2EEBA

Solution structure of the 22th filamin domain from human filamin-b
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
106
structure length
106
Chain Sequence
GSSGSSGSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Filamin-B
publication title Solution structure of the 22th filamin domain from human Filamin-B
rcsb
source organism Homo sapiens
total genus 7
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2007-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2eebA00
5I66B 3B3IB 2F74A 4HEME 3QQ9C 4PGJA 1LK3L 1T5WB 4OJFL 1E28B 2V2TB 5C0EA 5FF6B 1HOCB 1M7IA 2JB5H 3UCRA 4C55A 2E7HA 4HBQA 5DJCA 5B38A 1RD6A 1J1OL 3VXUE 1OTUC 3VXOB 3VGFA 5EO0A 4L5FH 2BC4B 1HDMA 2MWCA 2PO6C 1HILB 2D7QA 4DVRL 3UROR 3KNBA 2ZPKH 3SY0B 2DBJA 4YBHA 3MV9B 3E8UH 1EHLH 2FD6L 3VFGL 1FFQA 2XZCH 1A6AB 4IHOA 5EPMA 3IFNH 4FFYL 4N0UA 4DVBB 2R23B 2BRRH 1WBYA 4XH2B 1J0JA 5IB5B 2P5EB 4PRHB 4MB4A 4MVBD 3VG9C 3LIZH 3V8OA 5KSVA 3FFCA 5FO8A 2BDNH 3RUGB 5FA4B 1CFSB 3ZL4H 2GCYB 4YFLI 3EOTH 2ICWB 3MJ9A 1B88A 4X7SL 4XB8A 4S1QH 2IFFH 2VZSA 5E8PB 2NY3C 4E41D 3TCLB 1BIIA 4JY4A 4PJAF 5J4MA 1JPTL 4R4ND 1GCFA 4PJFE 4Z8FH 3AUVA 3HUJF 3KYAA 1MFBH 3QJFA 1J18A 1RZJH 3BH8B 4NCC2 2AQ3A 1KEML 1TZIA 2J4WL 4WW1A 3V4UL 4GRWH 2APFA 3TBSA 5JHDB 1U3JA 2DQIH 1YY9D 2IQ9L 3H42H 3IKCB 5FYKD 4AH2B 4NSKB 5DD0H 1FO0H 2V5YA 1XGPB 1BZ9B 4F37F 2V2XB 4FTVD 3ULVF 3LRSB 2PETA 4HS3A 1CZ8L 1P7HL 3SCMC 3PDDA 2E8YA 1DL7L 2YBRA 2OP4H 4ZD3H 4YPGB 4NQCE 5L8JB 5CKAA 3WS6A 3FTGB 3QDGE 5FA3B 3UTPE 2UY6A 4M8QA 3MCG1 3SE9L 2XN9A 2W92A 2FJFA 2RCSL 4NQDB 2NY4C 3MRLA 2EH7H 1CE6A 3BYYA 3C2AH 2W65B 5L88H 2Z35B 3PP3K 1MOEA 3MCKB 1EMTL 2X9WA 5KOVC 1QBMH 2B0SL 1MCNA 4KROC 4OZGE 1BQSA 5TQ0H 3RVUC 2DI9A 4MXQD 2E9IA 3STLA 1JNJA 4GRLA 3BX7C 1EBAA 1UVQA 5HGDA 3GSOA 3DVFA 4PJ8C 2VZTA 5JW4Q 2Q86B 2VIRA 3M1BA 4ZSOB 3GB7B 1UJ3B 1IBGL 3C08H 3B5GA 3MMEB 3CUPB 3Q6GL 4WUUA 2D03L 3ZYOA 1HHGA 2I07B 2XFXB 3BXNA 3UMTA 2X9XA 2E7CA 3DECA 3C2SA 1HXMB 3C09C 3JWOH 4Z95H 3BKJH 3QI9B 3RWCA 2OX5A 1J1PL 4HFUH 3WIFA 3HG1D 4MQXC 3L3JB 4XWOC 1A3LH 5DS8A 4OD1L 1H8SA 1RZ7H 5EOCH 2YR3A 5DQDL 3P2TA 4AK1A 4OGYH 1N3NA 2G60L 4JQXA 4XCFH 4F58H 3RTQB 4LPVA 1NBQA 1JPGB 3QIUA 1VFAA 4HK3J 2NY0B 4XC3H 5FYJH 1UWEL 1QLEL 2DQFB 5EUOF 4LVOB 3GUTB 3LEVH 4MX7B 3IJYA 4PJXA 2IALA 5J56B 2V5TA 4BK4A 5KOMC 1UENA 4MQSB 4UOW1 4MA8H 1KJ2A 4N9GA 1B90A 5KVFH 3LQAC 4LKXA 3RDTC 5IM7B 5HYEA 1KOAA 4S1SH 5I1AB 2LE9A 1X7QB 2N1KA 3S6CA 4TVPH 4Y2DD 5BS0A 3FQNA 2VTFA 2OR9L 2XOTA 1V3JA 4J23A 1V7ML 4M02A 3FO9B 4U6VL 1JK8A 1JP5A 3P73A 1VPOH 3SGEI 3FO1A 5HDQH 1W8OA 4FMKA 2YA2A 1DP0A 1FZMA 1CXHA 1SEQH 4G6FD 3WNMA 4JHAH 1C8PA 4WV1B 5DYOA 3NPZB 1OP5H 2XA3A 1JHLL 2Y7QA 3QULB 4APQA 2BNUB 1DBBH 3IDIA 4WEUD 3DARA 2VSDA 4DZ8B 2NR6C 3G6DH 4Z7UA 3ARPA 4C4KT 1AO7E 5B8CB 1XR9A 3GSNL 1HQRA 1NEZA 5JXAL 1OSPH 4X99B 2ICWJ 2K7QA 3JWDH 2EE2A 4YO0A 2R8SL 1XF2A 5EOCJ 5IB4B 5F1KC 5GHWH 3BQUA 1JF5A 4JKWA 3NABH 5E4EB 1VA9A 1JGUL 1WIUA 4LOUD 5CGYD 3UJIL 3HAEA 3FT4B 4M7LH 1WF5A 4JQIH 4FFZH 1YNTA 3C5ZA 1KEGL 4BQBA 4XNZB 4LGSB 1AY1H 4IRSB 4NN7B 4YHLL 5B39B 4MXWH 4WGVB 2FJGA 2EDLA 4GLRI 1MY5A 3NH7H 3QEHB 3KGRA 5I9QB 4ZFZB 3STZA 5CSBA 1NANH 2BX5A 5KSBF 3S7GA 1KCRH 2VL5B 1HZHH 1K8IB 4XNUL 2IANE 4P23B 2R0KL 5T5FL 3TLRA 5JOFB 5CMAA 1F6FB 5D6CB 5TGBB 2RGSA 3ULUC 5FYLL 4DKEL 2FX8L 5AUMA 1BBJA 5HBBA 3QUXC 3RVWD 2FEEL 2FR4A 1P69B 4RA3A 3V8CA 3LEYL 4ZAKD 4XAKD 3MLYH 4LPXA 3VFWA 3P0YH 3SE3A 3RGVB 1O7VA 5DT1L 3TWCL 3TFKC 5E8EA 3MRCB 2AJUH 2NX5E 4XMPH 1KTLB 5JHLH 2V9QA 1QRNB 4C83A 4JFYA 2IG2H 4O9HH 3RKDC 2G5BB 3WN5C 4LVNC 5ABDE 3D85B 2EKSA 2PYEE 1WWWX 5IV2A 5FO7B 3WE6B 1KC5L 4HJGB 5IW6B 3EFFB 1TZHA 2AJYH 2RAMA 4BM7A 1R3KB 1WAAE 1OARH 4NNXA 4RGNB 4JFQB 5MENB 1D7FA 2NQCA 3F7PC 4D0DA 3QWOB 3O3AB 4YBQD 5JW4M 2J8OA 4N8VB 4OF3A 4K3DH 1MQKL 3O4OB 3VMPA 5LGJA 1D5IL 4M61A 1AXTL 4NQUA 4UV7L 2KQMA 3RY6A 5FUCE 4M1CD 2CGRH 5E2UL 5ESAA 15C8H 1OF2B 5F9WC 1PEWA 3ZT7A 3SGKA 5GGRB 4I0PA 3TN0D 3MBXL 1HHHB 2QV2A 4XTRD 3MLVL 4W70A 2CIKA 3TZVD 4Y1AD 1LEGA 3BPLB 4M62H 1U8MA 5HDLA 5DJYB 1IGYB 4MMZC 2DS4A 1AD0B 2ZSVA 2PNDA 4UIKH 5EZLA 2A6KA 5BZWB 1INDH 3ARGD 2JCCA 1DTUA 2V7NA 2VJXA 3SDCC 4P2QE 2EDWA 3O41A 3Q3GB 4JO3L 2D4FA 4PG9A 4TNWF 3ULUE 3DO7A 2E5EA 2XQBL 1TLKA 1HHJB 2P4AB 1RAMA 3HZYB 1CVRA 3H0TA 5SWZE 3MRRB 3FHAA 4NDMB 2DLFL 3MFFA 2WK2A 1CLOH 1NAML 5DFTA 3TM6A 5MEQA 4X8XA 1DN0B 1MH5B 1T1YA 2VLRA 4E41B 3S98A 4AYFA 4NN6B 1RZIA 1A7QL 4EDXA 1JE6A 3RWDB 1CGWA 4X6DA 4UT6L 3NGBC 1LK3H 1QFOA 4OJFH 4PYHA 4ZXBA 4JG0L 4JZJC 1P1ZA 2FWOB 1PLGL 3ALWA 1J1OH 2BCKA 5DRXA 5IEKA 1SQ2N 2AJXL 2DQHL 5I2IA 2G75B 1MNUH 4DVRH 1KCUL 4X6CF 1HXYB 3P77B 3N0PB 2ITDB 1IGJB 4FTVB 2FD6H 5C0DB 2VNCA 1Q0XL 4N0FB 4FFYH 3JUYA 4G8EA 5ESVA 1WCBB 4F37K 4D2NA 3UEZA 2KDGA 5GRYA 4RMVA 1D6VL 4RQQA 3QQ4B 1ODAA 2Z93B 4X4ME 2AKRB 3MJ8A 4X7SH 4LRNL 5K9KA 3CMGA 2B1HL 3MRJA 5IFJA 3TIDA 1ZSDB 9CGTA 1JPTH 5DZNA 3NFSL 5I19H 5A1AA 4GKSB 1JGVH 1ZVSA 3W11C 3FOMA 1GOGA 1KEMH 2J4WH 2DMBA 4R3SB 5I0DA 4Y4KC 1FVEB 4YEEA 5HYJA 4BQCA 2VN7A 4OFKA 1B0RA 1OAUH 2IQ9H 1EHXA 5D7LA 4LLQB 1NGQL 1CZ8H 2GI7A 3AREA 3RWFA 4F7EB 2CUIA 5B4MC 4R96A 3KJ4C 1DL7H 1D5ZB 4QY8A 1NKOA 1V05A 2NTSP 3HG1B 4IJ3B 1MHHB 5F7UA 1UM5H 1IEHA 5I8KL 4OQTL 3FRPA 4OFIA 3SE9H 4JDVB 2RCSH 5HHNB 5F1IB 2OZ4A 5ITBL 4OD2B 4OV6F 1NGZB 2D7OA 1RJZB 2BY3A 2B0SH 5I1CL 3NCEB 5TE4H 4P46A 2PW2A 5EH1A 1LNUA 1MCBA 4L4TE 3CC5B 2A6DA 3GSNB 1CIDA 4XC1L 2N4IA 5T3ZE 1IARB 1DLFL 3P9MA 5DGRA 1TPXC 2B1AL 1JPFA 3TBTB 5FYKH 1UKQA 1VFMA 1DVFC 4NKDB 1MHEB 1IBGH 2V17L 1T03L 4HWZB 2ZSWA 1C12B 2EO1A 3Q6GH 5H35B 1FG2B 2D03H 4HBCL 3OQ3B 4Y2DB 3X13B 1UT9A 1FVCB 1KELL 3GSQA 2G9HB 1GGIH 4YHPA 5SX4I 1JN6A 4JM2C 4PJDB 5F8RC 4KHXL 3FB8A 4QRPA 1T5XB 3B8SA 5A43C 5K59F 2EIDA 4ZFOA 4L8CA 1V3LA 1ZHLB 5EDXA 4OD1H 5CJXA 1PG7L 5DQDH 5I18H 3I9GL 4PJIB 1RIHL 2EC8A 2QJDA 4S10A 2G60H 4LBEB 5D96B 1CGTA 4LFHG 1AE6L 4ONHB 4FQHA 5DA0B 1VKXB 3ZE1E 5IESL 4WJ5A 4TUOA 3HNVL 1JPST 3EGSB 1QLRB 1MCPL 1UWEH 3M8OH 1QLEH 2GJ6A 2R56L 2JJTA 1T3FA 2JB6B 4DOHE 1Q94A 4KK9D 3BKCL 1RZJC 1YY8B 2FBOJ 4KMTL 4XI5C 4Y4FA 3Q1SH 5EU3A 2VUOA 4WWKC 1F3JB 2Z92A 4ODUA 3EDFA 2EIZB 1T0MA 4ZUSA 2ICWI 1KTDB 3L3OA 4M7ZB 3T0DA 1G7MA 4ZDHB 3QHZL 2OR9H 1JRHH 2PW1A 2VLLA 1V7MH 3PUCA 4CN6A 2R2BB 4D94A 5IMLA 4LLYB 3DXAB 1Y0LB 4OGAD 3RL1A 3FRUB 3DSFL 3VFTA 1TTGA 3VXME 4KTDL 3L6FA 5CJOH 4YE4L 3VXUA 4U1LB 1NGXB 5HJ3A 1JHLH 1UH4A 2E6QA 4GKNA 5FIEA 1GPOL 3DOSA 2W60B 1XZ0A 2DAVA 4S11A 3ZKND 1RK1A 4CBPA 4ZFFA 1N4XL 3GSNH 5EO1A 1QBBA 3MRHA 3ZYZA 5JXAH 3C6SB 4F9LC 1MHCA 1G7HA 4LDOB 3H9HA 4ZAKB 3VD3A 2A1WL 5DO2C 2CLVB 5CZKA 1CFTB 1WISA 2R8SH 2VRAA 3MLUH 4LPUA 1Y18B 4MA3A 1JGUH 2EDBA 3UJIH 5BOPA 3GMOB 1Y6KR 4PJFA 1BOYA 4N5UA 1A7NH 2C5DC 1KEGH 5K9OA 4WI2A 2XZAL 3MGTA 5MEOB 4YHLH 3ZKSD 3U0WL 2HKHL 5D7IE 3JWOC 4NQXB 4LLVA 3TPUA 1Q0YL 4BH8A 4G6AD 5JDJA 1MWAL 2OTUA 4LAQL 1YMME 3RI5F 1NGWB 4XNUH 2VB5A 4P5MB 2EO9A 1KB5L 1EGJA 1HEZB 3TBYA 1A5FL 2R0KH 5T5FH 4FOMA 3HZKA 1GL4B 4Y5YA 5C1MB 3RNQA 3OR6A 1NDMA 4H0GA 1NAMB 5E99L 3PXJA 2FX8H 5C0IA 4NWTL 4PJGE 4FQ1L 5E7FA 4I2XE 3LEYH 3MRQA 2HA1A 4NQCA 3TN0B 3HR5B 3UBXI 5ISZD 3VXSD 5DT1H 3MTRA 3TWCH 5IKCB 3QDGA 2BFVL 3TZVB 3CZJA 4HPOL 4Y1AB 3BZ4B 3I02A 4XP6L 2I24N 1EEUA 3J7HA 4GO6B 4FABL 1JPSL 2Y6SC 3ARGB 1IEBB 1U8OA 2V7HB 4HH9B 1IC7L 4NPYB 4KI5C 1K6QL 3K7UA 1KC5H 1LO4H 2IH1A 4F3FA 3SKOB 3DBXA 4HK3N 2FZ3B 2X44D 5IEHA 4JFPA 4TNWK 4GSDL 4YGAB 4BQ6A 4L3CA 5EBLA 2X42A 3D6GA 3BZEB 2DMCA 4U7SA 5TE6L 4P99A 1JUFA 2NTFB 4MA7H 4KJQC 1AXTH 4UV7H 5DD6A 3MV9E 5E2UH 4NBYB 1DEEB 1ZT1B 5T1DL 3QIBD 2CSPA 3N9GL 4EXKA 3CSYB 1EZVY 5J0BA 2P5EE 3F5WB 4PRHE 3Q5YA 2YPLE 1UJ3C 3MLVH 3RUGE 1EAPB 2GQHA 3FB5B 5CJ8A 5IVXF 5F88A 5HYFA 3GSWA 2DQGL 5I17A 4AEHH 2J5LB 3QI9C 5ICYB 1F11B 3IDYB 3TVMD 1HSAB 5FDWB 5C92A 1GC1L 1WFOA 4JO3H 4LNRB 1DFBH 3SCMA 2Z4QB 3MFGB 5FYJE 1AR1D 3QXAA 2ENSA 5GXBB 3BW9B 2RJMA 5AZEL 3TT1L 4NHCL 4XCCL 4R8WL 5FYJU 2DLFH 4XCNA 3RTQC 3U9UB 1NAMH 2DWDA 5JHDE 1KN4L 2NY0C 4K3JH 3O4LD 2AJZA 2CD0A 4WI5A 4ODTL 2XKNB 4HG4K 4LVOC 4HC1L 4QOKD 3VDAA 1EBPA 4ZO6A 5D9SA 1A7QH 1TVBA 1WC7B 3AY4C 1D5BB 4AQ1B 1XGQB 2H6PA 3L3IB 5F3HB 1KPRA 3W82A 4OFYD 4UT6H 4KPHL 3MV7D 3DROB 1A4KB 4X5XA 5HI4C 4KFZC 1A6ZA 1PLGH 2P24A 1E6JL 5JPNA 4PJ8A 1HNGA 5L2KB 1HK6A 2AJXH 2DQHH 1VADB 4HF5L 1AO7A 4NQDE 5ALCL 3UJTL 1RZKL 5GGUB 1AD9B 1WZ1L 1KCUH 4X6BA 3MRBA 1G7LB 2VKWA 4GQ9H 5JA8B 5LVEA 1D6VH 2XWTA 3KPNB 4JLRB 1MI5D 5F1NA 4ZSOE 1F58L 4YDJA 5I1KL 5B8CC 2BY2A 1SYSA 3O2WL 5I8CA 3WLBA 3D3VD 2B1HH 2VL4A 4HIIA 3ULSB 2Z8RA 1TITA 5D7KD 3ZKMD 1JVKA 2NW2B 4NQVB 2AVGA 4U1SB 3NFSH 4QHKJ 2BVPA 4KKAD 1SEBA 4P5KB 5ILTH 4PTTB 2AQ2A 3V5HA 4XXDA 5E4EC 1GGYA 2IANA 2DQTL 3HPJB 1NMBH 1KIPA 3BEWA 4MAUL 2AI0L 5D72L 4ZUUB 3RDTA 4B0MM 3L1OL 3HRZB 4XNZC 5ESQB 1WWBX 32C2A 4IRSC 4GMSL 3MUY1 1XF3A 3OKOB 4K9EL 3BUTA 1C5BL 3OKKA 2M1KA 3TCXA 5I9QC 2VISA 1OGAD 3FQWA 1K4CB 2CH8A 1IGML 3I3EA 3MCLH 4NRZA 2NX5A 5IJKC 3NN8A 5E2VL 1VGKB 4P23C 3G5VB 5A2KH 1Y6NR 5EOTA 5I8KH 4OQTH 1L0QA 4HHAB 4XCEB 4MXVF 1S5HB 1JV5B 2PYEA 5ITBH 1F4YL 2ZOLB 4JKPL 3CFCH 2AABL 4Z7VB 1I8LC 2EE9A 2R1XA 3K3QA 5DFVD 1MLBA 1A64A 5I1CH 1WAAA 1CR9L 4N9OB 1VDGA 2HAZA 1UADC 2VR4A 4MD0A 1MIEL 3A6CL 1OP3H 1W0YT 1JZ8A 4XC1H 4HJJH 5MHSD 2A38A 3X3GL 3ZSTA 1DLFH 4U2ZA 2B1AH 1I9EA 1LP9F 2R1WA 2DQUH 1T03H 2V17H 4W4OC 4A2LA 2WWMD 1B3JA 3WXVL 1BFTA 3K2UL 4HBCH 4G6KL 5CBEA 5C86A 1KELH 4O2CB 1A6WL 4POUB 1KCSL 1KJMA 1UYWH 3QDAA 4RGNC 5EC2B 1NUNB 1BOGA 4KHXH 4H1LA 3WJLC 2DWEA 3OG6B 1JF6A 1QO3B 2R15A 4XNYL 1DE4A 2FJHB 4ZUTA 1AHWB 3WUWA 5KW9H 4HIHA 3C6LA 3I9GH 3OBAA 4HUXB 2JK5A 2C4XA 1RIHH 2FEDC 1FV1A 1NLBL 1AE6H 3QA3A 4LKCB 2C3WA 1WVZA 3SQOL 5IESH 3HI1A 4P2QA 1GGTA 3KHOA 3HNVH 1KB5B 2QKIB 1MCPH 4TNVK 1ZGLB 2GEEA 1XF5A 3RWIA 1UEYA 5FM5M 1GVIA 2Q76A 2PCPA 3BPLC 5SWZA 3BKCH 5KSUB 4KMTH 5HDBF 4HKJA 1H3XA 4RAVA 1BFVL 4QKXB 5IG7A 1B0GA 1SMOA 4WNQB 4GFTB 3O2DL 3D39D 2DIAA 4RISL 3MOBL 3QUKB 5SX5K 3QHZH 3VFSA 1G6RL 3F12A 2ZJSL 3WN5A 1OHQA 2H41A 4NGHL 3VXTB 3FO2A 3GJEA 5DEZA 3REWB 4M5YL 4MVBC 1V3MA 1I7ZA 4X0KA 4GW1B 4JY6A 1VACA 3QZWA 4OUOA 4QO1A 3FT3B 3PHSA 4KTDH 4YE4H 1SJHA 5KVDL 2DLTA 2DTMH 3SDDD 4ODXA 1S7WA 2YMXL 1QRNE 1RJCA 1GPOH 2Q6WB 2G2RB 3U0TB 3MROB 4NN6C 4JRYD 3RI5K 4YFDB 3VJ6A 3PL6D 1F4XL 1OB1B 1JWMB 1QVOA 3MNZA 2APBA 2WP3T 2DLGA 3VFVB 3DX6B 1YEDB 1AIFB 3AMKA 1NC2D 4YXHL 5CD3A 2V2WA 1FYTD 3EIFA 4LCYB 5D1QD 5TE7L 5ISZB 2A1WH 2X4TB 3VXSB 3SPVB 4RGNE 1X4XA 5MENE 4BFBD 1XF4B 4X4MA 4KK5D 1P2CB 4I3SH 1YY9C 5EIQA 4MCZB 4MJ6B 1W0VA 1NFIB 1BGXL 1ITBB 1EUTA 4XPAL 2GHWB 4Q9QL 1KNOA 1Z9SA 2XZAH 1DUZB 1INQA 3C60D 3TJHD 3U0WH 5F96L 5BRZD 3IDUA 4HXAL 4GRMA 1I8KA 4LSPH 1Q0YH 3BPCA 4GKZA 4U1GB 3OKDA 4XVSL 4LAQH 3H7LA 2EH8L 3BYTA 4LSRL 4U1MA 3I3DA 5I1GL 1KB5H 4H0IA 1A5FH 4MNHA 2X10A 4EZMA 1N6QL 2DIBA 3TYFB 5DR5L 5SV4A 5E99H 2F19L 4UNUA 5AAWA 5I6XB 2O61A 3UTTD 3LKSA 3OHXA 4FQ1H 2CRMA 3QIBB 1BF2A 3Q2CA 3RWGB 4KRLB 4J3XA 2BFVH 3BKML 4HPOH 2J88L 4JZJA 1FZJA 4XP6H 1JHKL 4NJ9L 3PWLB 2DQEH 5IR1B 1LEKB 3EYFA 5IK3B 3EFDL 3VDBA 4Q58C 3W9DB 1CTOA 4FABH 1JPSH 1HHKB 4Z76A 3NIGF 4E41E 2DKUA 2OXGA 5IW1A 2WINB 2UZXB 4ETYA 1C08B 1IC7H 4WTZG 3TVMB 3CX2A 4NRYB 1K6QH 1TVHA 2IBBA 4L4TA 2Q1EA 4I4WA 3VRIA 5CIPB 1UCBL 4IJ3C 3BDXA 2D7MA 3HZMA 1HCFX 3ZDXE 3T4YA 5EBGA 1D6EB 2YD3A 2BVUA 4GSDH 4HUWB 1KLGB 2ATKA 3MA7A 4K3HA 4F57L 2CO6B 4IS6B 5TDOA 5HGBB 1IGIL 2EDJA 2YRPA 2R1YA 2MSPA 4IMKC 5TE6H 4LEOA 3O4LB 5DJ2B 1K9TA 4GG8A 5FYKE 5HVWA 4ZOEA 3V95A 4QOKB 3DUUB 3FQUB 4UTBH 5HVHB 1P9MA 4FTVE 1WBXA 5TH2A 2JJUA 2QL1A 5T1DH 5FKPA 1BECA 5FYKU 3N9GH 3ZDZE 1NH6A 1LO0L 3G5XA 2YSSA 5DQ9B 3MV7B 4LP5A 2ADGB 3ARFD 1TETL 5JR1L 4DK3A 2X1PA 4Y2DC 1NCCL 4Y4KA 5C8JB 3V5DA 3SGJC 3MPCA 4FXKA 2DQGH 4NKOA 2VDKL 1IQDB 5DJ8A 1HH6A 1GC1H 4XVUD 4N8CH 3UTZA 4RFOL 3BGMA 5GGTL 2X70B 2VDOL 4JHWH 5D96C 5AZEH 3TT1H 1PYWB 3O2VL 1MI5B 2IQAA 4LCCC 4NHCH 4R8WH 2ID5A 4XCCH 5CP7B 5E8NB 4Q9RH 3NZ8A 3ILQC 3PHOB 1YYLL 4MB3A 3VD9A 3V0WH 1T1ZA 1CD8A 2B8OT 1KN4H 2BOBB 4JM4L 3D3VB 1DQJB 5DEFB 1T6VN 4ODTH 1N5AA 4JN2B 2OJEA 2R4RL 4IRZL 4HC1H 5I16B 3LKPB 4ZG1A 5ACMA 3CFJA 3VXMA 1YPZF 4LIQL 5J9PB 1QD0A 3O3EA 4A6YB 4M7JL 4KPHH 3QHFL 3HG1E 3UTSD 1CDGA 4LOUC 1FNEB 4M7ZC 3EJZD 3V6ZB 2W0PA 1E6JH 3GJFB 3ZT6A 2XV6B 2DL2A 1DVFA 4LVEA 2BSRB 5TF1L 4DUWA 4HF5H 2FL5A 3UJTH 3SKNA 1WZ1H 1MCQA 5CIPH 4TOYL 3PP4L 4OZIF 3T08A 1UZ8A 3ROLB 1OGAB 4JM2A 4BH7A 1A4JA 3EAKA 1MJ8L 2CQVA 4KK8D 3PGCA 5C0AD 5IB3B 3T3PE 2YUZA 4LPCA 2ADFL 1ORQA 3KPLB 5T1KA 4MHHG 4K8RD 3IF1A 1LO2L 2O5YL 1F58H 3VFOB 1DDHB 5I1KH 4YUEL 1QFHA 4WI7A 5C9KA 3O2WH 2UWEF 3KYMB 4JFXB 1A1NB 3RVWC 4LHUG 4UBDD 5EBWA 1Z0MA 4ZAKC 5D7IA 5D1XD 1KIRA 2J8UF 5IVOA 2J6EL 4Q97A 4PJDE 4GUPA 3UPCA 4N5ED 5J7CC 4JZNA 1YMMA 4F8QA 3PWVB 4V1DD 2DQTH 2VABA 3VFPA 2BY0A 5H2BB 5D1ZD 5FB8B 4MAUH 4WWKA 2YC1A 4NO2B 2O26U 5D72H 5HYSB 4PJIE 3L1OH 3V6FA 1U8PA 4GMSH 4LARL 3CVHL 4PJGA 4I2XA 4K9EH 3GHEL 3KS0J 4UDUB 1C5BH 1AXSA 4CADA 1FO0A 4NNYB 3T4AA 1IGMH 4K8RL 1G6RB 1A7RL 1ZHNB 4YBQC 2EYSB 4ODSL 2DF3A 5E2VH 1MVUA 5JXEA 5H94B 3G5YB 3QNXB 3U2SA 2DIJA 1T80A 2X4NB 3CDGA 4UINL 4YHZH 3LKOB 4M1CC 4WHCA 5EN2B 4Q0XL 3RPIB 1F4YH 3S96A 4JKPH 1QR1B 5I66A 2AABH 3B3IA 4L3AA 3F8UB 2ENYA 1P84K 3LKRB 2EKJA 4K94H 5FOBB 4XTRC 4TTGA 1T5WA 2KH2B 3KPMB 1E28A 3DXAE 3MA9L 1MCDA 4D0BB 1CR9H 3LKQB 4F9LA 5FF6A 1HOCA 3TZVC 2V2TA 3PV7A 1MIEH 3A6CH 3GJFH 4DKDC 3D87B 4BFEA 4OF8A 3VXOA 1OAZL 4BZ1L 3X3GH 1IL1B 2BC4A 5E08L 3PABB 3ARGC 2HRPH 1HILA 3PQYD 3WXVH 1K5NB 1MVFA 3D39B 1PD6A 4FG6C 3SY0A 3MV9A 3QCVL 3K2UH 5C9JB 5JORB 5GPRA 1IQWH 4G6KH 3BGFC 5J12C 3OB8A 3ZTNL 1A6WH 2MFNA 1A6AA 1KCSH 4BSJA 4POZD 4DVBA 2R23A 3GSUB 1FL5B 4JHZA 4XH2A 5IB5A 2P5EA 4PRHA 3FZUC 1LO5B 1FORL 3RUGA 2A74B 3K4AA 4XNYH 2ZP0T 5FA4A 5GS3A 1CFSA 5HDOA 4Q7DA 1YNKH 2ICWA 3SDDB 1D3CA 3LD8B 3MJ6A 5E8PA 1JZ7A 1T1XB 4XNXL 3TCLA 5KSAD 1VGEL 4U7MA 3OL2A 4P3CH 1CDIA 2P7TB 4L8DB 3SQOH 3IT8D 3PL6B 4FQJH 3PNWB 2HT4C 3BH8A 1NC2B 4LSQL 5F7LB 2L4OA 1FYTB 5D1QB 3H7BB 3BO8B 3UPAA 5DDHB 2MCPL 1UWXH 1N0LA 1X9QA 5F7DB 5JHDA 3MNWB 2QTEA 3IKCA 2J5LC 3O2DH 4AH2A 4J3OC 4BK5A 4NSKA 4RMUA 3IDYC 1XGPA 1BZ9A 4RISH 2WBJD 2V2XA 4LLMB 3ARRA 3LRSA 4PG2C 1G6RH 2ZJSH 5BW7C 3Q0HA 4NGHH 4FQIL 3C60B 4YR6B 5BRZB 4YPGA 2DB8A 2XWBB 3FTGA 4J6RL 3P4LA 5FA3A 2CJUL 4Y1AE 2ARWA 4NQDA 3SKMB 2YMXH 1ITCA 3O6LH 2HJKB 1N8ZB 3V6OC 1JZ2A 2W65A 1RMFH 2Z35A 4DGIL 1UA6L 3MCKA 1F4XH 4NKMB 3DX8B 3UTTB 3PJSB 4XZUB 4YXHH 1QFUL 2FNBA 2W0FB 3BKYL 2YK1L 4PJEF 5E8OB 4OI9A 1ZLUH 5ID0B 2Q86A 1ZEAL 4ZSOA 3GB7A 1UJ3A 3EO1B 4NC1C 4HH8A 3B9KD 1WWAX 4O4YL 3MMEA 4RWYL 3CUPA 4DWHA 4IRJB 1NC4D 1YEJL 3MRGB 2I07A 4K7PX 5FV1L 2XFXA 5C0BD 3RPKA 1BGXH 1UJTA 3RVVC 5L2JB 2BHZA 1W8NA 4XPAH 5E1AB 1HXMA 3K4DA 3MRPB 2GJZB 3LN4A 2C1OB 5I74B 3QI9A 5TDPB 4TRPH 1WUNT 5F96H 4HXAH 3NIFE 4ISVB 2NXYD 3L3JA 5IGXL 4MYWB 2JJVA 1X5IA 1BZQK 4XVSH 1MCOL 1RURL 4C58B 2FH8A 3DGGB 4YHIB 2EH8H 4HLZG 4LSRH 4XX1E 3RTQA 5I1GH 3MRFA 1JPGA 4CMHB 1N6QH 3LKNB 5AZ2L 3SBWC 2DQFA 2VKXA 3GUTA 4J3TA 4MX7A 2F19H 3BJ91 4PD4K 5FDYA 4L8SB 3GMNB 5IM7A 3BKMH 3ARFB 4OF5A 2J88H 5I1AA 1WGOA 1X7QA 2GITB 3GBNL 2EEDA 3EFDH 3FO9A 2EDNA 5KANI 2F53B 3V6OE 3P4MB 1T22B 4F15B 3P0GB 4WV1A 4Y0GA 1UCBH 1FFNB 3QULA 2QQKL 2BNUA 5JQ6L 4DZ8A 4EI6B 3M17B 4F57H 3HPLB 1IGIH 4JZOB 5B8CA 4NC1E 3B2VH 2CRIA 4NO5B 4Q74A 3AC0A 4RMSA 5C0FB 1S9YB 4DFHA 4WHTB 3MV11 5IW3A 4X99A 3NZHH 3R0NA 5J3HC 3FQXB 4YFLF 4AJ0A 1JF1B 3AFLA 3ULVD 1AGBB 1LO0H 2GT9B 4MD5B 3L9RB 4NUJB 4BZYA 2FO1A 4Q9BA 4NZRL 4KQ3H 3BP4B 1TETH 3ZE0F 5JR1H 3ZO0A 3FT4A 2NMSA 1NCCH 3EOAB 4XVJL 2E3VA 2OS7A 4IRSA 4WO4D 5B39A 4OGAC 4ZFGH 1CDYA 2KQNA 2E6JA 2VDKH 1TENA 3D25B 3QEHA 1QFWI 4ZFZA 3CVHB 1AHWC 3IGAB 4RFOH 1X6NA 1OTTD 5MERB 5GGTH 4ZPTB 3KLAB 2VL5A 4PRPD 3VWKD 3BP5B 1K8IA 1JGEB 5IJKA 2VDOH 3ZKNC 5E95B 4P23A 3O2VH 5JOFA 5D6CA 1CLZL 1YYLH 5TGBA 3MJGX 4ODWB 3O6KH 4XMKL 4JM4H 4K3EL 3ULVL 3K80A 3VG0L 1CWVA 4LSSH 2R4RH 4IRZH 4Z0BL 5D1XB 1I8LA 3RGVA 2VXVL 1FGVL 5T3XD 3MUZ1 4HAGA 3DJ9A 4LIQH 3MRCA 3EYQD 4Y8DC 1DLHB 1KTLA 4M7JH 2IWGA 3G6JF 3QHFH 4V1DB 5JQHC 1QRNA 2VITB 4RAUB 5D1ZB 1N2RB 5J1TC 5TF1H 2G5BA 3D85A 1IC5L 4XWGL 5FO7A 3WE6A 3QFDB 4TOYH 4Z7VE 1AJ7L 2NW3B 3PP4H 4HJGA 4L1DA 1CGVA 5IW6A 5LXGL 4M00A 3EFFA 5IHBA 5CZVL 1R3KA 4G6AC 4ONGL 4GJTB 4JFQA 5MENA 3WJLA 1MJ8H 1IAMA 4QXTB 3QWOA 1MAML 3O3AA 1XFPA 4UZGA 4ORGB 4NHUB 4NYLB 5FGBC 3X12B 1T20B 4N8VA 2DOCA 1LO2H 2XA8L 2O5YH 1E6OL 5FM8A 3SDXB 3AS2A 3JV0A 4Z7OF 5T3XL 3U0PA 3BVNB 1M7XA 1OF2A 3B6SB 5DSCB 5GGRA 4HQQL 1AKJD 3SDYL 1RK0B 4QYOB 5JOEA 2J6EH 1QSZA 4YBLB 1HHHA 4PLKD 1QSFD 4LK4A 1NGYB 3ARVA 1KPVB 1MELA 5DJYA 1IGYA 1YJDC 3ZZ1A 1AD0A 4GG6F 1NFDF 3I3BA 3PP3H 4ELMF 5BZWA 4G7VL 3PQYB 2B39A 3L3KB 4JB9L 4LARH 3CVHH 3H9SD 2R2CA 4R90L 3HS0B 3Q3GA 1BWWA 4R9HA 2VWEC 3GHEH 1BFSA 1B4JL 4R7DB 4NCDA 1EHNA 4U1GC 1Q9OB 3DURB 1HHJA 1GC1C 4K8RH 1BJ8A 3HZYA 5CUSL 1A7RH 3MREB 4R4FH 1GSMA 4ODSH 2VDML 3MRRA 4NDMA 3O45B 3RHWF 1DN0A 2X4SB 1S3KL 2GK0B 3MRIB 1MH5A 1ZT7B 1FE8L 4PJCF 4UINH 4E41A 5KSAB 3RX7A 5I6XC 3NCCB 4YDVB 4Q0XH 3S3SA 1BQHB 1KLUB 3QIBC 3RWDA 4GH7B 2Q8BL 3T2NL 2ZUXA 4K7FB 3U7YH 4MJID 3MQIA 2X1XR 5D2LF 3R1GH 1T7VA 1CCZA 2FWOA 4M6NL 4HWBL 4UQ2B 4BZ1H 4N90D 4U6XB 7CGTA 5E08H 2G75A 1FH5H 2RBLA 2VQUA 2YHGA 1IT9L 4DAGL 3W5NA 1HXYA 3P77A 3QCVH 2ITDA 3TVMC 2WBJB 1IGJA 4FTVA 5DHVH 5C0DA 4JANB 4V2CB 1Q9KB 3ZTNH 3O8XC 4N0FA 3RL2B 1WCBA 1RPQA 1W2KT 4J4PD 4MDIB 2IF7A 1FORH 1A2YB 5ISZE 3QQ4A 2OJZL 3VXSE 2Z93A 3BRGC 2AKRA 4D9LL 5E6IB 3IRPX 4NFBA 1JMZA 3OZ9L 1RVFL 4XNXH 5EFIB 1VGEH 1ZSDA 4BQ9A 5HVHC 3RVTD 2VLJD 3NOIA 4R6UA 3U46B 1MIMH 3L7FB 3VD4A 5A2JH 4G9FD 2E7LC 4OI8A 3CX5K 4KC3B 4LSQH 4PJHB 3WHXB 5B3JE 1J0KA 4G3YL 4R3SA 3VFRB 1FVEA 1J8HD 3B9KB 1NL0L 1NC4B 1E4JA 3JV4B 2FCBA 4QCIB 5IF0B 5C0BB 4LLQA 3VGEA 2CUMA 3RJDA 3FKUS 4F7EA 2XIDA 1FN4B 5T1MB 4K9EC 4FQIH 4FQXD 1G9NL 1D5ZA 1IAII 5F3BB 1KGCE 4EIGB 3O9WD 3HG1A 2NXYB 4W6YB 4JVWA 1MHHA 4J6RH 3CZFB 3DLQR 1GJIA 2AEQL 1FDLL 5EOQL 1JGLH 4M1DL 1MQ8A 4RRPA 4JDVA 2F5BL 5HHNA 5F1IA 2YD8A 5DQJB 2Y36L 3ZKMC 4OD2A 3L3HB 1NGZA 1RJZA 3S8WA 4DGIH 4IMKA 3MXVL 1G9ML 4K94C 3CC5A 3GSNA 1NSNL 1QFUH 5DK2B 5CSZB 2X09A 2YK1H 2F54D 1G0YR 4EOWH 2DLIA 1FSKB 3TBTA 5FHBL 1MCCA 1CIUA 2OI9B 1A7PL 4MCYB 1MHEA 3JTTB 4NKDA 4HWZA 3VXPB 3O11B 4O4YH 2QHLA 1C12A 2RFXB 5H35A 1FG2A 4DEPB 4Y2DA 3MOQA 1YEJH 3X13A 1FVCA 3U6RB 2G9HA 4GAGL 2OR7A 4UB0L 3O4LE 3SGJA 2RHEA 4YPJA 4PJDA 1A02N 4PJAB 4QOKE 1FZOA 1T5XA 3B9AA 2HRLA 4DGVL 4K7PL 2OXHA 1U91B 3HUJB 2OK0L 2J2ZA 3QIWC 5IGXH 1ZHLA 1FNAA 3MV7E 4LCIL 1RURH 4JCLA 3FOLB 4PJIA 2DKMA 2KPNA 1N59B 4ONHA 1VKXA 4LCCA 2H3NB 2HFEB 1PFCA 3EGSA 1QLRA 5DFVC 3QJHB 4OLYL 2HN7B 4C56D 5AD0B 3T04D 2JB6A 1F6AB 1BFOB 1CI5A 2BSSB 1YY8A 1KCLA 4GXVL 2PR4L 4X6EB 1F3JA 4OTXH 5K93A 2EIZA 4AL8L 1T2QL 2EE3A 2NYYC 1MI5E 1KTDA 2YD2A 3THML 1J1XH 1P7QD 1E4WL 3GBNH 4ZDHA 2AXJA 1A8JH 3U7WH 5JNYB 3D3VE 5HTSA 2R2BA 4WO4B 5D7KE 4LLYA 3DXAA 1Y0LA 3ZLQC 4KV5F 3FRUA 3BPNB 3KYKL 4WU7B 1GHFL 4U1LA 4WCYL 1NGXA 1NGPL 2V9RA 3FB6B 3HCVB 3MLTB 4PRPB 3VWKB 2QQKH 3GNML 2W60A 1ZGLP 1RQ5A 2DL9A 1TJIL 3A6OA 4GXUN 3NIDE 3D18B 3C6SA 5EBMA 2DYPD 1OY3B 4ZAKA 4PJBF 1OGAE 2CLVA 2DICA 1CFTA 2HG5B 3DUSB 2MPAH 4KI1A 3AAZB 5EU5B 4H26B 3EYVB 3CFDB 1TQCB 5JO5B 5E5MB 4NZRH 1Y18A 4RMTA 5D93C 1WFUA 1FCGA 2X9YA 3GMOA 3ME0A 1SY6L 4XVJH 1CFBA 3MLWL 1U8HB 3BH9B 2HT2D 3VFUB 5MEOA 2EIEA 4NQXA 4JRXD 4FP8L 1DZBA 1KYOJ 1DQQB 2VC2L 5GGSB 2MNUA 1OAQL 3SDDC 5EUOB 1RULL 3LD8C 3HNSL 4X9HA 3DVGB 1G7QB 1NGWA 3F6LA 1EXUB 2W9EH 4P5MA 3DETD 5MHSE 2XRAL 4BFGA 1HEZA 1CLZH 3PL6C 4F9PC 4XMKH 1S7QB 1NAMA 3ULVH 1U2HA 2VYRE 5DGQA 1UM4L 3F6IA 3VG0H 2VMFA 5I76B 5D1QC 2XG5A 2C3VB 4Z0BH 1AKJB 4KK6C 3TN0A 3HR5A 2VXVH 1FGVH 1L0YA 5DC9B 1IE5A 5IKCA 4J3UA 2EXWD 5GRJL 3TZVA 3WS3B 3TT3L 4KK5C 4D9RD 4Y1AA 2F58L 3BZ4A 1RV6X 1PW3A 3ZE2E 2V5MA 4WW2F 4HS8L 2BMKB 3ARGA 1IEBA 2AV7B 4H0HB 2V7HA 5EU6D 4HH9A 1JTOA 3C60C 4JFDD 4NPYA 5EA0L 1IC5H 3H9SB 4XWGH 3TJHC 2Q7NA 4AMKL 1AJ7H 1CFNB 3SKOA 3WIIH 5LXGH 2X4OB 2FZ3A 3FMGL 5CZVH 3KXFB 3C8KB 1D5XB 1YN6B 4ONGH 3T3MF 5IP4A 1JZ3A 2FATL 5CINL 1T66D 1MAMH 3RJQB 2NNAB 1KTRL 4KAQL 5ICXB 4RMWA 4XP5L 3BZEA 2XA8H 1E6OH 5JIKA 2NTFA 3UP1A 3D39E 5T3XH 1DEEA 1ZT1A 4PJ7F 4YGVB 4HQQH 1QNZL 5J6HB 3SDYH 2EYRB 5I1HL 1HI6B 2C26A 3CSYA 4NT6B 2WUBL 3DYOA 3F5WA 4MJIB 2LTQB 1YA5A 4LFHD 1NCAH 1EAPA 5ADPL 3FB5A 3QAZB 2LU3A 4IRJC 4YX2L 3MLZL 1A9BB 2HKFL 4Z5RB 4GOSA 2YPVL 4WDIB 5KSBB 4G7VH 1KPUB 2QSVA 1JTTA 5I74C 2GAZB 5ICYA 1F11A 1HSAA 4R90H 5FDWA 4PGZA 4PG2A 5AYQA 4LNRA 1B4JH 5BW7A 1YEKL 2Z4QA 2ZUWA 3SHSA 1IILE 1MCEA 2BOCA 2UVFA 1JNHB 1FYTE 5GGVL 4WHYG 5CUSH 4IDJL 3BW9A 3BEVB 2VDMH 5DVOA 3OKLB 4EUPH 3U9UA 1U8KB 1S3KH 4CMHC 4JDTL 5C3LD 4GW5A 1JZ6A 2ICES 2XKNA 3HLAB 4ZO7A 1I8MB 3V6OA 4OQTA 3TO2B 2VLJB 3JV6B 4WHDA 5GS0D 1WC7A 2Z8WC 5F6IB 1XGQA 3L3IA 5F3HA 2Q8BH 3T2NH 1JI2A 2XTJD 4G9FB 3VRJB 3EDJA 4IOIB 4PIRF 2ARJB 4L8SC 5BRZE 5A3ID 4UMGA 3ARFC 3DROA 1A4KA 3JVGC 2Z8SA 4M6NH 4HWBH 1OP3K 3BIKB 5TDNB 5L2KA 1YEFH 1H5BB 1VADA 1J8HB 3C5JB 1NLDL 4OBSA 3NPSB 1P4IL 5GGUA 1KV3A 1AD9A 3MRKB 1IT9H 3V2AR 4R97B 3BN9D 4GBXB 2GYSA 1PY9A 4F15C 4KI5F 5DMGD 5D7JD 4XVUC 3UO1L 2K7PA 1MJ7L 5DUML 1G7LA 4FQXB 3UTTE 5J89A 2C9AA 1VERA 3U1SL 5I1DB 2RR3A 2EDRA 3MR9B 3O9WB 1GAFL 4NN5C 1X5KA 3KPNA 4JLRA 4W6XB 3FB7B 4NOFA 3JUZA 1S7RB 4UU9B 4FZEH 1L4IA 4D9LH 1FFOB 5HY9B 5GS0L 3RIAK 1JMXA 4YK4C 3ULSA 1RVFH 4OZGB 1T21B 2B2XH 2NW2A 2QHRL 5D71L 4KTEL 4NQVA 4U1SA 3KPRD 4KZDL 3SBWA 4P5KA 4OM1L 1XGRB 1LE9B 4PTTA 4MLSA 4EN3D 2F54B 3HPJA 3EJZC 5F7MC 3PWNB 1OD9A 4G3YH 4U1HB 4PRAB 3ILPB 4ZUUA 3HRZA 5ESQA 4LGRB 4QRUB 5IJVB 1Q8MA 3B9EA 4H5SB 1NL0H 3JXAA 3OKOA 5INDB 1IAKB 2X40A 4GRLC 1CDJA 1K4CA 5GGRY 2VXUH 2Y9RT 1G9NH 4KK8C 5DRZB 2BHUA 3LMJL 1VGKA 5L7XL 2OMBA 2R0ZL 2A9MH 3G5VA 1FL6B 1JZ5A 2D4DA 2AEQH 2I60L 2ZUVA 3QQ3B 5D70L 2A73B 4M1DH 4LIQE 4HHAA 4XCEA 2F5BH 4G8IB 1S5HA 1JV5A 3MYZA 3IFOB 2ADIB 2ZOLA 2Y25A 4Z7VA 5D1XC 1MPAH 3ET9F 2IC2A 2A77L 4C56B 3MXVH 5I1EL 1G9MH 4X6CB 5EUKB 1IGCL 4N5EC 1GRWA 2D3VA 2JELH 5IFAH 4U0RB 5CEZD 1NSNH 4XB7A 1FLRL 4RBPK 1L0XA 3VMNA 5FHBH 1KIUA 3QIUC 4XPHH 3IDGB 3DSNA 3W81A 1RU9H 1P7QB 2YWYA 4GMTL 1I1AD 3LY6A 4O2CA 1U3ZA 1NUDA 4OZFG 3NAAL 3C8DA 4GAGH 4UB0H 1XMWA 5BJTB 5DRWB 5EC2A 3REVB 3QPQD 3AS3A 2COQA 5D8JL 1QO3A 1IEAB 3W0WD 3DMMD 4DGVH 4K7PH 2P48B 2FJHA 2OK0H 3R8QA 1AHWA 4BZ2L 5HSFA 3KHQA 1OQXA 4LCIH 3UTSE 3WFEH 4HUXA 1QKZL 1QHOA 2Z91B 4LKCA 4MNGB 3VGDA 3WNKA 1I3VA 3EYOB 1GZQB 4K23L 4MMXC 3KPSD 5HHXL 1KB5A 2QKIA 4OGZA 5CEZL 4OLYH 4YBLC 1ZGLA 3OF6D 3G08B 2DYPB 4DK6A 5T5NF 3MJ9L 4RGOL 2WBKA 4KUZH 5KSUA 2HJFB 1R5IB 4GXVH 1GGBL 2PR4H 4CDGC 4PYGA 2XZQL 4WNQA 4YH6A 4AL8H 1T2QH 4QNPE 1YYML 3U36B 3WNOA 4BSVB 4FHBD 3PWPD 4NOBA 3THMH 1E4WH 3QUKA 4BKLB 3VDCA 2VDPL 4EVNB 4POZC 3PIQB 2WANA 3VXTA 3OV6A 2VDQL 1TNNA 3REWA 1T7WA 1QEWB 4JRXB 4GW1A 3LVEA 1MFDL 4X9GA 1A6PA 3FT3A 3KYKH 1GHFH 1IJ9A 1PZ5B 1WFNA 4WCYH 2OTWB 4YIQB 1NGPH 4JO1L 4V1DE 1F3DJ 5FGBA 2Q6WA 5KSAC 2G2RA 5DRNB 5IBUG 3U0TA 1WJ3A 3MROA 2WIIB 4WUUD 5KVGH 1TJIH 1OB1A 5E2TL 1JWMA 4ZS6D 4Z7NF 1XAUA 2FLBT 3VFVA 3DX6A 1X5GA 1AIFA 1YEDA 3U30B 4R7NB 4LCYA 2N56A 4ODBD 3MLRL 5ISZA 1ZHKB 4MNQD 2X4TA 3VXSA 4G5ZL 3SPVA 1SM3L 1XF4A 3ZKQD 2R0WL 5KN5B 1P2CA 1MAKA 4DKFL 3A6BL 4MCZA 4MJ6A 1NFIA 2WBJC 1IC1A 3SDXE 4Y2OA 1SY6H 5DUPL 3MLWH 5EU6B 2ZG1A 4JFDB 1DUZA 1OM3L 1MY7A 3EO9L 1ZT4B 4FP8H 3V0VB 4IEFB 5F97E 5E6IC 1RULH 2D9CA 3HNSH 4TSBL 1DSFL 4UNVA 3L5XL 2XRAH 2HVKB 4KXZI 4DFIA 3TYFA 3PQYE 1IGFL 4HMCA 4PPTA 3V5KB 1UM4H 3QIBA 5TF0A 4MJ4A 2BZDA 4LMQE 4X5LA 1KG0B 4HC1A 5K9QI 3RWGA 5LWYL 5GRJH 3TT3H 3B9KC 2PTUA 2EDYA 3PWLA 5IR1A 3U4BH 5IB1B 1LEKA 5IK3A 3SGDH 2CIIB 3W9DA 3LPWA 2H1PL 1HHKA 3GBLA 3GKWL 2WINA 4KY1H 1DEDA 1C08A 3BE1L 5EA0H 3TVMA 1Q72L 4I48B 4NRYA 1KJ2L 3W2DL 4AMKH 4YEFA 5CIPA 3UYRL 1BX2B 4R4BB 3VH8G 3ARUA 1D6EA 4OZHA 4CVXB 2FATH 4HUWA 3AGVA 2Q8AL 1KLGA 5CINH 5IMMB 4QT5B 4IS6A 2VN4A 5HGBA 3CFBB 2KL6A 3EW3B 4XP5H 3OJMB 3O4LA 3OGCB 4JFZL 5DJ2A 3T0VA 1UB6B 1FAIL 3D5OF 4QOKA 3DUUA 3FQUA 2AAVA 1QNZH 5E94B 1FSKC 2XTJB 2WUBH 2E7LA 5DQ9A 4CMMB 1SJEB 1P5UA 2OI9C 3MV7A 2ADGA 2DLHA 5D7SL 5ADPH 3BIAX 4YX2H 3MLZH 4MJ5B 2HKFH 4NM8L 1HE7A 3B5TA 5C8JA 2YPVH 2P5WD 4F7PB 2R0LL 3QXWA 1UCTA 1ETZB 1IQDA 4ZXBC 1YECL 3DV6B 2PXYD 1YEKH 3IXAB 5GGVH 2X70A 4PJHE 5F8QC 1NCDL 1PYWA 1MI5A 5CP7A 5E8NA 3PHOA 1T2XA 4XP1L 2BOBA 4J3SA 3TIEB 5CEYB 3D3VA 1DQJA 5DEFA 3UDWC 4JN2A 4PR5B 3CH1B 5C0BE 5I16A 4OIAA 3V6BR 2YN3A 4WENB 4Z7WF 3LS5L 3HE6D 1TIUA 2H9GB 3BUYB 3LKPA 5DJZB 3KPRB 1WWCA 4NO3B 2DLEA 3QO0B 5J9PA 4P57B 4PY8J 4A6YA 4XRCB 2P8MB 4PLJD 1FNEA 1EO5A 4KKBD 4OD3L 3V6ZA 3GJFA 1YQ2A 4MAYD 4YHKL 2BSRA 5CD5D 3GIZH 3MRMB 1NLDH 1HWGB 1YEEL 3QYCA 3IAGC 5HHMD 1P4IH 4WO4C 5DUBB 5ADOH 2B7DT 3ALPA 2P43B 4HJ0D 3ROLA 2YPKB 4YHNB 1L9NA 1OGAA 3UO1H 1MJ7H 1OTTC 1H3VA 4CAGA 2DQCL 3VWKC 3U1SH 5IB3A 4OI7A 1GAFH 5HVGB 3SOBL 1NCBL 4B41A 2FHBA 1V7NH 3KPLA 5SX5H 1QQDB 4IOFD 3VFOA 1DDHA 3D9AH 1A14L 5GS0H 3KYMA 4JFXA 1A1NA 3INUH 5IVXB 4U2YA 4UDTB 5F9OH 5D71H 1QZ1A 2NY5L 4KZDH 4PJAE 3RVXD 1DBKL 1E4XI 3EYQC 4OM1H 1TQCC 3HUJE 1QFWM 3DPBA 3PWVA 4LF3B 1AH1A 4WTXA 2DDQL 5H2BA 2EDFA 5FB8A 5JZ7D 2YXFA 3H3KA 4NO2A 5HYSA 1CU4L 4HKBB 5L8KB 4J3VA 4B7IA 1I1AB 2VH5H 4WUKL 4UDUA 1OD7A 2ERJB 4GT7A 4NNYA 4O58H 4R2GD 5BCAA 4JPIB 1FC1A 1ZHNA 3W0WB 1SBSL 2EYSA 3WO4B 3DMMB 3ULVE 3MOAL 4XNMB 3LMJH 3STBA 1UG9A 5L7XH 5H94A 3G5YA 2UYLB 5DI8B 3UYPA 2EIBA 3QNXA 2I60H 4HEPG 5D70H 1XH3B 2X4NA 5JIHA 3LKOA 1LGVA 4LASL 3CGTA 3NCBB 5EN2A 3RPIA 3GI8L 1QR1A 3KPSB 2ZUQB 2A77H 3LKRA 5FOBA 3KPMA 3QCTL 4D0BA 4ETQB 5I1EH 3LKQA 4PLKC 3GMMB 1J87A 1FLRH 1IL1A 3HR6A 4MDJB 2YWZA 3PABA 4PRPE 3FL7A 1MUJB 1K5NA 2NY2D 1G7PB 3D39A 3PWPB 4YZFF 5C9JA 5JORA 2CDFB 3LB6C 3TBWB 4GMTH 3Q5OA 3NAAH 4I3GA 4QRQB 1FLTX 3I50H 3W9EB 3GSUA 1FL5A 3UX9B 5GS2D 3BZDA 2UUDH 1I7UB 1LO5A 1A6TB 2VLKB 5D8JH 4N68A 5T3XE 2A74A 1ED3B 1UB5B 3WFDH 1EEYB 5HI5D 1L7IL 1HSBB 3SDDA 4U0QB 5IWLC 3K46A 2ZUUA 1T1XA 1REIA 3DYMA 3WKML 1QKZH 4QXGL 2P7TA 4L8DA 5KTEL 4P2RD 3DIFB 4K23H 3PL6A 4F9PA 1PBYA 5C0JB 5HHXH 3PNWA 5CEZH 3VI4F 2LTQC 4S1DD 1NC2A 3QDJD 5D1QA 1FYTA 4FFWD 4HUVB 3H7BA 1JTPA 1T6WA 4MNQB 3BO8A 4RGOH 5DDHA 1UQSB 2EDDA 5EUOE 1SJXA 2D0GA 5F7DA 3MNWA 4TYUA 3FO0L 4EI5B 2APVA 2XZQH 1YYMH 4KKCD 1YUHB 4S1RL 3WXWH 4LLMA 1Y6MR 4NZDA 3D69B 2VDQH 2X89D 2M8XA 3C60A 3L5WB 4J4PC 3N85L 3P30L 4YR6A 4P46D 5BRZA 1FRGL 2XWBA 3I2CL 4YC2B 1CS6A 4F7MB 5FCUL 1LE5B 3F65A 1QSFE 1NUGA 4JO1H 3SKMA 4F33B 1RSFA 4GRWB 4KDTC 2HJKA 1N8ZA 5BMFL 3GRWL 3RVTC 2VZOA 3VI3F 1LP9B 4HSQA 5F6IC 3ZHLA 3MJ7B 1EH9A 4NKMA 5E2TH 3L3GB 1Z3GL 3DV4B 1OP9A 3DX8A 3H9SE 4WGWB 3G6AB 5I8OL 3UTTA 3PJSA 3QXVA 4XZUA 2WMPA 1XCTB 2ZG3A 4QRPD 2W0FA 1Z6JT 3K81A 2GTWB 3F58L 5E8OA 1A47A 4NWUL 1IZKA 3KXFE 5ID0A 1SM3H 1WQVT 1H5BC 3EO1A 4LHUD 1MRCH 3NPSC 2X2YA 3EJYD 4DKFH 5C0GB 4IRJA 3KYNB 3A6BH 3MRGA 4PJ5D 4GBXC 4R97C 1AQDB 1YMHB 2AEPL 5L2JA 3P9LB 5DUPH 3H9ZA 3CXDL 5E1AA 5AG8A 3MRPA 2GJZA 2C1OA 4FQXC 3RWJB 3QDMD 4M3KB 2AXFB 5TDPA 4G9DB 1OM3H 1CXFA 4M48L 5D5MF 3O9WC 3EO9H 4ISVA 1BAFL 4MJIE 1C1EL 3DGGA 4TSBH 4YHIA 3NBNA 5DJ6B 4N90E 1EUUA 1UZ6F 3OKEB 5KSBE 3LKNA 1CYGA 4ZFOL 3KPTA 2YPLB 3OXRB 5J6GB 4WU5B 2B20A 3T0AA 3K4ZA 1FNHA 4PGBB 4L8SA 4AIZB 1IAIM 5LWYH 3GMNA 3ARFA 2UVEA 3JVGA 1AQKL 4HUKB 2A9NL 4FFVD 2BNQD 3KR3L 2GITA 1BM3L 2P5WB 1E4XL 1BQLL 1DQTA 2F53A 4BELD 3GKWH 1OPGL 4Y7MA 3BE1H 4LHJB 1T7YA 1B9ZA 1CDBA 1Q72H 2VLJE 3P4MA 4LLAA 1T22A 5HGGS 2FR4B 3W2DH 4LCWD 2PXYB 4G9FE 3UYRH 1X4ZA 4Y8AA 1FFNA 4U1IB 4PJ9D 5DTFB 4L8BB 1NQBA 1BJ1H 2Q8AH 4EI6A 3M17A 5IQ7L 2VO5A 3HPLA 5C0ND 4JZOA 1J8HE 4NO5A 3QG7L 5C0FA 1FGNL 4PP2B 3VWJD 3KAAA 1I85C 1FAIH 4WHTA 2QLVB 4PGCB 5E2WL 4NC2B 3FQXA 3HE6B 4U0RC 1JF1A 1AGBA 5HYQB 4G6ML 2GT9A 4MD5A 3L9RA 4NUJA 2CMRL 3HFML 2J6EA 2P8PB 3BP4A 4DUVA 3AB0B 1CD1B 2F5AH 4MAYB 3T65B 1CL7L 3EOAA 4NM8H 3T0ED 5E03A 4MS8D 5CBAB 3LAFA 1KJ3L 4PY8I 5HHMB 3RRQA 2R0LH 3D25A 1CK0L 1FNLA 3CVHA 3WLWD 2QSCL 5C0RL 3IGAA 4EQ3A 3QQ9D 3N1GC 5MERA 3KLAA 1XCQB 3BP5A 1JGEA 2F54E 1NCDH 4UOJA 5KBNC 3F7YB 3F62A 3U9PL 3EZJB 4D3CL 4XP1H 4ODWA 1RI8A 2PO6D 4ENED 4X4YB 2Z0BA 1OT2A 1PG7X 4RNRB 5D1XA 1BD2D 3LS5H 4EUPG 3TNNB 4TVSa 1C7SA 4WTWA 3V4VH 4CKVX 1U0QA 2W07A 5FEBA 3VXRD 5CEXB 1EGJL 1DLHA 5A2IH 4V1DA 4BFIB 2VITA 3T0XA 3GIVB 4RAUA 2DN7A 1UACH 1BREA 5D1ZA 1G7JB 5MEQB 1N2RA 4M03A 1YEEH 1Q9LB 3FQRB 4H8WC 2NY3D 3U48A 1U6AL 4QXUL 3QFDA 4UI2A 1H3WM 2Y23A 2NW3A 4NO0D 5GZOC 4C56E 1SVZA 1ULVA 1ONQB 4X6CE 2AW2A 4R2GB 2FYYB 1TJGL 5A2LH 4QXTA 2DQCH 2EICA 1SBBA 2WW8A 4ORGA 4YHML 4NHUA 4NYLA 3DETC 5BOZG 3SOBH 3X12A 3TYGL 1NCBH 1T20A 4TQEH 4KMLB 5DMJB 4Z7VF 3OAZH 3SDXA 4ALAL 1A14H 3BVNA 3U30C 2HFFB 3B6SA 4OM0L 5DSCA 4D8PB 1RK0A 4QYOA 3TEUA 2EXYD 2NY5H 5KANG 2EXWC 3QR2A 2CDGB 1NGYA 4XPFH 4DN4L 1KPVA 1I1CA 4PGEB 1J7VR 4Z77B 5ANMB 4CVZB 4X9BA 3E1F1 2DDQH 3HI6L 1WFTA 4YHOL 3VCLB 3QXDB 3BP7B 3E6HB 3PQYA 4J7RA 5DC4B 2NY2B 1A0QL 3L3KA 1CU4H 3BN3B 3FJTA 4MNGE 5B3NA 1MCLA 1TQBB 3HS0A 4WUKH 5F71A 5KAQG 4R7DA 5FYLD 1FJ1B 1WTGT 2MMXA 1Q9OA 1EVTC 3DURA 4U6YB 3FN3A 4KROD 2HLFC 1E4KA 1T66C 3H8NA 3MREA 3PWJB 3MOAH 1DQML 1ND0B 3O45A 4JPKL 4K71B 1YPZB 1QLFB 2X4SA 5FUCC 2GK0A 3MRIA 1ZT7A 2JTDA 4ZS7H 1KTKE 5KSAA 2NZIA 3B5HA 3I6GB 2YZ1A 4YDVA 3GI8H 4P2RB 1BQHA 1KLUA 3JZ7A 4M9OA 4K7FA 3WDHA 4QRSB 3QCTH 1AGFB 5LCVL 3QDJB 1G0DA 4JRXE 4KVCL 2UZYB 3S5LG 4OZIB 2IMNA 3C6LC 5KAQF 4UQ2A 5F6HJ 2Y06L 4MQXD 4UT7L 4XWOD 4U6XA 4O2FB 1DBAH 5EORL 2NCMA 3RZCB 1S9XB 3BD3A 1BVLB 2GFBB 2WBJA 2XXMB 3ZMRA 5CKGA 4JANA 1Q9KA 4HUNB 1U3HD 2UWEB 3RL2A 3HC4L 2I27N 1EIBA 1HH9B 4MDIA 4OLUL 5CP3H 5FHAL 2QQLL 1A2YA 2J8UB 1EK3A 4BQ8A 1XGUB 1L7IH 5GS1B 4PP1D 4D9RE 5E6IA 1JPFB 5LQBH 1EA9C 2ADJB 3RDTD 5K59E 1T89C 2NLJB 5EFIA 4QXGH 5KTEH 3CH8A 3U46A 3L7FA 5EU6E 3VGAB 3S4SG 1BEYL 1MREL 2XTJC 4PLOB 4JFDE 5J06A 5ENWB 2W9LA 4QRPB 1T0NB 4PJHA 3WHXA 1CD9B 4JRWA 5DK3A 3VFRA 4LHUB 1MSPA 3OJDB 4L29B 3B9KA 3IVKB 5F1SA 43CAB 3FO0H 1NC4A 3JV4A 5JUEL 4PJ5B 4XAWL 3BN9C 4LRIC 4QCIA 5C0BA 5IF0A 5DMGC 4YQXL 4FQ2L 3FN0L 5GS2H 1N64L 2VDRH 4KHTL 5ITFB 2OQJB 4NC0B 1FN4A 5T1MA 3QDMB 3CPLB 3N85H 3P30H 3TBVB 1KFAL 1AGCB 5F3BA 5M95B 2G5RA 3HNTL 3DRQB 3I2CH 5KS9F 1N7MH 5FCUH 3CZFA 2DD8L 3RBGA 1Z9MA 1U93B 3SQBA 4LEXL 2VXSL 2E9WA 5DQJA 3L3HA 5BMFH 3GRWH 4QEGA 3DNKA 1Z3GH 5BO1H 1U8LB 4EXPX 5T33L 1QRKA 5I8OH 2JJWA 1YDPB 5DK2A 5CSZA 5IROC 4NWUH 4N1EA 3QUML 3D0LB 4MCYA 3VXPA 3O11A 2RFXA 1WK0A 4QWWD 2BNQB 3CCHB 4LU5L 3U6RA 5SWQB 3NCFB 1SYVB 2AEPH 3CXDH 5GJSL 4PREB 4PJAA 5ERWB 3QUXD 5HYIA 4M48H 5L6YL 3EDEA 2H2PD 4L1HA 4OZHF 1U91A 3HUJA 4LCWB 1I7TB 2FX9L 2XTJE 1BAFH 2IADB 4LSDA 3RIFF 1FHGA 1C1EH 4HWEL 5TJWK 4PJ9B 3WFHB 1IZJA 1FFPB 4NQSB 5DVMA 3FOLA 2EC9U 3O3UN 1N59A 4KH2A 1OCWL 2H3NA 3K8MA 3RNKB 2HFEA 3S9DB 3QNYB 3RKDD 3QJHA 1MJUL 2HN7A 3UJJL 3VFGH 3UDWA 3VWJB 3WJJC 5AD0A 3DO3A 1DQDL 1F6AA 4DW2L 5BXFB 1BFOA 4X5WB 3M07A 2BSSA 1HYSD 1WTLA 5DVKA 4OCSL 4X6EA 4ZMAT 3OXSB 3RFZC 2VR5A 1R24B 2XI9A 2A9NH 5CHNB 3X17A 1I1AC 3KR3H 3ULUL 3T0EB 1BM3H 1ZVHA 1P9MC 5JNYA 2ERJC 3ARBD 3LDBB 4WO4A 1OPGH 5I1JL 3QPQC 4OQ1A 3B83A 1R5VB 3UYOD 1IM3B 1JNLL 3WO4C 3DMMC 3KPRE 4I77L 4WU7A 4LHQB 4NP4L 2XQYG 4S2SB 3V4UH 3HCVA 1EJ6A 3FB6A 3IFLL 3MLTA 4OZ4B 4PRPA 3VWKA 5IVNA 5CSGA 3RGHA 4KVNL 4PJEB 2P46B 5IQ7H 1ORSB 3L5HA 3D18A 3QG7H 2ZUQC 2PO6B 3N1QC 1FGNH 1YN7B 5I0ZA 1S8DB 3MSPA 5E2WH 1JYXA 4U33A 3SDCD 1BD2B 4HZLB 2X41A 2HG5A 1IM9D 3DUSA 3OTTA 3U79A 3VXRB 3AAZA 5EU5A 1NCWL 4H26A 3EYVA 2CMRH 3CFDA 3HFMH 5JO5A 5E5MA 4MLIA 1CL7H 3BFOA 1U8HA 2KZ1B 3BH9A 5IVXE 1KJ3H 3QISA 1EMTH 3VFUA 4QXWA 3IU4L 3K2MC 3WNPA 4QHNB 3BI9X 3EYUL 1L9MA 3S35X 4NO0B 1VFOA 1CK0H 4HW6A 5C0CD 1DQQA 5GGSA 3IDNB 5CJQL 1TTUA 3DYPA 1KF9B 2QSCH 3T0WA 5C0RH 2BSED 5EUOA 5D2NB 3D0VB 5CEZE 3DVGA 1G7QA 1HYRC 1EXUA 3HA0A 3T77B 4G43B 4Q9CA 1VESA 3BHBB 3U9PH 4ZOAA 1EFXD 1X5FA 2AGJL 4OGXL 2FECI 1S7QA 4ZS6C 1KB9K 5I76A 1JFQL 4YDKL 1MEXL 2C3VA 1AKJA 1J1PH 4G6FB 1PJ9A 5GRWA 4TUKL 3W0WE 3WS3A 2VDLL 4YJZL 5IB2B 4EI5C 4DGYL 4DKAA 3F7QA 3CMOL 1Q1JL 3UXFA 4F2MB 3GSXB 2BMKA 1RUQL 4HWBA 2AV7A 2CR6A 2EDHA 2ZZUT 3H9SA 3KYOB 4QXUH 3WDIA 3RY5A 5HVFB 3KPSE 1CFNA 1LK2B 1HQ4B 4YC2C 3BWUC 2L7UA 1OSZB 3GSVB 2X4OA 2D7TL 3C8KA 1D5XA 1MFAL 1YN6A 2KZWA 3KXFA 1CDCA 1F97A 1TJGH 5CJ5A 4JAMB 4YHMH 2NNAA 5E24E 1RZGB 2A0LD 5ICXA 4I9WD 5FUOL 2P47B 4M8VA 1Z0NA 5IWLA 1IKFL 5TQ2L 4ALAH 3TA3D 4U6VH 3PWPE 2AQ1A 4OM0H 4YGVA 2BVOB 5FK9B 5J6HA 5JW4N 2DQJL 2EYRA 1HI6A 4NT6A 3C09B 1U8JB 5JXEC 4MJIA 3ZYJA 2VLKE 3P9WB 4KGJA 4P2OD 4DN4H 1KT2A 2VR9A 1A9BA 4Z5RA 1F3RB 3HI6H 4WDIA 5KSBA 4KRMB 4M9PA 4QGYA 1KPUA 3LS4L 3DI2B 1RZ8B 2EDXA 2HWZL 1A0QH 1T83C 2GAZA 1T1WB 1ZLWH 4M4PA 4XBGB 1QA9B 3BRFA 4PBVC 5F6HI 1U3HB 3IETB 5EZJB 1FIGL 4LQFL 4PRDB 3X14B 3QDHA 1JNHA 1X3DA 4J4PA 3TPKA 3R0MA 4H25B 3BEVA 4MNQE 1WCQA 3NCYS 3OKLA 5CFHA 1DQMH 2J1KA 2LVCA 4JPKH 4LDLB 1KIPB 1U8KA 2P42B 3G6JB 4ZO9A 4L3ED 1JZ4A 3HLAA 4KDTA 1I8MA 3H6JA 5E7BA 4HX1B 3TO2A 2VLJA 3JV6A 4HLZH 4MXVE 4G9FA 3VRJA 25C8L 4IOIA 2ARJA 4W6WB 5LCVH 3MYJB 2BRQA 4KVCH 2AXHA 1YEGL 1NJ9B 3TESA 1S9WB 5AAMA 3BIKA 5TDNA 4UT7H 1H5BA 1MFEL 1U92B 1J8HA 3C5JA 1MRFL 5EORH 4GRWE 3QUMB 3MRKA 3S37X 5FYLH 4DKEH 3H3PL 4P49A 5ID1B 4GBXA 1LP9E 2ICEB 4OCMC 1JWUB 2PXYC 3AMLA 3FHQA 1NAKL 3MGAA 4ORZC 4FQXA 5JLZB 3HC4H 5I1DA 1QR4A 3MR9A 3O9WA 4G8GD 5FHAH 2QQLH 4MQTB 3FB7A 1S7RA 4UU9A 2O5ZL 4MSWB 5C6TL 3Q48A 1FFOA 5HY9A 1NANI 3QSKB 4Y5XB 5JDSB 1ROWA 2ZPKL 4OZGA 4CJ0A 4GG6B 1T21A 3SE8L 1NFDB 4YDLB 3HE6C 4ELMB 1LEIB 3V7AE 4OCNC 3I75B 1MREH 1XGRA 4MD4B 1KXTB 1LE9A 1F00I 3OJVC 4ZQKB 1TCRB 1FAKT 1EVUA 4PLJC 2F54A 3AB0C 3BMVA 4ZUTB 3PWNA 3MBED 4MAYC 4U1HA 4PRAA 3ILPA 2GUOB 3TNMB 1OVZA 1MQKH 3WBDA 2IFFL 5IJVA 1GOFA 4QRUA 3HMXL 1D5IH 4H5SA 4O51B 4CVUA 5JUEH 4XAWH 5HDBE 3P0VL 2HTKC 3VFMB 4HUMB 5INDA 4YQXH 4HJ0C 4FQ2H 1BP3B 2YD1A 1N64H 1IAKA 4KHTH 4OFPA 1MFBL 4OB5L 3QNZB 4PJCB 3MBXH 2YRLA 4P3DA 1ZWIB 3QUXB 3JWDC 5DRZA 4YXLL 2ZNXA 1KFAH 5EC1B 1UKTA 3Q6FB 1A1OB 3HNTH 1JWSA 1FL6A 2R4SL 1UXSB 4RDQG 1NDGB 5D2LB 3VRLF 3QQ3A 2A73A 4LEXH 4RIRB 4G8IA 4I1NB 2Q7YB 3S36L 3V0AC 5K9JL 3RIFK 1UM6L 4IM8A 3IFOA 2ADIA 1FO0L 1TFHA 2NXZD 3MV9D 2P5WE 4ZNEE 2UV3A 4C56A 3RVXC 1I85A 4LVNB 4X6CA 5EUKA 3WEXB 1QPXA 5T33H 2XQBH 2OP4L 4ZD3L 3VW3L 1QFPA 1QBLL 1ZAGA 1U8IB 4JR9L 3QUMH 2FECL 5JZ7C 4X4ZA 3TF7C 3GSRB 3IDGA 3QH3B 1TXKA 1P7QA 4LU5H 2Y5TB 3CFKB 4RDQF 5L88L 4MQ7B 3ARBB 5IUSA 5GJSH 5DRWA 4TVPE 5BJTA 1W72L 4R2GC 2XT1B 3REVA 1SY6A 3EHBD 43C9B 1IEAA 3BRDA 4RX4D 5JOPD 4JG0H 2YUXA 2FX9H 3JWNC 3TC9A 1A7OL 4KGLA 5JHDD 1T0PB 4HZAA 2Z91A 4MNGA 3WUZA 4P4KD 1F6LL 3EYOA 1GZQA 2XNAB 3NFNB 5HHME 1MJUH 3UJJH 1GZPB 4WV1C 1Q0XH 3BKJL 3BGAA 3G08A 2DYPA 3SDCB 4HFUL 2OLDA 4KI5D 3CD4A 3K1DA 2HJFA 1R5IA 1IM9B 3D1MC 4KWUA 3LV3B 4ZUWB 4N1CA 4OCSH 2HT3D 3C87A 4TN9A 4JGMA 5EOCL 3SGEH 3IYLW 4LRNH 2NY2C 3GMQB 3U36A 4BSVA 3T2QA 5CCKL 3F7VB 1TQBC 2CLRB 5GQBA 4BKLA 2IBZX 3AM8C 5GGQL 5F89B 4EVNA 3BWAB 4L4VD 3PIQA 2GSIB 2DI7A 2XQYK 1V3KA 4KJQD 1QEWA 5I1JH 4JRXA 1R3HB 1JNLH 1SHMA 5C0CB 3NIGE 4I77H 4K71C 1H0DB 4NP4H 3DGCR 3HHRB 2OTWA 4YIQA 3IFLH 1X6LA 4HT1L 1OLLA 4S1SL 5DRNA 4NN7C 1MAJA 2WIIA 3MNVB 1EFXB 4K07A 4Q6IB 4LCUB 1LO3L 3TJEL 2FX7L 2VOTA 1NGQH 5HDQL 1ACZA 4ZPVB 1X44A 4FFWC 4R7NA 4KZEL 4I13B 1ZHKA 4M93B 5DA4A 4GAYB 5EIIB 5J1SC 5DJ0B 2VZ1A 1XGTB 1OGTB 4Y19D 5KN5A 3MLXL 3EUUA 5DZOA 4B53A 2HYMA 3RZCC 5HPMB 4KKCC 4B7LA 4J8RB 1DN2A 4GLRH 3GKZA 1N5YL 4PJXF 5EU6A 3RGVC 4JFDA 3IU4H 1BHGA 3EYUH 3QXTA 4G80B 3GMRB 3RZWA 3V7AG 1ZT4A 3V0VA 4EQ2A 1WBXB 5FCSH 4ZNCD 5GS1C 3I85A 5LBSL 3NABL 3VXNB 3S35L 5ANME 4UV4L 1A6VL 5HI4D 5JA9A 2HVKA 1AGEB 1J9CT 2AGJH 2H8PB 3C5SB 1CDHA 4FFZL 4JQIL 4QRRD 5EG6C 3VGAC 3TA3B 1S78D 1LDSA 1YQVL 3HAEG 4CU6A 4N0YL 1JFQH 4YDKH 3Q5TA 1Z9LA 2FH6A 1KG0A 4U3HA 4Z7UF 4TUKH 3O4OC 1KCRL 2VDLH 1QYGL 4P2OB 1PG7H 3L3DB 3UZEA 3EJYC 2N7AA 2XKUA 4ZTPL 4RAHA 4DGYH 5IB1A 1YPZE 3CMOH 1MWAB 3PDGA 2CIIA 2W91A 4FQCL 1SMAA 1RUQH 5IT2L 3VGBA 3DVNB 2V6HA 2R56H 4I48A 4P2RE 2P8LB 1H3UA 2X7LB 4PBXA 2XACC 1YEHL 1BX2A 1MFAH 3QDJE 4R4BA 5L9DL 1U3YA 2AJUL 4OZIE 4CVXA 2CXGA 5IMMA 12E8L 3X3FL 4PJBB 4POYA 4QHMB 3KPPB 4QT5A 5F70A 3CFBA 2Z31D 4O9HL 4PV9B 1IKFH 2VE6B 5TQ2H 1T89A 1UB6A 3H2WA 4L3EB 4IIQB 3HB3D 2C3XA 1WZLA 5E94A 2DQJH 2MKLC 2UWEE 3DSFH 2C4FT 1OARL 1INEL 4CMMA 1SJEA 1U9KA 3MO1B 1JI1A 1ZE3C 2J8UE 2JJSC 5KG9B 4MJ5A 3OB0H 2YD4A 4R4NC 5ACLA 2QQQA 4PTUB 4F7PA 3LS4H 3W39B 1N4XH 4E42B 4LRIA 2CGRL 4JKKA 3UAJD 1H15B 1I1FB 3DV6A 4JE4B 4RBPH 1FIGH 3LN5B 1JRHI 4M43L 3IXAA 4FNLL 4PJ9C 4QRPE 4G8GB 3MODL 2ZG2A 3PF2A 5DHXB 5C0NC 2GIYA 4LSUL 1BLNB 3OSKA 3G9AB 5CEYA 3TIEA 2LAAA 3OR7B 2AK1L 4PJ5E 1UFUA 2D0FA 4PR5A 4CL7A 3CH1A 3KLSA 1MLCB 3ARXA 5FGCB 2AERT 4PGDB 4WW2B 2HKHH 2H9GA 1UH3A 3BUYA 5DJZA 5B21A 5BVPL 3KPRA 1CQKA 4NO3A 4CADB 3QO0A 4JG1L 3QDME 2MKWA 5FM4A 25C8H 3KG5A 4P57A 2A2QT 2OSLB 2GW5A 4FXGB 35C8L 5GGSY 1MWAH 4LVHB 4XRCA 1YEGH 2P8MA 1LDPL 5IROA 3MBEB 3T0EC 2M26A 1V5JA 4YDIL 1MFEH 4MS8C 3MRMA 1D5MB 1D9KD 1MRFH 4LDEB 4NFCA 1FNGB 3LDBC 3OWEA 5DUBA 3OKYA 4MXQC 2FEDD 1CGUA 4K3GA 4NWTH 2YPKA 4YHNA 3WLWC 4U3CA 3WKNA 5BZDB 1NAKH 4OUUB 2YS4A 5DJDB 2D0HA 3S37L 3DTXB 1T7ZA 1LILA 4PJ7B 1W72B 2YEZB 3IAPA 2UUDK 3O81A 3GMPB 1QQDA 5K9QG 2JCCF 2O5ZH 5F9DC 5C6TH 1EO8L 3NMEA 5LGHL 1MNUL 5C70A 4ENEC 2SEBB 5EZIL 2BNQE 5IVXA 5C09D 1M71B 4UDTA 1UGNA 1MCRA 3SE8H 2NXZB 1B0WA 3WJJA 4OLXL 4HIJB 4WWID 1K8DB 4Y4HD 4P48A 3PV6B 1H9VA 4LF3A 4LCWE 1KCVL 4J1UB 5ALBL 2XG4A 4PS4L 4O5LL 2FEEI 3VGHA 1TZGL 4GKOA 3A67L 3QO1B 4CJ1A 2QR0B 4M5ZL 4HKXB 1T2JA 3HMXH 4HKBA 3CSBA 4U1NB 5HHOD 1OAXL 4X6DF 4E5XB 3CK0L 1I1AA 3P0VH 3UTQB 5DF0A 1K2DB 8CGTA 5I19L 4OB5H 4JPIA 5D2NC 3O6FD 1JGVL 3KJ6L 3W0WA 2OCFD 1PSKL 4YXLH 3DMMA 4XBPB 4HMDA 4XNMA 5A2FA 2QSQA 4GQPH 3VD5A 2UYLA 2R4SH 5DI8A 4P59L 3UPRB 5TPWL 1XH3A 1DBML 2I26N 3S36H 5K9JH 1PG7W 1OAUL 1UM6H 4P4KB 5JMRA 3T0EE 2J3SA 5DFWH 1R5WB 3KPSA 1P4LB 2EXYC 3OF6A 4LLUB 4ETQA 5C2BL 3GMMA 2LFGA 3VW3H 1T4KB 1QBLH 4AG4L 3ARZA 4JR9H 1UM5L 4MDJA 5SX4H 3GGWB 4YXKL 1MUJA 1G7IB 2C3HA 4OCXL 4PJEE 1F8TL 4F8TA 1G7PA 3PWPA 1ZLSL 2CDFA 3TBWA 3QT2A 3FRPG 4QRQA 4L4VB 1IVLA 1F90L 3W9EA 1KULA 3KPQB 5M7QA 1W72H 5TE4L 2YOCA 1I7UA 1BD2E 1A6TA 1CXEA 5FGSA 2VLKA 2XTLA 3DHJA 4NM4L 3ZKXB 1ED3A 1UB5A 1EEYA 5CGYC 3VXRE 1HSBA 5FYKL 3QXUA 4QHKI 5DJAB 1A7OH 5ALCH 4JDZB 3QHTC 1RZKH 5FECB 5LKNA 3N06B 2Q20A 1ZHBB 3DIFA 2MQ0A 1GGIL 2XPGB 5C0JA 5JW5B 2Y72A 3DVIA 3P4NB 3WD5L 3LN4B 4RMRA 3UBXB 5DD1L 4HUVA 3GMLB 4QTHB 4MNQA 5LAXB 2E6PA 3QEQD 1UQSA 1NFKA 5D2NE 4Y19B 5I18L 4EI5A 1RHFA 2HMID 4K7PY 1NMAL 1YUHA 4XP9L 5CCKH 4I0KA 4QHLB 3MRFB 2EDTA 2R2EB 5GGQH 1U3HC 3QCUL 4S0TD 3M8OL 3D69A 3IXTB 3DX7B 3L5WA 3B8YA 2C1PB 4J3WA 5C2UB 1XT5A 4WFFD 4JPVL 5HHPA 4F7MA 1LE5A 4PP1C 3Q1SL 5DZLA 4AEEA 2AI0H 2HVJB 4HT1H 4F33A 2EEBA 4RZCB 4HMEA 4P4RB 4WHYH 1BVKB 3MC0A 3VA6A 4PFEA 1FNFA 4GAFB 1LP9A 1JRHL 4QRRB 2HP4A 3MJ7A 1A9EB 1LO3H 3L3GA 3DV4A 3TJEH 2FX7H 3R8BB 3G6AA 1XCTA 4KZEH 2P45B 2ZWLT 5FYLE 2GTWA 3LPFA 2PYFB 5CJOL 4AT6B 2HFGL 3MLXH 3ZDYF 3HZVB 5AWNL 2DBLL 5C0GA 3OAYK 1VSCA 3KYNA 1V8HA 1AQDA 4Z0XB 1YMHA 3ILQD 3P9LA 1M6OB 1N5YH 3TN0C 3VMOA 3ZE0E 1T83A 4PRNB 3RWJA 2AXFA 4G9DA 4JO2L 5MEPB 2PF6A 2C7UB 2OBGA 4QGTA 1LMKA 1VFBB 4IBLT 4Z7QF 5GRUL 5DC0A 3MLUL 2MJWA 3PE9A 4XPBL 5LBSH 4Y5VB 1EERB 3HN3A 4HGKC 1ZOXA 4OZFB 3S35H 4EJ1C 4Y5XC 1II4E 1CXIA 1TDQA 1A6VH 4UV4H 5DJ6A 2OYPA 2Z31B 4YDLC 3V7MA 3OKEA 4XCYB 3B4NA 3KWWB 1A7NL 5DD5L 3L95B 1YQVH 3DXAD 4N0YH 2YPLA 1RFDL 1DBJL 3OXRA 4XAKE 5J6GA 4WU5A 1Z5LB 5DHYB 4O02L 4PGBA 1S9KC 5CILL 1EJOL 2XY1A 4ODVL 2GCYA 4AIZA 5SWSD 1QYGH 1J88A 4QWWC 3RQ3A 4ZTPH 4C57C 3TH2T 1NLBH 4CW1B 4JRYB 3WFZA 1C16B 2P5WA 3G6JE 3G9VA 4FQCH 4ZNEA 1ZANL 5IT2H 4URTB 2P49B 4JREB 2H2PC 3MGOB 1KBGL 2PXYA 5E5UB 1WIOA 1YEHH 4I3RL 4U1IA 5L9DH 5DTFA 4L8BA 4DN3L 4PJFF 3HMWL 1AXIB 12E8H 2JF1A 3X3FH 1BFVH 2CUHA 3MOBH 1I7RB 3FONB 4PP2A 1CFQB 3OAZK 4PGCA 1OAKL 1WICA 3OX8B 3HE6A 4M5YH 1LO4L 3NACL 2LABA 2AJ3B 4JFOB 1HYSC 4Z7OE 5HYQA 1INEH 2X4UB 3D2UD 5IBUB 3KPOB 5KVDH 2I5YL 2XXCB 3C9NB 2P8PA 5F7FA 4HK0B 2IPKB 1CD1A 4MAYA 1KYOK 3T65A 4HAFA 3ZTJH 1D9KB 4XMLL 2ZCHL 3ARBC 2AS5M 5CBAA 4JJHA 4MA7L 3ARQA 4GG6E 1NFDE 4JJ5B 3BESR 3U0PB 4ELME 1NKRA 1IKNC 1TMCB 2VXQL 5TE7H 3RP1A 1E0OB 4OZFH 4M43H 4Y88A 4FNLH 1CLYL 4U31A 4UT9L 1XCQA 2PUQT 3MODH 5CWSB 3F7YA 4OZGF 1J12A 5E8DL 5IQ9B 4LSUH 4X4YA 5C09B 4Q9QH 5F7KC 4AEHL 2AK1H 3PDOB 5HD8D 3C8HA 4FG6D 4RNRA 3X11B 2CPCA 3TNNA 6CGTA 5BVPH 4PJCE 1DFBL 3BD4A 4JG1H 4Y4HB 5CEXA 2YN5A 35C8H 3E2HB 3FZUD 5E00B 5C08D 4RA0C 3KLHD 4BFIA 4PY7B 3GIVA 1LDPH 2VERN 1G7JA 1I75A 5D2LE 4YDIH 5F7YC 1WBZB 4K3JL 5GGVY 3P11L 1Q9LA 3FQRA 3LSOB 5HHOB 3E6FB 1CDUA 5DR5H 1U8NB 4I18B 1ONQA 4AIXA 1J0YA 2HT4D 3O6FB 4N0RA 2FYYA 4AZ8A 3S37H 2B4CL 5H37G 1VCAA 1X5JA 1PX3A 4ZUVB 1JHKH 1H8OA 4NJ9H 5CP3A 3OMZA 3FFDB 4Q6IC 1LHZA 3G04B 4NQED 3SN6N 4J12A 1EO8H 4U1KB 4WTZA 5LGHH 1I8IB 5EZIH 1R3IL 2HFFA 3TO4D 3IJHB 4D8PA 3FQTB 4FA8A 3VH8B