1T6WA

Rational design of a calcium-binding adhesion protein nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
RDSGTVWGALGHGIDLDIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords hypothetical protein XP_346638
publication title Design of a calcium-binding protein with desired structure in a cell adhesion molecule.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6wA00
1OGAD 3WHE1 2R69L 2Y07L 5BQ7B 2BSTA 1AGFA 5DRZB 4PJ7B 4U1GC 4XNZB 3UC0L 3WFHB 3ARVA 1X9QA 4BSVB 1M71B 4TUOA 2Q8AH 1KPRB 5HYFA 1G7LB 2RIKA 3UAJC 1BBDL 1KIQA 1U8PB 3MTRA 1S9YA 1A7PH 5T1DL 3Q6FB 2VSCA 1P9MA 5CWSB 3PHOB 3MSPA 5HHVL 3TO2A 1XF3A 3RUGA 4OKVA 1OTSD 1SEBA 2FZ3A 2JIXA 3OKEB 12E8H 1MELA 2ICEB 2W92A 3Q48A 5TE4H 5BS0E 1JNHB 2CDGA 2XFXB 3O2DL 4J3XA 1JPTL 1UVQB 4LAQL 2HVKB 4FNLH 3WD5H 1OTSC 4LCCC 4JQIH 5ACZB 1RZ7L 2OTWA 1UQSA 1DL7L 3I2CH 4RNRA 5BVPH 1KB5H 3BP5A 1HYRC 2AV7A 1A6PA 3T09A 1MRCH 1A9EB 4M5ZH 2HLAA 2ZG3A 4PYGA 4XWOD 3BWAA 4GW1A 2PW1B 2XRAL 4JJ5B 1PG7W 1ODAA 4MDJA 4LMQE 3QB7C 2V7HA 1LEKA 1FVCA 4YBHA 1LO0L 2E8ZA 1IVLA 3FT2B 3TH2T 3OV6A 3DI2B 4XWOC 1G84A 2VZVA 4E9LA 2Z8WC 4NRZA 4D9RD 3OKLB 3VFSA 3SDDD 4UTAH 3U7YL 4G80A 2X4SA 4D0BA 3BVNB 5DMIL 5E2UH 3QDGA 2NXYD 3V0VB 1FZKB 1SYSB 2BVQB 1ZVYA 4JY6A 4JN1H 1A8JH 4Z7OF 5JXEA 5A2KH 3P77B 3SDDC 1R3KA 5MI0B 2CQVA 2VUYA 3ZE2E 2AXGB 3G5XA 3GUTB 1WFTA 4I0PA 2MHAB 2NXYC 4JRYB 2QSCL 5IT2H 1EFXA 2YA2A 1S8DB 1NKOA 4ZODA 1HYSD 4F9LC 2GK0A 5SX4H 5IQ7L 4JG1L 1QFUL 1BWWA 2X4NB 2VISA 1RUPL 4H20H 3GMPA 1MLCB 4TRPH 1OP3K 4LHQB 4N8VA 4ONFH 1Z9SA 4EQ3A 4BH7A 1HYSC 1LP9B 3O2WH 1DANT 4JM2F 2ED9A 1CFBA 1XGPA 3OGCA 4PB9L 3SDXE 1EERB 1S7VA 1OAYL 3PV6A 5H2BB 1YPZE 4UV7L 3L5WB 4MA3B 5KZCB 1RULH 1BFVL 2UY7A 1HNFA 5D6DA 4RA3A 2LU4A 2XY2A 5HY9B 4X6FB 3UPRB 2W0FB 4Y4KA 4EDWL 5LQBL 4BZ2H 2EE2A 1JHKL 2X70B 1U8LB 5AD0A 1T03H 3T0AA 5B22A 1ZA6A 3RVTD 4KJPD 4LLUA 4RAVA 3MCG1 3PV7A 1NLDH 1MSPA 4E5XB 5E1AA 5DD3H 5J1AB 3RWFB 1KLUA 2VMFA 3STZA 2AGJL 1IGML 4FZ8H 2ZSVB 3RVTC 3CD4A 1X4XA 4KJPC 5HGHA 4PG9B 3NBNA 3UTPD 4Z5RB 5D1ZB 3PGDA 3JBG7 1N8ZA 4LFHG 2F8XC 4N5UA 1WK0A 3CFDB 4I2XB 1BOGA 1C7TA 3C6LA 4RDQG 2BVUA 1QLFB 5DJ6B 2FR4B 3CPLB 4M7LT 3QXVA 4U2YA 4Z7UB 3O4LE 3QO0B 1X5ZA 2MSPA 3BQUB 1IBGH 4ZAKD 2Y06H 3FQNA 3KXFB 1MCFA 4OLXL 5DEFB 4NOFA 5I9QC 3OKMA 4M4RA 1NCCL 1I1FB 4H0GA 4HXBL 5C0CD 5BVJA 2BERA 5E4EB 3TT3L 2EKSA 4Z7WF 3DUSA 4ZAKC 3JWNC 1MOEA 4H1LB 2XXCB 9CGTA 4NNXB 1XIWB 3PDDA 5H37G 2DI7A 2R69H 2Y07H 3QUYA 2EYRA 3SCMB 3UC0H 3NCYP 5CAYB 4MB4A 1BJ1J 1AXSA 3MRMB 5GS0D 4WI4A 4BQ8A 4S11A 1BBDH 3TBVA 3PDOA 4PJEE 5DURB 3V9FA 4XBEL 4PLNC 1LE5A 3I6GA 1HHKA 4JM4L 1I75A 3CGTA 3JV6B 1DN0B 5BJTB 3MV9E 1OSZB 1FG9C 4L8BA 5GS0C 4LVEA 5CFHA 5HHVH 3VD3A 4MWFB 3BYTA 2E7BA 1ZLWK 3C6SB 2R2BA 1IKNA 1BEYL 3B8SA 5HDBE 1HOCA 1FFNA 4GAFB 3O2DH 1FAIL 1JPTH 4LAQH 4AY0A 4MNGE 1OHQA 3ARWA 3U30B 4Q9RL 1RZ7H 3LPGA 5DI8A 2NYYD 5GGSY 5IBLC 3LSOB 1DL7H 5FO7B 3AS3A 5HJ3A 5L2KA 3B9VA 3D2UA 1H15A 4HIJA 1H5BA 3H9SA 4HT1H 2YEZB 4Y1AD 2XRAH 2NYYC 1WAAA 3EJZD 1M7XA 2SEBB 4CU6A 3BW9A 2EXYC 3MV11 1MY7A 3MV7E 3AB0B 1I8LA 1G6RA 3WFEH 4E41D 3H9HA 3SGDI 1LO0H 4QXWA 2F19L 3MLZL 4PTTA 1I7TA 1CN4A 3QAZB 1DQDL 5LAXA 1T83C 4RAHA 1VACA 1TQCB 3EJZC 3KPNA 1YC8A 3U7YH 3RY5A 5DMIH 2N1KA 2QBWA 1T7XA 1BREA 1QNZL 1J8HA 3QQ4A 1YY9D 3D85A 5JHLL 4NDMB 5C07E 3G04B 2VDNL 4XNXL 2ADJB 4K9EL 3C8KB 1ZT1B 5EBWB 1K9TA 1G7PB 3O3EA 1HHGA 4G9DB 3OL2A 1GZPB 3VXUE 1YY9C 4OV6F 5IEHB 4OLWH 4QF1B 3P0GB 4HCRA 1ZLUH 5IG7A 2QSCH 3IDYC 1U2CA 2ESVB 2P46B 1IFHL 4OUUA 4G8IB 1EJOL 5MEPA 3OG4B 5L0QC 3FB6A 3D69B 5IQ7H 3U82B 4GG6E 4JG1H 3GDBA 1QFUH 1I1AD 5DVNA 1RUPH 3BZ4B 4UNUA 3WHXB 3DJ9A 2VQ1B 1U0QA 4U6HA 3BPOB 1XGTB 3KG5A 5CMAA 4ZUTA 3HKFA 1I1AC 1JI2A 5CEZD 4WI6A 5KVDL 4M3JA 3MV8E 1OAYH 2OBGA 4UMGA 4UV7H 5I66B 1BFVH 1N26A 2MMXA 1YN6B 5C08B 3VRIA 4B50A 1XCTA 1MJ7L 5E9DA 4D3CL 4MNQE 4PJCF 5CZKA 1PQZA 2MCPL 3L3OA 1MWAA 3KPSA 2VWEE 3LRHA 4M61B 1K5NA 5ISZA 4EDWH 5LQBH 3PQYD 1KJMA 2EC8A 1JHKH 3HUJF 4X4MA 5BV7L 2IANE 1KCSL 2ZOLA 1QO3A 2QQLL 4I3SL 4JFDE 3CVHA 2I9LA 3FTGB 3IF1A 2EH8L 5ETUA 2VLRD 3QSKB 1QEWB 1UH2A 2AGJH 3T1FB 3CZFB 2PYFA 1IGMH 5DD5L 1CFTB 1NUDA 1CT8B 3VGAC 3S4SA 1GGTA 5MEQA 3GSVA 4FG6D 3OJ2C 3VA6A 1PG7L 5IW3A 3OR7B 5GRYA 2XYCA 4DOHE 2BVEA 3EO9L 5FK9B 4XRCB 3OF6A 2R0WL 2VR9A 1UH3A 3X13B 2CRZA 1V5JA 3NIDE 4FG6C 3RDTA 4OCXL 1T1YB 1R6VA 3F8UB 4FZEL 4HAGA 4OLXH 4PV8B 4BFBD 5I73C 3HCVB 4LCIL 4EN3A 4WO4B 4HF5L 4JM2D 1KCKA 4HXBH 3UBXA 4N0UA 4LARL 3TT3H 3C5ZD 1UB6A 4HPYL 1N64L 4LEOA 4LKXB 3FAWA 4LCWE 4N9OB 1CDCA 5DLML 1CBVL 2VIRA 4OZGF 4JM2C 3CDCA 1WIOA 1YMMA 2X42A 1FBIL 4PIRF 1XF5A 4Z76B 1HE7A 2DLEA 3C5ZC 5C0BE 1DUYB 1IGCL 2WBJA 3B3IB 3ECBB 3MMEA 5HI3D 3DYPA 4DQOL 4L3CA 2DM4A 4HMCA 4XBEH 1D6EA 3G6JE 1NFIB 1SMOA 3CH8A 4JM4H 4KPHL 4OI9A 2HYMA 3RY4A 2J8OA 1NDGA 5HI3C 5I1JL 3RZCD 4JPWL 2JB5L 3FQTA 3TIDB 1BEYH 1RIUL 3CDFA 4NO0A 1KIPB 1TTFA 1FAIH 4PJGE 5DJCB 3GIVA 4YC2C 1EEQA 4XVTL 3RZCC 1QUNA 1VFUA 4Q9RH 4PV9B 5CIPA 4EI6B 3UYPA 3KPRE 4WW1B 1IEAB 2V6HA 4F7EB 3HE7D 1Z9MA 4CN6A 1G7IB 3H2WA 4IIQB 2E7LA 4GRWF 5KVMC 2GT9B 3CCHB 3QIWA 5C0AE 4ZO9A 1CXEA 1QBBA 5FB8A 4M8QB 5DWUL 3HE7C 1MI5D 2Y9RT 4NCC2 5GIRB 4PJ9B 4U4BA 1MIMH 2F19H 3MLZH 4LVHC 1MHHB 2XWJB 3F7QA 1DQDH 2YZ8A 2FCBA 4Y2DD 1B0GA 5LWYL 5L8LB 2Z31B 5JW5A 5DRXB 1GL4B 1B4JL 2HG5A 1YA5A 3CFBA 4ZS6D 4MJ2A 2XZCL 3RIAF 3VXRB 4V1DB 1QNZH 1D5BA 4IMKA 3OKOB 4W6WB 2YD5A 5JHLH 1AGEB 1UWXK 1H3TA 3L3KB 2VDNH 4XNXH 1WTGT 5EC2B 3FOMB 4LSRL 4Y2DC 4K9EH 1NBYA 4ZS6C 5F88A 4D94A 5EN2A 1TDQA 4MAYB 4K7PL 4L4JA 5F7LB 4L4VB 3B5TA 5MENB 3W81A 3MJ7B 1EX0A 1IFHH 3VFUA 1CDIA 5DK2B 1EJOH 3H0TB 1NEZA 2GFBB 4ELMB 3RWHA 4JFQA 4IHOB 4X99B 5TQ2L 3MLUL 3BXNA 1KTRL 4H25B 2IMMA 5JW4R 2D31B 4LPVA 3FOLB 2V7NA 3A6BL 4OCLC 3S5LG 3FQWB 3IDGB 3S5LB 5FYLL 1V7ML 2MTPA 3HZMB 1IQWH 2MOVA 1Z9OA 3TH4T 2ITDA 3P9LA 4PJAE 2ZOKB 5FF6B 2DQGL 3E1F1 4GW4A 5KVDH 3P4MB 1Z9LA 3L5IA 5HHMB 3MJ9A 3FRPA 3T77B 4XNUL 5EC1B 4YPGB 1PD6A 3CK0L 2QADD 4K71B 3WO3B 4NKQB 1OD7A 2CJUL 4WWID 1MJ7H 3AVEA 4ELKA 4D3CH 4JZNA 1G9NL 2MCPH 2X4RA 4ZOEA 3ARFB 2ATPA 3VFOB 1M7DA 4PJHE 2EDTA 3QHFL 1CGSL 1YPZF 1GVIA 2NY5L 1YYLL 5BV7H 1SHMA 1KCSH 5DJDB 2QADC 1CR9L 2QQLH 3BUYB 1K6QL 1PJ9A 4I3SH 1IAKA 4ALAH 2DOCA 2EH8H 1CE1L 1JPFB 1MCLA 1Q0YL 2XKUA 3SGDH 5J11B 4YR6B 3BIBX 5C2UB 1WBZA 3WIFA 4WU5B 5DD5H 1ZHBB 8FABA 3MPCA 4PRDA 5J6HB 4B7IA 3FT4A 3FZUD 1PG7H 1FO0B 4FQIL 2BOCB 3E6HA 4WV1A 3EO9H 4APQA 2R0WH 1JN6B 4UAOB 1QSED 3PWNB 2HVJA 5DRNA 4P2CG 3QNYA 5SWZA 4OCXH 3FZUC 3T0EE 4LVNC 1MLBA 4FZEH 3BPLC 4TNVF 4LCIH 3VJ6A 1OQOA 3RWIA 4HF5H 1INEL 4WI5A 3MRNB 1FG2A 4K23L 5DK0A 4G42A 4LARH 5D7JD 5EH1A 4FS0A 1SJHB 3E2HC 1N64H 4OZHF 1IC1A 3F7PC 3OXSB 5DLMH 3HG1D 2A1WL 4JVUA 5DJ0B 1CBVH 2H32A 2XTJD 3RUGE 1A7NL 1HKFA 1D9KB 4YAQB 4OLEA 4M5YL 1BVLB 3GM8A 1FBIH 1MJJB 5D7JC 4CU7A 1P7KB 2DLFL 4HKXB 1JGLL 1PY4A 4DQOH 2ATKB 2XTJC 5KSAD 1ZSDB 3KLSA 4ZOBA 1BAFL 3C8HA 4KPHH 5ESQB 1HHHA 4X7FC 3SE3A 4YGAB 4ISVA 4R2GB 1MVUB 3TBSA 1KT2A 2Z91B 1XCQB 4P2YA 5I1JH 5DJXB 1FV1A 4PJEF 4XWGL 4JPWH 1F6AA 5KSAC 2Q8BL 1RIUH 1E27B 2OLDA 2VLKE 2BSRB 5KTEL 4NC2B 2FIRT 3ZT5A 2OZ4A 5DUBA 2FO4A 4HUVA 4XVTH 3JV4A 3DSFL 4S1QL 1ORQB 2J8UB 3IGAA 1QSFB 2DQFA 2V2WA 4XT1C 1MCIA 2C7UA 4JFFE 4MDIA 5FM8A 2NY1D 2JJTC 4P3DB 3QDJD 3B8YA 3QDGE 4NWTL 4POUB 4YXHL 1QTYT 5TE6L 3LRSA 4MX7A 1Y6NR 2YR3A 1F02I 1HXYA 5INCB 2NY1C 5FYLE 3ROOA 3SJVD 4UINL 4JDZB 5LWYH 4PJ5B 2AV1A 3CZJA 4I9WD 1DUZA 1NGPL 3WFCL 1JWUB 2HLFD 3MNZB 5MERB 3VD7A 3ARXA 3S8WA 3V6FB 3CFEB 1IM9A 4LSRH 2R8SH 2MFNA 3FRUA 2CDEB 2YRLA 1NLBL 4P5KA 1G6RL 1IAMA 2HLFC 4NQEB 4Y5VA 3BIKA 3NCJL 4K7PH 4G8GB 5IKCB 1P2CA 4LP5A 4X6BA 1E6JH 4X8XA 1CLCA 4OCWL 1C8PA 4P2QB 3PWJA 4JHBA 4J12A 3DMMA 5CSZB 3QXAB 4XCCL 3L3JB 1R3JB 2YKLL 3WNPA 5DD6B 1O7VA 3HZVB 3WS6A 3EO1A 3UTZB 4J1UB 1SVCP 3A6BH 3RKDD 3GSXA 1ZE3C 3V6OA 1AKJD 5FYLH 1CU4L 2WINA 3DOSA 1V7MH 4Z78B 5BS0D 1P7QA 4HCRL 3V5KA 2ZUSA 1DDHA 4WFGE 3LQAC 1FHGA 3ARDA 3RKDC 3X14A 1IC4H 5E5MA 3GJFA 3KPPB 4XNUH 3VRJB 1JIBA 1QFWM 5F7FA 3RPIB 2CJUH 1BZQK 4RIRB 3GSNB 1QR1B 2VITB 1G9NH 1GC1C 3QI9B 4XHJD 3QHFH 3DV6B 2DN7A 1CGSH 2NY5H 5D2NB 1F4YL 1YYLH 1A6ZB 4G9FA 1VGEL 3RNQB 1JGUL 3GSQB 2C1PA 3QWOA 3MLVL 4L8DB 3SGJC 5IF0A 1CR9H 3HS0B 3QUMA 2IBZX 1K6QH 1MUJA 2X44D 2P8LB 3L7FB 5FGBA 2FJGA 4M7JL 4NHUB 3STLA 3C09B 2Q20A 4XHJC 1CE1H 1B3JA 3CLEL 3TZVD 3JUYA 3Q5YA 2COQA 4N9GB 2EO1A 2O61B 4J3SA 2FYYA 3VMNA 1I7UA 3U7AA 4LLVB 4X5XB 3QNZA 1DEEB 2D7PA 1DQJA 4FQLL 3D39B 3Q5OA 3TZVC 3OMZA 2P5WD 1U8HB 3CFKB 4FQIH 4L1HA 3SPVB 4PR5B 4YHPA 3UYRL 4LSSL 1E4XI 2EDRA 4CKVX 2UVFA 1T04A 4KJWC 4U0RB 3KPOB 2YWZA 1QHOA 1WFOA 4I48B 4CMHB 1W0VB 1AGBA 4NC1E 3ES6A 3KLHD 3U48A 4YXLL 2WP3T 5F3BB 5J89A 3L7EB 1TCRB 1INEH 4HMDA 4IMLB 3OX8A 3IU3B 2A0LD 32C2B 2PXYA 5GRVL 1ZHKA 7CGTA 3KLHC 1BGXL 1A6TB 2HN7A 4DKEL 4XVJL 1NBQA 2A1WH 4N1HB 1A7NH 1DN2A 4U1NA 4M5YH 2A0LC 4PTUA 3P9MB 3B9KA 5JOFB 1JYVA 4S2SB 3O6FB 4Y5XB 2DLFH 3DVNA 4P5MA 2NW3B 4YO0A 4P4RB 1JJUA 1CE6A 4U1MB 4JB9L 1JGLH 1XF4A 2K3TA 3U4AA 1LNUA 3NFSL 4AIOA 5JXAL 3DO7A 3A6CL 3SDCA 4KY1H 2A6IB 5KVGL 1VKXA 5T5FL 2H45A 5L2KE 3LOWA 5EZJA 4XWGH 5HGAA 4DFIA 4L4TB 1J05A 3H9SE 4LPWA 3VXQB 1UJ3B 1NCNA 2Q8BH 4PREA 3RIFK 5LGJA 4NQUA 4X6DA 4U1SB 4KI1A 1GXEA 5CS7A 3SE4C 3TBTB 5KTEH 1WAAE 3CFCH 3DXAE 3SO3C 4MJ5B 3S37L 1BJ1H 3DSFH 4OJFL 4S1QH 3LS5L 2H9GA 2NY0D 5GGVL 4ODTH 2O5YL 3LQMA 2X4OA 5GS2H 2L7JA 3ULVF 3LS4L 2A9ML 2AEWA 4Y19A 3BRDA 4ODBD 4PJGF 1E4KC 4WUUA 4BK5A 4YEFA 4NWTH 4YXHH 1SEQL 5C8JB 2VDOL 4ZNEE 2NY0C 5TE6H 1MCEA 2AJYL 5C09A 4AM0B 4OGXL 1FNGB 3O4LD 5CKAA 2M2DA 4U1GB 1F90L 1NPUA 1PZ5A 4KHXL 5DD0L 3G9AB 2HFFA 1G7MA 4PBVC 5AYUL 2AI0L 1OGAB 1T0MA 4WUKL 4NKOA 1NGPH 3WFCH 2RHEA 5EORL 4O4YL 1NUGA 1AR1D 4OLZL 1XGQA 4X5LA 1MCWM 3QA3B 5J06A 3WNLA 1U8KA 3QRFM 5DYOA 3FFCD 4G8EB 3BP4A 1IGJB 1EZVY 2FBJL 4KKAD 1G6RH 1RD6A 2X7LB 2DL2A 3NCJH 3RBGA 1AR1C 3VG0L 4ZD3L 2CIKB 4NFBA 4XNMB 4G6ML 5KSBA 3L3DB 3QEHB 5J7CC 4OCWH 2L4OA 1QZ1A 4H8WL 4LCCB 4KKAC 3MRKB 3T0BA 3ZZ1A 3Q3GA 3GSOB 4XCCH 2BNQB 2ERJC 2YKLH 1SM3L 5E9DE 1QFHA 1HDMB 4ZDHB 5GRWA 1V7NL 3IXAB 4X9GA 5TH2B 5D1XA 1YUHB 5IV2A 3KPSE 1N6UA 1CICA 3FAXA 3OKNB 3R0NA 5IEKB 2CXGA 3HRPA 5T5NG 2DWEA 1D7FA 3LKSA 1C1EL 4P99A 3EFDL 4HCRH 4X4ME 4BH8A 2RAMA 4U1HB 1N3NB 4HEPG 4HUNB 1G7HA 3DV4B 1K4DB 4OT1H 1WBXB 3QP3A 3HMWL 4HHAB 3QCUL 1KXQE 4XVSL 5K9KA 3AY4C 3ARUA 5IJVA 4C4KT 4HS6B 3VE0A 4PJAF 3WKNA 3VCLA 1L0XA 1CF8L 3BPCA 2VXVL 5GRZA 4V2BA 5FA3A 5SX5H 5CEYB 4G7YL 5JLZA 3LDBC 2VH5L 4NZUL 1F4YH 3LKPA 1GAFH 1VGEH 2Q6WA 1I85A 1NSNL 3FB8A 3MLVH 4QT5B 4JLRA 4HIHB 4ZFFA 2Z8RA 3G6AB 1AHWB 4M7JH 5ID1B 5GHWL 3VFMB 3MJ9L 4MLSA 4UNVA 1X7QB 3CLEH 3KYKL 3MJGX 2YXFA 1UZ8B 2NXYB 2LE9A 3HA0A 1EGJA 4HLJA 5E70A 3H7BB 4GKZA 1YEGL 5JIIA 3MBED 1A4KA 3HAEG 4POYA 3HAEB 4DZBB 3OTTA 2HT4D 4FQLH 2DI8A 4WNQA 2D0GA 4ZXBA 4JFHD 2GTZB 2F53B 2DQEL 3OJVC 3UYRH 1QG3A 4LSSH 3GSWB 4UNTA 2EEAA 3QFJA 1U93B 3CVHH 4UOW1 2FJFA 2P4AB 4TOYL 3MBEC 4BYHA 1QRND 2HT4C 2PTVA 5IHUL 1OGTB 2BNRE 3G9VA 4YXLH 5D96C 5IWLC 1FP5A 3L9RA 1ZGLP 3JV0A 2OMNA 5GRUL 4O5LL 3C9NA 1T3FB 1WISA 5FO9A 4JO2L 1LO5B 1OF2A 4F33A 1RZIB 5B39A 1BGXH 1I1CA 2JCCA 1JGEB 3MRQA 4DKEH 4XVJH 2R4RL 4NRXA 3SKOA 3TNMB 3WO4B 1P69B 4LHUD 1RK1A 4F37F 5IM7B 3VXNB 3L5JA 3S88L 4PY8J 4J4PD 3WKML 4JB9H 4X6EA 3VXTB 3IFOA 3QEQB 4MJIA 3KPMB 5I8KL 1BX2A 5CINL 1WZLA 2GY5A 3RWGA 3H8NA 3NFSH 1P1ZB 5JXAH 2R1XA 1MFEL 4LPUA 1KEML 3KAAA 1R3HA 3UTSB 4JQXA 4N0FA 4UU9B 5KVGH 2OS7A 1A1MA 4J4PC 4HKJB 5T5FH 2X4PB 1X5YA 4MQXC 3BYYA 3VGHA 4NKDA 5JPMB 4D0DB 1XR8A 3VH8A 1P53A 2IEPA 1WV7T 1FZJA 3S37H 1NH6A 5CJBA 4UTBL 4OJFH 1KIRA 1A6UL 5DDHA 3D9AL 1B4RA 3LS5H 3LCYA 5GGVH 2O5YH 2BXZA 4P48A 2Y5TA 1ORSB 4OKDA 5I9QB 3ZKXC 5KBNC 3LS4H 2CGRL 2A9MH 3FB7B 4BQ9A 3B43A 1S7XA 3TEUA 4R96A 4QOKA 1SEQH 4HWZB 1Q9LA 3IFPB 2VDOH 3QJHB 1A6VL 2ZSWB 4ZAKB 5I1IL 4RGND 2AJYH 1XF2B 4MA7L 4OGXH 1BQHG 1KF9B 1BQHB 2OR9L 1E4XH 3DECA 2OZ4L 4NT6A 4UZGA 2EZ0D 5C0CB 1F90H 3QUZD 4UBDD 5DD0H 5CEXB 5CIPH 1GIGL 3IJYA 4EBQL 5BXFA 4RGNC 1WWWX 4ODUB 5AYUH 4M6ML 5ESVB 5EZOL 2AI0H 4WUKH 3WXVL 3W5MA 1FL6A 2EZ0C 2APTA 2ZKHL 5EORH 4O4YH 3QXUA 3BJ91 3W39B 3QUZC 4UBDC 5F7NC 2VZSA 4LCWD 4OLZH 3MUJA 2C9AA 4ZUSB 4L29B 2UZYB 4OFYD 3C5JB 3CFJB 4PRHB 1YEKL 3QHZH 2ICWB 3RWEB 2FBJH 2BSSA 2YRZA 3U0WL 4ZD3H 4P23B 2UYLA 3HNTL 1D5XB 2ARJA 5F89A 5F1NB 4BUHA 1JCKA 3S34L 4JO4L 4HG4J 4Y2OA 3DUHA 2G60L 3JTSA 4H8WH 1FNFA 4RMTA 3U9UB 1K4CA 2KKQA 5DRZA 4PJ7A 4HS3B 2AVGA 4BSVA 1C5DB 5ABDE 1L0QA 1V7NH 2DTML 2JTDA 3O8XD 4YZFF 3ULVD 2A74B 3KDMB 1U8PA 1C1EH 1A14L 3EFDH 4XB8A 3MXVL 4H88L 2CLRA 3VXSA 3Q6FA 2EYTB 3HMWH 2AEQL 3QCUH 3O8XC 1NC2A 2YS4A 2XQYK 4XVSH 4Y1AB 3ULVC 4O02H 1JYXA 1JHTB 2ICEA 5BZDB 5TJWK 4NO3B 4M3KB 4UT7L 2H26B 1CF8H 5IVXB 2VXVH 1S9XB 5C0AD 4G7YH 2R9HD 2VH5H 4FFZL 4NZUH 4AT6B 5DVMA 5JTWA 1NSNH 1NCWL 4QRRE 5GHWH 4E42B 4RAUB 4X80L 2FHCA 3MJ9H 4MQ7B 3KYKH 2C4FU 1A9EA 2UWEE 3QUKB 4L8CB 3WL9B 3IDYB 3REWB 3ARBB 1LEGA 3HE6D 4OGAD 4G6FD 2PW1A 1YEGH 5I15L 4XAWH 3D48R 4OCSL 3ZYOA 3AC0A 2X2YA 1L9MA 4KC3B 3UCRA 3PDGA 2VLME 2DQEH 3FQUB 4S1DD 3QUML 2VR4A 3HE6C 3QQ9D 4OGAC 4TOYH 3MLSL 2EIEA 3H9ZA 5EU6A 4AZ8A 5KS9A 3F65A 4GRMA 3BVNA 5IHUH 1JNJA 2AW2A 1T20B 3OKDB 2OJEB 1F3JB 1I1AB 4S1DC 2NY2D 3V0VA 1TVBB 3TF7C 1FZKA 1SYSA 3M07A 5GRUH 3QQ9C 4O5LH 2FWOA 4IEFB 3ZHLA 4JO2H 3P77A 4BKLB 1ZHLB 4M6NL 4WWKA 3TBWB 4O51A 4ZPTA 2AXGA 4JY5L 1I9RL 5F9JB 2E6PA 2HJFB 2NY2C 2R4RH 1NUFA 4JRYA 4L8SA 1J1OL 1FNLA 1U9KA 4W4OC 4JEGB 1S8DA 1UENA 3TP4A 3V8OA 2GIYA 1JHLL 3IAGC 2GJ6D 4YQXL 3S88H 4AEFA 4Q6IC 1TXKA 3WKMH 1YYML 2XNAB 4MNHA 3QWQB 2X4NA 5FYKD 4CU8A 1HCVA 5LVEA 5I8KH 5CINH 2JB6B 3HR6A 4WI8A 4L3EB 4GG8B 1MFEH 1KEMH 1LP9A 1QQDA 2E7CA 4FQHA 4ZS7L 2C1OB 5DXWA 5IJKC 4RA0C 1S5HB 3PABA 2AJUL 3VGAB 1S9VB 5DUML 2H32H 3WV0A 1F4WL 4TUJB 1W2KT 2F74B 2GEEA 5H2BA 3GGWB 3UTOA 1KN2H 1U95B 4P9HC 3L5WA 3DHJA 4GAYB 2VJXA 2IC2A 2NCMA 1CD8A 1BBJB 4JGUA 4D9QE 4UTBH 1PX3A 1A6UH 3D9AH 5HY9A 5IVOA 4EVNB 5I1CL 4OGZA 4R7DB 4L9LA 4F7TA 5C0IB 4F9PA 5ITFA 2W0FA 5E2TL 4M1DL 1KJVB 1U8LA 1W0WA 4YE4L 2R0LL 2F54B 3C60D 3KHOA 3FHAA 3PHSA 5DJYB 1A6VH 2DJUA 3UMTA 5I1IH 4E5XA 4MA7H 5J1AA 1NQBA 3ZT7A 4NHCL 2PO6B 1RK0B 2XACC 2OR9H 3SKNB 2OZ4H 3EYUL 4HLZG 5EZLB 5KANI 3T0ED 4LP4A 2ZSVA 5FYJL 5H94A 1I8IB 3C60C 1H0DB 3C5ZB 3BRGC 4Z5RA 1GIGH 1V3MA 1ZHNB 2IALB 2EH7L 4EBQH 1L9NA 5ECJE 3WLWD 4M6MH 5EZOH 4I2XA 4YHYC 3WXVH 5D72L 4AEHL 4AQ1B 2C3VB 2ZKHH 3SKMA 3T0EC 2FR4A 3CPLA 1IAOA 1DBBL 5JNYB 4NQDA 3I3BA 1MHEB 3QO0A 1FNAA 3WLWC 3KXFA 4MHHI 1YEKH 3CSYB 5I1AA 4EDXB 4XAKD 1UA6L 3U0WH 1KBGL 3HNTH 2OM5A 3ZKSD 1T7VA 5LGHL 4JO4H 4H1LA 5FGCE 2G60H 3NAAL 1C5BH 1CFVL 2DMBA 4NNXA 3SGEH 4CDGC 4DN4L 5I1HL 4HFWA 1I3RB 5E8PB 1I1RA 3SCMA 4GMTL 2LAAA 2BMKB 3IJSA 1NAKL 2LVCA 5FA4A 4X83A 3T0DA 3LV3A 2DTMH 5TE7L 4EUPG 2VLKD 4EUPB 4I77L 1KOAA 1L6ZA 1G9EA 4G9FE 1A14H 1RAMA 1F58L 3JV6A 5BJTA 3HE7B 5T3XL 1OSZA 3MXVH 3BZFA 1JF5A 5HYIA 5KN5B 4K94C 4P46D 2AEQH 4QRQA 4MWFA 3U83A 43C9A 4LVHB 5DFWH 1NDMA 3EGSB 4JFFD 3D3VB 2AJZB 2RBLA 1WZMA 1ZA3A 4UT7H 4Z7WB 1MI5B 4X5WB 4UB0L 4QRPA 2J2ZA 4BSWB 4P46C 3UTTD 2WANA 4FFZH 1G0YR 4Y16B 2IF7A 2RCSL 5IB2B 4Y2DB 4BFIB 4HV8B 4TQEL 3PP4L 2ZUYA 1NCWH 4NZDA 4PY8I 2MNUA 2YPLA 3TA3D 3FONB 1WWAX 3GJFH 4Z7UF 3BP6B 1I8KA 3RVUD 4Z7NF 5EU7E 2YEZA 5I6XC 1FJ1A 4C57C 5I15H 4XPGL 4QTHB 4OCSH 3X3GL 1HI6B 2EDLA 3TA3C 3QQ3A 4GKNB 4IOSD 2FJHB 4JFED 5DZNA 3VGFA 5EDXA 2FSEA 3RVUC 1VPOL 4R97C 4I0CC 3QUMH 1MCOH 2LV4A 2DF3A 3HC3L 3MLSH 5IMLB 3BEWA 4XP5L 4O58L 1EGJL 2AJXL 3VFVA 4MJ4A 4NDMA 2H6PA 1VCAA 3G04A 3MLYL 4UIMA 3C8KA 3ULSB 5EBWA 1J0IA 4JO3L 3X3FL 4F15B 1G7PA 1C08B 4M6NH 3V95A 1EBAA 1NMCB 4J23A 2HT2D 1I9RH 1Y0LB 3ILQD 4U1KB 4R4BA 3C5SA 1J1OH 3RZWA 2ESVA 4GRLD 3EYSL 1L6XA 1JHLH 4YQXH 4X6DE 1UWEL 3D69A 4PBXA 4WI3A 2XKNA 2HT2C 3ILQC 1Q94B 3BJLA 3BZ4A 5FYJE 4GRLC 3P9WB 3D0VA 2FX9L 4N90E 4QRUA 2XZQL 4ZS7H 3CJJA 5FHAL 4U7MA 1D5IL 3MLTB 4Y19E 2AJUH 4X4XB 5DUMH 4GUPA 5DZOA 3VFPB 3E8UH 1F4WH 4WUUE 4YHNB 2ZUXA 4J3TA 5F70A 3QXWA 1Z6JT 3RL2A 1KPUA 3FQRB 4CBPA 5EUOA 5I66A 5C09E 1ED3B 3B9EA 5SV4A 1Z5LB 2BOBB 3DROA 4PJFB 4KDTA 4NWUL 1BZ9A 2VL4A 3EZJB 3S36H 5I1CH 2WIIA 3A6OA 3K8MA 4LHJB 4LVNB 4M61A 4DK6A 2JE8A 5E2TH 1ZVHA 4M1DH 1OTUD 4YE4H 1QSEB 3GIZL 2R0LH 1T4KA 4KGLA 3FTGA 3J8F7 5EIIA 2VLJA 2W1NA 2W9EL 4P4KA 7FABL 1UZ6E 1PKQB 1QEWA 2EDKA 4W4NA 3T1FA 4NHCH 1ITCA 1CCZA 1QYGL 3EYUH 1VESA 1OTUC 2ED7A 2DLGA 5FYJH 1CT8A 4XNZC 3QDMB 3GZKA 5D7JB 5DJZB 3GSUA 1OD9A 2C26A 2EH7H 1AP2A 2ITCB 5CJOL 1UWXH 2GAZB 3OR7A 5T3XE 1RJLB 3HG1B 3KPTA 4YDKL 3MLRL 4RMQA 5D72H 5FK9A 4ZFOB 2XTJB 5I1LA 3ME0A 1HXMA 2YC1B 4UT6L 1PLGH 1W72L 5D2LE 3X13A 3W82A 4PJCB 5ID0B 4M43L 3AMLA 1DBBH 1URLA 4XPHL 3S6CA 3ILPB 3IAPA 4LL9A 3MRFB 3HC0B 1WGOA 2WLZA 4DGIL 3HCVA 3HUJB 4K8RH 4KDWA 5KSAB 4LCUB 1JV5B 2N56A 1EO5A 1UA6H 3VDAA 4DCQB 1KBGH 3L3HB 2FL5B 3EO0B 5C0RL 1ITBB 5LGHH 2LU7A 3EKCA 2C4FT 5F44A 3NAAH 1CFVH 4DN4H 3EJYD 5I1HH 2OYPA 3KPQB 5EIQA 3W0WB 2V5SA 4WTXA 2CRYA 2K9UA 1JTOA 4Z76A 5IB4B 1NAKH 1JF1B 4ZFZA 1DUYA 2DYPD 2VZOA 3P73B 3B3IA 5D7LA 1UH4A 5TE7H 3V2AR 5AG9A 2A6JB 2AJ3B 3EJYC 3O3BA 1I9EA 4I77H 3DXAD 2E9BA 4WFHE 1NFIA 5LBSL 4Z7QE 1LMKA 5CKGA 5T3XH 4XP9L 5KSUA 5FKAA 2WMPA 5TF1L 3EDFA 3QDJB 4ONHB 4GKSB 3MQIA 1P4LA 1U8IA 2FRGP 1T5WB 4PRPD 1MJ8L 5D5MB 4XH2B 4QHMB 1BM3L 1RJYA 3HTLX 1KIPA 1I8LC 1TVDA 4UB0H 1D5MB 3C8DA 4QGTA 3AGVA 4X7SL 2PCPA 5DJCA 4OAWB 1F45A 3NIGE 4F7MB 2BVOA 3CU1A 4OZGB 2RCSH 4PV9A 3DLQR 1CFSA 3U4EB 5KOVC 4TQEH 4Y4FD 4MCYA 3PP4H 3QFJE 4WW1A 4I18B 5EU3B 1IEAA 1JK8A 2KDGA 1G7IA 2Y25A 5I1EL 3TPKA 1PEWA 4R90L 4WFFD 4WHYH 1KB5B 4J7RA 2R0KL 3CCHA 4HWUA 2ADGA 2KUTA 4Y4FC 3TN0D 2DD8L 1DEDA 4XPGH 3X3GH 3MA7B 5GIRA 4WW2A 3PUCA 3CXHJ 2XV6B 2XTLA 5A16B 2EDBA 1VPOH 2QKIA 2UWEF 5DJ2B 2JCCE 5B3JF 4C55A 2XWJA 5EOQL 3HC3H 3TN0C 2Z31A 5DRXA 4XP5H 3QCTL 2HMID 2X9YA 4O58H 3VXRA 5DC4B 4V1DA 1EGJH 3I6LE 3OKOA 2AJXH 1N6VA 1AGEA 4G3YL 2JK5B 3L3KA 5JA8B 3MLYH 2AXJA 5EC2A 3FOMA 2B5IC 3V4PH 3VXMA 3GMMB 1RZJL 4JO3H 3X3FH 5TPWH 3VXPB 2BCKB 2HMIC 4CVZA 1GH7A 3BN9D 3VGBA 5BS0B 1BWMA 5F1SA 1F00I 1UT9A 4L4VA 3RKPA 5MENA 1IEHA 3F7VB 2WP3O 2V2XB 3EYSH 5DK2A 1JWMB 1FVDA 1DCLA 3GKZA 1UWEH 3BN9C 4KROD 1KJ2A 1PKOA 4X99A 4K2UL 1TJIL 5IB1B 4O2FB 2VXQL 1QLRA 1RSFA 4NBYB 3IKCB 5D1ZD 4QEGA 4AENB 3FOLA 1IJ9A 3S5LA 2XZQH 4KROC 1J12A 2CR6A 5FHAH 4Y8AA 1D5IH 4GAJL 4MSWB 1REIA 3HZMA 3W9EB 4KHTL 4QGYA 1QPPA 3QIBD 2DLIA 5FF6A 1ZLUK 5D1ZC 3O3DB 3BQUD 4QOKE 3TZVB 4XNQB 3GMLB 3V4UL 1N5AB 1CL7I 3MBXL 5EC1A 4YPGA 3CMOL 5T1KA 4K7FB 3ZYIA 4DAGL 4NWUH 3QIBC 3BQUC 1PSKL 4NNYB 3ARFA 2EICA 2P5WB 4DZ8B 1Q9KB 1V8HA 3LKNA 3F58L 1XIWD 2XY1A 1B2WH 5DJDA 2VQUA 4DVBA 5E4EC 2C5DC 5F3HB 1KCVL 3VMOA 7FABH 2EIZB 1T21B 1U8JB 3P3YA 4C56A 1XIWC 1QYGH 4YR6A 3FB5A 1T2JA 3K0WA 4OZIE 4WU5A 1HWGB 2ZPKL 1ZHBA 2BNRD 1GOGA 4AH2B 1ZEAL 3DBXA 1OAXL 5J6HA 4PJ8A 1X44A 2YRPA 5CJOH 1CLYL 1CTOA 1IL1A 4Z8FL 2BOCA 1CYGA 1FYTA 3KPLB 3MLRH 4J8RB 4YDKH 2I5YH 3IETA 4UT6H 3PWNA 3HC4L 4M43H 3MCLL 4PP2B 3SDXB 2QJDA 2NY6D 4XPHH 4PJ7E 3TNNA 4YPJA 1XGUA 3LN9A 1QA9B 4YK4B 3ARSA 4LDEB 4PUBL 4KTDL 1YPZB 2QR0B 4DGIH 1GGUA 2Z92A 2FDBP 5DD1L 2IFGA 3GRWA 2NY6C 1MHPH 2OTUA 1ADQL 3SO3B 5C0RH 3VXSE 3OXSA 5DR5L 3BP7B 3NTCL 4Y89A 4HBCH 4M7KL 1D9KA 3QEUA 3LQZB 1MJJA 5KG9A 1P7KA 4XCYB 5I71C 5EBMA 4FP8L 2VSDA 1IQDB 2ATKA 3L3GB 4KJYB 1ZSDA 3TO4A 5LBSH 5CJQL 4XP9H 3AB0C 4J3VA 1CL7L 1NGQL 4DN3H 1OPGL 5SWQB 3HMXA 3R1GL 5TF1H 1VFBA 1XCQA 5DJXA 1EO8L 1YNKL 3RFZC 1AIFA 1MJ8H 1TQCC 2NZ9D 3IXTB 4F58L 1X5JA 1BM3H 2ILLA 3O9WA 2BSRA 4XP1L 5SWSA 3O4LB 1VFOA 4BQ6A 4OZHB 1G7QB 4X7SH 1A1NB 2NY4B 2NTSP 1UB5B 3MR9A 1JWSA 1CI5A 3TYGL 2NZ9C 4MQTB 4OM0L 4GO6B 2FLBT 2W65B 1VB9A 4MZ3A 4TVSa 5F6IC 3WJJC 1OARL 1HH6A 1RIHL 5EU6E 5KS9E 5I1EH 2X4QA 5CGMA 2CUMA 4R90H 2I07B 2ZUQC 4P3DA 5MHSE 1AQDB 3NZ8B 2R0KH 3NFPB 2DD8H 1AGCA 3SE8L 1JTPA 1QOKA 3QIUD 4OLYL 1DQQA 2ERJB 2RB8A 4PJEB 1I7RB 4ZQKB 1HN1A 3MRIB 5D7IE 4AL8L 1RVFL 5EOQH 2BRRL 4HXAL 4PJ5A 2R1YA 2CO6B 4OZFG 5ITBL 4NKMA 4OZFB 3QCTH 4OBSA 3BPOC 4WEUD 5KSVB 1UG9A 3CX2A 3MGOB 4Z9KB 5C08D 3QIUC 3S97C 3ARQA 2VNCA 4L5FL 4G3YH 2OXGA 3DURB 3VDCA 5GGRB 4P5TA 5HPOA 2A6KB 4WRLA 5CJXA 1E4WL 4K55A 3INUL 2CDEA 1RZJH 4F80A 3GB7B 2WV3A 3ESVF 5E8NB 5E6IB 3ET9F 4MNGB 2YPKB 5HSFA 4PJIA 5ANME 1BD2A 5IKCA 1TZIB 1G0XA 1OW0C 3DX9B 4H5SB 3P4NB 1WT5C 3LDBB 3WIHA 4X7TB 2VQTA 3QWRA 4K2UH 1TJIH 2Q3ZA 2P7TB 2VXQH 5CSZA 1R3JA 3CX5J 4JAMB 4X0KB 5DD6A 5E24E 3HZVA 3DI3B 5IW6B 4J1UA 5CGTA 3AMKA 4RRPA 5EU4A 4MCZA 2BC4A 2VB5A 3D1MC 4KHTH 3AREB 5TFSL 3PWUA 2DLTA 2A83A 2UY6A 3V4UH 3WFBL 5MP6L 5EG6C 1CZ8L 4QRRD 4WO4D 3MBXH 3RGVB 5MEOB 3U6RB 4DAGH 1ZXQA 3N1GC 4IRSB 3GSNA 5C07B 1PSKH 3VWJD 1CK0L 4ZO7A 5D96B 3DV6A 3F58H 3T0WA 1QHPA 2R2HA 3X17A 4WO4C 4I2XE 1CDHA 3RNQA 3HS0A 4KQ4L 3O11A 1CDBA 2VLMD 2P8LA 5FECB 3OKKB 2ENSA 1KCVH 5BRZD 5AAMA 1NC4B 3VWJC 3I02B 5I76B 5ALBL 1J0ZA 4NQDE 1PX4A 3B2VL 3EYFA 2EECA 4N9GA 4BM7A 3KXFE 1JE6A 5INDB 4M6AA 4GG6B 3QUXB 4XZUB 4LLVA 1ZEAH 5D7KE 5CD3B 3FMGL 4I4WB 1OAXH 1DEEA 3D39A 4XXCA 1U8HA 3H7LA 3OWEA 4MYWB 4Z8FH 3SPVA 4LIQL 3GO1L 1YEHH 5IVNA 4J3OC 3HC4H 1UCTA 1F4XL 5H35B 3MCLH 1W0VA 1VDGA 4LKCB 1ZLVK 2YD2A 3MV8B 1LDPL 4PUBH 3WFDL 4KTDH 5F3BA 3UDWC 5C0JB 3GSRB 1JPST 1IMHC 5K59E 4HS8L 3K1KC 1QFPA 5DD1H 5D2LF 4OF8A 2IADA 4MNQB 1NMAL 4Y5YA 4U0QB 4LPTA 3RJQB 1RHHB 3KYNB 1YEDA 3M17A 5DR5H 1EV2E 3T8XB 4F2MB 3NTCH 4XCEB 2YOCA 5D70H 4NRYB 2IAMA 2VC2L 5E5UB 1A0QL 4FA8A 1GGYA 4M7KH 1HILB 4MXWL 3BWUC 1J7VR 4LNRA 1NCAL 5DJ8B 3O6FA 4Y5XA 4PJ9D 1DLFL 4P4RA 4JRXD 4LASL 1EEUA 4FP8H 4QRPE 4U1MA 2O5XL 3T65B 4DEPB 1OP5H 2BVPB 4JVWA 3TJEL 2IPKB 2OL3B 1OAZL 5CJQH 1MQ8A 1CL7H 2Y1VA 4PJ9C 1NGQH 1IM3B 1AD9B 4H1LH 1OPGH 1YDPB 4B0MM 3R1GH 2YPLE 4OF6A 5F1IB 1MRFL 4DOHB 4CJ1A 1EO8H 4LLWB 5H37H 1MH5A 1YNKH 4L4TA 4PB0L 4X9HA 1UJ3A 1VFAA 1YN7A 3MRRA 4F58H 4U1SA 5EO9A 5AWNL 3MREB 5C0EB 4Z7QF 4ZPVB 4ZFGL 5SV3A 3TBTA 2K7PA 4XP1H 3R4DA 5FOBB 4MJ5A 4WJ5A 4MAYD 3EDDA 4NQCD 1EHAA 5M7QA 3TYGH 3RRQA 4ZUWB 3LKQB 3WJLA 4OM0H 5T33L 3G08B 4YFLF 5K9OB 1OARH 3DO3A 2NX5A 3I9GL 4R26L 1OTTD 4MAYC 4LCWB 1DBKL 2AQ1A 3LKOB 5IK3B 5E0QA 3MUGB 3DX6B 4HIXL 4GW5A 1DE4A 4WCYL 5C0BB 1FNGA 3SE8H 4YHIA 1OTTC 4OLYH 3F5WA 2Q1EA 3LIZL 1T1XB 4NP4L 2AXHA 4AL8H 1RVFH 2BRRH 5AUMA 5HHMD 4HXAH 2M1KA 2ESVE 3ZKND 5ITBH 1OGAA 3MOAL 2CSPA 4ZNCD 2XG4A 4JCMA 4L5FH 3DTXB 4RBPH 4KRLB 1A64A 3QA3A 3S35L 1V3LA 4LSQL 1IE5A 3O8XB 3ZKNC 1E4WH 3INUH 3ARGB 4G8EA 4EEEA 4ODXA 1BMGA 4R9HA 4FHBD 2X7LA 3IRPX 4K71C 5F1KC 4PJGB 3MUY1 3DWTA 4ZUVB 2H2PD 5ACLA 4FOMA 1LQSR 2P8MB 4CL7A 2D9QB 5HYSG 3KJ6L 4LCCA 1ND0B 4G6KL 1CGWA 5HYSB 3MRKA 3BZEB 2J7LA 5EUOE 4B41A 5E6ZA 3QRGL 5FYJU 4GLRH 4PGCA 3UXFA 4M48L 1NGYA 2H2PC 1HDMA 4FQ1L 5C0AB 3IXAA 1S78D 3JVGC 1KENL 5TH2A 5J11C 1C5CL 1YUHA 1JYNA 5C3TA 5IEKA 4PD4J 5TDNB 2EDFA 1T0NA 4LIQE 1N3NA 4OM1L 1F42A 1K4DA 1NCTA 2VLLB 2VLJE 2B8OT 4HHAA 1S78C 5TFSH 4TVPD 2VOTA 3WFBH 1KJ2L 3ARTA 1CZ8H 4HWBA 4FQXD 2DM3A 2EEDA 4UAOC 3MUHL 3MV01 4QRSB 5T1LB 3EOBB 4L9DA 1CK0H 4N0YL 1OT2A 5DRWB 3BSZL 5I2IA 4HPOL 4FQXC 3BESR 2FIKA 3AXLB 4KQ4H 4QT5A 3GI8L 1Q1JL 2QQNL 4U6XB 4YBLB 4OV5B 3SDDA 3G6AA 5A2FA 5BV7B 5ID1A 5EU7C 1JZ7A 2ARJQ 2GUOA 3VFMA 4U6TA 5IQ9B 4B5EA 1X7QA 5ALBH 1Y6MR 3B2VH 2NY2B 3GKWL 1TZHA 1HHIA 3TGXA 3RJDA 1U8MA 5T3ZH 3EDKA 4X8JB 3CH1A 3FMGH 3HAEA 3MCKB 4DZBA 1A2YA 3WNMA 3O3AB 1UXWA 4X7CC 4F9LA 4UDTB 5CJ8A 4YDLC 3PWVA 4LIQH 3GO1H 1BVKB 3GSWA 2BY3A 3RX7A 3RTQD 4OZIF 1U93A 4LRIC 2GCYB 4QCIB 1N2RB 3LN4A 2GJ6B 3PHQA 4PJAB 5E94A 3QXTA 4NZRL 4ODWB 4BQCA 5JDSB 5F9WB 5JA9A 1LDSA 1LDPH 1NJ9A 1CS6A 5D7LE 4MA1B 3RTQC 1T3FA 4H26B 4HS8H 5GJTL 1TETL 1QSFD 1FRGL 2WM0A 1XT5A 1GHFL 1NMAH 4UQ2B 4E0RB 1MCCA 3AS0A 2E5EA 1RZIA 3CIQA 5T5NF 1JGEA 1ZS8A 2CLZB 1A0QH 3TNMA 1AGDB 4MXWH 4O2CB 4D2NA 4WU7B 2HFGL 1NCAH 3BT2L 3G5YB 1DLFH 4LASH 3B5HA 2NTFB 4URTB 2O5XH 2JLLA 3TJEH 4HW6A 3GRWL 1P1ZA 5HYJE 1OAZH 1MCQA 4YH6A 5EO1A 1J1PL 3VFTB 4UU9A 3VD9A 4HKJA 3IVKA 2D2OA 3C08L 4GOSA 1MRFH 1B0RA 3ELAT 5JPMA 4PB0H 3PG2A 3A67H 1SYVA 4D0DA 2JELL 4YHYB 2BY2A 5AWNH 4KRPD 2BSTB 1AGFB 2FH6A 4KUCF 2AAVA 4NQED 1S3KL 3T0EB 4XBGB 3HI6L 4TUOB 3U0TA 4C83A 5E00A 3RVXD 4G8GD 1LWRA 5ESAB 1KIQB 2MPAL 5T33H 5IIEB 4KRPC 4P2QD 4DVRL 1S9YB 3HMXL 12E8L 2CKBB 3FB7A 3I9GH 4C59B 4R26H 2W38A 4MAUL 3VXRE 3RVXC 4JQVC 4ORGB 1DBKH 5L7XH 5J6GA 4HWZA 3IFPA 2CH8A 2ZSWA 4FXGB 4ZAKA 1XF3B 4OKVB 1SEBB 2FZ3B 1XF2A 4LLQA 4HIXH 3VXME 1BQHA 4WCYH 2CUIA 1KGCD 3QDAA 5C0CA 1GGIL 2CDGB 3RY6A 4M62L 3LIZH 5HI4D 1Z0NA 5DVOA 4NP4H 4L4VE 3EFFA 1UYWL 3FT3A 5D6CB 2X4TB 1CG9B 5I16A 4Z0XA 2H2SD 1QSZA 3MOAH 2WWMD 4U3XA 4PRNA 2XT1B 2A38A 2FECI 1P84J 5HI4C 2JKXA 3WNKA 3WNNA 3RIFF 2ICWJ 4ZUSA 1KLGA 3JWOC 4L29A 3QI9D 5D7IF 3S35H 4LSQH 3WHE0 3BWAB 3CFJA 1PY9A 1U91B 2H2SC 4KV5E 2VLKB 2WWMC 1NGXB 1CXFA 4I13B 3IYLW 4PGBA 2GSGA 1RUQL 1LEKB 4R0LC 1L7TL 1FVCB 4LSPL 1D5XA 1JNNL 5IR1A 3QI9C 5HD8D 4P46B 1KUMA 3VFRB 5FM5O 3NIFF 5D2NC 1OSPL 1HSBB 2ZG2A 3UROR 1UC6A 4G6KH 4JHAL 4JFFB 4NRZB 1QPXA 3VFSB 1NFDF 3QR2A 3QRGH 2P1YA 4PP1D 2DICA 3BHBA 4HS3A 2YUVA 1K2DB 2HJKB 5JIHA 3QDGB 5A2IH 4M48H 3GFUA 5HD8C 3HZYB 3UTTB 1KENH 1C5CH 1SVZA 2X9XA 5I6XB 2A74A 3KDMA 1ETZB 4PP1C 2VL5B 4OM1H 1BJ8A 3G5XB 4I0PB 4S0TD 2EYTA 5C0FA 3WIHL 1EFXB 2YA1A 1I9IL 1M1SA 4R97B 1KJ2H 1Q9WA 4Y1AA 4XNYH 4C56E 3GMQB 1JHTA 1T83A 1YJDC 5F72S 4U0RC 2ADIB 5BZDA 3TCXA 1SBBA 3O2WL 4CMHC 1A6AB 4YGVA 3D18A 4N0YH 1S9XA 1GSMA 2VISB 4HK3N 1IGIL 3SHSA 1P6AB 3BSZH 4E41A 4HPOH 4MXVF 4N8VG 2J88L 3CU7A 4N8VB 4AT6A 5JPNA 1FYTE 2VXTL 4U6VL 5LJYH 4MXQD 1Q1JH 1DTUA 2F8OA 2QQNH 5K9QI 1T1WB 1XGPB 1RULL 1T2XA 2LU3A 1ES0A 3LKRA 4RAUA 2CKNA 5BCAA 4MQ7A 2XZAL 2YD1A 3GKWH 3QUKA 4L8CA 2Y72A 4QKXB 2EEBA 3MACL 3KYAA 4HX1B 4MXQC 5B38G 4BZ2L 3GSNL 3R06B 5B38B 5EPMB 1RJZB 5DMJB 1MAJA 1B9ZA 4DUVA 2ZCLL 5SX5K 5AYQA 2FECL 3FQUA 2QEJA 1PYWA 1AO7E 2RGSA 4GRLB 1BFOB 3QPQD 4C58B 4PRIE 2YPVL 4LLYA 3OAZH 2O26U 1ZA6B 4U49A 2P45B 4J2XA 3OKDA 5HVHC 1F3JA 1I1AA 5E1AB 1KLUB 3D0LB 2XZZA 4LK4A 4NM4L 5IHZA 3QG7L 1S7SA 1JZ6A 3QPQC 5GJTH 1FRGH 1N7ML 1GHFH 4BKLA 1ZHLA 5DMGD 2YXMA 4HJJL 5HGHB 3QQNA 1FC2D 4AEIL 3PGDB 5F9JA 3VWKD 3TVMD 2HFGH 5DMGC 1OWWA 3BT2H 3RA7L 2XNAA 5SWSE 3T3ME 3O4OB 3VWKC 3WN5C 5ICZB 4IDLA 2AJSL 1X4ZA 2JB6A 1R0AL 2XWBA 3GRWH 3OKMB 3TVMC 3PQYA 25C8L 3ZL4H 3G6DL 3D25B 1GZQA 1J1PH 2X1XR 5BVJB 2C1OA 5GRVK 2EKSB 2Z8SA 4NUGL 1S5HA 1I4FB 3C08H 1RU9H 2AK4D 3KWWA 3ARRA 4KK6D 4TUJA 2VLRA 2JELH 3AS2A 3GGWA 4ODSL 1U95A 3HI5L 1PVHA 4YFDB 1DLHB 2HTLD 1S3KH 4PRAA 3MRHB 1PDKA 3HI6H 4HH8A 2DWDB 5DHVA 2XXMB 1J18A 4G6AD 1FCGA 1AR2A 3PWPD 3KYMB 4KK6C 3PDOB 5FCSH 5C0IA 2MPAH 4J3UA 1LE5B 2F5BL 5EWIL 2DQIL 1MNUL 3I6GB 4N8PA 4DVRH 4PJ5E 3HMXH 2HTLC 1KJVA 1FN4A 5J57B 4MAUH 2AXFB 4L8BB 2BNQD 4YEEA 3V6BR 1YNLL 4G6AC 5DJYA 2X89D 4XX1E 3TBYB 2PN5A 2V2TA 4QHNA 4CW1A 5EZLA 3GI9L 3UJIL 2CK2A 4JM2A 3FQXA 1GGIH 1T7YA 4EKXA 4M62H 1NANH 4I5BA 1ZMYA 2AEPL 3C5ZA 1FZOB 1ZHNA 2BFVL 3B83A 1CGXA 4PJIE 1BD2E 1UYWH 1A4JB 4HT1L 4XCNA 4BQBA 5GGUA 3JTTA 3IS0X 2C3VA 5TDPA 3PIQA 2J12B 5HJ3B 1RMFL 5L2KB 1QFOA 4U7SA 3FHQA 1UKSA 5JNYA 3BD3A 1H5BB 4XC1L 1MHEA 3B9DA 3UTQA 2DYPB 4JPVL 2JJSC 3WFEL 4EDXA 3DXAB 4N5ED 5I1GL 4D0CA 1RUQH 2P48B 2L0DA 3V52L 1L7TH 4LSPH 4MS8D 1OP9A 1JNNH 4BSJA 4PTTB 1I7TB 3BE1L 3H3KA 2VN4A 3ZTJH 1OSPH 2DM7A 3RZCA 2PYEE 4X9IA 4JHAH 4KUCD 3DSNA 4PRPB 1I3RA 4N5EC 5IESL 1OAQL 2XI9A 2BMKA 1AHWC 5J9PB 3QQ4B 4MS8C 4X4ZA 3D85B 4KRNA 2F53D 4OLWL 4NN7C 1T66D 5EUOF 4JFPA 4Y4FB 4M7ZB 3O3EB 1HHGB 1XZ0A 3HE7A 3OBAA 4WFEE 5KN5A 4RFNB 5IG7B 5CBEA 1I1YB 4IS6B 3WIHH 1PG7X 1I9IH 4R8WL 4PG2C 1RUML 4QO1A 1T66C 1ZANL 4OUUB 2AJZA 3FB6B 3MO1A 3TN0B 3I6KA 4FFYL 4Z7WA 1MI5A 3DNKA 4X5WA 1LHZA 2CMRL 3NZHL 3RQ3A 1IGIH 1R5IB 2Y7QA 1F13A 3D39E 4Q97A 2P24B 2J88H 5EU5B 4R4FL 2OK0L 1F4AA 4GT7A 2VXTH 4Y2DA 4U6VH 2B5IB 5DGRA 2FHFA 4BFIA 5IB2A 4HV8A 2A73A 5CZVH 1FL3B 5LKNA 1U3JA 1WIPA 4NGHL 5IVZA 5FCUL 3C87A 3TIEB 5I1KL 4HWBL 2XZAH 2HFEA 2BNUA 3BP6A 2CD0A 4AEEA 3QEQD 3MACH 5A40E 3WO4C 3MRPA 2VZUA 3U46A 3GSNH 5KVEL 5KAQG 4QTHA 1CGTA 3ZDYE 3FN9A 1HI6A 1XCTB 3UTSD 5E9DB 1G7JB 1FIGL 1NBZB 2ZCLH 4GKNA 1PQZB 2FJHA 2DRUA 1EA9C 4KI5E 4FMKA 1K5NB 1SJVA 3BN3B 4BFGA 2YPVH 2B2XL 4NQSB 1QO3B 4OSUL 4KROB 2I9LB 4ZYKB 1UXSA 4LDLB 5CLWA 4U1LA 3IF1B 3RWCB 3F7RA 4OIIL 2XG5A 1E28B 4NC0B 3QG7H 2PYFB 3BEVA 4NM4H 2VAJA 3ULSA 3UZQA 1N7MH 2OR8A 3BKYL 4HJJH 3S4SG 3HLAA 3S4SB 3I75B 4CMMB 5MEQB 4XGZA 4AEIH 3PGCA 1Y0LA 3QIBB 4ZTPH 3LZFL 2VDLL 3W9DA 4L4TE 4O2EA 3U36B 5DT1L 4K07A 4U6YB 1KG0B 2ZCKL 3GHBL 5GRXG 3T0VA 2E7HA 3RA7H 4NQVA 1INDL 4MJ6A 5IB5A 4L9LC 4LEXL 2CPCA 3E3QE 4U31A 3TYFB 2AJSH 1N0XL 4XXDA 1R0AH 3MRLA 4EN3B 2EIDA 4P3WA 5DSCB 25C8H 3UBXG 1T2QL 3G6DH 4RZCB 3UBXB 1MQKL 3K2MC 1MJUL 3K7UA 4NUGH 1KTKE 1UB6B 2ICWI 2NX5E 4FQQB 4J3WA 4X4XA 4TSCL 4TN9A 2HJLB 2Z93B 3FQRA 4U1JA 4PRHD 4ODSH 4RGMB 3HI5H 5L2JB 1Z5LA 4HKZB 4OIAA 4D8PB 2BOBA 1XF5B 2BNRB 1MFBL 2EXWD 4P23D 3ZYJA 1U3ZA 4Z7VF 4FXKB 1FL5B 3FN3A 2F5BH 5D7KD 2DQIH 5EWIH 1MNUH 1ZT4B 2LTQB 5GZND 3L5HA 2EXWC 2X1PA 1QSEA 2YD7A 5IBLD 4WW2F 4P23C 1YNLH 4QTIL 3CNKA 2NY6B 4K7PX 4YIQB 1NDGB 1AC6A 1KXVC 2O5ZL 4JDVA 1A7RL 1PKQA 1UKQA 1P4IL 3VI4F 4HJGB 3UJIH 2AQ3A 3GI9H 5GSRA 5GZNC 3WEXA 1XH3B 3CDGB 1ZAGA 2X1WL 2Q76A 2EXYD 2AEPH 5D7JA 1ZGLA 1RZKH 3N50A 1X3DA 2BFVH 2DQCL 5I71B 3ULUF 5EOTB 5HHXL 1S7TB 2WW8A 2I9TB 4UDUA 1I7ZA 1RJLA 3HG1A 3O81A 1J5OL 1DQLL 4NN6C 3HHRB 4NSKB 2G5BA 1RMFH 5HHOD 5ID0A 2QSVA 1JFQL 4XC1H 2IPUK 1MIML 4JPVH 5J12B 3MRFA 2GI7A 3B9AA 2MJWA 2EYSA 4X6CA 4NZJA 4DWHA 5FB8B 3HUJA 2ZWLT 5KSAA 3H42L 1A5FL 5I1GH 4DCQA 3V52H 3EO0A 5HYEA 1MAML 4M03A 1FFOA 3BE1H 3PGFL 4JO1L 1O0VA 4KV5F 4JANA 3ARBD 2AEIT 3SKJL 2H1PL 2HG5B 5IESH 1OAQH 3KYOA 5JHDD 1YQVL 3F6IA 5GS0L 1D5BB 1JF1A 5F6IB 3N1MC 5E03A 3JWDC 4ZSOA 2HT3D 4PJFF 3W11D 3IB4A 2JJTA 4FQJL 2ZUQB 5F7EL 2A6JA 2AJ3A 3ARBC 5GRJL 2XKSA 5I8EB 1BFSA 3QZWA 3FL7A 5F88B 5EN2B 2WUBL 2GJJA 4D9RE 1G9ML 1WZ1H 3W11C 2HT3C 3PF2A 5C3LD 4Y4HD 1PAMA 4R8WH 1HCFX 3QDJA 1RUMH 4ONHA 1ZANH 4GKSA 3VFUB 4MB5A 1T5WA 5JW3H 3MRCA 3RWHB 4XH2A 4FFYH 2B7DT 3BXNB 2CMRH 3NZHH 1TFHA 3QIUB 1IQWL 2IQ9L 4Y4HC 4OAWA 4TYUA 3SJVA 4JFZH 4R4FH 4F7MA 2OK0H 5F7YC 4OZGA 3VXOB 1YMHB 4GS7C 3JXAA 2W60A 5EU3A 1CVRA 1DR9A 4NGHH 5FCUH 3P9LB 2CK0L 2DQUL 3EYOB 4JCLA 4GW4B 5I1KH 4HWBH 1RV6X 1XR9B 3FRPG 5F7HA 4X4YA 2PUQT 5ENWB 4L3ED 5IFHL 2FO1A 1WITA 5KVEH 1RPQA 2FLRT 1MEXL 4X9BA 3MA7A 4KFZC 4HWNA 4PJDA 3RWJB 1FIGH 3SN6N 4JZNB 2V5TA 1MFDL 2ATPB 4HBQA 5DJ2A 1M7DB 4NO5A 4ALAL 4KQ3L 1FYHB 4JZJC 3VD4A 1H8NA 4KKCD 2B2XH 2YD8A 2Q7YA 4OSUH 3WIIL 3VFNB 2OQJA 3LMJL 2ZCHH 3OQ3B 3HRZA 5HHQA 4M1CD 2D4DA 3REVB 3GJFK 4QHLA 2E27L 4OIIH 2X1QA 3OPZL 4Q2ZB 3LPWA 3HAEH 4KKCC 2E9JA 3GMMA 4M8VA 3BKYH 1AKJA 1QRKA 3V5DA 2BCKA 3A0OA 5BS0A 1F11B 1KPVA 4M1CC 2F54D 3FT4B 2ICCA 4RMVA 1JUFA 4RX4D 3NVQA 3LZFH 2VDLH 3F7VA 4WV1B 4APQB 3RX5A 5DT1H 4XVUD 1XMWA 2PO6D 2HH0H 2ZCKH 3GHBH 3L1OL 3L95A 4QRRB 3UPAA 2HVJB 5DRNB 3SGJA 4RCAA 5D5MF 1JZ8A 1INDH 5IB1A 3S98A 2UWEB 2QQKL 2ARWA 3IKCA 4LEXH 3VWJB 1N0XH 3UTPE 1D5ZB 4XVUC 3RWIB 3WLBB 2PO6C 1T2QH 5JOPD 2IBGA 1ZOXA 4GFTB 1MQKH 5EZIL 1WBYA 1MJUH 1EHNA 5CEZL 3EZ8A 2Q87A 5KW9L 2GTWB 1FGVL 4LPYA 2GSIA 2VABA 3CDYA 4TSCH 3SDYL 5BRZB 2B4CC 3OJMB 3TZVA 3FO1A 1SBSL 2XPGA 4OQTA 1INQA 4XNQA 2O93L 2VAAB 1ACYL 4U7KA 2H32B 2GK2A 1BF8A 5GZOD 3ZKMD 5EA0L 1UADC 1MFBH 3ARYA 4K7FA 4K3GA 2JJWA 3VGGA 1S7QA 3SDAD 5C0CE 3Q6GL 3HI1B 4NNYA 2GW5A 3PL6D 2BDNL 2P5WA 3H9YA 1Q9KA 4D9LH 2BY0A 5GZOC 3LEXB 3MJ6A 4PRBB 3ZKMC 1HHHB 2HKHH 1AY1L 5B8CC 1SMAA 4ISVB 2NY7L 4QTIH 3SDAC 1JVKA 2P5ED 3TBSB 2VDPL 3PL6C 1FV1B 2O5ZH 1T21A 1A7RH 3IDMB 1U8JA 4WGWB 1P4IH 3T2NL 5C71A 3S3PA 4FTVD 4AH2A 3SKUD 1XFPA 4S1SL 2FO4B 1E0OB 2DQCH 2H41A 2K1MA 3MX0A 1LGVA 3JV4B 1JRHI 4ZOAA 5HHXH 4CADA 3OHXB 3IGAB 3KPLA 4PBWD 3D3VD 2DQFB 1J5OH 1DQLH 4B53A 3V5HB 2C7UB 2BY1A 2EDEA 4MDIB 1TNNA 5AZEL 1JFQH 1A22B 4JRXB 3X11A 5ICYB 1FIEA 5DQJA 5C1MB 2EE9A 2H3NB 3LRSB 3NACL 4HD9A 4MX7B 4Y16D 2QR0A 2YD6A 1YC7A 3ZLQC 4WY7L 3H42H 1BVZA 1A5FH 1EUTA 3TWCL 5EBLA 1HXYB 3SE4A 5C6WH 1TJHL 4A2LA 1MAMH 5CZXD 1YNTA 3P11H 3PGFH 3BP7A 4JO1H 4X7DC 5HYJD 4Y16C 4JPIB 3SKJH 4KXZI 2AV1B 5FUCC 2R8SL 2H1PH 1DUZB 2X10A 3TJHD 1YQVH 5GS0H 1CQYA 3ZO0A 4XCYA 5CZXC 1E4KA 1IM9B 4NUJB 4FQJH 5EFIB 4KMQA 5F7EH 4NQCB 1IQDA 3FRUB 4E41E 5GRJH 4KJYA 4KKBD 4OD1L 2CXKA 3TJHC 1E6JL 2WUBH 4Y5VB 4TNWK 3CSGA 1G9MH 4OFDA 3VI3E 3ZE2F 5SWQA 3V4VL 3BX7C 3MLWL 1P2CB 3IKKA 4X6BB 5FUZL 4RGOL 1Q9OB 3EOYG 5ADOL 4KKBC 1RFDL 3IXTA 3MRDA 5DEGB 5E56A 3O4LA 1KC5L 4OZHA 2EDJA 1TVHB 2IQ9H 5J3HD 3ULUD 5H8DA 1U6AL 1BQLL 3EO1B 1PFCA 1IC4L 1V3KA 4OIBA 5DJAA 5CD5C 2W65A 4F15C 1P7QB 2DJ4A 3NA9L 1WC7A 2CK0H 2DQUH 1NMCC 4Q58C 1DDHB 4P2RE 5J3HC 1F2XK 3ULUC 2I07A 3SDXF 1AQDA 3CVIH 3NZ8A 3X14B 5I17A 1IKFL 3GJFB 1K8IB 5IFHH 1MRDL 3FFCA 4HUWB 4LLDA 1MEXH 4Z6AT 2ZZUT 1CIUA 4PLOB 2F15A 1MFDH 2G9HB 1IZKA 1ZLVH 4EZMA 4PJEA 4KQ3H 1I7RA 5JQ6L 3E0GA 5CEZE 3MRIA 2EDDA 1A3RL 4HZLB 4G9FB 4KRMB 3QWOB 2C1PB 1MY5A 4OZFA 3P4OA 1MUJB 3WIIH 4RSVA 3LMJH 1UM6L 3BKJL 2E27H 4LSDA 3DURA 2LVEA 2NLJB 5ICXA 4JN2B 3OPZH 5GGTA 3TPUA 1HKLL 1BPVA 1F6FB 1A9BB 3AY4A 1I7UB 3PQYE 1FC1A 3QNZB 3CLFL 5CP7B 4EQ2A 4RWYL 4MNGA 2YPKA 3S37X 3EOTL 3MNVA 3DX9A 3P4LA 4H5SA 3MNWB 3P4NA 5J4MA 1LILA 2XN9D 1OAUL 2VLRE 1U8OB 4XB7A 1QBLL 2XWTB 3L1OH 4FQXB 4MD5B 4R4ND 4GBXD 3FN0L 2P7TA 3QDMD 1AGBB 3BGMA 3ES6B 2QQKH 4JAMA 4JREC 3K3QA 1NUNB 5IW6A 4IDJL 2YN5A 2EDHA 3OX8B 1IEBB 5EZIH 4R4NC 4GBXC 2PXYB 5CEZH 2D0HA 1ZHKB 5KW9H 1FGVH 3ARPA 3SDYH 2HN7B 5HGDB 4XBPB 4AMKL 1BFTA 1X5HA 5EUKB 4P0DA 4YDLB 1SBSH 1IC7L 4EI5D 1ACYH 1YEJL 4XPBH 4U1NB 4CN1A 1CQKA 3B9KB 4HJ0D 1KULA 5EA0H 1BLNB 3PJSB 3U6RA 1ZTXL 3DVNB 3MBEA 4M4PA 4YO0B 4FFVD 4KY1L 5F97E 3Q6GH 2EDWA 1Y18A 1XF4B 2BDNH 5IMKA 4EI5C 5IWLA 3SY0B 3AS1A 3DO7B 4HJ0C 3RTQB 1G6VK 3W0WD 1AY1H 2UUDH 1QRNA 5D1QD 4FFVC 2NY7H 5CILL 3OKKA 1VKXB 3CFCL 2IH1B 2VDPH 1AO7D 3I02A 1TIUA 5EZJB 5HGAB 4DKFL 4PRID 3T2NH 5LGJB 1ZK9A 5E7FA 4ODTL 5DHVH 1QBML 5INDA 5C7XL 1WWBX 5D1QC 4S1SH 5HDBF 4I4WA 1R5WB 3QXDB 5F21B 5HBBA 1VEMA 4PJXA 3AROA 4XTRD 1F2QA 3FO2A 1ACZA 4LHUA 4Y19B 5H35A 2FEEI 4JY4B 5AZEH 4LKCA 1BZ7A 1KB9J 4KU1A 4KJQD 1VGKB 4J4PA 5C9JA 2BSED 4WEMB 1F3RB 3NACH 5AZ2L 4XTRC 5C09B 4EXPX 4HLZH 1MCJA 5C0JA 5FHBL 5F9DC 1I3VA 3IDJA 3P40A 4WY7H 4A2MA 3QCVL 4Q74A 5EO0B 3TWCH 2BZDA 2W07A 1TJHH 1HSAA 4KJQC 1UFUA 4ZO8A 3UJTL 4CNIB 4F2MA 1G7MB 5HVFB 3LH2L 2HTKD 3O41B 1T0MB 1YEEL 1TMCB 3G5ZB 1DANU 1HILA 4I18C 3NFNB 2ZUUA 4KRPB 1YEIL 5DJ8A 3WUZA 4Z7WE 2X4UB 1II4E 1UM4L 5L6YL 1RZ8B 1U8KB 5DYOB 2BVPA 2HTKC 4HFUL 3BP4B 4OD1H 1QSVA 2OL3A 3NGBC 1GCFA 1NAMA 1IM3A 1AD9A 1YDPA 1KCUL 3V4VH 4X98A 3MLWH 4LLWA 5FUZH 4RGOH 5ADOH 1J87A 1RFDH 3NPZB 5C0EA 3MREA 5D2LB 4ZPVA 5CBAA 4NQXA 4AQOA 3VFGL 5FOBA 2MQCA 4NFDA 3ABZA 4GG6F 1KC5H 2CLVA 3QUZA 1U6AH 1BQLH 5LG1A 3RI5K 4OT1L 5D1XB 3ISWA 4ZUWA 3LKQA 3WDHA 1XAUA 2DWEB 3NA9H 2F9BT 4LCWA 3QISA 3ZE0E 4JGJA 4YHOH 4R0LB 5KANG 1IKFH 4WHYG 3K8LA 3LKOA 4OFYA 5IK3A 1JRHH 1MRDH 3MUGA 4BFEA 4HG4K 3RL1B 1GAFL 4JFOA 1I8MA 3N1FC 3STBA 3VCLB 3BH8A 5FAAA 1ZKAA 4JFYA 3BPCB 6FABH 5FA3B 1T1XA 5JQ6H 5FGRA 5A1AA 4OCYL 4YHML 1A3RH 2Q6WB 5C0GA 4OTXL 3IDXL 4JLRB 5TF0A 2QSTA 2WWKT 1UM6H 4KJWD 3BKJH 4WI2A 4PGDB 3MROA 1MWAL 1PW3A 2UV3A 2PYED 1J0YA 1HKLH 3O8XA 2N7BA 3KVQA 1A4KB 4KXZH 1P4BL 3CVHL 3WSQL 3GNML 3CLFH 4RWYH 4WNQB 2R2CA 3QT2A 3EOTH 3MYJA 3FJTA 3GMOB 2PTUA 4HUXA 1X6LA 1QD0A 1YQ2A 1OAUH 4NCDA 3BGAA 4G6JH 1QBLH 1ND0A 4JZOA 3T4AB 5HYSA 4CGTA 1WJ3A 3FN0H 4CVWA 2VXUH 1IGYB 3NIDF 3LQAL 5FM5M 2R15A 3L9RB 2V5MA 2RFXB 5C0AA 1QVOB 4IDJH 1EXUA 3AUVA 3K4AA 5FO9B 4WI9A 5E1HB 3QFDB 3BDXA 4FQ2H 1FFQA 1S9KC 2AKRA 1GC1L 2JCCB 4AMKH 3S96B 1SY6A 1XGRB 4NRXB 2X05A 1IC7H 3GMRA 1YEJH 4PFEA 4TSAL 1PKQE 2Q86A 1N0LA 1RK1B 3HE6A 3MODL 3IJHB 1ZTXH 2QHRL 4QRSA 3EOBA 1MFAL 5IMOB 4X6EB 1MCHA 2CIIA 4F7CB 4UILL 4YK4C 3RHWK 5HVHB 3CUPA 5FDWB 4A6YA 3X12B 2OCFD 3HG1E 2A9NH 5JMOC 3G6JF 1CWVA 2I24N 2XTJE 4N0FB 4OV5A 5CILH 4HC1A 4OQTL 4LLMB 4DKFH 2AS5M 1TZGL 1KYOJ 4UUJA 5GS1C 4UOW0 5B21A 4AG4L 5EBGA 3VU2A 3L6FA 4W4OA 4X6CE 3VH8G 1QBMH 3VH8B 1IILE 5C7XH 2KH2B 1FZJB 1AI1L 3MCKA 4S1RH 5TGBB 4Q6IA 4Y8DC 1EIBA 4W6YB 1KIRB 5DDHB 3OXRB 3BMWA 3VWKB 1J8HE 1X4YA 3WN5B 1BIIB 2Y5TB 2OSLB 3TVMB 3W2DL 2GCYA 1N2RA 3MRJB 1WUNT 2GJ6A 1E4XL 2X41A 3DVGA 5JDSA 5IJKA 4CRPA 1W72B 1Q9LB 5AZ2H 2NY4D 4ZSOE 5I1DB 5FHBH 2F5AL 4PJBA 5IROC 3QCVH 5JZ7D 4H26A 4OCNC 3NCMA 4UQ2A 4E0RA 2BJML 1GYAA 2XIDA 1KV3A 3IDIB 3UJTH 2AK4B 1IGTA 3ALXA 5BXFB 2NY4C 2V5RA 2CLZA 3ZE1E 1CIDA 5FM4A 4LSVL 1AE6L 4O9HL 3LH2H 5F7WC 3MOBL 5JZ7C 1YEEH 2IH3A 1FAKT 3QHZL 1FL6B 1ROWA 1FVEA 1YEIH 2R29L 3NCFB 2VDRL 3E3QC 2EDQA 4M93C 1XGYL 5E8DL 2NTFA 4WVRA 4LGPB 1UM4H 5J1TC 3UJJL 5L6YH 3PWPB 4HFUH 4OZIB 2KQNA 3SJVE 4WHTA 2PR4L 3MV9D 2R1WA 1IAII 4AYFA 1KCUH 1M05B 2UYLB 4RMWA 5ILTH 3C60A 2ARJB 5F89B 5I8OL 5EOCJ 1HH9A 4LDOB 3RAJL 3T0XA 3JTSB 4ODHL 4G7VL 4HUKB 1QP1A 3AM8C 5ISZE 1K4CB 3VFGH 3KJ4C 3T0EA 4XBGA 3VI3F 5E6ID 4PJDE 2VN7A 1U58B 2G75B 3GMNA 4MB3A 4LNVA 1OP5K 1OY3B 5ESAA 2EDXA 5IIEA 3BDYL 1MREH 2X9WA 4O02L 2CKBA 5E6IC 2IFFL 4P49A 2CLRB 3VXSB 4LQFL 1NMBH 4ORGA 3NN8B 4DW2L 1NC2B 3PNWB 4FXGA 3PP3H 1J0JA 2PTTA 2PW2B 4G8FB 1JGDA 3MV7D 4UQ3A 1A02N 1SJEA 43CAB 3ARED 1I9JL 4GRWE 5F7MC 4OCYH 4UV4H 4YHMH 4PJHF 5JORB 5D6CA 2D9CA 2X4TA 1R5VA 4NN7B 2Z35B 4OTXH 1T5XB 2BX5A 1CG9A 3IDXH 4YDVA 5L88H 4XMKL 1OL0A 5D9SB 3RGVD 5JQHC 2G2RA 4XAWL 4QYOB 4LSUL 1TCMA 4IRSD 1MWAH 3AREC 4Z95L 4N0UE 5C07D 5DMKB 3EOAB 4JRWA 3MLXL 4MMZC 1U2HA 1LEGB 4J6RL 1C12B 5B4MD 1U91A 2VLKA 1DVFD 3RGVC 1P4BH 3WSQH 1NGXA 4KVNL 3FO0L 3GNMH 3VXUD 1YMME 3LN5A 4IRSC 4P59L 3BO8A 5I75B 4NJ9L 1NC4D 4P57B 4C54A 4P46A 3M45A 3VFRA 4BJLA 3S36X 3BH9B 4Y0GA 1QKZL 4WTZG 5I74C 5B4MC 4BELD 1HSBA 4NNPL 1DVFC 1UWGL 4HUUA 4JFFA 5EU6B 5KS9B 3QUXD 4GRMB 1K2DA 4RBPK 3LQAH 2HJKA 5GGTL 4MD0A 2AERT 3FO9A 1P5UA 3SGKA 1KIUA 1IAIL 3DGGB 3HZYA 4HDIA 4YDJB 3UTTA 5DS8B 2FWOB 4HK0A 2P5WE 5F8RC 3QULB 1ETZA 4GRWH 1EMTL 3QUXC 4WWKB 1NGWB 2VL5A 4O51B 4ZPTB 1GC1H 2R0ZL 5D7IB 3TA3A 3MV8D 4HSQA 4L8SB 3B6SA 2Y6SD 4MQXD 1WICA 4TSAH 1FNHA 3RUGF 3MODH 3GMQA 4WHCA 1HEZB 2QHRH 2ADIA 1EVUA 4MNQD 2AK1L 1MFAH 4MNHB 1A6AA 4UILH 4NN5B 2I25N 4JFEA 2Y6SC 4L3AA 3U79A 3ALWA 2KBGA 4NO2B 1NFDB 2IAND 3JSSA 4FQHB 1QQDB 1KN2L 4JFDD 1S7RB 4FFWD 1T1WA 4O00A 2PETA 3PABB 5ANMB 4OQTH 4U2ZA 3LEYL 2HKFL 2VWEC 1TZGH 3MRBA 4AG4H 1ONQA 4MD4B 3OR6A 5EULV 3HPJB 1O5DT 4N1EA 4HX1A 1LE9B 1F8TL 1JTTA 3R06A 4XPAL 5B38A 1AI1H 3E6FB 4FFWC 5EPMA 1RJZA 4YDIL 3SO5A 4XPTH 4PY7A 3S3JA 1K85A 3HR5B 1QLEL 4L9LB 4F7TB 4DEPC 5ITFB 1R3IL 4GRLA 3SBWC 1BFOA 3W2DH 3HN3A 5BW7C 4AIZA 1W0WB 1R24B 3MFFB 3PXHA 4XC3L 4DGVL 3QDHA 2YD3A 3D0LA 2F5AH 4UOJA 4N68A 2YSSA 5I8CB 1OCWL 2BJMH 5H94B 4P3CL 3AU1B 1MFNA 5E08L 4LSVH 1AE6H 4O9HH 1E4JA 4GXVL 2ZNWA 3MOBH 5FO8A 4YHKL 5DGQA 2MQ0A 3SKMB 2R29H 1IAOB 4ETQB 4P2OD 2VDRH 5C0BD 4PYHA 1XGYH 2R23B 5E8DH 4NQDB 4IRZL 5F6HJ 4OZHE 3UJJH 3IDNB 4M1GL 5ICZA 3B5GA 1LO4L 5I1AB 1S7UB 3ROLB 1C5BL 2PR4H 3TLRA 5KJRL 4P2OC 3D25A 5BQ7A 2WQ8A 1I4FA 3WFHA 1M71A 4H1LG 5I8OH 2IPTL 1KPRA 2OMBA 3RAJH 1U3HD 4ODHH 1G7LA 2IWGA 4HFWB 3ARGD 1T6WA 4G7VH 3FFCE 5ERWB 3RY6C 4Q6YA 1DLHA 3K1DA 3MRHA 4NN6B 3IJSB 3IU4L 5FA4B 2DWDA 5DFVD 2CDFB 3LD8B 3LV3B 5CWSA 3KYMA 1U3HC 2OL3L 3F12B 3PHOA 5CP3A 5JMRA 2I27N 2H8PB 3ARGC 3KPRD 3BDYH 4U3HA 1NAML 1X5GA 3OKEA 3WUWG 4K9EC 1N4XL 4KZDL 3OJDB 3WUWB 5T1DH 2IFFH 3BZFB 4LQFH 5DFVC 2AXFA 5HHOB 5GPRA 4DW2H 3V7MA 1JNHA 2XFXA 4QRQB 43C9B 1UVQA 1DQTA 1N59B 1NDMB 2HVKA 3TBYA 3EW3B 5ACZA 1ZA3B 4TSBL 4IJ3B 3N06B 4QRPB 2C3XA 1G9MC 3ZE0F 1I9JH 4QRTB 1FZOA 5JUEL 5SWZE 3HPLB 5I30L 1A4JA 4QXTB 3CC5B 5DK3A 4XMKH 1T6VN 5JIKA 4JJ5A 5JHDB 4OF3A 2YPLB 3H6JA 4LSUH 5T1LD 4Z95H 2UZIL 1I8KB 2DYPA 3MLXH 3VG9B 4J6RH 3FT2A 1FJ1B 3RWDB 1GRWA 1MCOL 1OWRM 3RGHA 4LBEB 3DXAA 4KVNH 3FO0H 3OKLA 5ADPL 3QQ3B 4P59H 3S3SA 1CGVA 4NJ9H 4Y88A 2FSEB 3VA2C 4Y4HB 4OZFH 4Z77B 1QKZH 2BVQA 4NNPH 1UWGH 4KKLD 4X7EC 4PRPA 4GS7B 3BEWB 4YBLC 1A47A 4AIXA 5BV7C 5J9PA 5GGTH 3VFVB 4ZNEA 1IAIH 3ETBF 3GUTA 2H6PB 4CAGA 2MHAA 3ULVL 4JFHE 2WBWB 3N0PB 3DUUB 4UIMB 5FOJA 5IB3B 1GGCL 2ORBL 1RURL 4KKLC 1EMTH 2VZ3A 4Y4FA 2UZXB 4XMPL 3QNXB 1QRNE 2R0ZH 4N1CA 5HHNB 4U1IB 3CXHK 5HDLA 4R4BB 3C5SB 4W6XB 4DFHA 1I1YA 4IS6A 4CVXB 3DYOA 1MLCA 4JZJB 3EJJX 5HGBB 3TN0A 4P2RD 1EHLL 2J6EA 2AK1H 4JDTL 2XKNB 5F9WC 2VXSL 5J0BA 1R5IA 3E8UL 2P24A 4MA1C 5EU5A 3D0VB 2A6DB 4PJXE 4IOFD 3WS3B 1A3LL 4QRUB 2HWZL 1AXTL 1MCKA 5GJSL 3SEPA 1FL3A 2J8HA 4MA3A 5KVFL 3S7GA 1SY6L 4GUPB 3LEYH 4PB9H 2HKFH 3TIEA 4IRJD 3RL2B 1KPUB 3S36L 4X6FA 4OF5A 3UPRA 5EUOB 4IOFC 2APXA 4HKBB 4RWHA 5CHNB 1F8TH 4XPAH 1CD1B 2X70A 3DROB 4YDIH 1WAAF 5JO5B 1G7JA 1BZ9B 1NBZA 4A6YL 1DSFL 4IRJC 2DBJA 4JKPL 1QLEH 2WIIB 5J13B 1KTDB 4F57L 1MCSA