2ADFL

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
total genus 51
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL01
5GISL 4H88H 2HRLA 2ZPKH 1YYML 5MEPB 3EYSL 3HS0B 5JA8B 1IGTA 3BE1L 1D5IH 2VR9A 5I18L 3FFCB 3W9EB 1MCHA 3QXTA 5EUKA 5DWUL 2HWZH 1QBMH 5C8JB 1F2XK 4N0CC 4WNQA 5M7QA 2R8SL 2G9HA 3FOMB 5FF6B 5C0CE 3LD8C 2Z91B 1H3WM 2BNRA 2JLLA 5FGCE 1VGEL 2H8PA 4GW5A 1UXWA 4KMQA 4H5SB 2NXYD 5FUCE 2AJXH 1RFDL 5IHBA 2PXYD 2DKSA 4LLWB 3PV6A 3BZ4A 2ZP0T 3QXDA 4MAUL 4K3HA 1TPXC 2I25N 2PCPB 3QEGH 1AD9A 4BK4A 4XPTH 5KTEL 4TOYL 5CBAA 1XGUA 3ARFD 3QDJB 4QRSB 1FL5A 4OFDA 4K7PH 2NY6C 1JGLL 3GHEH 3WDHA 2OI9B 2FO4B 3NVQA 4HMCA 5EORH 3L6FB 3OJ2C 3TIEA 3MGOA 4KKAD 4N5ED 2KL6A 1JI1A 3W0WB 5IBTL 3RIAF 4RMWA 1RURL 1J0KA 2WINA 3IDXH 2R0WL 1T80A 4HCRL 4LHJB 3L5IA 1BBDH 1E6JL 4ONGL 4JRXD 2VDOH 4U1LA 4FA8A 3WNMA 1DBML 2NLJB 1MCFA 5JHDD 1GC1L 4IRZH 3TA3C 4NWUL 4PRIE 1E0OB 1ZHLB 5F7WC 2ZPKL 3GSRB 5IFAH 4HS8L 1A6AB 3BI9X 4PY8J 2C4XA 4P46A 1IM9B 4KAQH 1ADQA 1IBGL 1R3HA 3K46A 2HWZL 1QBML 2WQRA 4CNIA 2ERJB 3TBVA 5TQ0H 5DK0B 2P24B 2BVOB 3QWOB 4QY8B 2YD3A 1WBZB 3FO1A 1NC2D 5HGHA 5C07D 3EOAB 3GGWB 4DN4L 5DO2D 3C08H 5SWSD 2H2PD 4KHXL 1EV2E 3O3AA 4OBRA 4OGAD 2AQ1A 1WZ1H 2FECL 3QEGL 4ZPTB 2GY5A 3LRGA 5C0IB 1OGAD 3CVIH 3I50H 3D0VA 5ILTH 2QQKL 3IDIA 4X5WB 5KAQF 4OUOA 5J1TC 3ZKMC 3GHEL 3RY6C 3NFSL 1MRDH 5IHUL 5IB5B 3U4BL 1MI5B 1KCRL 3PWPB 4ODXB 4GMSL 4ZSOB 4U1JA 5JW4Q 4PJ5D 3IDXL 5BS0D 4FFWC 2V6HA 3RX5A 2VDOL 2WANA 4JPWH 1QBAA 2DIBA 3X17A 1DLHB 4P2QB 4IRZL 5FB8A 4YK4C 4YFEA 1S8DB 2W91A 5LG1A 3TJEH 3DUSB 4DGIL 4FXLA 5IFAL 1UZ6F 1UM5L 3TCXA 4AIOA 5I17B 4HLZG 1WLHA 2Z0BA 3I75B 4QTHB 2J4WL 1CD0A 1DLFH 3Q6GH 2FX9H 2YA2A 2X1XR 4PUBH 5EZOH 1F6AA 2OJEB 5D72H 3UZQA 3EJYC 1JF1B 4ESKA 3B6SA 4E9LA 3TNMB 3X3GL 3JVGA 4TQEH 3C08L 5F1KC 5T33H 4N0UA 3CSPA 4JG0H 1R24B 3RVWC 1RJYA 1FAKT 2W65B 3ZHDA 3V5KB 4EVNB 3X14A 3I50L 4KPHL 5C0NC 3S37X 4PGEB 2IBZX 1Q9OB 3U6RA 1NBQA 3TO4D 4S1RH 1DQDL 3GMNA 3QG6B 5BZWA 5B39B 2DIAA 1ZLUH 4Y5YA 1NC4D 1B6DA 4MVBC 4XT1C 4PJEF 1BWMA 1EUTA 3DMMC 3W5NA 4GW1B 2B1HH 1INEH 2VIRA 2QBWA 2LQRA 4V1DA 4XWGH 4F15B 4KRLB 5CJOH 4HMDA 4BH7A 5EUOB 3REWA 5D8JH 4DGYH 3UPRA 5CEXA 1NFDE 3OB8A 3DGCR 3ZT5A 1JPGA 1A4JA 1ZVYA 1VEOA 3TJEL 4P5TC 2HMID 2HN7A 1QFOA 2UZIH 2BJMH 4P5KA 3MLSL 4HQQL 3ZT7A 2ZUUA 4HKXB 4Y19A 3T0ED 1XF4A 3OX8A 4UB0L 1I7UA 4R9HA 2FSEA 2EEAA 3WHE0 3O2VH 4KUCF 1C5CH 5L6YL 4PJEA 1PG7W 2FX9L 3ARGC 3OB0K 4QHNB 5D7JD 3RWCA 2ZKHH 4W6YB 4Z7WB 5EZOL 4DCQB 2FBJL 3K4AA 4M7ZC 5GRJL 1PLGH 3WL9B 4J3SA 4HPOL 1KB9J 5I1CL 1NDGA 4EN3C 2X70A 2VLRE 5KVFH 3UJTL 1HQ4B 3BKCH 3WD5L 4ZQKB 3UTTE 4Z8FH 3U79A 1UJ3B 4F3FB 5E6IC 4G6AC 1F11A 4S1DC 1JWMB 5TDPB 5E2VH 3ARDC 3CXDL 4PIRF 2AJYH 2AVGA 4YZFF 5C0CD 4GG8A 3UTZA 1M7IB 4P4KC 3O11B 2V9QA 5D7IB 3WIIL 1I8LC 2B1HL 5I1AB 4NFBA 1QSFB 4QRRE 1FGNL 1S9YA 2FYYB 3WLWD 1G7IB 4HFWB 4XWGL 5CJOL 4PJCF 4R0LC 1KYOK 1RUAH 2WUCL 5DTFA 5F1SA 1BPVA 3CDYA 3D3VB 4YH6A 5KVEH 4DGYL 1BFSA 4ONHA 5T1LA 4MQTB 1AGDB 3ILQC 2LFGA 5E00B 4X99A 4MXQC 4Y1AE 1CLZH 2BJML 1JV5B 2EYSB 2NW3B 3ROLB 4MDJB 4X83A 1DVFC 4IRSA 1IVLA 4JO3L 1U8KB 2XTJC 1TITA 3BDYH 3NZHL 1CLCA 1A3RH 1A47A 3O2VL 3QEUB 4OCWH 3SE8H 1I1YA 1C5CL 1I7ZB 4U1KB 5IB1B 1QFHA 4MNQA 3TBSB 2ZKHL 3O6FD 1T6WA 2BC4A 3HNVL 3ARQA 4PRID 4X7TB 3DYMA 3CAFA 4JG1H 4I48A 4PJCA 1BQLH 3SDDD 3SKOB 4J3XA 4Z7OF 1IM3B 3OHXA 5A43C 4JLRA 1ND0A 3BUTA 4TPRH 1IMHC 1XGPA 2OZ4H 4H25B 4JAMA 3PABA 2CGRH 4XP9L 1H8SA 5EU7E 2VAAA 5BJTA 5HYJB 3WFHA 3ZO0A 5F88B 3IGAA 3B2UD 2P5EA 4POYA 5E2TL 2AXGB 3BIAX 3LVEA 1LNUA 4KWUA 4TVPE 4ZFOL 1YMMB 4X7DC 2EE2A 2AERT 2YUVA 5F9DC 1RUAL 4HC1H 4HULB 1JCKA 3GMQA 2LAAA 2YBRB 1XAUA 1YEJH 3VFRB 4NRZB 5TDNA 4F58H 1E4WH 2VLJA 3CX5J 5HY9B 5JIIA 4KJQD 4PG9A 1BX2A 3O0RL 3ZKSD 1CLZL 2YUWA 1T0NA 1OT1A 1AQDB 1QRNE 3QEQB 5EIIB 1NMAH 3ULUH 3BDYL 2DQJH 3BP5B 3PF2A 4NNXA 4OCWL 4Y5XB 1UEMA 3SE8L 1M6OA 5IMMA 3NCYP 4NQEE 1J12A 3VFVB 3I6GB 1LE9B 1A14H 3ULVH 5K93A 1BZ9B 2CK0H 3X11B 1U3HD 4NZTH 2HVKA 4NQXB 4M6AA 1ZHKB 1BQLL 5DRZB 4XVUD 1ED3A 5JQHC 4ZUTB 4TPRL 1WFNA 1MFEH 1FN4B 4F7EB 1AGEB 2CGRL 2O5XL 1NCDH 3PIQA 2MQ0A 3VMPA 1FORH 4L8DB 4BZ2H 1KUMA 1RJLB 5A3ID 3NFPA 3GBLA 3I6LE 2Y07H 4RAUA 4LLAA 1PYWA 2DS4A 1QO3B 3Q0HA 2XXMB 4LHUA 4K3DH 3H2WA 3QPQC 4M61A 4RFOL 5E2JA 4LBEA 1WWAX 2KH2B 3KNBA 3IFNL 4WWKC 4OZIF 1A1OB 4XHJD 2DQFB 5GIRB 2W0FB 5J12B 4HXAH 1YEJL 1X6LA 2VXTH 3MRHA 1EEZB 4LPTA 3OR7A 1A6UL 4ODUA 4QCIB 5GGUA 4NJ9L 2YWZA 3QJFB 4JFDE 2Y5EA 1QNZH 1P84J 5J9PB 2OYPA 4I18A 4W81A 1RUQH 3EYVA 3FKUS 5CZVH 2OR9L 3VDCA 3B9KB 1A6PA 3ULVL 3M1BB 4JO2L 5INDA 4O5LH 3ZT6A 2YN3A 4MD0A 1NEZG 1HQRB 3CUPA 4RMUA 4F33B 5K59F 4OZIA 5DJYA 4M93C 4OUUB 4XBEH 4Y4FB 4GS7C 4HZLA 5I8EB 2ICEB 3T8XB 1CR9L 4EJ1C 4P48A 2I07B 5B21A 2X4PB 4GKOA 4U7MA 2ILLA 4RGOL 4R7DB 3AXLA 1QSED 1XFPA 2UWEE 4FXGB 3G5XB 5L0QB 3O9WD 1MJJB 3C5ZA 1CD9B 2Z4QB 4Y8DC 2Y07L 3WMSA 2GTZB 3F6IA 1WTGT 4LPWA 3HE6A 5HI5D 2YD4A 1QKZH 4UINL 3IDGA 3KGRA 4K3DL 2NY0B 2VLRD 4HJ0D 2A2QT 3THMH 3C6SA 4BSWB 3UTTD 1KTDB 5IT2H 3QO1B 1KIQA 1K8DA 3R1GH 3U9UA 1U91A 3ULUC 4APQD 1FZMA 4U1NA 3FN0H 2VXTL 3HZVB 1KENH 3KJ6H 4M6MH 1CIDA 2FATL 4XXCA 3PWLB 2VKWA 3ZE0F 3GSXB 3LOWA 2IMNA 3ULVC 2Y06L 2MKWA 5D93B 3QIBA 1FBIH 3T77B 1RUKH 2VQ1A 1BZ7B 3RU8H 1QNZL 3HE7A 5GS1B 3OAUH 1BAFL 2VQTA 2R1WB 2NXYB 1INQB 3FB8A 1HK6A 1DBBL 2PXYB 5J89A 2O5YH 3HUJE 3O8XC 4OCYH 4CMHC 1V7MH 3ZKQD 5D7LA 1BFTA 4PJFE 4O5LL 5AD0A 3NA9L 3VXSE 2I27N 2W0KA 1K2DA 1UWXH 3HC0B 2XPGB 4Y1AD 2OX5A 2QQLL 3O4LA 1TIUA 3CIQA 4LLMA 4MCZB 2Q6WA 3K1DA 3ARFB 5I30H 5HVFB 1XR9B 4UQ2A 2GT9A 3RKDD 2MCG1 1I1CA 1MCDA 4X8JB 3VXME 5C0JB 5IVNA 5KZCB 3PL6C 1A7NH 4PP2B 3EAKA 4NZUH 3QAZC 5D96B 4V2BA 5F97E 1BVKA 1P5VA 1X6NA 5EZLB 4RSVA 1CK0L 4AENB 1IZJA 3HKFA 1T1XA 1DQQB 1S9WB 5GS0D 1Q1JL 2IANE 1CDIA 1CT8A 4JRXB 5H35B 5D6CA 3IU4H 5GGTA 1QKZL 1PAMA 4P59L 4U3XA 1CFQA 3THML 5JHDB 3LIZH 1KG0A 5H2BB 3FJTA 4XNQB 4QTIL 5IT2L 1LQSR 3GKWL 5ESAB 3R1GL 3FHAA 4HKZA 5HHNA 3FN0L 3LKPB 5J6GB 1KENL 5EBWB 4IJ3B 5SX5H 5E8PA 3C6LC 4XNZC 4P2OB 4QXUL 4LAJH 2OBGA 1MJ7H 2MCPH 3QBTB 1KTLB 4P2YA 3R0MA 4LU5H 2DQEH 2FO1A 1W0VB 2XZAH 2BOBB 3S5LG 5ITBL 4OLVL 1ZSDA 1NC2B 5C07B 3OXRB 1CBVL 2XN9A 3A67H 5MEPA 5HGBB 3HS0A 4M3JA 3ARED 3H6JA 5SWSB 4CVZB 3OJDB 2P45B 1ORSB 3TEUA 1OHQA 1GOGA 3MRKB 4KKCD 3MUJA 1KPVA 1OGAB 3MPCA 1R5IB 4F80A 3CH1B 5ICZB 1R0AH 2B20A 2OK0H 3MXVH 5DQJA 1FVCA 3FOMA 1J1OH 4Z9KB 5IF0A 1LD9B 3MBEC 4KJYB 2AV7A 1U93B 1A7NL 1AFVL 4NQED 3SDXB 5JOEA 1MCNA 4NZUL 5J11C 4OD2B 4X4MA 2EE9A 4PJ5B 2VSDA 5BS0B 2IADA 1A9BB 3ESUF 3IU4L 2DL2A 5FYJU 4XP5H 1K5NA 1RU9H 3QDJA 1X5AA 3LIZL 3OJMB 4HG4J 2FO4A 4OZGF 2GW5A 2QADC 3L6FA 5DJDB 2AW2A 5HHVL 1MLCB 4KMTH 3RJDA 3W0WA 4I3GA 3LY6A 5T1MB 1CDYA 1URLA 3I6LD 2CPCA 3OKNB 5F9OH 3L1OH 2Q8AL 1T20B 2VLKB 1O7VA 2DQTH 3U36B 4HUWB 5LBSH 3CFDB 5CJXA 1XR8A 5FA3A 1MJ7L 4H0HB 2MCPL 1A3LL 3SCMA 4FZEL 1MRFH 1FO0H 2VXVL 1IFHH 1DL7L 4J4PD 4ZO7A 3R06A 5A2IH 1X4ZA 3BP4B 3GSRA 4LOUD 2R56L 3TYGH 4ETQB 1DFBH 5FV2A 1G7JB 1VKXB 1SQ2N 5DJZA 5GGQH 3ALXA 1OAKL 4OZGA 3GRWL 1R0AL 2XV6B 4MYWB 4UT9H 2PNDA 2OK0L 3MXVL 3VJ6B 2V2TB 1I8IB 1UM4L 3TO4B 1U2CA 3AMLA 4JFDD 1AJ7H 3S96A 2BVOA 1NC4B 1TVHA 3MSPA 5EO1A 5GGRB 4JFED 3VFGH 3GGWA 4R2GD 4I0PD 4XMPH 2WK2A 4XNXH 2ZWLT 4W4NA 2PYFA 1XIWA 2P8LB 4ZAKB 1G7LB 4ZPTA 2DWDB 1MFBL 3TFKC 2Q86A 3CC5A 1MHHB 4XP5L 1RU9L 5I15H 2C5DC 2DQHH 1MH5A 4KK5C 1LEGB 4YDIH 4X5WA 1OD7A 2HRPL 5HYSB 4P2RE 1INDH 1VEMA 3CFBA 4QNPE 1N4XL 5JNYA 1BFVH 4KMTL 4WEUD 2F53D 2P46B 4GFTB 3PWPA 3RGVD 3T0EB 3S8WA 4ZSOA 5GHWL 3C9NB 1TCRB 1L0XA 5F9OL 4HT1H 4LCWA 2DD8H 3BIKA 2R4RH 2WUBL 3ZE1F 5D7JB 5FK9B 1R3KA 1U92B 3UPCA 5GRUH 1DLHA 1QOKA 2DQGH 1S7TB 5FYJD 3U30C 3CD4A 1S8DA 1OAYH 3BKYH 2WV3A 1IAII 3WIFA 4OLXH 5IB4A 2NTSP 4UAOB 2VL4A 3VGGA 1AY1H 1DFBL 4JFYA 1FVEA 2VE6B 4U6YA 3HLAB 1K3ZA 4UT9L 2APBA 1JYWA 3K4ZA 1NCAL 3VDAA 3VGHA 4ENEC 5H8DA 3S3SA 5C0EA 3GMOB 2NY2C 1Q0YL 2YSSA 5J57B 4JM2D 5JW5A 1AJ7L 4HKJB 5FGCB 4EOWH 4ZOCA 1JF1A 2YK1H 1RZIB 2GSGB 2DLEA 3PNWA 3TNMA 3MCKA 1T5WA 3H8NA 1OGTA 4ODWB 1NFIB 3MXWH 1Y0LA 5I73B 2X4TA 4PBWD 3GHBL 3V5KA 1ORQB 1J7VR 4LNVA 4G7VH 5DRXA 4OCXH 4PGEA 4YHPA 4KTEL 5EFIB 5I15L 4DK6A 2DQHL 1CE1H 2J88H 1UH2A 4NSKA 5ERWA 5B39A 3VG9C 3VXMD 5DRWB 5F9WC 5FM4A 1P69B 2BVPB 3BRDA 1RQ5A 3NIFF 4L9LB 4GW1A 3IJHB 3VH8B 1HCVA 4LEOB 1B6UA 2H2SC 3BP6A 2VL5B 5MEOB 1XGTA 4HT1L 2DD8L 2IAND 4HUNB 3DTXA 3RP1A 4GUPA 4OFYA 1EPFA 2AS5M 1HILA 3JTSA 1U8JB 5IHZB 3O6FB 4UV4L 5GRUL 1ZVSB 4HWBA 5AZEH 5HHPB 4PRIB 3BKYL 3FQRB 3VXTB 4JY6A 2V17H 5KS9F 3SDDB 1T6VN 2JCCB 4U1GC 1R3IH 1ZLSL 4N0CD 2Z8SA 5J1AB 4TTGA 4PRHE 4KTDH 4JKLA 2X4RA 5K9KB 1JGUH 3IJYB 5F7DB 4QWWC 3HPLB 3DI3B 1MJ8L 5C08D 1KCUH 3VI3E 3U7WH 2V2XB 4DCQA 2LE9A 2WWKT 3QQ9C 5BVJA 3TH2T 3MBXL 4M8QB 2F5AH 3BKML 5MP6H 4X9GA 4BUHA 1S7SB 3MRCB 4G7VL 5KS9A 2NZ9C 1T1YB 1CE1L 4JFHE 1NGQH 3IXTB 4HJGA 5JHLL 4NKOB 4E5XA 2XTJE 3P4NB 5HHME 3GFUA 4F9PC 4OF5A 4TSBL 1QSFA 3MRFB 2FGZA 1G7IA 3CSYB 1DTUA 3TA3D 5KANI 3D3VA 5C0AA 4PRAB 3LS4H 4Y88A 1YEHL 3DX8A 1RPQA 5E70A 4BSVB 2Z8VC 4JR9H 4OGXL 5FOJA 4FNLH 3EOBB 4JPVL 4HFUL 3RX7A 4IMKA 5TFSH 1U3HB 1T66C 1HH9A 1IGCH 4AYFA 1JV5A 2EYSA 4N90E 2NW3A 2R39A 1R3IL 4X6DE 1YC7A 1U8KA 3T1FA 4U1SA 5F1IB 4YQXH 1L7IL 3CLEL 4OZFH 5IB1A 3CZJA 3T04D 1DCLA 5GZOC 2D7OA 3TBSA 4KI5C 4JZOA 3C8KA 4JZJA 1QR1B 4MNGE 1JNLL 4R3SB 4PJ7E 1BOGB 4GJTB 4JDTH 5TJWK 3PDOA 4JFFD 4EIGB 3OZ9H 5IQ7H 1Q9LA 3SE3A 5BRZE 4M43H 3MGTB 1YEDB 4HPYH 1IM3A 5CLWA 1OWRM 4WHYH 3GSNL 4KVCL 3WUWB 3AS3A 4L3ED 3HPJB 4H25A 1FV1A 5BCAA 4YHML 2EDFA 1PG7H 3ARTA 3OTTA 2P5WD 4M7LH 3ZKMD 5CGYC 2ARJB 4I4WA 4XVTH 5HYJA 4XPFH 2D31A 5IJVB 2A77H 5F88A 4Q9QH 1OTSC 5C0BE 4GSDH 2AXGA 5I1IH 1A02N 1TJIH 4FFWD 4OT1H 5DDHB 2YD7A 2ZUQC 4XBPA 1YMMA 1GIGL 3D6GA 2VOTA 2I5YH 7FABH 1JNNL 3LRHA 2YBRA 5B38G 2ID5A 5LKNA 5TDOB 3ZL4H 3Q3GA 1KJVB 4XC1H 4FNLL 5HY9A 5IG7B 1FQ9C 3FRUB 3W5MA 2PO6C 1FIEA 1EMTH 1F4XH 2DM4A 3I3EA 5TFSL 3RI5F 3U0PB 5FEBA 3QUMH 3GBMH 3QR2A 1AQDA 4QOKB 3BN9D 2VB5A 3QEQA 1I1AC 4PR5A 5EIIA 4Y4HC 4L3CA 5T3XH 4OLEA 4Y5XA 3O3BA 4W6WB 3V8OA 3LAFA 1ZTXL 5L2KE 1JE6A 3F5WA 4MHHG 1QSEB 5FXCH 3VFVA 2LTQC 3I6GA 3O9WB 3S4SB 3V0VA 1U95B 5E2UH 1WK0A 2I9TA 3X11A 5J56B 1T2JA 4NQXA 1MAKA 4M43L 4RQQB 5IK3B 2W9LA 3HMXL 5DRZA 1HEZA 3WDJA 4HPYL 3OXSA 5C0ND 4N9GB 2VLRB 5EU6E 5HHQA 4MA1B 1FN4A 2G75A 3UTTB 3S3PA 4P3DB 1OPGH 4XMKL 2X41A 2IPKB 4MVBD 4L8DA 5HDOA 4EXKA 4APQB 1A7PH 4K7FB 3RZCC 2EO9A 4Q9QL 2Y5TB 1QO3A 2PW2A 2BSRB 2LAGB 5I1IL 4GG6F 5DJAA 5E5MB 3V0AC 1FL3B 3DURB 5AYUH 4BSJA 2NXZD 3ZDZF 2L7UA 4AZ8A 4WHTB 4FOMA 2YEZB 1IGIH 4EDXB 2I5YL 4OQTH 1A1OA 4G43B 3F7YA 1N5YL 4LHUG 1EZVX 4P5TD 4PJAE 2X4UB 2DQFA 5GIRA 1Z0NA 2I60H 4UDUB 3RIFK 1AHWC 1KB5L 4GKZB 2FX8H 2WWMC 4NQUA 1D6VL 1EIBA 5E99H 3IAGC 2MQCA 3P73A 1U3JA 3HI6H 4WY7H 12E8H 3ARGD 2P7TB 5FHBL 1S7UA 1UFUA 4OM1H 5T3XL 3OB0H 4WHDA 2QKIA 4CGTA 2NTFB 2IH3B 3T2NH 3D48R 5IW6B 4GG6A 4OZHF 4XC3H 4O02H 5FECA 1S7VB 4XCYA 5E2UL 4DJMA 3OQ3B 4YWGL 4FQQB 2WZPD 4F33A 4S1DD 1A7QL 5E4EB 4OUUA 1WUNT 3ARDD 3ULUE 3MRLB 3HR5A 4FQLH 1OPGL 1CF8H 1B2WH 1CWVA 2I07A 1IAIH 1WCBB 1YY9D 2YPLA 1FNFA 3GJFB 3MREB 4L1DA 4FXGA 5I16B 2CH8A 3RBGA 1MJJA 3ULVE 1NANH 3BZDA 1G84A 3ARVA 3IXAB 4N68A 2GTZA 25C8H 3T3ME 5FUZH 1YEGL 3MJ8B 5TGBB 5C2BL 5T1DL 1N7ML 1FC2D 5AYUL 4OZHA 2AK4E 3OV6A 4ODSH 1P7HL 3MJ9H 1KTDA 1LP9B 1CICB 1V3MA 4DUXA 3ILQD 4OQTL 2X5PA 4LVHC 3PWUB 3BEWB 3AROA 3GI8H 4KK9D 3AREB 2QHRL 4JFHD 3PP4H 1TQCC 3WFCL 1D5ZA 1DVFD 5IVZB 3U48A 3PWLA 5HHMD 3GSXA 2E9IA 3HI6L 4WY7L 4Z7UE 5TE6H 3P9MB 3T77A 3HHRB 3P9LA 1QQDB 3LN4B 5GS1A 3KWWB 2R1WA 4GAJH 1INQA 3T2NL 3UTPD 5JZ7C 1MEXL 3QJHA 4G8IB 1NUNB 3EDJA 3P77B 3C2AH 1MCOL 4D9QE 2ZCKH 3FN3A 4R4FH 2BFVH 1W72B 3EDEA 1C5BL 2EEDA 5EC2A 4FFZH 3BH8B 3TYFB 4MCZA 4DW2H 4H1LB 3B3IA 4Y8AA 4PRPE 1J87A 3OSKA 4FQLL 5E08H 5C0JA 4GW4B 3WO4B 5F89B 2GFBA 4MA3A 1Z9OA 1RULH 4PP2A 3DARA 5EZLA 1U8HB 4LAQH 5FO7B 1VA9A 1H5BB 5FUZL 4CVXB 3VXOB 5H35A 2HG5B 4O2CB 4EUPA 4M7LT 4RISL 2VSCA 4MNHB 3Q6FB 1FZOA 4JREB 2ICCA 4LCUB 1X7QB 2YMXL 5GXBB 3CLFH 3GI8L 2NNAB 3L3GB 2XACC 5HDBF 3LKPA 3PP4L 2OMBA 1OARH 4HF5L 4U1MA 1RZGB 3HAEB 4MX7A 5J06A 5C0BD 5ISZA 5CCKL 5IV2A 3U0WH 2GSIB 9CGTA 3O2WL 1HXYB 2AXHA 4JFDB 4R97B 1B88A 4KK6C 1ES0B 5SV3A 2DF3A 3SJVD 4QRTB 1NC2A 4JFEB 5C07A 3JV6B 1BECA 5GZND 1IAKB 1UCTA 2CIIB 4I0PB 5HGBA 5SWSA 3VXRD 4CVZA 3C2AL 3G6JE 3VDBA 1YECH 4EIZC 2I24N 2A83A 2ZCKL 1N59A 3KDMA 1OGAA 1R5IA 2BFVL 4R4FL 5LCVH 1N0XH 2WBKA 4KZDH 1NGWA 5FDYA 1KTKE 3SOBH 1U8OB 2X1WL 1HH6B 2BY3A 4D0BB 4BM7A 3RUGE 1U93A 4BYHA 3HNSL 3NGBC 4WU5B 2F53B 4LQFL 4W68A 3RGVB 5L2KD 2V9TA 3FMGH 1K85A 1B0RB 2ZUWA 3EDKA 4AIZA 5GS3A 4HGMA 3KLSA 4FQXC 4X4YB 1NJ9B 3MUGB 4HWZA 4C83A 2BHUA 2RGSA 5EU6D 1P4IL 1IGJB 5F7YC 4CADA 1J0JA 2X05A 3RPIB 3TNNB 2NYYD 5E8NB 1MCPH 3CLFL 2ZNWA 3QIWC 3QWRD 5CHNB 5JTWA 5SWZE 3DNKA 4GMTL 3AM8C 1M7DA 4F9LC 4PTTB 1T20A 4M1CC 3U0WL 1JUFB 3C60B 3U36A 4GT7A 4HUWA 3CFDA 4HHAB 1MCKA 5DLMH 4JM2B 4LCCC 4PS4L 2OL3B 3F7QA 1KPRB 5E94A 2FGWH 4NYLA 4X80H 3BP4A 3KYMB 4AM0A 4AY0A 1LHZA 4WW2B 1MCSA 4ETQA 2OI9C 2RAMA 4PJFB 1G7JA 4UV7H 4GKSA 1N0XL 3AY4C 2WQ8A 3H9HB 1R5VB 1Z2KA 3VJ6A 3CU1A 2WBWB 3TO4A 4TULL 2VWEE 5J13B 5DJ2B 3HFML 1SEBB 3LDBB 4NO5B 1G6RL 2RBLA 4OQ1A 2NW2B 2R1YA 3MJ7B 3MRNA 3FMGL 3WN5B 2DLFL 5HI3C 2P8LA 3TH3T 1G7LA 2A9NH 5F3HA 2DWDA 5KVGH 2IANB 1KCVH 4S2SB 4NQVB 3REVA 1L9NA 1MHHA 3OPZH 2GUOB 5L88L 1I85C 4AEIL 4HJJH 3CX2A 3WFBH 2CLZA 3MRRB 5DK3A 4KUZH 1O7SA 3UO1H 3U2SA 1MCPL 4LGPB 1S78C 3QUXD 4NGHL 2ERJC 5HHXH 5LVEA 1G7QB 4LPXA 3M17A 3T0EA 4PBVC 5FYLH 3T1WA 1GHFH 3ULVD 1BD2E 4JHAL 5JUEH 5IWLA 3LD8B 2D03H 4PG2A 3V79C 2Z31D 4NC0B 5DLML 2DLTA 2Z92A 1U92A 5C08B 1D5XB 2AK4D 4KDTA 3O8XD 1S7TA 1BHGA 5I75C 4L8SC 1A7RH 5IVXE 5I1DB 4IOIB 3U1SH 3MNWB 5C0GA 4YFLI 4ZXBC 3VFSB 1NUFA 2WP3T 2BXZA 4L5FH 1UT9A 2FEEI 4OLYH 5C0CA 3PL6D 2R1XB 3QCTH 4MA8L 4HKJA 5EULV 3LV3A 1H3PL 4H0GA 1RZIA 4HGKC 3N9GH 4ODWA 4WI9A 1SMAA 1A2YA 3RL2B 4D9QD 2I26N 2A9NL 4L4VE 5KVGL 1CD8A 2E7LA 1DANT 4MLIA 2FLRT 1KCVL 3TA3B 3HRZA 4GLRH 5DR5L 2QHLA 4P9HH 5DRNA 2EIZB 4OIAA 4HJJL 2XRAL 4KUZL 2HJFA 4XP6H 35C8H 1N2RB 4B50A 4EI5D 2V5MA 4L9LA 1OL0A 3SGDI 3IJHA 3VH8A 3SBWA 4YGVA 4LEOA 3IDMA 5B39G 5MEOA 4PLJC 3D69A 4TTDC 5JUEL 4J3UA 2D03L 4YIQB 1EEQA 5I8KL 1YNKH 4E41B 2AK1H 5BMFL 3PGCA 1D9KC 4X7EC 1NKOA 1U8JA 2Y72A 4XCFH 2B1AH 1CGWA 5D1ZA 4JFFB 4PRIA 3FO2B 3B5GA 3FQRA 2AKRB 4NP4H 5CP3A 4PLNC 2DMCA 4MD4B 4LSVH 1WBYB 4JO4H 3TZVC 4OLWH 2JB6A 4L3EB 3U1SL 2OTUB 1JPTH 4ZUVB 1NEUA 2P5WB 4DTGL 5K9KA 3MBED 3UTQA 4BH8B 3IJYA 4M6OH 3F65A 2WSKA 4NRYB 3S7GA 3CZFB 4L5FL 1B4JH 1T7XA 2V2XA 3QCTL 4F15C 5D2LB 1GGCH 1MHCB 1FNGA 1HHGA 3KPSD 4IHOB 3LEVH 4EI6B 3UYPA 3VRJB 1RUMH 1Y6MR 2DMKA 3DHMA 2ZUVA 2APFA 4OF6A 1BQHA 4YEFA 1S7SA 3MRCA 5CZXC 4YK4B 2X89D 4PTUA 2QADD 1EBPA 3HG1A 4YXHL 1FHGA 1T1YA 1F42A 1M05B 4Z77B 3IS0X 3LPGA 5F8RC 5D5ME 2UY7A 4LDEB 3UJIH 5F3BB 2AAVA 3P4NA 3I85A 5JO5B 1HIMH 4JJ5A 1W2KT 4CJ0A 3MRFA 2ADIA 5EBLA 4KI5E 4PY7B 3CSYA 1TDQA 3HNTH 4BK5A 4U6HA 5DT1H 1YNKL 4DKDC 4OV5B 4PRAA 4XCFL 1UJ3C 1CXIA 3K2MC 4PLOB 5KOMC 4MJ5B 2JELH 3HZYB 1YEEL 1DUYB 3CVHA 4WEMB 4LSVL 4JO4L 2IALA 1P9MA 5EU5B 4OJFL 5JLZB 3ARBD 3OR6A 3QPXH 3L9RB 3H9SD 4M6OL 4O2EA 2NR6C 1C8PA 1B4JL 5C92A 4P9MH 1QR1A 4D0CB 3HB3C 4HUUB 4XNYL 2QSTA 1YN7B 1BOGA 4R3SA 4HIEB 4P9HC 2DM3A 5EOCL 3OF6D 4S1QH 3TFKD 1NFDF 2NXZB 4LPVA 5I1JH 2CUMA 4CN1A 1OTUD 1T1WB 1T21B 3CK0L 4PB9H 3V6FB 1CFNA 3UYOD 3S9DB 3BZFB 5C70A 1V7NH 4P5TB 1EHLL 1A6ZB 4MS8C 1UWGL 5J7CC 5F6IB 2EO1A 3MROB 1YQ2A 1RJZB 3BPCB 4JVPA 1YNLL 3UJIL 1YEIL 3JUZA 3G5YA 3VWKC 4L8CB 2EKJA 2CRYA 4JPIB 5KN5B 3ARGB 3MRPA 4ISVB 2C7UB 1EO8H 1LDPL 5DD5H 1L6XA 4HDIA 4YHIB 3O3DA 5DT1L 1CI5A 4KQ4H 4YO0A 5BV7H 4DK3A 5DJXB 4LLYB 4YHZL 1NFDA 5TDOA 4UTAH 3V6OC 1KJVA 4LSDA 4L9DA 4X9FA 4LSPH 2WLYA 3WFEH 3EOTH 3U0PA 4QEGA 5CUSH 5CSZB 1GPOL 3ARDB 5E7FA 3EGSA 1D3CA 2WBJA 3NCBB 4ENED 1BD2D 2NY2D 4MXVE 2YPKB 3BOVA 4AH2B 3MODH 5HGDB 3T0BA 3QPXL 4UOW0 1WFTA 3I84A 4G9DB 1VFBA 1EEUA 2OP4L 1ZKAA 2DWEA 4S10A 4L4JA 3O9WA 4P9ML 4A2MA 3S4SA 2HT2C 5CGMA 3MV8D 5IK3A 1YNTA 3C8HA 4R0LB 2EECA 5IB2A 1GGBL 4N9GA 2VLRA 1JHKL 4XX1G 3UAJC 4Y4KB 1EBAA 1MPAH 3UTTA 3ZKXC 1LO3L 1S5HB 4LMQE 1B9ZA 4PB9L 4G3YH 4P3DA 4TSAL 2IPKA 1V7NL 4O58L 2BNUA 2BNQE 3T4YB 2DQCH 4APQA 4K7FA 2FJFB 4LFHD 5FKAA 2EYRB 1WZKA 2ZUYA 2JJTA 2K7QA 4EQ2A 2H2SD 3QULB 5DMIH 2VABB 3O6KL 2OSLA 2Q7YB 3U83A 1IAOA 1FL3A 4QRRA 2K9UA 4GQ9H 1RZ7L 4L4VD 2A6KB 5DD0H 1OQOA 1YMHB 3FT3B 5BV7L 4TUOB 1SJHA 2FJHA 1FDLL 4YDJA 1Z9MA 3SKMB 3LH2L 3EFFA 4LSPL 3WFEL 4GKZA 1S7XA 4Y1AA 3C87A 4OF0A 4JGJA 4CL7A 5CUSL 4QWWD 4X6DB 4ZTOH 1EZVY 4BFIB 1SY6A 1XGYH 1G0DA 1WAAE 3H9YA 3IETA 1I8KA 3QQ9D 5IW6A 1IEBB 3U46A 2NZIA 4MNGB 4K23L 3LMJL 5IROA 3AVEA 4PJ7B 1ADQL 1KC5H 4G42B 2X4OA 1ZA3B 4HIXL 1A64A 1MREH 4HGWB 3IKCA 1CVSC 4FFVD 4WRLA 1E27A 5IJKA 4DZBA 1NGZA 2NZ9D 4XPBL 2G60L 3OAZK 5F93C 1LO2L 5T3XE 2R69L 1A6TB 3CDGB 4M5ZH 3GJFA 3GSVB 2DQCL 4PRNA 1H0DB 5IMOB 4JVUA 1HDMA 2MSPA 1HSBA 5BV7C 5C0BB 3CDCA 4JO1H 1WTLA 4LF3A 3MJ8A 5TGBA 4CMMB 4MMZC 3B9KC 4XP1H 5I1HH 1D5MB 4NQSA 5ALBL 5HSFA 2IPUG 5GGSB 1MLBB 5GGSY 3VGBA 1CL7L 3SJVB 2JK5A 4ZS7L 4Y4FC 5DVOA 2CIKB 4UILH 3Q5TA 1DDHB 3JSSA 1KEMH 5ESVB 3AREA 2UYLA 3VXRB 3LCYA 3QI9C 1JJUA 4XTRC 4IRJC 3Q1SH 1ZEAH 2P44B 5IVZA 3BN3B 1JN6B 1BOYA 4WCYL 1N3NB 2HP4A 5L0QC 2WW8A 1QRNA 4K07A 4UT7H 4ZTOL 3P9MA 1HHIB 3CDFA 3D0LB 4ZFOB 5ICXB 3VMOA 3WS3B 5GZOD 5DEGB 1U9KA 1KXTB 1QQDA 3LN4A 1AR1D 1RIVH 2NX5E 2NY0C 1T0PB 2EIEA 3FCTB 4YHKH 3FB6B 4PGJA 4G8IA 5L2KB 4NQEA 2J6EA 3SGDH 1HHHB 3A0OA 4S11A 5IBUB 3WNKA 4YDKH 1KC5L 1UGNA 3ALWA 3OBAA 1W72A 2MNUA 1HCFX 2BY0A 5DZLA 4MGXA 4AMKH 5EU6B 1LGVA 1CFVH 5HGAA 1SYVB 1S7RB 3L5WB 4N0RA 3FAWA 1JFQH 3HZMA 4M5ZL 4GW4A 4QRPE 1OTSD 5D93C 1UXSB 4KQ3L 3WIHA 4LRIA 4NCC2 1WWCA 3BPNC 5HJ3B 2C4FU 2E27L 1B90A 4X0KB 3EO0B 1H5BA 2PXYC 4JO1L 1SHMA 4NUJA 4CVXA 2C26A 5BW7A 2HG5A 5EZJB 1V3JA 2A73B 3ARZA 3UTSE 5HD8D 3RPKA 3Q6FA 1RD6A 5FO8B 2N56A 3V5DA 4TNWK 3VWJD 4J4PA 1X7QA 4JE4B 2OCFD 2F74B 3ARFC 2PO6D 4PJAB 3T65A 4JQXA 1J0HA 5EU3B 1BGXH 1G0YR 1E6OH 3Q1SL 4M1GH 4M93B 1ZEAL 2FCBA 1RZGA 2CKBA 4KKAC 4QHLB 1I1AD 4XCCH 1EXUB 4C57C 3C5JB 1KLUA 1X4XA 5D96C 2UWEF 4UT7L 3MV11 2X4NB 5TQ2L 2YC1B 4V2CB 4JFDA 5EN2B 1FPTL 4DQOH 2D0FA 4IOFC 1UADC 4WI3A 4JFQA 2XICA 2HJLB 4YHKL 1MFAL 1AIFB 4HUKB 1MNUH 2CIIA 1W0WB 3I02B 1EHXA 2DJUA 4YDKL 3FFCE 5GSRB 4EDWH 1NBZB 1YZZA 4QT5B 2RFXB 4MSWA 2YRPA 4F7CB 3MUHL 4M7KH 3ISWA 1T0MB 1A1MB 1FSKC 4IJ3C 4WUUE 1AP2A 1U8OA 2K3TA 3SDYL 4D9LL 1CFVL 4P2OC 4D0BA 3GJEB 3O3EB 3RZCD 3DVIA 4P3WA 1YPZB 3QUXB 3RGVA 2UWEA 1L7TH 1B0RA 4TUJA 1CG9A 3VFNA 2HH0L 1FAIH 3LN9A 5DQ9B 3A6CH 1NJ9A 3BGMB 3MUGA 2H2PC 3NFNA 3HUJF 4U7KA 5CEZH 4OGAC 2Z31B 5DYOA 1U2HA 1IGJA 1MIEH 2AK4B 4PJFF 3O8XB 3TPKA 3RPIA 1DQMH 5IESH 2R15A 5B8CC 4Y7MA 2N4IA 5E8NA 2ATKB 1KCSL 1Q72L 2BNQD 2WWMD 1U8NA 5JW4R 2AEPL 1E6OL 4M1GL 2W60B 4MJ6B 1FZJA 1DBKH 4UMGA 4QF1A 1G7PB 4A6YH 2DLIA 2KUTA 4DKAA 4AL8H 3RX8A 1JUFA 5IEHB 5ID0B 4HHAA 1VCAA 1U8IA 4XI5C 1N8ZB 3QAZB 4DQOL 3WKML 4ZUUB 1F4WH 2FJGB 2OL3A 5JOPE 4NM8H 1G7HB 3MYZA 3QXUA 5EOQL 2GIYA 4K7PX 2E8ZA 3HUJA 4P23A 3TBTA 2VDMH 3U9PH 4OI8A 4CRPA 1X5IA 3INUH 3E6HB 4PJFA 4PRBA 3VXSA 1Z0MA 2XY2A 4Y2DB 3H9HA 1DP0A 2A74B 3G6DL 1FJ1A 1K8IB 3KPLB 5KJRL 3OKLB 5DJ2A 1SEBA 3QHTC 1ONQB 1UB5A 4U49A 4EI5B 3RHWK 3VXMA 4K3JH 1CYGA 1U0QA 3KPTA 5GRVK 1MOEA 1U8QA 3MACL 3S37H 3WN5A 4NQTA 5DHVA 1FAIL 3IAQA 5KSVB 4NO3B 2R29H 2ZJSH 4UQ3B 5FA4B 3E0GA 2EDBA 4S2SA 3S88L 5C0FA 1MIEL 2A6IA 4N0YH 3DV6B 2DMBA 3VFMB 5IESL 3UCRA 2AEIT 1ZS8B 3A6OA 5T3XD 3RWGB 3VD4A 2V7HA 4MD5B 3G5VA 1MI5E 1G7QA 2ZZUT 3PP3H 2APWA 5HYSG 5M94B 4A6YL 4NQDA 3MBEB 1A3QA 4AL8L 6FABH 4U0QB 4OD1L 3BJ91 2JJVA 1JNHB 4ZAKC 1ZGLM 3LRSA 1D5XA 2EDRA 4UOJA 4P2QE 1XCTB 5D7SH 5J11B 5FOBB 3T2PA 3KPSB 4RX4D 5FYKH 5I1DA 2F8VA 2P8PB 3EUUA 4MWFA 3BO8B 3INUL 4RMRA 2HMIC 1S9XA 2APTA 4UTBH 4IBLT 4L3AA 2Y6SC 1NGXB 2JB5L 1Z3GL 3KPMA 2QADB 1YDPB 3WXWH 1G6VK 4RFEB 5D9SB 3LKQA 3QRGL 5FCSH 4OM0L 1ZT4B 4XCEB 5EC1B 1BQSA 1EERB 3RUGB 3QDGE 2NX5D 5F7NC 4K3JL 1YQVH 5D7JC 3TBYA 4WGVB 4M62H 4M48H 4ZO8A 3UEZA 1I9RH 1KIPB 2X2YA 3S37L 3WO3B 5BO1H 1Q38A 2VUYA 2R29L 2ZJSL 5L9DL 4F8TA 3L7FB 3TA3A 4DKFL 4UAOC 1EGJH 2H26A 2EIZA 4KJWC 4UZGA 1YN6A 4M02A 5KW9H 1N2RA 1X4YA 2ZCLH 4WO4D 3DI2B 4QRPD 1LE5B 1QLRB 4ALAH 3IDNA 4IMLB 3RA7H 4D3CL 4YBHA 5F9JB 3G04B 1GGUA 5DUPL 1W8NA 3ARBB 2UY6A 1RZFH 3H9SB 4Z7NE 3R8QA 5EUOE 4KJPD 3UTSD 3VH8G 5ADOH 4BFBD 3WLWC 1OCWH 5CILH 1FNEB 3GMPB 5D7SL 2WM0A 5FYKL 5C09D 1WBYA 4RBPK 3O2DH 5FYLE 2EH7H 2FZ3B 2FH6A 4QNPF 3MLRL 4ZUVA 4UTBL 3F7VA 3QNYB 1S7WB 3RY6A 4LASH 4U6XB 2MFNA 3O45A 3MV7E 2R2BB 3NACL 4Z7WE 3TF7C 2B2XH 1MHCA 1MCCA 1P1ZB 4M1DL 4FQXD 4IHOA 1P7QD 4GOSA 3MJ6A 4M62L 4LP5A 3O6FC 1EVUA 5HHOB 3QCVL 1IC7H 3KS0H 2EDTA 3SDDC 2VKXA 1KPUB 2V2WB 4WUUD 4YHNA 4NO0A 3EYQD 4I0KA 1BQHG 3QIWD 5F6HI 4P2RA 2ZCLL 3MA7A 5D7IE 5F3BA 4BFGA 1N6QH 1JRHH 4AEHH 5JO5A 3QNZB 1UM6H 4ALAL 2E9BA 4M1CD 5F7MC 5FGBC 5JXAH 3DROB 3L3OB 3RA7L 5K9OA 1JZ6A 1BD2B 3J7HA 3B2UC 2NY2B 1OW0C 3L7EA 1MVUB 3FT4B 1HI6A 4M4PA 3RDTC 3OKOA 2YD8A 1YYLL 3V4UH 2E7MA 4XVSL 5AUMB 4MJ5A 1O5DT 3HZYA 4LCIH 4YHLL 1ZV5A 5I19H 1ZGLP 4G6MH 4Y0GA 2Z9TA 3MV8B 5DK2A 3IF1B 5CWSA 4GBXC 3O2DL 2HFGL 1G9ML 1IQWH 4KJQC 3ARPA 4LLQB 3S36X 1P6AB 3WXVH 3T2QA 4YBQD 1ZHNB 2NY1D 3GZKA 3L9RA 5IB3B 4ZUSB 43CAA 5FFLA 4YNYB 2GJZB 4OBSA 3DMMA 5I9QB 1KLFA 4D0CA 4J8RB 1CDGA 1N6UA 4HUUA 3LQMA 1YN7A 2B2XL 3N06B 1IGML 5HI3D 4ZOBA 2FD6L 5E2WH 2CRIA 1Q9KB 1DBJL 4NT6B 2GJ6D 5B4MD 4L4VB 1U3HC 5EPMB 1T21A 4XVUC 1V5JA 4P5TA 1B0WA 4J3OC 5LXGH 3FOLA 1CFTA 4HWEL 3WUWG 4X6EB 3MROA 4U1GB 2IG2L 4B7IA 2IEPA 2HKHH 3S34H 2DTMH 2UZXB 1RI8A 4JVWA 3DSFL 1HXMA 1JRHL 4Z7VB 4AEHL 5DGRA 5JXAL 3H3BC 3ARGA 5MHSE 3M8OH 2C7UA 3S35X 5IBLC 2QSCH 3BDXA 4O00A 3U7YH 3TVMD 5IP4A 1OP3K 2EDHA 3V4UL 3HE7C 4LLYA 4ETYA 4EN3A 5E5RB 2ICWA 1FNSH 4QYOA 8FABA 2D9CA 3MV9E 3ABZA 5E6IA 3V4PH 1G0XA 2RQ8A 3FQNA 5EU4B 1H3XA 4K71B 5CSZA 2Y7QA 3ARDA 5DJCB 4PRHA 4X7FC 4XPHH 4ZXBD 2EDWA 4AH2A 4CU7A 4ELKA 5HGDA 4P4KA 1NH6A 4CW1B 4G9DA 1F6FB 5JORB 1KT2A 1M7XA 4XX1E 4YX2H 4TVSa 1I8LA 3L3HB 1I9IH 1YEFH 2BHYA 1DN2A 5E2WL 4R0LA 1T3FB 3ZYIA 2F54A 4QHMB 3C5SA 2PW1B 3S4SG 4HS3A 1J05B 1CGSH 1S5HA 5JXED 3QB7C 4Z78B 3IVKB 4YDLB 1P7KB 5AAWA 3WKNA 2BHZA 4D0DB 1AH1A 4PJHE 3T4YA 1ZT7B 3NBNA 1CLYL 5GRXG 5A2FA 1AXTL 5D5MB 1DVFA 2EYRA 2IMMA 4IS6B 3QDGD 2DTML 3SDCB 4M03A 4TTDD 2VABA 1VDGA 5IM7A 3OKDB 2FWOA 5TH2B 1D5BB 4FTVE 4N8PA 3TM6A 3J8F7 1D9KD 2X7LB 3FN9A 5I1LB 5HI5C 2QSCL 5ADPH 2BZDA 3QEHB 3FT3A 4HJ0C 4JRWA 5LQBL 3QWQB 4MA1C 3JV4B 4H20L 1HYSC 1QZ1A 1JGDB 5IFJB 3TZVD 1GSMA 4G5ZH 3SGKC 3QZWB 3R4DA 3SKMA 3UX9B 4UNVA 4HUVB 3V4PL 4UIKH 4OCSH 2IFFH 3D85A 3EJZC 5DVNA 2AJ3A 4HKBA 1BBJA 3I9GH 4BFIA 2FECI 1NLDH 1NSNH 4H1LH 1FVDB 3DRQA 3FO9B 2APVA 1NLBL 4P5MB 5DFWH 5AYQA 1G1CA 2OM5A 3CCHA 4GXVL 3GUTB 4PJ7A 3CU7A 2ZUQB 4G42A 4N5UA 5BRZA 3UBXI 3Q48A 3H7LA 4RWHA 3MLUH 4NRXA 3WNPA 5MEQB 3QFDB 4WFFD 4BQCA 5ALCL 2ADJA 3VWJB 3LEYL 4DVBB 1A6TA 3CDGA 2AEQH 2PO6B 4ZD3H 3VRIA 3MV7D 1RVFL 3MRDB 1H0DA 3DVGB 2CDGB 5F7LB 1MCJA 1Y18B 4UU9B 2GTWB 3AB0C 2RJMA 3HAEH 1I1AB 5DZOA 5C0BA 3OKKB 5HDQL 4U1IB 3JWDH 3VD9A 3GSNB 1D5MA 3O4OC 4MAYD 1PBYA 1DEEB 5E03A 4P0DA 5ADPL 4JPKH 5ANMB 1A1NA 4U33A 4X9BA 4P57B 1MJUH 1DDHA 3GSOB 1C1EH 5ESVA 1CS6A 5IOPB 4WTZA 3E6FA 4G5ZL 3W9DA 4XPGL 2X4SA 1MIML 1MHPH 5CP7B 1JN6A 4R90H 2ADFH 3BWAA 4UIKL 1N3NA 4OB5H 2IFFL 4OLUL 2AXFA 5I1EH 1U58A 1HHIA 3I9GL 3D0LA 1EJOH 5C86A 3WS3A 5D1XC 5DEGA 2PTTA 3BAEH 3HB3D 4FABH 1SYSA 3RZCB 3N1GC 3GI9H 3V4VH 2R0LL 3BKJL 5L2KA 4N8VB 3GSUA 1HHHA 1ZK9A 1CICC 3JBG7 4KKNA 2NY7L 3DXAE 1E28B 4CVUA 1NAKH 4XHQA 1JHTA 4WWKA 3MLUL 4OZ4B 2EDXA 5IMLA 5EU6A 1WIUA 4K94L 4KKCC 5ACLA 5HPOA 4G8FB 3RWEB 3KXFD 4JFOB 4PGBA 1SYVA 1AHWB 5FYJH 3VG0H 2ZUXA 4I77H 2YD2A 3L5WA 4LSRH 4OZFB 2AEQL 1U8MA 4FG6C 2BNQB 3VWKD 3UJJL 3QWRA 1EAPA 4MQXD 2PYEE 5HJ3A 3HC3H 4H1LG 2W0LA 4KXZI 3VFUB 1CGTA 1OB1B 1QRKA 4GO6B 4X0KA 3H3PL 1T7WA 1TZHA 3BHBB 1VB9A 3FONB 1JNJA 3DSNA 4JRXE 1CD1A 5DHYB 5EZJA 2A73A 3TO2B 5J4MA 2OZ4A 2A6JA 1BEYH 4XAWH 1BQUA 4YXKH 1QPPA 3EFDL 4BA8A 5KOVC 4MA7L 4JPKL 3SE4C 3ARYA 3B2VL 2F74A 4PJAA 1MJUL 1DQJB 3VFOB 2C3VB 3KPRA 5EB9A 1MUJB 3ULUF 2EH8H 5JPNB 1IT9H 1MHPL 2FL5B 4R90L 1JYVA 2R23B 4I2XB 3C5JA 4OB5L 3OKMA 3MLXH 1A6VH 1GYAA 4HWBL 1EJOL 5EN2A 5MHSD 5FIEA 3DX6A 3T3MF 2QQNH 4HC1A 2EC9U 3FRPA 4I5BA 4LSUH 1I7TA 3KPOB 1NEZA 2HFEA 3GO1H 2HT2D 3GI9L 2CDFB 2HJLA 3GIVB 1NMBL 3V4VL 5IR1B 2VN4A 1ZANH 3I02A 1KB5B 3NCFB 3UAJD 3O41B 1NBZA 3MV9D 1F3JA 4Q7DA 3VMNA 1DN0B 1JPFA 4L29B 4MZ3A 1A1MA 2CXGA 4CBPA 1VFUA 2X42A 4WV1C 1WBXB 2XFXB 4B5EA 1KB9K 1TQCB 3JWDC 4LSRL 2LV4A 3PHOA 3JWOL 4Q6YA 4Q0XH 4Z7UF 4Y19E 4JFZL 5DJ6A 2B4CL 1OF2B 3CPLA 3NCJH 3SDXE 3STZB 4ERSH 4B41A 4PJ5E 5DQ9A 5BS0E 2C1OB 4I0PC 1PQZA 1BLNB 3E8UH 4JM4H 2D3VA 1HSAA 3QA3B 2CQVA 1BEYL 4XAWL 2AK4A 4NNPL 3O8XA 1WF5A 5LGHH 3MRBA 5E6YA 2CLVB 4OV6F 4UT6L 2VDQL 4GKNA 2R4SL 2ATKA 2W9EH 3FB7B 4DKEH 2EDOA 2W60A 4WEBH 2Z35B 4K9EH 1IT9L 4HIHB 4IIQB 4K3EL 4Z7QE 2VLKE 4FTVD 5C1MB 3V52H 3BX7C 1A6VL 5ID0A 4Z7UA 3KPNA 3UP1A 1SBSL 3MMEB 3PL6A 2BNRD 2EEBA 3U4EA 1GGIL 1N8ZA 4W6XB 4ZUUA 1L9MA 2DYPA 2NX5B 1G7HA 2XZCH 3GO1L 1JWUB 43C9A 5GGVL 3IJSB 3EYSH 5DC9B 4HSQA 1I8MB 1BJ8A 1ZANL 2XT1B 3WLBA 5C0DA 5I18H 3VXPA 1WCQA 3MNVB 2W38A 4KI1A 1PY4A 5DWUH 2HYMA 3U7AA 1K8IA 5JW4M 2R8SH 1MHEA 4LLDB 4E0RB 4PRPA 3AS1A 2MHAB 3C2SA 4WO4B 4Q6IC 3C60C 1AQKL 1NBVL 1P4BL 1HHJA 4QRPB 3C6LA 1FIGH 1BVLA 2CMRL 3ULSB 1F4YH 4JM2C 1Q94B 4ERSL 3NCJL 4OTXH 4YZFE 3OJVC 2LU4A 3HI5H 1AGBA 4J12A 5KSVA 4NO3A 5CMAB 4UQ3A 3TT3L 2QL1A 1I1FB 3F8UB 4WW2C 4LARH 4TOYH 3UTSB 1JTPA 32C2A 3G6JF 2EDKA 3QUYB 3QI9D 4XTRD 3X13B 4IRJD 1JGLH 3W11C 4UDTB 2XNAB 4PJCE 5C09B 4IOSD 2W9EL 2YA0A 1GZPA 1IL1A 5J13C 1R6VA 3IDJB 5EZIL 3LDBC 5IBTH 4P46D 3GIZH 3NZ8A 1IQDB 3L5HA 4WEBL 1R3JA 1PKQB 4K9EL 3RUGF 4EXPX 2AEWA 2R0WH 2Q76B 4HCRH 2VZSA 3KYNB 1E6JH 3MBEA 4ONGH 4WI4A 5CEZE 5DMKB 3NGBB 1P2CA 3V52L 2NY0D 1JNHA 1FFNB 1DBMH 2L4OA 3CX5K 5FKPB 1GC1H 4MQSB 4Z5RB 3KG5A 2XZCL 4FQXB 1P7QB 1J8KA 1XH3B 4P4RB 3RTQC 2YOCA 5JIHA 4HS8H 3BO8A 3G6JA 5GJSH 2D4FA 5JR1H 3I6KB 2DKMA 1KXQE 1IGYB 1WISA 4MXWL 1IBGH 2AP2A 3CFIC 4PGDA 2X89A 3NABL 3DETC 1KIRB 4EZMA 4NKDB 4WUUB 4Z7OE 1ZWIB 2IH1B 3V5HB 3EW3B 4FQPA 3L3IA 5D9SA 2VLJE 3A6BH 2AV1B 3QIWB 3FO0L 4H26A 5I2IB 3RUGA 5AG9A 3GMMA 3VXNB 4TUKL 4U3HA 1FIGL 3P4MB 4DN4H 1F4YL 1JF5A 5KG9A 1KIPA 4KHXH 4S0TD 3TT1L 4FQCH 4OTXL 1X5YA 5MI0B 4F8QA 4G8EB 3HI5L 3DXAD 4LCCB 4GRLC 5IEKA 3ARWA 4LARL 4K9EC 2QQKH 3TLRA 5KSAB 2C1PB 3QQ3B 2DBLL 3P9WB 5IUSA 3NFSH 5IHUH 1RZKL 3U4BH 1HOCB 1KCRH 5KZCD 4Y5VB 4GMSH 2DQDL 5SWZA 1WJ3A 2PYED 3GIZL 3NCYS 1X5GA 4IMLA 4Z18A 4FRWA 3W81A 5CJ8A 1UKSA 3G04A 3N85L 3QH3B 1FFOB 2NY1B 2JKXA 2KQMA 4X9HA 4IOFD 4F37F 4OCLC 4LSQL 3BESR 2BP3A 5CBEB 4JJHA 1HYRC 2R2HA 4XMLL 2V9RA 3UYRH 5MENA 3GMRB 4R4BA 5BOPA 1FNEA 3DX9B 3SO3B 3SDAC 4BQ8A 4DGIH 3OAYK 5EBMA 3OF6A 3GB7B 2JCCE 1UM5H 2WIMA 3GSQB 5GJSL 1E4XL 2H3NB 2GJ6B 5JR1L 4RIRA 1UYWL 2J4WH 4FQHB 4P2OD 1S7WA 5DEFB 3ELAT 1IEAB 3RVTC 4O2FB 3VGDA 2B7DT 5CKAA 4U6XA 5HBBA 5IW1A 3PWJB 3KHOA 3A6BL 4NWTL 4DZ8B 5FYKE 1NUGA 3X3GH 2VO5A 1HWGB 4PJIE 3L3KA 5CJQL 4FQCL 4JDVB 5FDWA 4LRNH 3FL7A 1FE8L 1NDMB 5IVXF 4JY4B 1KPUA 4KPHH 3G6AA 5ITFB 3TVMB 2CLRB 2IBGA 4CKVX 3LKSB 4L8SB 5I75B 5IKCB 1DQDH 3X12A 4YDVB 1N0LA 4LCYB 1G6RB 1UZ8A 3PE9A 1I4FA 5IIEA 4ODVL 1T22B 3G5ZB 4Y19D 3QNZA 1MFDL 3DPBA 1GC1C 2C3GA 3L3OA 4ZXBB 1K4DA 1BD2A 1XF3A 4XI5D 1MVUA 5DFTA 4ZFZB 3GSWB 3KLAB 5E9DA 5SWQA 2HA1A 2OQJB 1JGEA 3UYRL 4KXZH 5AUMA 1PZUB 4OFPA 2GI7A 3MRQA 5IVXA 1UWEL 3MLSH 4HQQH 4Y2OA 4UNUA 2VDNH 3U0TB 1U6AL 4UB0H 1J1PH 3HCVB 3CJJA 5TE7L 5JDJA 2Y23A 1QFWL 2ITCA 3D5OF 1ZHNA 2VLKD 4ZPVB 1DUZB 3BN9C 5IB3A 3VGAB 2AGJL 4ZUSA 5L6YH 2GJZA 2YUZA 1FO0A 2FBJH 3MNZB 4PJ8C 4J8RA 5GRJH 4P3CH 1Z6JT 4UI2A 3QDGB 4HPOH 5I1CH 2P8MB 4KV5E 4KUCD 4BKLA 1JZ4A 3AS2A 3FTGB 1OT2A 1Q9KA 2BVQB 4KHTH 4LP4A 1D9KB 3UJTH 3WD5H 3VD5A 4L4VA 4LRNL 5JW3H 4I3RL 4GRWH 2X1QA 4QHKI 2XXCB 3AAZB 1QLEL 2WNGA 3RVVD 3CXDH 1ZAGA 1OLLA 4QRQA 2FIKB 3LPFA 4X6EA 3IAPA 3TZVB 1FZKB 3VD3A 3LQZB 5J6HB 1WWBX 2AJUL 1HZHH 1C16B 3WIIH 5DUMH 3K7UA 1QLFB 3MRMA 1CN4A 2DDQL 5HVGB 5HVWA 2J5LB 4ZAKD 1FGNH 3CFEB 4OGYL 4G9FE 5DSCA 3BD5A 2DTSA 3KYOB 4ZDHA 2WUCH 3SE9H 2NXZC 2VTFA 4L4TA 1PG7X 4HV8A 2KDGA 3FQUB 1VFAB 2J8UB 2EKSB 4LK4A 4YR6B 4WJ5B 3PQYE 2R0ZH 2RB8A 2I9LA 5FCUH 4GAGL 1RMFH 2XZQL 5F6IC 1TLKA 2A9ML 4YPGB 2Y6SD 1MFCH 4QOKE 2VDNL 3EIFA 1CTNA 4JO3H 5DJCA 1J1PL 5D5MF 1R5WA 5I0DA 1B0GA 3NZHH 3LHPH 1QR4A 2E8YA 3WCYA 1HINL 5CEYA 1JMXA 1IC4H 5CEZD 3BUYB 4JANB 5FYKU 2OXHA 3MV7B 3ROOA 5CD3B 1QSEE 5JORA 1WT5C 2D0GA 5DUBA 3EDFA 4KI5F 3HNVH 2BY2A 4AEEA 4P3CL 2ZSWA 4F9PA 1FGVH 5GRVL 3FT2B 1GGYA 4JCMA 3RL1B 1JTTA 1T3FA 2JJSC 4JY5L 4KHTL 4MAYB 4QHMA 4WGWB 3HZKB 4NDMA 1J05A 1NMCC 2HFTA 5JW3L 2ORBL 4KJWD 4PJDF 4XP9H 4HS6A 1P7KA 1H8NA 1NGYA 2VLJD 4PLKC 4N0FB 3C09C 5D5MA 4NKMB 4IS6A 1HZHL 2V5SA 2GHWB 1YY9C 3BT2L 5DD1L 1CFSB 2XKNB 1J8HE 5E2TH 3GMLA 5DUML 3OKDA 4FFYL 4KGLA 5TH2A 2ZOLB 2V7NB 4M3KB 2IAMA 3QO0B 2XQYG 4JQVC 1XCQB 4HG4K 5I1LA 1GCFA 2XWTB 4QKXB 1WIPA 2VC2H 3SE9L 4Y4KC 1EO5A 4KVNL 1OSZB 1BREA 1V8HA 3MLYL 5IW3A 2EIDA 2R0ZL 5FCUL 4PJDA 3O0RH 4JFXB 4KK9C 4OIBA 1RMFL 3DV4B 4HUVA 3BPOB 4X9IA 5TF1L 3CSBA 5ETUA 1ZT1A 2M1KA 4UUJB 1MFCL 2X09A 4WDIB 4JKKA 2H9GA 4U31A 4BQ6A 2ICES 3KXFB 1JZ3A 2EXYC 3LHPL 2CUIA 1FG2B 2EXWD 1NGPL 1IC4L 4P5MA 3VWKB 5HI4C 5J0BA 1CE6A 3CFKB 4HUXA 1RIHL 1K4CA 1FGVL 4J3VA 4DGVH 1JYXA 1QVOB 3E3QC 3KYKL 3DO7A 4M6NL 3FQXB 2AJZB 4KFZC 1MF2H 5MEQA 3QFDA 4PV8A 2OR8A 2O5XH 5CSGA 3ZDYE 4DVBA 4YXLL 3GBNH 2PO6A 2H32B 4O4YL 1X9QA 3MRDA 1T5XB 2CDGA 1Y18A 2GTWA 3EO9L 4FHBD 3DLQR 4GRMA 4CU8A 1I1AA 5FYKD 3OKKA 3BH9B 4ZYKA 3WFZA 2CK2A 4Y4HA 2EDDA 4QHUA 4U1IA 3RDTD 5TPWH 4LKCA 5B38A 4F7PB 2J8OA 5A16B 4RFOH 4HIJB 4RMSA 5DD3L 1T83C 5DS8A 3IFNH 3BFOA 1LP9E 1ZA6A 2VC2L 4NO2B 3GSOA 3PHQA 1NAMH 5EO0B 3TJHD 4R7NA 4GBXD 2E6JA 4M5YL 3ZKXB 1L6ZA 3MV9B 1A6UH 3JTTB 3VCLA 3G08B 1U8PA 1BJ1H 2B8OT 2CR3A 4NJ9H 4WTZG 2GCYB 2GK0B 4HIIB 5C3LD 1XGRB 1YY8B 3RZCA 5AAMA 1FLRH 1ZLUK 1CDBA 5GQBA 3IT8D 1KNOA 5C9JB 2OR9H 2HT3C 2IQ9L 5D7KD 4JO2H 4OD3L 2YA1A 3CFJB 1WFOA 2VYRE 4DGVL 5GZNC 3KAAA 1UC6A 1D7FA 3K2UL 1Z5LB 3DX7A 4S0SD 5DJ0A 1MF2L 5IBUG 4G8FA 2BMKA 3P30H 4JFOA 3RKPA 1AHWA 4L8BB 4LKXB 4PREB 4WENB 3T0VA 1CR9H 2KPNA 5F6HJ 4OZFA 4PB0L 3GBNL 5I76B 2BNQA 3WSQL 4RGOH 4PJHB 1EUUA 5E56A 3KPPA 3VFUA 5EUKB 1WAAF 3SQOL 1OP5K 3QDME 2ZSVB 4X8XA 5IBLD 3FONA 5B22A 3HMXA 4UINH 1RK0A 5DHYA 4FTVB 2G9HB 3LKNA 5TPWL 4JKWA 4U3CA 1UA6L 2BNRB 2HLFD 3HE7D 2LU7A 2H8PB 4GW5B 2XA8L 4RGMB 1II4E 3TV3H 3V6ZA 3BZ4B 3QXDB 5IGXH 1DQJA 1EK3A 3ZSSA 3VFOA 5IFHH 1N5AA 2C3VA 1NAML 1MUJA 1W0YT 2NYYC 5D7LD 1AD9B 2FATH 2Q20A 3QHZH 5T1KD 5CBAB 1XGUB 3PWVA 5CFHA 1FL5B 2BCKB 2Y06H 1RIUH 3BP7B 5CS7A 2CJUH 4G9FD 1FH5H 1WAAA 1BAFH 3TIEB 3MGOB 5C0RL 1FLRL 4JFEE 5BV7B 3JV0A 1DBBH 1QEWB 3QQ4A 3D25A 1QA9A 4ORGA 3F12B 3NA9H 3PQYD 4S1SH 3FRPG 3O6ML 1RAMA 2QQLH 1DN0A 4U1LB 3QUMA 4L29A 1BP3B 1PX3A 3TCLB 4QOKD 1WV7T 1WBXA 4C59B 5LGKA 3QI9B 4IRJB 3P30L 3ZLQC 3ES6B 3BEVB 1F3RB 1G9NL 4KROC 1TNMA 4ZTPL 2DN7A 3ZMRA 4H8WH 2F53E 3T0WA 1LO0L 1OF2A 1SM3L 4P46B 3QFJE 3VFTB 1CK0H 3B43A 4QXGH 1Q1JH 4NPYB 3IDYC 4PYHA 3ILPB 4YAQB 4J3TA 4CNIB 4P59H 3QA3A 1WFUA 3BW9B 2VERN 3MX0A 5EBGA 1HYSD 5FYJE 3JV5A 5HGHB 3QDAA 2CLVA 4QTIH 2XN9D 3GKWH 3TV3L 4BUGA 5IGXL 5IFHL 3O3AB 1ACYH 4XB8A 3EJZD 1ZXQA 4FQIL 4ELME 4X98A 2PN5A 3QUXC 1KJ3H 1NL0H 3QHZL 2E6PA 1J8HD 4QXUH 1U36A 3D0VB 2Y25A 4LVNC 3IDIB 1CXLA 2NY4C 3F58L 1RIUL 4YEEA 3UTOA 1VEPA 2CJUL 3D2UD 1DEDA 3BPNB 3CVHL 1FH5L 4F7MA 5ITBH 4OLVH 3SGJC 2NX5A 2YD1A 4OQTA 1QFWM 2Z31C 1CBVH 1MELA 3IJSA 1F90H 2NY3D 4OF3A 4CN6A 4FZ8H 1I8MA 4U1JB 3PJSA 4JDZA 4QXTA 1MWAH 5FGSA 3DXAB 4S1SL 4TNVK 3BXNA 1FRGL 1J86A 4LLDA 2HLAB 4E0RA 3QNXA 2XA3A 2VXQH 2MHAA 4BZ1L 3NIDE 3B5TA 5DI8B 4JN2A 4H8WL 4QRPA 2DKUA 1AFVH 1Q94A 1XF2A 4XNMB 2UV3A 2PYEB 2B5IB 3I3DA 3EYFA 1FP5A 3G9AB 3LSOB 3QXAA 5ICYA 3S98A 1L4IA 2VH5H 5CMAA 4QXGL 1I1FA 4NQCA 3UTSA 3CSGA 3SCMD 2WIIB 4X6CE 1KULA 4Y2DC 2P1YA 4LMQI 1MVFA 2R2EB 4YE4L 1WITA 5HHVH 4ODTL 4HK0A 4E42A 3D87B 5ID1A 3IDJA 1ACYL 1RJYB 1FSKB 2WWKO 5CINL 1IQDA 2OJZL 4EI5C 1C08B 2E7CA 3V7MA 3VA6A 5D1XD 1KJ3L 4FP8L 1NL0L 2Q76A 2Q8AH 3U6RB 5DMKA 1AR2A 3LS5L 3GMNB 1A3LH 2H6PB 4FZEH 5BZWB 3B9DA 5C08E 2VXVH 4PV9B 2XKUA 5FKPA 1N6VA 4Y5YB 3MJ9A 5DC4B 1DL7H 1CICD 4LEXL 3ZTNL 5BXFB 1AO7E 4FQXA 1XH3A 1CGXA 1F90L 2R56H 2VIRB 4FZ8L 3AUVA 1RV6X 1XIWD 3FFCA 1MWAL 3W9EA 1GGTA 4H8WC 3PDGA 4BH7B 4DFIA 1LILA 1OAKH 3GRWH 4U2YA 5C8JA 5B8CB 3UC0H 2X40A 1KIRA 3REWB 2DQUL 4WUUA 1ZWIA 2IH1A 3V5HA 1UM4H 4FG6D 5CEXB 1NFKA 2N7BA 5FF6A 5CJBA 7CGTA 2AV1A 3MGAA 2VXQL 3QIWA 2Z91A 1B4RA 5I2IA 3RVUC 2OS7A 2HN7B 4H5SA 3AM8A 4F9LA 1S7QB 5E95B 1I3VA 4Y19B 1XF4B 4LLWA 3OX8B 2FB4H 1I7UB 2MKLC 2FSEB 2PCPA 3VRLE 1MFBH 2VH5L 5I66B 4LCCA 5DFVD 2H41A 2VDLL 3MA9L 3RWCB 4J6RL 4QRSA 4RA3A 4XP4H 2C1PA 2HRPH 5HYEA 3QQ3A 5AZ2L 2ESVE 2D7QA 3EYOB 4POZC 1UKTA 1N4XH 3MJGX 3X3FL 1NDGB 2X70B 3AY4A 3BJLA 5GHWH 1F11B 1BIHA 3RBSA 3QDMD 4E41E 5CBEA 2WUBH 2KQNA 4GG8B 5CGTA 4XAKE 2NLJA 3DX9A 4NOBA 4JFFE 1ZHLA 2AJVL 2ICWJ 1A6AA 3GSQA 1DSFL 2H3NA 1S9YB 4L3EE 1IM9A 1I85A 1SY6L 2D7PA 4NHUB 4FQHA 1PDKA 2P5WE 5DTFB 1H8OA 5DEFA 3UC0L 1NCAH 1X44A 1W8OA 3WNNA 4ONHB 1IRAY 3NPZB 3W39B 1Q0YH 3WFDL 3PV7A 3ARBC 5D2LE 5DK0A 2P24A 3QWOA 4QY8A 4X99B 1WZLA 1WBZA 4ZNEA 2ENSA 3STLB 3EOAA 2LU3A 3LZFL 1H3VA 1Y6NR 4DUVA 1NCNA 2FB4L 1SEQH 4JDVA 1AC6A 2B0SH 5C0IA 1NDMA 1I1YB 3GHBH 4JY4A 4OFYD 2COQA 5HYFA 1A7BA 1LO4L 4KTEH 1OTUC 4L8SA 5IKCA 2BC4B 4YDVA 4XP4L 1G6RA 4I48B 4PJCB 1H15B 1QYGL 4RFNB 2VWEC 1WZMA 5IB5A 1MI5A 4JLRB 1ND0B 4ODXA 1XGPB 3QFJD 4JAMB 4TVPL 4ZXBA 5F7HA 2VAAB 5BJTB 4XVJL 3KLAA 2Q3AA 3WFHB 2H1PL 2IQAB 4UV4H 3NCCB 4MJIE 4BQBA 4P2QA 3T4AB 3IGAB 5FUOL 3DUSA 4WTXA 1EDQA 3WHE1 4JHBA 1ZLSH 5I17A 1NANI 1V05A 3HCVA 1TZIB 4A6YB 3I75A 4RWYH 4QTHA 1F00I 2MPAL 3P11L 4JHZA 4PYGA 4ZPVA 3C60D 1MJ8H 1XZ0B 2VLJB 3KR3L 2OJEA 3MNZA 2IGFL 4PG9B 1IILE 1BX2B 3QDGA 5SX5K 4Z7NF 1T0NB 1WVZA 3MBXH 1OY3B 4NC2B 5EUOF 2GJJA 3WUZA 2VXSH 1I75A 2YD5A 3BKMH 1R24A 3C8DA 3VFWB 4WW1B 1D9KA 1SEQL 4LFHG 2B0SL 4NNXB 1WGOA 2W65A 5D70H 3TWCL 3RIAK 4EVNA 3AAZA 3W11D 3WV0A 4WVRA 5C0AD 3WS6C 5IMMB 1A6WL 3WIHL 1Q9OA 3DUUB 2FIKA 3QG6A 3TZVA 2GEEA 2AI0H 5JHLH 1I3GH 2HVKB 1DQTA 2BRRL 3TP4A 2O26U 1ED3B 5I9QC 3WNOA 4RAHA 4OAWB 4PJ9C 4Z7WF 4TSBH 1JI2A 2IBZY 3L95B 3PIQB 3EZ8A 3BDBA 4I9WD 5EUOA 5DVLA 1CXHA 1YEHH 3RTQD 4JGUA 3RNKB 3RWHB 3FQUA 5FHAL 4OGXH 2EKSA 4RAUB 5CZKA 2CKBL 1PYWB 2ED8A 4JPVH 4HFUH 5E24E 2EDJA 2EICA 4HKXA 2BERA 4WFEE 3DETD 4M61B 4LBEB 5IQ9B 4C4KT 3KNBB 3RAJH 4RWYL 5D7IF 1PZ5B 1L7IH 3CLEH 4HBQA 1X5XA 4QHNA 2F58H 4JANA 3MV7A 4TSCL 3MRHB 4Z7WA 3V0WH 1JNLH 3WL9A 3OR7B 1BJMA 1AI1H 4ODUB 5ISZE 1AO7D 3WJLC 4PJIB 2HTLC 5GGUB 3ET9F 3RL1A 2VXSL 1JZ2A 4GRLD 3B9VA 3RDTB 2HTKC 3GSNH 4KVCH 1HQ4A 3HZKA 4ZQKA 4WIQA 4YHMH 5F96L 1UJ3A 4F3FA 1XMWA 5D70L 4I18B 1JWMA 5TDPA 4FFVC 3G9VA 4K71C 3EYVB 5F8QC 1UB6B 4OI7A 1DR9A 5LGJB 5INDB 4GBXB 4FQ1L 1M7IA 2AI0L 3V7AG 3O11A 1I3GL 3CUPB 2Y1VA 3P0VH 1ITBB 5D7IA 1CFSA 1CCZA 2XKNA 2VITB 4M00A 4HZLB 2V7NA 5I1AA 4JQIH 4RDQG 2FYYA 5DMJB 1GIGH 5E0QA 4HFWA 1LEKB 4GRWE 4Z0BH 3UTPE 3NH7L 3SDAD 1JNNH 3OGCB 4NKIL 1NCCL 3E3QE 1OSZA 4LHQB 2O93L 5C71A 3OAYH 1AGDA 1OTTC 2ESVD 2W9DH 1GVIA 4YDLC 5E00A 1XT5A 3HE6B 3DV4A 1PX4A 3IDGB 3ROLA 3MLPA 5D2NC 4MDJA 4UUJA 2XIDA 3RVTD 4WDIA 2CDEB 3SDCC 1F58L 3QZWG 3RAJL 1L0QA 3QEUA 1FG2A 4E41D 1I7ZA 4U1KA 4XPAH 1U91B 3NCMA 3QIUC 3VWKA 4U1NB 2F58L 1ZTXH 4OI9A 4XAKD 3CFKA 4G6JH 1TQBC 3V0WL 1AR1C 4KC3B 1AI1L 2DQIL 3QG7H 4X7TA 3TN0C 5I8OL 5HTSA 4R96B 3SKOA 3HMXH 4J7RA 2ZCHL 3QIBB 4U6VL 2VZTA 1BJ1J 1KIUA 3CH8A 3HE7B 4HX1B 4LIQL 3V6OA 3FQTB 4LSTL 4XMKH 3NTCL 3FB8B 3SKJL 4JHWL 1S9KC 5D7LB 2P42B 1K2DB 3MRJB 3P0VL 3IFLH 5GRWA 2P48B 4QRUB 5T1KB 2Q6WB 4LLMB 4UQ2B 4WI5A 4JQIL 4F7PA 2F8XC 5A16A 5KVDH 4G9FB 1OAUL 2WMPA 4Z0BL 3SJVE 3MUY1 4OSUH 5HD8C 1N5YH 1GAFH 4NO2A 3P4OB 2X44D 3JZ7A 3VXRE 3VFRA 4NRZA 5EO0A 3VWJC 1KB5H 1RK1B 1T1XB 2W9DL 3PQYB 2Z8RA 3MV9A 5D6CB 2XYCA 1D6VH 1BFOB 3JTTA 3W2DL 4PJHF 1CFQB 2GCYA 1KG0B 1DQLL 5FHBH 4ONOA 4HIIA 3BP5A 4PJ8D 1AXIB 2YPLD 1TENA 2VMFA 4XPAL 3E1F1 3IYLW 4HKZB 2FH8A 5HHNB 4FQJH 5C9JA 4MJID 4G6JL 1LE9A 5E8PB 3LB6C 1BZ9A 3QG7L 1EFXD 2BDNL 4YWGH 1ZHKA 1TJHL 1GRWA 1A7QH 4WI2A 4N8VG 4ZUTA 2WLZA 4F7EA 4K3GA 1AGEA 1TZGH 2F19L 1ZSDB 4L8BA 1OLZA 4LKXA 4PREA 2XN9B 5I76A 1AGFB 4PJHA 1RJLA 4C54A 3Q5YA 4DEPB 1JYNA 1UVQB 1TJGH 1KPVB 3IFLL 1J8HB 4OZFG 1YEGH 2ZSVA 5DQJB 4YHYB 1FVCB 2UZYB 4FTVA 5DF0A 5T1DH 5C2BH 5BQ7B 1N7MH 3DBXB 1KXVC 5IF0B 5KVDL 1F45A 1P4LB 2AXJA 2AV7B 5F71A 3D2UB 1X5HA 3ECBB 4OSUL 3WEXB 3K8LA 2BRQA 1GAFL 2NY3B 2MOVA 5JOFB 2W0FA 4WHYG 2QHRH 1T7VA 3WFCH 1Q0XH 1EEZA 2IADB 4QCIA 2NMSA 4EBQL 2RHEA 1K5NB 5C7XL 1HN1A 1MQKH 2BCKA 3BP7A 3QJFA 1KBGL 4HLZH 4RNRB 5J9PA 4GLRI 4LVOB 3AB0B 3HI1B 1MEXH 5AEAA 1QEWA 4FQJL 3EBAA 1I9JL 4NKQB 3MO1B 5DGQA 5I1GL 3B9KA 1MCOH 3M1BA 3O4OB 3F12A 1F8TH 2J12B 3V8CA 2O61B 4PPTA 1C5BH 1HQRA 5JIPA 4WFED 4X7CC 1XR8B 1P5UA 5FA3B 4QHKJ 3TCLA 2YPVL 3SCMB 4Y4FA 2MJWA 1TZGL 3QI9A 5I8EA 2ICEA 4IRJA 3EKCA 1WC7B 4PLKD 3ES6A 4YPJA 3BEVA 3R06B 4PP1C 3T8XA 3N1MC 4IM8A 4H88L 1YPZE 2BOCB 2X4PA 2GY7B 4ZMAT 1F02I 1D5IL 4R7DA 5L7XH 3G5XA 3TBWB 1TJGL 3VFTA 2Z4QA 5DJZB 5ISZD 4OZGB 5D1XB 3UDWC 3V6BR 3PDDA 4NPYA 1BWWA 3ILPA 4YAQA 3BW9A 4Y4KD 4RISH 4KZEH 3S96B 4BSWA 2EZ0D 1TVHB 3CXHJ 5EO1B 2X1OA 4R4ND 2AABH 2YMXH 2AJXL 3QO1A 3EYUH 2WP3O 3WJJC 4HXBH 1X5LA 1XIWB 2PYFB 5J8OA 3HZVA 3RWFB 1CU4H 2DM7A 4HF5H 3V9FA 1Q0XL 4XPTL 2Q86B 3RY5A 2EXYD 3CC5B 1XGQB 3EOYG 5CCKH 3HG1E 3MOBH 1MH5B 2LABA 3O2WH 1MQKL 5A2KH 4K7PL 5HI4D 4XNUH 1BZ7A 3CFBB 2ARJQ 5EORL 5JNYB 2DJSA 3BZEB 1ZHBB 3MOAH 4X7SH 2PXYA 5CAYB 4Q9CA 2OTPA 4I1NB 1A7OH 5D1QC 3AGVA 2C3WA 4LCWB 3DXAA 3BIKB 1F8TL 2HAZA 1BBDL 3HC0A 2XPGA 1U3YA 3HRPA 2UVFA 1R3KB 3ARFA 2HT4D 2HLAA 1XR9A 4IIQC 4X8JA 3HNSH 4YFLF 3WIFB 5IB4B 5DI8A 4NZDA 4LQFH 5CIPH 4XNMA 5L7XL 1X5JA 2PYEA 4JFYB 2NPLX 4KAQL 4K2UH 1FVEB 4G6FD 3LSOA 2C4FT 4U6YB 4AENA 1DQQA 1S9WA 3QDMB 4JRXA 5C0EB 1ITCA 1UH4A 1P4IH 2YSSB 5JW5B 2WIIA 5ACMA 5TQ0L 4D2NA 4KZEL 3DGGB 5JHDA 5H2BA 4XNQA 4KRMB 2AABL 3PNWB 2R2EA 3MCKB 1T5WB 1OGTB 3EYUL 3QSKB 5ESAA 4GAYB 3DYPA 4HXBL 5J6GA 1WZ1L 1Y0LB 4GMTH 5EBWA 1CU4L 2W0PA 2X4TB 4WO4C 3CVIL 2RIKA 1C08A 4WV1B 4G8GE 4P2OA 5DRXB 4YHPB 3SDXF 1NUDA 1SMOA 3MOBL 5ILTL 4NSKB 2VDRH 3V2AR 5ERWB 1KTLA 2H6PA 5BOZG 4XNUL 4PV9A 2HT3D 1W0VA 4PS4H 2BOBA 1JHLH 1MRDL 5BXFA 3OXRA 1QFPA 3KPSE 4KJPC 2ZNXA 3QUYC 3MOAL 3VI4F 4X7SL 2W59A 1LEIB 5BZDB 1A7OL 3MCLH 3OJDA 3BGAA 3BP6B 1ORSA 1XGTB 3M45A 3MRKA 4OIIH 1T7YA 3DTXB 1R3LB 5ICZA 3CH1A 4GUPB 4BQ9A 1IKNC 5B8CA 4JPWL 1HILB 3JTSB 4FQ2H 3AU1B 4TULH 3OKEB 2C3XA 3HFMH 1LD9A 1G6RH 4KJYA 4JY6B 4Z7QF 3NPSC 2Q87A 3EJJX 1S7QA 3SDXA 1B3JA 2IF7A 3QFJB 2DLFH 4K2UL 1OP5H 5ABDE 4OD2A 2CSPA 2X4RB 4PJ5A 5BS0A 5I66A 1A9BA 5L8JB 1DLFL 4KDWA 3Q6GL 3DVNB 5L88H 5F70A 4PUBL 2X9YA 3U82B 4AEIH 5SX4I 2YS4A 2W92A 5D72L 2BVYA 5BVJB 3T3PE 3EYOA 3UROR 5DJDA 4TQEL 5T33L 1MLCA 3EYQC 4NGHH 4JG0L 1QHOA 2N7AA 2N1KA 3MCG1 2PKDA 5T1MA 2AQ3A 4ELMB 3K8MA 4X5LA 4KRPD 4JHAH 3OKNA 1AE6H 5KS9B 2VLKA 3H9SE 4Q6IB 5MI0C 4S1RL 2VDRL 3QXVA 2F15A 4HJGB 4WHCA 3H42H 4E5XB 3S36H 2D2OA 1JHLL 1EA9C 4OFIA 2YXFA 1XEDA 1KJ2H 3NOIA 5KSAC 1INEL 2JJUA 3MCLL 3AMKA 4MB4A 4OIIL 1VKXA 3BVNB 4NHUA 1OAQH 4Y5VC 1EX0A 5C0AB 3ORJA 1CDUA 4KROD 5D8JL 4FQ2L 3DX8B 2V2TA 1I8IA 3W39A 2CO6B 2W07A 4YBQC 4MA8H 2NY1C 1CL7I 3WYRA 1H3PH 1HH9B 5GSVB 1NC4A 5GGRA 2UZIL 4KKBD 3STLA 5GGVY 1MCWM 2KZWA 5HHOE 2E9WA 3SO3C 3T1FB 2JIXD 4ZAKA 4U1SB 3BGFC 3GK8H 1MCEA 1P53A 3RIFF 5DR5H 5B4MC 3DOSA 4JZOB 3C8KB 4JZJB 4M9PA 4X6CB 1LEGA 3RTQB 2XRAH 1PLGL 5D1ZD 3PDOB 5HYSA 1MSPA 2QQQA 1ETZB 5F72S 1Q9LB 1H15A 5FAAA 3S35H 5KANG 2VDPH 1UH3A 5KVFL 3BKCL 3IDUA 3SO5A 1FV1B 1KEGH 4Z8FL 3C9NA 2NY4D 3SN6N 1TCRA 1AE6L 4Z0XB 5E2VL 5I8KH 2YN5A 5DVKA 4Q74A 4I4WB 1J9CT 4NNYB 2AJYL 5BMFH 2XQBH 8CGTA 5D7JA 5FK9A 2D31B 2GKIA 2IQAA 2E7HA 3P4LA 3H42L 5HYQB 3T4AA 3BQUC 3S36L 1S9VB 3TVMC 1AO7B 3MV8E 1KJ2L 4GRLB 3MRIB 4XBPB 3ZYZA 2GQHA 3ZKNC 2MWCA 1TZIA 4A6YA 2VE6A 3HLAA 4DTGH 4W4OC 1OAQL 3HG1D 5CD5D 5DVMA 5KVEL 3MR9B 3GMOA 2SEBB 1XZ0A 3Q3GB 4B0MM 2V5RA 4GAFB 3FFDB 2GSGA 2GITB 4X6BB 4DOHE 1NFIA 5DA0B 3FB5B