 4EIGB 5GZOD 3MR9B 3RY4A 3TBCA 4JB9H 2Q76B 5IJBC 2YXMA 4OBRA 2GUOB 5TE6H 3FUIA 4W9GC 1UT2A 1IGYA 4WUUA 4KFZC 5KJRH 3D39D 3T9WA 4G72B 2C9VA 1D9KA 1H15A 4PCTA 2QPSA 2Y2YA 5EA0H 5EMYA 1G7IA 1TZAA 3QB7C 5CWSA 1JGUH 4PJBF 4UAOC 4UDTB 3H42H 1PTZA 3ZGIA 4ZNEE 3V6FA 1MXDA 3EO0B 5IB3A 5D71L 3SDCB 1JJUA 4PGJA 1AI1L 1IBBA 4PP2A 3G6AA 5SWZA 1L7IH 5DD1L 2E3VA 5EZIH 5IVNA 5E56A 3MJ8A 4ZDHA 3RX9A 4S1SH 3G08A 5EG6C 3MRIA 3VI4F 2DQIH 4CN6A 5JPMC 3TV3H 1FZJA 2WCPA 3U6RA 5K1VA 1T5KA 1CGYA 5EO1B 4XP4L 2NW2B 4APXB 4GKNB 3BDBA 2VRAA 3IFNL 3OPZH 3QIWA 4FHBD 1VIWA 3HB3B 2R0KH 4P2OD 4PRBB 5EC1B 3MRFB 4KKCC 2N1KA 3JZYA 3DX7A 4B96A 5E1AA 3VFGL 4P05A 5E2WH 1DR9A 2C3VA 2FJFA 2YRPA 5GIRB 3V5HB 3ZDYB 1FVDB 2DQJL 3NCEB 1EERB 2OCFD 3OJDA 3U6XS 1ZEAL 4GSQA 5IVXB 1O7VA 2YPKB 5HI3C 3RVTD 3CVBA 5IEKA 4LOVA 5IMLB 1H8NA 3U46A 4YN3A 4TQEL 1HCVA 1SJHA 3O8XC 4ZOBA 4IRJA 3MR9A 1WBXA 1YCSA 3JBG7 4FLRA 5JW4M 4GH7B 3KWWA 2VE6A 5FK9A 3I02A 3RVXC 3KLKA 3C12A 3EJYC 3CPLA 4K3JL 1WQVT 5KEZA 4PJ5D 1N5YH 4PJBA 2B14A 3FU7B 5BMFH 1HTYA 4I0PD 3EF7A 3QS2A 5AENA 2JF1A 2V2TB 3H9HA 1A1NA 3CH1A 2CCVA 3V5HA 1N6QL 2F53B 3RZCD 3QUGA 4ES9A 3X13B 3GF8A 3V4VL 3EFFB 5D71H 5F7EH 1TPXC 4JG5A 3MOBH 1YY9D 3Q3GA 1H3VA 1R5VB 2JFCA 3RDTD 5DD1H 3IDNB 3A47A 4MB1A 4QOKD 2EO7A 1WSST 2GHZA 3ILDA 5C09E 2LU5A 3T2LA 4KKPA 2UXGA 4A2DA 1RY7B 1XGUB 3S9DB 3E1F1 4JG0L 5F8RC 3QH3B 1NCDL 3U4EA 4OGZA 3KLLA 5HYSB 3K72B 5IQ7L 2XACC 3QNYA 2VLKE 1MH5A 1FUNA 4N8VG 3RY6C 5KBMA 2V4LA 2N7BA 4YHML 3IDUA 1F3DJ 1OGPA 1NIDA 4R8WL 5J12C 3HI6L 3VRIB 4QXGL 2Q8BL 4Y2OB 2EC9U 3BZ5A 4J3SA 5FGCE 5C0BD 5C70A 4YHLH 4NWTH 5FM5M 3QZPA 4M5ZL 4J4PD 3ZW3A 4I1RA 2H0EA 2LU7A 2WPGA 1OLLA 4FC3E 2ZG2A 4ORGB 4EN3A 3CFMA 1S5IH 3QPKA 3WELA 4CN1A 1EZUA 3KYKL 4KQ4L 3LZFL 1KCLA 3KPSA 1U8OB 2NUPB 1MHPH 1QAWA 3ARED 3BZFA 4N6QA 5JQ6L 5JXEA 4IDLA 5J1AA 3VD1A 3ARGB 1U8QB 3RUGB 4AYMC 2V5MA 4JM4H 4DJMA 3BH4A 4OV6F 4KO7A 4B0MM 3V6OE 4XB7A 1CQYA 2ALWA 1GS8A 1MOEA 5E5LA 1MRDH 2OYKA 1ROCA 4N2FA 1MHCB 1NLDH 4KX8A 2IAMB 4UV7H 1HCZA 2DMBA 1I8LC 3MGTA 4N8PA 5CKAA 1LP9B 1LO0H 2VIRA 3B37A 4X6CA 2I9TA 3QIUB 1Z9PA 1ZVYA 3BGMA 4LSUH 1TTAA 5DHEA 1KJMA 4JL2A 3U9UA 1GJIA 1QFOA 4B3EA 3AVEA 1N59A 3DBXB 2PCFB 5BZDA 2J72A 1XGPB 4M4RB 4HIJB 3JTSA 2QHRL 3MI6A 5CBAA 1RZKL 2OLDA 4EUPA 5IK3B 4WFEE 3NOIA 5J57B 2EXSA 2FZ3B 3PDOA 3JV4A 4ONGL 1EAJA 1MELA 4XN4A 3QORA 4PJ7F 4QMEA 3RVWD 3FTYA 2DPKA 3T3ME 5IW1B 2L0DA 2YGOA 3WN5A 2FNBA 2FX9H 3IGUA 2GAZA 3WIHL 4MXWH 3QFGA 3DBSA 2EDRA 5ESAB 5LNEA 5IG7A 1FGNH 3C8DA 4FYRA 4QAWA 4WI7A 2AEQL 3KPRE 4NC2B 2DD8L 1X5FA 2W81C 1N5YL 2R2EA 3AGWA 3MNZB 1GL4B 1S7WB 4O2FA 4Z23A 1TTGA 3VGGA 4LBAA 1JZDC 5IQLA 5CZKA 3IFPB 4N8UA 5C6PB 1T1ZA 2VDMB 1ZWIB 1E42A 5E23A 3B7RL 3H42L 4PLOB 1SOQA 4HFWA 5KVDH 4AG4H 3U9UB 5AZUA 1S9WA 2NY6C 5BQDA 1NCBH 4RRPG 1WFOA 1RU9L 1JWSA 4EPSA 3OPZL 5E6ZA 4G7RB 2BFVH 5HYSG 3V52H 15C8L 3ATEA 2CKNA 4PG2C 4RAUB 4WUUD 3POHA 4JY4A 3MCLL 3VMPA 2FZ3A 1D9KD 32C2A 2QVTA 1PIGA 3L13A 3OKEA 2NNAA 2P26A 2VDKH 4TSCL 2KC0A 4RIRA 1N59B 1L6PA 1RJLB 1QFPA 1VPOL 3MUHL 4UOQA 4PW3A 4YK4B 4OKVA 3VGBA 4BZ2A 2H0FA 4PTTB 1Q9WB 3RX8A 3HZYA 1BM3L 3MV8B 3QUZD 1IQDB 3AG1B 4OIBA 3CX5J 1TZ8A 2WZAA 4MDRA 4YDMA 4JO3L 1IGML 4N5ED 4F8LA 1KXTA 3MHZA 4YZWA 5HVGB 5L7XH 5LGJB 2HT3C 2NSMA 5E8EB 3IJYA 5B38A 1A3QA 1FL6A 1W91A 4GT7A 4PY7A 4XP6L 5J6GA 1CE1L 5C8JA 3DJZA 8PAZA 1BZQK 5LN4A 1BEYL 1RLWA 1M7IB 4XC3L 1MCHA 1QI5A 2NY6B 3GSUA 3FYIB 4FFYA 4K7PL 4QRBA 5EZJA 3UBXI 4KHTH 4IRJC 5DJ0A 5AOMA 4N86A 3CLEL 3MRPA 5GJTL 3VVWA 3PABA 1IBHA 1YEWA 2PPFA 3CFCL 4AL8H 5I19L 1ITBB 4Y1TA 3OAZK 5K59E 1CFQA 1Z5LA 1LLAA 1YJDL 4JHWH 5B1JA 1I8KB 2N3JA 4UT7L 3HNVH 3VSVA 4FYTA 5GS2H 3MJ9H 3N42F 1Z66A 3LKQA 2ENYA 1I8LA 1LGVA 4MS6A 4FQ2H 3VFVA 4TTDD 1ZIBA 1H6FA 1GMEA 1P0SE 3BO8A 1A7RH 1UOVA 1MJUL 4QF1A 2MPVA 3ZDZF 4XHQA 4ZFOB 3GBEA 1SMAA 4NWUH 1URIA 1X7SA 5JR1L 3RWIA 4JGNA 4NT6A 1EFXB 2MPAL 4S1DC 5EO0A 5K39B 3CIQA 4M43L 3K46A 4AVKA 4WDIB 5DLML 2FSEA 3L5XH 3PWVB 4P3WA 1NCOA 2B0SL 3ZE1F 1JAEA 4GEIA 4GXFA 1IQWH 1UC6A 4P46B 4TSBL 5KSAD 1SHMA 4ANWA 3CX5K 4OCSL 3C5JA 2B20A 3DGDA 5TD4A 2VXQA 2IPUG 3RU8L 4JKLA 4RLDA 4ZO7A 4OCLC 2F9BT 2E7LA 4U1HA 3TBTB 2Z4QA 1IGTB 3RGBA 2WXMA 5AKVA 3RL2A 1JZ8A 4DEWA 5BRZE 3NZHL 1KTKE 2RJMA 3H9ZA 3WUWA 4LKXB 3S88H 3ZLQC 4ADIA 4QF1B 2FUTA 2A83A 1QO3B 1HZHH 5AVTB 4TTGA 2VLLB 3RFZA 1I9JH 2GSGB 3VGDA 4LAQH 5IVZA 3DVIA 1WHOA 2R15A 4WNQB 3Q48A 1OGAB 3PV6A 1KDJA 4NLHA 2ADGA 1NCUA 1MWAH 4CVZB 3CTTA 4ZFFB 2NZ9C 5AYTA 4K2UH 4EN3C 2VRQA 5JHBA 4U3SB 2PYEE 3W38A 1Q1PA 3SDXF 1BBDH 4MJ5A 4HIIB 2HX8A 4XNZB 4HBCL 5AVRB 1O0VA 3TIDA 1ZTMA 2CLVB 4X7EC 5T1MB 2R4RH 2B1AL 5LKNA 2BWQA 4QYOB 2UWEF 4JFDE 1KY6A 5I75B 5T1KB 3S5ZA 2CA3A 4YBQD 4CGTA 4AUUA 1YNLH 1QFUH 1QLFA 2H2PC 5G4OA 3ESPA 1IC7L 5E8PB 1FFQA 3OKNB 1U2CA 5G2NA 4Z7WB 3WTVA 4M5YL 1IJNA 4KH9A 3H2WA 3MRCA 2DYRB 1HH9B 3WXVL 5CSBA 4AGQA 4HUVB 1F6FB 5JMRA 2CGYA 1UB5A 5DJ2A 3AROA 4H0IA 3VGHA 1BFOB 5MEOA 1I82A 4Y16B 2BDNL 4WKXA 3T5WA 4NNPH 2WIIB 3T77A 4K3GA 4WSGA 3KCPA 1BIIA 1L9TA 1X44A 5GGVH 4NM8H 4YDJB 4BELD 3U9PH 1MSPA 1BZ7B 1H3UA 2R29L 1X4ZA 4NKIL 3RDTB 1IBGL 3PP4H 4ORGA 3SGKC 4EN3B 4MQ7A 2BVYA 3OG4B 3TURA 3D34A 4TLUA 3UOAB 2CJUH 2NSXA 3UADA 1F90H 1MVYA 1VEOA 1NFIA 1OT2A 1HEZA 1FVEB 2EILB 3IDGB 1KYOK 1E9QB 3CHRA 4RFEA 5I6XB 3QZMA 4HU8A 1VFAA 3KS0H 3UPRB 3T4AB 1YEHH 5FGSA 3QJHB 1S9KC 4O9HL 2VDOH 1ZPLA 4L4TD 3LX9A 5HD8D 4HUVA 1ZHNB 4XWGH 4F9PA 4FMVA 1S9XB 2M2DA 4WWKD 1LE5A 2NX5D 4O02B 4XCNB 3SB3A 4GRWF 4DN4H 4OT1L 4NN5C 5D2LA 2WW8A 1NGQL 1UGKA 3TJHD 1UTDA 4L0ZA 1I7UA 4GRMB 3DBXA 4KZDH 4XO5A 1XIWC 1RZPA 4B50A 3K4DA 3APMA 3S35L 2ZYSA 4OZFH 3FQTB 3HKZA 5AAWC 1XGPA 1R6VA 4QRUB 1U8KA 2WAQA 5TK2A 1ZT4A 2QVKA 2YMTA 4F5CE 3RYMA 3X3GL 4OGYL 4LCYB 5TDOA 4D3CH 3MOAH 4DFHA 3JV0A 1MCEA 2VXQH 2UZYB 4XVSH 4A39A 3ZYOA 2WKOA 3JVGA 2XCMC 2GJ6B 2XXCB 2EVFA 1C16A 4Y5YC 3OKKB 4P4KD 4YC2B 3FO1B 3IMRA 4A1RA 4HJTA 1K8IA 4I0PB 5GGSA 3KR3H 4PJ5E 4LSUL 4NS0A 5DMIL 1AYOA 1JZJA 4FXGA 3RIKA 3SE8H 4OFVA 2Y5EA 1OWWA 4LSRH 4PIBA 3O6ML 3O6MH 1A9EB 3DIFB 3ZPDA 4BQ6A 2A73B 4E2OA 3Q2LA 4U2YA 1JN6A 2X28A 4ODWA 2MNWA 4HF5H 2C4FU 3SGEI 1EMTH 3I84A 4Y2OA 2BVUA 1BXAA 1PIFA 5IJVB 4EEEA 4UCFA 1PCXA 5K59F 1VADB 2KT6A 3C2SA 3BWAA 1I3RB 1DBAH 1Q0XH 4QNPF 4FABH 5CO1A 2E7HA 2D0FA 5IV2B 3LDBC 1RUML 2V5RA 4S2SA 2Y5TB 4EE2A 4OJAA 1QQDA 2Z8VC 2JNZA 3ELAT 4LCWB 1PLAA 5JORA 5BMFL 3NCMA 1IGYB 3DO3A 4KQ3L 4Z5RB 4OQTH 2PXYC 3VFPB 4F1ZA 5ECGA 3B2XA 4G6AD 5GISH 1HSBB 2HT3D 1X9QA 5EWIH 4WFGE 2VZUA 2GT9A 1DJGA 1VFMA 1CBJA 2WNXA 4Y88A 3C6LD 4BFRA 2VH5L 3QUZC 4BEIA 2XOTA 4K0OA 2XPGB 3KPMB 5DO2C 5DUPH 1UASA 2FVNA 3D2UA 3RP1A 5CCJA 4JQXA 5AG9A 5D5MF 1JUFB 3O45A 4GG6F 2K78A 3BUQA 5SWSE 5DYOA 2TRHA 4DPAX 3PABB 1LWHA 4GAJL 4I2XA 5D1QD 3RRQA 2NY0C 3IFNH 3PWPD 4LESA 4KTEL 4F7PA 1I7ZB 1OSPH 4C4BA 2R8SL 1R0AH 1RZJC 2G9HA 1D2PA 3ZKSD 3FQYA 1U8MA 4WTQA 1AIZA 4P57A 4PCKA 3FTGA 1RZQA 4FFWC 3PNWA 5KOVC 1RUKL 5DRZB 4JX0A 1KCKA 3KPRA 3TT3L 3A4DA 1SRDA 4YDJA 2JK5A 3FAXA 1B9KA 3U46B 3E6HA 5IROC 1JDAA 2HWZL 2PO6C 4ZSOB 1OB1A 5DMGC 4MLSA 3OKOA 4YZFE 2BOLA 3OG6B 3K6FA 1OP5H 3DV6A 4ODXA 5BXFA 2GW5A 3B5TA 5GPRA 3QDJE 3T6VA 5KW9L 3RIAF 1EDYA 5D6CA 2VN3A 5H4YA 4GFTB 2GJ6D 1KPVB 2VR7A 4OLXL 1UENA 3L45A 4Y8DC 2K3HA 2ZOLA 4GAGH 3LN4B 3TFBA 2WINA 2O5XL 3CFEA 4LLMB 4O02A 3VI4E 4KKZA 1TZGL 2BJML 4XN2A 3BQUA 1J8HB 2WO4A 2YAFA 5HGHA 2FBOJ 4OFKA 1EGJA 2QMKA 4XZUA 1MFDH 4D9RD 4KPHH 1EO7A 1JFQL 2FL5B 1DBKH 1EZLA 2CR6A 2OMYB 3CFJB 5HYFA 4FDWA 4LSRL 1KLFA 4FJZA 1HXYA 4X50A 3VFGH 2X09A 5JTWA 3DTUB 2ROYA 1LO0L 1T1ZB 4MQXC 1G84A 3QRGL 4UQCA 5TF1L 3CMGA 4GEJA 1ZSHA 3CSPA 4A6YA 4BH8A 1AH1A 3N2JA 1CTMA 3NEXA 5AALA 3OQRA 1CFSB 4PN6A 4JFEA 5HP5A 4LVOB 3QWOA 5IGXH 3WTSA 1W9XA 2I7OA 1HJCA 3FCBA 4P57B 3TIEB 2DMHA 4A6YL 4POYA 3O6KH 2Y36L 1KEGH 2J1WA 4JZNB 4Q14A 4XMXA 3EGXA 4FL4C 2AK1H 1J5OL 4TOYH 2COQA 1SXAA 3ZX1A 1W8EA 2Y2TA 1HWHB 3D33A 1C5BL 3I6GA 3MCG1 4LKCA 4X0NA 5EUOE 4AY0A 4BFKA 5I0ZA 3GRWA 5D2NA 1ZV9A 4HLZG 2W80C 3NABL 1E4XI 4XVOA 5AWNH 5L2KD 2VC2H 4YSOA 5F9DC 2BP3A 1BVLA 4EMZA 2X6BA 2WN3A 3FPXA 2R23B 3GMRA 4Y1AB 3KBFA 1KTLB 2X4RA 1T1YA 5ESVA 2I9LA 1UD3A 1M4KA 4ZFZA 1QW9A 1BREA 5IB5B 5A2IH 3FUJA 4M3HA 3W2DL 4FEIA 4NHUB 4GB9A 4GI6A 2HLAB 3VAEA 3T6QC 1ZDQA 1W0VB 5CJOL 1BW8A 1YG9A 1MIMH 2BY2A 5IHUL 1BFOA 5MEOB 3DSFH 5I1KH 1QATA 1F41A 2CBMA 1F2QA 2FJFB 2X4SA 2YGQA 1WPCA 3DIVA 4LP8A 5GIRA 1A25A 1F4WL 3RHWF 2V2WB 5IQMA 4Z1PA 1N0LA 2CNYA 1E5YA 4E9VA 5DC0A 3ARUA 1YMMA 4M1CC 4HS8L 2CXKA 4M7KL 5HHXH 2BSTA 3ARGD 1T83A 4HCGA 1MRCL 1CG9B 3LEVL 1JN6B 4M48L 4ODWB 4NI6A 3R8BB 1YY9C 5EOCJ 3S8WA 3SIKA 3UTZB 4KJQC 2ICEB 4AEHL 8FABA 3EOAB 5IK3A 2DEXX 2HZHA 3GXMA 3WGUB 1S9VA 5EN3A 4J6RL 5IZ7A 2JTDA 1YPZA 3ECBB 5B8CA 5HHMB 1J9CT 2HFTA 3QQ3A 2AGJL 4G42B 4G6JH 1AG0A 3B8YA 3IE9A 4G59C 1VRSA 1EAOA 4JPVH 4U1LA 5GQBA 1AG6A 1MI5E 1V10A 3FT0A 4HLZH 1DCEA 4MSWA 2HJFA 1TZIB 5EDXA 1UZ6F 3OC8A 4XAKE 3QWRD 3QNYB 4OJFH 4X6EA 1C5DA 4ZXBC 1CDYA 1CD1B 4RDQF 4ONHB 1XB8A 3IVKA 1ZANL 4DVRL 5M94B 2ARJB 1FNGA 1O7SA 2V37A 5ANMB 3QUXC 1XFPA 1XGTA 3ZE0E 3PNWB 1KJ2B 1OTTD 1FPTL 5E6UB 1JF6A 4IIQA 4DCQA 4HSAC 1D6VL 3FXIC 4FLHA 3D9AH 3TBYA 4TQ8A 2B59B 3U7WH 4YMPA 3B9KD 4FQCH 3LKPA 4MXQD 3MXVH 3O41B 1T6VN 4OGXL 1ACYL 1BQ5A 1Z3GH 1AGEB 4F57H 1AS6A 2IH1A 4BZ1A 1OAJA 3WY1A 3EYOA 3Q8EA 4V1DD 4QJ5B 4B9ZA 3QUYA 1UD6A 3MV9A 4A6YH 2LHAA 4CJ1A 4N1HB 1JGLL 3UJIH 3T3PE 3FO2A 4ZAKD 1BMGA 4P23D 4LCYA 5TDOB 3OKEB 1YN7A 1TTCA 1F5WA 4U1IA 1MAMH 3HC0B 1JP5A 3NCFB 1GY1A 4DUVA 5EOTA 4APQD 3RTQD 2AEPL 3QPXH 2FRGP 2J8UB 1BM3H 3FB5B 2QGCA 3BFOA 1KV3A 1KLGB 3GQFA 3N42B 3WBDA 1OQXA 5TFSH 1YC8A 2H6OA 2YQGA 3CXDL 1V7NH 3ETTA 1CD1A 1EFXD 1WP6A 2PTVA 2NY5C 3P02A 4FTVA 4K94L 1MG3C 2VWEE 1PZ5A 4P2QD 4RMRA 5I30H 1BOYA 1UT9A 1J12A 3QFDB 1P7QA 3N1FC 2XG5B 1KT2A 1K9TA 5CR1A 4PJ6A 1UEMA 5BOPA 5DS8B 1RU9H 1Z1WA 4NNYB 1MRFL 3G5YB 1NPJA 1KB5B 3KYMB 5DUPL 4S0SD 3V6OC 4GW5A 1X6NA 2KPWA 4DVBA 2UZIL 3B5HA 4LLUA 3GMNA 3OAYH 3DWTA 3PE9A 1A22B 3VXPB 4DGYL 1CXKA 1L6XA 4GQ9H 5KN5A 3KLHD 1GOGA 4NQEB 3DUUB 2HFEB 3OMAB 4P2OA 4U6YA 2PTTA 4RNRB 3AS1A 2X0UA 5H35B 4HH8A 3TN0B 2YA2A 5F7LB 3ZHKA 4ZYKA 4HS3A 4CVUA 1MW1A 3MKKA 1AD9B 1XGRB 2XTLA 1MFAH 4WTWA 5DJZB 3X14A 3PWJB 5TH2A 3K6SA 3NZ8B 3OHMB 4J3OD 2HH0L 1GCFA 5DO2D 4O5LL 1CFSA 4BM7A 3WFHB 3CMOH 1G9NC 3OB0K 4N4YB 4X7TA 1UXWA 2AQPA 2CCLA 1GC1L 5JHLA 2JIXA 4Q8BA 2IQAB 3TM6A 3I2CH 3VXUE 4KC3B 2XNAB 2JJSC 4J3UA 3F84A 4M5TA 1QTYT 3H2PA 1U8NA 3GSQB 2EDJA 4H8UA 3D8MA 2MMXA 2XZCH 4LASH 4A7TA 5KSBA 1GGIL 3L5XL 4OJCA 3ATFA 2EAEA 4OF3A 5BJTB 3TO4C 4RAHA 5BVJA 2FSEB 2PCYA 4NQVB 2WTPA 3O45B 3SOTA 5B21A 3HB3C 4FQJH 4HFUL 1JPFB 1U9KA 2VITB 2NUTA 3UEQA 2A4ZA 1WV7T 4MCMA 1THAA 3I50H 4FQPA 4N9GB 3V55A 3WNIA 5BV7H 1PZAA 5JOPD 2EIMB 3KEDA 4BH7A 2F19L 2V17H 5F96L 2G2RB 3MYZA 3P9WB 1DO6A 5FAAA 4P9MH 5CP7A 4IKJA 5DWUL 1EZVX 3S0PA 3C5ZB 4KAQH 1FFPA 3C08L 3QYMA 2DWSA 4GAYB 2AABH 2EUXA 3FQ4A 2CRYA 5F7FA 3G3LA 2CLZA 2EEXA 1H19A 4K9EL 2C9RA 3MLXL 3OAUH 3ETBJ 2YC1B 3I3DA 4KI5E 4KKQA 5F1KC 2WBJA 4HMDA 3ZDWA 2JQZA 1NGPH 2LQRA 4ZX3A 1YEEL 4KUCD 4PP1C 4GMSH 3ZTNH 1A8ZA 5LCVH 3V4VA 3QJVB 1OOAA 3MRPB 4G6KL 4WO4A 5PCYA 1ZLSL 3AQZA 1R4XA 4ATWA 1RHFA 4YSAA 2Q6WB 2XNAA 2GEEA 2WINB 2L8AA 4I3GA 4P5MA 2EXYD 1X4YA 2DJMA 3DX6A 2DB8A 4Y9GA 2OMZA 2DMCA 1OF2B 2WQSA 5I6MA 1ZVSB 3CVIH 2OMXA 2YR3A 3HOGA 3APNA 4XR8C 3BFWA 2XIBA 3LZQA 3RURA 4F20A 2A5UA 2BXYA 1BFVH 2JXMB 3ARGA 3GSNA 4JJ5A 3T0EB 4HKZB 4YXLL 1KN4L 1OGTA 2AVFA 2MNUA 1EWHA 3OKNA 5IMMB 4YQXH 4JG1L 3WNPA 4Y2NA 3VU1A 2X4TA 1S7QB 2D0HA 2KLTA 1JZ6A 5HJBA 5JW4R 1CFBA 4PJXB 1V3MA 4ZUVA 3CVHB 2Y5TA 5KANI 1N5AB 1MHHA 1SUHA 4NM8L 6FABL 3SPJA 4G3YH 2FDBP 2D3NA 2CXGA 2LU4A 4IYKA 3TWCH 3S37X 4HWBA 4KMQA 1IBGH 4IOIA 4JHZA 5AW9B 5J3HC 5BCAA 1PQZA 1YVLA 3TVMB 4LXFA 4FQCL 5IBLD 1BECA 3D0VB 2CKBH 2K4AA 5DZAA 3FTWA 4Q0XH 1ANUA 2IFFL 5IHZB 1HHHB 3VFOA 5JZ7D 3QAQA 4E9RA 2OA9A 3FZUD 5C2BH 1GGCL 3TX4A 3TZVD 1V7NL 2IXQA 4N2KA 2MCMA 3RDJA 3DPDA 3EJRA 4A37A 5LN8A 1YNLL 1PFCA 2G5UA 4JPWH 5IW6A 3RGVA 1KCRL 3NCJL 4P07A 1XH1A 3ARVA 3WUWB 1CTNA 2B08A 1ZS8A 3EGSB 2E56A 2ILLA 1SDYA 4KK9C 4NQDE 1A4KB 1DQJA 2GSGA 1AACA 3ASWA 4DQOL 2XWBA 2ZYRA 1N10A 4EZJA 3ZT6A 1F42A 3A6BL 3T6XA 3DVGA 3NSJA 3RL2B 1ILUA 4CMHB 2XG4A 2BZDA 1PD6A 1MDAA 4U3HA 2X1XR 3IS0X 1HOCB 1N0XL 1MJJB 1UWEH 2NYKA 1T2JA 2FEEL 3OHXC 4KI1A 1VKXB 4WU7A 3ALWA 3RHWK 3MNMA 4N24A 1Z0MA 3U7WL 4FA8A 2J57A 3UZVB 3MRHA 4OI9A 1AI1H 3DMMA 3RPIB 3SE4A 2A9MH 2D9QB 1P53A 2EXYC 4LCVA 5GSVB 2XXMB 3FQTA 4MGXA 2FWOA 2FHBA 3K4AA 1PPIA 2ZKWA 4G8IB 2VJXA 3BE1L 3L3DA 4FQXA 4Y5XA 2Y2WA 4P5KB 2YEZA 4PJ8A 3CFDB 1FZKB 1XF2A 4RIRB 1VCBC 3J2PA 3VXUA 2X2YA 4WFHD 3G5XB 4QPEA 3QEGL 5IFAH 4X7TB 4TLSA 4GIAA 3FUFA 3HAEB 3A0OA 2NY5L 2V7NA 2VW4A 4K94C 3FQXA 2CRIA 2IBGA 1JD9A 3TYGL 2OSYA 3GB7A 3ME0A 5E8DL 3SKJL 4AE1A 1VACB 3GJFA 3KXFB 1UJ3C 1FFTB 3EHBD 5BS0D 3B34A 2P7TA 4CMHC 1NC2A 1ZS8B 3EGSA 4AIXA 1TJGH 5I6LA 4QGTA 1RI8A 1QR1A 9CGTA 2KLRA 1GCYA 4XO8A 2ODIA 4TULL 1VB9A 2VR4A 4N68A 3SJVB 3NIGF 4MS8D 2CLZB 1X7QB 5CGYD 3ULUE 3K80A 5HYQB 4WU5B 1JFHA 1E50A 2VZ1A 2A1WH 2WHVA 1W15A 1UOWA 3KJ6L 1AC6A 4LHUG 5DQDH 4H1LH 2XQBH 2HSIA 4RMVA 4QDGA 1ZLUK 3FQWA 3TL5A 3TYFA 1BD2D 5IQ9B 1QABA 2F53E 3C5XA 4UBDC 1UM5H 4Y4HC 1TEGA 3HI5H 5BV7L 5EU6D 1GGUA 2FX7L 5GRZA 1T0MB 3AY2A 1MFBH 1GYUA 2PWGA 4XNUL 5FGRA 5IUSA 1KLGA 4XN9A 2AS5M 3SDCD 2VNCA 3QUMH 3ATAA 1KEMH 2ODHA 4LGPB 4OIAA 1QRNA 3RZWA 2BVQA 5DVNA 2V7NB 1JI1A 5HYJE 3S96B 1QHQA 2OSLA 4MDIB 5T8IA 3EFFA 4TLTA 2R59A 2H4EA 2Z31D 3DNKA 1BQRA 1OAUL 2R69L 4M8VA 5DEFA 3RIAK 2NY7L 4RAUA 2MPAH 2EH7L 1F6AB 3ZE1E 4P2AA 3EXLA 1ZAGA 3FRUB 4H8WC 1A47A 3GMMB 1BAFH 5ITFB 1YSOA 3BMWA 5HGDB 4PMFA 1U4EA 3KLHC 2CDFB 1MZYA 3IETA 2VSMB 3VXOB 4Z77B 3FCTA 5GSRA 1YMHA 4Y89A 5GJSL 3VNZA 3ZRSA 4JRXB 4GSDL 1FL5B 3EYFA 4OLZL 1DUZB 4U1JB 4JVPA 1HSAA 3QDMA 1JPGB 3ZO9A 1ZLVK 4DO4A 1KBGL 4K9JA 4DAGH 4U31A 3QCVL 3J07A 5DZLA 4LSPH 5FKAB 2B8OT 1W72L 3SPIA 2VZSA 1QO3A 3UYRH 2IAAC 3QZNA 2NLJA 3LEXA 2AV1A 4HAGA 5DR5H 2R27A 5D96C 3GZQA 2V3DA 4A68A 4F8OA 2FIRT 2CKBL 3IGAA 1T1WA 5IOPB 4RA3A 4WFED 5C0AA 1CMOA 5KUMA 3VGAC 4RMWA 3ULAB 4FA7B 2H7WA 1NAKH 4C56D 2Z7YA 3DHMA 43CAA 4LBEA 3HHSA 3T2NH 4KNUA 2YAPA 1FLRH 2TSBA 4X99B 4AQ1A 4JRFA 4LLVA 1Y0LA 4WZ9A 3QZWA 2OMUB 1M7DB 3FN0H 4L1SA 1V3KA 3FQUB 3L3KB 2BIHA 1I3RA 3BQUB 3PHAA 4JFDD 5F21B 3UTPD 2MCG1 3WFEL 5FYJE 1UADC 1AXTL 2XQYK 4J2QA 3SDDC 2NXYD 5JUEH 4MB4A 4A7SA 5AAWA 2UYLA 4TNVF 3V5KB 2O93L 2H2SC 3MLSH 1GXEA 4WI8A 2DKUA 4X5WB 2VM3A 2B5IC 5PAZA 3SJVD 4DP5X 1SJEB 4ZFOA 4NN7C 4W9IC 3SPVB 2N01B 2WYHA 1M05B 3G6JF 4GRLC 4NZTH 4YHPB 5MEND 1MCOH 3GBNH 1UB5B 5DJ2B 1TQUA 3IDXH 3MX0B 1KTDB 1I3VA 3C75A 3RWGB 2AC0A 4OLUH 3CXDH 1YEJH 1J1PL 3FQXB 4NJAL 6PCYA 3S36X 2E9WA 3ZDXB 1KXQE 4HMEA 4XPTH 5I6NA 3Q13A 4MX7A 3C8KA 4ZW3A 5GS0C 4LEBA 4JPVL 2CU9A 3A23A 2F08A 1GAFL 4P4KB 3QNXA 3EOTH 4GMTL 2PCPA 4PJ5A 4YJZL 3NIDF 4AGPA 4CVWA 4K23L 4FQHA 4WHYH 4OSUH 3T3MB 2QKSA 1JWMB 3MBED 4H1LA 5D7LB 4G8GD 4QCIA 1GGYA 5FPIA 1PZ5B 4JDVB 5T1LB 3MJ7A 2ZP0T 3MACL 5ELIA 1EDQA 2A0LD 3HKFA 5DJ6A 4XMKL 1VENA 3U4EB 4BJLA 3WY2A 3BUIA 3D9AL 4EZLA 3MA7A 3TNMB 5HYJD 2KLSA 2O6FA 2A9DA 1QPKA 1AE6L 4L4TA 4NPJA 4ZZKA 4H88H 1RLBA 1WD9A 1JRHL 4TPRH 1JHTA 1N68A 4YL9A 5L6YL 5A16A 1F4WH 2NX5E 4TQIA 4BWUA 4OZHE 5GGUB 1G94A 2BY1A 3MRQA 4C4KT 1U58B 4GKZA 5E99H 2CDGA 5IBTH 3D3VE 2D7PA 3ARDB 1HILA 2FJUB 4HPYL 4BFIA 3ZE0F 2JMRA 3RBGA 2PMZA 5F7NC 4CC0A 3KGSA 1HOEA 5EOQH 1Q0EA 5EOQL 2WD0A 5DJCB 1HHHA 4XP5L 2EUZA 1FL3B 1AR2A 3O9WA 4Y9BA 5D6CB 5JHMA 3AREC 3LH2H 5FCSH 1TDQA 4ZO6A 2VKXA 2HRGA 3QCTL 3OR7A 4PJHB 2XPZA 3QDJA 1LE9B 1MHPL 1O9ZA 4G8GE 4Y19A 3A6CL 1L6ZA 2EKSA 4OJEH 1ZGLA 1COBA 5IMKB 5CLXA 5CEZE 3PDGA 4UI2A 4WTXA 3ZL4L 2H1XA 1A6WL 2VXQL 4FI8A 1ZHBA 1NGXB 5KOMC 5I15H 4AYEC 5EPMA 4I1PA 4CA4A 4JPQA 4IRJB 3F7YB 1PL3A 1P4LA 2V9TA 1BQHG 4Y7MA 3DVGB 1AQ8A 1XCTA 4OCRH 5DSCA 1ZVHA 3O3DA 3F7VA 4PIRF 5H94B 3EGXB 5IVXA 4QUOA 4WW2B 3CLWA 3N1GC 2IWFA 4Z7IA 1E5AA 4UQ3A 2PF6A 3W0WD 4I48B 5IGXL 3BDYL 4DGIH 2GQHA 3VXNB 4FHKA 2X70B 3OJVC 3X11B 4TVPE 1QW8A 2ENJA 4WGKA 2EE3A 3FFOA 3FHQA 3NRPA 5D93C 3IN0A 3F7RA 4JFZL 2G9KA 3HFMH 2YD0A 5GS1B 2W88A 2XWRA 4XNQA 4CSSA 2WZ6A 5CIPA 4XCCL 1IC7H 2Y1YA 4DK5A 1HHGA 1M71B 3PGDA 3DX1A 2F58H 4L0PB 4IBYA 43CAB 3GHEH 4YC2C 5DD3L 3UCQA 2X4QB 1I9EA 1LMKA 5J11B 4FXKA 5IJKC 4JPKL 1SXZA 3L4VA 4RRPM 4XC3H 5DK2A 2JKNA 3EGDB 1XB3A 1MQ8A 3K72A 3QORD 1JZFA 3GIVA 4Z18A 3TVMC 1QASA 4I0PC 4D9QD 4ZXBA 3MOBL 4R4FH 3ZXAC 3KBPA 5J4MA 4M62H 3O6LL 3VFNA 3U9PL 1UD5A 4MBOA 1TETL 3RVVC 3BAEH 3V6OA 4ZODA 1GZPB 3SZ6A 3UC0H 4ELDA 2A6KB 3MXVL 3C5ZD 3L6FB 3NCBB 1KV7A 3CSTA 4NP9A 1ND0A 1SHSA 3RVTC 3CN0A 3NSXA 3WKPA 5KUKA 5HVHC 5CJBA 2NY0D 1XVSA 1TZHA 4NNXA 4WI3A 4KXBA 1Q90A 3LDBB 2XA8L 5IMOB 3C5SA 3E80A 3GUFA 3QQ9C 4HIEB 3GC3A 1BJ1H 1OAZL 2N0KA 2IFFH 1HJBC 1EBPA 1WGOA 2ZXGA 3E6FB 2R7EA 4MB3A 4KH2A 4QTIL 5HJ3B 4AEHH 1HESA 4RX4D 1BGXH 4N1EA 5SX4H 4KV5F 4Z0BH 5ISZA 4LSPL 5CHNA 2XVKA 3P3UA 4NKQB 3S96A 4F1SA 3CLFL 2ICWJ 3ILQC 1R5WB 3RLSA 4PCYA 1RERA 3EGDA 1N2RA 1KPUA 3KM1A 3KPQB 4YSSA 4NUJA 1Q0YL 1J8HA 2A6KA 2DD8H 3FSVA 3R0NA 5AWNL 3AXHA 2A1WL 4GKNA 4LSVH 2FGZA 1O7DC 1OAQH 3PGFH 4YLQT 3NEEA 1U8OA 2H26A 4MLIA 4L4VB 2KHAA 1GZQB 4K3DH 5D1ZD 3FBKA 1E9PB 3DX0A 5EU6B 3MJ6A 4P4KA 3RWHB 4KK8C 3PDOB 4AIEA 2JCWA 3WDJA 4NM4H 3T0ED 2QADC 5T1JA 2ADIA 4KKAD 5I17A 4XRCB 1LJMA 5DFVD 2VDNB 5I1LA 2PCFA 2F19H 5BZDB 2W9LA 3MJ9L 3D3VA 4X4YA 1PEWA 1GZHC 25C8L 4Q6IC 3WEMA 5IIEA 3L3OA 5I1EH 2KQNA 5JXED 3DJ9A 5EEVA 1CI3M 5ICXB 5GRWA 4BFGA 1ZLVH 1CICB 1FYTE 2J12B 4FQIH 1A6UH 3QG7H 2X89A 4IBZA 4PRNA 1U4FA 3OAUL 2P46B 1ETB1 3H0TB 3MCYA 4LLQB 4ETYA 3O6FA 1IJ9A 5TE7L 3SE8L 1AQDB 2EECA 3B9AA 2YD3A 5DQ9B 4L8SA 4PJFF 5EIIB 4B5EA 4L1HA 2AFNA 3R0MA 2ZSVB 1PW3A 1JK9B 1BYOA 3IPFA 3MLTB 3LEYL 3ARFD 4HZ1A 1EANA 2HMID 4TOYL 4F3FA 3ARQA 1WFJA 1M7DA 4MAYD 5JQ6H 2ITDB 4MWFB 3P2TA 4QXUL 2HXAA 3O9WB 5K1JA 4HXBL 4E42B 3EBHA 3V0WL 3KW8A 1JUFA 4OLVL 2LLGA 2ZUQC 4WFHE 1W80A 3MUY1 4NC1C 1KCVH 4R96A 1BD2E 4LP4A 4N20A 5CAYB 4NO3B 4NKMB 1NFDE 1ZGLB 4N2HA 1ORSB 2CO1A 4HIHA 4MVBC 4CVXA 4AV4A 3SDXA 3JWOL 2PW1B 2BS71 3MJ9A 4MA1B 3KYNA 4MNHA 2P8LB 2QGEA 3O9WD 1IILE 5G55A 3RVVD 2EE2A 3U79A 1U33A 1WAAA 4IGBB 1RMFH 3D2TA 3TA3D 5I5IA 4NAQA 4NENB 1XGYL 2J7LA 4BUHA 4P9HH 3FH5A 4RZKA 3TO2B 3W39B 1JWUB 2QKIC 2Y7MA 5C0EB 1PNDA 2VMEA 3IFLL 1CF8L 4DK3A 1FH5L 1FV1B 1HWGB 4B9IA 3PREA 5I6OA 4RFOL 4EXPX 3EZJB 2NYYC 4XP4H 4M7ZB 2QLVB 1JXJA 4OUOA 1P84K 1MG2C 4KJPC 4A63A 3KDMA 4G7QB 1XF4A 1S78C 3UACA 3JWNH 5IHZA 2QZQA 1JF1A 4EKXA 3COOA 3UTSA 3FT2B 4JFSA 1DEEA 4KX7A 3WCYA 2ITDA 2RGSA 4FNQA 4WFGD 1AGDA 4Z3GA 4W9EC 3GSRA 1Q4NX 2Q7YA 5HYEA 2C26A 3BAEL 3BGMB 2AXGB 4JRLA 4FTDA 2AAVA 5FK9B 1ASQA 4DO5A 2BDNH 2AK4E 4L9LC 3GO1H 3EJCA 2C9UA 1MEXH 1ZANH 2BSSA 2NTFB 3VG0L 3MCLH 3FH7A 3CD4A 3T77B 4WI0B 1QEWB 2OR7A 2QQKL 5CEZL 1I4FA 4W9CC 2EXTA 1LHZA 4LSQL 2ZYHA 1IGJB 3WFCL 4F37K 5CEXA 5E2TH 2YSSB 3GSOB 3UERA 3WJJC 1T1XA 2M26A 5INDA 5HPOA 3S3SA 2O6DA 3NDZE 1M6OB 3UPAA 2LAAA 3WN6A 3CZGA 3LNEA 1E8WA 2FQFA 3FT2A 5CJXA 2BC4B 3OXRB 2VYRE 2Y7SA 4NUQA 5I0DA 4HLJA 1E9PA 4GUQA 4HMCA 5HPMA 3LIUA 3TA4D 1ADQA 5MP6H 1KB9K 2JKSA 3WIHH 4CNIB 1KELH 1NDMA 3S37H 1CL7I 2V5YA 4N0YL 4H8QA 4BKSC 5AVYB 1OALA 4LF3B 5EBWA 3AY4A 5C2UB 1BQSA 4W81A 2BIMA 1F3JA 2VQ1A 4GW4B 1XWVA 5FV1L 3BAIA 1R5WA 2W91A 4FNUA 3V4PA 2FO1A 3DOSA 1A6TA 3WKYA 3GBML 1UG9A 1OZUA 2X4PB 3SDAC 5CP3H 1OCWH 4U7MA 3QAZB 3ULUF 5KTEL 2R2BB 4Z9KB 1SOKA 2DWDB 2XC8A 5E8NA 1TITA 1DLFL 1KC5H 2XFXA 4D9RE 4NBXB 4AJVA 1I9JL 2X4OA 4OF5A 2F61A 1P5UC 2G60H 3SN6N 3QJFA 1XGQA 3AM8C 4JCWA 2R51A 4R4ND 1AZNA 1DJHA 1DZ0A 5FYJD 5DCCA 2BCKB 2GSMB 3F12B 5CLZA 3SKUD 4NQSB 4PV8B 4OZ4B 2WY3B 1I7RB 1ET7A 1OSEA 1TEFA 1E4XH 3QEGH 5IFAL 1T1XB 5INDB 4UQAA 1P4IH 4JS7A 3M6DA 3SE6A 4KTDL 4XNYH 1OTUD 4YR6B 2VDQL 3NZSA 5EU7E 3HLKA 4J3OH 5HDQH 2XWBB 4WGWB 2CZNA 4DGVH 4LRIC 2DM7A 5K5YA 1S3KH 1HU8A 3FUMA 5DLMH 1NUGA 4DCQB 1NEZG 1A8JH 2JIXD 1NCAL 1V05A 1SBSH 4KY2A 5I5JA 1AE6H 2VLMD 1D7FA 5ACZA 2GYSA 1HQ4B 1E90A 4TLKA 1K3IA 5EU5B 2X2HA 2ZCHH 1UXSA 4QHKI 2X6UA 2BLFA 3QEUA 4LRNH 5HJGA 3D69A 4ISVA 1R3KA 1RUPH 4QRRD 3T1FB 1BBJB 3UZQB 5INCB 3RX7A 5T1LD 1LO4H 2W38A 3VQLA 5L8LB 5EZLA 1CZ8H 1D5BB 1NH6A 1TNNA 1SF3A 3QJRB 4XXCA 5HGBB 1MFCL 2CWRA 3ZRCC 4FF9A 2VDLH 4QHLB 2GKIA 4AK1A 1OK0A 2J4WL 2IPTL 1DLFH 1KC5L 2K45A 3K6DA 3WO3B 1E5ZA 4GXUM 2R56L 3PQYA 1KFAL 1INEH 1F02I 1U8CA 2N1TE 4OJYA 3UYPB 1NANI 2FT8A 4UTAH 1BQUA 5CEYB 4BSWA 4Z76A 1N4XL 1X5IA 1Z9OA 5EBMA 2NR6A 4ZMQA 4JY6A 4X8CA 3PP4L 3GMLB 3NACH 2G2NA 4URKA 1WUNT 2ZXAA 3DUHA 3X13A 2ADFL 2Q87A 5J5EA 5BOZG 3IJSA 3V4UL 1UKQA 5F71A 1I3UA 3NSFA 4LIQE 4F7CA 2RCSL 3RWFA 4N87A 3W0WE 4IHOB 2A74C 1BPLB 2D31A 2JVUA 4ZX6A 2RH0A 4J3TA 4X7DC 3CPUA 3BFQG 4RAVA 2LGNA 1KCRH 3NCJH 4U4BA 3FK3A 1XR9A 1XR8A 2BINA 3QNZB 3QO1B 4KTEH 4KZ0A 1QWNA 4OFYD 3C87A 1QLRA 4JB9L 4R7LA 1JTPA 3W57A 5AYQA 3CVIL 1ZEAH 5GGSY 3HVDA 1R3LA 1I1FB 2AQNA 3EH4B 1FNFA 3LZLA 3MODH 3P77A 1RUQH 3F01A 5DT1L 3EKCA 5KYYA 3LPOA 1MEXL 3QQDA 2DLFH 1AVAA 3GSWB 4LHUB 4U6VL 1W72H 1IB5A 4JZJB 3WN5C 2NXZB 1I8MA 1IGJA 4UMGA 5EEZA 4MNQA 5D6DA 1WFIA 2JQAA 4AGOA 2WXHA 1ZTXE 2DYPB 1J8KA 4X8JB 3CZSA 5D55A 5KZCB 4W9ZA 1AHWC 1OTUC 4IHBA 4OQTA 4YDKH 4PRAB 4TL5A 4JDTL 3T0AA 2ZJSH 5F9OL 3DROB 1HCFX 2QPUA 4MD4A 4BWWA 3TU6A 4UOW1 4CBPA 4M8RA 3DYOA 1B4JH 4WI2A 1AIFB 5JW3L 1F3JB 3GXUB 1GHFH 4M00A 3WFZA 5AQ0A 3O2DL 4URTB 4MJ5B 1CFQB 1Z5LB 4ZUSA 4PRBA 4EAEA 1BXUA 4ZSOE 3HG1D 4DUXA 2P9RA 4FFTA 4Y4HD 4XNYL 2AJYH 4HH9A 4OQ1A 3PAYA 4Q58C 2UWEB 4KTGA 4FQHB 2NY7H 2G2RA 1I1AA 5FB8B 2OMTA 3S7GA 5C0DB 3VG9B 4JE0A 3HC2A 4LIQH 2FIKA 5HHOA 4GUPB 3VVVA 1QSVA 2RFXB 3NAAH 4OD1L 4OZGA 1T20B 2MQGA 4V11A 1SY6H 1G4MA 2NXYB 2EEFA 3LS4L 1MFUA 5F9WB 3WSQH 5HGAB 1A4AA 2FBJH 1O7DE 5E70A 4AYFA 1P4UA 2NXZC 4HCFA 4TUOB 3VQMA 4BINA 4L9DA 2G5BA 1CFVL 1EDHA 3VCLA 2NX5B 5IM7B 1TXKA 3WHE1 4D0BB 2XN9A 1FZOB 3GHBL 4N0UE 4BV1A 2MH4A 2HVJA 1W16A 3L2MA 4NZRL 4QRQA 4F8PA 2F15A 3N0PB 3NCCB 4O5LH 1HK6A 2X42A 3M17A 5CZVH 4N25A 5T3ZH 1IAIM 1GSMA 1WBZA 2WNKA 4JRWA 5HI5D 5L4JA 1E9QA 2WWKO 3I6GB 4LKCB 1OCOB 4ZD3H 1IFHH 1QNIA 2WWNA 4PJXF 4RGOH 4L23A 4LK4A 3SBWA 3W5MA 1BQKA 5A6LA 1RKRA 2R1XB 3WYRA 2X4NA 1PZUB 4I2XE 1HKLL 4DGYH 4X99A 3P9MA 3H9SE 2VSCA 3U82B 2BNRB 3H2QA 3CFUA 2QDWA 1PKQB 2HRHA 4RESB 5FF6B 2RB8A 4XNDA 3O2WL 5C71A 3UTTA 2PUQT 2ZXDA 4DNLA 2CUMA 2OXHA 4MMYA 5GRYA 5IB4A 3HNVL 1MIML 2DQHL 4TV3A 1EJOH 2Z64C 3X2QB 1DBKL 5C0BA 3KGUA 4PJFE 4XO4A 2OMWA 1INDL 3MBWA 3HR5B 2PETA 4LT7A 2OZ4A 3WAJA 1PZBA 1DN0B 2ZUQB 3AXLB 3WXWH 2Z7WA 3BLKA 2SEBB 4A7GF 2X4UB 1JZEA 4LAJH 1H3TA 1OK8A 1SM3L 4DN4L 2ED7A 2P45B 3G5ZA 1W0YT 4G9FB 4BUQA 4YDIL 2A99A 4L9LA 5HHQA 4E5XA 2Z35A 4IRZH 3U7AA 2HLEB 1GRWA 4XH2B 5T33H 1XQ4A 3FRPA 1G9HA 1L5GA 2EEBA 1HHJB 5INCA 4GS7B 3STLA 5DLLA 3E8UH 5SWZD 2QQLL 4IGBC 4R7DB 1RHHB 3P3SA 4QCIB 4ELME 5FW7A 1AXSA 2APFA 1J0ZA 1OB1B 3HS8A 1MCJA 3HUJF 5F70A 3VXTA 4NXSA 4GBXB 3WLBA 2E46A 4HUNB 2QPFA 1UEYA 3MDJA 2AEQH 1TMQA 1UJ3B 4E9YA 4YDKL 2XWTA 4G5ZL 3ARRA 4NQCD 4J3OF 3BZ4A 4X6EB 3MCKB 2CRZA 3B8SA 5B3JF 2OI9B 1I1YA 2Q7AA 1DQIA 5CILH 2ZSWA 1CGSL 3GBLA 3C60D 3L4CA 4YVUA 4MVBD 3BZDA 4NERA 3FS9A 5DRWA 4NN5B 4F8QA 2ZF9A 1LD9A 4F33B 1WBXB 3UJTL 3OMIB 5IB2A 1EH9A 1QLRB 5C0CA 4NRZA 5LGYA 3PF2A 3ZKXB 5E94B 1HN1A 4AVHA 1YJDC 4PI0A 2YPKA 3L3DB 4UU9A 4Y5XB 4BZ2L 2IV9A 5C2BL 7PAZA 2DY2A 2AQTA 4AVJA 5SWZE 3WS6A 3CK0H 3EBIA 4GW1A 5FECB 5JLZB 4M8QA 3RWDA 1JNNL 3FONA 1JVOA 4G6JL 3KYOA 3EYQD 4CRPA 5DJCA 4D8PA 2ZOTA 1MNUH 1KBVA 4OCWH 1S5HB 1ROWA 5C3TA 4DQOH 2FAUA 3IYLW 4NSKA 1BP3B 4Y4FD 4BRJA 1IVTA 1JWUA 1S7WA 1RURH 2YMOA 3S5LB 1M9SA 3UO1H 1A7QL 2WVVB 1L4IA 4PLKD 4X2UA 2BWDA 2IDTA 3JV5A 4AUJA 4D8OA 4M62L 3WTUA 1JK8A 1NC2B 4JZOA 4FTVB 3ZHDA 4AYSA 1MI5A 4ONFH 1S7VB 3BUPA 4XMTA 1WWCA 4PG2A 3D50A 4LPXA 5DS8A 1AYRA 2H41A 4LDCA 5DHYA 1KPUB 1AFVH 2VM9A 3K8KA 1J0IA 2GFBB 2NY4D 2WQ8A 5CJOH 1E8ZA 5FHBL 4DW2H 5K9JH 2AHIA 4KZEL 4HJJH 1IC4H 2Y69B 3MRRA 4HQQH 1BVKB 2MTPA 2JKLA 5D9SA 2VDMH 1I8AA 1P7QD 1URLA 1NIBA 3HUJB 3K6NA 4U1SA 1UZ8A 4PRHA 2GUYA 1GGBL 4UIMA 3B2UC 4M7LH 4JFDA 3P2DA 2YWZA 4M1DH 5K9KA 3G6JB 5DFAA 1A7PL 3QAZC 2FQDA 1EEYA 4GG8A 2J8UF 4GLRI 4M9OA 3IMBA 2DQGH 3IK2A 4CADB 1XL6A 2GITB 2P5EE 5HHMD 1H3XA 5FECA 2OW7A 3LXAA 5FGBA 3ILQD 2HJLB 3BP6A 3P4NA 3NZ8A 1I1AC 2ARJA 2ZE0A 5L8JB 1JZ7A 4KV5E 3REWB 1ZE3C 1WC7A 4BK4A 3X1FA 1U8QA 4WFFD 4IBWA 4M7JH 1TZIA 4ZD3L 1I1AD 3FO1A 4J8QA 3M88A 4P3CH 5CU9A 3L3GA 4G2AA 1DQJB 2IANA 5LBSL 2AXFB 3P1VA 3UO1L 3KHOA 4G82A 4Z8FL 4UBDD 1G9ML 1OAYH 4MAZA 2W95A 4UM8A 4XGZA 1FNGB 3G08B 2X41A 4IBTA 1B2WL 3CFEB 4FGMA 3NEOA 4JFHD 1U8PB 1I8KA 3TJPA 5C08A 4QEGA 3QEHB 4Y1SA 5SV4A 4P06A 3ELQA 3GM8A 4WW1A 2A9NL 4GY4A 3IU3A 3CDGA 4MJHA 2B5IB 5ABAA 2ICWA 5KS9F 5GGUA 3FRPB 3T6ZA 2CH8A 1XH2A 4R97C 3SBWC 5DMKB 4YFLI 4LIQL 3OHXB 4NFCA 5DD5H 2X0VA 3DVNA 3HE6B 2G0LA 4L8CA 1AQMA 5F7KC 5GGRA 2ZUUA 4U1JA 3WFBH 3T0WA 1A1OB 3ULUD 3FB5A 3VI3B 3DO7B 1DQKA 1OP3K 4X5RA 3ETSA 3VFTB 1E6OH 2AXFA 2VLME 3O6KL 4PLKC 4HUUA 3L17A 4R5VA 5T5FA 5JIIA 5KYXA 1J48A 2W07B 1UFGA 5I66A 5AAMA 2OK0L 1Q8MA 3I75A 3PWLA 1ZLWK 2WOYA 4H2CA 2WBJD 4JPWL 5L7XL 3H7LA 2QELA 2ZUTA 1UOLA 4AIZA 1CK0H 3ZZSA 1A1NB 1RSYA 5CN1A 2R83A 4MJ6B 1AO7D 2A6DB 3VD9A 1OF2A 4NQEE 1GW6A 4U0QB 1G7JA 1S9YA 1W0VA 3TTYA 9PCYA 4AQEB 2GJZA 5E0QA 3WO4C 1FNLA 4F2MB 1GGTA 4UT9A 5E95B 4H8VA 4TN9A 3AAZB 4PY8I 4AQAB 4EVNA 5FOBA 4ADJA 1SLVA 5I30L 2Z1PA 4PJCA 1OHZA 4OIFA 2G3NA 4R90H 3G7TA 4LSSH 1EO8L 3ARPA 1I31A 4OM0H 2P5WB 4Y5VA 4NQDA 4X5XA 1PD1A 2EC8A 1JVKA 5BRZA 4AG4L 1L3NA 1WIPA 1UH3A 3FFCE 1AHMA 1GY2A 3IDMB 1UXWB 2XWCA 3QQ4A 1AMXA 4PJDF 1MJ7L 5D72L 5AUMB 4ZQTA 1NCIA 3QULA 4X6FB 3CVCA 4D0BA 2CO3A 4YUEL 1CVSC 3IEAA 4NQXB 3B9EA 2DTML 1TJIH 1EPFA 2J44A 4HWEH 3ILPB 4FQ1L 1UYWL 4HWEL 5K9OA 3ECBA 1E6JH 5EBMB 4ZZFA 2NDGA 4WQOA 2MHAB 1OM3H 2FJGB 2YD7A 2UXFA 3MNWA 4AW7A 3IF1B 4Z95H 3CCHB 1FO0B 3TEXA 5DVLA 2DIEA 5IBUB 1NGYB 3T2NL 4U33A 3ZR6A 1LK2A 1FIEA 2GBAA 1XXDC 2GBVA 2AEIT 2SODB 3LV3A 3MJ7B 3MUUA 4PV9A 3FSWA 2EDQA 3KYOB 4D8PB 1FE8H 3A22A 1TKWA 2HN7B 2OJZL 3I6KB 3VWKD 3WOVA 3MV01 1BXXA 2ED9A 4G1EB 5A40E 1E3XA 1T3FB 5C09B 5C0BB 1UH4A 3L08A 4CSTA 3PHSA 5IJKA 7TAAA 1JPST 5IB4B 2A73A 4WW2C 1FDLH 2J21A 1XXFC 3EJQA 1K4DA 4ANKA 5EBGA 2BY0A 4UTCA 4TNGA 1BOGA 3DOHA 2PW1A 5DJXA 3TASA 2G4GA 2PWHA 1LDPH 3C08H 1FSKC 4MZIA 5L88H 4Y7OC 2VUKA 3LD8C 5I0XA 1NPUA 4ZS7H 2MCAA 5DQJA 5EFIB 5D93B 4OLYL 4AZ8B 1EEYB 2V17L 3A6OA 3LQZB 3OAWA 2F2HA 1Z3GL 2Z7UA 1EVUA 4BK5C 2DRUA 4PD4K 4F57L 1PNCA 2AJSH 5FWRA 4NPKA 3NJNA 4Z3JA 2BWIA 3DTXB 1ACXA 1FZKA 5D7IA 1A1MB 5DWUH 1JSYA 1N4XH 4LHUA 1JF1B 4AGLA 3UGEA 4FQXB 2V2TA 2W0PA 4HETA 3BZEA 1MCCA 4N2DA 5F1IA 3WFBL 3WNKA 2CQVA 1UXLA 1NWPA 4R4BA 4BSVB 3Q5YA 5I1KL 2IIJA 4LPTA 4CILA 4K7FA 3EDFA 1S7RA 4FQLL 1K4CA 2C5DC 4WO4B 1OKEA 5EEUA 1HHIA 1NAMH 3F65A 3O4LA 4KOCA 1D2OA 4QXGH 1HSBA 3VTAA 3NAAL 3RGHA 4YX2L 3QZBA 3RPBA 1A7OH 3MPCA 4PREA 2CK2A 1WTGT 4GIOA 3VJ6A 2Y6SC 2ZOUA 5DMKA 3ZIYA 2XQYG 1S7XB 4HS6A 2WUBH 4HEME 3IDXL 2V5TA 2F18A 3BLBA 2G5BB 1YECL 2VL5B 4P3CL 1AKPA 2KDGA 5D7LD 2FGWH 1AFVL 1TVBB 4FJ6A 4MQXD 3SKOA 2AZAA 4LO9A 5JDSB 3QG6B 4PS7A 3F04A 1T20A 4KUZL 4KRPD 2XWXA 4U6HB 4PBDA 1C5BH 5ID1B 1AR1D 3UC2A 3VMOA 4MCYB 1AJ7H 3VA6A 2X1QA 1X5ZA 3QDME 1A7NL 1FAIL 3BWSA 4F8NA 5JHLL 1HZLA 1GC1C 3AQYA 1KCSL 3O6LH 1GVIA 2CKBA 3Q1SL 2ZSVA 5JIKA 1RIHH 3IJ8A 1I75A 3M1OA 3RNKB 4D9LL 2ZONA 3FCSB 2AXHA 4AQOA 1LP9A 1RVFL 2DQEH 3KL3A 2Y3NA 3O6FD 1UM6H 4JM2D 4Z7AA 1B4LA 2OTWA 5ERWB 3S3DB 4HOXA 1XX9C 2FATL 4RDBA 1Z9LA 4QWWC 1C5DB 1F45A 1HHIB 5E2VL 4NKOA 4AENA 4JEGB 4PJCE 4CMMA 3I9GL 4BZ2H 2OZ4L 4X0KA 4IMKC 4K5NA 5FR3A 4QRPB 3RPIA 2F5BH 5AAPA 3AAZA 5LGKA 2QR0B 4NO0A 4P99A 4YIQB 3BPLC 2J8OA 4QKTA 1UZ8B 2Y1VA 3U2IA 1UWEL 4OGAD 4P23A 1OTSC 4FKEA 5I0WA 4I18A 5AEAA 1RZFL 5KBLA 1FIGH 4XH2A 2IQ9L 4AT6A 2A6IB 4K8RH 3BP7A 35C8L 4GKZB 2VO8A 4J6RH 3TN0C 2VW6A 4BQBA 1RJCA 3KE0A 4KNQA 4OIIH 3IKCB 2BCKA 3C5ZA 5B38G 4X4KA 5A3IC 4FX5A 1AXSB 4P59L 4FHJA 4Y5XC 3SCMA 3Q8BA 4YSRA 3VB8A 1UYWH 4A2EA 4FG0A 3BW9B 4OAWB 3QXWA 1A6WH 1KT2B 3V6ZA 4OD2B 1LNUB 4TVPD 4GP8B 5F7YC 3SQBB 3GLEA 3HTLX 3O3UN 1KEML 1GGCH 2WQWA 5JPMA 1R3IL 2GJJA 3NCWA 3GLZA 1KGWA 4P3DB 5JA9A 1RVFH 2DQEL 2TAAA 1TKWB 2HN7A 1PG7W 1J8RA 3I6KA 3PRZA 3APFA 2C9QA 4I7ZC 2PYEA 5MERA 5HJDA 4GUCA 1R5VA 2WUBL 4DGIL 1AGFB 1T7WA 1X5MA 5DZJA 1KIRB 4IW4C 4MXQC 1XF1A 4PJXA 5E99L 4F7KA 1Y7VA 5CF3A 4YX2H 2FUQA 1T7ZA 5D7EA 3FT3A 3VM5A 2DH3A 3DTXA 5T1KD 1GOFA 1NMCC 3ML9A 1A0QL 4WK2B 3S36H 2XHNA 1BQLL 5GJSH 1HXKA 1PY9A 5KBNC 4HGMA 4YDNA 1AP2B 3E6HB 3U7YL 1M1XB 3H54A 5K93A 3TJEH 2GJ6A 2AVGA 4DKFH 3B43A 1WZ1H 4QOKB 3FAWA 1EEQA 3CQPA 5BS0A 5KJRL 2K70A 5GS1C 1S7UB 3B7TA 3O3BB 3W9EB 3WNLA 1QEWA 4M7ZC 2C1PB 4L29A 4NUPA 3QYCA 1W0WB 3X1NA 2C3HA 3A5VA 4FNLH 1V7ML 4YDLC 1UA6H 2X4QA 3ZU8A 3BXNA 4W6WB 1I8IA 4HUXB 5HHVH 2CLVA 4Z7VA 4OSUL 3DX7B 3BVVA 3MFFA 5GGVY 4NKDA 5A6IA 5FA4A 3SKMA 3N3EA 3T8XA 2HKFH 4GI8A 1KJVA 4LVEA 3UAAA 3ARGC 1P6AB 4HGWB 3U0TA 2BIIA 3O0RL 3KR3L 3V4PB 5JDSA 1E5CA 3RWEB 1S46A 2OW6A 1NMCB 2FCBA 2YA1A 3H4HA 5AOJA 3L9YA 5DURD 1X6LA 3EFDH 3EFOA 5IY5B 4K73A 1CVRA 3N9GL 2JB6B 3MJGX 1FC1A 3B4NA 4G6MH 5F7MC 3R7RA 3CDCA 2C8NA 4MYPA 5BUPA 2JJUA 3JV4B 3UTSE 3KYNB 4AM0A 3QXTA 2QPEB 3AUWB 1U95B 4WJG3 4IIQC 4QHKJ 4XP6H 2F7QA 4P9HC 1LWRA 3LRHA 4Y5YB 5D2LE 2R1WB 4U3XA 2ZIDA 3INUL 1MXGA 2CK0L 2EABA 3C6LA 3MBXL 3LSOB 1J0YA 2XZCL 2XZZA 5EU6E 2O30A 3KEHA 4JN1L 5JXAH 2XWJA 3S3BB 2HLFC 3L3IB 1HKFA 2RMNA 5J3HD 4RSYA 4TVPL 3WS3A 5JPNB 3EO9H 3R19A 1YYLL 3MRGA 1II4E 4FYSA 1ZWIA 2BCMA 3MLZH 1G0YR 1CR9H 1O6VA 3LKOB 5LWYL 3DV4B 1E7VA 4N8VB 2FSDA 1NDTA 2H3KA 3CZFB 3GEWB 4U6TA 3TBWA 4YWGL 1KGYE 3NESA 1U3JA 3GO1L 5B7FA 5F0PB 3VCLB 5C07B 3MX0A 2AJ3A 3FT4B 4MMZC 3KVQA 2OS7A 1OSYA 3L7FA 2DWEB 3LRGA 3SE9L 5MEPA 1IC0A 1R3IH 3GMPA 4G7VL 4H20H 4PM1A 3PWPA 5FA3A 3IXAA 5FYKD 4BFOA 1BF5A 1CICA 3N04A 4Q7DA 1BQLH 1JV2A 3K0YA 4JDEA 1J1XL 3N1MC 4HV8B 1AXTH 2Y07L 1CG9A 3O2VH 5AYUL 4ZFGL 1GTFA 5IIEB 2H6PA 5TE4L 1KBBA 2VABA 1WS7A 5CSZB 3WTWA 4QRUA 3E8UL 5AW8B 3WI9A 5E4EB 3MLUL 2W1NA 3FN3A 4FFZH 2DLFL 1K72A 2BO0A 2E0PA 3D0VA 4BIKA 1I8UA 4Q6YA 1UM4L 5FFGA 4NQCB 2PCPB 4QXWA 2E8YA 4JPKH 3ES6A 5T3ZD 1C7SA 1BVZA 4LSDA 2LABA 1AAJA 1EEUA 3CQFA 1LYQA 3ILEA 4EF3A 2FLBT 2Z65C 5DMGD 6PAZA 2A7BA 1K8DA 5BVJB 2VXTH 2ZUYA 1JNHB 1EAPA 3BT0A 3EO9L 4UV7L 4I0PA 5EWIL 1FG9C 1KTRL 1S7VA 3UCRA 4LEXH 4OZHA 2ARWA 1ZVNA 3IJEA 2JQMA 4W6XB 2IF7A 2MKWA 4N0CD 3TH3T 4KDWA 1ASPA 4YO0A 4XPFH 2BFGA 3VSTA 1BZ8A 25C8H 2IDUA 4PJHF 1SEQL 5ES4B 2P52A 3CDZA 4QOKA 4M93C 1AY1L 4PV8A 1JZ4A 3LRKA 4KKCD 3AG3B 3FT9A 3LS5L 3SYAA 2VAJA 3RE0A 3CG8A 2EKSB 4LNVA 4OFQA 5C0JB 4X5PA 5TDNB 5ADPL 3I02B 5C0FA 3DC0A 3GHEL 4V33A 1FSKB 4Y4HB 5IHWA 1ECZA 3AGVA 2PW2A 2QKIB 1S3KL 2QV2A 5T5FH 2J25A 3W11C 1QACA 1X9LA 1QX1A 3IAGC 3MRNB 3JWDH 2DWTA 4PSPA 5DMIH 4RGNC 3EDKA 1A0QH 4G6AC 3S36L 3T0BA 2PPAA 3FO0L 4XCNA 4JCMA 4LCCB 1I9RH 4J3OC 1TQBC 2Q6WA 1XGUA 4JO5A 4Z7UF 1IRAY 1MCRA 4YSTA 4PJBE 3BCDA 1ZHNA 3HIZA 4WI5A 2OKMA 5I0YA 1KIQA 4B6ZA 5DEZA 5I1IH 3UBXB 3V4VB 1NBYA 4HKXA 3UP6A 3EH3B 4G6FB 5EC2A 3WV0A 5E9DD 4EQ2A 5EBLA 4LCUA 3BRDA 3LZOA 4FNLL 1IGCH 1RZJH 1SDAB 2QGBA 4WO4C 3SKNA 1FGVL 2DQ6A 3V0VA 5FYJL 3MRKA 2BSTB 1XSOA 4MXVE 1S7SB 1SPDA 4XVSL 4YVNA 3MGOA 1ZDSA 1KB5H 1KB5L 3NPSB 4FCHA 2A9ML 1UA7A 1XMWA 1BD2A 2XVLA 3V0AC 3X11A 5D1ZC 4DGVL 3WD5H 4Z6AT 1CF1A 3GZKA 4ELKA 1JHLL 2AQSA 3VDCA 1UKSA 3C8HA 3GJEB 3KCWA 4TUKL 3T65A 4NWTL 2OSLB 4QRPE 3LQZA 2CO6A 3BAWA 3ESMA 3K2MC 4LQFL 2O5ZH 2Z0BA 3GNMH 1MZZA 1JK9A 3FOLB 4QTIH 4IS6A 4NI3A 2B7DT 3EYQC 3QIWD 3TBWB 3F58L 2A2QT 1ZV2A 2B2XL 1NM9A 3CSFA 4AL8L 5I19H 2ATPA 3P30H 3AABA 4ZAKC 4ONFL 3VXMD 1AKJB 2BMKB 5FHAH 1D5IL 1CLZH 1GW0A 3LQAC 1ODUA 1L3WA 2BPBA 4C4UA 4A38A 1U8JA 5ADOL 1J18A 5LCVA 3D1MC 3V4VH 5IJDC 5FUCC 2GTZA 4UNTA 3BQUC 2Y1AA 1XIWD 2F74A 1M57B 2VXVH 2QGDA 3MZGB 4ZT1A 5IHLB 3K8LA 1DLHB 2WYTA 3QUYD 1J9QA 1DSYA 5CXPA 1G5AA 3SDAB 3PL6D 4EUPG 5IREA 2C9SA 4HDIA 4N0CC 4AXWA 1MW0A 1MJJA 1C12A 1M7XA 2AJUH 3DJTA 3TPKA 5I73C 3QXAB 2DQMA 1DBMH 1KY7A 3ZN6A 1ACYH 2B4CC 4W93A 3N5AA 4IEFA 4OF8A 1KXHA 2ZJSL 5F9OH 4QRPD 5ESAA 3IFOA 3C6EA 1ZS2A 2EUWA 5MEPB 4HK0B 5GRJH 2Z92A 3CHQA 4J2XA 4MNQB 3MV7B 1JDDA 7FABL 4FULA 4BKLB 2NLJB 3CBRA 1TZGH 2BJMH 4JFPB 1CYWA 1DJWA 2V6HA 3DRQA 4PJ9B 4PPTA 5EOTB 3VX1A 4PRDA 1U8PA 4EUPB 2XU9A 1UWFA 3ROOB 3QJHA 3WKNA 1QUNA 4AIOA 4DEUA 2YGVA 4PVBA 5FA4B 3SKMB 5IBUG 5FB8A 1T4KA 3HW7A 1VEMA 2OCJA 1WH0A 4D9QE 4N0UA 4ETQA 5AZEH 4F24A 4PGDB 2YJLA 3O3DB 4PLJC 2OTPA 4IDJL 4RBPK 1T0OA 2KS0A 4NZFA 5T3XD 3ZE2E 1NCJA 2Q86A 3L2NA 1S4IA 2QFRA 2GTZB 3VMNA 1RXLA 4KRPB 1LD9B 5I15L 5LGHH 1LEIB 1KBGH 2FQEA 3CU1A 2OAAA 4KZCA 4N90D 3FTUA 2Q8AL 3JV6B 1XGRA 3LPGA 2ZSWB 4YFLF 1U8KB 4Z7QB 5IHHA 3U36A 4OZHB 1YDPA 5I8KH 4ZSOA 4DKTA 4LRIA 3HC3L 3D18A 2WLNA 3RWGA 3JQOB 1NSNL 3CVHH 3VI3A 1L9SA 1H6UA 2EDHA 1OB0A 3IMUA 3B6SB 2NNXA 3ULVC 3D85A 1E27B 2ORBL 1G9EA 4GMSL 1ZT4B 1ED3B 3IJ7A 4PJ9A 2G5RA 1S7TB 2CJ3A 2FEDC 5FV2A 2VISA 3PGDB 3LS4H 2E27L 2PWDA 5T1MA 5SWSB 4RGMB 4KRLB 1JRHH 4H5SB 4TPRL 4Y4FA 1D3CA 1IM9D 1SY6A 3QEQB 4ERSH 1J0KA 1LEKB 3V0WH 1B0WA 2JKXA 1MIEH 12E8L 5DD6B 3MRDA 3MRRB 4OD1H 2PKDA 4MZRA 3QULB 4M61B 4X6FA 2VQ1B 4GW4A 2IDSA 2EQDA 2FLRT 5C0NC 2VZTA 4HOWA 3NGBC 4HC1L 4QXUH 5C3LD 1CPUA 1KYUA 1XSJA 4UT6A 4HG4J 4XODA 3UBXA 3GJFH 1UGNA 4NZRH 3L4XA 2NMSA 4DWHA 3KBEA 3FO2B 5IQNA 1WVZA 4JDTH 1B0IA 3LZFH 4Y2DC 4PGCA 4S2SB 5FGBC 4ZBJA 5TPWL 4L5FH 4BZ1H 2R23A 3GMRB 4I5BA 3V9EA 2JSFA 4Q52A 5KBPA 4PB0L 3E9UA 5GSRB 1A3LL 1WWAX 4FQ1H 3IRZA 1E4XL 3EOBA 7PCYA 2OMNA 4P5TA 2KZKA 2IG2H 2J6EA 1XBDA 1DUZA 4AUYA 5F0JB 2PPDA 1VDGA 1KENH 4GG8B 1QSFE 4J28A 3CSGA 2P5ED 5CGTA 5HHME 3TO4B 1NFAA 3FUNA 3UP1A 1SMOA 2BSDA 5I16A 4W9FC 1DVXA 3APCA 3CFBA 2F7PA 3H3BC 4K7PX 3TT1L 3Q5TA 3RL1A 3HE7A 3KPPB 3OWEA 3WHE0 2XVBA 1G7PB 3Q8AA 3MYJB 4Q56A 2JJSA 2VDPL 3DIDA 3KPNA 1ID5I 4NAMA 3FCSA 4E68A 5JNYB 2EO9A 1SYVB 3RWIB 2LLNA 4B7LA 4ZX4A 5ETUB 5JW4Q 1JNLL 3BPCA 1KZYA 4L4JA 5FW6A 4WTZA 3MV8E 5GRVL 3AG4B 1Q0YH 4GSXA 1M2VA 3DX9B 5I1LB 1PSKL 3B1UA 3W0WA 1U8IB 2V2XB 4K3EH 3KW7A 2ICWB 1SJXA 1ZGLP 2RFXA 1MAML 4XC1L 2NXYC 2PWFA 4YHKL 4CVZA 2BHZA 2WANA 4XNQB 1B90A 6CGTA 4P2RE 4ODTL 5C08D 5HVHB 1C08A 1PD0A 5HGAA 4UV4L 2VLRD 2BP8B 3DRTA 2XKUA 5A2JH 2I60L 2RACA 3DX8A 2X70A 4HIIA 1IKNA 3FTVA 2ZPKL 1RPQA 3SE3A 1KFGA 3CC5B 1KMGA 4DVRH 5DK0A 5L2KB 4WEEA 5CBEA 4E41D 5L2JB 2J8UE 5AW0B 3THML 1H15B 2OULB 3NH7L 4NRXB 3Q44A 3ZBMA 5GHWH 2CPUA 5GHWL 1N8OE 3M1BB 4BQ9A 1KXQA 3K2KA 1TYRA 5EU7C 4XT1C 3UTTB 2Y9RT 1QZ1A 3WMPA 4PY8J 4HK3N 4LQFH 5EBWB 4DKEL 1EX0A 1VLXA 3ZIMA 5GRJL 3HNTH 3ZE1B 1DDHA 3MBWB 5EIIG 2IWGA 2X38A 3PWNB 3T1WA 1YPZE 5FO7A 5DGRA 2DWEA 2BRRH 1AO7E 1YEKL 3GMMA 4NQED 3OXSB 2WYZA 4QY8A 5D70L 4E42A 2XX0A 4DZ8B 4OUUA 5F7UA 4Z7VF 5AYUH 4ZFGH 1J8SA 3CZNA 3EYOB 4JRXA 4BCZA 4ZG1A 2IQ9H 3RJDA 1RUKH 2CALA 3W81A 4U6HA 4C56B 4X9FA 4UNIA 4EDXA 4K5LA 4KUZH 4XCCH 1HH9A 1Z0NA 2YUXA 2YD5A 3G6JA 4LVOC 4Q74A 2DLTA 2OYPA 2PABA 1IBYA 3RDTA 4RWYL 1P5VB 3AADB 3KH3A 3EYVA 1GYWA 5DJ8A 1MUJB 3DMMD 3BDXA 1A14L 4LL4A 2FX7H 4XBGA 3K1DA 1P4IL 4GS7C 3F62A 4QIRA 4NENA 4Q4EA 1R3JA 3I6LD 4JAMB 5D7JA 1PYWA 4XOAA 4EI5B 4MNQD 2XV0A 2D03H 4JHVA 5JHDE 4BFIB 3RNKA 6FABH 1KB9J 3BN9D 1L0PA 3NK4A 3HS0C 1BWMA 1KCBA 4HW6A 4XMVA 4R4NC 4RGNB 3W1ZA 2YXFA 1RK0B 2YFOA 1SMDA 1WIUA 1LQBC 1HE8A 1IC4L 1TQBB 4RDQG 1VEPA 3SJVA 1NGYA 3ZHFA 2ENQA 3NCYS 4M4PA 3QT2A 4AT6B 4GXVL 1QLEH 5HHPA 3MLVL 5E94A 2VUOA 4AGMA 2YAHA 1C12B 4HGWA 3LS5H 4HS8H 1NBZB 4L3CA 5HHXL 3U0TB 3RFZB 4MS8C 3V9CA 1NCWL 1YMMB 3VXSD 4MDJA 4KXZH 1QFHA 3BYYA 3BUYA 5JR1H 5HYQA 2WCSA 1NKOA 1T7YA 4R7NA 3IMVA 4TSAL 2VN4A 3T1FA 3FB6A 4B95C 3DECA 4UU9B 4QHMB 4OD3L 3R18A 5D8JH 4EIUA 3ARBC 4O4YL 1B6DA 1Q38A 4HPYH 3FO0H 4MNQE 5CMAA 1G7LB 3M17B 1E4KA 5JHDD 3ULVL 2WXNA 5GXBB 3RBSA 5C08E 2APWA 4HFUH 4L4VD 1LDPL 1RZKC 4LEOA 5DC2A 2Z0UA 3ARFA 2G2PA 1Q9WA 5SX5K 1H8OA 1GAFH 1H5BA 5DVOA 5C86A 1A14H 4P2QB 2ICEC 4HWUA 3WNNA 4W6YB 1T4KB 2D0GA 1MFDL 2XQYA 4N8CL 2D9CA 1TCRB 1KIRA 1DBBH 2YD8A 3HC4H 5EOCH 3THMH 1YEDA 4PBWD 3RNQB 3QFJD 4G8AC 2DM3A 1G7MA 2R2CA 2CR3A 4MMZA 3LIZA 4IU2A 4WHTA 4BDVB 5C92A 1E8YA 5CZXC 1NKGA 4UT9L 5DJAB 4PSRA 4CC1A 4O2CB 5DVMA 4ZAKB 5BRQA 1O75A 4IHOA 1CXEA 2ADJA 3FBQA 5I1GL 3QUXB 2P44B 3NSYA 3OAYK 4L3CB 5B4MC 4NQXA 5E9DB 1HHKB 1P9MA 2V33A 2X05A 1PLBA 3ARBB 2CAKA 4KJWD 1OM3L 3QS3A 4PJXE 1H5BC 4PG9A 5T3XH 4NUGL 4YSCA 1OP3H 2DI9A 5IFJB 5FUCE 3JYCA 1DSWA 1T66C 4X5QA 1T6WA 3L1FA 3EYSH 4L2YA 1NMBL 4IKLA 5BO1H 1I8IB 4HUXA 4I0CC 4KJPD 3MLPA 3U30C 1QBLL 4MB5A 1J0HA 1T1YB 5ESVB 1S7TA 4K94H 4WUKL 3K2UL 5IMOA 4NZUH 3GSVB 2IDFA 3HC0A 2UY7B 2BP8A 3CNKA 4XNAA 1D5XB 2HFGL 2ZX8A 3WY4A 1UUNA 4GKSA 4XVUD 3AG2B 5DJYA 4IU2B 4WHTB 1G7QB 3BEWA 1F2XK 5FDYA 1PDKA 4R2GD 3MFFB 4UILH 4ECNA 4NRYB 4K5OA 1S7QA 4QY8B 2LLLA 3DSNA 1FYTA 1QSEB 3QZLA 4POUB 4KUCF 4N2OA 3KS0J 4PYHA 1K85A 2XYCA 1IKNC 1XGZA 3MCKA 4O00A 1EHAA 1DFBH 2G30A 1RFDH 1FP5A 3GEFA 3N41F 3NTCL 1MJ7H 3CFQA 2FO4B 4OGXH 4OUUB 2UXTA 1KTBA 1YUHB 3HG2A 4ELMF 1SBBA 4JY4B 4PS4H 5IEHB 1L9NA 1I7TA 1I9IL 4EBQL 3LB6C 4UT6H 4NCDA 1ET5A 2YK1L 2Y23A 1B3JA 1EV2E 1M71A 2O4EA 3ECWA 4U6YB 1RJLA 1VGEH 3RGVB 3EOBB 3ZGHA 4E9SA 4GXUN 3MVSA 1EUTA 1EAQA 4NB7A 5BO1L 1CLVA 1TOXA 3GHBH 4MJ6A 4NZJA 5F7WC 2GTQA 1F4AA 1NAML 3PG2A 1RK0A 5J9PA 4FAAB 2CSPA 2EDYA 2JCCE 3OKLB 3QCVH 2VWEC 3OB0H 4PP1D 5KBDA 2YPLE 2DYPD 4PH8A 3HR5A 1EGJH 3NFSH 3L4UA 2J8HA 3GMPB 4HC1H 4YHOL 4F15C 4LHUD 5IB3B 1UA6L 2OXHB 3QIBC 4YXKH 4A2HA 4Y0GA 2B9BA 4JO1L 5EZOL 1E4HA 3N85L 4H25A 4KROC 1CYGA 2P3YA 2AJSL 1DBBL 2PN5A 2OL3L 1FNEB 3IPBA 3VXOA 1RH8A 4RISH 1LQSR 1P6FA 2Y1ZA 4OGYH 3PWPB 5FA3B 2HTLC 4PJ7E 1X7TA 3BAJA 3UBHA 2PYED 5IJVA 4GFXA 1ZT1B 3QO1A 2DS4A 1MFBL 2BW4A 2F54E 3F7PC 2VDQH 4LEOB 3NGBB 3PHQA 4UQ2A 4DUWA 3MRBA 3ZTJG 2DQGL 3KCPB 2GK0B 4KGLA 3D51A 2P5EB 3TO4D 1R3LB 1PZ3A 2MSPA 3P77B 3RZCA 4QLWA 2F54B 4OZ4A 2HH0H 4Z0BL 3UAEA 3F7QA 4PWKA 2VMDA 1NBVH 3PJLA 4Y2DB 4OF6A 1J87A 1U93A 2A3TA 2CHDA 3W9DA 4XNMA 5L4FA 3FRPG 4ODVL 5ABDE 1IKOP 1YEFH 4P46A 4HOZA 4Y9EA 4N6RB 3NABH 1HL4A 5L4IA 4KITB