2ADFL

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting/immune system
molecule keywords Von Willebrand factor
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL01
2W59A 5JPNB 3QUKA 3VJ6A 1EEZA 5FHAH 3T3PE 3DIFA 4LIQE 1MNUL 3TO4D 2VAJA 3IFOB 2FGWL 4I5BA 3P9WB 5I1LB 1J1XL 4IIQA 4JFOB 3S35H 3RWIB 5DD6B 5DHVH 4QHKI 1TJHH 1QSVA 2Y9RT 5T1DL 1KTKE 1FP5A 1U9KA 2FZ3B 3I6KA 1FLTX 1F6AB 4GXUN 4HUVA 1PSKH 2KUTA 1F90L 3T4AB 3OZ9H 4OLZH 3MRDA 1G7LB 2EE3A 4RQQB 5E8EA 1JPTL 5EO1B 4Y1AA 2XWJB 3QHFH 4NPYB 5TE7H 2A9NH 1T83C 4NHCL 4TUOA 1FNSL 3EW3B 5DQ9B 3FB8A 1A14L 1M7IB 5E2WL 4GMSH 5DF0A 4OZIF 3U36B 1N0XL 4R3SB 3H9ZA 3JWNC 5LCVH 4C56D 4PV9B 3SQOH 2A73B 3DUSB 2R2HB 4JZOA 6CGTA 4U1GB 4WV1A 4LPXA 4X5WA 4YHNB 5K9KA 3HC0A 4R4FL 2DWDA 5KOVC 1Y18B 4NNYB 3NGBB 1MLCA 1ZVYA 3N85H 2P7TB 3P73B 1K2DA 3GI9L 3U46B 5DJ0B 2Q3AA 4TOYH 2B1HL 5LBSL 2O5XH 2D31B 2OL3A 3IVKB 5D1QC 4KQ3H 3TA3D 4X7TB 3TBSB 5CSZA 1OGAD 1S5HA 3VI3F 2P5WA 5M7QA 5C1MB 3UBXG 4AIXA 4PTUB 5J12C 2FYYA 2IFGA 4AEFA 4C56B 5IEHB 3BPOB 2FEEI 1J0HA 4J3TA 2ADFL 1EGJL 5KSAA 4CAGA 3VFVB 2R2EB 4LFHG 5DURB 3QDMD 5D6CB 2PCPB 1E4XL 3D48R 3T2NL 3W0WD 3FQRA 2JTDA 4K8RC 1Z5LB 1AGFA 3Q48A 3ULUF 5K59E 4FQCL 2GTWB 4YHMH 4PRNA 2XTJC 3MV7A 4ONOA 2P1YA 3MLRL 1YC7A 1OGAB 1OCWL 2E7LA 5DRNA 4KROC 4K71B 3ROLB 3OAZK 4PTTA 8CGTA 2VDQL 1KN2H 1U8LA 4RFEB 4BM7A 3AC0A 5JW3H 1TZGL 4LLMA 4JM2F 2QKIB 3V0WH 4YUEL 5F6HI 3EO0A 3QDMB 2BJML 4M7JH 3ARBA 1IZJA 5BVJA 2XG4A 4JAMA 2GFBB 1PYWA 3IKKA 1MQKH 4JZNA 4Q0XL 4PJFB 2D7TH 2DQJL 3TT3L 1O5DT 3SO3B 5GIRB 5TDPB 3IYLW 3DSNA 5F21B 4P2RD 4YE4H 4X5XB 2ZSVA 5GGVL 4DKAA 1A0QL 2GUOB 1OT2A 3QQ9D 5DI8B 3IETB 5HHPB 3CFJB 3BZFA 4JHBA 1QTYT 1XCTA 5C0BA 3V7MA 3HZKB 5DRZB 4TUKH 5HYJE 3T0EB 5TE4H 2FX7L 4PJBA 4OLXL 5CJOL 4MNQD 1AGDB 4LDOB 3QG7H 3AXLB 4RIRA 1II4E 5KSVB 5C0AD 1G9MC 1O0VA 5IG7B 2FECL 5E2UH 3TO2A 2ZPKH 4HUMB 2QV2A 5KVFH 3RNQB 4YDIL 3SDXA 1TCRB 1OSPH 2VZ3A 1EJOL 5E03A 2CDEB 3WLWC 5I8OH 4HJJH 5KS9B 2I9LA 3RHWK 3U4EA 4PGBB 1T0NB 2X4NB 3G5YA 4LQ1A 5GRVL 3RUGF 4JDTL 1I1CA 3WNKA 1FYTA 3LZFL 3PWJA 1YN6B 1L9MA 4RX4A 1ZHKA 3KXFE 4XPFL 4G8IA 1BOGB 4L8DA 1XF2A 1NLDH 4RFOH 3JTTA 4JFDE 4Y2OA 5LXGL 4HWNA 1JPST 5C0AB 5ITFA 1IM3B 2B0SH 2EDXA 3SKOA 4Z8FL 5F9WC 2APFA 1YEKH 4NC1E 3AY4A 3EZJB 5GS2D 5LAXB 2C5DC 1BWMA 1T7YA 1YEDA 3FQWB 3VCLB 1HK6A 4FQHB 2ITDA 3ZDYE 4LBEA 4DN4H 4LF3B 3KR3H 1BMGA 5I1AA 1UACH 3IXAB 3DUUA 2P49B 3JV6A 1GGBL 1J88A 5EIIB 3VD3A 5IFJA 1JGUH 1SY6L 4H5SB 2R2CA 5FYLL 4F58H 4Q7DA 1BX2B 2VWEC 5TPWL 2O93L 1LO4L 4HXAL 3FFDB 1J8HE 3HE6B 3IAGC 2Q76B 2VR9A 3V8CA 4PJGF 1LGVA 4JRXB 4P23D 1I1FA 1RZ8A 3ZO0A 5EDXA 3HUJF 5EZLB 2B4CC 2YPLB 4GRLC 3X13B 1QLFB 3K4ZA 4HC1L 3I3DA 1JI1A 2ARJQ 5FIEA 3V0VB 4AH2A 1NUDA 3QG6A 2DAVA 3LKOB 2CKBA 5EOTA 3IJYA 1BFTA 3RWGA 5D7KD 5GJSH 4XP6L 1ZLVH 5BJTB 3P4NA 4LVHB 3L5JA 1NGWA 4CDGC 2PXYB 2ZOKA 3LIZH 5GGSA 1DEEB 3SN6N 4MJ4A 1P7KB 1B2WL 4U0RC 2AXJA 1U8HB 2FBJL 5B21A 1KTDB 4P23B 3BIKB 3HCVB 4S0SD 5F1KC 1WTGT 1MH5A 1KLUB 4TPRL 2EH7L 1BQHA 3MV01 1OTUD 3FT2B 1IC1A 3BP4B 4KJWD 5C0NC 3JZ7A 3JTSB 4L5FH 5GRJH 4YXKH 5SWSE 1AGEB 1BIIB 4OCYH 4C55A 1YNLL 4N0FA 3P40A 3EYQD 4XP9H 5JNYB 4OM1H 2Q8AL 1RVFH 3S98A 4KI5C 5I9QC 1YEGH 5IEKA 1YEIH 1BVZA 4YGVA 5FM8A 1YYLL 4ODBD 4JFYB 3LN9A 1JF1A 5HDLA 4GSDL 2CIIB 3CLFH 2AXFA 3UC0H 3NFNA 4WJ5B 4U1MA 1NBVH 1OSZB 5KANG 1WAAF 2EDBA 3BKJH 3TZVA 2VXTL 1UH2A 4QCIA 4LLVA 3GRWH 2CMRH 1K6QL 2ZUQB 3L3JA 3QRGH 1BF2A 2LVEA 2WV3A 4J3UA 4JFEA 5F8QC 5IMKB 5B4MD 3NA9L 2JCCE 4PJDF 3S6CA 1WT5C 3CFDA 4JFZH 4MMXC 2F54A 1HXYA 5IFAH 1QEWA 4P5KA 4PJCE 1BQLH 4KQ4L 4IIQC 4DN3H 4PRAA 1FE8H 1WC7B 3DPBA 5DHYB 5T5FH 5K33A 2X7LB 4K7PY 2DLEA 3QI9D 4PJ9D 5CMAA 3RAJH 5IHZB 1AH1A 3G6JE 2JK5A 4U1SA 1IT9L 3HS0B 1NCUA 3D39A 4XNUL 1NL0L 3RX7A 3LQAH 4YHLL 3MV9E 1Q9OB 2XQBL 2FO1A 4DZ8B 1F4HA 1KPRA 1N59B 3CNKA 1IQDB 4KAQL 2ITCB 3VRJA 5F96H 3AU1B 5KZCD 4XBPA 3WFBH 1FGNL 2X4TB 2K3TA 4ISVA 4QHUB 3B83A 5DZLA 5DJXB 3OR7A 4D9RD 1P2CA 5DEGB 5T33H 1XGPB 4X7FC 3GMPB 4HUUA 3SGKA 2Y7QB 2FCBA 2NY5H 4HIJA 5E7FA 1W0WA 3QI9B 4YO0A 1RUKL 2C4FU 1JWUB 3D3VD 4LLDA 3TCLA 2OTUA 4PJEB 2VAAB 3DECA 3CDFA 1A7OL 4PB9L 4XC1L 4WWID 1B3JA 1ACZA 5FDWB 2P47B 3ZKND 2D9CA 3PWPD 4M5YH 2YUVA 2C7UA 3IDXL 4Y4HC 1TZHA 1IGFH 2LV4A 4NZRL 4K7PL 4HIHA 4KK6C 2H1PH 2P8MB 1CGWA 1GH7A 1RK0B 3OXRB 4FN0A 3GMLA 1PZ5B 1X5ZA 1ZLUK 3GSVA 3UROR 4P46C 4HIXH 2DIJA 1E6OH 3NH7L 4MDIB 1O7VA 1T20B 4O51B 2N7BA 4B7IA 4Y4FD 3D3VB 3IFLH 2R1YA 1INQA 5J6HA 1T1WA 4XWGH 3BFOA 3ZTJG 1C5BL 1URLA 3QZWA 4Y2DD 5I1IH 3KWWA 2BNRD 7FABH 2XYCA 1CL7L 2CK0L 4GAFB 2QSTA 1CDGA 3LMJL 3PWPB 2MNUA 1K8IB 3KPTA 5FV1L 4UIKH 3L3OB 3T2PA 4GAGH 5CEZD 2OLDA 4U6VL 4ZUWB 5FO7A 5I16A 5DK2A 1PEZA 3QEHA 4K9EL 4FHBD 1H5BB 1K3IA 1ORQA 1VPOL 4OZGB 4YZFE 4XP5H 2OR9L 2RFXA 2QQLL 2IQAA 5D7JC 1QR1B 2E7BA 5DD5L 1U8MA 2NTFB 1QFWH 3MJ8A 1VENA 4YPGA 1RZKL 2DKSA 2IWGA 4Y5XC 1T1XA 4U3CA 3ARBC 3NMEA 4I48B 1T66D 4Y2DB 4YAQA 4QRTA 15C8H 5ESVA 4F15C 2BNRB 1EK3A 1MAJA 4G6JH 5I8CA 1BF8A 3ARGB 4PJAB 1U6AL 3GJEA 2F74B 1W0VB 5E6ZA 4FFYH 2HH0H 3KPPA 2P42B 5HI3C 2VR5A 1A02N 1G9EA 1FL5A 1TFHA 1OPGH 3ZYJA 1ZT1B 3PHQB 3L5XH 2H26B 3QNZB 1CZ8L 3MLVH 2FD6L 4HWBL 4I18A 5MERB 4TVPD 3UTTE 5JXAH 4K8RH 1BZ9B 4CN6A 3L3DA 2KH2B 3RPKA 2DJSA 1X5YA 2VSDA 5CEXB 4ZAKC 1J1PH 1OM3L 4WCYH 4TULL 1NFDA 3JV5A 2Q7YB 1CT8B 4EN3C 2H32A 1E4WH 4HD9A 5HGHA 2BY0A 3GSRB 3I75B 1CFSB 4LMQI 5BS0A 4XAWH 4ENEC 5I76A 3P4LA 4P2QA 4EDXB 1YC8A 4UILL 4QHKJ 3D0LB 3OJVC 4JREB 5B39B 1YJDH 4KRNA 4FMKA 4YFLI 4HJ0C 4RDQG 4ZDHA 4NQDA 4S1SH 1DR9A 2BVPA 1XH3A 4OCRH 4M3JA 3ZE0E 2BY2A 3L7EB 2VC2H 2Z93B 3AY4C 3ZHKA 5J89A 2WANA 3DX9B 3UJJL 1KCVL 4G3YL 3SY0A 3BW9A 1EHNA 3WV0A 2VDLL 5KSBB 1KEML 4O58L 1NLBH 3KJ4B 1F13A 4U2ZA 1V7MH 2WIMA 4JFOA 1M71A 1XIWA 5IMOA 4APQA 4F2MB 3WIHL 4OI7A 4PJHF 3WO3B 4E5XA 3QUYB 4XPAH 1KIRA 5I73C 3UO1H 4JGJA 1DUYB 2GIYA 3KXFD 4MLSA 1F6AA 1QLRB 4F33B 4UINL 3MV8D 4LVEA 3VXRA 3BT2L 3RI5K 5F3BA 1CFQB 3O3BA 4LSDA 4LSTL 1N5AB 4Z77A 5CKGA 2B5IB 1GPOL 3TO4A 5DQ9A 1OAQL 4GXVH 2L0DA 3WD5L 3U36A 2EH8H 4KK9D 3T65B 1A1MA 4OGYH 3B9KC 2A73A 2HFGH 5DC0A 3PL6C 4OD2B 3HZYB 4OGXH 1GXEA 3KXFB 3QFJD 1R5WA 3OKOA 4DGYL 3MV8B 5EWIH 4NNYA 2B2XH 4IDLA 4DK3A 4UQ2B 1EVTC 2W9LA 5DJDA 5AZEL 2V7NB 5IB4A 1JBJA 3U82B 2OSLB 1R24B 12E8L 2RJMA 1MPAH 3ARQA 2LE9A 4X7TA 4YDVA 3DV6B 4G9DA 1QRNE 3QIBC 3MRQA 2RIKA 3IDGB 3CDYA 5GISH 1XGRB 1Q9KB 3RIAF 4RDQF 2IGFL 4GW4B 1EDQA 5J06A 4TTDC 5L2KE 4MA7L 3BH8A 2OR7A 5BMFH 3WXVL 1FFRA 1KJ3L 1SJVA 4O5LL 4RFNC 5DJAB 2NY1D 4I3SL 4LHQB 4KMLB 2KL6A 3W9EB 1MCOL 4WU5A 3MXVH 3S37H 2P43B 3NCYP 5ILTH 4HWUA 1J8HB 5IB3B 4D8PB 1ETZA 2MKLC 4RGOH 4YBQC 2GTWA 2WUCH 3WFEH 2IFFL 3ARDC 2I9TA 1MHHB 1ODAA 4O2CB 4F9LA 3DI2B 3TA3A 3M1BB 3TZVC 4XP4L 4OFKA 1FNAA 3QXAA 4MD4B 2E9IA 4Q58C 3ROLA 1JGEA 4XRCB 2X1XR 1NAMB 3C5SB 3V6ZA 1M7DB 3OB8A 2QKIA 5BXFA 1FPTH 1Q94B 5CBEB 1CDCA 4OF0A 5E95B 1QLEH 4XXCC 1FV1B 5F44A 3GM0A 2NY1B 2YWZA 5I1CH 3W0WA 3BGFB 1NSNH 1A6WH 4AEIL 1V7NL 4JZJC 1I85C 2GFBA 1R5IA 2DQHH 1KXTB 2IPKA 2BRRL 1NPUA 3HTLX 5E00B 1BD2D 5J13B 4PJ7A 3RZCC 4LARL 4XWOC 5TDPA 3D85D 35C8L 3VXSD 2VE6A 4M7KL 1MFDH 3WJJA 4X5XA 3V6OE 2O5YH 2I27N 2PYED 5D7IE 3IETA 3CFJA 4J3SA 3C09B 1WICA 5D1ZD 5LGJB 3MRJB 3BZ4B 4U1HA 2K7QA 1X6NA 3G6DL 1A6AB 3AM8A 5LGHH 2X1PA 4YX2L 3IJHB 4J2XA 2F8OA 5DVLA 4OCXH 1EH9A 1J18A 2VZTA 4LHJB 4M48L 1KCRL 3OPZL 3V4PL 3CVHL 3F58L 1QBAA 2CLRA 4FXKB 3D85B 4NOBA 3HZMB 3PQYE 1X4ZA 3DXAD 3HLAA 5IQ7H 4P2RA 1LEGB 4MQXD 4JKWA 4M1CD 2D03H 2G60L 2PYEB 1KPUA 4OZHB 4QRRA 4LLWB 2X4NA 4HBQA 3PG2A 4BH7B 4DQOH 4F7EB 4PV8B 4PRDB 3QWQB 3FRPG 2R69L 2H41A 2LTQB 1RU9H 2VXUL 3DYPA 4MNQA 5BQ7B 3VFTB 1IAII 1T6VN 2HVKB 2YN5A 4MNHA 1I1AC 1UM6L 5CAYB 2DDQH 1KYOK 1H3PL 2CIKB 2JCCB 4LVOB 1IM3A 2J8UA 1G6RB 3W39A 4HG4K 3KNBA 3QNXA 2J8HA 2R1WB 3OKLA 5ADOL 3EOTH 3HMXL 2HTLC 3ZDXF 3DXAB 3W2DL 1MELA 5ECJE 4HHAA 5B38B 4LF3A 3IS0X 3HC4H 3RBGA 3N1FC 1I3VA 5EIIA 4XNMA 2I07B 1IGMH 5TH2A 2AABL 4F9PC 3R1GL 3SCMA 3ARPA 1IBGH 1BEYL 4P9MH 3F8UB 2ZNXA 1I7ZB 5T1MB 5JHDE 3AMKA 3CVIL 4NM4L 1BX2A 4HV8B 4P57B 1TENA 1PKQB 2VXVL 4MAYD 1S7WA 3PWLA 3MRNB 1MRFL 3HE7A 5D1XD 3GMOA 2OQJB 1IGJB 1VEMA 3MRPA 3ZSSA 1PG7W 3TV3L 1SM3L 3TESA 3BEWA 4HS6B 3FRUA 4G80B 5EZLA 4KHXL 1J9CT 3L5HA 1UC6A 4Z18A 5KVEL 1W72B 5E0QA 3QSKB 1J05A 2PNDA 3VDCA 3O2VL 4IOIB 4UT7H 3RKDD 1S7XB 1INDH 1SVCP 4HIEB 1JRHI 4OLYL 1IZKA 4ELMB 4OZIE 3KPSD 5BJTA 3ARFC 4KWUA 5KOMC 1ZMYA 2QQQA 1LNUA 4M3KB 4MAYB 3SDDD 2V5RA 2YKLL 5DD3H 3SDCC 1AKJA 1P7KA 1ZLSL 3LSOB 4XNZC 4N0UE 2IMMA 3P4OA 1KTDA 4RGNE 3DMMD 3BIKA 3HCVA 1CFTB 2AJZB 2E8ZA 3F7QA 3L3KA 4HF5H 4RAUA 2XZAL 3BPCA 5IHBA 4KI5F 2EECA 2VDKH 1A2YA 4TUJA 2VH5H 5HHVH 4UDUB 5AD0B 1S7TB 2B1AL 4Y89A 2DMBA 2EDDA 4H1LB 2AVGA 3L3IB 4X6CB 3VI3E 2BNQD 3U9UB 5JNYA 3KPSB 4BSJA 3VFSB 3CMOH 2DTMH 3SJVD 4JLRB 4X98B 5JPMB 3F12B 4JFYA 2DLFH 2ZKHL 2CIIA 3TM6A 3PABB 1RURH 3IXTB 4XPBL 4XP1H 2JE8A 1OSZA 1KCLA 1M05A 1HN1A 5HJ3B 5IHUH 5AEAA 4UNUA 2FJFB 3TT1H 4X4ME 1IC7H 4RZCA 1EGJA 4KPHL 2XZCL 5I0ZA 1DDHA 1BOYA 3O0RL 1ACYH 5F88B 4DKFL 5IMKA 1ZLVK 3BVNA 3BIBX 3CXDH 4F7CB 2VDNL 3ZE1F 3QPQD 3QPXH 1T03H 1LP9A 3P30L 5CZXD 8FABA 5IHZA 4GQ9H 2G5BB 1QBLH 4R8WH 4NFBA 1Q72L 1EPFA 4NWUH 4YHOL 2X09A 1CG9B 1I8KB 3PJSA 2VXSH 4LRIC 3STBA 4NHUB 3KYNA 3MXWL 1RZ7L 3LKSB 3AU1A 2ICEB 3S96A 1JYNA 5ENWB 3P9MB 1HINH 1A4JB 3I6LD 5DJXA 2M26A 2X2YA 3T09A 4HIIB 4LSVH 3MREB 1EZVY 3QUXC 1FNGB 4WNQB 4K94L 3UJTL 2UZIH 4OKVB 3B43A 4PJ9A 1T3FA 3Q3GB 1RUQL 1N6QH 2HP4A 1JWUA 4PJEA 2VAAA 4U7KA 3RX8A 3MZTA 1FJ1B 1XF4A 3LN4A 2XNAB 1MFBL 5FDWA 3B8YA 1L0YA 5FYJE 2ZUWA 4OI9A 1D6VH 4JN1H 2FBOJ 5IVOA 3TBWA 3O2DA 4XMPH 2Q8BH 2VISA 1KB9K 3V95A 1NUFA 1IAOB 1S3KH 2N4IA 3RUGE 4EXPX 1RK0A 4OCNC 4CKVX 1IEHA 4LKCB 4JFFE 1H3UA 3WFHB 5T5NG 1JF5A 3AS3A 4ESKA 3EOBA 1U41A 2RHEA 1IKNA 4MJIE 1ES0B 1RJZA 2YD9A 3VMNA 5HXMA 3D3VA 2X4QA 1ADQL 1CDJA 5EZOL 3A6BH 2VUOA 4M1DL 1L7TH 3OXSA 4R7NB 4F80A 3KHOA 1MHPH 2EIZA 3VGAB 3FO1A 4RMRA 1U3HA 4WWKB 4ERSL 3PWPA 4DTGH 2FGZA 5E08H 3L3OA 5GGTH 1YEEL 1YPZF 4F9LC 5HHXH 4RWYL 1TVBB 4LEOB 4XCCH 3TYGH 5GRUL 3VA2C 1H9VA 4JRYA 1I4FB 3ME0A 2L7JA 5FA4B 3VD5A 2VRAA 4JFHD 2WUBL 4JKMA 3EO9L 3U4BL 4NUGH 1JP5A 1IE5A 4Y4FA 4A6YL 1MJJA 3BN3B 1JWSA 4Y2DA 4CBPA 3UTPE 2BNRA 2O5ZL 3ARZA 4UV7L 3TPUA 2FDBP 2UZXB 3CDGB 4Y0GA 5ACZB 4LAQH 4LPVA 5TE6L 1OAXL 3BN9C 1JHKH 3R06A 3QIUB 5DMIL 1QPXA 4CMHB 4HK0A 5ALBH 1IEBB 3MYZA 1CGSL 1SBSL 4EBQL 1F4XL 1ZA3B 4OQTH 3C6LC 4KVCL 4FTVE 3KAAA 4PJBF 4P4KC 1VERA 1SMAA 1ZT1A 4I13B 4G6KL 3PWUA 3L3HB 3DX6A 5EU4B 4Z7QF 5DSCB 5L2KB 4QYOB 3H6JA 3SDXF 2Z8RA 2AK4D 1HZHL 1N6VA 5GHWL 1CGXA 3VFGH 4KRPC 3FTGB 2C4FT 2VLRE 2P8PB 1Z2KA 4FQ1L 4E41E 3LEYL 5T5NF 1CT8A 3CH1B 5JW5A 5L7XH 1BQHG 3WFDH 1CFSA 4OF7A 1UENA 5HI5D 1JE6A 3K1KC 4MWFA 3RGVA 4EVNB 4EDXA 3WLBA 1JGLH 1A7RH 4GKOA 2ADJA 3REWB 4W4NA 1B9ZA 5FHAL 5TF0A 1V3KA 1PX4A 1U8OB 1KLFA 2P4AB 3AAZA 2VB5A 1HSAB 4QY8A 5KTEL 3LS5H 4QHLB 2CK2A 5FYKE 5HYFA 1BGXH 2DRUA 1B4RA 1VB9A 3I6GB 2P24B 2CLZB 5EO0A 4Y16D 4XPGH 4XT1C 2YRZA 2DD8H 1F42A 4OGAD 1GSMA 1PSKL 1DN0A 5GRZA 3FOMA 3OZ9L 2EICA 2JF1A 4OLZL 4X8JA 3RVTC 4Q74A 3MA7B 3DX7A 5CZVH 3EJZC 4AYFA 4ODXA 5HGGS 1BJ1J 5C0GA 5EUKB 2A9NL 4Z7NF 4DUXA 1NJ9A 3SCMC 1VKXB 3S7GA 2D0GA 5GS0C 3W82A 5DK0B 5LCVL 1OARH 5AYUH 1JZ8A 3VXTB 4U0QB 1EFXD 3K2UH 3OGCB 4Y16B 5F1NA 2ICES 4F37F 4J1UB 4OBSA 1N5AA 4B50A 5LVEA 3N85L 1RULH 3X12B 5BRZE 2RBLA 5I71B 1KJ2A 3PQYB 4TOYL 1CR9H 4F8QA 4KQ3L 3MTRA 5HYSA 2VIRB 3RWJB 3OJDB 3QUZD 1WIOA 1C7TA 3S3PA 4GG6A 1KIPA 5MEOB 5CP7A 3OKEA 1EFXB 1N64H 1WCQA 1X5AA 2ZUVA 4YR6A 5BW7A 3MV11 1FSKB 3B2UC 3C2AH 1EO5A 2V7NA 2OSLA 4IJ3C 5GGRB 5GZOC 4MS8D 1WJ3A 3OAUH 1NC4A 4U6HA 1B0WA 3IDGA 2BK8A 3VG9C 3K3QA 1KB5H 2XIDA 4GW4A 3CC5B 1WZMA 4P5TD 2EDQA 1XGYH 3EYFA 1WF5A 2ERJC 3QH3A 4PG9A 5I1GL 2PW1A 1CI5A 2J12B 4YDKH 3H9SD 3QFJA 4UOJA 2CLVB 3V0WL 5JHDB 4CVXA 4D9QD 1A1OA 4MXWH 3RWHB 3RJDA 5FF6A 1PG7H 2VQUA 4M7JL 3WHXB 4DVBB 4NKDA 4IRSD 4DWHA 3LEXB 1CLCA 3VFWB 3QZWG 2W0LA 4LIQL 4O2CA 2AJYH 3M1BA 4HX1A 1BZ7B 5EOQH 1Z6JT 2BVTA 1S9YA 2D7TL 3F7RA 5FYKH 5E6IA 5F70A 4ZXBD 4XVUC 1NAMA 1VACB 1HQRA 3LHPH 4YE4L 4MD0B 3N50A 3QCVL 1M7DA 4NRZA 4WW1B 5CBEA 3WNOA 1CCZA 5C0DA 1RK1B 2ZG3A 3SGDI 1NCDH 1XF3B 2CH8A 4AENB 2Q86B 1VGKB 3Q6FA 3TN0A 4OZIB 4TUKL 4LLQB 3GIZH 4UDTB 4JY6B 5TE4L 3BPNB 4IRSB 4HFWA 2ZUSA 5E00A 4LOUC 1PY9A 1X3DA 4HWEH 5A3ID 5CKAA 2BY1A 2VN7A 3H9HA 3RVVC 5ICYA 1YY9C 3ZYIA 4OV5A 5KVFL 3ESVF 3G5ZA 3ULUD 1OSPL 3GSNH 1CWVA 2V17L 3MRJA 4WO4D 4MDJB 3MODH 4M7ZB 3IJHA 3ARSA 2A6KA 4WGWB 4OCWH 1A7PH 3D9AH 5JOFA 2HT2C 5IVXB 5A2JH 3ARUA 1M7XA 1NLDL 3ULVF 4RFOL 1BD2A 5AWNH 3TFKD 3VXSA 4JG0L 4Q6YA 2AV7B 4PGDB 1T0PB 3B9AA 3TH2T 1JUFA 4OZHA 4G6AC 2HFFB 2LQRA 5E4EC 4HMDA 5D1ZA 4DN4L 2D0FA 3UMTA 1UACL 4NQEA 4O02L 3U0TB 2SEBA 1JGUL 1FNEB 2YD5A 3CCHB 5FB8A 4YPJA 4F58L 2Q3ZA 2A0LD 3VFNB 5CEYA 4JPIA 4GUPB 2HVJA 2R1WA 3PV7A 5DTFA 1RZIA 3U6RB 3REVB 4CL7A 1KCUH 1DFBH 2YUXA 3RWCB 1HQ4B 3HRZA 4QF1B 4UBDD 4L8SC 3BRGC 2NY4D 2O61B 4YHYB 5DJ6A 1FL6B 3UTZA 4FFZH 1FZOB 3U0WH 1CD8A 5F7EH 3TLRA 2WLYA 3IDNB 1F3DJ 3NPZB 4YHPA 3HG1D 4YEFA 3DVNA 5TGBB 4N68A 4DJMA 1B4JL 4HV8A 1EAPB 3W9DB 1JGVH 4HLJA 5C0IB 1OAKH 1YYML 4PJHE 5FUOL 5C08E 4YFDB 5JA8B 4YWGL 1G0DA 3N9GL 3EO1A 3EYOB 5GJSL 3MRNA 4J4PA 1NFIB 1VFMA 4ZFGH 3EBAA 1VADB 3Q6GH 4HGKC 2OQJA 3SPVB 2XY1A 4QRSB 1MHCB 4U1IB 2NXZD 3RIFK 5DEFB 1I1YB 3IS1X 3VE0A 3L5IA 2DQIH 4HS6A 2NY4B 1AQDB 1BJMA 4IMLB 3WIHA 2H2SD 4QNPF 3KPRE 4MHHI 4RNRA 4OFDA 4O4YH 3MLSH 3UBXB 5EN2A 4IOIA 4HUWA 1S7XA 4DAGH 1XR9A 3QDGE 4BFBD 4L5FL 5GRJL 4W81A 4ZD3H 5F7KC 4JQIH 4XC3L 1JIBA 4OCYL 2EYSA 3RUGB 3UPRB 1S9XA 4JO4H 4G5ZH 5E5MB 2I26N 1CLYH 1RVFL 1FZJA 2Y5TA 5D1XA 4JFFB 1YEGL 1Z9OA 3RY6A 4S2SA 5SWZA 4X4XB 1N6UA 5D5ME 2G2RB 5DO2C 2NXZB 1NFDF 3BZDA 1QSEE 1X5FA 2AJZA 2WQRA 1M6OA 3MRHB 4XAKE 3CLFL 1R0AL 3TP4A 3UC0L 3C60D 1NBVL 4F57H 2VDOH 5D7LD 4Z95H 1UKQA 1S7TA 5IM7A 1LO2H 5GZND 2CDGB 4H1LA 5MI0B 2VQ1A 4ORZC 3GRWL 1OB1A 2CMRL 1QBMH 1OGTB 3QRGL 3RGVC 2I5YH 3SDDA 1OLZA 2CSPA 4JLRA 4X98A 2J88H 4PRBB 3TBTB 5J1SC 3HRPA 4JFZL 3DMMA 4XXDB 1OOAA 3GEWB 3PABA 5IFAL 4DN3L 1BQLL 4JE4B 3IXTA 1FE8L 5CGMA 5T5FL 1FVEB 3TNNB 2VZ1A 2FJFA 5J3HC 4FG6C 5C70A 1K8DB 3C60B 4PJGB 4TNWF 4AEHH 2HJKB 4U3HA 5D7LB 5C0FA 1QFHA 3JWOH 1Y6MR 5I1JH 5ANMB 4M7LL 3WJLC 2VLRD 2BNQA 3HUJB 1QO3B 1U8KA 2NNAA 5C7XL 2NY3B 1PY4A 5F96L 3BQUD 4WFEE 3WFBL 1KULA 3SJVA 3FFCD 4QXTA 3KPQB 1YN7A 4QGTA 3FT4B 4FTVB 3IB4A 4ZOEA 4GAJH 5T33L 1CD1A 2Q20A 4EIGB 3DTXA 2NY5L 4PRHD 4QKXB 4X4ZA 1NGZB 4G8FB 2J5LC 5EFIB 3IKCB 1ZTXL 1GGIH 4NHUA 4UQ3B 4Y4KD 2OJZH 2VLRB 4PJ5D 4KGJA 4YDLC 1A4JA 2QQKH 3D69A 1VFBB 4HLZH 4MA1C 5D2NE 4HIIA 1IGFL 4NN7C 4DFIA 3MREA 2NXYC 2H1PL 1F97A 3FFCB 5D93C 1DQMH 4TYUA 3BESR 1R3LA 3VG0H 4GW5B 4OKVA 1DP0A 4OUOA 3QUMB 5TQ0L 4NQUA 4HIXL 3G5XA 5TDOB 4EI5C 3LKPB 2R8SH 1I9JH 3VFOA 3TIDB 2DQFB 5HGAB 5JUEH 3DJ9A 1BIHA 2QADD 2XNAA 3PWNB 2CDFB 1F3JB 3BRDA 5KAQG 2HFTA 4KXZH 4G8EB 2QSQA 4FQIL 5I1IL 3L7FB 4OLUH 4Y4KB 1T5XB 3RRQA 1SBBA 3IFNH 4YBLC 5DQDH 3SKJH 4PJ5B 3W11C 7FABL 4GW1B 1C1EL 1IAOA 3OX8A 1I7UB 2Y6SD 4UIKL 3RKPA 5FA3B 2CRIA 5F6IC 5H37G 4GAGL 4G7YH 1TMCB 3V9FA 1ZEAH 2ZCHH 1AC0A 2BOCA 3MQIA 2DL2A 2HT4D 4P4RA 4YIQB 3IU3B 3OKKB 4UMGA 4XMLH 5A43C 2E6QA 4MQSB 1NGXB 3STLA 3E2HB 5BV7C 4PJDB 4GS7B 5EZIL 3EJYC 4CMMA 1QFWL 1HHKB 2NY6D 2QADB 4JJ5A 5HD8D 5C9JB 3ZDXE 1WBXA 4GO6B 15C8L 2DQGH 2W0KA 4G6JL 1G6RL 3EDJA 3EHBD 1MNUH 3VXME 5JORB 2ATPB 3C5ZD 1TVBA 4X7EC 5JIHA 2FGWH 4Y5VC 5J57B 4RMWA 5EB9A 5E6IC 4FFYL 4TNVK 5K9OB 3PP3H 5FA4A 5BRZB 3SBWA 5F93C 5T1DH 4NQVA 3RL1A 4KJYB 2NY2D 5KG9B 5FOBA 3BSZH 1CDYA 4PGCB 4YLQT 2NY6B 3TN0C 4OCSL 2YD4A 1HILB 2P5ED 1VDGA 5JHLH 1JPTH 1R3KB 4K9EC 4WFHD 1LEKB 2VLJE 1CVSC 3MNVA 3RNKB 4NHCH 5JXAL 1FNSH 4E0RA 2X4OA 3QNYB 5E8PB 1A14H 5FAAA 4Z78B 1N0XH 4CW1B 1ZA3A 4N1CA 1CK0H 1IAKB 3GIVB 1RZKC 3FT3B 4N1HB 3E0GA 3HPJA 4PB0L 1BWWA 1LEIA 1IGYB 2Z92A 3QHTC 1J12A 1NANI 2NY2B 1NGPH 5KAQF 1S7QA 1ZVSA 5F7FA 5T3XE 3MRIB 1OP3K 3RWDA 3CFKB 1YJDL 2P5EB 3FTGA 4GT7A 2P8PA 3MBEB 1WITA 2OI9B 4S1SL 1X6LA 3MACH 3CH1A 4OCRL 3FCTB 5K9QI 3CFEB 1I7RB 1NCWL 4HEPG 2EKJA 5HDOA 4LPCA 4EVNA 4Q2ZA 2IBZY 2CGRH 1E4XH 2J8UF 1V7ML 4WY7L 2XN9E 2YSSA 4TSAL 2AK4A 1L9NA 1TTUA 5ID1A 4P2OD 2DS4A 4XPAL 3UO1L 1FCGA 4Y5YC 2UY6A 2F53E 3I84A 2NYYC 1KXVC 3MLRH 4XBGB 2NZ9D 3FO0H 1KF9B 3K1DA 5BCAA 4XX1G 3O4OB 3LDBC 2WWKO 3O81A 4IRJA 1TIUA 3DUHA 3VXOB 1TZGH 3VXQA 2PTVA 5EUKA 5I2IB 4IS6B 2C3VB 32C2A 3GI8H 4OLEA 4U6YB 1VKXA 1U8PB 3ZE1E 3IF1B 2EE9A 2P48B 3AB0B 5E99H 3X14A 5C92A 4OZFH 4OGYL 2E8YA 4YXHH 1H8NA 1HH6A 5E8OB 2HFGL 3VXTA 4J4PC 4WDIB 4OGXL 4Y1AE 1E28B 1ZS8A 4J1UA 5EWIL 2WWKT 3B6SB 5I1HH 5GGVH 3DVIA 5JR1H 1TPXC 2H6PA 4WI6A 2V2XB 2IALB 5I19L 1MPAL 4BSVB 4UT9H 1SEBB 4KK5C 3H7BA 2FX7H 5EC1B 5CJOH 5JOEA 3RWJA 3OJDA 3O2WH 4FMFA 1Y6KR 5L8KB 1E27B 5EULV 3TIEB 2EIBA 1EV2E 3MUJA 1CXEA 4I77H 3T4YB 1EFXA 2FO4B 4UTAH 3O3DA 4G8GA 4YDIH 3TCXA 5J11C 1UWXK 4NNXB 2EDRA 1S9WB 2GJ6D 5ILTL 4LNRB 5GGRA 3QDHA 5T3XH 4RGOL 1S78C 3NZ8A 5JDSB 4XCYB 1A21A 3WFEL 2FR4B 4LSQH 3LQZB 4P59L 3VFMB 1A4KB 3CC5A 2V5TA 3QR2A 4HBCL 5D72L 3UBXI 2H8PB 3QUZA 1X44A 1F3RB 2G9HB 4V1DD 5DYOB 4Z8FH 1FPTL 1A8JH 4NJ9H 3SKMA 4AK1A 4XB7A 4B41A 4Z0XA 3CXHJ 3EDEA 4I3RL 5I1CL 1ZGLB 4PJHB 1A6WL 5C08B 3LKNB 3MV7E 4HPYL 2GJ6B 2CUMA 4NO0D 3OKDA 2NW3A 2DQHL 1KEGL 2IANE 5CBAB 2XA8L 4JHWL 1ND0B 5D1QD 3BJLA 4OCMC 5IF0A 1YPZE 3QEGH 2W9EH 4P5TA 5CIPB 4MD0A 5TPWH 2BHZA 3MGOA 1LP9F 1LO4H 2A74A 4LSPH 4JFQA 5EORH 3BKCL 1XF3A 5IROA 4YHIA 3H9SA 4NBZB 4AENA 2H3NB 3KYMA 2Y25A 5LGHL 1IAMA 3O6FC 2C3HA 5GSRB 1U93B 2J6EL 5J9PB 4K8RD 4OCXL 3JV4A 4IRSA 4NQCA 4D0DB 4NO0B 2XZZA 5EZJB 3MRKA 3VRIB 2NY0C 2XTJD 3SGJA 4R2GC 4ZXBA 4FQJH 3O3EB 3B9DA 4N1EA 5IQ7L 4KROD 3FOLA 5C0BE 2R0WH 2D03L 3D25B 4N0CC 4O2FA 2MHAB 2WW8A 1KELH 4DQOL 2PTUA 3ORJA 3QQ4B 4ZUUB 1MWAB 1YDPB 4I2XE 1TLKA 4PJEF 3F7YB 2YPKA 1HHJA 1HCFX 5IVXA 5CGYC 1HDMB 3SDXE 2FB4H 4TPRH 2EH7H 2N56A 3VA6A 3EGSB 4PGDA 5B8CA 3E3QE 4NGHH 1FYTE 4JCMA 1AGBB 1AO7D 2Q8AH 2ZUYA 4WO4A 1WWBX 5HYEA 3VWJA 3HC4L 5B3NA 1VSCA 3U0TA 3FB7B 4ODWB 1IGML 2VITA 2HN7B 1AD0A 1KJMA 1SJEB 2HFEB 4ODSL 4AT6A 4P9ML 4GSDH 3DBXB 4DFHA 3U7WL 2DKMA 3L6FB 1NBZB 2A9ML 4H8WH 4PLJC 2E7HA 4X83A 1U3ZA 1G7IA 4YGAB 3P9LA 5DVNA 3N1QC 2O61A 4L9LB 3FKUS 3WLWD 1NAKH 1K6QH 3L1OH 1AD9B 3STZA 2JIXB 1AO7B 3NA9H 5GGUB 2EO9A 4G9FA 5DHVA 4X6BB 3WNMA 3BWAB 1OF2B 1SHMA 4Z7NE 1ZHBB 5HYQB 3BUYA 4RBPK 4UT7L 1INDL 1DQTA 2AJVH 4PGEB 3VGDA 5D2NB 5TDNB 4ZNEA 3BEVA 4U1JA 5F97E 2PW2A 3QWRD 1NL0H 3QJHB 4YK4C 3BO8B 5F1IB 4ELKB 4EJ1C 3D0VB 5DD3L 1MHCA 2XQBH 3Q5TA 4EEEA 4WU7B 1I1YA 5DWUL 2ICCA 2QQNH 3RU8L 4JRWA 1MCEA 4ZG1A 4AJ0A 1F4YH 3HNSH 4KAQH 4CU6A 5EBGA 1QACA 1G9NL 2EC8A 3V5DB 2HRLA 1U3YA 4S1QL 4BK4A 4CN4A 4HF5L 3HG1A 3GGWB 1ERNA 2GT9A 5BOPA 3QXTA 4LLUB 3LCYA 3D18A 5T1KA 2VH5L 4NNPH 2AXGB 3VGFA 2CJUH 1VEOA 3NCCB 3VMOA 4ZYKA 4RMQA 5HYSG 1UJ3A 1K4CA 2OJEA 2OTWA 1T1YB 1A7OH 4NRYA 3CMOL 4X4XA 2IADB 5CZKA 4PB9H 3VFUA 4XC1H 1FG2A 5BV7H 1NH6A 1T89C 4ZSOA 1D6EA 2DLFL 1X4XA 3IDXH 4KKCD 4NZRH 1DLFL 4GRLD 3OSKA 4EUPH 4MA8L 5IHUL 5I6XC 4L29B 4BSWA 2R29H 4RSVA 3RVWC 3TT1L 4MJ6B 3FO9B 2CDGA 1IC7L 1LO0H 1T4KB 5KSUB 4HWZB 1A1NA 1ACYL 5HVWA 5EO9B 1GZQB 1BECA 3TBTA 2XZQL 5T3ZE 3U1SH 2DM2A 1CGYA 2NX5D 4R4BB 1FNHA 3GKWH 1SYVB 5E1AA 2OYPA 3T0XA 3JUZA 5DJYB 2B20A 4J7RA 5F7WC 2Q6WA 4YHZL 3NGBC 1FVCB 4JO1H 1QBLL 3C60A 1MCRA 4U6VH 5KSBF 2ZOLA 4J8RA 2AJXH 4JFEE 5INCA 2JJVA 4NWUL 3MLXH 3UYRL 2VXSL 4IRJC 5C3TA 4WFGE 1QO3A 1VFOA 5C6PB 1D9KD 1P4IH 3GMMB 5CUSH 4B0MM 3GJFH 1N2RB 4KI5D 4QGYA 4OJFH 5I17A 5EBWB 4U0RB 3P0VL 3ARXA 2GJJA 2FSEB 1MJUL 1G7QA 1UA6H 3F6LA 2UZIL 4FZEH 1A9EB 1NGZA 1S7SA 1LMKA 3LRSA 1GAFH 3O11B 3S35X 3S3JA 2FJHB 2ZG2A 4UQ3A 4ONGH 3MNZB 3GMRA 4M6MH 1UCBH 1FGVH 3FHAA 2HG5A 4MVBC 1D6VL 4JN1L 1D9KB 2D7OA 2DWEA 4K71C 1A5FL 3BQUA 4JPWH 4XMPL 5HSFA 2Q8BL 2B7DT 5I9QB 4GG6F 1CZ8H 4HWBH 1UM4L 1KLGA 5JW4Q 3MJ7A 1R3IH 5CWSB 1J87A 5HY9B 1NGQL 4PRHA 5TDOA 2LAAA 3QO1B 4UU9B 3LKPA 3U30B 3PIQA 2AJSL 3ULVE 5IB2A 3TIDA 1ZA6B 5HGAA 3DI3B 4XCNB 5DUPL 1MVUB 4FFWC 3MBXH 4X8XA 3LN5A 3A6BL 2PN5A 1OAYL 3OKNA 4V2CB 2IH1A 3LY6A 4LCUA 1MHPL 4PJ5A 4GW1A 2F53B 1HCVA 4DTGL 1W8OA 2X44D 3CFIC 5E08L 2MQ3A 4K94C 4K3DH 4UILH 3S4SB 1EEZB 2AEWA 5GGTL 3DIFB 4NDMB 2ARJA 4HMCA 3SKUD 4Q9QH 4XCCL 4I5BB 4IIQB 1DQJA 3TYGL 3E6FA 4XPHH 3U48A 2I60L 3GSXA 5DC4B 3T0EC 5DFTA 1T1ZB 1VCAA 5K9JL 3I6KB 4NN6B 1XFPA 2X42A 2PUQT 1PZUB 5ERWA 1Y0LB 1WLHA 5C9JA 3UJJH 1KCVH 4G3YH 3IDIA 1AXSA 1UXWA 1ZK9A 2C3GA 3QHZH 3MRDB 3T8XB 3BX7C 3ES6A 5E8EB 3WL9A 4Y1AB 1F11A 4Y4HD 3H0TA 4KK6D 5EG6C 4TUOB 3NFSL 3K74B 5GRXG 5ALBL 4Q9CA 1CF8H 5HTSA 3FB8B 4NZJA 2P5WD 2CO7B 2PKDA 4OQTL 3K81A 5HVFB 4M4PA 1KSRA 4KJYA 5E94A 2RGSA 4UINH 5KSAD 4X5WB 5IP4A 1KFAL 1HILA 4LSTH 3VWKA 4LEXL 4R4NC 2D3VA 5K93A 1MLCB 1R5VA 3AFLA 3RNKA 3S5LA 3VFGL 3OTTA 5HI4C 5JZ7C 1GPOH 3C5ZA 3R8QA 3UJIH 2OL3B 4LVNB 3SGJC 5TQ2H 2YA1A 5CSZB 3B5HA 1IAKA 2JJTC 1S5HB 1IM9A 1YQVL 2P5WB 3QCUH 3QO0A 3WFDL 3ZTNL 5D7JD 3UP1A 3MOAH 4EKXA 2FYYB 5EU7C 4DGYH 3HB3C 4UTBH 1JGLL 5KSAB 3EUUA 5FYJL 5LG1A 3ROOA 2ZUXA 3HE6C 2P46B 4OAWA 2WZPD 3ARBD 5HYJA 1OT1A 4P5MA 5AZEH 1AGFB 3UPCA 1NFDE 4OZHF 12E8H 1EMTH 3LS5L 3CSGA 1MHEA 3P4MA 2DBLL 3GSUA 3O3AA 5BS0E 4PRNB 3E1F1 4GRWF 4AZ8A 4MB4A 2FIRT 2DD8L 2IGFH 2MJWA 4P2QE 5HI3D 3ULVH 4MA7H 4PTTB 3BPLC 3WUWA 2V2WB 1BVLA 5D7JB 1KJ3H 4H1LG 1V8HA 5CZVL 5CP3H 1NEZB 1MCOH 2RAMA 4NQDE 5SX4I 5DJCB 4LCCC 4ZO7A 3EO0B 3IGAA 3ZHDA 4K55A 3QXVA 3TBYB 2PXYC 3ARBB 2VOTA 2ARWA 4F15B 2D9QB 4JAMB 2IFFH 4LLYA 1OW0C 3HHRB 1OARL 5AYUL 4XP4H 3VD9A 3V4VL 2VN4A 4ZAKD 3K2UL 4JR9H 3BWUC 2YA0A 2ZSVB 2BZDA 5DVMA 1J0IA 4ENED 5I2IA 2V7HA 4K23L 1RULL 4Z7OF 3BZFB 1XCTB 1X5GA 1V7NH 3IF1A 1AR1D 3RZWA 2X4RA 3OG6B 4HJ0D 4PJBB 2BRRH 4P2OA 5E2JA 3WFCH 4XHQA 4WDIA 2Z8WC 4LARH 35C8H 1U8QB 1E28A 1LD9B 4WGVB 3O45A 5HYIA 2DQUH 5IW6B 3EDFA 3U4EB 1AHWA 1L6XA 3G5YB 3G6DH 2JLLA 3HNVL 1GGCL 1FYTB 1YNTA 4GBXC 4N5UA 1KN4H 3DWTA 1ZHKB 4OIIH 4G8IB 4ZOAA 1KB5L 4L8DB 4M48H 3K8LA 1XGYL 1RQ5A 1XF2B 2R23A 2QEJA 3JTTB 3T3MF 5IJKA 3CVHH 1G7HA 2FO4A 4Z76A 4YDKL 2F58H 1UJ3C 5FUCC 4X0KA 5ITFB 3SKOB 1I9IH 4TSCL 1LVEA 4MXWL 3T0AA 4XCEA 1UZ8B 1AC6A 2V9RA 2VDML 1YEDB 3QUML 1ZSDA 3GBMH 2ITDB 5JDSA 4LBEB 5JIIA 2FR4A 2AK1H 4LP5A 5I1AB 4C56E 1B0GA 4JHAL 4R96A 3DUUB 3JV6B 3VFMA 2AJYL 2C1OA 5EOQL 1J0KA 4KJQC 5IFJB 2VXUH 1DANU 3OF6D 5FYKL 5JMRA 5SWSA 4JJHA 1UM6H 3B9KD 2H8PA 3LHPL 2G9HA 3PL6D 1SMOA 3M8OH 5ADOH 1NCDL 4Z0BH 5FYKU 3QI9C 4HKBA 3B3IB 3RHWF 2D4FA 4NKMA 1QKZH 5ISZD 2GJ6A 3MYJB 1OGAE 4OZ4B 1I1FB 3GIZL 1RZ8B 3VXPB 2VL5A 5AUMA 4ZMAT 4IOFC 1ND0A 4XHJC 2LU4A 1DUZA 3CLEL 1BEYH 3QIBD 4Z7WA 3MGAA 3UYPA 1JYWA 4NM4H 5M95B 2H2PC 3QG6B 3MRBA 5DR5H 3QDME 3W0WE 3B9KB 4TTDD 3DLQR 2CKBB 7CGTA 5EOTB 3GSNL 5GRWA 4Z7UA 4K3HA 1NCAL 3PL6B 4V1DA 1XGTA 4OFVA 5DS8B 4CNIA 3E8UL 4FXGA 2R4SH 1NGWB 3MODL 3TV3H 2ZOKB 4PJFE 1SM3H 5GGSB 1A7PL 1KYOJ 2D0HA 4PJCA 4ZS6C 3WIFA 4HG4J 4WI9A 1JPFA 4KHXH 3KS0J 5GRVK 1W8NA 4LMQE 4YBQD 5FO9B 5KVEH 3G6JA 4HFUL 3ARDD 4W4OC 1MH5B 5D1QA 1Q8MA 5AWNL 3TZVD 5HPMA 1BQHB 3QIBB 4XNYH 2R39A 4JVWA 4NO3A 1B0RB 2VR4A 4OLYH 4LCWD 4WUUD 5DLML 2DF3A 5GS1C 1D5BA 1T22A 4UI2A 3UDWA 4N0FB 3VH8A 1GHFL 2YKLH 1JTTA 2GEEA 3EJJX 2UVFA 4RFNB 5CHNA 2NW2B 2F54D 4JPVH 2YUWA 4G6MH 4UZGA 1H8SA 4L4TD 3GHEL 1JF1B 5D8JL 3K0WA 4P2RE 5KS9E 5JDJA 2AXFB 3NFNB 4FFVD 4U1MB 2BSRB 3ARDB 3D39D 4NO2A 3GSWA 4KJPC 3ARGC 4XWOD 4M93C 3TZVB 1NCTA 1KCUL 1DFBL 4GLRI 1T2XA 1TVHA 2MCG1 1JJUA 1JV5A 4PS4H 1G7PA 4QCIB 3CPLA 4H25A 4M5ZH 4MNGB 3L3JB 4FFZL 4MNQE 3U0WL 5F7EL 2DQCL 3CU7A 5C0AE 1T2QH 2HFEA 2ZKHH 3AREC 3CFDB 4LU5H 3ETBF 2F54B 3MJGX 1QEWB 4P5KB 2JJWA 2XG5A 1XEDA 4PRAB 3V5HB 1JGVL 3G9AB 1JZ3A 5CMAB 4OF6A 3HR6A 2JK5B 4ZFGL 4U1SB 2ADGA 3D39B 3ZT6A 1BQUA 3BP7A 4YJZL 4KPHH 4FQXA 2XZCH 2YPVH 1JFQH 1G6VK 5C09D 2D7MA 2DQIL 4KY1H 5C8JA 2WBJC 5EA0H 3VRJB 2J3SA 1HNGA 4PP2B 5I1KH 4XBPB 1ZOXA 4WHTA 1OF2A 4ISVB 4O4YL 2OZ4L 1AIFA 3MLSL 3P30H 4M8QB 3OR7B 2M8XA 1P2CB 2ZJSL 5TDNA 1I1AD 4JREC 3V52H 4ZD3L 4HUUB 3H42L 4JQIL 1SEQL 4HIJB 5JOPD 1D5MB 3GSQA 1W0WB 3MO1B 1HH9B 4GMTL 4YO0B 1WFOA 4E42A 4JO4L 3D0VA 4LK4A 4WU7A 1QUNA 3TCLB 2OTUB 3IRZA 2HTLD 1QYGL 1RZ7H 3R0MA 3VWKC 4JY4A 2QR0A 3PGCA 3GGWA 1HSBA 2C7UB 4LLUA 1TZHB 4HIHB 2BC4A 4F57L 4Z95L 2W0PA 5DDHB 1LO2L 3GSVB 1XGQB 5IB5A 1I1AB 3O8XC 3QWRA 1QBML 4NKIL 2MQCA 1FO0B 3QUYC 2I5YL 2IADA 1SJHA 4OB5L 3WDJA 2J88L 5L9DL 2R1YB 1INQB 5J6HB 1T1WB 3QZWB 1MRCH 3KWWB 5IB1A 3ALXA 4V2BA 4ZO8A 5BZWA 3RGHA 5D7KE 4MJ6A 2VDRH 2K7PA 5CS7A 2VQTA 5KSUA 5FO7B 5I16B 2B5IC 5DK2B 3QEHB 2WSKA 4BFIA 1ORQB 2WIIA 3JWOL 2OMBA 5A16A 5C71A 4M61B 3ARFD 2RFXB 1GZQA 1FZMA 2IQAB 4WUKH 4NWTH 4HAFA 1ADQH 1TQBC 2P8LA 5EZOH 3SDCD 5FGBC 1B88A 3MJ8B 4YPGB 3K4DA 4KTDH 4R4BA 1NGYA 3LD8C 2XWTA 1T1XB 3IFPA 4YAQB 4QRTB 4GAJL 5ESVB 3OAYH 1FVCA 2NLJA 5I8CB 1PVHA 4GRLA 1AFVL 4HPOH 1U8IB 4XCFH 3T1WA 1QQDA 4AL8L 4FOMA 1UB6A 1X5LA 4NC1C 5LKNA 3WBDA 3KPPB 1GGIL 4OD3L 3K46A 1KB9J 4MSWA 3GMMA 5F7UA 4WW2C 3L3GA 2OJZL 1LP9E 2YC1A 3ARFB 1BFVL 1FL5B 4L3ED 2QQKL 4NO5A 1MUJA 3SDCB 5EBWA 4DUWA 1T7ZA 2NX5A 2X89A 2DKUA 1OAXH 1SJXA 1A9EA 2FX8H 5DMIH 4CVZB 5GQBA 3L3DB 2R8SL 1CGSH 2XWBA 1I9JL 1SBSH 5K9QG 5ICZB 4KVCH 1NFDB 1WBZA 2H32B 5HGHB 4HKZA 4OLUL 3QP3A 3SKJL 3H9YA 1P6FA 5DQDL 3A6CH 5BS0B 3MRRB 1R3JA 5F7DB 4P2QB 1KACB 3WKML 5I1DB 5A1AA 2DICA 5CWSA 1YMMD 4G7YL 4PJEE 2HMIC 1HWHB 1NDGA 4ONHA 2X4PB 5FV2A 2NY1C 3CIQA 4I9WD 3V79C 4BZ2H 1NBQA 3ZT5A 1ZEAL 2ZCHL 3QO1A 1OAUL 4ZDHB 5JLZA 1ZA6A 2DOCA 2F15A 4KRLB 2BVPB 1MVUA 1XH3B 1FIGH 3VXRD 5J13C 5C0RH 3UZQA 3GKZA 1ZXQA 5E9DD 4D9RE 2G5RA 4U1KA 2OK0L 2DQGL 2IBZX 3GJFK 5F7MC 5AG9A 3SY0B 3BW9B 3S4SA 3A67L 1HXMA 1WT5A 4NDMA 3C09C 4N90D 1BAFL 5MEND 1QRNA 3TH3T 5SWQA 1CQKA 3QUXD 4APQB 1M71B 1XIWB 2E7MA 3D3VE 5IMOB 5KTEH 4JB9L 4E5XB 1KIRB 1T1ZA 2LU3A 3C9NA 3DSFL 4L8CA 1A9BA 3PWPE 1RIUH 1DVFA 3CUPA 1Y0LA 3S36L 4D3CH 4WRLA 3BSZL 5IVZA 3RVXC 2F19L 3RY4A 1S8DA 3VXRB 3RL2A 3RTQC 5F3BB 3T8XA 5JHLL 3O3BB 3ZKXC 43C9B 4OZGE 3UAJC 1LK2A 4JRYE 4Z77B 1NEUA 2D7QA 2XACC 4MJ5A 4BFEA 1EBAA 3S37X 4ZUVA 2GAZA 3TO4B 5MENB 3GMNA 1NMCC 3T2QA 3AVEA 2YEZB 3BZEB 1CK0L 1A1MB 3NFPA 1Q1JL 4I0KA 1FN4B 4M6NH 3KYKL 2BNRE 2IBGA 4RWHA 4PJAE 2VNCA 3BE1H 4HMEA 1XMWA 1R5WB 3OKOB 1NGPL 1U8JB 3K8MA 1UJTA 4BQBA 5CEZE 1FNLA 2XOTA 4K7FB 5DJDB 5IB4B 3RA7H 3CSYA 4Y4HA 5ALCH 5D2LA 5EC2A 5MHSD 3V7AG 2MCPH 3DURA 3MACL 1QHOA 1CU4H 1FFQA 4YDVB 4G9DB 1Q9LB 3MRQB 3V6OA 4P46A 2A2QT 1MCDA 2Z8SA 5IVXF 3UDWC 3GHBL 5HDBE 3BH8B 1HKLL 3ZE2E 1DQDL 1MCCA 1J86A 3L5WA 3ALPA 1MLBB 2CGRL 3RI5F 1IAIH 3WCYA 5GGVY 4HJGA 2ZP0T 4WU5B 1I3RA 1QD0A 2R1XB 2AV1A 3BN9D 2AGJH 2WP3O 3MC0A 1ETZB 4N9OB 2Z35A 3FONA 3SE8H 5L0QC 1CFVL 1YECH 4NP4L 4YQXH 2I9TB 4HUKB 2X05A 1S9KC 3TA3B 5IMMA 1N8ZA 3FO0L 3QXAB 3C6LD 1JGEB 3O2DH 2V2WA 5D7JA 1EIBA 5JIKA 2XKNA 5ACLA 5I1GH 4P4KD 3V6ZB 1NEZA 5BXFB 1YJDC 1IGIH 3IRPX 4TVPE 5DJCA 2AEIT 2EC9T 1T7WA 1EO8H 3GI8L 4Y5XA 3WS3A 3TBYA 2R0LH 3W0WB 1OTTC 4OFIA 1E6JL 5TFSH 3KYOA 1DEDA 2FWOA 4GKZB 4M9PA 4LIQH 5E99L 2WP3T 4JGUA 1R5IB 4KRPD 4ZFZA 4YXHL 3TJEH 4X6FA 1CIDA 2IPKB 4POZC 4PJ7B 5KSBE 3X11B 5CSBA 4JGMA 2FH6A 4FQXC 2VE6B 4X5LA 1P7QA 3IDJA 3QCVH 5I1HL 4GQPH 3C6LB 5JR1L 1JL8A 2LAGB 4QRRD 5JPMA 4JO3H 1DBMH 4U1LA 2X4UA 1F3DH 2WWMC 1IL1A 3O4LD 4QXGH 2ESVD 1JRHH 4U1HB 3U4AA 4XPTL 4UT9L 1KPVB 2C4XA 4LSSL 1CLOH 3O2WL 5F3HB 1T80A 1U8QA 4PJ8C 1LD9A 3QWOB 4I77L 4ZAKA 5F72S 4UTAL 2OP4H 2CLRB 3D6GA 4EN3A 2E9BA 3HLAB 4P2RB 3KLHC 2V17H 3PDGA 5IW6A 5AZ2L 4QRRB 1KPUB 3RVTD 2BSTA 3OR6B 2FJGA 1F00I 3EJZD 5CEZH 1IGCL 1IILE 5T3XL 2ESVB 3SCMD 4IM8A 4LSQL 4RAHA 3P0YH 3IJSB 3MV8E 5GS0D 4MNQB 3WMSA 4MNHB 5E2VH 2HJLA 1U95A 2H9GB 4JG0H 2J8UB 3W39B 3KNBB 3QNXB 3KPNB 3HE7D 4NJ9L 2A6IA 3LH2H 5EPMA 3OKLB 4N0UA 3QIWA 1UZ8A 4X9GA 3BHBB 2QSVA 3NABH 4HHAB 5ITBH 3F5WA 4O02H 4IBLT 5C0JA 4XNMB 5TH2B 4I3GA 5I74B 3KVQA 3QFJE 5SX5H 3SCMB 3CZJA 4NRXA 3QEGL 4P0DA 2W9EL 4LHUA 5F71A 4LSPL 5EORL 1S7WB 4HAGA 3T0BA 2ATKA 1HHGA 1K9TA 3PWLB 3B3IA 4WI8A 4D94A 3IDYC 1AKJD 3HE7B 3GMOB 3MRPB 3MYJA 3B2UD 1RJLA 4OZ4A 4K3JH 5KW9H 5GGTA 3VXPA 2X9XA 4TVPH 1BQSA 3BEWB 3DETC 3FRUB 4DGVH 4F3FA 2DLIA 2XTLA 1AE6L 2CRYA 1ONQB 5GZOD 4ZFOL 1J05B 1B4JH 1B6UA 1TJGH 2KBGA 3OF6A 3VD4A 4FQJL 3B9KA 1YYMH 5FUOH 1HI6A 1MIMH 3BMVA 4YWGH 3P3YA 3N9GH 3PL6A 2R0WL 5D4QA 4HKJB 2YD8A 5DS8A 1S7VA 1LNUB 1KELL 2ZUTA 5ETUA 1AKJB 3AS1A 4LLAA 3P4OB 4PP1C 5ISZA 2FH8A 4JANA 4HGMA 3EYVB 5FO9A 1FRGH 5EUOB 4KUCD 4AIZA 5FKPB 4P3CH 5E7BA 2FB4L 1UB5A 3L3KB 1C7SA 4N9GA 4RAUB 3F7VA 1XGUA 4WWKC 3NACH 3BPCB 3LPWA 3QIBA 3S5LG 1CBVL 1B0RA 4XVUD 1A2YB 4MXVF 4TUJB 4XC3H 1A6TA 4NGHL 5IBTH 1JTPA 2HKFL 2ERJB 2NW2A 5CD5D 3CK0H 1RIVH 3VGHA 1BD2E 1EFQA 3U0PA 3ILPA 3VXSE 1VFUA 1D5XB 3NN8A 3RVUC 4LOUD 1R0AH 3BDYH 2W60A 2BSRA 2PYEE 3ARDA 4OZHE 5J8OA 4L3CA 1M05B 3RVVD 4H8WL 5CJBA 3BH9A 1YY9D 1SYSA 4GAYA 3EIFA 3QIUC 4RZCB 2X9WA 4LCWA 4OIBA 4F7TB 3IAQA 4WUUA 2E6JA 1NAKL 4MNGA 3L1OL 1DDHB 2MKWA 2YXMA 3BVNB 4XXCA 3FHQA 1MJ8L 3WUWG 2HT2D 5C2BH 1MOEA 4JZJA 1I85A 4L4TA 1RZJH 2JB5H 3V5HA 2IAMC 4PIRF 1LP9B 4BQ6A 3DXAE 8FABB 1CE1H 1PDKA 2AJVL 4LKXB 4MJIA 3RZCA 1DVFC 1AQKH 1A3QA 3MNWA 3PJSB 4M7LH 2QQNL 4G6AD 3BI9X 1F4YL 1WZ1H 3HNSL 4HK3J 5C7XH 3KYNB 5AAMA 2EZ0C 4PP2A 3S96B 1PKQE 2HLFC 5HPOA 2EDJA 5A2IH 4M8QA 4DZBA 4Z7OE 1TETH 5F9DC 1NAMH 3D2UA 4BQCA 1QHPA 3VGEA 4NNPL 5BO1H 4Z5RB 1MRDL 1D5MA 1KT2B 2CJUL 1UQSB 1HH9A 3MO1A 1N7MH 1T3FB 1H0DA 4PJ9B 5CGTA 3PUCA 2P45B 3MLUH 1ZTXH 5C9KA 4POUB 3QXUA 1XF4B 3LN4B 1CXFA 5C09A 5BV7L 1MI5D 2B8OT 1U3HD 2OR8A 1OLLA 5E4EB 4RAVB 3TBWB 4ELME 3M45A 4OT1H 5KZCB 2VISB 5HI5C 1QVOA 1EVUA 2R29L 3UTOA 5DDHA 1ZANH 1D7FA 3DRTA 4MQ7A 1XGQA 1LO0L 3V6OC 4JRYD 5TQ0H 1I1AA 5JW4R 5MEQA 2APVA 3EOBB 1FO0A 1RMFH 5J1AB 3S34L 4FABL 3T3ME 1RJZB 1CFNB 4BH8B 5JXEC 1G9NC 2X4QB 1DBAL 1AXTL 2Y06H 4R97B 1XF5B 4FQIH 4L8SB 3U1SL 5B3JF 1WVZA 3OXSB 1K5NB 4NUJA 3GKWL 2H45A 1I8IB 5DRXB 2EIZB 5E8DH 1C1EH 2CUIA 3FO1B 5FYLD 1U3HB 4ZUTA 4X6CE 1KB5A 3RPIA 5LQBH 4JO1L 3KPSE 4F9PA 2AJXL 1Z3GL 5I71C 2ILLA 4I4WA 3MLXL 4M61A 4JRYB 5J56B 1P4IL 5CUSL 4N8VA 3HN3A 5EZIH 3UEZA 1P9MC 4Y4FB 1NCBL 1MJJB 4OJFL 5DO2D 1JWSB 2BERA 3MCG1 3NAAL 2CXGA 4DGIH 3TPUB 1G6RH 1P5VA 5DZNA 5IVNA 1KC5H 1UA6L 2CQVA 1U8IA 1CDBA 1GGYA 4FZEL 2CRMA 3R06B 2BNQE 1EEQA 1Z9SA 2KDGA 1GAFL 4HK0B 1J0JA 3CDCA 3SJVE 3PNWA 2GK0B 4ONGL 4KKNA 4M6ML 3ARFA 1UCBL 1FGVL 2HWZH 2BP3A 3RGVD 4JPWL 3SDCA 1MCPH 1QBBA 3VRLE 3PWUB 4OCSH 5ESAA 4HS3B 3O41B 3DX6B 1R3IL 2FEEL 2HJFA 5I8KL 1OQOA 2HLAA 2E6PA 4O00A 2AKRA 4CVZA 5J3HD 4H26A 4GRMA 3BDBA 4P3DA 5EU6D 1DBJH 1UM5L 1DSFL 3LS4H 5ICZA 1FBIH 3SDYL 3J8F7 3MBXL 1F8TL 1IGTA 5JW5B 1I3UA 4KKAC 1W72H 2HT3C 4PB0H 5DA4A 3Q2CA 3MRRA 3SE9L 5F7DA 3OAZH 4MWFB 3RGVB 3NPSC 4L3EA 3CAFA 5C0CD 1LO3H 3WLBB 5I1DA 2W65A 2ADJB 4PR5A 4K3DL 1RY7B 2X4PA 4HZAA 4M03A 3WNPA 3MFFB 1IEAA 4Q9QL 3AAZB 3R0NA 5JO5B 2BSED 4HW6A 2BFVL 3OAYK 4XPHL 4QY8B 5C0EA 4YH6A 2VLKD 5EO0B 3BJ91 4G6FD 1BBJA 3I6LE 1NCWH 3QIWC 4PBVC 5FO8A 4RGNC 2EDOA 1DN0B 2Z31C 3FOMB 1JPSL 3CFCL 3QHZL 4X8JB 4O2EA 5T3ZL 3ALWA 3DX7B 3RFZC 4YC2C 2EDTA 5C0CB 4ODXB 1N5YL 2KZWA 1N3NA 2NXYD 5C0GB 4WY7H 1NCNA 1YMMA 4H1LH 4ODUA 4TSAH 3SGDH 4JY5L 1NJ9B 4OCLC 5JQ6H 2HTKC 1I8MA 1CF8L 3ZKQD 4LPYA 2UY7A 5GXBB 1DJSA 3GSOB 3UTQB 4EI5D 1ED3A 2J5LB 1CXKA 3MJ9A 4QRPD 4G6FB 4LRIA 4UV4H 5F1NB 1CICC 4Z7WF 3ZYZA 5E9DA 43C9A 4J12A 3W11D 1XT5A 1A3RH 3PHOA 4Z7UF 1NC4D 2AXHA 5IV2A 1KJ2B 4MA1B 5MENA 1P7HL 1PG7X 4NN7B 3UJIL 2YEZA 3QUXA 5D93B 3BZEA 5TQ2L 5JW4M 5HYSB 3K4AA 1A3LH 2ENSA 1UWEL 1FN4A 2BX5A 4PJCF 5D70L 5D6DC 3QCUL 1U92A 3JVGC 3MOAL 1JZ5A 3ZLQC 4M43L 4GG6B 2F9BT 3EJYD 3G6JF 1KIPB 5DJ2B 1U8JA 4JM2C 1JMZA 5CP7B 5FK9B 2BMKA 3OKEB 4UTBL 3QFDB 5CJXC 4K7FA 4YR6B 3WS6C 3X3FH 1JYVA 4IMKC 1EMTL 3THMH 5I19H 4GKNA 4JFHE 1IC4L 1NC4B 4U6HB 4PJXA 1Q9LA 3SO5A 5E6ID 1EO7A 5DQJA 1X4YA 3MLTA 2X41A 3ULVL 3EYFB 2EYTB 3QH3B 5DJ8A 3RY5A 5FHBL 4PG9B 2O26U 1WCBA 1MLBA 2PW1B 4PBXA 3QFJB 5HVHB 1C08B 2KPNA 4EQ2A 3F6IA 4CVXB 3TN0D 4CN1A 3QCTH 1A1OB 2R1XA 4OQ1A 1EHAA 5FF6B 5DUMH 5J4MA 4NKDB 3ZKSD 3INUH 4QHMB 3PGDA 4P59H 2YA2A 4HX1B 1S9YB 4HBCH 5D72H 5E6IB 1QNZH 1D5IH 1FDLH 4JR9L 5FECA 1HQRB 5KBNC 1OWRM 1TZIA 4NRZB 3DX8A 3DO7A 2FL5A 1J1OL 2AK4E 5C0DB 3RDTA 4YXLH 3NZHH 3MLZH 4I3RH 1U2HA 4H88H 1WWWX 3Q6FB 4GKZA 2Y4SA 4HPYH 3TN0B 3LPGA 3MA9H 1KEGH 3P77A 2NXZC 2XA8H 2ED8A 4HFWB 4JHWH 1R3HB 4KMQA 3WFCL 5F9JA 2OX5A 3H9HB 5ICYB 3X11A 3MUHL 4OV5B 2FEDC 4Y19D 3C6LA 4W6YB 5EU5B 3G5ZB 3BKCH 4HS8H 4P4KA 4YZFF 2DQUL 5MI0C 1E4XI 1FFNA 4NQED 1J8KA 4KKBC 2XQYK 4ZPTA 2A6KB 1KPVA 2J6EH 1KN4L 5JOFB 4OIIL 3BDXA 1I9RH 1LDSA 4X80H 1VHPA 4PLKC 5F3HA 3VD7A 1HHIA 3O9WA 1ZHLA 3QWOA 2E3VA 1BD2B 2NYYD 2F58L 4UT6H 3VXSB 4MCYB 2FIKA 4POYA 1I9IL 1EEYA 1NC2D 5GPRA 1JUFB 3V5KB 3OR6A 2VZSA 1C5DA 5IW1A 1KG0A 3QYCA 4MB3A 3GBML 5D1ZB 3ILQC 3KPRA 4NCC2 2R0ZL 3O4LA 2ESVA 2AK1L 3L9RA 3IAPA 4GRWB 4NQEB 2NY3C 3IJSA 3IDUA 2R2BB 2SEBB 4UB0L 2A77L 5FB8B 1YY8A 4I0PC 3LB6C 3HR5A 5CEYB 2H9GA 4JPIB 1J5OH 2HVJB 3PXJA 1JZ6A 3C6SA 4J4PD 3KPNA 4W68A 1RZIB 5DTFB 2I24N 3M8OL 5J6GA 4N8PA 4Z0BL 3VGBA 3BHBA 3HRZB 5D5MA 3LDBB 3U7YH 1RUPH 1QKZL 1FZKB 5DJ6B 1TCMA 1JWMA 4S1RH 3UTZB 1H8OA 1S5IL 3H3PH 4GKSA 1RHHB 4YHPB 4KK5D 4ODSH 3DVNB 1BFSA 3S4SG 3MROA 4JKPH 3U7WH 5DR5L 3MRLA 2A9MH 2FECI 2YRPA 3QULA 4OIAA 5L2JA 3EO1B 1DZBA 2R4SL 5SWZD 4LPTA 4QHNB 3ZE0F 2PTTA 3VE0B 4P9HL 3UTSD 1ONQA 3MRFA 1WBYA 1S78D 2EXYC 3Q1SH 2OXGA 4WIQA 2MWCA 4RNRB 4BYHA 3H9SE 5EN2B 5FCUH 3LRGA 4XNYL 4HUWB 4DW2H 3KYAA 1XR9B 1WIPA 4D9QE 4JG1H 2JELH 4PRPD 4HKJA 1ZLUH 2EYSB 2Y5EA 3EFDH 5F7HA 1S9XB 3ZL4H 1JK8B 1RAMA 5DWUH 1FZJB 2Y5TB 5D1XB 3RU8H 4DCQB 4S2SB 5SWZB 3BKML 2RR3A 4JPVL 3EYVA 3MMEA 4G6ML 5EUOA 3QDJD 1IFHH 1JN6A 1G9NH 5FKPA 6FABL 5SV3A 4S1QH 3QXDB 3QISA 1M6OB 3BD4A 3B2VH 3MLWH 4BQ9A 2MQ0A 4HKXB 1UVQA 2VKWA 5C3LD 4XZUA 1FFOB 5IM7B 1U3JA 3EDKA 2VQ1B 1YQ2A 4PS4L 1OB1B 4M5ZL 4WENB 5IVXE 1FHGA 3SDDB 1KENL 4L4VA 1DN2A 3BD5A 3RIFF 3DYOA 3VXUD 3O6FD 1T2QL 5IMLA 1OAZH 3DMMB 4LU5L 4R0LA 1D5XA 3QDJB 1DLFH 3ULUE 2UV3A 3OGOE 4MA8H 1P1ZB 2EDHA 2NY0D 4R2GD 1FC1A 1GCFA 4F7TA 5C0FB 4M6OH 3MGTA 2YPVL 1OY3B 1JFQL 3TBVB 1MSPA 3PGFH 2AERT 2BNQB 4N0CD 5KVGH 4OM0L 4KY1L 4WFFD 3HI1A 3DHMA 1U8KB 2NNAB 5EA0L 4QRQA 4DK6A 2XZQH 5I1KL 1CDHA 5CJQL 3SJVB 4BA8A 3VXUB 1NEZG 4QXTB 1YN7B 3O6FB 5CGYD 4YHZH 4ZUSA 1MFAL 3X3GL 4LKXA 4JPKL 1CD1B 3V52L 1JZ4A 5DMKA 5IIEB 3DTXB 4HK3N 2NY0B 2COQA 3MBEC 4DKEH 3QEQA 2OI9C 1OVZA 3UYRH 4ODVH 1MCWW 1S9VA 1E4KC 3JUYA 2DLHA 3S8WA 3GNML 3D69B 4G7VH 3N1PC 3VXMA 4OZFA 4ZNEE 3BRFA 4U1NA 1NMBH 3P0VH 5ESQB 1MJUH 5JA9A 4Z5RA 1NANH 1KT2A 1R3LB 1UQSA 1WWCA 4I1NB 4PJIA 3HI5H 4PLJD 3G5XB 3EYUL 3V7AE 2YS4A 2YK1H 4U7MA 5D2LF 2APWA 2PETA 2XFXA 3EKCA 3VFOB 3IDMB 5IBUG 5CCKL 4MX7A 3HG1E 3WN5C 3ELAT 2C3XA 2UWEB 4RAVA 1MRCL 1A5FH 3TH4T 2C26A 4EIZC 2A6DB 2VLJA 1QFOA 3OX8B 5JQHC 3MLPA 2VLLA 1UM4H 1ITBB 1ZV5A 2VDRL 1F5WA 2YOCA 5FGCB 1NGQH 3CVHB 2DMKA 1RSFA 3BP6A 3KPLA 2BOCB 2AJSH 4Z7VB 5J1AA 4P4RB 1EXUA 1CFNA 4PFEA 4WUKL 4BH8A 4NWTL 5DUPH 3NCFB 3STLB 4CMMB 1XF5A 4L8SA 2CRZA 1OAYH 4KTDL 4DEPC 1K5NA 4HT1H 4JJ5B 1MI5A 4L3AA 5DRXA 1I8IA 3FL7A 2NZ9C 4R7DB 4ZQKA 2RCSH 3CZFB 1WBXB 5FGRA 2DMCA 1ZKAA 4G42B 5F9OH 1RD6A 4HPOL 4FQLH 4XCFL 3ULUH 3WKNA 1DBKH 2FHBA 1PKOA 3WE6A 2I60H 3NCYS 4H0IA 1QSFD 4NQVB 1GIGH 3DRQB 5K9JH 3RL1B 1MVFA 3RDTC 4LHUG 4P49A 5FOBB 2FHFA 3MSPA 5HHOD 4PJGE 4LGPB 2XN9A 5D7LE 2D4DA 5F89A 4RMVA 1SY6A 3OJ2C 1UYWL 5ANME 2FX8L 5LJYH 3HUJE 3MNVB 4JCLA 3JWOC 3NFSH 3RVWD 4E0RB 2X4OB 4Q6IA 5EOCJ 2YZ8A 3GM8A 3DV4B 3QAZC 3G08B 4OFPA 2VZOA 1H15B 2QHRL 4JN2B 4R9HA 2GK0A 1EHLL 2GI7A 2Y72A 5DGQA 3OMZA 2YD3A 5EBLA 1MCBA 4JFXB 1CIUA 5L88H 1QSFB 3HPJB 4X7SH 4QT5A 1OL0A 2PYFA 1U8NA 3A6CL 1LEIB 2Z92B 4LSRL 4UNTA 1KFAH 4KDVA 5DK3A 3RP1A 4HS3A 3O41A 1CL7I 1S7QB 1ZVSB 4HC1A 4LEXH 5HHOB 2VABA 4ZFOA 3F7PC 3RWDB 1QFUL 2A83A 5GGQL 4BZ2L 2NPLX 1A6ZA 3O9WC 1A7QH 1S7RB 5I6XB 4TNVF 1QPPA 4XMKL 1CN4A 3NBNA 4RRPA 3NCJL 2B39A 1YQVH 1G0YR 2FRGP 4IRJD 1FIGL 3FFCE 3OG4B 4JVUA 4MXVE 3ZTNH 5C0RL 3OV6A 3SKNA 4OD1H 4Q2ZB 3G04A 5FYJH 4ZFFA 4PRHE 3T08A 3BAEL 5F9AC 3MFFA 5DURD 4NKQB 4P2YA 4PRID 5JO5A 2YSSB 2E27L 2PO6C 2AK4B 3G9VA 4KVNH 4MD5A 5CLTA 2DL9A 5ID1B 5GSVA 4TSBH 2DBLH 3A0OA 4PJ5E 2EIEA 5EU6A 4HQQH 1WAAE 1RIUL 3QBTB 1OP9A 4D3CL 1G0XA 5DMGC 3U83A 3WJLA 3BGMB 4IRJB 5ADPH 4D9LL 3TJHC 4MVBD 2MOVA 3VXQB 3WO4C 5C0CA 32C2B 4PJDE 5I30H 1QG3A 1YUHA 2DQDL 1DE4A 2R9HC 4OBRA 4PRIB 1HEZA 3X14B 2Z0BA 5I66A 3BKYL 3EOAA 3GSOA 3UTQA 2EE2A 4M6NL 1HH6B 4ZO9A 2VLKA 4NOFA 3V4VH 1T04A 3BE1L 4G8GD 1BHGA 4C59B 4FFWD 2JJSC 2YD6A 1HKFA 3SE4A 1ZS8B 3BYYA 2X1QA 1W0YT 2EXWC 3P11H 4K23H 4EZMA 2IANA 1GOGA 2H6PB 5DJZA 3RA7L 4QRUB 5ALCL 4XH2B 2ZUUA 4LCYA 2YN3A 4XGZB 5D96B 2MCPL 1CU4L 1LWRA 1YPZA 4XNQB 3H7BB 4NQXA 5I18H 4CADB 2J1KA 4YNYA 3T0ED 4EI5A 4LSUL 5DJ2A 4NZTL 5FK9A 1FC2D 2A6JA 3QFDA 4QRPA 1IAIL 3O3DB 4G8GB 1C16A 1T5WA 4L8BA 4JQXC 3KS0H 5I8EA 5KJRL 4HGWA 4L9LC 4LL9A 1RFDH 1FH5H 3HNVH 4NBYB 4JO2H 2AGJL 1BM3H 1GGCH 3SE8L 1DQLL 4NYLA 3NZ8B 1U58A 1T2JA 1YECL 4YQXL 4U6XA 3H8NA 4KH2A 2R4RL 3KG5A 3WUZA 5EH1A 1JZ7A 2EYTA 3FQTA 1AY1L 4ZTPL 3O2DL 2P5EE 3QUZB 4KTEH 1C08A 3CXHK 4WFHE 3V0AC 5D2NC 4I2XA 3SKMB 4TSCH 1IGIL 4Z0XB 1CE6A 1EO8L 2VDMH 5A2LH 2R0LL 3QUMH 1T0MA 4EUPA 5TFSL 3TYFA 5B3JE 4R0LC 4R4ND 4NQCD 1UXSA 5HI4D 5JZ7D 2NW3B 3OKDB 4JHAH 4MXQD 4PPTA 4QHMA 4FA8A 5ABDE 3TJEL 2GSGA 4Y5VA 4ZS7L 5H35B 2W0FA 4KHTH 1UEYA 5HHMD 2R0KH 5IF0B 4P5TB 4XNXL 25C8H 2GTZA 2XRAH 4AG4L 3MGOB 4D0CB 2A74B 4JO3L 2L7UA 1DBML 4JFQB 5FGSA 3TEUA 2HYMA 4YHIB 3H9SB 3HB3D 4FS0A 5CD3B 4QXGL 3VXNA 1N0LA 4Q9BA 1JRHL 3OWEA 3HE6D 5HHQA 4N8VG 3KYMB 4OLWH 4NC2B 3SDAC 4NN5B 4JDVA 1EERB 1CXLA 2QL1A 3JV4B 1X5HA 3R4DA 3PXHA 4JRXD 1R3HA 1X7QA 4J23A 4NQCB 1CLOL 2EEAA 3N06B 4EOWL 1IVLA 3HAEB 3CLEH 1BJ8A 3MRKB 3FN9A 2YPLD 1ZHNA 3GJFA 4ZXBB 5HHMB 2OP4L 5EU5A 1BLNB 2MTPA 2EDKA 3FOLB 4XVSL 1HHHA 4A6YB 1NCAH 1FCCA 4GG8B 3EZ8A 1I7TB 5FCSH 5IK3A 4O2FB 3E8UH 3VWJD 2DLGA 5CEZL 5E8NA 5DFVC 4JDZA 3FB5B 2V2TA 2PXYD 2YPKB 4X6EA 3P0YL 1HHJB 3TNMA 2VLMD 2WINA 3PV6A 2Y36L 4HDIB 4HFUH 2C1PB 5E2VL 1GZPA 4U31A 3SE3C 4S1DD 1WISA 4MCYA 4KKCC 4Y19A 3LH2L 4JKLA 5B8CB 4O9HL 5DLMH 2W91A 3V5KA 5DT1L 3U79A 2YMXL 1GHFH 3LPFA 3NABL 3BPLB 2IPUK 4NZUL 4HWBA 1U42A 3KDMA 5H2BA 3DROA 4WO4B 4X6DB 5ITBL 3UPAA 3VWJB 1FORH 4G9FD 2R2BA 4LDEB 3C5JA 2VITB 4LCCB 1AD0B 4QOKD 3GHEH 1C12A 1KJMB 5D8JH 1INEL 4AT6B 3CFBA 3OHXA 4I8DA 1HNFA 4KDTA 4Y5YA 1GC1H 2C9AA 4J6RH 2XT1B 1P84K 1JHLL 1G7IB 1T21B 2D7PA 3P9LB 5C07D 1NC2A 5F7YC 1FZKA 1CLZL 1IAIM 4K3JL 5CFHA 5KW9L 4X9FA 5IUSA 4TVPL 3STZB 4DGVL 3TVMA 2DQCH 2GJZB 4OFYA 3R8BB 3O3UN 2LU7A 1RHHA 4G9FB 1D9KC 5DHVB 4GBXD 3MZGB 1PLGH 1TJGL 2NR6C 5T1KD 5A2KH 2BOBA 2IEPA 3KPOB 4JFPA 2GY5A 4QOKB 4X4YB 3BUYB 4K7PX 1TQCC 1MIML 3C8KA 1X9QA 2GJ6E 4XTRC 3BEVB 4PY8J 4U1JB 2DB8A 2PW2B 3ZDZF 4A2MA 2AEQH 3MR9A 3U30C 4QHNA 4UAOC 5D71H 5C07B 1KJVA 3VDAA 4Z7WE 3BXNA 1FRGL 4CUCA 4P3CL 2OZ4H 2YR3A 3ISWA 3NACL 4Z7UE 3HG1B 4V1DE 4GBXB 4KJQD 4LCIH 2GT9B 4Q6IC 4ZTOH 3RJQB 3D18B 5IKCA 1AI1H 3MOBL 1UCTA 2ZJSH 5T1KB 3I9GL 3H42H 4CU8A 1SEQH 5IBTL 1N4XH 3PF2A 5E4IA 4TRPH 3FZUD 3PWVB 3AUVA 4GMTH 5DRWB 4ZYKB 1KGCD 1JK8A 5IJVB 1CXHA 1KJ2L 3SGEI 1UJ3B 1K4CB 4L9DA 1UEMA 2OJEB 4IRZL 1ZT7A 2EYRA 2GSIA 2OTWB 4NRYB 5FUZL 4DCQA 1QYGH 3CK0L 1RIVL 3VFUB 5DC9B 1FG2B 3WIIL 3QT2A 3UYOD 4Z6AT 4OUUA 4NN6C 1JHTA 3UTSA 3QXDA 4ZSOB 3MRCA 1D6EB 3FQNB 1A6VL 4IOFD 2JKXA 4XHJD 4HKXA 3BDYL 1Q0XL 1FFOA 1PQZB 4BSWB 4M62H 1RZGA 3ZT7A 4CU7A 3T77B 2H2PD 4KC3B 1CTOA 3HKFA 5I15L 1A1NB 3FQXB 4PRPA 4FZ8H 4NKIH 3WXWL 1WEJH 4M4RA 1TNMA 5ICXA 4OB5H 1X5KA 5IOPA 5L9DH 5IGXL 4X7DC 1CFBA 3UXFA 2XTJE 4ZS6D 5C2BL 3QDJA 4QTHA 1RZJL 4WV1C 2JB5L 1RHFA 2J4WL 5E1AB 3T0DA 3ZTJH 5I1EL 2Q6WB 1P1ZA 1CE1L 2MPAH 2E5EA 3MUZ1 5FKAA 2ZOLB 4J8RB 4RGMC 4PYHA 4JM4H 1AQKL 3KLAB 5INCB 1VFAA 3TBVA 4LVNC 2YUZA 5CP3A 1WZ1L 4G43B 4PY7A 4WI7A 1KIQA 3FMGL 1XZ0A 2QBWA 5CILH 3VXUA 4DOHE 5DEZA 2QHLA 3O6FA 3TC9A 3QQ3B 4KKLC 1TETL 5I17B 4H8WC 5KSAC 3EYSL 1NAML 1MCIA 3G5VA 5D7SL 3SHSA 5BO1L 1G7QB 1AFVH 5IIEA 1F02I 1NBYA 3S9DB 1FQ9C 1GYAA 4L4JA 2NY7H 3ZKMC 1N7ML 1S7SB 3LRSB 1AO7E 4KJPD 3ARGD 4AL8H 3MLUL 1F58H 4UUJA 4OD3H 3SE4C 4F7PB 3BP5A 5IT2L 4NT6B 3GMRB 5GS1B 1BFVH 4KDWA 2HG5B 3AS2A 2E7LC 2DWEB 3BQUB 4B7LA 4OT1L 3MCKA 4PREB 5CIPH 1GGTA 3ARED 5ESQA 5ID0A 1ZANL 1KLGB 2EDLA 3MJ7B 4XBEL 1FYHB 4ODHH 2OMNA 3NTCH 4JKKA 4PRHB 1MJ7H 1S7UB 1RMFL 3PIQB 5IB2B 1AGCB 1RUAH 3IDMA 1YEJH 2M1KA 2F5BL 2R56L 4M93B 1LE5A 4PJXF