1T6WA

Rational design of a calcium-binding adhesion protein nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
b'RDSGTVWGALGHGIDLDIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein XP_346638
molecule tags Metal binding protein
source organism Rattus norvegicus
publication title Design of a calcium-binding protein with desired structure in a cell adhesion molecule.
pubmed doi rcsb
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6wA00
3QUMA 3S3JA 1Y18B 1U42A 1MEXH 5DJAA 2BVUA 1TCRA 5I19H 4M6AA 4BFGA 2VDQH 4XCFH 3X12A 5F1NA 1E4JA 2X1PA 5DQJB 3SGDI 1KIQA 3IU3A 2DBJA 3WUZA 3BZ4B 2A9MH 4MHHI 1DQJB 4D0CA 1JK8B 1ADQL 4FQXD 4KHXH 1CFVH 5CKAA 4YNYB 1EEZA 1L7TH 1WGOA 3BDYH 4K7PY 3CGTA 1U36A 3PL6B 1VGEL 4XZUA 4D0BB 1MCNA 4KMQA 1ORSA 2GW5A 3RGVD 2VH5L 1TTGA 4MS8D 4AIXA 3TESA 3NACL 1QR4A 4HW6A 1A9EA 2FBJH 1NUDA 3V6OE 2WM0A 3WV0A 5T5NG 1KBGL 4JHBA 3V6FA 3U4BL 2IANE 3MV7A 3NCJL 4OSUH 3MR9A 4OUUA 4LLVB 3VXUA 2CKBL 3M17A 4JN1L 1S78D 2BFVL 2FD6L 4YX2H 3HG1E 3WKMH 3JV6A 1WFNA 3IDXL 1BEYH 3QPXL 1E6JL 4WJ5B 1A2YB 3QUYB 4KRPC 4D9RE 5D70H 3N1PC 1NBQA 3Q2CA 4KJPD 3DV6B 2XV6B 3MTRA 3MUY1 4D3CH 3MLVL 5D1XC 1R3JB 5LJYH 3LKPA 4YAQB 5CZVH 1P7QB 1BOYA 4ODHL 4HIHB 3MYJA 1LO4L 1JTPA 5TDNA 5GIRA 1IGJB 1NGZA 5B38G 1OD7A 5I1EH 1AGFA 4OQ1A 4BSWA 4MAYD 5DLML 2SEBA 4GG8A 1JNLH 3T8XA 5H8DA 5C0RL 3PP3H 2HVJB 3OAYH 2YD1A 1NGXB 1KG0B 2XWBA 1ADQA 2VDLL 1KYOK 3VMOA 3F8UB 1GYAA 1CDCA 2Z8VC 4QOKD 3MLSL 2AJXL 4WW1A 4O5LH 1ZGLA 1A6TA 3OJVC 4MXQD 1IGTA 1JTTA 2I9TB 1CT8B 1F4WL 1BM3H 1OF2B 4IIQC 5T1MB 5D7LD 4TNWK 4OZHB 5F71A 1HINL 3KLSA 3SDAB 3RIFK 4RFEA 5TF1L 2EEBA 3TNNB 1YEKL 5A3IC 3GMLA 3QA3A 4YUEL 3VXPB 2X4SA 2IBZX 4O00A 1RUQH 2JELH 5C9JB 1MJ7L 4UAOB 1BJMA 3RWEA 3ULVE 4JREB 4YLQT 3RWDA 3V52L 3OG4B 4GXUM 4HUKB 4F2MB 1NFIA 5GRZA 2CKBH 4OZFA 1FZMB 2P7TA 3VFTB 5I73B 1DBKL 3O4LA 4Y5YC 3T09A 4DKEH 4IOIB 5J9PA 2J8UB 4P59H 2UY7A 1KB9J 2NY4B 5FKPA 2FEDD 4JJHA 3LZFH 1ZLSH 1QFWH 1J1PL 4MQSB 3ZTJH 4PP1C 3ZYOA 4X6DA 3OPZH 3BZFA 4X99A 3GKZA 1HWHB 5D2NE 5DA0B 3WD5H 2VLRA 3SKUD 1RZJL 3DTXA 1IT9H 1NFDB 1RURH 3BPLC 2GK0B 4P99A 4MDJB 1FFNA 5BCAA 1CQYA 4Q9CA 5E8NB 1DVFA 1RAMA 1U3HD 1MJJB 3RGVC 4W6XB 2E6QA 5KSBF 3M1BA 1UEYA 5GHWH 4OLYH 1IGCL 3RAJL 2GITA 3CFCL 3W82A 4O9HL 3RZCB 3S5LB 3PWNB 3ZE2F 1BPVA 4PY8J 2NY5H 4OCWL 5JXAL 1Y18A 4W4OC 3S96A 4QGTA 3QB7C 3MXVL 3I6LE 1RZFH 5IJVA 4XXDA 3KPQA 3P9MB 3T65B 5I8OL 1F6AA 5LKNA 1JYNA 1CFSB 2EZ0C 3D2UD 2A6IB 4HZLA 1RZ7L 2CD0A 2CLRB 2WV3A 4P3DB 5GGTH 5JQHC 1PX3A 3QDJD 4UTBL 4OBSA 3MRQA 3GDBA 3CVHA 3K80A 2GUOB 4PJXA 5DUPH 2YPKB 3IB4A 3UTPE 4PJEF 1ES0A 2P8PB 2XWJB 3AB0B 4G8EB 4RQQB 4O9HH 4G9FA 4LCWA 4DCQB 3T2NH 4PRHB 1F3JB 1UFUA 3PXJA 5DK0A 3ZKMD 5HHNB 4M3JA 4PY8I 4LLMA 3OB0K 1MVUB 5E0QA 1KBGH 2X4RA 4OCYL 4Z7UE 5E9DB 2AQ3A 3MV9B 4F57H 4XP4H 5DRXB 2VDMH 1XIWC 3IAPA 3SOBH 4BZ1H 4JFDA 4YXLH 3DMMB 1ZVHA 1ZHLA 3D9AH 4YDJA 2R8SL 3P4MB 4LMQI 4HUUA 3JWOH 2AJVH 2FLBT 2GTZB 2OSLA 5I1DB 5KANG 3QO0A 2M1KA 3DO7A 5I8EA 1S9XA 3AREC 3EOAA 2Y6SC 4MCYB 2WWKO 1MHEA 4AEIL 4ZPVA 1F3RB 2IWGA 4OCSH 2D03H 5E8OA 2YA1A 4X6BA 4UMGA 2CPCA 1RUAH 5CBAA 4TVPL 4YIQA 3HC4L 4IHOA 4YHZH 4W70A 2XOTA 1E27B 1T80A 5KG9B 1F90L 3V5HA 2Z4QB 4KKLC 3WHE0 4K7FA 1ZHNA 3L9RB 1EVTC 4UTAH 4GO6B 4MNQB 3G6JF 4KI5C 4RBPH 3QCTL 3B3IB 3FB5A 1N5AA 4I3GA 4MQTB 1QLRB 3MRMB 2V9TA 1EJOH 3VCLB 2MNUA 4OZFH 1W0YT 5IHZB 2FGWH 5DJCA 4NO3A 3VFWA 1EPFA 2HMID 2YWZA 4DVRL 5EWIH 3HAEH 1DR9A 1RHFA 4KTEH 5I75C 2NY4D 4K3EH 2Q3AA 3FN9A 5D71L 4OCSL 2OI9B 1ZWIB 3EOTL 1WITA 4I5BB 3T3MF 4WUKH 2XZQH 3QCUH 4WI9A 5ESQA 1A1OB 3B9AA 5L2KE 3FOMB 4WEBL 4DFHA 4FMKA 3TZVC 2AQ1A 5DRWB 1J18A 2B4CL 2JJWA 3DVNB 3QQ9C 2FZ3B 1QD0A 2VZSA 3ILQD 3KXFB 1INEH 4X9GA 3UTTE 1LO3L 2CIKA 3FFDA 5CP7B 3U30B 3MBEB 1I7TB 1ZWIA 2FJFA 3TBYA 3X14B 4ESKA 4RAVA 4YXLL 4L9LB 4UDTB 1B9ZA 4M5ZL 1SBSH 2A74B 1YEFL 5KN5B 2EYSA 2EE2A 1JGEB 4NO3B 3VFWB 3VFGH 4U1GC 5I1IL 2O5XH 3V6OC 2B5IB 4AL8L 3LAFA 4ZTPH 4FFVD 3UAJC 1D9KC 1UVQB 4NC2B 1JTOA 3MRJB 3K0WA 2R56H 4JZJB 5TJWK 3TZVD 4B41A 2XA8H 3U46A 1CFTA 3IXAA 4R2GB 4X5XA 4M93B 5IVXB 2YN5A 3O2DL 4P4KD 5EBLB 5TQ2L 5K9OB 4OGYH 3O8XD 5F9WC 5BJTB 1UJTA 3QIWC 1YN7A 3MLWL 3MJ9H 1KEGL 3U0TB 3DIFA 4LLDA 4MX7B 1MI5D 1XZ0A 2HMIC 1Y6KR 2DLHA 2FATH 3RNQA 4BZ2L 5D7LB 4OZIA 2XNAA 3U7WL 3EFDL 2A77H 1A14L 1IEBA 3VMPA 1DEEA 4PJAA 2WINB 1UJ3C 1VKXB 1MAKA 4DKFH 5C08B 3H9SB 3QRFM 5HI4D 4QOKE 1C5BL 3HMWH 4F15C 4JR9H 4MD4B 2FIKA 3LN9A 2NY3D 4L4VE 5TDPA 1PEZA 1XGUA 3SO3C 3MLUH 1VSCA 4JO2H 5L0QC 1F2XK 1LEKA 4P2QA 2HFGL 3ZKNC 3PABB 1JGLH 3D87B 3JWDC 5DVLA 4XH2A 3MRDA 5FO7A 5C9KA 3E6HB 1YQ2A 4WFED 4WUUE 1MRFL 3RVWD 3HZVA 1HYSC 4EIGB 4FS0A 4MA3A 4GS7C 5IMMA 2NR6D 4RIRB 1KEML 3DPBA 4Y4HA 5IBLC 4HXBL 3BSZL 5E99H 3MRHA 3CX5J 2VERN 1BJ8A 2XQBH 2EDEA 5L2KB 4FNLL 1JHTA 5DRNA 1HKLH 2DLEA 5GGVH 5IR1A 5IQ7H 2HH0L 4HKXA 2UV3A 5T5NF 3OR7A 5EIIA 1B0RA 1A1OA 5AYQA 2VSCA 1F6AB 2IGFH 4XMKL 4JFOA 3T1WA 2VN4A 5K33A 5C0DB 3ARTA 4QXGH 4OUUB 2IBGA 3ARFA 4OAWB 1AO7A 2ESVA 2R2BB 3V4UH 4XPHL 3ILPA 3CMOL 4NUGH 4BQBA 3TBSB 5D7JC 4OLVH 3AAZA 2OBGA 5KOVC 4H88H 4YQXH 5ERWB 4XMLH 5HHPB 3FQTB 4AG4L 5BS0B 2NW2B 4OCRH 1CN4A 1HQ4B 3HG1D 2OZ4A 3SQOH 3HE7C 1RMFH 1TQCC 3ULVH 4DOHB 4XVTH 5D7IB 4L4VA 3EW3B 1QRND 4AT6B 3DO3A 1B0GA 5I9QC 1AHWC 3QWOB 5CS7A 4M7LL 1DDHA 1A7OH 1VPOL 4HEPG 1IAIH 3V5HB 4Y5XB 2AK4D 3D69A 1JPGB 1KIQB 4U1KB 1RMFL 2G60H 3KPLB 5F89A 4UTAL 4YPJA 4KDTA 5M95B 4JPVH 4PJIE 4XP9L 3IYLW 5DDHA 1HSBB 1XR8A 2HRPL 3FQWB 3O0RL 4JVWA 4N5ED 4KZEL 1FYTD 1RIHL 1Q8MA 3DO7B 3LV3B 4LCUA 3QXVA 4LPXA 4CADB 4G42B 1G7PA 3QG7L 3T0BA 5KJRH 3HS0B 4AK1A 1LD9A 3NACH 2OR9H 2JCCE 3TIEB 2HFTA 5KVDL 5EZJA 1CGUA 4ZNEA 3O0RH 4IOFC 4XPTL 4YHZL 1QTYT 1R5VA 3H2WA 3W9DB 1HOCA 3CFJB 4FHBD 5CSGA 5I76B 5IVNA 4M6OL 1AP2B 1ACYL 2A6JA 2BNQA 3FTGA 5C07A 1J1XH 1T0MA 2J7LA 2Q1EA 3BQUA 5C9JA 1YEJL 1T4KA 3DVIA 4ZDHB 3UTPD 3KPPA 5GGUB 4CDHA 1X6LA 3MOAL 3MJ9A 4WTWA 4XVTL 1DVFD 1IKFH 2UVEA 5JNYA 4Y8AA 2V17L 2FBOJ 1CLCA 3QUZA 2E9WA 3E3QC 1X7QB 3VFVB 4CVUA 4MJID 1GGBL 4NFDA 3ORJA 4CN4A 1KTLA 5MEOA 2PN5A 5C09B 3BHBB 4WHDA 3S6CA 5DQ9B 2HP4A 4HLZG 1LDPL 3K8KA 3NCFB 3FT4A 2AP2A 1JRHI 4S0SD 2DQFA 2ZOLA 4UIKL 4EOWH 1MCOH 3T2NL 4FXLA 3RY6A 4ZO6A 1TQCB 1N0XL 3S88L 3DUHA 4GJTB 1JWSA 2P5WD 1VPOH 1CICB 4GXVH 4I2XE 4U6HB 5IW3A 1YEFH 1JVKA 3CK0L 4HJGB 5HPOA 1O0VA 4LLDB 4MX7A 3VGDA 4XP1L 2O61B 5GRJH 1MFCL 4FQXB 1EHAA 2B8OT 3DROA 1OAKL 2R4RL 2XRAH 3ARBD 1G6VK 1S9VA 1TZIB 3CDGA 4NQEA 1IZJA 2D2OA 3NH7L 4U49A 1HEZA 5JDSB 1MJJA 4LVNB 3DXAB 5E8NA 1CFTB 3IXAB 2GIYA 4ODSL 4MDJA 3MLXL 3GJFK 1MCCA 5DGQA 4UDUA 4GRWH 1LGVA 4XCYB 4KUZL 3MZTA 4PGEB 3BP7A 4XPGH 3RBSA 3U6RA 3L7EB 2VITA 2ZPKL 4O02H 3EDEA 2WBJC 4O51B 5C09D 1WUNT 3B2VH 3O4OC 1TTUA 5C0DA 4PJCF 1C12B 4NQCE 5L8KB 4YDKH 3L5IA 3LIZL 2VR9A 3SDDC 5I71B 3ABZA 2XXMB 3KPRA 1IM9D 1S8DA 3O2WL 1ZHKA 4MGXA 4NKIH 1MRCH 4OGAD 2OYPA 5E5RB 3PDDA 3A0OA 5IJKA 1HXMA 4D0BA 3WJLA 3QCTH 1C5DA 5IR1B 3SDCC 3I3EA 3BSZH 4YC2B 1RIVH 5FHBL 1FYTB 3VFMA 1CICD 1RU9H 4Q0XL 1XCTB 5EU7C 3WD5L 4P4KB 3ZKSD 4J2XA 2F74B 1KACB 2CDEB 4TSCL 3RNKA 4DN4L 1QSEA 4AEIH 5FUOH 5C8JB 3WIFB 1FZKB 1KF9B 1S7UB 1W0WA 3CFIC 2DIBA 4L3CB 2KQMA 1FAKT 1G0DA 3Q5TA 5E5MA 4U2ZA 5ISZA 2LV4A 2ZSWA 1YC8A 3RU8L 2BC4A 4XMPH 3OKYA 2JIXD 4MD5B 4POZC 4XP1H 5ADOH 5C08A 4ZYKA 2ZCLL 5HI3C 2FJHA 4M5ZH 3GZKA 4Y4FB 3RVTC 3D85D 4DEPB 2ADGA 3RX5A 1NCDH 4ISVA 3X13B 4HJGA 1TQBC 1NGXA 1OAYL 2R0LL 2CRMA 3GSOB 4U6XB 3C8DA 4C4KT 3VXMD 4GG6E 2X4QB 2AGJH 3V5KA 2DQJL 3WS6C 1L0YA 1OGAA 3AFLA 5F9JB 5CEZL 4PYHA 1U41A 1OAXL 1G9MC 1VERA 2ADGB 3F12A 5DJZB 1P7QA 4NM8H 3O45B 1GIGL 5D2NB 4PS4H 4ZYKB 1Z5LA 4NSKB 1YECH 5CJ5A 4GQ9L 4OZ4A 1X5JA 3P11L 1CI5A 4HXAL 4OZGF 1BQUA 2ZSWB 3VFVA 1AFVH 4PJ9C 2H32H 5CHNB 4DWHA 1A6VH 3D39E 2IH1B 4GT7A 4OCYH 1ITBB 5CILL 1OD9A 5JHDE 1MFEH 1DQMH 4ERSH 1FC2D 3EZ8A 2FIRT 3V0WL 1M7DA 3L3KB 4OLWL 4DCQA 4UNUA 1Z0MA 4P23B 3DSNA 1N6QL 3CLFH 3FFDB 5CP7A 2FEEI 1X5KA 2HT3D 3S3PA 2FHBA 1FZOA 3X3GH 2F8OA 5FYJD 3L1OL 4IRSC 3AREB 3VXSB 2J8UF 5E8EB 4J3UA 1JZ8A 4P48A 4I5BA 5HGHA 1X5LA 2PUQT 3EO1A 3SE9L 1G7PB 2EIEA 3GKWH 3RA7H 4KGJA 1ORQB 2A38A 5KSAB 4Z0XB 3V0VB 2FNBA 1DQTA 1H8SA 2OCFD 2CIIA 2APTA 3OKOB 4KK5C 4YXHL 3KPSE 4M6MH 4OT1L 5F1SA 5MERB 5IWLC 3AXLB 4NO0D 1EHLH 5HDBF 5ISZE 3JV4A 4HC1A 3BEVB 3RI5F 5HYIA 4O4YH 4FZEH 2IANB 3FRUB 1U8MA 2DLFL 3VXMB 4HD9A 3TO4B 4PJBF 4A2LA 4Z7VF 15C8H 3I6GB 5FK9B 2DBLL 1FVDB 3V5DB 1T22A 4XX1G 2R1WA 4LIQL 1XGPB 3OTTA 4LSTH 4C54A 3NABL 4R8WH 3S4SA 1DBBH 1G9NL 2GJ6E 3DROB 5KSVB 3QO1A 3V0WH 3F7VA 3UYRH 2BY0A 4NUGL 5I8CA 2P5EA 3QXAB 4PREA 1RUQL 4DTGL 2FH6A 1WLHA 4QCIB 4NO5A 3TPUA 2ZJSH 4E41B 2QHRL 1WZLA 1KLFA 2AAVA 3IFNL 3R1GH 3GHEL 4HPYL 1M7IA 1CG9A 2BVPB 4CDGC 5E6ZA 3ULUF 2R8SH 1TVBB 3F7YA 3R8QA 3FQNB 2G5BA 3E3QE 5GRJL 35C8L 4NO2B 5GGVL 3RX8A 5IFJA 1QR1B 1RZKH 4J23A 3FFCB 3VXRA 5IQ9A 5DQ9A 2J8HA 2ZSVB 3BEWB 1FZMA 3HN3A 4PJEA 4HGMA 4LCYB 2Q76A 4P9ML 4I0CC 3MRHB 3TN0D 1DLHA 2X2YA 2C5DC 5KANI 5L9DH 4LLMB 3F12B 5DJZA 5IJKC 1NGQH 5K9QG 3VXUE 4QHKJ 4AH2A 1MAJA 5EU4B 2PYFB 1UZ6F 3S9DB 1MRDH 2F58H 5IG7A 3C9NB 3PGCB 3SDAA 5FYKH 1YY8B 5IB1B 1CFNB 5T5FH 4ZUVB 5L2JB 4L8CA 4IRJA 3TV3H 5FM4A 2NLJB 5KTEH 3MLTB 4JGJA 4U1IA 3W9DA 4AQ1B 1PLGL 1G7HB 1EERB 3QZWB 4LGPB 3L5XL 4AIZB 2JJVA 1CFSA 5EC1B 4I48A 3MGTB 2ZG3A 1JV5A 1NCWH 5DC4B 4NUJB 3K2UL 3X11B 2E3VA 1SEQH 5DD5H 1CE1L 1AQDB 2NZIA 3GBMH 1W72L 4HH9A 4JJ5A 4BKLB 3KPRE 1J5OH 2P5WE 1XZ0B 4WUKL 1GOGA 1KEGH 4I2XB 1HHKB 2WANA 1EEUA 1IGJA 5F89B 2CDEA 5LGKA 4HIHA 5KS9E 2OJEA 3D69B 2PYEB 5EOTB 4X6CA 3I85A 3UJJL 4KQ3L 4N0YH 3V2AR 1N4XL 2VXSH 2BXYA 2LTQB 3B2UD 4HG4K 3VXQB 3G6DL 5D7IA 4LASH 1JYWA 2VQTA 5SWSE 2Z8RA 3KXFD 3TT3H 5IW1B 1IEHA 4WU5B 4FP8L 4WO4D 4K94H 5L6YL 2FEEL 4LEOB 2BJMH 1AJ7L 5I1CH 1F4WH 1CICC 2EYTA 4NQDD 1X5GA 2DYPA 3FFCD 3QSKB 3TNMA 4MWFB 1FFPA 2Y9RT 1YYMH 3OV6A 4F57L 3AM8A 4N0CC 3U7WH 1EGJA 2Y07L 4WY7H 1F5WA 4L4JA 5C0GA 3CCHB 1J0YA 4P59L 1W72H 4UDTA 4QHNA 1NSNL 4N68A 2FJFB 5KVEH 1B90A 4XP9H 4GRWF 4OLZL 2ZUVA 1IILE 3DETD 1GAFL 4R6UA 4GKNA 3EYFB 1T04A 3D5OF 5FUCE 1R0AL 4KJQD 2P8LA 5H2BB 1P6FA 1OB1A 3CNKA 4F2MA 4FQQA 2EDBA 3PGFL 4GSDH 3RWEB 3PDOB 2W9EL 1YEEL 3VGAB 1A6WH 1P84K 2IALB 4YHPB 5BV7B 1MIMH 5EUKA 5GXBB 1I1AB 4PGBB 1RUKH 5MEPA 2L7JA 2OTUA 4KMLB 4BQ6A 4XI5D 3PIQA 5JW4R 2A9NL 2X89D 4M61A 2APWA 5T1MA 2AW2A 4NJAH 3LRGA 5SX5K 1F45A 3OKEA 2ZOLB 3O3DA 1FNAA 4K3JL 2ATPB 5IWLA 3MACL 2IPUG 3PXHA 2D31A 1P7HL 4QWWC 2NX5A 2AEIT 5GS0D 1ODAA 5C0AD 5JW5A 4K3DL 4GBXC 1YEHL 3VRLE 2Y07H 5C09A 4LSPL 4R90H 5C3LD 3RJQB 5HJ3A 2DL2A 3CK0H 4JY5L 3LEXA 1P1ZB 3T8XB 1U8OA 2GCYB 5B3JE 4Z5RB 3WL9A 4MJ2A 4UINL 1WZ1L 1DN0B 1JWMB 3HLAB 3P9LA 4LASL 4YXHH 3C5ZA 1KCSH 3SBWC 3AY4C 3DIFB 2RGSA 2D4FA 5CJOH 3OX8B 2VLKB 4HHAA 1P9MA 1FBIL 2AXFA 4UT9L 4D0DA 1CFQB 1QKZH 4KDTC 1GPOH 4M43L 5EB9A 4Y4FC 1Z0NA 4M1CC 5F8RC 5ALBL 1CTOA 4BJLA 1XGRA 1ITCA 4IRJD 4KPHL 4P2OD 4WJ5A 4ELKA 2V7HB 5E00B 5IFJB 4OIAA 5A40E 5D7LE 3TYGH 1CZ8L 2YEZB 4NKOB 2YD3A 3ULUD 4URTB 2OJZH 1FO0B 3CZFA 5LBSL 2OMBA 4PRHA 4DGYL 4RQQA 3H3PH 3MO1A 3HNVH 1GGCH 4PJXF 1JN6A 1ES0B 2P8PA 5ISZD 1BGXH 2EDOA 5F6IB 1UJ3A 2R4SL 2WUCH 3CVHB 3BT2L 3G6JB 3MNWB 1CBVH 1PJ9A 4NN6C 3VRIA 3LB6D 4NQUA 2MPAH 2R1WB 2EXWC 5IBUG 5JTWA 1WBZB 4KC3B 4X83A 3VH8A 2ZUXA 5CEYB 1B0GB 3EO0B 5ALBH 2P8MB 3IS0X 2WQRA 4L4VB 3KPQB 3P9MA 4OCLC 3QDMD 1YNTA 2DM2A 2YSSA 3OJ2C 4GAJH 1PZ5A 5MP6L 1MQ8A 3WS3A 4MAYA 1TDQA 3FO0H 1JMXA 1PLGH 4HG4J 4PLJD 5CJOL 2R1YB 4ODUA 5E6IC 4PLNC 5GRUL 1BOGA 3V8OA 2H8PB 1NAMH 2NW3A 3WXVL 3HC3L 3X11A 3ARFB 2QJDA 1MNUH 2F53B 5J13B 3GUTB 1OPGH 4LSSH 4HBQA 5B39G 5BOPA 3FB6A 2ZCHH 1WEJL 5IW6A 3OR7B 5EPMA 4IRSD 4K7FB 3SDCB 3N1FC 5GS2H 5LQBL 4G9DA 1FVCB 1JPSH 4JPKH 4TNVF 5DD1L 2N7AA 4UQ2A 2E8YA 3STLB 2QQLH 3VFRB 4WV1B 2GTWB 3PQYA 4NIKB 1JYVA 3ZSSA 1I9JH 3MGOA 4ETYA 4HPOH 1RIUH 4MA3B 3LOWA 3SKMA 1HZHL 1MSPA 5FYLD 5GRUH 1S9XB 1FH5H 2P1YA 3P73A 3U30C 4TTGA 3IFLH 4P46A 4H1LB 2NY0B 3GK8H 2X89A 5HPMB 1VFAA 3HMXH 4UQ3A 4JZOB 2X4NB 1PQZB 1G1YA 2BERA 5C2BH 1XCQA 1Z5LB 4K2UL 4NSKA 3QNYA 4OFKA 4WDIA 4YPGA 5FM5O 2BCKA 5F7YC 2R0ZH 3O9WA 1U8KB 4WFGE 5C0CE 5LGJA 5C86A 2CR6A 3IFNH 4ZUUA 2R29H 2IPKA 4UILH 1VDGA 5DO2C 4YDVB 3T2QA 1C5CL 1I3RB 4KY1H 4R4BA 4C59B 5DEGA 1G7LA 3L6FB 3GMOB 4NO5B 2JB6B 3MMEA 3TPUB 4G9FB 4E41A 4JEGB 1OW0C 4Y5VC 3WJJA 1FG2B 1MI5A 4X98B 3PWLB 5KVGL 2HVKB 3QXTA 1JGUL 1KCUH 4JFXB 3V8CA 1RIVL 4O2FB 1PKQA 2IEPA 1QNZH 3PHOB 4PJBE 5BZDB 3WE6B 1RIUL 4MXVF 4N8VG 4JFFB 4MNQD 3BGFC 4O2EB 3LS4L 1MFNA 1XF4B 3TA3B 3LQAL 5EU6D 4UAOC 5DJXA 3LIZH 2EDFA 3BEVA 3SJVE 4M7LH 4KUCD 3MLYL 2C26A 1S7XB 4YEFA 2DWDB 4EEEA 2X10A 1PAMA 4GRMB 4HXAH 4N8CL 5EUKB 3NPSB 4HBCL 4TULL 4J3VA 4GMSL 2GITB 3UZVB 1WTGT 5FO9B 2YRLA 3TF7C 1X5HA 5D70L 3RUGE 4KMTL 4OGXH 5DUPL 3VMNA 3C5ZC 3DHMA 2E7LA 5CEZH 1ZLUH 3CC5B 1UWEH 3OXRA 3AREA 4PTTB 4U1MA 3CPLB 3MACH 4Z7VE 3BN3B 3KHOA 4AM0B 3IGAB 4BH7A 1RUPH 2C3GA 5BO1H 3PJSB 4QRRA 3NPZB 2R0KL 4XNUL 3ZHLA 1INQA 4WI2A 1RZKL 2GSIB 1KENH 5DWUH 4ZPTA 3M8OH 2YRZA 5EORH 1QP1A 4IMLB 4I0KA 3DV4A 4ONGH 5B8CC 5IKCA 2R0KH 3SQBA 4P23D 1BFOA 1EAPB 5JOPE 1U8KA 4KKNA 2E9JA 1AKJA 3SGJC 3HKFA 2Z91A 1QSZA 5IOPA 4OTXH 4L3EE 5IB4A 1P4IH 2DQDH 1MLCA 3L9RA 2BDNL 3VXRE 4ETQB 2W65B 4C83A 1HNFA 1T5XA 2HLAB 2ZUYA 4LSDA 3IT8D 3MUZ1 3VD5A 1SBBA 1K5NA 3L3JA 1OGAB 4KTEL 1X44A 4MB3A 2A6DA 2EH7L 3A6CH 4F58L 5C0BB 4RFNB 5DHYA 1LO0L 1A22B 4OD2A 4MMZC 2AXJA 3DUSB 2HLFD 4F3FA 4MAYC 1OGTB 2C1OB 3OMZA 4NPYA 2XQYK 2DKMA 1T1YA 2DIJA 3QUKA 4UU9B 3VU2A 4DFIA 1F42A 3V79C 4XNZB 1FPTH 4P46D 4AIZA 2Y6SD 3FQUA 5E9DD 3SDCA 4HUUB 4D94A 3UROR 5KVFL 1DBKH 2YUWA 5GS1B 1ZVYA 1U8LB 4FQIH 3TJEH 3UC0H 1X7QA 5DRXA 1QBLL 4U31A 2PR4H 5TQ0L 1NBZA 3WFDH 1UA6H 4RGMB 4KI5D 3T77A 1ZA6A 3ZDXF 4NKDB 4LAQL 2JELL 5EZIL 1E6OH 4KKLD 1S78C 1MQKL 4S11A 4E42B 5IHLB 1T1XA 3QNZA 4ZUSB 4KK8D 3BW9B 5BW7C 4NOFA 1I8LC 1PY4A 4KV5F 3VG9B 1P69B 5FXCH 5FYLL 4HCRA 1UWGH 5FHAL 1MIEL 4MJ6A 1FL5B 2R0WL 1ZGLP 3GGWA 1DL7L 4H26A 3KPOB 3HZKA 4K8RH 5HGBA 2HT4C 5EULV 1DBJH 2P8MA 1R5VB 1GZQB 5CAYB 3W39A 3AUVA 3OAUL 4PRAA 3O2DA 2NY4C 4XNZC 5DLMH 4JY5H 3QQNA 3HS0A 5GS0H 2ZCKH 3MODL 1G84A 1UENA 1FGVH 1QPPA 4IIQA 5IK3A 1KELH 5D4QA 5TFSL 4F8TA 2Z8SA 3KPNB 4EI6B 5L0QB 4KKBC 4NQSA 2VDLH 2VZUA 2NTSP 3C8KB 5FIEA 4DVBA 5DZLA 2YA0A 2PO6C 4QCIA 5C0FB 4R4ND 3V6BR 3BP7B 1F4XH 1M7XA 1RK0B 4OCXL 2NX5D 4TRPH 5DZOA 3FB8B 1XMWA 1EMTL 5I1EL 3UTZA 5HYEA 4RMUA 4HKZB 2BNRB 3S88H 1RZ7H 3S4SB 1OAYH 1UB6B 1T22B 1JZ2A 3HG1B 2AJYL 1E4WH 4N0UE 1GC1H 4RWHA 5FK9A 4ONHA 5F7HA 1GGUA 3JV0A 1EFXB 3ARBA 4WFFE 1J0KA 4EI5B 1NCAH 5E7FA 3L3GB 3O3AB 3MYZA 4XRCA 2JF1A 2KUTA 1ZS8B 4L9LC 4NN7B 5FEBA 4N90D 2R0WH 1BZQK 1MREL 3K3QA 1AXTH 3K46A 5F1IA 1AXSB 4R0LC 1EH9A 1CDUA 3LEXB 1MCRA 1N2RA 2Q6WB 1UCTA 4MD0B 5CD3A 1S9KC 1MH5B 2VDNH 3DURA 3KYNB 2FYYB 4K8RC 3ZE1E 2ADFH 4JO4H 1A7RL 1QSED 4F9LA 3D1MC 5CUSH 3SGDH 4JRYA 1IAOB 3UTQB 1ZOXA 2NXZD 3DX9A 5SWSA 1A0QH 3RY4A 4PJBA 3KNBA 4UBDC 4KAQL 3QULA 3L3OB 5D7JA 3N85L 3KYAA 1A3LL 2I26N 2MKLC 1BD2D 3ME0A 3ZKND 3PABA 1GC1L 1TITA 2DDQL 1JI2A 3QI9B 4CN6A 5E4EB 3WDJA 5HGDB 4P9HC 3FO1B 1CQKA 1YMHA 3FQRA 1G7QB 2DQIH 5JZ7C 5F7KC 1S7VB 1GPOL 4YBHA 5ENWB 4GBXB 1VKXA 2JTDA 3SDCD 2CSPA 5E03A 5DJDB 4PRNA 3CU7A 5J06A 4K71B 4LQFH 4OGAC 4F3FB 4P5TD 5I74C 2ZWLT 1XR8B 4NRYA 4IEFB 1CDJA 5HVFB 5L88L 1P4BH 3MV9E 4OLYL 1T5WB 3PV6B 3UJJH 3SKJH 1NCDL 2QHLA 2P5WB 4XWGH 4PV8A 1JBJA 4X6FB 2V5YA 2VLJA 5D96C 1NCBL 1FJ1A 4YJZL 5C08E 4LGSB 2NY5L 3L5WA 5EDXA 1ZMYA 4ETQA 2R69L 1I8IA 1ZHBA 3VXQA 3MCKB 4RGOH 3RIAF 4OUOA 3VGAC 4LPYA 1I8IB 1ZHBB 43C9B 4P2RE 5E5MB 4OKVA 3OSKA 2H45A 1SM3L 5GJTL 2MCPL 4U3XA 5HHPA 4ZUTB 2YC1B 3O2VH 4OLEA 3GSVA 3AAZB 5I66A 2EDDA 3DV4B 4L29B 5DHVB 3VG0L 3OHXB 2YD6A 1DBBL 1G9NH 2X70A 3RWFA 5L8JB 2C4XA 5EIQA 3N9GL 4TN9A 4PRPB 3CMGA 4QRTB 1MCKA 3IJYA 3FRPA 4OF6A 4U6VL 3MGTA 4L3EB 1L0QA 2NY1D 1YEEH 3FOLB 3QQ9D 4HK0A 5DXWA 3GSUB 5JW4M 5J1AB 4HFUH 2OLDA 3CFKA 5C07D 1QLFB 4AMKL 5HHQB 2J88L 5C71A 3QDGD 3SPVA 1CGSH 4IRJB 1BWWA 2A1WL 5HHME 1QQDB 2RQ8A 3VFSB 3TJEL 5JA8B 5DK2B 4MDIB 2X6MA 5DQJA 5IG7B 4GRMA 3HUJA 1Q0XL 4PJ7A 4J3WA 2FR4B 4LVHB 4G5ZL 4ENEC 1UZ6E 3NCEB 5TQ2H 5T1DL 3WLBB 3ZDXE 5AUMB 1FBIH 2IADB 4JDTL 4JRYB 5C0BE 1Q9OB 1LEKB 3O4OB 3WXWL 3T0DA 2AEQH 2OL3L 3WE6A 1NANH 1CXIA 1QVOB 2B4CC 1ZHNB 4KVNH 2KH2B 3UP1A 5ETUA 5KOMC 1CGWA 4ZFGH 2YD8A 3VXRB 3WHXA 2VJXA 1QFWM 1EEYA 4NO2A 3VFPB 3RDTA 3ETBF 4QHMB 1NDGB 2VDML 3U7YL 5A16A 1MY7A 3NCYP 3VXME 2O5ZL 3TT1L 3QFJE 1F3DJ 5BMFL 2EDLA 1EV2E 1VEPA 2APXA 2XNAB 3FCTA 1D6VL 1FE8L 2V7NB 3QUML 4Y1AE 3U0TA 3SDDA 4PS4L 1NDGA 2W60B 4EUPA 1ZK9A 4RGND 1GGTA 2CQVA 1IGML 4HGWB 4LHUB 1E4KC 2YUVA 4QRRD 1EHNA 5EBLA 5GGRB 1NLDH 3PWUB 1HNGA 1D5BA 1YY9C 2Q8AH 5AYUH 2PXYA 5A2IH 4PGZA 5I75B 2AJ3A 4JG1H 3FB8A 1MCWM 1A7PL 4JDZB 4LK4A 5C0FA 2X1XR 2V9QA 4ZXBB 4OLVL 1KJ2H 3LQAH 4PJXE 1KIPB 1CU4L 4G80B 5HHOD 5HVHC 2YBRA 2XACC 2YPKA 1BJ1H 2AEPH 5CFHA 3HI5H 1IZKA 1ND0A 3LHPH 5E2UH 3A6BH 3VWKC 5I30H 4HEME 3I84A 3TYFA 4P3DA 2ED9A 5I73C 4EN3B 4TVPH 4HQQL 1LEGB 4MMXC 4L8SC 4OQTA 5F8QC 2D0FA 4C56A 5TGBB 5T1DH 1RVFH 2QQNL 4PY7B 4JFQA 1P5UA 4ZFZB 4WFHD 5I15L 4F37K 2BSTB 5IBTH 3ZE0F 2AJSH 4TSBH 3WNNA 4U1LA 3EJZD 4DK6A 3BDXA 1BBDH 5HDQL 4GG6F 4HWZA 1JGUH 4FMFA 3AY4A 2H2PC 1JGDB 2EDWA 1SYSA 1U3HB 4Y1AB 1H3WM 3LKOA 5I1LA 1WC7A 3ZT5A 4RMSA 1F4HA 5EUOE 4NCDA 4ZAKD 4GFTB 1YNTB 5T3XH 1OHQA 4LIQH 4JN2A 5EC2A 2NYYC 4HQQH 4OZ4B 4XPBL 5ID0B 3CVHH 3IFOB 2IG2L 2BSRA 4PGCA 1E28B 2YR3A 4TTDD 1MOEA 1A6UL 3SDYL 2X7LB 4QT5A 2IQ9L 1FCCA 3O3EA 4BFIB 2QBWA 1D5IH 2E7MA 4FQHB 1VFOA 4POZD 1I8LA 1MFAH 4M9PA 4NQDA 4OI7A 2HG5B 1CDBA 4QY8B 5J9PB 4U0RB 4OGZA 1F97A 1OAUL 1FVEB 5I15H 4OZFB 1WTLA 2V5SA 4H1LG 5GPRA 2BNRD 1WWWX 4MJ5A 5D6CB 5KSBE 4NCC2 4MD5A 2AXGA 1NFIB 3U79A 2IH3B 4ZFOA 1FC1A 3ROLB 1O7VA 3ULUC 4DGYH 1A3RL 5D6DC 3KYOB 4H0GA 4JY6A 1CFQA 1K8DB 4KJWC 4MSWB 5TE4L 3MFGB 3CLFL 4CVZB 5JOFB 2ADJB 3U2SB 4NWUL 5FF6B 3SDXA 4UZGA 3MJ7A 4BK4A 2ATKB 3KYKL 3UAJD 3OXSB 4JO3L 1A3RH 3ARDA 5DK0B 5DD6A 5EU5A 3TH4T 3LKRA 1ZV5A 4L8SB 3VA6A 5I18L 5IEHA 3I75A 3O6FC 3HE6D 5C0AA 3QIUD 1V7NL 5LGHL 1BF8A 5IESL 4LHUG 1S7WB 4I77H 3G04B 1A8JH 3L95A 2A83A 3GRWA 3EBAA 2IPTH 1Z3GH 3G5YA 4ZXBD 1IKNA 2VKXA 3NPSC 4HC1L 2L7UA 1KYOJ 1FFRA 2R9HD 3BT2H 3HAEG 4P9HL 2GJZA 4ZQKA 4P2RD 1GOHA 3H9SA 3I2CH 1L9NA 2HLFC 4LHUD 3OZ9H 3SO5A 5A3ID 2I24N 4OBRA 4XB8A 5DVNA 1IQWH 3KPTA 3RWIB 1VHPA 4GRLC 4K3EL 1U3JA 1I1AA 3PWNA 3FJTA 2DRUA 3OGCB 3KDMA 3QRGH 5D6DA 1EJ6A 5DJXB 5T3XE 4XRCB 4RRPA 2DQGH 5D1XD 3MRRB 5I17A 1G9ML 1KJMA 4O4YL 5BXFB 4FG6D 1JZ3A 5BJTA 4OV5A 1UYWH 3TVMC 1JF1B 3HG1A 3WS6A 4FP8H 2VZ1A 5SWSD 3U46B 2H32B 4PIRF 4B53A 5C0EB 1UH4A 1S7QA 1U9KA 2AJYH 4ZTOH 1FG2A 4X98A 1X5ZA 4WFFD 4PJFB 1T7WA 5JW3L 5GSVB 4DZ8B 1RJZA 3WFHB 3IDNA 3LMJH 6FABL 1CK0H 5DFVD 1GRWA 2BOBB 3ALWA 1OT1A 2Y4SA 1EXUB 2R9HC 2X42A 4XPFH 3C5JA 3FO9A 1K9TA 2NY7H 2IPKB 3LS5H 2A6KA 5GGTA 1YEIH 3JTTB 1AXTL 4Z78B 3QH3A 3SDXF 2AXHA 2D4DA 4KFZC 2W9DH 1PEWA 4N0CD 3B9KC 4YPGB 3MBED 5EOCL 4KRPD 2BX5A 4PJDE 3O3BB 3VRJB 4Y0GA 1MAML 3MUJA 3W81A 1NLBL 2Q8BH 2XN9E 3HE6B 1I9RH 5BRZE 3VWKA 4W6WB 4S1DC 4BSVB 2X09A 3T4AA 5L88H 1DN2A 5F7MC 2XN9A 1U8NB 1OP3H 1NAKL 3AC0A 3ZL4H 1FGVL 2YPVH 4HH9B 3NTCH 1VA9A 4RFEB 4APQC 5SWSB 25C8L 1QYGH 4JANA 3MRBA 1GIGH 1E4XI 5DGRA 1DUZA 3OB0H 5FOJA 2MMXA 2J1KA 3ECBA 4K8RL 1S7TA 4RGNE 1NAMA 4F7TA 5LXGL 2W0PA 3QRGL 5FKAA 3ZYJA 3G6AB 2PCPA 5KG9A 4LLWB 5TFSH 3QP3A 3ZHKA 4RMWA 1UKQA 2XWBB 4XTRC 5E1AB 4KHTL 1YY8A 4NPYB 2F53A 3GUTA 3THML 4KTDL 4FQHA 4XC1L 4ZFFA 3GI8L 1NBYB 5BS0E 4ONOA 3ARXA 4HXBH 2EECA 5E6YA 1KPRA 4DQOH 2R1YA 4RGNC 4FQCL 2AEQL 2OL3H 1MCOL 2E9BA 2HJLA 4OZIE 3PNWA 3L3GA 3O3AA 3QHFH 1ETZA 4FQ1H 4QOKB 5JR1H 1I9IH 3HPLA 2CKNA 1KJ2A 4LKCB 5AAWA 3P9WB 1BX2A 3DMMA 1PX4A 1UADC 3LQMA 2WW8A 3FFCA 1UXSB 3QHTC 4OIIL 4Q58C 3MRLB 4PB0H 2FX8H 3FN0L 2W59A 1MHCA 3VXUB 1NFKA 4XBGA 4L4TE 4HWEL 2OQJB 4LBEB 4Z77A 5JPNB 4K7PL 5D72L 5SWQA 3GI8H 1AO7B 2ESVB 2R2BA 4PG2A 5FYKU 1Q9LA 3F58L 2QADD 4G8FB 4WUUB 1FFOB 4KKBD 3UEZA 4NWTH 4HJJH 1CLZL 2GY5A 3N1QC 1XGPA 2Q8AL 3B6SB 5D1XA 3ISWA 2ED8A 2A6IA 4HZLB 4QXTB 3S4SG 3WN5C 5CJXA 1ZVSA 2VE6A 3MRRA 3QDGE 2UZXB 1F13A 4DTGH 3V52H 4WENB 1CD9B 2B20A 1T20A 4YBQC 4OTXL 1OAXH 5ALCH 3C6LD 3BVNB 1KIPA 1ZLVK 2A0LC 1DN0A 4Q6IC 3A6OA 1YEGH 3WL9B 3T04D 4RGOL 2VQUA 2R0LH 3EOYG 4GOSA 4O2EA 4WI8A 3HC0B 3KGRA 5I1IH 4H25A 4M8QA 4R9HA 1P7KA 3ES6B 5GGVY 1FCGA 4P5MB 5I1HL 3OKLB 1QUNA 1U8JB 1KB9K 1IM3B 1Q9KB 4Y5XC 3RWHA 5BZDA 5HD8D 2LU3A 2ZOKB 3O6ML 5HVGB 4PG2C 4XVUC 5C0AE 1WBYA 5L9DL 3ALPA 4M4PA 3SN6N 5F7UA 3BKMH 2W0LA 4P23A 4NP4L 4R96B 3H3PL 1FLRL 1J86A 2R2HB 3SE8L 5I1JH 1K85A 3LVEA 5FUZH 4P2CG 5TDOA 1F2QA 5J12C 4WCYL 4R4BB 3ZMRA 4Z6AT 4CL7A 4ODWA 1HSAB 4P4KC 4Y19D 1K5NB 1L0XA 1BIIB 4Y1AD 4XBPB 1QBAA 5AAMA 2P7TB 3VFTA 2X4UA 4G7VL 3DX8A 4LFHG 2YN3A 1YPZA 3D3VD 1LEIA 1IEAA 4WWKC 3SDYH 3RUGF 3BH9A 3DWTA 1FNHA 2O5YH 3UYOD 5EOCH 3FT2A 1BIIA 1GHFL 1BFOB 1EAPA 5J56B 4L8DB 3VXPA 1AXIB 2EYSB 1JZ4A 1BP3B 1YN6A 3QYCA 2GKIA 3C5SB 3U9UB 5D2LB 1UM6H 5D1ZB 4JQVC 4K7PX 2PW2B 2LU7A 1YNLH 3EOBB 3MNVB 3QNXB 3IRZA 4G6FB 1Q0XH 1HH9A 4KVCH 2GQHA 4TVPD 2VL4A 4MS8C 1H15B 5TH2B 4Z7OF 1N6QH 1JPSL 3CSPA 1Y6NR 5E2TH 3DX6B 5IP4A 3MRFB 2A1WH 3SDXE 3NOIA 5F9AC 2VWEC 4L3CA 1R3HA 3ZT7A 4NT6A 1A6VL 3QFJB 5C8JA 3RWFB 4Y2DC 4A6YB 2HFFA 4P3CH 1I1FA 5I66B 1FIEA 1ZANH 2IFFH 4JM2F 3RNKB 5FB8A 4FQPA 4LLUA 5DHXB 5IHZA 4MHHG 1R3HB 5HDLA 4PJ5A 2F54E 2YSSB 5GRWA 5B21A 2XPGB 1MREH 4XMLL 1F8TL 4JKWA 1UWEL 3EJYC 4AYFA 2KZ1B 1JNHA 5J12B 2P47B 5L7XH 1E27A 4Y4KC 5IMLB 2PW1B 35C8H 4K55A 1ACZA 3JUZA 3ROOB 5E8PB 3PG2A 1KTRL 5IUSA 4JO1H 2DWEB 2OR7A 5HHXL 4NOBA 1I8MB 4B7IA 3PV6A 4GKOA 2Z8WC 4PLKD 1Q9LB 2VXTL 4D9LH 5INDB 3E0GA 3GMOA 5DEGB 5CBEB 2OZ4L 2OQJA 4OLUL 5FYLE 4EZMA 2W0KA 4NQED 3C60C 2ADJA 3F62A 4ZO9A 3FN3A 4XAKD 1RJLB 1AD9B 2F5BL 3W9EA 4HX1B 4YFDB 4HZAA 4MA8L 43CAB 2O5ZH 3VXRD 1IC4H 3WFCL 1MCPH 3HPLB 2ZCKL 3BRGC 1IQWL 1SYVB 2DL9A 4UOW1 1HSAA 4GG6A 4Z7UF 2Z92B 5B8CB 3L3OA 5E2VH 1DBAL 4U6HA 1EHXA 2HRPH 4PJCE 5GISL 1LK3L 1SJEA 2NZ9D 3VFOB 4GAYA 3HAEB 4JR9L 3UTQA 2AI0H 4N1EA 4HIXH 3ARPA 2XTLA 3CLEL 2C3XA 1I85A 1OAQH 2EDJA 3GMMA 4QYOB 1WT5A 5HJ3B 5AZ2L 1EX0A 3LN5A 4M6NL 3VFPA 4M9OA 1T21A 3HZMB 4Z95H 2GJ6A 4AZ8A 1A6UH 5BVJA 1F6LL 1LE9B 1KLUB 3F5WB 3Q6GH 1WCBA 4M62L 3MUHL 4LLQB 1QBBA 5TQ0H 3OKLA 1UM5L 3WFDL 3S8WA 3BPNB 4P5MA 5IW6B 2E27H 4J1UB 4MD0A 5SWZB 3GJFB 1EUTA 4JFDD 4JFZH 1IAIM 1KN4L 3WLBA 1ZT1A 4PJ8B 5T1LB 1ZE3C 4V1DB 3ARGC 4PGBA 5K59F 4YHNB 5MERA 4EI5D 3CDFA 4S2SB 5GJTH 5D2NC 4C57C 3RIFF 3BKML 1A4JB 1R3IL 3ARSA 4OM0L 1T4KB 5T3XD 1XGYL 3WS3B 1JHKH 1KXVC 3KWWB 4LMQE 1MFCH 3S37L 4KK9C 5IB2A 5F7NC 1UB6A 3QXDA 4WO4B 1XH3A 8CGTA 4D9RD 1IAIL 3MROA 4P5TA 5TGBA 2FO4B 3THMH 1MCDA 3FOLA 5I18H 3RZCD 3VE0B 2NNAA 2J5LB 1RFDH 2FGZA 2JK5B 2I07B 5E94B 1M7DB 4HJ0C 3UDWA 3FO9B 4CBPA 4JFFE 3ARYA 1KB5L 3B9DA 4I9WE 4X6DB 5FUCC 3GSVB 3NIGF 1OP3K 4JDZA 4N0UA 4XGZB 4AEHL 3LKQB 2P5EE 3K1DA 1VCAA 5E08L 2NPLX 2OR9L 4PJFA 3EZJB 1OWRM 3L5JA 4LEXL 3VE0A 1YYML 2BSED 4FXKA 2EC9U 3OJDA 3G08A 4MXVE 1QFUL 3WNKA 5IMKA 3UC0L 2BRRH 4I0PB 3U83A 5IB2B 4J3XA 1NCCH 2WQ8A 1VB9A 4ZO8A 5D1QB 4XCNB 4D3CL 4D0DB 1QEWA 1CGTA 1OPGL 3IETA 5ERWA 2QSTA 4YH6A 3OX8A 1KPRB 5FB8B 1K4DA 1M6OA 1I1FB 3P3YA 4QHLA 1MFBH 1NC4A 2UZYB 2BFVH 4DN4H 5FHAH 3JTSA 3L3IB 4I18B 1QFHA 1SJVA 3S36X 1I9EA 2F8VA 5TE7H 4WTZG 4Y16D 1GGYA 2DMBA 4XVJL 1C1EH 1GSMA 4HIIB 5EC1A 4HWNA 1FNGA 4PJ8D 5T1LD 5FHBH 2FH8A 3MA9L 3K2MC 4BQ9A 1YMHB 3FQRB 2JB5L 4GKZB 4TUJB 2VH5H 3DUUB 2EIDA 2C1PA 4XVJH 5D9SB 4Q6YA 4KKCD 1XF3B 2C3HA 3VW3L 4JFED 4UILL 3GMRB 5DJ2B 3IDJA 4XAWH 3VJ6B 2GI7A 1DQLL 4LPUA 5JQ6L 2EKJA 3LH2L 4Z0BL 5JHDD 5FYKL 5DD6B 4HDIA 5C2BL 5SWZD 3VFUA 1NUGA 4PLOB 1FSKB 3PWJA 5I16A 5F9OL 3C5ZD 5DJ2A 5DMKB 5BZWA 4ZNEE 3MLSH 2DQEH 1G6RL 3SCMD 4V1DD 3DRQA 2KPNA 3NH7H 1UKSA 2VDOH 1AO7E 2ESVE 4GKZA 3LPFA 4S1RH 3S36L 3F6IA 4ODTH 1BLNB 3FAWA 4X6EA 2Y5TA 3BKJL 5LWYL 1QKZL 5I1JL 3EYQD 3FQNA 4UT6L 1JCKA 3TIDA 5J6GB 3WKNA 3DETC 4H5SB 1JGLL 4LCCA 1M4KA 4YK4C 4JRXD 1Q0YL 2F54A 2QEJA 2PYEE 2NXZC 3IDNB 4QRPB 4L8BB 5C0GB 4PD4J 3TP4A 2IGFL 5C6TL 2DWEA 5I8CB 4Z8FH 1VACB 4EI5A 3U0PB 4OCXH 1V3KA 3U48A 3DXAA 1A7QH 2XQBL 3H9SE 3D0VB 5FGCB 3BPOC 3HC3H 5JW4Q 4K8RD 1S5HA 4OFPA 1R3LB 3P77A 3QI9C 5FECA 3I6GA 4Z7WF 1KJMB 3KAAA 3DBXB 3FKUS 4KKCC 1SEBB 4D0CB 3BP6A 1UVQA 2CJUL 1I8KB 2HKFH 2CLVB 4WY7L 5GS3A 4KMTH 4I2XA 4XVSH 4K71C 1S7XA 1HI6A 3BVNA 1D9KD 4FZ8H 4X0KA 3KJ6L 4EI6A 2D0GA 3ESUF 1O5DT 1H3PL 3RVVC 1OP5H 2X41A 3VXNA 1R3KA 3GSXA 1MY5A 5E2TL 3DNKA 3U4AA 2VABB 1YJDL 1FZJB 2J4WH 3DI2B 3VXSA 2COQA 5DJYA 2RCSH 4JVUA 5HGDA 4YHKH 2CDFA 4YZFE 2D7MA 3QG7H 1MI5B 4WUUA 4LKXB 1P84J 4IRZL 3BRFA 2RHEA 2XXCB 5FDYA 1BD2A 4J8RA 2IAMA 4M3KB 4KJYA 1BFVH 3OR6A 4RNRB 1AGDB 1CGVA 3KPMB 4YFLI 4I3RH 2DI9A 5DJCB 5H37H 5JOFA 4LF3A 1YMMD 2EIZA 3EYUH 4U4BA 1BIHA 1N5AB 1NC2A 4HJ0D 4JCMA 2YZ1A 1HDMB 5GS1A 2FX9L 3CJJA 2VZVA 2HT4D 1MCQA 1P4BL 4HLJA 2UZIL 2GJ6B 4R7NA 5CGMA 4G42A 1L6XA 3PP4H 4LVOB 3EHBC 2G5BB 5CIPA 1KCVH 2FHFA 5GRVL 5SV3A 4Z18A 3AU1A 3DUSA 4A6YL 3GFUA 3GB7A 3QEUA 4N9GA 1CG9B 3BE1H 3FT3A 2A0LD 3DSFL 3QDJB 4EOWL 4WV1A 5DUBB 2K1MA 3GI9H 1KB5H 1Z9OA 3MNZB 1H3UA 2DJ4A 3B5GA 5FGSA 3H9YA 4RX4D 4UNVA 2M26A 1JNLL 2HTLC 4LSRL 4HX1A 1NAMB 1JPTH 2Y1VA 4Z7VB 3GM8A 4JG1L 4F7EA 3SKOB 5HHXH 2BVOA 2BNRA 2NW2A 1ZA3B 5JO5B 12E8L 3HB3C 5IKCB 2H8PA 4WFEE 3RZCC 1JPTL 4FFYL 4HWZB 4NM8L 4OLXL 5EU6A 2VDRL 1VENA 2FR4A 1FORH 2XZAH 3T4AB 4HFWA 4K23H 5D1ZC 3ARUA 3C60D 1NAML 4ZS6D 1WK0A 2RBLA 4MQXD 4OB5L 3WJLC 3ZKMC 4HIJB 4HUXA 5B39A 4KXZI 4I3SL 5HTSA 4CMMB 1MJ8H 1V3MA 1C5BH 5M7QA 3QIBC 4GAJL 5C6WH 3QH3B 1S8DB 3KLDA 4G43B 4EBQH 1DQDL 3GNMH 4HH8A 4Y4KD 2K7PA 4G6KL 1FLRH 5DRZA 1L7IH 1KXTB 4OFIA 2AI0L 3L3KA 2NQCA 4I9WD 4OM0H 4PJIA 3DHJA 7FABL 3MRDB 1KB5B 3E8UH 5GS0C 1S7QB 1HKFA 1WEJH 1I7ZA 5ACZB 5JORB 1I7RB 1AQKL 4ELKB 5CD5D 2IC2A 3BAEL 4PLKC 3HI1A 2KQNA 1LK2A 2DMKA 5L6YH 5E24E 3S34H 1T1WB 3D0LB 4MLIA 4QOKA 2F5BH 2AXFB 2PXYC 5DD0L 4MA8H 5D2NA 5DJ8A 4JPVL 2HTKC 4POYA 3QNXA 3WIHL 1X3DA 1CL7I 5DVKA 1CICA 3ZHDA 4MVBC 1JWMA 3HLAA 3P9LB 2X4TA 5D7LA 1QA9B 2WK2A 1G7LB 2CUMA 3U7YH 4Z5RA 1PKOA 5C0CA 4HAFA 3AU1B 1W72A 5C3TA 3HUJF 3RDTB 1KV3A 2FWOA 3LN4B 5MI0C 2BRRL 3GMQA 3VDAA 5I1KL 4GW4B 3KVQA 4ELME 3AM8C 3G6AA 4I77L 4JO1L 2FJHB 5IVOA 4JLRB 3WFBL 4DGIL 3O11B 3EIFA 4PJ9A 1YUHA 3EDDA 4XHQA 3Q6FB 2XT1B 3DX8B 4ACPA 1Q94B 2G9HB 3KYKH 1DUZB 4MNGE 1X5AA 4MCZB 4U1JA 2FD6H 1VGKB 2JKXA 1UQSB 5DYOB 4MA1C 5E1HB 2UWEB 2P44B 3BMVA 1P7QD 2CO7B 5LG1A 3IJSA 1ZANL 1GGIL 4EXPX 2O5XL 3CAFA 3IAGC 5J6HB 1U8PB 4MDIA 4NQCB 4Q9QL 4LSVL 4IRSA 2OI9C 2IALA 1PG7H 3STLA 3BP4B 2F74A 4OJFH 1IGTB 4PPTA 2I9TA 3IGAA 3VRLF 4BH7B 5F21B 2PKDA 3QUYC 4CJ1A 4ODHH 5HI4C 1ULVA 1KGCE 4HPYH 3LD8B 5H2BA 3CC5A 2EDQA 2HA1A 4RX4A 3U4EB 4MAUL 5T1KD 4Y2DD 4B50A 1TXKA 1SJHB 3GSNH 4YHIA 3MRCA 4O2CA 3LV3A 1UKTA 3JTSB 3L3IA 4JM4L 4LVEA 3RWCA 1KNOB 2OJZL 4QGYA 5B38B 2SEBB 1CK0L 1TETL 3BUYB 4BSWB 1GC1C 2DWDA 3FQXB 1NGZB 4KKAD 5TE7L 3UTSD 1UGNA 1FL6A 5TDNB 3G5VA 3MRPB 2Y06H 1F6FB 4LDLB 3WNLA 3Q3GA 1A6AB 4YDLB 1DDHB 4AMKH 3H6JA 5CMAB 4L4TB 5IMKB 5CINL 2IQ9H 3C60B 3ARDC 2XA3A 1S9VB 1MHPH 1TFHA 3O9WC 3PL6D 3KG5A 3EFDH 4IHOB 5CZXC 1U93A 3MBXH 3T0VA 2IG2H 5ECJE 2C3WA 1A4KA 3RA7L 3DMMD 3KDMB 5C09E 1HHGA 3FONA 1WIUA 2MQ3A 4L8BA 2H1PH 5EUOB 4XC1H 5EN2B 4P49A 3FAXA 3RWIA 4MA7L 5CSZB 4N0FA 3JWNC 1JI1A 3IF1A 4GQPH 3MOBL 2OXHA 5DJDA 2HJFB 1CIDA 1CXFA 5J6GA 3WFCH 4EIZC 2GFBB 1PD6A 3H7BB 2CMRH 4XZUB 4LCCC 1BZ7B 3BRDA 4TPRL 1N8ZB 5F9DC 5I9QB 1IMHC 4E0RA 4IOFD 3O2WH 2VB5A 4EI5C 1IFHH 1FDLH 4WI7A 3ARGD 1VFBA 5C6TH 4OF0A 5CEXA 3MLVH 3CU1A 4LCWB 4H88L 5CUSL 4HKBA 4PJXB 3NFPB 1T66C 4E0RB 2DJUA 5AEAA 3SKOA 2Q76B 5FYJL 3TA3D 3BGMA 3KS0H 1EO8H 5KZCB 3PWUA 4P2RA 3FB7A 2DIAA 4LLQA 3AB0C 3QPXH 1GGBH 3F5WA 3KYNA 3KYMB 5EPMB 1T21B 2Y06L 3QJFB 3LN5B 1FVEA 3STZB 4Z7QE 4PRBA 4PJGB 2V7NA 1HHIA 3MRBB 3TLRA 5EO0A 1L7IL 2KDGA 3H8NA 4EDWL 1RZGA 1INDH 1AY1L 3QWRD 1A0QL 3WFEH 3CFDB 4X6CE 2XZCL 4PJHE 5D72H 5FGCE 3IXTB 2DQCH 2B2XH 5GZOC 3N1MC 5T3ZD 1YN7B 2HWZL 2HT3C 5TPWH 4C83B 1CYGA 5MENB 4FOMA 4AY0A 5K9OA 5CEYA 3G5ZB 1DVFB 5BVPH 4P57B 1JUFB 2IAMD 1I7UB 5I1LB 3MRPA 3TCLA 4KZEH 3BZDA 2YUZA 3G6JA 2VLRB 2A6KB 4L4TD 3ZDZF 5L8LB 1RUMH 5EIVA 3HUJB 1RZJH 3K2UH 4UT7L 2IAND 2IF7A 3MO1B 3VXTA 2NR6C 4RAUB 5E94A 1TZGL 1AE6L 1CWVA 4HK3N 4U05A 1A6PA 3WFEL 1FQ9C 5JA9A 4FZ8L 3MBEA 3MJ8A 3ARVA 4XC3H 4D9LL 1J1XL 5FOBA 5C0EA 2I5YL 3R0MA 4NHUB 1G7MB 4JRWA 4HKXB 1J8HE 1LEGA 1RK1B 4NZJA 3MRNA 1JF1A 2QKIB 1Z6JT 3WJJC 2XN9D 2DLTA 3GIVB 3MV01 3O6KL 4YE4H 3D3VB 4QRTA 2X9WA 3VDCA 4ZUSA 4B7LA 3H9HA 2X70B 1MCHA 4OQTL 4BKLA 4NFCA 4JHAL 3Q1SH 4QRPE 4PJHA 1LDSA 4ELMA 2XKSA 2YC1A 3EDKA 4NUJA 3OF6A 5HYQA 2Z31C 2YPVL 1U8OB 3ZT6A 15C8L 5FGBC 3TT1H 1FG9C 3S35H 3RWJA 4I8DA 1UACL 1PG7X 4N8VA 1IL1A 3MLZL 3SY0B 5TH2A 1XT5A 1AHWB 2YOCA 3WUWB 2WMPA 4R3SA 1FNSL 3I50L 3HFMH 2FECL 2ADIB 4CMHC 1AGCB 4DVRH 4NO0B 2NY2B 4Z7NE 1CFNA 1VACA 3B9EA 2YK1H 5EG6C 2HVJA 3SGEI 3QDAA 5F70A 2HTKD 3EO9H 4QRQB 1HWGB 4FFVC 1CD1B 2PYFA 4NRYB 3BUTA 3TO4D 1NCTA 2LAGB 1R5IB 4A6YH 1LNUA 1RVFL 1X6NA 2Q3ZA 4H20H 3BAEH 4HAGA 1TJGL 4Y4FA 1S3KH 1T5XB 3JUYA 2H1PL 3SCMB 1U8IB 1RJYB 3TWCL 3RTQA 3JXAA 5EWIL 4JPIB 5IB4B 3SDDD 3P4MA 2Q87A 3IRPX 1AI1H 4JGMA 2IH3A 5E95B 3DYPA 3MOAH 4DKFL 2X4NA 4W68A 1CF8H 2VXVL 2HT2D 5D8JH 1CDIA 5AUMA 5MEND 1WICA 1AI1L 4JGUA 4HDIB 1U2HA 4EQ2A 3RPIB 3IKKA 2R2HA 4RISL 2EDHA 1MJ8L 3HC4H 1I8MA 2VISA 2XG5A 3T4YB 5F7DA 1A9EB 1H3VA 3QO1B 3BH8A 2CIKB 3MREB 4CU6A 4FXGB 2EE6A 2AJXH 4TUJA 1JGVH 5E8DL 2O93L 3RWHB 3X3GL 4AEHH 1IM3A 4HFUL 4CMMA 1BQHB 4WW2C 2GT9B 4IMKC 4UOW0 3DSFH 3EYOB 3FB6B 4N8CH 5DVOA 1CTNA 2GJ6D 5K9KA 4CGTA 3HA0A 4GW5A 3QEQD 2CXKA 4LLUB 4P3CL 4P2OA 4K2UH 3GEWB 4QO1A 4Q9QH 4S0TD 1U3ZA 1EK3A 1CIUA 1GL4B 3MA9H 3UCRA 1KJ3H 3C6LC 4L29A 4YFLF 3OKOA 1N0LA 5DHVA 1AQDA 1J05B 1FGNL 3RJDA 4X9IA 1JL8A 5A2KH 1C08A 2DICA 4Z0XA 3ET9F 3V0VA 3IETB 1JNJA 4G8GA 4JFFA 5JLZB 3NGBB 2EDNA 3TC9A 3EO9L 1SEQL 5DD5L 4LU5H 3NCMA 3HI5L 1HEZB 2D7TL 1J87A 3QIUC 43C9A 4JZNA 1JGVL 1EBPA 5IFAL 3L7FB 3QIBB 4FXKB 4HS3A 3TYFB 2GK0A 4DEPC 1H9VA 4HUMB 3W0WA 1T03H 1IBGH 1QSFA 5IB1A 4GMSH 3NCBB 2YD9A 4GUPA 1JWSB 1E4XH 2ZNWA 4DVBB 5E8OB 3VWJD 2ORBL 4PB9L 5EA0L 4M1GH 4JY4B 1GZPB 5SV4A 4LHQB 4NZRH 1TENA 4MZ2A 3S98A 4JVPA 4XCCH 4Z7WA 1SMOA 2EE9A 4KGLA 3OAZH 1XIWA 3LRHA 1BMGA 1DQDH 1KUMA 2BCKB 3GNML 5ENWA 4XP6H 1S7VA 5DSCA 5IF0B 3TZVB 3NABH 4KU1A 4P5TB 2V7HA 5E00A 3EYSH 1G7QA 3DRTB 3PV7A 3MLRH 2DKSA 3RHWK 1F90H 1HDMA 3T1FA 1ETZB 4ODVL 1IGCH 3IFLL 1NH6A 4YDIL 1A7RH 5GQBA 4IS6A 3PNWB 5KVDH 1MWAH 4LP5A 4XBPA 3C2AH 5DT1L 3MV9A 3LSOB 5EZIH 3REWB 5FCSH 1P4LA 4P0DA 4QHUB 2EIZB 4JM2D 3P73B 3MV8B 4ODWB 3H7LA 1NBVH 3VD7A 5I19L 1AQKH 1QACA 4MNGA 1YC7A 4ORGA 4PJ8A 5T1LA 5J1SC 4PJIF 3T77B 3GSOA 4U6XA 4G8EA 4UT7H 2R29L 2G5RA 5F6IC 1W0VA 1JMZA 4ISVB 5E7BA 3QDGA 4LKXA 4NQXA 4YXKL 2LVEA 4OM1H 1T83C 2BC4B 1E6OL 2N56A 4F7TB 4QRUA 4Z8FL 4YHYB 4Y16A 1JHLH 4RMTA 1U8JA 2HJKB 1ZXQA 4YDIH 3B83A 3EJZC 3SE4A 2XWTB 1T0PB 3MLWH 4TUKL 3FL7A 4ONFH 5TE4H 5ICZA 1KN2L 1OVZA 1JHLL 5J3HC 2FRGP 4TRPL 1MFBL 4JM4H 4LDEB 1RZKC 3PP3K 4LCWD 2ZKHH 3V7AE 2MHAB 1PBYA 1T20B 1PZ5B 1A14H 2ZUQC 5J1TC 1JIBA 1QQDA 1AFVL 4ZTPL 1N8ZA 4E41D 5I74B 2ZUUA 2BNUB 1KFAL 2EEAA 5L2KD 2BHUA 4GMTH 3VH8G 3B9KD 5F9OH 2IJ0C 5IT2H 1RJLA 2ZJSL 5D7KD 4IJ3B 2WWKT 3VI3E 1S9WB 1UB5B 4JE4B 2Z93B 4LLVA 3UBXG 5ICYA 5GRXG 5ESAA 4QHNB 1RULH 3BZFB 1IGYB 1MJUH 3FONB 4AENB 4PP1D 4U0RC 1S9WA 4MWFA 3WMSA 1NKRA 4ZG1A 3DJ9A 3BGAA 4WW2F 4TUOA 3TBVA 3VWJB 4N1HB 5CHNA 5C92A 1JRHH 1KCVL 3CH8A 5T33H 3DMMC 4JHZA 3ESVF 3CXDH 3W39B 1IGIL 1EEZB 3MCKA 3HNSH 3B8SA 4M6ML 4OT1H 2D7PA 3HZKB 5HGBB 3RTQB 5CEZD 2XPGA 1ZLUK 2KBGA 5BZWB 3QWRA 1G0YR 1UWXK 5CP3A 2AV7A 4KAQH 1R5IA 1INDL 1SJXA 4ZAKB 3QIWD 5K59E 3UBXI 1QSFD 1I3UA 2DQHH 5JHLH 3UJIL 2JCCA 4PTUB 3LZFL 1ZLSL 3HCVB 1E4WL 1R24A 4LSTL 1B2WH 4YX2L 4YO0A 5C0IB 4HCRL 3FT4B 4M1DH 1TTFA 1HXYA 3PHQA 3SJVB 5D9SA 4OCRL 2XIDA 4NJ9H 1OP5K 3REVA 2AABH 2BMKA 2FBJL 1J11A 3SE3C 4UUJB 3L95B 1EO8L 2BMKB 3H42H 3LQAC 4NNPL 5JR1L 1DEEB 4JFHE 1WWAX 3RU8H 5C0IA 1YJDH 1SVCP 2XYCA 4KQ4L 5JNYB 4I18A 3NA4A 3VXSD 4RWYH 3BDYL 1IC7L 2WIIB 2B0SH 2JCCB 4NYLB 3L6FA 4WUUD 1QFWI 1SMAA 4EDWH 2ICEA 4M7LT 2OTWB 2IQAA 3U36B 3V95A 3T0XA 4NZTH 4LSSL 1LO3H 1MHHB 2QKIA 5DS8B 5HGGS 1NJ9A 1LEIB 1XGYH 5IFHH 4PP2A 1C5DB 5HYJE 3NMEA 4GW4A 1IQDA 1RZ8B 4Q2ZB 5DR5H 3T0EC 1BZ9B 1NC2D 1QR1A 3HUJE 4FABL 4NFBA 2JE8A 2PO6B 4XCEB 4X8JB 4N0UB 4XGZA 4XWGL 5DJ0B 2QQLL 4JRXE 4RAUA 3S7GA 3SGKA 2AKRA 3MPCA 1GVIA 3V4PL 3LKSA 5DDHB 4YHOL 5TDOB 3MR9B 2BOBA 2FL5B 2C7UA 5INCA 4EKXA 2PTUA 4M1GL 3PP4L 1NEUA 4WHTB 4H8WC 3I02A 2VITB 3L7EA 3K8LA 1FNLA 1FLTX 2QLVB 1HCVA 2P5EB 3QXAA 5I8OH 1E28A 4FQCH 2XZZA 2FZ3A 1WBYB 3GIZL 5FDWB 3MV11 5DI8A 5JDSA 5KZCD 3CDCA 1OTSD 3OG6B 1NGPH 2XFXA 7CGTA 1CLOH 1QO3A 4I13B 2Z31D 4BZ2H 2W0FA 3B9KA 4R26L 2H3NB 4WFHE 2DQJH 1TJIL 4Y88A 1A47A 1RV6X 3SJVD 1WJ3A 2E6JA 3IU3B 3CZJA 1V3LA 4OF5A 5DTFA 1NCBH 4R26H 5F1NB 3RTQD 4HV8A 3C09B 1B0WA 2DM4A 3TN0B 5DRZB 5BVPL 1DZBA 1WFOA 1KC5L 2BSTA 3MLUL 4G43A 1T7YA 3H9SD 3IJHA 4KVNL 4XTRD 2HJKA 4M7KH 2ITCB 5EU3B 4Q7DA 1HHJA 4NN5C 1RZIA 4R7DB 4XNQB 3UPRB 4QXTA 2HKHH 2Z4QA 3IDGA 1KC5H 4KK6D 4RBPK 4EDXA 4I0PC 4PRAB 3OPZL 1CS6A 3HZMA 4UINH 1GZQA 3JSSA 4HS6A 3BH8B 5HHVH 1ND0B 3KPOA 2VDNL 4X6BB 2EH8H 3GGWB 1VFMA 4L5FH 1T7ZA 4LSVH 5FUOL 2HAZA 4ODSH 4G8FA 3T0AA 4RMRA 5I2IB 5BV7L 4L8SA 3MQIA 2EDRA 1VFBB 4G6AD 2ZUSA 4APQD 1R5WB 2ATKA 4LOUD 1CBVL 5LGJB 3QJHB 5HY9A 2V2XA 3QG6A 4PJGE 5ACMA 1LE5B 4KK8C 1IC5H 4ZOAA 1XGQA 3PWVB 5C07B 1TZGH 4WDIB 3RPKA 5J8OA 2X1OA 2FIKB 3PWVA 4HGWA 4C55A 4F7MA 1J10A 4EUPB 4GMTL 3R8BB 4LNRA 2VR5A 4KV5E 4MYWB 4PJAB 2FECI 4YQXL 2Q86A 3IKCA 4G8GD 2OK0H 1XFPA 2MKWA 5MENE 1IGMH 3PGFH 1MF2H 2UYLA 5FUZL 4X7TA 1A21A 1RHHB 2W38A 1UCBL 4U1HB 2NTFB 3BWAA 1TMCB 1A1MA 1FIGH 2D7OA 5DZNA 4NNXA 5MEQB 4XP5H 2C4FT 4WEBH 3D85A 2CLRA 3VFGL 5C0RH 2APVA 3TA3C 2I9LB 3CFBB 3EUUA 3KLHD 4X5XB 3GSRB 1KIUA 3VXMA 1WBXA 4CKVX 3HE7A 3EJJX 1T2QH 1MCJA 4D9QD 5JLZA 1TVHA 4OFVA 4K9EC 2OTUB 3FQXA 1C08B 3P0VL 2I60H 2HKHL 1JGEA 1D3CA 2OTPA 1I1YA 1J05A 2VIRA 4YK4B 5B38A 1UWGL 4DZBB 1B3JA 3NIFE 2PF6A 4DGVH 5FA4B 4JKKA 4U1LB 5F7WC 1D5XA 4BSVA 5HGAA 4PJAE 3NZHL 2E8ZA 2HFGH 3BD4A 2CDFB 1KIRB 1ZKAA 5JXED 3ZKQD 4C56B 1U8HB 2RFXA 3K74B 1ZLWK 3KS0J 1FFNB 2VLJD 1CLYL 4HF5L 1MCFA 1HZHH 2YK1L 3BP4A 4PJHF 1A64A 3KPRB 4WV1C 3QPQD 2FEDC 4WHTA 1EHLL 2BY2A 2FL5A 5KSAD 4G80A 4LQ1A 4DZBA 1FNFA 1ZT4A 1WISA 1LVEA 5DJ0A 1MFDH 3RPIA 3QHZH 4YHLL 1VGKA 4LEOA 4KHXL 2ORBH 4PB9H 4XXCA 4UDUB 1HILA 3TGXA 3NGBC 1SQ2N 4RZCA 4WHYG 3QISA 3BD5A 5ITFB 3RVXC 3G5ZA 5DD3H 1S9YA 1F4XL 3C6LB 3QUZC 2DQTL 2VLKD 4DN3H 4W81A 5BRZD 1J5OL 2YPLA 4PV8B 3G5XA 4X4XB 4XPAH 2C3VB 5GS2D 4NN7C 1ZT7A 3I6KA 5KW9H 4NQVB 3HHRB 1W72B 4KI5E 1D5MA 4AQOA 1H8OA 3TNNA 2DQTH 1U6AH 5GHWL 4JG0H 1I75A 3EOAB 1DCLA 1V7NH 5LGHH 5I8EB 5AG8A 3P4OA 5CILH 3NCCB 1FN4A 4PRBB 2VUOA 1ZT7B 1RPQA 1T1WA 3RDTD 5HYSA 2F5AH 2VNCA 3QUYD 1BQSA 1ZHLB 5ISZB 1YZZA 2VAAA 3C6LA 2ED7A 2NLJA 4Z7UA 2D31B 2UUDK 5IVXA 4J3SA 3BGMB 2VWEE 3MGAA 3QG6B 3MC0A 4JZOA 3OKEB 1S7UA 1W0WB 4UQ3B 1I3GL 3TCXA 3MRJA 4H25B 4JFHD 4M8QB 4TVSa 5DMKA 4KWUA 2VXQH 5C0AB 3RVUD 1AR1D 5HYQB 4UBDD 4HWBH 1OAUH 4NN6B 1FNEB 4PJFF 4TUKH 2ARJB 4O58H 4IDJL 2F53E 5FGBA 1FDLL 2BHZA 5CCKL 2GTWA 3MXVH 3K8MA 2W9EH 1DSFL 2H6PB 2WBJB 4TVPE 1T89A 1CU4H 2IAMC 2E5EA 4WWKB 5D1QD 2AXGB 5E99L 1F4YL 4XNMB 3ARFD 4X7CC 3H7BA 3B2UC 3FOMA 1L7TL 1T04B 1AD0A 3LY6A 5FOBB 5TF1H 4KZDH 2AS5M 5HGAB 5GJSL 2EXYD 1M7IB 3VWKD 4HFWB 3CSGA 4UV4L 2Q7NA 1AH1A 4O51A 1NUNB 1YYLL 3VD9A 3VXTB 4BZYA 2D9QB 1Q9WB 5JO5A 1J8KA 5KBNC 4FQ1L 4FQXC 5D5MA 4P9HH 5KSVA 2H9GA 1OGAD 5IW1A 3WCYA 1BGXL 1JPFA 4PBWD 3BQUC 2MWCA 4LKCA 2G75A 1JPFB 3SOBL 5IESH 4HKZA 3BZ4A 4X9FA 3D85B 2IANA 3FRUA 2QQNH 1T7XA 2HJLB 4FFWD 3VRIB 1CZ8H 4L1HA 3DTXB 4IDJH 1NAKH 3JV4B 4R4NC 4C56D 2VXTH 3WDIA 1SYSB 4DUVA 3BD3A 1Q9WA 3UPAA 1ADQH 1TCRB 3CFEB 3RZWA 3JVGA 2VO5A 1NBYA 3HI6L 4RFNC 4U0QB 2BOCA 4Q74A 1QHPA 1VEOA 4UIKH 5KSAA 4D8PA 1DQQB 5ICXA 4OAWA 3HMXA 5CGYD 4A2MA 4PRNB 1HE7A 1IAKA 1KOAA 4NNYB 2OSLB 1RQ5A 2BNQD 1NGPL 5FA3A 2YEZA 1QLEH 5C07E 4KZDL 2H41A 1GOFA 4MAUH 1G7HA 3FHQA 5DUML 2L4OA 1KTLB 4PBXA 5MEOB 4S1SH 3NCJH 1KELL 5ITBL 1XGQB 3JZ7A 1S7TB 5D1ZD 1F11B 2ZCHL 1T2JA 3VWJC 1LP9E 4ONGL 4JM2C 2ICEB 3C09C 3X3FL 2HRLA 2R1XA 4P2OC 1HKLL 2VLKA 2XY2A 4QXUL 4WU7B 4S1DD 5B4MC 3O4LD 2IAMB 5CJ8A 1AC0A 3KLAB 5CJXC 1J9CT 4NYLA 4RGNB 2B0SL 2LE9A 1P4LB 4QHUA 3NAAH 1L6ZA 2GYSA 3CIQA 4XH2B 4NWUH 4GKSA 4IS6B 1LDPH 1FRGH 1SVZA 3R06A 3VWKB 3MRQB 5BW7A 2YZ8A 1JF6A 5I8KL 1YEDA 3BWUC 1X4XA 1LO5B 2GHWB 3CSBA 1NFDF 4R8WL 1KLUA 1Y6MR 2EH8L 4JLRA 3TJHC 3UPRA 3ARDD 1B4RA 4JFZL 3UZQA 1A9BB 1K6QL 3PGDA 4JDVB 3LRSA 2F15A 4YO0B 3W11D 1NGWA 1IT9L 2LTQC 3RGVA 1I1AC 1EAJA 5BQ7A 1FN4B 4JY4A 4HMCA 3HAEA 1DFBH 2BSSA 5C0BA 1A3LH 1CDHA 2EC8A 1U0QA 1EEQA 3S37X 5EN2A 1LILA 3GSQB 1QSFB 1ZS8A 3HPJB 3INUL 5HYFA 3GBLA 1JPGA 4U1KA 1AE6H 3J7HA 4Y89A 4NKIL 2Y7QB 1DFBL 2W65A 2ZG2A 3LEVH 4JQXA 3TO2A 2H32A 3DYOA 5BOZG 3IDIA 4P46C 1LK2B 3WLWD 3MUGA 3EGSA 3TYGL 3SKNB 1TJGH 2A73A 2VOTA 4LSQL 5KVGH 5DI8B 3ZE1F 5ITFA 2ID5A 3PE9A 3H0TB 1QFOA 5KJRL 1V05A 4RMVA 3WNOA 4OGYL 1N59A 3OKDA 5LAXB 5FO8B 1VADA 4NQDE 3W5NA 2D7QA 5F9WB 5KAQG 3O6KH 3BJ91 3ILPB 1WAAA 3KPRD 3GSWB 5HHOE 5INDA 4EVNA 4KJQC 4WNQB 4PRPE 1X9QA 3F7QA 2DN7A 4HT1H 4BA8A 5KN5A 3LKSB 5IFHL 3P0YH 4M1CD 4LCCB 4OD3H 3KPNA 1U95A 2DDQH 1IVLA 5K9JL 4L9LA 5EOQL 3LEYL 4LIQE 4G9FD 1WZKA 1BLNA 1T1ZA 4ODXB 4HS8L 3EO1B 1LMKA 3O4LB 3EAKA 4O5LL 3GO1H 3MLZH 1U8HA 1PZUB 1AC6A 1FAIH 3GSUA 2GAZA 4KPHH 1FL5A 1YECL 1J0JA 2PYEA 4Y4HB 1JNNH 3I3DA 5IIEB 1W8OA 4JFFD 1MF2L 3GSWA 1D5ZA 4EVNB 2GSGB 1Q38A 5EU6B 3ARDB 3ALXA 4XCYA 5GGRY 2AABL 4ZUTA 1ZA6B 4TULH 4P2QB 3VDBA 3WFBH 4MXWH 5D2LF 5LCVH 2WWMC 2WNGA 3RVTD 2D3VA 3X17A 5DURB 2HFEA 5GRYA 3Q6FA 4LQFL 3ROLA 4UUJA 3QZWA 4OFYA 5CGTA 5HBBA 1K4CB 1IC5L 3INUH 2CH8A 4LARL 3L5WB 1Q72L 2HVKA 3MRIB 4FABH 1X5IA 3R0NA 4X6DF 2WINA 3QUKB 5JQ6H 1A1MB 1RUML 1N7ML 4Q6IB 2YD2A 1PYWB 5KVEL 4X7TB 3N50A 3EYVA 4FTVA 3ZDZE 3OAZK 3O3EB 1E0OB 2VLLA 3NVQA 4MVBD 1FGNH 2ICES 5D7IF 5HHVL 5D96B 2BNRE 2HLAA 1DLHB 3JVGC 1IEAB 1AGEB 4K94L 1MCIA 2ZG1A 5C0ND 5A43C 3PQYD 4TQEL 2G2RA 2MPAL 3SY0A 3U1SL 2DD8L 1A6WL 4CUCA 1MVFA 3SHSA 1NC2B 1HILB 4WWKD 1OSZB 1S7SB 5JORA 1L4IA 4NHCH 5HYJB 2G60L 4LF3B 2BXZA 4OJFL 3KLAA 1BVZA 4Y8DC 4KHTH 3JWDL 3O6FB 3CLEH 2MCG1 1X5FA 5EA0H 4CVWA 2ZUTA 3C2AL 2R1XB 2I07A 1A6ZB 2F53D 4JM2A 2WLZA 4P4RB 1HYRC 2P46B 1IAOA 5JPMB 2Z93A 1I1CA 5BV7H 4M7JL 3QXWA 3U4BH 3WN5B 1K3IA 2ERJB 4AM0A 2GAZB 1I85C 3G9VA 4PJ8C 3I2CL 4HWBA 1FZJA 2FO1A 3F6LA 1T1ZB 4KH2A 5ID1A 1FRGL 2BNUA 3RRQA 4EQ3A 1ZHKB 2J6EL 4RFOH 1MH5A 1DANT 3QDME 1OSPL 5EU6E 3W5MA 4K9EL 4XVUD 3ULUE 2IPTL 3T65A 4BUHA 4G7VH 1U95B 3HZYB 4P5KB 4PG9B 4YGVA 3CXDL 1WIOA 4X4YB 4EN3D 3OF6D 3KJ6H 4GLRH 1JF5A 4V1DA 4W4NA 2ARJQ 4ALAH 5DTFB 1C16B 3KPLA 1QLRA 3MRMA 3DGCR 3VD3A 3B8YA 4OKDA 4JKMA 2B7DT 2QV2A 1ONQB 1BQHA 4UIMA 4MNQA 4M5YH 4LAJH 3VH8B 1WBZA 1TZIA 4PRIB 3IDIB 1RUAL 2VRAA 3TO2B 1RSFA 5CBAB 3MNWA 1BWMA 1FNSH 3U0PA 3MOBH 3UTZB 4CRPA 2VTFA 4DW2H 1RZGB 3TN0C 5CZKA 1DL7H 1EFXD 2GEEA 3VGBA 2KZWA 5JPNA 1N0XH 3EDJA 1U91B 1A5FH 4XBGB 5BQ7B 1P6AB 2R4SH 2WUCL 4XHJD 3RGVB 4LPCA 5SWZE 2FSEB 2Z35A 3T0EE 2JJTC 4X6DE 3FRPG 1S7SA 4F7MB 5I6XC 4YDJB 1QFWL 5ETUB 4OM1L 1G9MH 3T0WA 1JHTB 2DQUL 2QQKH 1OARL 1J8HB 1LE5A 1BVKA 4PYGA 3DRQB 5IHUL 1MRFH 5AD0B 4AEEA 1GCFA 1NCNA 4PJ9D 1NSNH 3A6CL 3RGHA 2D03L 1YDPB 4Y5YB 2ARJA 3LHPL 4FZEL 4Z7WB 1BF2A 1PFCA 2VXQL 4FNLH 3E6HA 3B43A 4E42A 4QRQA 2XQYG 3BP5B 3O2DH 4YXKH 1FP5A 2HT2C 5F88B 4N9OB 3QCVL 3VFSA 3GMRA 1NBZB 1FFQA 4HT1L 3RY5A 3VI4F 3BPLB 4V1DE 1BZ7A 4IDLA 3ZO0A 1A7OL 5HYSB 1KPUA 2DKUA 5EZJB 3ULUH 2VC2H 4KK5D 5DJ6B 1DLFL 4ZOEA 5J4MA 2CDGA 1IAKB 4NNYA 1CGYA 4JO3H 4N0FB 2DBLH 4D8PB 3D18B 5BO1L 4PJHB 2HWZH 1FO0L 4X0KB 4K3JH 1BOGB 5IB5A 4Z76A 4OB5H 3CMOH 5IIEA 5SX5H 2CLVA 5EORL 4UTBH 2V5TA 25C8H 3M1BB 3STBA 1RUKL 1R3JA 2H26A 1OGAE 3EYQC 5DMYA 5C0JB 4PR5B 3TV3L 2DJSA 1FYTA 3VFMB 5ITBH 3NFNA 4UB0H 3SO3B 4Q9RH 4WEUD 5D2LE 1KTDB 4ODXA 5IVXF 5GSRA 1OT2A 3MREA 3NIDE 3VWJA 3JTTA 4Z78A 4GQ9H 3VA2C 2RB8A 3B4NA 2Y23A 3M17B 3C5SA 3U9UA 2MFNA 3TBSA 5D5ME 3WIHH 4OI8A 3QEQB 3C2SA 4WNQA 3MV7B 4LCWE 3IU4L 4DZ8A 3TCLB 3AS0A 3PJSA 4NKOA 3RVUC 4WGVB 3LQZB 1DQML 5JOPD 4PD4K 3SGEH 1DLFH 1SY6L 3UO1L 2K3TA 4GBXA 2ENSA 2RFXB 4NZTL 4QLRA 4R4FL 3OXRB 4HGKC 4PTTA 2WBJD 2ZUQB 1NJ9B 4OCNC 2A73B 3HR5A 2VYRE 5C7XH 4X5WA 1KIRA 2EDTA 4JPIA 3QI9A 1WF5A 2OTWA 3TT3L 1JHKL 1TPXC 2ENYA 4YDLC 2CMRL 1U8PA 4PRID 4LHJB 5GGQL 5JIIA 3QT2A 2AJVL 2UWEA 1NGYB 2ZKHL 2WIIA 1TVHB 4KDVA 1QZ1A 2R15A 3ZTJG 2VAJA 3QR2A 1B4JH 1XAUA 3B3IA 3FB5B 3AROA 3STZA 1CDYA