1T6WA

Rational design of a calcium-binding adhesion protein nmr, 20 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
RDSGTVWGALGHGIDLDIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILNKALDLRILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein XP_346638
publication title Design of a calcium-binding protein with desired structure in a cell adhesion molecule.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2004-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1t6wA00
1YEIH 4C56D 3E3QE 2XFXB 2YSSB 2X09A 4HF5H 5B8CC 4ZUSB 4NQXA 4FP8L 1EVTC 2W9DL 3L7EA 1F00I 2JB6A 3MCKB 2YZ8A 2BOCA 2HTLC 4KK5D 1KEGH 1R3KB 3JWOH 1ZHBB 2EH8H 4KU1A 5E24E 4Z7VF 3RUGE 1TCRB 2E7BA 1JGVL 5DHYA 1WC7B 2E6QA 3TO2A 4J3TA 1IL1B 1AGEA 3RVVC 4WV1C 1MLBB 4Q97A 4ZUVB 1W72A 3ARSA 1YYLH 4N0UE 1WWBX 5K9JH 2R0WH 4XGZB 3TEUA 3ARDC 4KI5E 3WS6C 4JFXA 2AV7B 3LB6C 3OGCB 4GW4B 4XWOC 4OFPA 4KMTL 4RMVA 4MSWB 2NW2B 4I18B 5IROA 4NZUH 5LGJB 5HYJE 3E6HA 4R4NC 1MI5B 5T1KB 1JWMA 5HGBA 4G43B 1JGEB 3R4DA 2P24A 5D2NA 4MA3B 3LVEA 4TNWK 1GPOL 2MTPA 3T0BA 3C8KB 4PYGA 4FMKA 1VFOA 3BD4A 3D9AH 3QCVH 1KCRL 1T21B 2DKSA 1XF3B 2VB5A 4XPBL 3EYOB 5HHXL 2K7QA 2FDBP 3WIIL 2V5RA 1E0OB 1MPAH 1R3LA 3KXFD 4KC3B 4U1SB 1MRFL 4NZDA 1FFNA 4Z78A 3WNOA 4WI3A 3IDYC 4M61B 1J1OH 1VGEL 5D1ZA 2YPLE 2G9HA 4QF1A 2CLZA 1TJGH 2RR3A 4KV5E 2YKLL 3ILPB 5DJAA 2EDDA 4BZ1L 3O2VH 4KI5F 5EN2A 3DMMC 4Y5VB 2NY0D 4CVZB 1CK0H 4XP1H 3TCLA 3HUJA 3NIGE 3RIFK 4JKKA 3MOBL 4ONFL 4S0TD 4V1DD 5IMOB 3IYLW 3T0DA 4BZ2L 1BPVA 1GYAA 5HHOA 2FX9L 3CSPA 1QSVA 5L6YL 1J12A 2P7TB 3IDIB 3GM8A 2FHFA 4F9PA 3MUJA 3QI9A 4PJFB 1KUMA 3SO5A 4C56E 4EI6B 4R3SA 4Y4FD 3RY6A 1JUFB 2WWKO 3DSFL 5ENWB 1MCLA 4OFIA 5AWNH 3CSYA 3HR6A 5GHWL 3KPRB 1CFBA 1M7DB 1CFSB 3N85L 2RFXA 3LIZH 3UDWA 1V7ML 2ICWI 1XH3A 3GMOB 1BBJA 4HSQA 4IRZL 5IF0A 4NQCE 1QVOB 3BPCA 4EBQL 2MQ3A 3RIAF 4KGJA 5K93A 2GYSA 4K9EL 5HVGB 3SGKC 3SDXE 4D0BB 3VA6A 4ZUUB 1TZHB 1S7VA 4Y5XB 2K9UA 2DI7A 5ANMB 2IH3B 1MRCL 5MP6L 1HILB 4YZFF 1NLBH 4QRQB 1S7RA 1J8HA 5T33L 3SDYH 2BZDA 3LS4H 3QAZC 4KV5F 1MFAH 2I5YL 4WFHD 4BFIB 5LAXA 4GO6B 4U6HB 1IGIL 4YX2L 1TXKA 4Q9QH 1A4JA 5IFHL 4UT9L 4KJYA 3NIGF 3CU1A 5IROC 5C0GB 3RWEB 2GJ6D 3ABZA 4Y0GA 2F53A 3V7MA 1VACA 5ACMA 4KROC 3CFIC 5DA4A 4MXQC 1FVEB 1I9EA 1B0GB 3PG2A 5E08L 4WI7A 1SJHB 3VGAB 3ZTNH 4P57A 3L5XH 5FO7B 4G7VH 5D2NC 1J8KA 1WICA 1NGZB 4E0RB 1XGYL 1MQKH 1D9KD 5T3ZD 1A02N 4IOFD 1RIVH 2AK1H 3N06B 4OLUH 1RIHL 2QHRH 4GW1A 1QQDB 2BXYA 4QT5B 5KSBE 3MLTA 3P77B 4KWUA 5JW4Q 5LQBL 5BRZD 2Z31C 1A7RL 4S1RH 4M8QA 5MERB 4MNQB 3DX7A 1KT2A 1S7XA 5C0FB 1PFCA 4RMUA 1JJUA 2JTDA 1I4FB 3L5WA 4TTDD 1DEEA 3U1SL 2L7JA 2GCYB 4X6EB 3IU4L 3L3OB 3QO1B 1U8LA 3ZHLA 4KRPD 3VFTA 3RVUD 4I3GA 4V1DE 4K2UL 3MLRH 3WNLA 5CUSH 1ND0B 1I1YB 3L3JB 3DRQA 3MRMB 3ZSSA 4JY5L 1U95B 2D31B 4LHQB 2P8MA 2P5WA 4EQ3A 1M71B 4GOSA 5E8PB 2VISB 5A2KH 4AYFA 3CPLB 4F9PC 3QI9C 1JWSB 4G8FB 3OSKA 4JPVH 3JV6B 1IKFL 5DC9B 2WWMD 3ZKNC 3O11B 3NAAL 4LPYA 4Q2ZB 4ZPVB 3S4SB 1JNLH 3LZFH 4M5YH 4WO4C 1D5BA 3ARBA 3LKPB 3ZDXE 4PUBH 3TA3A 1BOGB 3UDWC 1FNAA 1NMBH 5C2BL 5M94B 1PSKL 3G5YA 4QEGA 5ETUA 3H0TA 5B39G 5IMKA 3KNBB 5D6CB 3KXFB 3B2VH 5KSBF 1P5VA 4M43L 1CICB 5D7JD 2BSSA 3AS0A 3RVWD 2DL9A 2F54D 2V2TB 5TE4H 3LEVL 3IKKA 3U0WL 4M00A 4CADB 5IBUB 3DETC 4XVSL 1ZKAA 4GUPA 3UTSA 3DVGA 4KXZI 1U92A 1NCDL 3O9WD 4F33B 4QHUB 2OCFD 4LASH 5IK3B 3BIKA 1YPZA 1EEQA 1E4KA 1ZWIA 5TQ2H 4ZS6D 3QXAB 5J4MA 5FOBB 3MR9A 5LG1A 2GJZA 4HWZB 3GRWL 4D3CL 5E2WH 5B38B 2FEDD 4QWWD 4OF3A 3ECBB 5TDOA 3CD4A 1KPRB 5GJSL 5HY9A 5ACZA 2R1WB 3BZFA 3DWTA 1S7TA 3IF1B 3V6OA 3CZFA 4Y4FB 3VH8G 3UBXG 1G9EA 3PL6A 3I6KB 5T3ZE 2QADC 1EO5A 3CC5A 2UVFA 5D72H 1FBIH 4EXPX 3P73A 3WO4C 3P40A 2P5EA 1I9JH 1S78D 2C3HA 2VITA 1DL7H 3ZDXF 4NQSB 1YYMH 4HPOL 3D3VD 2OX5A 3BP7B 3UYRH 1LP9E 2QSVA 1KIRA 4NO5A 1UM4L 3BKJH 3QPXL 2YRPA 1MFBH 5IOPA 1DN2A 5BRZE 5L2JA 2EDWA 4N8VG 1ORSA 4YXLH 2CDFA 2Q86A 3QXDA 4YQXH 5IEKA 1B2WH 4XVUC 3LKOA 4YHLH 3MOQA 1OVZA 3HG1B 3UC0L 5FO9B 2C4XA 3V5HB 1P7QA 5T1LD 3JV0A 2XKNB 3TT1H 1JPST 3BXNB 2GITA 4KDTA 4YDVB 2A73A 5ITFA 4MWFB 1XR8A 1TTGA 5T1MA 1U2CA 2GJ6B 5ESVB 5F1NB 3GSNH 3H7BA 2CRZA 2NY6D 2VXTL 5DQ9B 3EOAA 4M5ZL 3T2NL 1ZGLP 1BAFH 1TVBB 4GJTB 4PJ7A 3HC4H 2A6KB 2Y06L 3BPOB 5CIPB 3U4AA 1JWUB 4QGTA 2ZSWA 1CLYL 4K71B 3T08A 1GGIL 5I17B 2AKRB 4CU6A 2Y9RT 5IB2A 2APFA 3MV9D 1GAFH 1VDGA 3IDXL 3RL2B 1XF1A 2B0SL 3ARBC 1P4IL 2P8PB 1K2DB 3OMZA 3DVFA 2EH7L 2B20A 3OF6D 3TA3C 4PJIE 2QSTA 3F6IA 5IESH 3LQAH 1L0XA 5FK9A 1LP9F 3OB0H 4PV8A 3QCUL 1FO0A 3B9DA 3TPUA 3M8OH 2WWKT 4KAQL 1IAMA 5BV7L 1AJ7H 1A6UL 4KHXL 1AXTH 2WIIA 4HKJA 3D5OF 4PJXB 2GY7B 5HDQL 5I66B 4PJXF 1XGRA 2EKSB 1P6FA 4F3FA 1GZPB 3G5VA 3QXWA 4KRPB 4OCWH 5FCUH 1YQ2A 3WFEL 5DJ0A 5MEPB 4NNPL 5I73B 1LO4H 3DUSA 3SCMB 4OUUA 4U6XA 4WWKB 1EUTA 1P7KB 1IC5L 3X13A 4OIBA 4UQ2B 5C0AE 1QP1A 2YD1A 1YMMD 3PIQB 5C0ND 4S1QL 1FZJA 1FRGL 3IU3A 5CWSB 4RMTA 3UTOA 5HBBA 3SQOH 3VI4E 4KGLA 2YWYA 2BNUA 2ZCKL 1QNZH 5CSBA 3QDJD 4NZJA 5DK3A 3MLUL 3NCYS 4XAWL 4XCEA 3FRPG 5KN5A 3IJHB 3TT3H 5L2KA 1QRNB 3QHFL 1CL7I 4PTUA 3U6RB 1BJ8A 2Y7QB 3FTGB 3MGTB 4RNRA 2WLYA 1Z9LA 5LGHL 2M1KA 1OTUD 4L4JA 1ZLUH 4Z77A 4N5UA 1OT2A 2P46B 2F54B 1YEKH 5L8JB 4PJGB 4WW2B 3UZEA 4MCZB 3WFCH 1EO7A 5E4EC 5FKAB 5JOFB 1MCPH 4MDIA 3W39A 1KN4L 1G0YR 4H8WH 2PYED 5TDNA 3BX7C 4ZPTB 3O9WB 3WFHB 1I7UA 1QBMH 4ERSL 4W6XB 2IALA 4Z76A 1P84K 3TN0B 2DICA 3HNVL 1TJHH 1M1SA 4GLRH 4KDTC 4EEEA 4NGHH 5KANI 1A7BA 2XFXA 2YSSA 4YHIB 5CJ8A 4FQ1H 1F42A 3VD4A 4ZUSA 2R0KL 2NY5H 3RA7L 4PPTA 5IB3B 3CLEL 4LVOC 4LSUL 3QJHB 3S34H 4WI8A 1AO7A 1E6OL 5LXGH 1JHKL 1AGBA 1R3KA 2AABH 1E4WL 1ZHBA 3S96B 4Z7VA 3SHSA 4YGVA 1P4BL 4POZC 1WC7A 3IFNL 3B8YA 4P2CG 1IL1A 2AK4A 4OD3H 4OFYD 3LQMA 1MLBA 3VWJD 4ZUVA 1RHFA 4HGKC 5D1QD 1YEJL 4MD0B 3D3VB 2DBLH 3MUGB 1ZT7A 2ZZUT 1KLFA 4XGZA 2OQJB 4OD1H 5IJVB 2XTLA 4Z7UE 5C09A 2AV7A 3OGCA 4GW4A 4TVSa 4M9OA 1IGYA 1CBVL 3M07A 5J11C 1Q9OB 3V0AC 4EIGB 1QO3B 1QFWH 1OGAD 5JOPD 2NW2A 2WQ8A 5LGJA 3QUXB 1MI5A 32C2B 4LHUA 1CGXA 5JR1L 4K7FB 3QUZD 3V8CA 3ETBF 5T1KA 4G43A 1JGEA 4AEHH 2DLFH 2OL3H 2R0LL 4MA3A 3WNPA 2EDEA 3G6DH 3C8KA 4FABH 1FAIL 4BFBD 2AGJL 1T21A 2H3NA 5LJYH 1XF3A 3O6FD 3FQNB 4R7NB 4R9HA 1HIML 3DSNA 1DQMH 3MRGB 5TJWK 3OB8A 5CD3A 4O2CB 3DUUB 1SQ2N 1S9YA 4FQXD 4U1SA 4X0KB 1TQBB 1WIUA 2NY4D 4M61A 3HMXA 1S9KC 3QP3A 2L0DA 3S5LB 5DTFA 1N0XH 4NWTH 4FNLL 5IEHB 3ILPA 3S88L 1LNUB 4RFEA 2AAVA 4MQTB 5A1AA 4Y5VA 4U7MA 3B83A 4U1JB 5F93C 1GOGA 4CVZA 4E9LA 2CMRH 2IGFL 2EECA 2UVEA 2ZWLT 4KTEL 5E2UH 1PYWB 1N4XL 4XMKH 4GXVH 5HI3D 3DRTA 5JZ7C 2AJXL 3ARFD 1GZQB 1RZKC 3WDJA 2P7TA 3IDIA 2W0FB 2VZ1A 4MXVE 4PJFA 1ITCA 3MLVH 3KHQA 1H9VA 4EI6A 1MF2L 2KUTA 3HFMH 5ENWA 2X1WL 2ADIB 4ODWB 3TH4T 2D9QB 3P0GB 1FC2D 3LPFA 1CFSA 1U6AH 4M48L 4YHOL 4NO0D 1K4CB 1YMMB 3GMOA 3QWQB 1DBML 3O6MH 3VDBA 1JV5B 5HHMB 4HBQA 1GGBL 5EBLB 3TNNA 4GG6E 4BUGA 1QEWB 1C1EH 1QVOA 1N0LA 2FGWH 1XGQB 5E56A 1BZ9B 2AJSH 1ZAGA 3I2CH 4D0BA 4ZUUA 1L0YA 4OSUH 1IAII 2C4FT 2HN7B 3QDJB 3RVXD 3V9FA 4Y5XA 5ANMA 1X5XA 2IH3A 4S1SH 5IMMB 5GGVL 4JPWL 5DR5H 1HILA 3KS0J 3ZE2F 1P53A 3ELAT 4JFHE 3TJHD 3T2QA 2CUIA 3G5XB 4ENEC 3THMH 4X4ZA 4HF5L 1G1CA 5IHLB 5D4QA 1OGAE 3BN9C 5DEFB 5JOPE 4BFIA 1R3JB 4U6HA 3ZKMC 3DROA 4BK5A 1KEGL 1A2YB 4PRHE 4NM4H 1X5ZA 5INDB 1EHAA 3JWOL 5C0GA 1HYSC 4EN3D 2Y36H 1NBVH 3DGCR 4Z0BH 2EH8L 3RWEA 4E41D 2CKBB 4NT6B 3BKYL 2F8OA 2JKXA 2GT9B 4Y1AD 5ERWB 5GS2H 1FVEA 3O3BB 3S37X 2H41A 2EIEA 4MXVF 1CIDA 4C56A 4PV9B 2IAND 2VE6B 3U7WL 3BZ4B 5AUMB 5FO7A 5AG9A 3QDGB 5KSUB 3X12A 3EDEA 1NGZA 3RTQB 4E0RA 1YYLL 5FA3B 4I0PD 1BVKB 2NY3D 5SX4H 5EIVA 5K9JL 1NCBH 2QSCH 2EDTA 3W9DB 1LHZA 1FGNH 5C7XL 2AEPH 4FN0A 4HIHA 4ETQA 1JPTL 1IGCH 4GG6F 4NZUL 2VERN 1A7PH 3P77A 3O6LH 3S3SA 1WVZA 1ZV5A 5MERA 3KHOA 3CIQA 3ZE1E 3ZO0A 5MEND 4PLKC 2XICA 5T5FH 1I4FA 1A3QA 1YEFL 2H32B 4X6EA 2GCYA 3U36B 3L3OA 3QO1A 2ICWB 2HLAB 3D9AL 5IBTL 4KI5C 4GAYA 1KC5H 1MHCA 1C5CL 4JFDD 2F9BT 1F3JB 3RP1A 3RX5A 1N59B 1I1YA 1RK1B 5I1GH 3L3JA 3OAZH 1ZHNA 3BKCL 4B53A 1U95A 5E70A 4XPTH 2OJEB 5HI4D 5SWQB 1M71A 4HMEA 5MEOB 4TNVF 5FYKU 4UBDC 1JI2A 2VISA 1ZTXL 3ZYOA 3CPLA 5E7FA 2KDGA 1JWSA 4G8FA 3Q2CA 1J1OL 3O11A 1F6AB 4Q2ZA 3S4SA 1GGUA 4OGZA 3LKPA 5F44A 4ZNCD 5FAAA 5EG6C 1BOGA 3L95B 3CK0L 1CK0L 2DQIH 3IDUA 3BZEB 1UQSA 3KXFA 4IRSD 1S3KL 2ADFL 1CICA 1F4WH 4HFWA 2YN5A 2V2TA 1W8NA 1V3KA 5JW5B 4CADA 3KDMB 3UJIH 4QXGH 3MV8B 3F65A 1LDPH 4HGWB 4JRXD 4Y5XC 2FRGP 1RAMA 4NWUH 3T0WA 2F74B 1ZA3B 3ARQA 4QHUA 3ULSB 1IJ9A 1CT8B 1R3HA 4JHZA 1WWCA 2XTJD 4NM8H 3WLBB 5ISZE 4Y2DC 5FOBA 4ODHH 1I8LA 2ZNWA 4HWZA 4Z9KB 1UYWL 5DLML 1KB5B 4MAUH 5B38A 4E41E 5K59E 4M4PA 3ECBA 2YXFA 1G9MC 3ARFB 1KPRA 4Y1AE 2R1WA 3D18B 3K81A 4POUB 3TWCH 2YUVA 3IF1A 5DMGD 2CK0H 4HAFA 1JPSL 2OMNA 2IANE 4AM0B 4BA8A 3CFCH 4U0QB 4Y4FA 3QFDB 3VGAC 5IB5B 3I6KA 5DJ6B 4UTAL 1AFVH 1T6WA 4P99A 4RA0C 4CL7A 1U8KA 4MJID 2APVA 1NLBL 1KBGH 3LKQB 1UKTA 4NZRH 3G6AB 3ALPA 2BDNH 3LS4L 4OZHE 2C1PB 4KK5C 1MFAL 4NQSA 3BP7A 2P4AB 3OXRB 1FNSL 4EI5D 5A43C 1XCTA 1DFBH 3DTXA 5EB9A 3GSRB 4X99B 2G5BB 3MZGB 2C1OA 2FIKB 3ZYZA 4KY1H 3DARA 2O5XH 4LF3B 1G7IB 1EZVX 1S9WB 3HG1A 4WI5A 5FO9A 3V5HA 3L5XL 2EO9A 4XB7A 4N9GB 5E8NB 3I84A 3PQYE 2XKNA 4G7VL 3BXNA 1VADB 4OLXL 1DBKH 4DK3A 1B9ZA 3JUZA 1ZLSH 4JFDE 1CE1L 4S1DD 3LD8B 2AK1L 4MWFA 2QHLA 5C8JB 1NBQA 2A2QT 4RAHA 2GJ6A 2ICWJ 1KXVC 5ESVA 3CFJB 4DKDC 5F1NA 2W65B 3QBTB 5LKNA 5DQ9A 4KFZC 3RZCB 4P5TB 4O58H 1TVBA 4NZTL 2A6KA 1QBLH 2V9QA 1K9TA 5CIPA 4S1RL 3CDGB 5I17A 4OLYL 2R23A 2AKRA 4NPYB 3ZTJG 4UV4H 2EIZB 4S2SB 4AG4H 3TBTB 4I0PB 2A6IB 2NY3B 5J1SC 4B5EA 2P8PA 5IFAL 1K2DA 3CH8A 1OQOA 4OZHF 5FUOH 5DUML 4K8RH 3JWDL 5GS0H 1KIQA 2J8UE 4V2BA 4AJ0A 3MLRL 3VXSD 5CUSL 2J8HA 2XKSA 2XT1B 3O4LD 1GGYA 3GKWL 3IRZA 5MENB 4JRXE 5E0QA 4ELKA 1L0QA 1Z9SA 5DUBA 1ZLVK 3B9EA 2MSPA 3B5HA 4ONGL 4PJXA 1SEQH 4JREB 5I66A 3PWPD 2XTJE 4UB0H 2WUBL 5IG7B 2EKSA 3GZKA 1GZPA 3HPJB 1F13A 1P2CB 5DWUL 2ENSA 5MEPA 2N56A 4PUBL 3SCMA 4FFYH 1NMBL 4WWKA 1R5IB 1P7KA 1NBZB 2OI9B 1I8LC 4Q7DA 1Q9WB 3WHE1 3K8MA 3QEHB 4JFPB 4UQ2A 3PIQA 2ZSVB 1JN6A 5HYEA 4N0RA 2VLKD 5EBWA 3TV3H 4G7YH 5CWSA 5TE4L 3LRSB 4LSSL 4OCRH 4QHKJ 4Y4FC 1EGJA 4RGMB 2Q8AH 4IIQB 4ZO9A 5ADPH 3HAEB 2HJFB 3MOAH 5D5MB 3IJHA 5D5MF 4HWNA 4LASL 4OQTA 1QRNA 1RHHB 2GUOB 3A67H 3BISA 5F88B 1YNKL 5TQ2L 4O5LL 3WUZA 2Y7QA 3FTGA 3MGTA 3W2DH 5JW4N 4IRSB 2XN9B 4ZAKD 2J8UF 4X9HA 1MCCA 1UFUA 2F54A 1IM3B 2ITDB 1F58H 5IV2A 4OZIE 4WVRA 3QHZL 2MCG1 3D2UB 4MCZA 5FKAA 3VFUB 2JJSC 3GMPB 2AXFB 4JM4H 5CLWA 4ZPTA 2EDYA 3EDJA 3O9WA 3WFHA 1KIPB 4WGVB 2DRUA 3QDHA 3GNMH 1J11A 1P69B 5J0BA 2YRZA 4MQSB 5D72L 1ADQA 1FBIL 1OQXA 4N1HB 1UH3A 2DLIA 3DHMA 2AQ1A 1I9JL 2DN7A 3O6KH 4P4KD 2GKIA 2M2DA 1FYTD 3QJHA 1YYML 3EO9H 3UYRL 3JWNC 1MFBL 3C9NB 2VABB 1EO8L 4Q6YA 3S96A 4OZFG 4YXLL 4YQXL 4R0LC 2VZTA 1B2WL 4L4VD 3M45A 1PLGL 4YHLL 2B5IB 2CPCA 4K71C 1G84A 5EOCJ 2J5LB 2WW8A 4MJIB 5CD5D 3T0ED 5EZJB 1D9KC 3FB8B 4U6VL 4OLWH 4UQ3B 4IOFC 3TT1L 1MCIA 3D3VA 5ESQB 3P4OB 2KBGA 3BDYH 2OQJA 4JQXA 1AE6H 5HYSB 4OZGE 5FHBL 3WIHA 3O4LE 5I71C 1Q9OA 4HS3A 2KZ1B 1QO3A 4WW1B 3ARED 3GSNL 3HE7B 1FZOA 3QUXA 3WFZA 1JK8B 3FQTB 4C4KO 1INDL 5DT1L 4DFIA 4XXDB 4K7FA 4BQ6A 2EDKA 1U93B 3GJFB 3PWPE 1Q38A 4HS6B 3BT2H 4TTDC 1GAFL 3KPQB 2E9WA 1T66C 4N0YH 4OCSH 1F4XH 2EE9A 1IQWL 4KRPC 3DV4B 3RVUC 4OF6A 3NH7H 2XA8L 1T7YA 4CDHA 3QH3B 3FQNA 5IESL 3LQAL 5BQ7B 4ZSOE 2DKUA 3KLSA 3MRJB 4Q6IA 3MRGA 2NCMA 5CCKH 1I9IL 1L6ZA 3GMQB 3M8OL 4O2CA 3H3PH 4R8WH 2CIKA 1AY1H 1DSFH 2BY0A 4X0KA 1AXTL 1XFPA 3MRKB 5DRXB 1X6NA 1PKQE 3MV9A 1G7HA 2BP3A 2I27N 2WWMC 3IDJB 4QY8B 3QXVA 1MHHB 4PRAA 3TIDB 4GBXB 4HD9A 3PP3K 3S5LA 2RB8A 4HMCA 4OCWL 5FCUL 3MA9H 1UJTA 3NPSC 4PGEB 5IEHA 4MB4A 5ALBH 1LNUA 1UGNA 3VXSB 1LO4L 3FONB 4AT6B 2XV6B 1Z3GL 3SDDD 4X7SL 3ET9F 3ULVE 5CBEB 3V4VH 3IAGC 4OTXH 5I15H 4PJAE 3RVWC 4HPYL 5DQJA 2AV1B 2C7UB 4M1DH 1PYWA 1EFXB 5D93B 5FYKE 1TLKA 5B4MD 1JIBA 3PWLB 4R4BB 4MZ2A 2PW1B 4YHPB 3MNZB 3D0VB 5DD6B 2W0FA 3O9WC 1HYRC 5DHXB 1QFOA 1FO0H 4CMHB 4FFVD 2E27H 5I75C 2B39A 4U0RB 4DOHB 2ADIA 3IT8D 4ZS6C 4HUWA 4Q9RH 3UPRB 4XCNB 5IQ9B 3OR6A 5D7KE 2RJMA 2FEDC 3HZMB 1K4CA 4QWWC 1IVLA 1YMMA 3LN5B 2VLKB 1JV5A 3C87A 3MRQB 4QRTA 4WWID 5EBLA 8FABB 2D0GA 4H88H 3SE9L 1QEWA 5BZWA 3QCTL 4WDIB 4EQ2A 1YEKL 3QUMB 1RMFH 1BZ9A 5E2VL 2QL1A 4UOJA 2LTQC 3T0EE 2FD6H 2HN7A 3QDJA 2IPTL 5IMMA 2DM7A 2H1PH 1S78C 2UWEE 1FNLA 1TJHL 2FO4B 1Z0MA 4NGHL 3G5XA 4FQ1L 3R8QA 3VXUB 4TPRH 2NY5L 3HTLX 4JQXC 1PG7H 4YBLB 1XGPA 4JAMA 5DEFA 1A1OB 3O0RL 1RURH 3TIEB 3VGDA 3WD5L 1R3JA 4N8PA 2X1XR 5LXGL 2CXKA 3FT4A 3K74B 3SQBA 3VFGH 4PJAF 1V3LA 3JV5A 2IQ9H 2CKBA 2PYEA 4NT6A 4F57H 4WHYH 4CJ1A 4O2FB 5ERWA 4FXKB 3O3BA 4C83A 3RGHA 2VE6A 3CVIH 2DLGA 3BZ4A 5AUMA 3QDGA 4X6CB 3RTQA 2AXJA 4X6CF 5FA3A 3U0TB 5IHUH 2HFTA 1FYTB 1Z5LB 3DVNB 2DBLL 1S7WA 5BW7A 1JP5A 1KNOB 1RZ8B 1O0VA 3W9DA 2X42A 2NY6C 3BDXA 1QFWL 1S7SB 1RFDL 3P4MB 3O4OB 4Q6IC 1T5XB 1TJIL 2PTVA 2X4NB 4BH8B 4L4VB 3VGEA 4UT6H 3K80A 2WNGA 4IRJB 4PLOB 4AEIH 5I1DA 4UIKH 5SWSE 4FXGB 4PD4J 4X6BB 1L4IA 3ARXA 3NN8B 4AEHL 3L7FA 2OL3L 3BO8B 2H32A 3U36A 4RIRB 2BY3A 2ICWA 2HLAA 1OGAA 3SKUD 5I8CB 5EDXA 3HHRB 1HXMB 1H8OA 1F3JA 2C5DC 1N59A 1RK1A 2XWTB 1DQML 1XZ0B 4LLVB 1UG9A 3QUZA 5SWQA 2OJEA 1I7ZB 1SYVA 1UCBH 5EBGA 1JYVA 5I0ZA 1LO5B 2OP4H 4GAFB 4I2XE 3RKDD 4ELME 1JGDA 2JK5B 5CZXD 1C08A 5HVHB 2X4QB 1UB6B 3QWRA 1OF2B 3TH3T 3P4LA 2EXYD 2V5MA 1F6AA 5EO1B 3O6FA 1N0XL 2BK8A 2WAHA 3GSQA 4JRYB 4LKXB 4H1LB 5EU3B 5C9KA 4OGAD 4JKPL 3AMLA 43CAA 5IR1B 5I18H 3SKJH 3L95A 4WNQA 5C0NC 3OHXB 1HINH 2CMRL 4X4XA 5E8EB 1R5WA 2NW3B 1BFVL 3T04D 3BZEA 1QOKA 1RZFH 4CAGA 1GRWA 3QISA 4RCAA 4OCYH 2Z8WC 3WUWG 3SGEI 2A9NH 4GXVL 1HHGB 4B7LA 4DUXA 4WJ5A 5JW5A 1BVLB 3KDMA 4I4WB 5JA9A 3MV8A 3DOSA 4HGWA 3MLVL 2DJSA 4P49A 4MLIA 3EJJX 2ATKB 2F74A 1ZA3A 5SX5K 3S3JA 3ULSA 1KJVB 4R26L 1CT8A 1FL5B 3FQXB 1RV6X 3WLBA 2F19H 4CU8A 1A9BA 1OTUC 3ROOB 1U8NB 3HMXH 1RJYA 4I3RL 3HRZA 4TNWF 4N1CA 4XH2A 4GQ9H 1KB5A 4XBPB 1DUZB 1S5IH 2HT3C 3ARFA 2FGWL 3D18A 1VFUA 1PBYA 3EDDA 1S7QA 2AJSL 1F3RB 3I2CL 1K4DB 4AM0A 3T0XA 4OSUL 4ELMF 1H3UA 2X4UA 3QFDA 1CVRA 5IB5A 1LO3H 5DJ6A 3MRLA 5KS9E 4MGXA 4OT1H 5DR5L 1X5FA 5EFIB 3RTQC 4MA1C 2KL6A 4PJ5D 3G6AA 4NO0A 4C4KT 3HNTH 4F8TA 4WENB 2IPUG 2C1PA 1A6PA 5I8KH 4NBYB 1CDJA 2K1MA 2YOCA 2VXQH 4K3JH 2NYYD 3OXRA 5EO9B 4YR6B 3IETB 5D9SB 2BVOB 4NP4H 4NM4L 4TUOB 1RZGA 2CUHA 2JELH 4DTGH 2Y36L 1NBVL 4Z0BL 2IBGA 4NQVB 3O81A 1DQLL 4PRPD 2FIKA 3VWJC 1G7IA 2XQYG 5D1QC 4EKXA 4WEBH 4N9GA 2HH0H 5E8NA 2VLRD 4LIQE 1XCQB 1VADA 2VLJD 2HP4A 3JTSA 3QDAA 5EPMB 4YK4B 5C08D 2DQFA 2XA3A 2A77H 2HJLA 5C8JA 3WFDL 5F89B 1ORQB 1AGDB 4EN3A 3CFJA 4YHNB 4M93C 4Y1AA 1IGCL 2W65A 4LARH 3RWIB 3B8SA 2UZIH 2B4CC 3QUZC 5GGTA 3O6LL 3RZCA 1J86A 4JDZA 4YHYB 3KPSD 1UA6H 4QTIH 3CDGA 4NN7B 2P1YA 1UXWB 4NPYA 3LKNB 4X7EC 3MFGB 4MHHG 2EIZA 1G9MH 4MNHB 4X9FA 1YC7A 5ICZB 4I0PA 1A1MB 2A6IA 5KS9F 4LU5H 3N1GC 5T5FL 3SO3B 3O6FC 3MJ8A 3VFWB 4Y19D 4Y88A 3KYOB 4BZYA 3SE3C 1INEL 3QR2A 2UV3A 1FE8H 4CVXB 5ID1B 1JZ6A 3KJ4B 3EUUA 3GMRB 4FQXC 3CXDH 4XPTL 5MENA 2NY4C 3LCYA 1CGUA 1DANU 1ZVSB 3HZKB 3PHOA 2X4RB 4RBPK 4DQOL 4FQLH 5IG7A 1MCJA 1JTTA 4HH9B 3GI8H 3TVMD 3HPJA 4G5ZH 1P2CA 2OK0H 1IC4H 3B43A 4DVRH 4DW2H 3ULVH 4LSRL 4GRLD 1R5IA 5F9JB 5EORH 1Q9WA 4XPHH 3KGRA 1JPFB 2I60H 3QEHA 4JFPA 4OKDA 5CEZE 3CSBA 1N26A 1NMCB 3ARFC 1GC1H 2FBOJ 2I07B 4XAKD 1RU9H 4TOYH 4JDVA 5C2UB 3PE9A 1QACA 3V0VB 3MJ9A 1EA9C 3RWJB 2CK2A 1F8TH 1ULVA 2DF3A 4J3OC 1F4AA 1W0WA 3UJIL 4YFDB 4KVNL 1HN1A 4G6KH 2QR0A 1LDPL 1QSFE 4IIQA 4NWUL 3HAEA 5DZLA 2X1PA 2XRAL 5D5MA 5EUOB 3WDHA 4JO4H 5GSRB 3CMOH 4K7PL 2WQRA 3FOLB 1AR1D 1HHKB 1RHHA 4M3KB 5AZEH 3P4NA 5F88A 2YUWA 2J8UA 2XN9A 4IRSA 1FL3B 2XPGB 3ZT7A 3G04A 3V8OA 4P59H 1IM3A 3HI1B 4PRPE 2NLJB 3W0WD 4JY6B 2BVQA 5IVXE 2O93L 4XP9H 4YNYB 4G6ML 4LBEB 1H15B 3D2UA 2IFFL 1NCAL 5DJXB 3L3HB 3RVXC 1BM3H 4JRXA 3VFUA 2WP3T 3GMPA 2AXFA 2CK0L 2EDXA 1RJZB 3UYPA 4DGVH 1IEBB 1Q9KA 2VLRE 3CFCL 4RMQA 4HH8A 4HWBL 1KIPA 4HIIB 1W8OA 1A1NB 3CDCA 1AFVL 1N6VA 4IMKA 1MH5B 3QZWA 2WZPD 4NZRL 1LE9B 5C08E 4XP6H 5IW1B 2BDNL 3C8HA 1MWAB 4C58B 4QXTB 4EN3C 1C12B 4U4BA 3MLWH 3NABH 4LDLB 2NY1D 3C9NA 1DFBL 1QR1B 2VABA 3O2WH 3SKNB 3KPSE 4PJCE 5D2LF 3MJ6A 1HKLL 2ZOKB 3C09B 4ZTPL 3QQ4B 4KQ4H 4KY1L 1OHQA 1IARB 2E3VA 4IS6B 4MJIA 1HH6A 5JLZB 5FM5O 1II4E 4PJ5B 2J6EL 5EZJA 4XCFH 3TF7C 4HHAB 4I0PC 3FB8A 1AP2A 2NY3C 3D85D 4UQ3A 4Y19E 3S7GA 2XXCB 1DBKL 3ZKXB 3VXOB 1ZLSL 3R8BB 5I2IB 4J6RH 2DL2A 2X7LB 5HYSA 5GRZA 1NBYB 4QRSB 1G6RB 3CLFH 4WW1A 5D1XB 5T3XH 5ACLA 1MCQA 3R1GH 4DZ8B 1N3NB 4G42A 2FHBA 2Q87A 1NLDH 2DI8A 3ILQD 1JK8A 4O58L 1WISA 4XXDA 3ZE0E 5L7XH 3KYKL 5I74C 1U93A 3FHAA 1D5ZB 3QIBB 3GJFA 3HI5H 4HS6A 2VLJB 1I7TB 4JREC 4AG4L 3KG5A 3MLYL 5JXED 3KPPB 2NZIA 1C7TA 3DV4A 3ZT5A 4GXUN 5IVZA 2DQEL 5JOEA 4HKZB 2P44B 4YAQB 4YE4H 5FUOL 4K8RL 5AD0B 3HLAA 3QH3A 2PW2B 4ZMAT 5GS0L 1FFQA 5BQ7A 1NGQH 4IOSD 1JRHI 4XAKE 5HI4C 4XPAH 4G9FB 1TTUA 3MRJA 3VFOB 4GT7A 4JDTH 1T04B 3GMQA 4AIOA 5A2IH 1MEXH 1U3HB 3DXAB 3FO0H 3NZ8B 2OTUB 3SEPA 1W0VB 3MRKA 5F7FA 3MRDB 5KSVB 1OLZA 5DGRA 3IDJA 1SEQL 2YHGA 1KPVA 4RGMC 4JM2D 2R2BA 4IIQC 4UB0L 1I1RA 2MOVA 1HCFX 5EU5B 1BD2B 2JB5H 5CIPH 1DQDL 3MACH 3HMWH 5J12C 4PGEA 1LEIB 3VXSA 4AT6A 3UJJL 5HI5D 4IRSC 4M62H 3W0WE 5GRYA 2EDLA 4HX1B 4TULH 2AV1A 2C7UA 1NCTA 2V2XA 3QWOB 3NCJH 4XP5H 3REWB 4G7YL 1QPXA 5E2TH 4U49A 4O9HH 1L7IL 3STZB 4R4BA 2PO6B 2FWOB 2PW1A 3AUVA 4YHPA 3MNZA 5DC0A 3D0VA 3PWPA 5DD6A 1HXYB 4KUZL 4PFEA 5BJTB 4WU5B 1ZA6B 2Q8AL 2XTJC 4IMKC 5ADPL 4QOKD 1CLZH 4LAQH 3MOAL 4Z95H 4Z0XA 2XXMB 5GSVB 4P2RB 1P9MC 4XCNA 1A7QH 1P5UA 3HZMA 5GISH 3W2DL 4JO1L 2XWJB 2VLKA 2UY7A 3MRQA 4QTHB 5F8RC 8FABA 1EUUA 2AEQH 4JPKH 1RZIB 4WDIA 3QUMA 5DMGC 1F58L 1X5AA 4R97B 2VWEE 4JG0L 4NO2B 1M6OA 4HLZH 2ZKHL 4GMTH 2VZOA 4JM4L 4PJ8B 3V6BR 5FM4A 2J5LC 1MCOH 3VRLF 3KLAB 1QZ1A 2OTWB 2PF6A 4ZFZB 1NKRA 3ARPA 3GNML 5FUZH 1PG7W 5CEYA 4DWHA 4NYLB 1KENH 5C6TL 1E6JH 1RJLB 1YDPB 2FO4A 3VA2C 4GH7B 5JIIA 1PQZB 4JO3H 4ZAKA 3O6KL 4LPTA 1EGJH 4ZFOA 1A1OA 1U9KA 3TIEA 1MJ8L 1R5VB 3U4BH 4PJAA 3VG9B 4OQTH 1KCSH 1MLCA 4FFZL 2ZCHL 3T8XB 2HJKB 4MNGB 1P6AB 2D0HA 4OM0H 5GRJH 1RUAH 1B88A 5E2JA 4XB8A 2DDQH 1A6VL 4M7ZB 1KOAA 4JFFD 4OLWL 4X6CA 4M1GH 4S1DC 1NUGA 4P4KA 3VD9A 5F97E 3UBXI 3U0TA 4L3ED 1FYTA 1F2QA 1Z5LA 3DVNA 2QSQA 1NDGB 2YD9A 3HZVB 4K3EL 5DMYA 5E9DE 4LSVH 1KNOA 3BOVA 3MRNB 1NH6A 1RZ8A 1AE6L 1IAOA 3GIVA 5J6HB 1X5GA 5EIIB 5H94B 5KVGH 5FGCE 1CQKA 1S7SA 1F3DJ 3HB3D 3P4MA 1T5XA 2X4NA 4I77H 4BH8A 4L4VA 1QFUL 2EC9T 5HGAB 3GMNB 4NKMB 5FGSA 5D71L 2NXYB 4NC0B 4Y16B 1A0QH 3D85B 3BT2L 4X6BA 1GGCH 3NN8A 3ULUD 1H3VA 4N0YL 4OCSL 3GI9H 1F4XL 3NCFB 5GJTH 4KJWC 1OWWA 2MQ0A 4G6AC 3ZKSD 4RIRA 3KS0H 4OCXH 1IM9B 3EDKA 2E7CA 5HXMA 5CJQH 4G8EB 3NH7L 3CXHK 3NGBB 2YEZB 5I8CA 1CIUA 3AREA 1HXMA 1RIUH 3VXPB 4PGJA 4OI9A 1G6VK 1KTLB 1K8IB 4HUUA 2XWTA 3DJ9A 5CCKL 4LLVA 1MSPA 4FG6D 4PP2B 1I7ZA 1KN2L 4LCIH 1F5WA 5D93C 5E03A 3H3PL 4R8WL 1AY1L 3QRGH 3WIHH 3C6LB 3C2AH 4PJDB 4L8BA 4FS0A 3WS3A 4D9QD 2JK5A 3TLRA 4PJDF 5B22A 4RMSA 5KG9A 1HK6A 5CBAB 1Q0YH 1UB6A 1J0JA 2XZCL 5EO1A 5IW6B 4JRYA 4LKXA 3GHEH 3L3IB 4H1LA 5EU3A 2NY2B 3LAFA 4RWYL 5ALBL 2CO7B 5IR1A 4YDKL 2Y5TB 1A8JH 1T3FB 4KKAD 3D0LB 4DZBB 1F11B 3OHXA 3V4VL 4OTXL 5I15L 1CXEA 3UTQB 3MV7D 2Z35B 1ERNA 5ECJE 1HHGA 4O2EB 4PRIB 4OF0A 4PLNC 3PJSB 4GKNB 5EZOH 3LKSA 1BVLA 4I4WA 3BRGC 4FZEL 1HDMA 3MBXL 2R39A 4K07A 4JM2F 5CS7A 1FO0L 2LE9A 4FA8A 4JCLA 2ATKA 3QEQE 1K85A 3LQZB 1KJVA 3UJTH 3FQXA 1FL5A 4MJ5A 1SBSH 4ONHB 3VXQB 4OIIH 4ZAKC 5ADOH 4OV6F 4W6YB 2EYSA 1NCUA 5A2JH 5D7IB 4YBLC 1BBDL 1AC6A 4XBPA 5T5NF 3ZDZF 4WUKH 2IPKB 3QO0B 4Z5RB 3MJGX 3MLXH 4H88L 1X5JA 3ARDB 4LGSB 4H20H 3P9WB 4JFED 4HKXB 3NFSH 1H8NA 1K4DA 1KF9B 1BEYH 4XPGH 4WU7B 3RVTD 3FAXA 4JFFE 4QOKB 4UI2A 5F21B 3HZYB 3C5ZD 2I9TA 5EU6D 2H1PL 2VDKH 2QTEA 5EFIA 2W9EL 3CFBB 3BJLA 4P4KC 1QFHA 7FABH 4LAJH 1D5XB 4P2OD 1A14H 3QFJE 2ESVD 4TPRL 1B4JH 2DQUH 4MB5A 2DQCH 5CFHA 1FORH 5FKPB 1PG7L 2E9BA 1RURL 5DUPH 1PEWA 5EO9A 4YR6A 2X6MA 3IETA 5D9SA 2A83B 1I3GH 2BVOA 3T2OA 1AIFA 3VFGL 1J1PL 3O4OC 3Q6FB 5DJDB 1V7NH 4NUJB 4TRPH 2IQ9L 2X1QA 2V7NB 4NQVA 4J4PD 4LVEA 1U3JA 4F57L 5CD5C 3T0EC 4ZO7A 3C2SA 3ULUE 1JPGB 1U41A 4BSJA 3LPGA 4EUPG 4FTVB 3AC0A 2DI9A 3CVIL 5KSAD 2ZJSH 1RJCA 1T1XB 5C0BD 3Q1SH 2F5BL 1YJDC 1MFCH 2JJWA 5H35B 5I1IH 5EPMA 3IDYB 4CRPA 5JNYB 3AREC 4U1GB 5F89A 1KXQE 1P84J 1CF8H 3IFPA 4U3HA 4RDQG 4ZNEE 2LAAA 1N64L 1EBAA 3RWIA 3X3FH 1DVFD 4HIXH 3DMMB 3T77B 4D9QE 4AEIL 4Z7OF 1UXWA 3LKNA 1VENA 4WTZA 3VGGA 4MNHA 5KS9A 5FO8A 5ICZA 4L3EB 4MXWH 1A1MA 2O5ZH 2CQVA 1N7ML 2CKBH 5I9QC 3U7YL 5C70A 1MY7A 1IKNA 5AYUH 3VFWA 5LVEA 3KYOA 4J8RB 5EO0B 1JHLH 4K3GA 2FJGB 4ODTH 4L9LC 4L3CB 4DKFL 4PJ9D 4ACPA 4J2XA 4CVXA 3MV7E 1HOCB 4OCLC 6FABH 3K1DA 4GAJH 1PZUB 2XZZA 1UCBL 1RZJC 3JBG7 4WI2A 4WFFD 2OP4L 3H8NA 4KH2A 2DMBA 1ZVSA 1S9XA 3HZKA 2X4RA 3EHBD 3OPZH 4HH9A 1X6LA 2PYFB 4ISVB 4Q58C 5MEQB 3T1FB 3RNQA 3SDDC 1FH5L 3R0MA 3MRHB 1IFHH 1KCKA 3VXME 4PBWD 3O8XB 3RAJL 3SKJL 5F9JA 5JW4M 3BVNB 1BF2A 1JPFA 1HINL 1W72B 5J3HD 4QRPD 2H32H 1LQSR 2VR5A 4MA7H 5B4MC 2I07A 1IAKB 3EO0A 4JFYB 5D7LB 1SVZA 4LPUA 4HQQH 3V0VA 3GBNH 3RWJA 4FFVC 2J2ZA 4YHZL 4AL8L 5EU6E 4NN5B 1AXIB 3RGVD 4JRWA 2ESVE 5GSRA 1HHKA 5J56B 2F19L 3GM0A 2CO6B 5BO1H 3EW3B 4KKLD 2NTSP 5D2NB 1FL3A 2XPGA 3VFMA 1MAMH 4GQ9L 3B9KD 3OAYH 3QT2A 4UU9A 3HI1A 4P2QE 1S5IL 2NLJA 4JY6A 4GAGL 4YNYA 4LBEA 3L3HA 2Y5EA 2PUQT 2FECI 1RJZA 1IEBA 1ZOXA 1ZS8A 2IG2H 4BJLA 1QUNA 5C0BE 2VJXA 5F3BB 1MH5A 4OT1L 3VFRA 2Z31B 2FSEB 1G7QB 1MCSA 3ESUF 1FFNB 3HNTL 4Z78B 2E9IA 1U8HB 5CJBA 5TE7H 4YK4C 3OKYA 1MWAA 2VXQL 2NTFB 3RL1A 1I3UA 1JTOA 4G6FB 1C12A 4QF1B 4YFEA 4JFEB 4NP4L 1WBYB 1QR1A 2ORBH 5D2LA 2ZUTA 2JELL 3SKNA 1W2KT 3EDFA 2ZOKA 5E6ID 3QQ4A 3C5ZB 4NN7C 1KB5H 1WFOA 2VRAA 3BGMB 5JLZA 4HT1H 3OJDA 4PJ5A 4NQDD 5IKCB 4HHAA 2UUDK 4DUWA 5JHDD 2HH0L 3KPOB 3WXVL 4PP1D 3EGSA 3QPQD 4PY8I 2IFGA 1NGXB 1S8DA 5IHBA 1IKNC 5T1DL 4ZG1A 1B90A 3CZJA 5I2IA 1XEDA 2X2YA 2ZUVA 3TNMA 2X7LA 2A77L 1NBYA 3SBWA 5GS3A 4QRSA 1UVQA 1G6RA 3KJ4C 5I1CH 4WO4B 2BVTA 3OKKB 5HVFB 4X5XB 4WFFE 1WQVT 2YBRA 4F15B 3SJVD 1VERA 3OQ3B 1BBJB 4HJGB 4QTIL 1UA6L 1HKFA 2D2OA 1D5ZA 3QIBA 5KSAB 3AS1A 2X4SA 4FXLA 2VLJA 3D39B 5H37G 1I7TA 4RQQA 4FQQA 4GSDL 4PRNA 5F9WC 5TF0A 4LU5L 3BQUD 1OP5K 2AJ3B 3KPPA 1LGVA 2IPUK 2ICES 1A3LH 1JE6A 4HCRA 4HKZA 4HS8H 4YAQA 4RRPG 4QRPE 2PW2A 1FLTX 5F1SA 1J8HB 4B7IA 1DVFB 1T89C 3VFOA 1T04A 3KPSA 3QIWD 2R4RH 3VG0H 1KCUH 5C6PB 5C0IB 1U3HA 3DXAA 3EIFA 3NZ8A 2OTUA 5CZXC 2XQYK 1W0VA 2ILLA 3LSOA 4RMWA 2Y4SA 5CP7A 5EOCH 2F53B 5GGTH 3GMLA 4OGAC 4WY7L 3GI8L 5EU5A 3H9SE 1BD2A 1XR9B 3E2HC 2EYTB 4G5ZL 2XG4A 2AJVL 3G6JE 1LEIA 4KXZH 1IC4L 4P57B 4BQ8A 4DVRL 3ULVL 3MODH 2QADB 5J6GB 1NL0H 5EORL 1DLHB 4XPHL 2Q6WA 3WO4B 5FUCE 4Y4HD 4IOIA 5C07B 3HNSH 4HX1A 1FQ9C 5FYKL 1GC1L 4CVWA 2F58H 1RU9L 25C8H 3QWOA 4TOYL 3REWA 3V4PH 5F8QC 4HWEL 3STZA 3REVB 2PO6A 5DO2D 4HEME 5EZIL 4U33A 1HXYA 3EYUL 5LWYH 2FATH 5BJTA 3K1KC 4CN1A 2EKJA 5GQBA 4WU5A 1IGFH 1ZA6A 3PHSA 3M1BA 4UINL 5KZCD 1ZEAH 1T0PB 3CMOL 4I9WE 1MIEH 5GSVA 4P2RA 3Q5YA 3DX7B 5AZEL 4YDLB 3NZHH 2K3TA 2VDOH 5GRXG 2DM4A 2XWJA 3OR7B 1TITA 1NCNA 4NQED 4P59L 4DKEH 1U8LB 2OM5A 1KJMA 5BZDA 4NO2A 3IDNB 3C09C 3BAEH 1PX3A 5FGRA 1UENA 4NQDE 2NX5D 3RGVB 3O2DA 5JHDE 4DGVL 3DRQB 4OI7A 1LD9A 3KLAA 3ZKQD 3OKEA 3WIFA 4ZFZA 2H6PB 4JANA 4E5XB 4XPFH 5D8JL 1S5HB 2H26B 4UNUA 2QQQA 1ZE3C 4NYLA 1RJLA 2C4FU 3MJ9H 1YDPA 4XP6L 3VWKD 2BY2A 3ZKXC 1PQZA 3NA9L 2NYYC 5F70A 3QEGH 5DFVD 4YHKH 3OX8B 1H3PL 3LN4B 4MVBD 3SBWC 3HAEH 1R5VA 3EBAA 4TVPH 4UDTB 3NABL 4R7DA 3SJVE 1BIHA 5HYQB 2XOTA 4TQEL 3FZUD 5C1MB 5F7UA 2ATPB 2VQ1A 1G7LB 3T8XA 2HJKA 4KQ4L 4MNGA 1J9CT 3G5YB 4PIRF 5E94A 4H26B 5IMKB 2Q8BL 2ARJQ 5GIRA 1OSPH 2PR4L 2BSSB 3QSKB 5HJ3B 1C5DB 3AAZB 3OG4B 4UUJB 3WN5A 4H0GA 2VDPH 1CGWA 2VNCA 2BSRA 1NDGA 3HZVA 2FBJL 4YEFA 4GUPB 4AK1A 4J6RL 3MRNA 5J6HA 5EIIA 5H94A 3HI6L 5E00B 1MELA 1NANI 3CLFL 2IMNA 3WSQH 1O7SA 3U9UB 1H3WM 5T3XL 3SDAD 4F80A 1NLDL 5DEZA 3GMNA 4M02A 3MR9B 4ZS7L 4ZD3H 3HE6D 4Y16A 1RUMH 3CX5K 3D85A 4ODVH 1HWHB 3AB0B 1LE5A 5IW3A 5DS8B 2IQAA 12E8H 3RWHA 4JB9H 1ED3B 4O4YH 4G8EA 2YEZA 3FCTB 4YE4L 2RIKA 1OAUH 4CKVX 1MNUH 5M7QA 2AQ2A 3GJEB 4Y8DC 1E28A 1KTLA 4XPAL 2YXMA 4OD2B 4PP2A 5B39B 1A5FL 5T5NG 2BHUA 3K3QA 4YDIH 3C6LA 3TBSA 1FG2B 4NC1E 4PJDA 1J0YA 4GRWB 5JXEA 1FP5A 2JJTA 1VESA 5CBAA 4G9DB 2CDFB 1OM3H 1FNEB 5LGKA 4URTB 3QIUD 4Z7WE 2MJWA 5E4EB 4K9EC 5D96B 1CR9H 1T0NB 4OQ1A 5DD0H 3RWGA 4ZXBB 4GRLC 3MACL 3L3IA 3GJFH 5BVJA 2P45B 5CILH 4F7MB 2HFGL 2Y5TA 1T3FA 4P23D 4A6YB 3D0LA 4DZBA 1F11A 1L7TH 4M62L 5BMFH 2JIXD 2A73B 1CL7H 1T5WB 5EUKA 5ITFB 4TULL 3UTQA 1T1ZB 5INCB 2Z35A 4R97C 4LVOB 4O2EA 4PRIA 1OD7A 4O9HL 3PJSA 4GKNA 3GRWA 1JI1A 5DI8A 4TTGA 4ODSH 3VH8B 3UBXB 1AR1C 2KQMA 2YPVH 4LAQL 3LQZA 3CJJA 3VXRB 4ONHA 3VXQA 4APQD 5IB4A 1A7QL 3BP5B 1TZGH 4N5ED 5D7IA 1MRDH 5GISL 4G8GB 5SWZE 4UOW0 5I8OH 2IPKA 2WLZA 3QO0A 5CJOL 1AQDA 3VG9C 3ARDA 4NKIH 4HKXA 4N8VB 2X4PB 4M6OH 4PV8B 1S7UB 1BQLH 3FMGH 4QOKA 1MCOL 4R96A 1RZ7H 5IJKA 1EHLH 1YEDB 2HTKD 4M7ZC 4I5BB 5CMAB 5FUZL 3WN5C 3QNZB 1F4YH 4WI4A 5D7SH 1KENL 4Z7WF 1CE6B 1E6JL 3CFBA 4MA8H 1D5XA 1ZT1B 4JO3L 3D48R 2GTWA 4NQEB 4U7SA 1XGRB 4GMSH 2LV4A 3FQUB 3G5VB 2A83A 4LDOB 5DJ0B 5EUOE 5DJDA 4NUJA 1KCSL 2BVYA 2NX5B 4N0CD 2V7NA 1KCVH 1OARH 1F6LL 3KR3L 3P3YA 2E6PA 4OM0L 4Y16C 4P5MB 1JPGA 1RUAL 1FZJB 4FTVA 1JGLH 1HE7A 4LIQL 2DDQL 3QUMH 3SKMB 2MPAH 3DI3B 1QLEL 4M1GL 1T1XA 3EKCA 1ZMYA 1Y6KR 3B5GA 1F90H 2BNUB 2EE6A 4C55A 1BWWA 4M1CD 1N5AB 5JNYA 2GQHA 2IAMD 3NGBC 4LSVL 1U42A 1PKOA 5KVGL 5KAQF 3ILQC 2YPLD 3E0GA 5E5RB 3P0YH 4I77L 1C7SA 5E7BA 3TH2T 5J1TC 1FV1B 1WFTA 2VXUH 1D5IH 3ZYIA 3DMMA 1NDMB 4QCIB 5EU4A 3T77A 4RNRB 1U8MB 1CGTA 2BNRB 2X44D 2CGRH 1KJ2B 4NCC2 4M6NH 5HHNA 2M26A 5JXEC 1L9NA 5JHLH 1FPTH 4MMXC 4L3EA 4LVHC 1GGCL 3ZL4H 5F7WC 1NC2D 3RBGA 1JFQL 2A6DB 3GI9L 3D69B 3IS1X 4P9HH 3V6ZB 4JVUA 1EXUB 4YO0B 2YWZA 4M6MH 5EO0A 4FQHB 2FJGA 4Z76B 4L8CB 4L3CA 3E8UL 3RHWF 4P46D 1HOCA 2Q3AA 2ZG1A 1WIOA 3PGDA 5LBSL 3OKDB 1T0MB 4LCIL 1M7IB 1AO7B 1NCCH 3L3GB 2CLVB 4LCCB 4DEPB 1AGBB 1OCWL 2Z92B 4MMZC 2ZUSA 4Z7VB 1E27B 1NGWB 1Q0YL 4NQCD 4XWGH 4YGVB 4NBZB 3SGKA 4BM7A 2CIIB 2GSIB 1CFQA 2PYFA 4ISVA 5MEQA 2DB8A 5C0CB 5HI5C 3T1FA 2ADJA 2AK4B 3GHEL 3MRHA 3K4AA 3O8XA 1IGJB 5CEZL 1D5MA 4XNYH 4X4YA 3BVNA 3MZTA 1QBBA 4X6DE 1D6EB 1WZKA 3X11B 3MCLL 5TFSH 1ZT7B 4HULB 1FCCA 1IAKA 5D7LA 4JFYA 1ZGLM 5C09B 4KK8D 1IGYB 5EZOL 1T1YB 4MLSA 2HFEA 3RU8H 1N6QH 5IJKC 3VFPB 5JIPA 2VXSL 3J8F7 4LHUB 4AMKH 1RD6A 2JE8A 2WUCH 4FFWD 1IAIH 1MHPH 1UM5H 5H2BA 4AEFA 1SBSL 5E1AB 4OIIL 5ADOL 4PRDB 3NOIA 3LH2H 1G0XA 1I3RB 1FFOA 4U1IB 4Y8AA 3RJDA 2YK1L 4WUKL 3NIDE 2BFVH 1INQB 3JVGA 3MLXL 4RWHA 3UTTD 4H1LH 2H3NB 4RX4A 1N6UA 4UILH 1A7OH 4IEFB 4PP1C 2CRYA 5DJYB 2JJUA 4K94L 1BEYL 5CD3B 2X4TB 5K33A 2PCPB 3RUGB 5F3BA 2XACC 2Z31A 2HYMA 2VDKL 4APQB 1S9YB 3RUGF 1RZJH 2FX8L 2FSEA 3LRGA 1G7QA 7FABL 1CVSC 1I1FB 5IHZA 1U8HA 2Z8SA 1B4JL 2DQUL 2DQCL 1FORL 1VB9A 4HUVB 2NTFA 4U1GC 4D0CB 4LLUB 1BZ7B 5DTFB 4N0UB 1I3GL 4JFEA 4X6DF 1WBYA 2GSGA 1T2JA 3LMJH 3UAJD 4RFEB 5ILTL 3MA7B 1CXIA 4LCWD 4N0FB 4Y2OA 2VN7A 2VR4A 3C5ZA 2D7TH 1T20A 1QD0A 1V3MA 4TUKH 3TZVB 1WT5A 3BGMA 5HYJB 3W11D 5IKCA 4TSAH 3KPOA 3DRTB 2ZJSL 5JW4R 2EICA 3Q1SL 1NGXA 3DPBA 2VO5A 5BV7C 1HI6B 2A0LD 1MFCL 1CD1B 4F9LC 4GXUM 5AAMA 5DK0B 2EIBA 1QSED 3HB3C 3HRPA 5JMRA 1NGPH 4JGUA 4WO4A 4Z6AT 2Z8RA 4J4PA 3OKKA 1HQ4B 3NIDF 4X5XA 1YNLH 4MAYD 5KVEH 4HUKB 3X3FL 4OKVA 4HK0B 1NC4D 4HJGA 1UB5B 3TNNB 5KSAA 4KZEH 2VH5H 2A38A 3RVVD 3D39A 4QHLB 2PTTB 4N90E 1NGYB 4UNVA 5I1LB 4MXWL 5F7EH 1VCAA 2DQGH 2CKBL 2AJ3A 3ARGD 5AYUL 1TNNA 4ONOA 1JHLL 4ODTL 5GGRB 4F37K 2YPLB 1MCWM 3O8XC 1JNJA 2BNQD 2CLRA 4FG6C 3GMMB 3VGHA 1X4YA 1DVFA 3B9AA 2AXGB 4RFOH 6FABL 2YRLA 3SDCB 4Y2DB 3PV6B 5C0IA 4GAJL 4NNYB 5C6WH 2DQHH 2QBWA 3DROB 1OTSD 1J0HA 4WUUD 4NN5C 4K23H 2GK0B 3BMVA 3F7VB 1XT5A 1BQHG 3OPZL 3WNMA 1J87A 1XR9A 3EFDH 2EYTA 3GB7A 3Q6GH 4KKAC 4DN4L 4C56B 1IFHL 4Z7NE 5D70L 1IGML 5J6GA 5ALCH 3X12B 1DLHA 2E7LA 3UTTE 5GRUL 2A9ML 3QG7H 5C07A 3JVGC 4MQ7B 4L4TD 1WAAA 4MA7L 1X5IA 3PWJB 2MHAA 1AH1A 3DX9B 1OAXH 4H25B 1JF1B 1MUJB 4DGYH 1MOEA 3REVA 4HIHB 2Q20A 4KRLB 2F5AH 4NQCB 4X4MA 1UEYA 1K5NB 4ETQB 2H2PD 4MD5A 4MJ6B 1JNNL 3SDXB 3SDXF 4QHKI 1U58B 5EWIH 5ITBH 5CEXB 3BKMH 4HK3N 2X40A 3GSWA 1FVDA 3F5WB 4NQTA 4LQFH 3OR7A 2E7HA 3S98A 2HKFH 2CJUH 3FO2A 4ODUA 4M3JA 4AIZB 4LCWE 3S36H 4GAYB 3RVTC 1MHCB 3IDNA 4HEPG 3NBNA 2F15A 3C5ZC 3RGVA 4HG4K 1X7QB 1ZHNB 3SN6N 1WT5C 2H6PA 2QJDA 3MNWA 4K3DH 4E5XA 5KJRL 1S5HA 2HAZA 2H26A 4P2OC 3OXSB 1EHXA 2DQJL 1QSEE 1RI8A 3T4YB 5TE7L 3OX8A 1B3JA 3LN4A 4Z7NF 3GHBH 2BVPB 4UDTA 3EOTH 4J4PC 5DF0A 5HYQA 2ORBL 1G7PA 3C08H 2ATPA 4F15C 3HC3H 1G7LA 3WFBH 4A2MA 5KSBB 4H26A 1UQSB 5DVKA 1K3IA 5JQ6H 5KSAC 3T09A 1LWRA 4XX1G 4KQ3L 1UJ3B 4HT1L 4HFWB 5HJ3A 1C5DA 3AAZA 3TO4D 4UUJA 2DM2A 4NJAH 1CN4A 1GSMA 2W9DH 1CD8A 4FQPA 4CN4A 2E9JA 4PJBE 2BNQE 3MRRA 4UDUB 2G60H 5E00A 2AJYH 5C3TA 3I02A 3U9UA 1R3HB 1DVFC 3ARTA 5E6IA 2NY0B 2I9LA 1CXLA 4HZLB 4NO3B 4V1DB 4WUUE 1MWAH 4J3VA 4RGOH 4NCC1 4YC2C 5CGMA 2FH6A 1YNTB 1D7FA 5C0AD 1QRKA 1Z9MA 1NFDE 2VLMD 3PP4H 5DS8A 4L8SA 3I75A 1A3LL 1JGUH 3KJ6H 5K9QG 3CUPA 1I8IB 3K7UA 4Y5YB 1ED3A 4XZUB 5IBLC 2ZPKL 3FCTA 4HS8L 4HJJH 4HC1L 1U8KB 3FRUB 1WIPA 4EDWH 4L4TE 1HSBA 2E7LC 3GJEA 3SJVA 3BN3B 4OD2A 5B39A 1CQYA 3FFCE 4P3CL 1OWRM 3VG0L 1KCUL 1GIGL 2C3VB 4QRRE 4LSTL 3TGXA 2HT2D 2ZUUA 1FG2A 4HAGA 1XCTB 1G6RH 1XIWD 3BQUA 3ARRA 3EHBC 3DTXB 4MJ4A 4LLYB 4U1MB 4G9DA 5D1ZD 1FNEA 4M03A 4M8VA 2C1OB 2IEPA 4PJEE 4MHHI 1T0NA 1AC0A 4WHDA 2AW2A 4ZXBA 2OR9L 4PY8J 4XPBH 4PJBF 4YDLC 4F7MA 3GO1L 5J3HC 3MODL 1OP3K 1C16B 4A6YA 4GG8A 1NL0L 3WIIH 2UZYB 3QIWA 1QLRB 1WBZB 1T5WA 4ALAL 3OWEA 3QDMD 1T1ZA 5INCA 2F58L 4HCRH 5CHNB 5HHOD 1LILA 25C8L 1F3DH 3AFLA 3V4PL 3KLDA 3K4ZA 3K8KA 4LVNB 2CSPA 3QQ3B 3RGVC 2OZ4A 5LWYL 2FATL 2Z9TA 1EAPA 3BJ91 3VH8A 3UBXA 1IGFL 2YKLH 1NAKH 4R0LB 5IT2L 3TYFB 1ODAA 3CNKA 4BZ1H 1NFDF 1ZEAL 4PS4H 1XGTB 1MIEL 3VXRA 2R23B 4KKLC 2R69H 3LEXB 1D9KB 3OJMB 3BP5A 3B9KC 2VDOL 4Y4HA 1J7VR 1QHPA 4G8GA 4H0IA 5DURD 3D6GA 4GS7B 3W5MA 1WCBA 3ARUA 4LOUC 3BUTA 3DX6A 5KAQG 1JYXA 4L3AA 1LP9B 1KIQB 4N8VA 3BAEL 1HH9B 2X4PA 5I71B 1MFEL 1S7UA 5BRZB 3CU7A 4OGYH 1YEDA 4XPFL 3VMOA 4I5BA 5CMAA 3QNZA 1CE6A 2KKQA 4ELKB 4PJEF 4YDJB 1V7MH 5DUBB 1ZT1A 4LEXL 4KZDL 3QEGL 1YMHB 4NQEA 4YHKL 3MLZL 2V9RA 2IBZX 1CDUA 4EBQH 5I1AB 3G5ZB 3FQUA 3VW3L 5E5MB 5E6IC 4XBGA 4KDVA 2NX5A 1FJ1B 3BIAX 4R2GD 3GKZA 3E6FB 3ULUL 4L5FH 5MP6H 4P5MA 2RCSH 1JN6B 1IC7H 4K8RD 1TVDA 2VLME 3QPQC 1OSPL 4GFTB 1X5LA 3GBMH 1U3ZA 1G9NH 5GS0D 5I1JH 1KIUA 5EBWB 3AB0C 3SKMA 4L8SC 1I1CA 5F7LB 1BJMA 1WZ1H 3O2DH 3PABA 4R4FL 1IGIH 1N5AA 1CXKA 3T4AB 1QFPA 1VEOA 4KPHH 4PG2C 5ABDE 3LOWA 1FFRA 3NPSB 1FV1A 4PJIB 1ZGLB 4QCIA 1NDMA 3ZSTA 4PJIF 1U8MA 2BNRA 1KJ2A 5D7JB 1EVUA 4MJ2A 3TO4B 1RUML 4YXHL 4DVBB 4ODVL 1O5DT 3BQUC 2D4DA 5IV2B 2CDGB 4MX7A 2A6DA 4LMQE 3D69A 3V52H 5D96C 3V6ZA 1CGYA 1WTGT 12E8L 1FNGA 4ZXBC 5TE6H 1EXUA 1ONQB 4YO0A 4O4YL 3FB6B 1CFVH 3HUJE 4FQHA 5I75B 4L8CA 3SDAA 1A6AB 2MCPH 1IEAB 5FYJH 1OAUL 3ISWA 3GSOB 1MNUL 3QDME 3QIWC 5LQBH 5HHOE 2YMXH 3EOBA 1A7RH 2ADGB 4M7LH 5FV1L 3OKDA 1T0MA 5C71A 2DLEA 5BS0D 1M7IA 3L3GA 5I6XC 4YDIL 5CJXA 2CLVA 2APTA 4LCCA 2XZQL 5C0AB 3BUYB 2WBJD 2ZCLH 3GIZL 3UO1L 2Z92A 3U1SH 3BGFC 4P9MH 4P4RB 1E27A 1NGWA 2KH2B 1OM3L 2CIIA 2LTQB 5ICYA 4CNIB 2GSIA 3L5HA 2QQNL 1CR9L 5C0CA 3VI4F 2HA1A 3FRPA 4K2UH 2EXWD 1A6WH 1B0RA 5CILL 4Y4HC 2LABA 1IGJA 2GAZA 3HR5B 1L7TL 5BMFL 1D6EA 3X11A 2EDBA 1CL7L 4JFHD 1I8KB 5DO2C 1XIWB 4JE4B 4JHAH 2CR3A 4HS3B 1T1YA 3H9HB 3U83A 3UXFA 1RUQH 5JQHC 1FZOB 3VFPA 3OKLB 4ODSL 2PNDA 4PRHD 1S9VB 1E4XI 3KPLB 1KEML 4LL9A 1UWXK 1A6TB 2YPVL 2IBBA 1Q9LB 2ZUQB 1DP0A 5T1LB 4RFNC 5E1AA 2OTPA 1PSKH 2KQNA 4PRDA 1I3RA 3HUJF 1TZGL 2DYPD 1MRDL 4KTYA 5HGHA 5I8OL 4U1IA 3V6FB 3ALWA 3QQNA 3LEVH 1INQA 4D94A 4PJHE 1CGVA 1NAML 3CVHL 5FGBA 4NKIL 4IMLB 2BSTB 2XI9A 1Y6NR 3N0PB 4OZFB 5DJYA 2NY6B 5I30L 4Q6IB 3FMGL 1RZ7L 3PL6D 1EJ6A 1EHLL 3VWKC 2X4TA 2PCPA 3RUGA 4APQA 2DJUA 4XI5D 1BX2B 1Q1JH 2CIKB 1F4YL 3S35H 5DFVC 2Z4QB 2P5ED 3MV9B 5JPNB 1I1FA 1G7HB 4MVBC 5DURB 3GRWH 3ARZA 4D3CH 1I8MB 1GHFL 4GMSL 4PRAB 4HUVA 4D0CA 2X89D 4LLUA 2YD4A 1BZ7A 3FZUC 4RGND 3H2WA 1KYOK 4N0UA 4NC2B 4XMPL 2D03L 3PF2A 5J1AB 1RVFL 2QV2A 3MA7A 4JFQB 1KCVL 3AS3A 5TDPB 3RJQB 4N0FA 4Z7UF 3JWDC 2OR7A 2FH8A 5JMOC 5HHVL 3TZVA 5DQJB 5HYJA 1Q72L 5DRNB 1P7QD 3QUML 2R1XB 1NUDA 1DQQA 1HI6A 3WKMH 1MQ8A 3INUH 1CD1A 1CDBA 4XC3L 1RUKH 1LEKB 5DK0A 3NFNB 5KTEL 3SDAC 3SE4A 2VDMH 3U82B 3FN0H 1FIGL 1NEZG 3OJ2C 3EYSL 1ACZA 4W68A 5BS0E 1HQ4A 2P5WE 4HUWB 4XP4H 3RRQA 3OR6B 3HE6C 4PJHF 2VXUL 3OJVC 2HMID 1D5IL 4HK0A 3U30B 1DLFL 1UB5A 4QRTB 5CJXC 1CLCA 4LCCC 3ROLB 2NXZD 4DEPC 4M6NL 2VAAB 4XNUH 5BZWB 3DURB 4QHLA 5JHLL 2PTTA 1NGYA 5I1LA 4G8IB 5E8OB 5E99L 4P9HL 4PGBB 3HPLB 3L5JA 3NFPB 3PXHA 4M6ML 2IMMA 5GGRA 2YPLA 2VUYA 4LCYB 3GMMA 2I24N 1PGRB 1URLA 1YEIL 3T2NH 1BF8A 2AXGA 3SDCA 1KTDB 4Y2DA 5F7MC 4GKSB 3PV6A 1GGIH 4JFOB 3RWCA 4NNYA 5ISZD 3RNKB 1F97A 1XGPB 4JAMB 3RX7A 5HVWA 1NCCL 2Q3ZA 1TPXC 3FT4B 2BCKB 3UTSE 3SGEH 3RY4A 1SHMA 4M7JH 4XNMA 1RY7B 3N1MC 2PYEB 2GK0A 3F7VA 1ZLWK 1YPZE 2EH7H 2SEBA 3V2AR 4ETYA 4JZOB 5FB8B 4C83B 4XXCA 5JW3H 2D7NA 4PTTB 4P46A 5BOZG 1JZ8A 1UACH 5TF1H 1ES0B 3IXAB 3QCUH 5SV3A 1MCKA 4MA1B 4XNYL 3E3QC 3BGAA 2GHWB 5TFSL 1S7WB 4MQ7A 3PWJA 2R0WL 3ESVF 1I1AD 2VQUA 5FGBC 1DUYB 3V6OE 2WBJB 3DX9A 4H25A 1JF1A 1MUJA 3W82A 3CXHJ 4GG6B 3QEUB 4NQCA 1K5NA 1SVCP 4ZUTB 4ZTOH 4MJ6A 5FHAH 2P5EE 3MYZA 3SDXA 3WFEH 4NNPH 5TQ0H 4AMKL 4APQC 1CG9B 2WUCL 1IAIL 1U58A 5DYOB 1EEYB 5CEXA 1OSZB 1UM5L 5I1DB 3VWJB 4N5EC 2R2EB 5L2KD 3T65A 4XVJH 5D1QB 1D3CA 1HHJA 1YEGH 3TESA 4RGNE 3F5WA 3L7FB 2DIJA 3PQYD 2BFVL 4AIZA 4QNPE 3QCVL 2JCCE 1ZT4A 4HZAA 1OGAB 1KG0B 3MV01 3Q0HA 4UILL 3T0AA 2QQLH 2ZCKH 3IS0X 4PRHB 1W72H 1X7QA 4M93B 2HTKC 3F8UB 5H8DA 3TZVC 2R29H 3KYNB 3BP6B 3QUZB 3KYMB 1J18A 5KOMC 1SYVB 4LP5A 1MPAL 5F6HJ 4BH7B 3OXSA 3RWFB 5DFTA 3MCG1 1JGDB 5DZNA 1C08B 3T4YA 1WFNA 1DBBH 1PD6A 3SE4C 2COQA 2HFFB 3UTTA 2BVPA 1U8OA 1ZSDB 2Y07H 3O6FB 4N0CC 3UX9B 3GSQB 4PJ7E 1CDGA 1TJGL 3OBAA 3LMJL 1TETH 1KN4H 43CAB 3O2VL 3F7YA 4WNQB 4NNXB 4XP1L 5M95B 2HRPH 4WHTB 4X4XB 5KSBA 1R5WB 2D7TL 3LQAC 1UJ3A 4FQXB 1BFOB 3FQWB 1SY6A 2NY4B 3UZQA 4M1CC 3MREA 1UH2A 4RSVA 4WJ5B 2IAMC 3OGOE 1E6OH 3MROB 3ZE1F 1DBAH 1FVCB 4UDUA 5TPWH 4LNRB 4KK9D 4U1LA 2QQKH 5FA4B 4J3WA 5E4IA 5AWNL 2XWBA 5BVPH 4LCWA 3GSVB 3SDCC 1HYSD 4K7PX 4HZLA 1A9BB 3IFNH 4NKDB 1F6FB 2JCCF 3LIZL 4NO3A 1RJYB 3BEWB 5DHVB 2JF1A 4V1DA 3HRZB 4XH2B 1BHGA 5T1KD 4LPXA 1QSZA 1YNTA 2VH5L 1YEJH 5KOVC 2EC9U 1M7XA 1QHOA 5F7EL 2R15A 1JNHB 2DQGL 3P9LB 3A6CH 3MGAA 4U1KA 1S7QB 3BE1H 2VUOA 1EFQA 1IC1A 3U4EB 1QSEA 4XXCC 1CBVH 1I8IA 2X4UB 4XZUA 4Y5YA 4P46C 3MRLB 3FRUA 4MAYA 2DBJA 4NO0B 2A6JB 3SDYL 1CYGA 5JR1H 3WDIA 4RFOL 4PJ7F 1VFMA 2H2SD 5AEAA 2X9YA 2C3VA 2NXZB 3WUWB 4NIKB 4CN6A 3FHQA 3VFNA 4Q9QL 1RZGB 1FL6B 1WGOA 4K23L 4LLYA 4U1MA 4X9IA 5L2KE 3RZWA 2AGJH 2JJSA 2MMXA 2DQDH 1J10A 3Q6GL 1AGFB 2BNQA 1R24B 2XG5A 3A0OA 4OM1H 3ZTNL 1DE4B 1DN0B 1C16A 2E7MA 5IVNA 1CLOH 5ALCL 1MQKL 1UCTA 2OMBA 3AVEA 1QLRA 3VXTB 4JQVA 3JTSB 3QG7L 1I7RB 1WBZA 3F58H 5IQ7H 5ISZB 3SKOB 3WXWH 1RIVL 2DOCA 2DQFB 5CHNA 1RK0B 1RUPH 4OLUL 2HJLB 2QHRL 5FFLA 2NY5C 3SPVA 1OAXL 4EN3B 4E41B 3RI5K 3QQ3A 5A2FA 2F5AL 5K59F 4Y1AB 5DRWA 1BP3B 4FFWC 4FNLH 1NFDA 3NACH 4R0LA 3TYFA 4JDZB 2IANB 5F9OH 5J13B 1TIUA 1XGTA 1V05A 3KPRD 3LEXA 4U3XA 1D9KA 5DJCB 5F9AC 5F7NC 4LQFL 3UEZA 4DKAA 1YY9D 2HKFL 2CJUL 4Z7VE 1AD9B 4ORGB 1BECA 3MJ8B 4OZHB 3WO3B 5FM5M 3S36L 5F72S 4C54A 2C3XA 3IGAA 1KELH 1LP9A 5JORB 3AMKA 1HH9A 15C8H 2AK4E 2L4OA 1TENA 5BRZA 2FR4B 3F6LA 1UJ3C 1T7WA 4ZFGH 4K3DL 2E8YA 4M48H 3TBVB 3CDFA 5I74B 2NPLX 4F7TB 4YDJA 1DBMH 3BZDA 1YMHA 4J3XA 2VDLH 4AZ8A 2X5PA 3PHOB 4JPVL 3PQYB 3G08A 3GHBL 5SV4A 5I1AA 3UAJC 3G5ZA 4LPWA 4GW5B 1MI5E 5E5MA 2O26U 1JNLL 3EOTL 3LZFL 4JFDB 4M5YL 1DDHB 2NY0C 5DD1H 4DCQB 1FJ1A 3C08L 2ZOLB 2WINB 3HC3L 1VHPA 3E6FA 5LCVH 5GGVH 4UMGA 3B2VL 4HMDA 5JQ6L 5IVOA 4JDVB 1JMXA 2B1AH 2A0LC 4NJAL 5JPMB 1UKQA 1WTLA 1EH9A 1QR4A 3P9MB 1FZKA 1W0WB 4LPVA 4MD4B 2QR0B 4Y5YC 1UXSB 2V5SA 1W0YT 3T4AA 2G60L 5C9JA 3STBA 4MAYC 2AJYL 1ZLVH 3BKYH 4TYUA 4TUJB 5J12B 4X7TB 5EA0H 1R6VA 3P4NB 3RX8A 4PJIA 1ZGLA 3FT3B 1UWEH 2J8UB 1NFKA 3CH1B 1JRHH 4FQIH 2L7UA 5D7JA 2FYYB 3P11H 3AROA 1MWAL 3G04B 1U8JB 5E2WL 4RGOL 4PGDB 3TO4A 4MNQD 3U7WH 4DVBA 3ULVD 2FL5B 2BVQB 3ARGC 1TTFA 2CDGA 2CRIA 1NCWH 3BW9B 1KACB 1OAQH 5E5UB 5FYLH 4JRXB 3PP4L 3OV6A 1KCLA 1JGUL 3KJ6L 2P48B 5FYKD 1Q9KB 1FCGA 1ONQA 5C7XH 1WBXB 3FB6A 3X3GH 4HJJL 1JPTH 1A6AA 1IEAA 2XTJB 3GSOA 3QZWB 4EDWL 4HWUA 1M4KA 3TCXA 1WEJH 4JQVC 1K8DB 2ADGA 1F4HA 3CCHB 4Q9CA 1DL7L 5E8DH 1OTSC 4NHUA 4PJFE 35C8H 5D7KD 2VLLA 2W1NA 4LVNC 5C0AA 3BKJL 1G6RL 2AXHA 3BUYA 3K4DA 3MO1B 3BFOA 1YEFH 4P4RA 1WCQA 5IBTH 5I76A 3KPRE 4CNIA 5HD8D 5KVFH 1C5CH 3MRFB 1CU4H 1HH6B 3WMSA 4EVNB 3SGDI 1AP2B 3BKCH 3HR5A 4GS7C 3WE6B 4IJ3C 3RFZC 1TDQA 2OR8A 1CICD 4EI5B 1I8KA 1ZTXH 5FOJA 1XIWA 2VKXA 4HCRL 5DEGB 2H2PC 1AXSB 5ANME 4YZFE 2N7AA 3H9HA 4KDWA 3C8DA 5HSFA 2V17H 4G42B 3OKLA 4OZIB 4JR9H 1S9VA 1BAFL 3KPLA 4OZIF 3HC4L 1NAKL 3QULA 5C0EA 5I1HH 1A6TA 1Q9LA 5T1LA 1YY8B 2A74B 4PS4L 3CK0H 4I48A 4GRWH 2R69L 2VL5B 1NFIA 2BOBB 4HWBA 4NUGH 1S3KH 2ADFH 5FDYA 1N2RB 2VDNH 1YN6B 3QDMA 3T3PE 5EH1A 3MQIA 1AKJD 1I85A 4Q9BA 3V6FA 5DDHB 5IVZB 3V5KB 4IMLA 1H0DA 2BSTA 3HLAB 4POYA 4ODBD 1GH7A 4A6YH 4OZFA 4PJFF 2ICEA 3OKOA 4OV5B 3CMGA 4UNTA 4OGYL 1BX2A 1AJ7L 5T3XD 2Z4QA 4NDMB 5FEBA 5JPNA 1UH4A 3L1OH 2Q1EA 1UYWH 5DLMH 2OZ4H 1VFBA 1IRAY 1KPVB 1I8MA 1LK2B 2J6EA 2R2BB 5SWSD 3L9RA 1MAJA 3OF6A 3V5DB 5IFJB 4PLJD 5J1AA 4EOWH 1JPSH 4Z7UA 4JFQA 4OZGB 3UP1A 1CFTA 4MNQE 3O4LB 5TDPA 4OZGF 4MB3A 5D7JC 4UTAH 4L5FL 2N7BA 3TO4C 2LAGB 1EMTH 2RCSL 4OJFH 1IC7L 3HG1D 3LEYH 2E6JA 5I1JL 2V2XB 3GBML 5DRNA 1G9NL 4RMRA 2R1XA 3C60D 2VDQH 3KAAA 3SQOL 3MUZ1 3PWPB 4WI9A 1A9EA 1FNSH 1WZ1L 3O2DL 4PBXA 5J06A 3S8WA 1QNZL 1LEKA 3NFNA 2FO1A 2X41A 5EC2B 5IB1B 4Z0XB 3Q5TA 3T3PF 3TT3L 3U46A 4KPHL 1KJ3H 2EDQA 1SEBB 4WRLA 4PJHA 3B3IB 2N1KA 3PP3H 5FECB 1OP9A 4ZSOB 3ROLA 4JN1H 2VAAA 3MC0A 2GTZB 3DURA 4OLXH 1UZ8B 3DYPA 4CMMB 1M6OB 1CE1H 3BHBB 3WFCL 4G8IA 1MCPL 4PB0H 5E8OA 2BY1A 1PKQB 3V52L 2GEEA 4H8WL 4PGBA 4PRBA 3HPLA 3NFPA 3ALXA 5TE6L 2V9TA 1QBML 3OKNB 1CFVL 2IC2A 2RBLA 4KK6D 2MCPL 3KXFE 5FYJL 4LCYA 5CEYB 4N68A 3RHWK 2B2XH 2ZUXA 1U91B 1KPUB 2F8VA 4NZTH 5J7CC 4HXAH 2YMXL 4ZAKB 1KTDA 4M7LL 2HT2C 4GKSA 4OLYH 4JFOA 1XIWC 3RNKA 3S34L 4ZFOB 4X5WB 5DGQA 3ULVF 2BCKA 4L9DA 4PJAB 1PG7X 5D1ZC 1T2QH 4YUEH 3UTZB 2V7HA 2ZCLL 2AABL 1OT1A 2DTSA 4FZ8H 1MLCB 4P9ML 1IZKA 1T66D 5IFAH 1TFHA 3DGGB 5DUMH 4JZOA 3JWDH 5I16B 1KJ2H 2ZUQC 5FB8A 1V3JA 3EOYG 4OZ4A 7CGTA 1CCZA 4OD3L 4PTTA 1ES0A 2OJZH 3IXAA 1A6WL 4H0HB 1T7VA 3SCMD 3CX5J 4XMLH 4WWKD 3QG6B 3GKWH 4P4KB 1RZKH 1I85C 5BS0A 4LDEB 3N1PC 1IQDB 4F7EB 1QYGH 1Y6MR 2WP3O 3EYFB 1DUYA 3GIVB 4OD1L 1IAOB 2WBJA 4RA3A 3C6SB 4NKQB 4JHAL 4ONGH 4ORZC 4U2YA 4GG6A 3QEUA 3NCEB 1ZK9A 3MLPA 2WUBH 4ZUTA 5GGQH 3RY6C 1RUQL 1XF5B 4IDLA 5T3XE 5IGXH 5DWUH 4F58H 4JVWA 4CGTA 1H3TA 1CG9A 3H3KA 3T0EB 4OFYA 5DYOA 4L8DB 1EEYA 1OSZA 3VWJA 1QRND 2R2EA 4YBQD 5D1QA 4JJ5A 3T0VA 2DLFL 3U48A 2UWEB 2UWEF 3G6DL 5EZLB 3LV3B 4FABL 4ODXB 4LSSH 4FQ2H 1MHEA 2NMSA 1KG0A 2OXGA 3AREB 3KYAA 3HG1E 5MHSD 1P4LB 1G7JB 4PRHA 4HUUB 3KWWA 4V2CB 2I25N 1OAKH 2MKLC 3BP6A 3KYNA 3KYMA 4WFHE 2VZVA 3FQRB 4HXBH 2QEJA 4YPJA 1GOHA 1Q1JL 3TN0D 4BH7A 1YNKH 4O5LH 1D6VH 1K3ZA 3RWFA 2YA0A 3S35L 4L8BB 2DYPA 3WS3B 3WCYA 5DMIH 3WV0A 5KG9B 2GJ6E 1AKJB 3T1WA 2HFFA 5I9QB 1FAKT 1ZSDA 3QHZH 4LLAA 3U79A 4NWTL 4R2GC 2MWCA 4BQBA 2APWA 4L9LB 3K8LA 3SE3A 3F7PC 1ZHKB 3U30C 1NJ9B 4NNXA 4K8RC 4WHTA 3F7RA 5GS0C 4LCUB 4JO2H 4FQXA 5E2UL 1BFOA 4XMKL 3FQWA 3IKCB 4OBSA 4R6UA 4NRYA 3LKSB 1HDMB 5A16B 1EERB 3WKML 3MROA 5SWSB 3INUL 2X89A 1JZ5A 3AU1B 1FVCA 1RUKL 2FJFA 4LNRA 3VXNA 1YEEH 2VDML 5EC1B 3HFML 1EHNA 2EC8A 3FN0L 1EO8H 5FA4A 3SY0A 4I0CC 4MJ5B 2RHEA 3SDDB 4R90H 3IDGB 3GSVA 2JCCA 2YPKB 2EYSB 1PLGH 1U6AL 3QUXD 4NKDA 4XP4L 1ZHLB 2B8OT 5FXCH 3BEWA 5DHVA 3O6ML 3MX0A 4F2MB 4PJXE 4U6VH 4B50A 3C60B 4XNUL 2B7DT 1C1EL 4P3DB 5CEZD 2ZG3A 3OB0K 1JNHA 1T6VN 3P9LA 4DN3H 1QKZH 4I2XB 2YA2A 4ELMB 3B2UD 5FHBH 3U4EA 4JKLA 4XCYB 4S1SL 2I9TB 4HIEB 3F12B 3BYYA 2VZUA 3KPMB 4IDJH 1QSFD 2FEEL 2R2CA 2A6JA 1Q94A 4UT7H 4LKCB 1INDH 3TP4A 3THML 5DT1H 1AD0B 3U9PH 2WBJC 3MRIB 1CWVA 2BHZA 5SX5H 3WUWA 1FLRH 3S3PA 1MCEA 2IJ0C 3BWUC 1A4KB 4NHCH 1AIFB 4M7JL 1FNHA 1FL6A 1IQWH 3GSXB 4HDIB 4ZO8A 2NY7H 1QRNE 2EXWC 1T1WB 2XA8H 1XF4A 1AGFA 5JW3L 1R24A 1FZMA 1UACL 5GGSB 3IAQA 1DE4A 5TF1L 1DN0A 2PXYD 2F54E 1I9IH 4WHYG 4LQ1A 2VMFA 3SOBH 4KRMB 3NVQA 4PJGE 3VXTA 2EEAA 3VRIB 1F02I 1I7RA 5ISZA 3SKOA 3UPAA 3MRBB 1P1ZA 4XBEH 5MHSE 1RK0A 1NCBL 3O41B 2QSCL 4JEGB 2YUZA 9CGTA 1FGNL 4E41A 2AEPL 2VC2H 5E6YA 1CFNB 1JMZA