2ADFL

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting/immune system
molecule keywords Von Willebrand factor
total genus 51
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL01
3F58L 3NIDE 1CF8L 3EO0A 4GAGL 1GGUA 2FD6H 1S7RA 1OAKH 4RMQA 4WUKL 5GS2H 4A6YB 1KEML 2BSSB 4NT6B 3D5OF 1UM4H 4JM2F 4M7ZC 4ONFH 2B20A 1BM3H 3RWJA 1OP5K 3FO9A 3MLYH 1I9JL 1QEWA 5GGUA 2WZPD 3T2QA 3UYPA 3PNWB 4IRZL 2LVEA 5F1SA 2EC9U 3INUL 1UEYA 2IMMA 3L3KB 4PJAB 1L9NA 5ACLA 3RHWK 4X4ME 4F8QA 2NY4C 3PP3H 5HYQA 1NEUA 1GZPB 1I9RL 5BRZD 4X6EB 3VWKD 2HLFC 3JVGA 5GSRB 5ALCH 5CJXA 3C5SB 3ULVL 2F54B 4AEIH 3ZYOA 2XZZA 1H8OA 1JK8A 2Y36H 1FORL 3W82A 3DBXB 1X5FA 2W0LA 5EU6A 4KC3B 5AG8A 5T3XD 1OTSD 3H9SB 4Y2DA 5D1XB 4Y4KC 3QUZB 3FRPG 1WFOA 2OYPA 1T4KB 1N5YL 1DLFH 2Q3AA 5C0CE 3HI1B 2L7JA 3MV8E 3NTCL 3IU3B 4KQ3H 5E9DB 4ODTH 3CU1A 4HJ0D 4P4KA 2XA8L 4MQXC 5L2JA 1ZGLB 2CH8A 3CDFA 2DLHA 5A2FA 4RWYL 1LD9B 3PP4L 2A73A 1R5WA 4JZOA 25C8H 1HH6A 5JZ7D 1TZIB 1S3KH 4NQEB 4XC1L 1VGKB 2EZ0C 3VD5A 5HBBA 5C0IA 3QQNA 4DVRL 5FIEA 1FBIL 4XWOC 4HUKB 3U82B 4IRSA 3RVXD 2ICES 1HK6A 1LE9A 4PB0L 2CK2A 5I1DA 4EVNB 3O6FB 4MNGB 2GT9A 1LO0L 5B4MD 4KHTL 3RKDD 1CWVA 2QLVB 1F4YH 1TIUA 5HHXL 4J2XA 2DQGL 2VXTL 4WEBL 3UDWC 4EOWH 1NCAH 5EUOE 4NM4L 4XPTH 2AEPH 1I8KA 3E8UL 4APQD 3I9GL 5TE4H 4ETQB 1YNKL 2AERT 3OG6B 1CK0L 5GS3A 3CFBB 3N1PC 5TH2B 3K0WA 4KQ4H 2D2OA 1T3FA 2BSSA 1OSZB 3CC5A 1CD1A 4XGZA 5KSBB 5FXCH 5T33L 1WQVT 4ZOCA 4XC3H 2ARWA 4BFIB 3DX8B 1AI1H 1HXMB 5E8EA 5HPOA 3EYOA 3VXMB 3HI5L 5T1LD 5TGBB 3KPOA 3OB0H 3DRQB 1FIEA 3R1GH 2PXYD 3D0LA 4XC3L 3CVHH 1FZJA 4OLVL 2C1PA 3CX5J 4KQ3L 4OCRL 3W5MA 1NGQL 5L88H 1T6WA 3L3JB 4LAJH 1FLRL 4KZDH 2BHUA 5IBLD 3CLFH 5I6XB 1KXVC 4WI8A 3VXUE 1AGDA 4RAVA 4FQCL 4JFHE 4NNPL 4UB0L 5DJ6B 1K8IB 4JLRA 4NBYB 2RQ8A 2DWEB 1QBBA 2CIIA 3T3PE 4FQJL 3V6OA 4G8EB 5E2WH 4U1KB 3MJ8B 5IB5B 3Q5OA 5IR1B 5FHAH 1IT9H 5L7XH 1QTYT 2VE6B 1YECH 4OCXH 3WFDL 1XGRB 2YWYA 1HSBA 3BD3A 4LK4A 3AU1B 3GMMA 3S88H 2AEQL 1SM3H 2WIMA 3LVEA 5FCSH 3MFGB 4O4YH 4HKXB 4XNZC 4J4PD 4JB9L 4LDOB 1TMCB 4MDJA 4UQ2A 2JB6B 1HHGB 1RHHA 1UWGH 2Q8AL 2AJXL 2PKDA 3MREB 4U1SB 5EU3B 3O8XA 4GRWF 4NNXB 2DDQL 2ICWA 1UQSB 1R5WB 4WI9A 5DD0L 1HKFA 1MVUA 4ZG1A 3N1QC 4DOHB 4PYGA 2R1YB 2Y5TB 4KJQC 3MLRL 1CZ8L 4WHYH 3WD5H 1R0AL 2ZUXA 4AT6A 4H0GA 3TBWB 3F7VB 3BN3B 5HYFA 1IGTB 1YJDH 4MWFA 1DBJL 5KSAC 4LSRL 1FNGB 3O3DA 2FWOB 3IFOB 4LPWA 2IH3A 4HIEA 1P2CA 5EOTA 5F7DA 4BK5A 4E41B 5GIRA 1J0KA 3GMOA 3OJDA 1A1MB 1P7QB 1P1ZA 2J8UF 5D2NB 4Q9QH 5E8DL 4YX2L 3CD4A 1AC0A 4JR9L 2NY3D 4H8WC 2FJFB 2N7AA 4IS6B 5FM5M 3O3UN 1NMBL 4DW2H 4I0PA 4X9IA 5DQJB 2NTFB 4KI5E 1QVOB 2BY3A 1HYSD 1YEHH 2EDOA 4Q0XH 4JJ5A 3RJQB 3CVHA 3QRFM 1F42A 1JNHA 1EHXA 5BVJB 4FFZH 3VJ6A 1BVZA 2Z93A 3GI8L 4P59H 3AAZB 2WSKA 2VLRE 1ERNA 2WWMC 1U8NB 4NT6A 3PHQB 2OM5A 4LPVA 1TZHB 4HWZB 4JKLA 3MMEA 3HZYB 4UT6L 4B53A 3SE8L 4QNPE 4JO4L 4PG9A 1AR1D 4N0RA 2BNQA 3LD8C 4NQCB 1QLEH 3VH8G 3MJ9A 4KUCD 3GSNH 3QUML 4JPIB 3MLZH 5GS2D 4MA3B 1DQML 4M5ZH 3TF7C 4FFWD 4U6HB 3WFZA 1U8OA 4GRWH 1CDIA 1A7OH 3UTZB 4MJ5A 5EN2B 1WFNA 5DO2C 3QT2A 3QI9A 1GC1H 5TDNB 2DM4A 4CN1A 2BMKA 4MJ4A 1I7TA 3L3OB 1D9KD 4R4ND 4LHQB 5C09B 3H0TA 3SDCB 3GJFA 3LAFA 1CXIA 2HTLC 2AVGA 3P73B 2F5AH 2ZPKH 4QXGL 4G7VH 5D1ZD 1MHHB 4GLRI 5F9AC 2BVOB 4U6TA 4CW1B 1OCWL 3QP3A 2VISB 4LRNH 5J89A 4NUJA 4U33A 2EIZA 3ARGD 3UTQB 3AS1A 3RL1B 3WN5B 4GKZA 2HJFA 3BXNA 4IRSD 1MELA 3HLAB 3T8XB 1JHLH 2YEZA 3OKOA 1ES0B 2BJML 1GCFA 5FA4B 2BC4A 3NIFE 4TOYL 3LEYL 5EBLB 4OQ1A 4QHLB 4X8XA 1IFHL 2NY6B 3L1OL 1KTDB 3S97C 3V5DB 4NUGH 1MFEL 1UJTA 4U6VH 3U0TB 1NCAL 4ZXBB 1KCSH 1BF2A 3RDTA 2Z35B 3KGRA 4OGAC 4GW1B 1U8PB 3GMOB 1SJEB 4YHNB 1CVRA 2FL5B 3P9MB 4PP2B 4QHUB 4R7DB 4JRWA 1HCVA 2P8LA 3GBNL 3QHZL 2A6JA 3TO4B 1A0QH 4BH7A 4D94A 1UA6H 5LWYL 1W2KT 1F4WH 2ORBL 4PJHE 3VMPA 3A6BH 1JVKA 1A2YA 2YD7A 2R69H 4WI3A 2Y4SA 4YHLH 1MCSA 3GSUB 3QDHA 3FO2B 1FRGH 1OTTC 3KJ6L 1VHPA 4F15B 5IF0B 3GMLB 2BDNH 5D71L 4OLWL 5MEPB 4GRLC 2ZZUT 4BFGA 1YEHL 4HUWB 5LWYH 4PUBH 4KGLA 1N3NB 3O3EB 1INQB 5F1IB 4OCWL 4I5BB 3DSFH 5IMOA 3BH8B 5FYKE 5D5MA 4ZFOA 1N59A 2R4RL 3E3QE 3TIDB 4H88L 5DZOA 3DIFA 4HXBH 3D87B 1C5CL 2X4TA 5ICZB 3GIZL 3KPMB 3G5VB 4IJ3B 1H3XA 3MOQA 1FN4A 4Y4FA 2E27L 3H3KA 1KB9K 5CSBA 4DGYH 4KZEH 2BX5A 1IAOA 2WUBL 4Z7NF 4M48L 1V8HA 4P9ML 2WP3O 2DKSA 2FX9H 3OJ2C 4R9HA 4ZS7L 4ZXBC 4GG8B 3BJLA 4QOKA 4PGBA 4YBLC 4MJ5B 5DJ2A 4XMKH 2AJ3A 2NY5H 1NCBH 1I1FA 1ZLUK 4YGVB 2E5EA 5GSRA 3JWDH 3U6RA 1ONQA 2HVJB 3RGVB 5C0IB 4QRTB 4AIXA 5JW3L 4XP4H 4Y19E 1TETL 5JW4R 2SEBA 2GJZA 3QDMB 3Q48A 3RIAK 2HFFB 3CDCA 3ZL4L 4KK9C 2GI7A 1XF4B 2EC9T 2VDKL 4YIQA 1M7IA 1KELL 3NH7H 4JPKH 3BHBB 3X13B 3FB5A 1WZKA 2VLLA 3S96A 4GKZB 1FL5A 2ADIB 4WNQB 3VXRB 1UM4L 1NCDL 2ZUWA 5C6TL 4K3JH 2Z9TA 2EYSA 4O51B 4P0DA 4LF3A 2OL3B 2HLAB 3T65A 5JPMA 1S9WB 3KPSE 5TDOB 4OQTA 2VYRE 2LTQB 3AREB 4ORZC 1I8LA 3NIDF 3WUZA 1DQTA 3QG7L 4JO1L 1INEH 4H1LG 4XP6H 2RFXB 4IRJD 2UWEA 3M17B 2WQRA 4Y1AB 3IDXL 4I0PD 3H7BA 5LKNA 1D5BB 3GSVB 4IIQC 5HHNB 4O9HH 2OI9C 5JXAL 1U95A 4U4BA 3IETA 3ARBD 3S36H 2PN5A 4XB7A 5MEOB 1NSNH 3MXVH 2E7CA 3BZ4A 1KPUB 1BWMA 4Q97A 3RZCB 2GHWB 2NY7H 5EIIA 3QZWA 1JWSA 5DD0H 4ALAH 3Q6FB 3VXUD 4C83A 4MA7H 1CIUA 3FHQA 1OARL 4HPYH 1S7TA 2ERJB 2P5EA 4TSCL 1EO7A 2W9DH 3IFPA 3OHXA 1LEKA 1IE5A 5E8PA 4KUCF 1XAUA 2WMPA 9CGTA 3QWOA 4QXTA 4UNUA 4PV8A 15C8L 1ZVSB 4HPOL 4FN0A 1K4CB 5JW5B 3KPLA 1I7UB 4PJ7E 1T1YB 3I75B 5F88B 2CK0L 1ZK9A 2WINB 4NYLB 4RAHA 5C08D 2ZUQC 5EU4B 4HUMB 5F96H 1IC5L 2DQFA 4PJ9B 4LCWE 2VXUL 4DVRH 3HNTH 5HDBE 5FYJL 1TLKA 4YC2B 1YYMH 1G6RA 3NCCB 4G6FB 4ODVL 5ITFA 4PJXF 2V7NB 3V5HB 1TQBC 4UT7L 4M62H 1RULH 5T3XE 4R8WL 1IGFL 3U6RB 4MNGE 1CR9H 1TPXB 2C7UB 4XTRD 4MAYA 3F12B 4CADB 5I1GL 3DETD 1V7NL 3V6BR 1F02I 4FABL 3MCLH 5DEFB 1YJDC 5EIVA 3MLVH 3WNMA 5ACMA 2BVTA 4MDIB 5C0BA 3ILQC 4ELKA 3Q5YA 1VFOA 2BRRL 4Q74A 4F58H 4X83A 5DEZA 5EWIL 5K93A 1FFQA 3OJDB 1FL5B 2ADIA 2DQDH 3EOAB 4MQ7B 5DJ2B 1XF5B 3DROB 5IQ7H 3O2DH 4M8QA 4LEXH 1Q9LA 1WISA 4QTIH 2Q8AH 4RFNC 2DBLL 1NEZG 1NUDA 1ZS8A 2D0HA 2BK8A 4AYFA 2NTFA 2XRAH 2NX5D 3I2CL 4Z7WA 5I1AA 3KYOA 1QRNE 4HF5H 3B6SA 3BWAA 1NCBL 4N8CH 5SWQA 1M05A 2JB5H 3HE7C 3OSKA 1A6AA 4LU5H 4Z78B 5ABDE 3FAWA 4PY7A 1D5ZA 2HT3D 1DLFL 1IGYB 1NEZA 1RQ5A 5DUMH 1WFUA 2AEWA 2J7LA 4GQ9H 5E08H 4WNQA 1I3UA 4I0CC 3VXRA 1W72B 4UU9B 4A6YL 4ONHB 5EDXA 2A9NL 4HUUA 4CUCA 3FQTA 4G6KH 5DMIH 1HOCB 4FZEL 4KK5D 1HH9A 2ENYA 3EKCA 1MQKH 1QA9B 4DGIL 3NABH 1BM3L 4B7LA 2X70A 5J6GB 1JF1B 3U7WH 1NC4A 4LMQI 5FYLH 3P30L 5CEYA 3AUVA 3B2VL 4OCMC 5KVDL 3ETBF 3OKMB 4AG4L 3VG9C 5TE6L 3WXWL 1CGWA 4V1DA 1WTGT 4O4YL 1FDLH 3HUJE 2ARJA 4PLJC 1DP0A 4HJJL 4HIHA 4PGCA 1C7TA 2GITB 5C0FB 3U0PB 3CFJB 1E4KA 4XZUB 5FYLD 2QQKL 1AD0B 4R7NA 2VZ1A 2NY0B 2G60L 5H35B 4O58H 1JNNH 3GBNH 5CUSL 1NGPH 4G8IB 4PBXA 2VISA 1T66C 1U3HB 6FABH 5TE4L 3K4DA 1IM9B 5CMAB 3ZE1F 1UZ8A 3IYLW 4Y5VC 5K9JH 4NO5B 4LCCB 4M93C 4X7SL 4JRYA 4HUVB 1X5YA 4NKOB 1HHHA 4O58L 1A02N 1ES0A 3OXSA 4HF5L 5BRZE 3HFML 1MWAB 1PAMA 4EIGB 2XFXA 4JGUA 3GSQA 2CO7B 1CU4L 3KYMB 2NY3C 3U1SL 3MLTB 3O2WH 1YEKL 3ARDC 3UJIH 2XXCB 1S3KL 4XC1H 5C2UB 2HYMA 4QHUA 1E6OL 3IDNA 4K8RC 5I74B 2ZPKL 4QXGH 5IW6A 3CDYA 1JGUL 5D8JH 2OQJA 1T1XB 2BVOA 2YD3A 1CQKA 2VH5L 4H1LB 1FHGA 3OXRA 1OL0A 2FEDD 4XVTH 4IOIB 4JVUA 4ZFGL 1CBVH 1NBZB 3RUGE 4MJIE 3UTPE 1S9XA 3SKNB 3QUMA 5IFAL 5B3JF 4CBPA 1BQLL 3GJEB 4UIMA 3GSWB 4RGND 2ZCKH 4CMMA 1QR1B 3VMOA 3SCMA 3MR9B 4EUPH 3QUMH 3EBAA 3SDAD 4DQOH 5H2BA 5FDWA 4YXLL 5J4MA 1YNTA 1UXWA 3QUXD 3NPSB 3F7PC 4DCQB 2AKRB 1AXTH 1C1EL 4J7RA 3QEQB 5FCUH 4JM2D 1K85A 1X4ZA 5DD1H 1UM5L 3X14A 2A83A 1HNFA 4GBXC 2EDYA 1WBXB 1F3JB 5K9QG 4K3DL 4KI5C 3MBED 2PYFA 4JM2B 2Q87A 3ALPA 2A74B 1G9ML 2HAZA 4QGTA 4V1DB 5F9WC 2VLRB 5IVXB 1B0GB 1CZ8H 3MROB 1FC1A 3L3IB 4R4BB 3KPSD 4JPKL 5BMFH 5EG6C 1NLBH 1C8PA 1M4KA 2FIKB 5I30L 3O9WB 5DVKA 1ZGLM 3RNQB 1KLGA 2P5WB 1QQDB 2PUQT 3PGFH 1FYTD 1I4FA 2GUOA 3QDMA 3L3HB 4D8PA 2FR4B 2DKUA 2OL3L 5KVEH 2HMID 2DQHL 1KC5L 2C9AA 3UJJH 3QUKA 4QXUH 5TE7H 3B9KC 4N0UB 3OGCB 2M2DA 1BVLB 1HSAA 3U4BH 3WLBA 3OKDA 2LAAA 3QQ9C 4KK8D 1MWAH 3K8KA 3RGVC 3TCXA 2HTLD 1UACH 1X3DA 1PDKA 4LARL 4U1HA 1U58A 1A7RH 4GQPH 4JRYE 4PLNC 1D9KA 3MNVA 5L0QC 1LO2L 1FVEB 2R2HA 2OTWB 4Q2ZB 1X4YA 5T5NG 3ARYA 3LRSA 5DJ0B 5FYKH 4ORGA 1U3HA 3E0GA 1K6QL 2VB5A 3W2DH 4MNHB 2X1QA 4U3CA 1S7SB 1L7IH 3O81A 4UBDD 2A77L 4F37K 2B4CC 4GG6A 3IVKA 4U1GB 5FGSA 5IK3B 5HY9A 5T1DH 1J1PH 4ODBD 4Y4HD 4NCDA 5CGMA 3MOBL 1MLCA 2AP2A 4GT7A 5E5MA 1JWMB 4FHBD 3F58H 1NBZA 3TNNA 4LCYB 1QKZL 5E4IA 3GGWB 1HHKB 3T4YA 1GGBH 4WGWB 1TFHA 1DBBH 1NGXB 5I1KL 3QZWG 1MJ8H 2WIIB 4N0YL 3RBGA 4J3TA 5ADOL 5I16B 1HQ4A 2X1PA 4RZCA 4MQSB 2AABH 1BQLH 3MPCA 3ROOB 4PRPB 5E6ZA 2GT9B 4JFEA 2H2SC 1P4LA 2E6JA 3MNZB 4OZGA 1F58L 4ZD3L 3CUPA 1KGCE 2ADJB 3DTXB 3WKML 3MUZ1 3DI3B 2F8XC 4S11A 1FGVL 3O9WC 4M6NL 3VI4F 3D0LB 2E7HA 3O0RL 3MZGB 4DUWA 3JV4A 4PRBA 4JAMA 3C6LA 1DBMH 4WTZA 4XB8A 5IBTH 2QQKH 4XVUC 1BQSA 2DYPA 1JF1A 2K3TA 4Z76A 3P0VH 5H8DA 4XXDB 4OZGE 1L0YA 3MNWB 4X80L 1Y18B 4Y2DD 3TV3L 4DKEL 5IWLC 4L4TE 4YXHH 1A7PL 3V6FA 4KVCH 4OKVB 3C87A 2R0ZH 1FORH 1OT2A 2VDMH 2NY5C 4P57A 2ZOKB 1A0QL 1NAML 4OFKA 2D7NA 5DHXB 1P6FA 2JJWA 1TVBA 3IJYA 3KPQA 3N9GH 5D1XA 3RQ3A 1L9MA 3GSXA 4JFHD 3ET9F 1ITBB 4NP4H 4JO1H 4U1JB 3DROA 1X5IA 1EPFA 1X5XA 4AEHL 4F8TA 1UG9A 2ZCHL 1R24B 1CICC 1YMMB 1MRDL 3OR6A 4XAWL 1HXYA 3SGEI 5HGHB 5FO9A 1ZHBA 4I9WE 3L9RA 1EUTA 5DK0A 3RU8H 1IC4L 4D9RE 1A3RH 4XNXL 1AJ7L 4EN3B 4OCWH 2VKXA 1DBAH 3BN9D 3ARBC 1N7ML 5M94B 3HS0A 4OZFB 5I8EB 5FUOL 2V9QA 5A2LH 2J8UB 1IGJB 3NA4A 1A47A 2UZXB 4HS8H 1V7MH 1T4KA 2VDOH 4CAGA 5E70A 2Z92B 4TNVF 3KPNA 5ISZB 5HHOB 1U8JB 2COQA 4FQIL 5I1DB 3QUYC 4OIIH 5KSUA 4OT1L 4HEPG 2DQDL 4UOW0 1MHPL 1Z3GH 3MLSL 1SYSB 4O02L 4L1DA 2J8UE 2RHEA 2EDFA 1IAIM 3VA6A 3RUGF 3U4EA 4MNHA 4KKNA 4W6WB 1RFDL 5B3JE 4R7DA 1TPXC 2JELL 4PJGA 1MNUH 1RJZA 3LZFH 4NWTH 5L9DH 1UYWL 2IPKA 1IQDB 1KJ2B 2FHBA 1MFAL 4F57H 4LQ1A 2Z31A 4P2OB 4JN1H 4Z7OE 3ARZA 3M1BA 3IB4A 4OQTH 3QIWC 3S34L 5EUOA 1FZMA 5BO1L 4XVJL 4HQQH 4F9LA 1JGLL 5HGDA 3O2VH 4N0FB 3CVHL 3O3BA 1L7TH 4NZUL 3PWVA 4JGJA 3F8UB 3ARFA 3PHOA 4ZPVA 3MLUH 1IM9A 5D1XC 3PV6A 2HFEA 1T1WB 4LLQA 2UYLB 4JZJB 4BKLB 2F5AL 4GSDL 4AQ1B 3KPMA 4X6DE 3ULUD 1INDL 1WAAF 2R0KL 3QQ3A 5LGHH 3HZMB 4LNRA 1T21A 1V05A 4G8EA 1BLNB 1VPOH 1UWXH 4PJDE 5L7XL 1CK0H 2EXYC 3IJYB 1JZ3A 1CLCA 1OP3K 1ORQA 3ARED 4JHWH 2MJWA 2DMBA 3RWGA 2F54A 5HVHB 4WIQA 3C5JB 4YXHL 2DYPB 2E7MA 4EDWL 5ID0B 1U8KB 3SGEH 1NAMB 4QHNB 1Y18A 4OM1H 1RSFA 3IDGA 1MPAL 2VAJA 3S5LG 5FYLE 3MV7B 3ILQD 1PG7W 3AM8C 3NZ8A 3MRNB 1BFSA 3N9GL 1NBVL 3FQNB 2VDRH 3QDMD 5I2IA 3KPTA 2KZWA 3KPQB 4KKAD 4DWHA 2WWKT 1I9EA 2J8UA 3GO1H 4X6BA 5GZND 2DI7A 3BPOB 3KS0H 3MTRA 4JKMA 3LDBB 3SGJC 1MCRA 4LLUA 4ZXBA 2X5PA 2V7HB 1I9JH 3KS0J 5AYUL 5A3ID 2YMXL 1WAAA 1XR9A 5EU5B 4MD4B 1T5WB 2QQNL 5ALBL 4XNYL 4PS4L 4WEUD 3G6AB 1RZJL 3AVEA 1PD6A 1S7QA 3QAZB 3VFRB 1DZBA 4M62L 1CBVL 4BJLA 2VWEC 3WUWG 1J1OH 4ODHH 4P9HH 5AAMA 2DQHH 3BIAX 4PJEF 4ZUSB 4TN9A 1UJ3A 1NCWL 1CFSA 4XNYH 4K3EH 3T77A 5J57B 5C0BD 3CCHB 3QI9D 2EDXA 4JRXE 5CZXC 3BZEA 4OGAD 3X3GL 1XIWB 2IQAA 1SQ2N 1OB1A 3TO4A 1ED3B 1EEYA 1FV1A 1WWAX 3MLWL 2JJVA 5J9PB 2VZUA 4PRPA 3VD3A 4C59B 1XZ0B 2QR0B 2VQUA 4PRDA 3DGGB 1OAUH 5I74C 1KLUA 1Z5LA 2P7TA 5SWSD 3C09B 4H5SB 5D7IB 3P11H 5D1ZA 1T2XA 3LB6C 1EEQA 2H32H 2YD5A 1BQUA 4TQEH 4HK3J 4ODVH 2EIDA 3MRBA 4CNIB 1OGTB 5KVFH 1FFPB 4HZLA 5IROA 5EBMA 4KRPC 3BKJH 2W9EH 1AH1A 3PWPA 3DIFB 3QH3A 5DWUL 3B9EA 4WTWA 1Z9LA 4RMWA 3SBWC 3OL2A 1ODAA 4NN7B 4ODWB 2XPGB 1QQDA 1KENH 3HC4L 4Z7WE 4EN3D 2DTMH 4TNVK 2BSRA 3X3FH 1TNNA 2CDEB 2OMBA 4BSWA 4WI6A 2HG5A 2FR4A 1RZKC 3ARDD 1XH3B 3DUHA 1BJ1J 4KY1L 4CADA 5D93C 4G80A 4G7YH 12E8L 4K23H 8FABA 2L0DA 1IILE 5C6WH 3QI9B 2JCCB 4LSDA 4G9FA 1RUKL 3MX0A 3ZKXC 5LQBH 3RWIA 2Z8SA 3QDGE 2YS4A 5C09D 4XP9H 4M3JA 3BRFA 1RVFL 5I16A 4U1SA 5EU3A 4BQ6A 4JO2H 1IAIL 3ARRA 1B9ZA 5DK0B 2H3NB 1JHTA 2HWZH 4L8DA 3A0OA 1EHLH 1NBVH 2RFXA 4QY8A 3V0VA 1FAIH 3V6OC 5SX5H 2Z35A 4Y5YB 3PWPE 2AJZB 5KSAA 1FG2B 4AT6B 4ZYKA 1H5BC 1X9QA 2I25N 3BH9A 3QPQC 2H8PB 1LP9A 3GHEH 3QCUL 4H26A 1MCJA 5HVWA 2W9LA 3QRGH 3R0NA 2OL3A 5JPMB 2V17L 4ZS6C 2P24A 2YKLL 5FA4A 1D5IH 5DHVH 3GSOA 2V2TB 1U8HB 3RZWA 3FT3B 4M7ZB 2MNUA 5BOZG 2C5DC 1J05A 3D9AH 4JM2C 1N0XH 1A6WL 4HJGB 3QIBB 3IKCA 1FLRH 2E8ZA 2CQVA 5LCVH 5GXBB 4IHOA 1R3LB 3P4OA 3NCJH 4MCZB 2P49B 4MD4A 1KN4L 3B5HA 4LSVL 4AEEA 1WF5A 3UTTB 4X99A 3ZO0A 3NPSC 4I0PC 2QSVA 1OP9A 4NDMB 2IH1A 1C5CH 1MHEB 2YN3A 1HINH 4B41A 3ARDB 4MJIB 4RA0C 5C8JA 5TDPB 5I1CL 1NMBH 3DURA 5J7CC 1WITA 3FL7A 3P9LA 1DVFA 4XX1E 5SX4I 1J0YA 1RV6X 1PLGH 3FCTA 4Y4HB 4ODHL 4P9HL 1J18A 4Y7MA 5ITBH 3TN0A 3IS1X 3B5GA 2JJTA 4QXTB 1VACA 4Y4HC 3QUZC 5DRZB 4J8RA 1MRCL 1WCQA 3OKYA 1N5AA 3BEVB 3LIZL 4IBLT 1XZ0A 2R23A 4FQ1H 4PB9H 4P57B 1DQMH 3TJHD 2Z91B 2V5RA 5E2UH 5IBUG 3K80A 2W92A 4OI7A 2BNQD 3AXLA 4YX2H 5DLMH 3S35L 1RUPL 4CDHA 5JHLH 2CD0A 1A6UH 1UGNA 2YKLH 5FAAA 2CRZA 3WDIA 2FO4A 3PP4H 1AHWB 3T1FA 5KS9F 2HFTA 1XGTA 2IJ0C 2R2EA 3QH3B 1HHJB 5AYQA 3E2HB 3R8QA 4TULL 4I2XA 5T1MA 3FO0H 5CSZB 1KSRA 4HK0B 1NH6A 3ARWA 2BSRB 4PD4K 2ICEA 1UM6L 1KLFA 2OJZH 1WC7A 3FAXA 4YBQC 4BZ2H 3L7FA 5F1NA 2I60L 4NBZB 4XP1H 2NZ9D 3D0VA 3SHSA 2KBGA 1RZ7H 1N8ZA 1EJ6A 1RI8A 3HRZA 3FMGH 1LO3L 5HHOD 1FE8L 2WAHA 1KTKE 2MPAL 1S5HA 2RR3A 1L6ZA 4JQXC 4NRZB 4OZHB 2C3GA 4YHNA 5D7LA 2V17H 1KIQB 2AJSL 1RZ7L 4O02H 4PRNA 1Q0YL 3WLWD 4UINH 1KYOJ 1XF1A 2FIRT 4Z8FH 1QBLH 5IMMA 1Q9OA 2NNAB 3VI3E 2Q7YB 5HYJD 4QRPB 3HPJB 4HKJB 5DJYA 1K2DB 3LPGA 1MRCH 1G9NL 4HMEA 5BZDB 3HMXA 5IT2L 5E2JA 1CICD 2XWBA 3VRLF 4OZHE 2O5YL 1DDHA 4HIHB 4IOFC 2IPKB 3DX7B 2EYTB 3I85A 3EYSH 3VRJA 4GKNB 3HNSL 1ORQB 1A3LL 4Y2DC 2GJ6E 2Y7QB 5I66B 5I18L 2A0LC 4C54A 4PGDA 1H15B 4UDTA 5F7MC 4XT1C 4ZPTA 2ILLA 4MXQD 2HTKC 5FK9B 3MOAH 4OFPA 1CE6B 3QEGH 3KJ6H 2YA0A 2ZUSA 1RMFL 1MEXL 1CICA 4R4FL 4O9HL 2EIBA 2ZG3A 3LHPH 2ZOLB 4Y2DB 4ZUUB 4GW4B 5IJKC 1K4CA 3WHE1 5JW5A 3QB7C 2AXGA 4LPUA 4LQFH 4ZOEA 1X44A 4L4VE 3MLSH 3LMJL 1G7JB 4YHML 4OBRA 1WLHA 3HZMA 4LNRB 1UWEH 5IFAH 4OF8A 5JIKA 4LSPH 3O11B 1U92A 2VXTH 2DS4A 4L3AA 5CWSA 5F3BB 2FRGP 3MRMA 4HIJB 1FZKB 2AS5M 4LHUA 1LP9E 3PL6A 5I8CA 3G04B 1EHAA 3V95A 5C9JB 1GH7A 2ERJC 2VC2L 2VDQL 4QTHA 2CUHA 5B38A 1YNLL 1GGIH 2YZ8A 3IJSB 3L5HA 4C56B 5D6DC 3EDFA 4PRIA 1S9YA 3S37X 4HLZH 4JREB 3OAZH 1KT2A 2GFBA 4O2FA 4LIQE 3GO1L 1ACYL 4PREB 3V9FA 3ULSA 2NCMA 4XPFH 4WWKD 1KG0B 2M26A 3IXTA 3I3BA 3TEUA 2A6KB 1I1YB 4HWBH 3TBVB 1IT9L 1OGAE 3O8XB 3MQIA 3HG1B 1IEBB 4JFDB 5CFHA 4MD5B 3GJEA 3RZCC 1U3ZA 3VXNB 4QRPA 1A4KB 3BP7B 2I9TB 2ADJA 3KPPA 1SEBB 1WT5C 1OLZA 4P5TA 1DBML 1O7SA 1S78C 3BSZL 2ARJB 2NLJB 2X9WA 3TN0D 3MA9L 4ZAKA 3BEWA 4P2QD 3SDAC 3AS0A 1IRAY 4NFBA 4BZ1L 2H6PA 2IPTL 1VADA 2M1KA 3C60B 1B6UA 3MV7E 4P23C 3U0PA 4JFDE 4P4KD 4P23A 1T80A 1JGVH 4NHUB 4RAUB 1G7PB 3GBLA 4U7KA 4JPIA 2YRLA 1CDBA 1LK3L 1LO2H 4P5KA 1FJ1A 2XOTA 4WCYH 3B9AA 4XVJH 5D1QC 3P9WB 2H9GA 4HK3N 1RJCA 4ZSOA 5IOPA 1CXFA 5GRVL 3WS6A 4EJ1C 1UZ8B 3DVNA 4H5SA 5D7IA 4Y8AA 3N1FC 1FSKC 4JRXA 3OXSB 4K3HA 5FF6A 1JFQL 1Q8MA 5IROC 4PGDB 2JK5B 4MSWA 4WW2F 5BV7B 3SKMA 4GRLA 4UUJB 4MA1B 1MCKA 1MRFL 4KDTC 1EO5A 4U7MA 3O6FC 2FSEB 5GISH 2YXFA 3C8DA 4QRPD 2VXUH 4HZLB 5DRXA 4EEEA 1R3JB 4MA1C 1I7ZB 3UMTA 1A5FL 1C7SA 1CXLA 3T0EE 4HLZG 5B8CB 2ZNWA 1KB5B 1AXIB 1S7VA 4PIRF 5C92A 5GZNC 4ZQKA 4XPGH 4OZIA 2BC4B 5EA0L 1C16A 1FC2D 5F9OH 2W65A 3ZKND 3IJSA 3SDYH 1U36A 2D4DA 4IMKC 4XPAL 4M1GL 5JXED 4G6AC 4OLUL 4ZTOL 3B8SA 1LILA 2GSGB 1CGSL 1O5DT 4NRXA 5E6IC 3IKKA 4GW1A 1U8PA 2Y36L 3O41A 4WHDA 3H9SE 3FQRA 1UJ3C 3SQBA 4ZUTA 4HGWA 4X7SH 5JDSA 1LDSA 1EJOH 1ZTXH 2DM2A 5KAQG 2KL6A 3KXFD 3BUTA 3L7FB 3HAEH 4XBEH 4NDMA 5E5MB 2VDNH 3IAQA 3HB3C 2H2PD 4LLVA 5GHWL 1CS6A 3OR7B 3VXUB 1KTRL 4R26L 1W72A 4UU9A 3FHAA 3WNLA 3MLZL 3F65A 1ZTXL 1U3YA 1J5OL 2C26A 4JQIL 4OAWA 3ZE0E 3OKOB 2VZTA 3MGOA 1R5VB 4PTTA 3FQWB 3U0WH 5EZLB 5BW7A 1RZFH 3I6LE 2GEEA 2VZSA 4M4PA 1IKNA 3EYQD 3LKQA 5E8DH 3C2AH 3KHQA 3PWPD 1JNLL 1YN7A 5DT1H 1X5ZA 3CXDH 3SPVA 1OAQH 4ZFOB 5IMMB 1E4XL 4RFEB 1AP2B 3LQAH 3MXWH 1NUNB 4IHOB 2DMKA 4JLRB 2IANB 2B8OT 3JXAA 5DJAB 5FM5O 3BP6A 1FNFA 3RVXC 3S88L 1K3IA 2YPLB 1MJJB 4XAKD 4JREC 5JR1H 2OK0H 1H3TA 1YEFH 4RMRA 3BQUC 5BXFA 5E2WL 3KAAA 4L3ED 5IJVA 4MA8H 4MJIA 4Y5YC 4ZO7A 3ARBA 3C6SA 3LV3B 4M1CC 3L3IA 4R4BA 2Z8VC 2VXSH 3ZYZA 5DMYA 2GAZA 4RGMB 4AZ8A 4JRXB 4ZMAT 2YD4A 4LPCA 5F7FA 4Z5RB 2IMNA 1Y6KR 3RWGB 4QHMB 3O3EA 1NAKH 1T0NB 5HGGS 3NA9H 3ROLA 4LVOB 4P3DB 4X6DA 3JTSA 3MA7A 2JTDA 5FOBB 1KB5H 1F4XH 5DJ0A 1ZGLP 3D0VB 4KVNH 4DUXA 2DI8A 3STZB 5D93B 3HCVA 1XGYL 3OKDB 3UTSA 4QRRA 1IBGH 5HHOA 3T8XA 1YMMA 1RU9H 2R15A 1YY9C 2A6IB 5EBWB 2FBJH 3B9KB 3RJDA 4UV4H 2XI9A 3FB6B 3QCTH 4KTDH 3P30H 1A6PA 4NNXA 1ZWIA 5IWLA 2ADFL 2ZG2A 3T1FB 2FJHB 4RQQB 4OD2B 4JFQA 3T4YB 4UILH 4C55A 3U9UA 4RGNB 4WTXA 3OX8B 1CD9B 3H7BB 3LRHA 2F19L 5D2LB 5JLZA 4S1QH 4X6FA 4LEOA 3U2SB 2F58L 5ICXB 3HC4H 5D5MF 4E5XB 3LN5B 1ETZA 4XMKL 2I5YH 4MZ3A 2NY4D 5D7LD 2Z93B 4EI5A 5FOJA 3C60D 4V1DE 4D0BB 1QPXA 4MB3A 2F58H 5I9QB 3P4NB 2R29L 5K33A 4HS6A 1HN1A 2BNQB 2XQYG 3TJHC 1HKLL 1QVOA 1QFHA 1JGVL 1JTTA 3MRLA 3QA3B 3DOSA 1OTSC 1KPVB 3DUSB 5DQ9B 3VFVB 3TBSA 4OM0L 1IJ9A 1UH2A 2Q86B 5IP4A 2XN9B 3EOBA 3VWJD 3PL6D 1BD2E 3IDJB 3TA3D 1B0RB 2BNQE 5KAQF 4YPJA 4OF0A 3V4PL 1C08A 4HS3B 4TUJA 3R8BB 1HIML 5SWSB 1B4RA 4FFVC 1KXTB 3MRMB 4KRLB 5CJBA 3WHXA 5EUKA 3BVNB 4YBQD 3FT4B 2APTA 4BUGA 1A6VH 4MVBC 5E1AA 4G7YL 1DN0B 2CUMA 3LEVH 1GGTA 3K4ZA 3M45A 4ZFGH 2UUDK 4FP8H 2J1KA 5DXWA 4FS0A 2VH5H 1MJJA 3NABL 5KVEL 4J3OC 4XNQB 2QQNH 3O4LA 4Z77B 1MQ8A 1KCSL 2PETA 5ESQA 2H26A 4MXVE 3I75A 3ZDYF 4JHWL 1ZSDB 2VQ1A 3S4SB 4NC1C 4WFHE 5J6HB 2BHZA 2H32A 3QEUA 3ULVH 5I0ZA 1QFWL 1NMCC 1ITCA 1UB6B 4K7FA 2HWZL 1CT8B 1ZT7A 4NUJB 3LQZB 4JFZL 1CDUA 3ULUF 4NC2B 1FSKB 4ODTL 1OGAD 4ZFOL 1V3LA 3MUGA 1QFWM 1P84K 4EUPB 4NQCD 4K8RL 4BH7B 1REIA 2XG4A 3TVMA 5IG7B 1JWMA 1VGEH 5GGRB 4GMTH 4P2RB 3VI3F 4WW1A 4JDVA 4J3VA 5C09E 1G6RH 3MRJB 4QOKD 4POZD 2NX5B 3ARXA 4R4NC 5L2JB 1ZGLA 3ARQA 3F7QA 2YMXH 1QUNA 3S34H 3FB6A 3PDOB 1QKZH 2WIIA 5C7XH 2FJGB 3G5YA 1PGRB 3QXDA 4HGWB 3PIQA 1WUNT 2KUTA 3JSSA 4RDQF 5TE7L 3F6LA 4WUUE 1JTOA 1MCHA 1AXSA 2OSLB 4OZGB 5JW4Q 5IQ9A 1YYML 4NKQB 4JHBA 3G5VA 1OP3H 2VJXA 3B3IB 4OGZA 4HKZA 1IEBA 2QQLL 4LCIL 5IW1B 3QWOB 4PJ8B 4F2MA 2E9WA 3O6FA 4KJYA 4LSSL 4PP1C 5E56A 1MCNA 3JWOH 4XNUL 2R4SL 5DQ9A 1OAXH 1AY1L 4KDWA 1P7KB 2GW5A 2B4CH 1KJ3H 1NMCB 3FKUS 5CZXD 4UUJA 4D9QD 1FV1B 4R3SA 2BRRH 3ORJA 3TO4C 1QSFB 1YEJL 3D39B 5SWSA 1VADB 1G1CA 2AXFB 4Y5XC 4NQDE 3RGVA 5IGXH 3GMNB 4NHUA 4Z18A 5C3TA 3NA9L 4P2QE 1FO0A 1CF8H 2G75B 2NXYD 4G9DA 1G7LA 3VFVA 4WO4A 2YHGA 3OF6D 4WWKC 4KROC 4CVUA 1JMXA 4OIAA 1T5XA 1WVZA 4P9HC 1VEOA 3H9HB 1GRWA 2WM0A 3EJYD 1KTLB 3EGSB 4HHAB 3OR6B 4HUXB 3GMPA 4NP4L 3BYYA 1ZT4B 4UQ3B 2BCKB 2QL1A 4R0LA 3OQ3B 4OBSA 5F8RC 4QF1A 4WHYG 3IRPX 1RUQH 3NCBB 1XIWC 4O2CA 3RZCD 3JTSB 3MA7B 5K9OB 3UXFA 4XCNA 3MCKA 5DRXB 4YEEA 4ZAKC 1QG3A 5ENWB 2AW2A 4NN6B 1IGJA 3PP3K 3WJJA 1AJ7H 5GJTH 3OB8A 3AS2A 1UQSA 5I71B 2GK2A 3MA9H 4HUNB 5B8CC 1YEEH 5GQBA 3HMXH 1D5ZB 1UFUA 2CR3A 3QXAA 3CSGA 5J8OA 1E0OB 4A6YA 2XKUA 3QDAA 1ZWIB 5BV7C 1II4E 2Q20A 2V2XB 2WWMD 5FGBA 4NQDA 2EKJA 1TZIA 5FHAL 1PZUB 4K3EL 1AE6H 2GSGA 1DEDA 4NRXB 4K7FB 2DJ4A 1VGEL 4E41A 4YHZL 4C83B 3ZL4H 4EDXA 5GGQL 5D5ME 4DFIA 1LP9B 5DJZA 1NFDB 1EJOL 4LRIC 3W0WE 1F3JA 1H0DA 3QG6B 4NNYB 5GS0C 3UC0L 1DFBH 4CN4A 4NJ9H 1CFVH 5F7HA 3VH8B 4LCWB 2IQ9H 1WT5A 1K2DA 3ARFD 4NKDA 2OP4H 3BW9B 1X5JA 5GGRA 3V7MA 3M1BB 5IM7A 5I75B 3BZ4B 3KVQA 1KLUB 1FPTL 3QEHA 1VB9A 4XMPL 5AYUH 3RY6C 4Z6AT 2JJUA 3OV6A 3MRDB 4JFFD 1MEXH 3M8OL 4LDLB 1MRDH 1QACA 1OT1A 4RWHA 4YHLL 2IGFH 1EK3A 1KIPA 3MLVL 4B7IA 1F6AB 5BRZA 5J1AA 5I1EL 1EBAA 1GZQB 3CPLB 3HKFA 2C3HA 3SN6N 4BQBA 2AXFA 5DMGC 4K2UH 3EOBB 4X7FC 2AABL 2QADC 3FZUD 3DUUB 4NKOA 1N2RA 5TF1L 1E4WH 4WO4B 3MJ9L 1QRNB 1FVEA 4JFYB 3JTTB 4BQCA 3MLTA 4PGEA 3K8LA 5E1AB 5KOVC 4KZEL 5HYSB 1KJVB 4HWNA 2H2PC 2MSPA 1MUJB 4FNLL 4N5EC 4NQCA 3ZKNC 3RPIB 1ZS8B 4Q9CA 4MXVF 2VMFA 4ZNCD 1CG9B 3P11L 3AMLA 1S8DB 3FB8A 4N8VB 3L5XH 3NCMA 5HY9B 4L8DB 1NDMB 3VDAA 1P4BH 1HKLH 3LN5A 2BHYA 4TSAL 3C08L 1FYHB 4LEXL 2JJSC 5DD1L 3UTQA 1X7QB 5KW9L 1KYOK 1YY8B 4G9FB 2BRQA 4X7CC 4UQ2B 5DMKA 1DTUA 2HN7B 4NKMB 5T1MB 5EBLA 5IB4A 5D7SH 2G2RA 2XN9D 3VWJB 1J0JA 3D85A 5FO8B 1DCLA 1QYGH 2IAMC 1RAMA 2B39A 2YPLE 4UTBH 2J3SA 3BUYB 4J6RH 5C0RH 1F6FB 4TVPH 3DV6A 1PZ5B 3U4BL 1JF6A 2ZNXA 5HHVH 2EIZB 3C5ZA 1M1SA 2DOCA 4ZFZB 2Z8WC 1OGAA 5ALCL 2FWOA 3IFOA 1O0VA 4C57C 4U6VL 4M61A 32C2B 2FCBA 4LCCC 5GRXG 3I6LD 4KTEL 2J6EH 1Q0XL 5JOPD 3RIAF 5FUCC 35C8L 4FQLH 5F1OB 2GCYB 4EIZC 5D6CB 4FQIH 4PJGF 3SDCD 1Y6NR 1DQQA 2R9HD 2VSCA 4ETYA 2QR0A 2WK2A 2IPUG 3RHWF 4HKZB 3WE6A 3TT1L 3CVHB 1KEGL 3MRLB 1XF3A 3AY4C 5GJSL 1QHOA 4BUHA 4RBPH 5T3ZD 4UV4L 4YR6B 5ADPL 4PBWD 5IM7B 2HRPH 4OLWH 4Y4FB 4Z7UA 1U8MA 3N0PB 4LVEA 3MBEB 4HMCA 3QFJE 4TUKH 5DVNA 3S3SA 2NYYC 1A3QA 3FN3A 2ZCHH 5EO9B 3O6KH 1DVFB 2HTKD 3EJZD 5HVHC 4BSVA 5T3XL 1DBJH 3TO2B 4RFNB 3HFMH 5L2KE 2D3VA 3GMNA 4W81A 4WUUD 3BVNA 4JKKA 2CO6B 2YC1A 5ETUB 1G7LB 4LLYA 2X4QA 2MCPH 3TPUA 1AR2A 5EN2A 1V5JA 4K7PX 4MHHG 4OI8A 3QQ4B 3U30C 4E0RB 4XP1L 1NFIB 1QBMH 4W70A 1CVSC 4PR5B 4TVSa 4I18B 4K07A 4XRCA 1SM3L 1U3HC 3JWOL 4FNLH 4FXGA 4L5FL 5HPMA 1NLDL 5CAYB 1IAMA 1QFWH 2AGJL 1MAMH 3L6FA 3HRZB 3O41B 2VC2H 1EX0A 4JO2L 1NL0L 5IB4B 3QXUA 2HKHL 3T2OA 5BV7L 3QEQA 2ITDA 4MXWH 5D2LE 1M7DA 4Y19D 1CIDA 1UYWH 2Z31B 4NQED 1FP5A 2EICA 3S35H 1BX2A 3OR7A 3CLFL 1E27A 2YRZA 2OZ4L 4ZNEE 5HHVL 3RX5A 1G6RL 4LHUG 5E9DD 2YWZA 4HCRH 1FGNH 2V9RA 1A7OL 5C0RL 1AQKH 5I9QC 4OFDA 4PJ8C 1AGBA 3O6KL 4K8RD 4QRSA 4HJJH 3QDJA 3ZKQD 1NGYA 4RIRB 4FQXC 3VGAB 1P9MC 3U79A 4RGNE 1JPTH 4IS6A 5BMFL 5EZIL 4Y2OA 4H8WL 5I76B 4PJ5B 1MCWW 4K9EH 5DRWA 4RNRA 3H8NA 4MHHI 1A3RL 4KHXL 4TTDC 3BPCA 2GIYA 4WU7B 1H8NA 2P5WE 1KIUA 5F6IC 4F2MB 5C0JB 3BDBA 5AEAA 3TN0C 4MVBD 3ILPB 5DJ8B 4G42B 5J13B 4UQ3A 4KJWD 3L7EB 4RAUA 4WFFD 2VDPL 1VFBA 5J3HD 4E42A 4U7SA 2VRAA 3GSRA 1D5MA 5BQ7A 1MWAL 5I75C 4JG1H 2AQ3A 1JK8B 3SDXE 4FG6C 3RL1A 4LAQL 3WN5A 3X3GH 4KQ4L 5F9WB 4JY4A 2OR9H 1R3IL 5F3HB 1MCDA 3H42L 3I2CH 3PWUA 3UYRL 3L3DB 4AJ0A 5A16A 4M43H 1DQDL 5HHPB 1ADQL 3T2NL 4LLDA 4TSCH 2XIDA 4LLYB 3C08H 2X4QB 3SKMB 4HFWA 3SY0A 5CHNA 3LS5L 3WIIH 2PO6B 4LAQH 4M6AA 1F45A 5D70L 4L9LB 1MFDH 3LEXA 3TH4T 5C9KA 5J13C 4K3JL 4YGAB 1MSPA 1QR4A 3NAAL 4NO2A 4TNWF 4APQB 5F7KC 5ID0A 2XICA 3G6JA 3LKOA 1YQVL 1LHZA 3E6FB 4JFOA 3ROOA 3LQAL 3NZ8B 5DWUH 2CDFB 3MRKA 1BFOA 3B2VH 5KVDH 4UTAL 4KK8C 3BKCH 3T3MF 4ZUSA 4BQ8A 2E7BA 4H0IA 4IMKA 1GIGL 5C0EA 2WBKA 5DZLA 5F8QC 2Z4QB 3D39E 2CIKA 4QXWA 3ZE0F 3ESUF 1GOGA 4MQ7A 1K4DA 1XF5A 1NGWB 5GRWA 1HQ4B 2IFGA 4OCXL 3SKJL 2FNBA 3QIUB 1WCBB 5E00B 2NXYC 4PLOB 1I1AA 5DC0A 3IXTB 1JPGB 1B6DA 3CFBA 5FYKD 1QBAA 2APVA 1TCMA 3SDDA 3ARVA 3VFMA 3H9ZA 4PY8J 4OZGF 3RWEA 1J8HB 2F53A 5KSBA 1U9KA 3VFSB 2ZCLL 3HHRB 1IAIH 2HFEB 2P8LB 3L3KA 1FJ1B 5C08B 1ZV5A 1HWHB 1TCRA 5BO1H 5CEXA 1QNZH 1WIOA 4P2RE 1N4XH 1KEMH 3QQ3B 3OKKB 2AJYH 4JQVA 2KPNA 5JORA 2NLJA 3CFCL 4GO6B 3Q6FA 5HHQB 1MH5B 3L5JA 5TF0A 3UPAA 4YDVB 4NPYA 3MLUL 1F3DJ 3SGKC 3NMEA 4I5BA 3LKNB 2H2SD 4NZRH 1I3RB 3HRPA 1YEDA 1ZVSA 4QYOB 1JL8A 1G7HB 1RMFH 4XCFL 3QDJD 4R8WH 1FCCA 3HZKB 3U7YL 4J3XA 4PRDB 3DGGA 4G6JL 3HAEA 5GRJH 4XP6L 3ARBB 2MCPL 3FMGL 3NN8B 1NMAL 1Q1JH 2HFGL 4PJBE 1DLHA 4OZIF 4UTAH 4XCYB 2VXSL 4WHTB 2PR4H 4NO0D 4OCLC 1HE7A 3IDYC 4R96A 5AD0A 4K9EL 1IGIL 1JWUA 1F2QA 5ILTH 5IVNA 1QSED 1I8IA 4NRYB 4Y1AD 1A7QH 3VFTB 3QXWA 5CWSB 5FUOH 1AFVL 4DN4H 4PGBB 3PXJA 1QLRA 1OAUL 3ARFC 4OD2A 4PGEB 3T4AB 3TCLA 2ZWLT 5D7KE 4R0LC 4LSTL 1LK2A 5I8KH 2Q3ZA 1BAFH 3V4VL 3OAUL 4JPWL 3IDNB 3G5XA 4ZQKB 3WXVL 3TZVD 1S8DA 3FB8B 4S10A 3TVMB 3S6CA 5HI5D 2GTWA 3RWCB 3QUXA 5IB1B 2OXGA 5GRVK 2D4FA 4HBQA 3BZFB 3S96B 4JQIH 1YY8A 1EAPB 3D69B 2XY1A 5LG1A 5GS0D 4O51A 4NWTL 4G43A 3KPSB 1GC1L 2B5IC 3MGOB 2X9YA 1XR8A 5L2KD 3CIQA 4GSDH 3MRFB 2PNDA 1KULA 3QJFA 4WEMB 1KN4H 3W0WB 4RISL 4ZPVB 3VGHA 2QADD 4Z7VF 2F19H 2D0FA 4OCNC 3QWRA 4QLRA 1AXSB 1YPZF 3WJJC 5EZOL 4FQCH 5BZWB 4BK4A 3KPLB 1LWRA 4HX1B 3BIKB 3PHSA 3IF1A 4TULH 2BSTB 5IBTL 2QQQA 4MYWB 4F3FA 4JO3H 1PYWA 3SE8H 1OWRM 1B0RA 1Y0LB 2RGSA 4M1DL 3C60C 4YHYB 1JZ6A 3HI6H 5LGJB 2H6PB 1DE4A 3C60A 1K4DB 1EGJL 2FZ3B 3MV8B 3IAPA 5I1IL 4LVHC 3BT2H 3FTGA 1QFPA 3VFUA 2NR6D 1FFPA 5GGVY 2W0FA 1AGDB 4LBEB 3LN4B 2EDHA 3P40A 4HMDA 2C7UA 3LCYA 4YDVA 2X4SB 1Z9MA 2ZUQB 4YAQA 4HBCH 5BS0B 4QRUA 1YDPA 1T2QL 5HDLA 3RWFB 2EDRA 3PGDB 4OQTL 3G08B 1QFUL 4IDLA 1L4IA 1CFQA 1CFVL 2IAMD 3TBYB 3VWKA 1MJUH 1E4XI 4Y16D 5C8JB 5J6HA 1SVCP 1KFAH 1YEGL 2GAZB 5IIEA 1A6VL 4PS4H 3H2WA 5CEZD 2EYRB 1R3HB 1SHMA 4R2GC 2BDNL 2ESVD 1JCKA 1HZHH 3UTSE 3ZTNH 1JHLL 1MJ8L 3KYOB 4JZNA 5JZ7C 4QOKE 2OTWA 5CCKH 1SJVA 4X6DB 5F3HA 3GMRA 1V3KA 3RA7H 1LK2B 2YC1B 2CMRL 4QGYA 4XWOD 5TQ0H 2R4RH 1PQZA 1TJIH 1BOGB 4OFYA 4DW2L 1EZVY 4W6XB 1A7RL 5D9SA 4YJZL 4BZ1H 4GMSH 3LQAC 4L9LA 1RUKH 2EXYD 1MFBH 3IVKB 3IU3A 1LE9B 1N7MH 2YD8A 3BOVA 1UC6A 3VXQB 4MJID 2Y9RT 3RTQB 3VE0A 5GGQH 1EZVX 3BPNC 4EUPA 3V52L 3VXRD 4X9BA 2YK1L 5D1QB 4YK4C 3H42H 4ORGB 2PW1B 2VLJE 3AY4A 3TZVB 3P4NA 2FL5A 2QHLA 1C5BL 3HNVL 1G7QB 1Z0MA 1A9EA 1NC2A 4X6FB 3HTLX 5KVFL 5LAXA 1JNHB 1MLCB 2YK1H 4YUEH 1JI2A 2DAVA 3BW9A 4PJFE 5DJ8A 4XI5D 3S5LA 4L4TD 1AD0A 4R7NB 1JNJA 1G9MH 1T22B 1F5WA 3MV11 2D7MA 2XN9A 5D4QA 1ULVA 4EI5D 4HXBL 4OB5L 3DMMB 5DVMA 3MMEB 4I3RL 1RJYB 1VFMA 5GGSY 3V5KB 3MV8A 4CJ0A 1KB9J 4YHPB 3DRTB 3VFSA 4Z9KB 1TNMA 3QDJB 1VACB 3C5ZC 5DRZA 4PGJA 3B8YA 4GS7C 3C9NA 1CDCA 4N0YH 1XF2A 4LRNL 1IM3B 2BSTA 4IMLB 3PDDA 2APWA 1KCVH 3EOYG 4UIKH 1DR9A 4NIKB 1E4WL 1Q38A 1SY6H 3MROA 1GHFL 1FO0L 2HT4C 1YNKH 3HZYA 4EQ3A 3N85L 4ZUWB 2DL9A 2FIKA 4DGVL 2IEPA 1YYLL 3SJVB 3QNXA 5CIPH 5GRUL 3QUYD 1V3JA 2YPVL 5GGRY 2DF3A 3OKEB 4QRRD 3OBAA 5IHUH 4Z0BH 1MHHA 1RIUH 3SGKA 2XXMB 1IQWL 3WNNA 3UYOD 1LDPL 1CE6A 2WUCH 4XP5L 2MTPA 3AC0A 4GH7B 3BPLC 1MIEH 5KSAB 4DFHA 4WENB 2NMSA 1G6VK 4PJXA 4XCEB 5EZJB 4E41D 3MO1B 4IM8A 1KT2B 5DEGB 4U1HB 1ZEAL 1LEGA 2D7PA 4K8RH 3LKPA 5IMKA 5I73C 5MP6L 1CFQB 5H94A 1ZT4A 4KGJA 3JWOC 4XP5H 1BIIA 3RVTD 1X7QA 2BERA 4Y4KA 1NGWA 3WIFA 3GM8A 3W9DB 5FYJE 1N6UA 1TZGH 5GGVH 3U30B 1JPTL 4WI2A 4FZ8L 4DVBA 2IH3B 2NY6D 3EFDH 4HIEB 3QCTL 5MP6H 1NBYB 2ZP0T 1KC5H 2GY7B 4MCZA 2QHRH 2F53B 2FATH 4XNZB 5BVPL 3LKRB 4PRNB 5JXAH 2XA3A 3WYRA 1I9IH 2A6JB 2OZ4A 2APFA 4MD5A 1F3DH 3MUGB 4M5YL 3THML 3T09A 1T1XA 1A9BA 2V2TA 4U6YB 5GRZA 1SYVB 1ZLSH 5FGCE 5CEXB 4GKSB 2ID5A 4O5LL 1YEFL 4JY5H 5C0NC 4KXZH 3U0TA 2YSSB 4HC1L 1G84A 4FQHA 3QPXH 1MNUL 5C0CD 1WWCA 4YDLB 1EGJH 1T22A 1T7ZA 1IEAB 4Y88A 4KHTH 3Q3GA 3FFCE 4G8GE 3CC5B 4RX4A 1U8NA 3PHQA 1CLZL 5J1AB 3BKMH 3ZLQC 3VXOB 1JMZA 4KI5F 3WD5L 3QDGA 3QFDA 4U1MB 4URTB 4D9QE 2P5EB 5I1HH 3OHXB 3LH2H 3OGCA 4GMTL 1LMKA 5MEND 3EJJX 3FO2A 4KJWC 1JIBA 4RX4D 2I9LB 3UJIL 2VIRA 3SDXF 2A6DB 1RD6A 5HJ3B 5A1AA 3FQXB 4I3RH 5DO2D 3L3JA 3FTGB 4HCRL 4AEFA 5KZCB 5GGSA 4ACPA 1NKRA 5C0AB 1IL1B 3LD8B 4NFCA 4P4RB 4YGVA 3ZMRA 1NGQH 2LE9A 5CBAB 3T0WA 4ZO9A 3D2UA 3DECA 4K3GA 4X4YB 2P44B 1MQKL 3SE4C 4R4FH 1XGPA 1AGFA 4UIKL 3HE6B 5DFWH 2W9EL 2ESVE 4K94C 1C12A 3WL9A 4Q58C 2EE6A 3GFUA 3P77B 3ARTA 3VFGL 5CP3H 3NN8A 3QEUB 1RUAL 3CMOH 2EYSB 4LF3B 1NFIA 1LK3H 3T3ME 4NO0B 1BD2D 4UAOC 4ZUTB 2HJKB 3T0DA 4GRLB 4WI7A 1DL7L 5GZOD 3CDGB 4L8SA 1QRKA 2D0GA 1S5IL 4N8VA 1J87A 5L8KB 2R2HB 4Q2ZA 4YIQB 3HC0B 5K9OA 1CXEA 4NM8H 4LCUA 4AIZB 2EDNA 2JLLA 3MLWH 4Q7DA 4NWUH 3V4VH 4OJFL 1GGCH 4FTVE 2R0WL 3KYNA 4QEGA 3TIEA 1GJIA 1QBLL 3BP5A 5SWQB 1N6QH 3P9MA 1JRHH 4PP2A 4F3FB 4FZEH 4WDIA 1URLA 1KN2H 4X7EC 1MI5A 5GS1B 1RZ8A 2I9TA 3QNZB 5ANMA 4X6BB 2LV4A 4JN1L 3LB6D 3DNKA 1OAKL 4WUKH 1KTDA 3ZDZE 1OTTD 3MRPA 4D0CA 3LEVL 1AP2A 1YN6A 2VDLL 5IV2B 3QRGL 5I1LB 2FECI 3ZHLA 2NX5E 2XA8H 2Z31C 5HDQH 3NIGF 3E3QC 1PFCA 4KTDL 3DYMA 1T04B 2HT2D 4EN3C 3KG5A 3FB7A 5I1EH 3BH8A 1J8HD 1XCTB 3VXOA 5L8LB 2X1WL 4WUUB 2Z0BA 5DRWB 2FATL 4OD3H 4LLVB 1OQOA 3VFOB 3Q5TA 4NYLA 3BKML 3AAZA 3TESA 3ARSA 3GJFK 2LU3A 4N0FA 3LS4L 4ZXBD 1WZMA 2X4UB 4JB9H 3MRRA 1T20A 5E94A 4LKCB 1R3HA 3HC3L 1J86A 1L7IL 3ZHKA 3WIHH 1J12A 2DLEA 3QHZH 4M7LT 5E8PB 2VL5A 1QHPA 4P3DA 5DTFA 3QO1B 5HI3C 1MCPL 3BP4B 1M6OB 2D31A 1ADQH 5F7WC 5JDJA 3WS6C 5T1LB 1DBKH 5JUEH 3MNWA 4APQC 2R0ZL 4PJDA 3E6HB 4MAUH 1J0HA 1JPFA 5L2KA 2Y6SD 5DQDH 4OZIB 1TXKA 3QNYA 5I1HL 2A0LD 1PW3A 5BXFB 3DXAB 1LO5A 5EOQL 2X7LA 1YNLH 3QUYA 3EO9H 3SDAA 5F9DC 1FQ9C 2ATPB 2PO6D 1MCWM 5GGVL 2AJYL 4U1LA 4TUOB 2HVJA 3TZVA 5DYOA 4GAFB 4X4YA 2XPGA 5IB2B 5LQBL 4LFHD 1I7RB 1NC2B 2HFFA 1PEZA 5F7NC 2FYYA 3QQ4A 4Z78A 3PQYA 43CAB 4HDIA 2CKNA 4LSSH 3DPBA 2YPKB 3ULSB 5DJXB 3GM0A 1ZXQA 4LARH 4KH2A 1MVFA 1ZMYA 3KPNB 5ISZA 3I9GH 2CIKB 1F3RB 5AAWA 3QIWA 1HQRB 5FKAB 1A7NH 4LOUD 2ZSWB 1JZ4A 4MNQA 3GSNL 3VCLB 4CVXB 3C09C 5E00A 1CFNA 1ZA3B 5KSAD 4XWGL 3EDKA 3VE0B 3KLDA 3O4OC 1SYSA 3QCVH 1QNZL 4S0TD 3QUZD 5JHDD 3ARPA 3LSOB 5CD3B 4ZYKB 1F4HA 2FBJL 2BVQB 2YPLA 3K2UH 3K3QA 5A2IH 4HEME 3SJVD 1KPRB 4HS3A 1C08B 2NR6C 4FQHB 1I3VA 3ILPA 2CKBB 4QT5A 2WLYA 4WW2A 2XNAA 1HZHL 5FF6B 3VXSB 3ZTNL 1J1PL 2YOCA 2KZ1B 1MREH 1RZIA 5IHZB 2X4RA 4YHIA 2R1WB 2Y72A 5ERWB 4JE4B 2J4WH 3UTOA 3UP1A 5GPRA 3O9WA 3GSRB 3MV7A 1RUQL 1EO8L 3TIDA 3KPRE 2A1WL 3UTSD 4IIQB 5EC1A 4C4KT 1N0XL 2CIIB 2HA1A 3VXPA 2GUOB 1FN4B 1IGMH 4Y16C 2DTML 4F80A 3VXSE 4LVHB 4Z77A 4G6JH 1BZ9B 2AXJA 3MV9A 3LPWA 1MFEH 4MB5A 1UZ6F 1FNEB 1BVLA 1HSAB 4U3XA 4QNPF 4Y4KB 1NBQA 4H0HB 3RNKA 5I73B 2BVPA 1BD2A 2WUBH 4I1NB 4Y4FC 1I85A 1BZ7B 3T0EB 5HVFB 1CGTA 2W60B 3CH1A 3MRGB 2ICCA 4X0KA 4J1UB 4I48A 2VR9A 3WUWA 4PJXE 2A73B 2DDQH 5JPNA 4BSWB 1A21A 5DFTA 4KVCL 3L3DA 5D1QD 4EUPG 4OLUH 4FQ2L 5F9JA 5JW3H 1XGQA 1S7SA 2H1PL 4P3CL 2MHAA 3OX8A 5IEKB 3VG9B 4K9EC 1FLTX 1M7DB 4JDVB 1BBDL 3BWAB 5C0EB 1A1NB 5EZJA 3RKPA 3T0BA 3ZKSD 3VG0L 3ARGC 4QHKI 2DICA 1AD9A 1DVFD 5HYJE 1IZJA 2AK4A 1XGUA 1A5FH 3CU7A 4XAWH 4WY7H 1YEIH 2FD6L 3LKOB 1MF2L 2PXYB 1HHJA 4NQXB 3NACL 4ESKA 1G7IA 1GPOL 1VA9A 1ZA6A 4YK4B 3F5WB 3V7AG 3LY6A 5FKPB 2OBGA 1A6ZA 2DWDA 5E99H 5B3NA 3KYAA 5DFVC 4HGKC 4MZ2A 4NQSA 5AWNH 3RL2A 3WMSA 43C9B 2AJUH 4JCLA 2WLZA 3QA3A 3QWRD 5AG9A 4EI5C 5JQ6H 5BZWA 3VJ6B 3OMZA 3TNMB 3LSOA 5CD3A 2YPKA 1T83A 1GC1C 5BZDA 3SCMB 4CVWA 4YFLF 1N64L 4JFPA 2DQUH 3MC0A 1S9VA 4N0CD 1EHLL 4N9GA 4LSQH 3P4OB 3VXTB 5I15H 4LKXA 2C4FU 1JGDB 3PGCA 3WHE0 2Q76A 5T33H 1OTUD 3WJLA 4TSAH 4XP4L 1EEYB 1T66D 1XCTA 5M7QA 1MJUL 3KLAA 1FL6B 4OF3A 3VRLE 3ES6B 1ZHKA 1MHCB 4Z7UB 5IUSA 4HKBB 8CGTA 4JJ5B 1Z5LB 1OAZL 2P7TB 3WV0A 2ADGB 3H9HA 3D39D 3PXHA 4KVNL 4PJFB 5FV1L 4WO4C 2GITA 3SJVE 4PJBF 5E0QA 1KB5L 2HVKB 1YJDL 2BY0A 1P7KA 3FO1A 3VG0H 4F7TB 1H3VA 4YDKH 3EAKA 5JNYA 3BKJL 1MFCH 4Y5XA 4S0SD 2I07A 5KSBF 1KF9B 3MRGA 4NHCH 1JN6B 5C2BH 3U9UB 4X4XA 1KCRH 4NO3B 5JA9A 2PTVA 5CMAA 3MRIB 1HYRC 4H26B 4HD9A 4GG6B 5L2KB 3WN5C 4OGXL 4PJCE 4LHUD 3BQUD 4J3SA 4E41E 1GVIA 5D6DA 1A4JB 12E8H 1PQZB 4K23L 4G5ZH 2BVPB 1DUYA 1TTGA 4I18A 4XRCB 1NCCH 1RUMH 3CSPA 4WV1A 3FFCB 4G8GB 4LCIH 1WBYB 4AM0A 1N64H 3QUMB 4ODUB 5J11C 2IFFH 4L3CB 3KDMA 3VXQA 4EDWH 3BMWA 2VABB 3MV9D 2F5BL 4N1HB 4Q9RL 1OHQA 3P0YL 4JM4L 5KOMC 3SGDI 3S37H 3VRIA 2OTUB 1WC7B 2JELH 5MENA 4OSUL 1PY4A 4XPFL 4WUUA 1E4JA 3ARDA 1YPZE 2R2CA 5GJSH 1P9MA 4GBXD 3DMMD 3D25B 2F5BH 1IC5H 5IMLA 1SY6A 5E2TH 4PJ8A 4DEPB 1RJLB 2DQEH 4TSBH 4RFOL 1EVUA 3HE6C 1DQJB 5T5NF 3RIFF 5BJTA 2VITB 1ZA3A 3SEPA 5KJRH 3QIUA 2E3VA 3I6GB 2P45B 1HILA 2FH6A 2Y25A 1PSKL 4JFEB 5DGQA 2VWEE 4HT1H 1HDMB 5IHBA 4HKJA 3PHOB 4R6UA 1IGFH 1TVHA 4OLVH 2BVQA 1H5BB 4YNYB 3RWFA 5SWSE 1E4XH 1N2RB 3ISWA 1FZJB 2EO9A 4JY6B 3WNPA 1F00I 2VE6A 1UENA 2D03L 5A40E 2P8PB 5GZOC 1TENA 4GLRH 4LQFL 1UKQA 4I3GA 4W6YB 5K9KB 4OCYH 3FOMA 1IQWH 2YD9A 1B2WL 1D6EA 5C0GA 1KCKA 4I3SL 4LBEA 4QKXB 4ZO6A 4OLEA 4O5LH 4G6AD 3IU4H 3TPKA 3MRDA 3O3AB 4U1NA 5E6ID 1K8IA 3TLRA 4AENB 2QV2A 3PWJA 1NAMA 4QHNA 1FE8H 5INDB 2PYEB 3RVUD 3CX5K 1I3RA 4QYOA 1JFQH 3EDDA 4OCSH 2ESVB 5ESAA 3NFNB 3CPLA 5IFHL 3FOLB 1F8TH 2UZIL 3J8F7 5IG7A 3PL6C 4D0DA 5HSFA 1FNAA 4JG1L 2PO6A 4JFZH 5DVOA 4I4WB 4NKMA 3DX6A 3IFLL 2IGFL 2XG5A 3O2DA 3QNYB 1CDGA 2FHCA 1I1RA 1I85C 3RDTD 1VKXB 3W9DA 2PTTA 4JCMA 1QRNA 4CVXA 3NBNA 3DV4A 4RFOH 4P2OC 4WV1B 1BJ1H 2CLRB 3QUYB 3NIFF 5E1HB 4XMPH 1NGZB 1I8LC 5F7YC 5LXGL 1BREA 5DRNB 4U1LB 1CLOH 1ZLVH 4MJ6A 2ED7A 2NXYB 3UCRA 1NCWH 4H8WH 1NFDA 4KAQL 1X5LA 1WZ1H 1MFCL 4OLYL 2E7LA 3IXAB 1U95B 4KY1H 5EZOH 2APBA 3PQYB 43CAA 3CZFB 3NIGE 3N1MC 2CLZB 4GKSA 2XNAB 2MQ0A 2XV6B 1CL7L 3FFCA 4G8GA 4PJFF 1SY6L 4UOJA 2AK4D 4TRPL 4HSQA 1O7VA 1AGEA 4PJIF 2DQJL 3VGFA 3B9DA 2FX8L 1WK0A 2G2RB 3VWJA 4I0PB 5DQJA 1OP5H 4TVPD 1RVFH 2AJVH 4PV8B 3KLHD 4KK5C 3R06B 4JFDA 4Z76B 5LAXB 4PJHB 4ZUUA 2ED9A 3WFBH 1S9KC 3RI5K 3LRGA 3W81A 2G5RA 4QTIL 2X10A 3V0WL 3RWJB 4QCIB 1TCRB 1X5KA 3D25A 4L9LC 5BV7H 4K3DH 4CMHC 3RPKA 4LLMB 1CI5A 3DUUA 1UM5H 1PEWA 4JQXA 1HCFX 3S9DB 1JNLH 4JRXD 3M8OH 3D39A 1CGVA 2UVFA 4M61B 4PG9B 3RVVC 1SMAA 1U92B 3GRWL 3MLXH 3IDUA 4NPYB 1NUFA 5GS0H 1YN7B 3QSKB 1NCUA 3C2SA 5CJ5A 4R0LB 1KGCD 4GRMA 1G0XA 3MCG1 5C0DA 3EYVB 3T0VA 5FK9A 2GJ6D 4UT7H 4DEPC 2NW2B 4AENA 7FABL 5DJAA 1QFOA 1MHCA 5ENWA 4M4RA 3L9RB 3NACH 4MQTB 4U2YA 2P5ED 4X6CE 2OCFD 3IU4L 4P46C 4P5TD 5IVOA 1BOGA 3MJ7B 2AK4B 2BJMH 4U1JA 4L9DA 1M71A 4HV8B 4X80H 4DKEH 2GTZB 3ZSSA 1GL4B 1HXYB 1G7IB 1FZOA 5F89A 3HMXL 5BCAA 4KTYA 4EDXB 3DBXA 4L8SB 1MIEL 5CJXC 3HG1E 3MO1A 2R8SL 2IPTH 5E4EC 3A67L 4LCUB 4TPRL 5D96B 4Y5YA 4Z95H 5DK2B 4P5MB 5BS0D 3UPRB 4OIBA 1DFBL 1Q94B 5E2UL 4LSUH 2YUVA 1ND0A 1QSZA 1T0MA 4KFZC 3D6GA 1FL3B 5C6PB 4EQ2A 4NN5C 5IF0A 4LFHG 3MODL 3ME0A 3OG4B 5DQDL 1X6NA 3A6CL 3Q3GB 2IBBA 5J12C 3W0WA 2X4PA 4ZOAA 5C07A 5I1KH 2OTUA 5H37G 3MRQA 5HGDB 4XXCC 2VKWA 1A9BB 1BZQK 5KTEH 5E99L 3F7YB 5DD5H 5BW7C 3IF1B 5HHMD 5I1AB 3BPCB 3QUXC 2VXQL 4UILL 4Z7VB 1U93B 1A64A 5E6IB 3GUTA 3VFOA 4KK6D 3OKNB 2C1OB 1ED3A 1AIFB 5E7BA 3CZJA 2Q7NA 3HMWH 4G8FA 4PG2A 1T21B 2O5XL 2VDQH 1UCBL 1R3JA 1HOCA 1UZ6E 3QFDB 4HIXL 4FQ1L 4RGOH 4U1MA 4TUJB 4YEFA 4LP4A 2VDKH 3BEWB 4CU7A 1KJVA 2EE3A 2OI9B 5TH2A 2C1PB 5FYJU 5ICZA 3ZYJA 3KPRD 2MCG1 1S7XB 2AJXH 1H5BA 4YNYA 2AAVA 2A6DA 5A2KH 3DUSA 4X6CA 5E8EB 4GW5A 3NCYP 1QFWI 5C07D 1Q9KA 2WANA 3IDJA 3ZSTA 3FOMB 5EOQH 4X9HA 4J6RL 4LIQH 3FN0H 1FFNB 5ESQB 3O3AA 1LEGB 2ZJSH 4MS8C 4U1NB 4KI5D 1TTUA 3CVIH 3B9KD 5E9DE 4JPVL 2VN7A 1ZLWK 4H25A 2DIAA 4XHJD 1OAYH 2OJEB 3BPNB 1ZSDA 3RVWD 3X11A 5EUKB 1D5XA 1CG9A 5DD6A 1RIHL 1PJ9A 2X09A 2CRIA 3HA0A 3T0AA 4DVBB 5CSZA 3NCJL 5HD8C 4XAKE 3QYCA 1MFNA 5SX5K 1I7RA 3O8XD 3FQNA 1S9XB 3SKNA 3VD4A 1CE1H 3UTSB 2VOTA 3S3PA 3RWIB 2NY7L 3TVMC 3CFDA 3PV7A 4TNWK 4HDIB 3DX9B 5IMKB 1CFTB 3B9KA 2YPVH 3WDJA 2HMIC 1WBZA 4UBDC 2R8SH 3H3PH 3IRZA 3BDXA 3WIFB 4DZ8B 2AQ2A 3X12A 5MEOA 6FABL 4JZOB 3V0VB 1UA6L 2E8YA 5FYKU 2DI9A 5DS8A 3DHJA 4DUVA 1ORSB 2A38A 1A1OA 2ICWB 4XVSL 3HUJB 5D2LA 5JLZB 4WDIB 4JDTH 1T04A 2QJDA 3H6JA 3MBXH 1MCCA 4XBEL 4JM2A 5FB8B 4F7MB 2IAND 2R2BB 5EUOF 4P5MA 4XXCA 5F88A 4KROD 4PJIE 4F9PA 3RWDB 3MFFB 2A77H 3TBTB 2ADFH 3EO0B 5HHQA 2VIRB 3C5SA 3RU8L 4JFFE 4YUEL 3CLEH 2Z31D 3IFPB 4OD1H 3ROLB 3DRTA 4NKIH 4NZUH 3MCLL 3R06A 3JUZA 1JGLH 3TJEH 2OSLA 1BOYA 1U8QA 4MAYB 4HCRA 3MYZA 3ZKMD 4OLXL 3BP6B 4Z7QE 4NO5A 4JFFB 3W9EA 2LABA 3EHBC 5ID1A 1EERB 1A7BA 3ZE1E 5EO1B 1NKOA 2R0KH 3ULUL 4U6HA 5DD5L 1T6VN 5ICYB 5MHSE 1CD8A 3QULB 4ZO8A 2VAAB 3GSQB 3KYMA 4I3SH 1A14H 3P77A 1TJGL 1WZLA 3LRSB 2JCCA 4DGYL 2OS7A 1FFNA 1N6VA 2BP3A 2L7UA 1C5BH 3EGSA 4HUXA 4CMHB 3FQUB 3K1KC 1KBGH 5TF1H 3WUWB 4TYUA 5GHWH 2FHFA 2B4CL 1BEYL 2DWEA 1S7XA 3I84A 3TYFA 5T1KB 5CZVH 5E08L 4DTGH 2ICWJ 3CFKB 3OWEA 1OOAA 1UH4A 5ADPH 4EBQL 4GBXA 3BESR 5D2LF 5IR1A 1SJHA 3MCKB 4MNGA 3HZKA 1IGYA 3N50A 5IGXL 5DUPH 2VDML 4XBGA 5D72H 3V0WH 2C3VB 3W0WD 1I1CA 3W5NA 3GJFH 4WJ5A 5GS1A 1AD9B 2D9QB 3B9VA 4HS6B 1NBYA 3X11B 5DURB 3VXMD 5IKCB 4YE4H 4XBPB 3JWNC 2H3NA 3M07A 1C5DB 4OFVA 5F1NB 4P2CG 5AWNL 4AIZA 4HWEL 1BP3B 1FNHA 3TBSB 4RRPA 1N8ZB 3SKOA 4OCYL 4NQSB 3MACL 2NY1C 5FM4A 4PJ5D 2F53E 4F7PA 2QHRL 2ITCB 2VDPH 1DANU 2EECA 2H41A 5GRUH 2YBRB 4IEFB 4WU7A 4M03A 3OAYK 2C3XA 1DQLL 4NFDA 4DOHE 1EAJA 1AGBB 3T0ED 3WXWH 4F9LC 1CE1L 5F70A 1ZHLA 4JKPH 1Z2KA 3NFSL 4WU5B 4Y4KD 1T89A 4P49A 4G8IA 4K7PY 3QIUC 1GGCL 2G5BB 1J10A 4UT9L 4L4JA 4BYHA 5IT2H 3DX7A 4PYHA 2EYTA 4J8RB 2X6MA 3JZ7A 4WRLA 3OZ9L 4RMUA 1U8QB 5DR5H 3RI5F 1FCGA 4N8VG 5E8NB 1TZGL 2BOBA 3G6JE 4QRQB 1N4XL 1NFKA 1JYVA 1BD2B 1Z9SA 2X4RB 3S98A 5KVGL 4ONGL 4WWKB 5DJCA 5L0QB 4YDKL 5K9JL 2NTSP 3VXSD 2R56H 2KQNA 1P69B 4U1IA 3T04D 4OGYH 4PJ8D 4OLXH 3OZ9H 3HPLB 2W91A 4F7TA 2ARJQ 1KJ2H 3WO4C 1LEIB 4W68A 3GMRB 1GGBL 1M6OA 2D31B 1WAAE 5K9QI 1N5AB 5F96L 3SDYL 4E9LA 1I9IL 3SE3C 4UV7L 2BNRD 4X5WB 5DSCB 4OGYL 1LNUA 1FH5H 3OXRB 1S7VB 2HKFL 4XPHL 2QKIB 2DB8A 2B1AH 1CQYA 3MLPA 2XTJC 5EO1A 4O2FB 1FNLA 1JGUH 1WGOA 5KZCD 3X13A 3QIBD 4F33B 2J88L 5T5FL 3CMOL 3GJFB 2VR4A 3TNNB 4M02A 2ATPA 3SDXB 1XGTB 1NPUA 2PXYA 1YMHA 5CZVL 3BQUA 1F4AA 2Q8BH 3T0XA 1JPSL 3TYFB 1ZHBB 3W39B 1FG2A 3I02A 5FUZH 1NC2D 1CFNB 3DARA 5EORH 3O45A 5KS9B 2AV1A 5JOPE 3BHBA 4X4MA 3BGFB 4DJMA 3GUTB 1J9CT 4KRMB 2K1MA 5ANMB 4GAGH 1X5GA 5IFHH 3JV6B 4IOFD 5FCUL 3BAEL 3S36X 4N8CL 1J0IA 4ZAKB 3EDEA 4YHKL 2NYYD 5F7DB 5KVGH 4KKAC 2W59A 3STBA 3QBTB 3HG1A 1KPUA 5FA3A 3BGFC 3K2MC 1X5HA 1YEEL 4QHKJ 1WV7T 2JF1A 5GGUB 3GRWA 4OZHF 3JVGC 2W07A 1E6JH 4U6XA 5IBLC 4DN4L 4ISVB 1CCZA 5CINL 4P99A 2VXVL 4JVPA 5T3ZL 3RGHA 4N0CC 4X6EA 1MJ7L 5C09A 4YPGA 1K6QH 5SWZB 4U0RC 1H15A 3G6DH 4QF1B 1IC1A 4JDTL 3VFWB 1DQLH 1BZ7A 3ABZA 5FDYA 3T0EA 1T0PB 1RK1B 3V5KA 3Q6GL 2NZIA 6CGTA 3PWVB 2OMNA 1G9NH 3IFNL 4PJBB 3HAEB 3PWJB 5F3BA 2VQTA 1VFUA 1LEIA 4YFLI 3LOWA 3V52H 4HG4J 3LKPB 4OM0H 5E8NA 3DHMA 3NAAH 2DN7A 3AXLB 4LU5L 4QHLA 1JWUB 3F12A 1FFOA 1YUHA 2GTWB 5IB1A 1CYGA 3BYTA 4ZSOE 2MQCA 4U0RB 2CJUH 2EH8H 2N56A 5TDNA 2A6IA 3STLB 2AV7B 3TJEL 1IAKB 3DV4B 1A1OB 1UT9A 4NSKA 4JG0H 3OF6A 4CVZB 1RZJC 5KG9B 1J0ZA 3P4MA 5EWIH 1NFDF 2NPLX 3CX2A 1MCEA 4Z7VE 3O6LH 1Q72H 4UI2A 1ZA6B 3RWCA 1QSFD 5F71A 1UACL 2XT1B 4CKVX 2ATKA 1XEDA 1QO3B 4WI5A 3OJVC 3KWWA 4M6OL 4ZD3H 1CR9L 1RJLA 4Y5VA 5MEPA 4WI4A 2YD6A 5LGJA 4JO3L 5K59E 2JB5L 4MNQB 2P1YA 5BOPA 2B5IB 1INQA 1FO0H 5F1IA 2FEEI 1HYSC 4X7DC 4PBVC 3ULUH 5JMRA 3S37L 5FUZL 3RRQA 1Q9OB 1Z6JT 3BFOA 3ALWA 3EOTL 3V6FB 2ZCKL 1CD1B 4XGZB 3HE7B 2X40A 3WIHA 1W72L 4KRNA 2ITCA 1G7PA 1A7PH 1X6LA 4MS8D 5HHNA 3MV7D 4KI1A 4JHAL 1U8LA 1BX2B 5E8OA 4HPOH 3G08A 4JAMB 3GHBL 2R69L 2WBJC 5TGBA 4QT5B 4QOKB 5F6HI 2VLKB 5C0AD 1FPTH 2M8XA 4P2RD 2DM3A 3O6ML 3MFFA 3EO9L 3UZQA 4G6ML 3RWHA 2FBOJ 4OKVA 3SGDH 3RPIA 1XIWA 2YPLD 3I50L 7CGTA 3L7EA 3C5JA 4AMKH 4B50A 4GRMB 2DD8H 2GK0B 3VGEA 5FOBA 5LJYH 3IDGB 4YHOH 1MCIA 2I07B 2X4OA 1I7ZA 1FVDA 4HC1H 5I30H 4UTBL 3U83A 4KRPB 2I60H 4RNRB 2VLLB 4RBPK 2VZOA 4NO3A 3TFKC 4CRPA 5I1GH 4XNQA 4FXLA 3SBWA 2F54E 2ZUVA 4ERSL 5E9DA 3JUYA 1YYLH 1JYXA 4J3WA 5I8OH 1C16B 3CH1B 1ZANH 4J4PA 1EHNA 2YD1A 3CFEA 4YPGB 3B4NA 3FO1B 2W9DL 1JHTB 4KHXH 4XNMB 1CGSH 2FJHA 5T1DL 3O2DL 1VGKA 2IG2H 1KEGH 2BZDA 3FT2A 5ETUA 1T03H 4M7LH 2AV7A 3GNMH 3DGCR 4JZJC 4HIXH 4RGOL 1KCLA 5DEFA 5T1KA 1RK0B 1MI5B 2F53D 4JDZB 4KKBC 4E0RA 1KIRB 1JV5B 2GFBB 5DVLA 1BFOB 1SJXA 4HFWB 3SY0B 4MQXD 1YEGH 3WFHB 2O5ZH 3QIBA 4Q6IC 2ATKB 3RDTC 1NGZA 1KJ2L 3TA3B 1JBJA 1CTNA 3CVIL 3SDXA 4AM0B 1VERA 2WV3A 3EYQC 1QLFB 1OM3L 1KACB 4ENED 4CL7A 1OF2A 4EXPX 1T2JA 4CMMB 5D8JL 4K2UL 4ONGH 4G6MH 4G9FD 3QG7H 3FB7B 5GGTH 3WNOA 1AQDB 3O45B 5KS9A 1RZJH 4EI6B 3CZFA 5E6YA 2FECL 3LHPL 2YXMA 2I27N 1G0YR 5B4MC 2QADB 4YHOL 4HWBL 4X5XA 1TVDA 3P0VL 5IMLB 5SV3A 1LQSR 2NXZB 2YZ1A 4UMGA 2VLJD 4KMTL 1LO4L 3MSPA 5CD5C 1KUMA 4TTGA 5C08A 5E7FA 2DQFB 4PJ9A 3HPLA 4S1RL 4D9LH 4N90E 1P7HL 3BKCL 3QDJE 2B0SH 3ZTJG 3OKKA 3MRBB 4M7KH 2J8OA 3BP4A 3ZKMC 4J23A 3CXHJ 1UKSA 4WU5A 3SDDB 4DN3L 4KMTH 1MH5A 5D6CA 2E9BA 3RNQA 2ZKHL 2LQRA 4MXQC 3UO1H 2DIBA 1QSVA 4GG6F 3A6BL 3H9SA 2YA2A 3WLWC 5CJOH 2H26B 4XI5C 4PJEB 2FO1A 1RIVH 2ESVA 5ESAB 2PXYC 2A74A 4ZFFB 3BPOC 4PR5A 1R0AH 4BH8B 2HRLA 5HDQL 2F74A 5FHBL 5GRJL 4H25B 5TE6H 4LKCA 3VD9A 3HNTL 1JN6A 4RWYH 2K7PA 1KXQE 5I18H 5IVZB 2BSED 4I9WD 2EEAA 1CL7I 1HHHB 4MAYC 4PRHD 2GSIA 4QY8B 4KDVA 1AHWC 3NFNA 3V5HA 1B90A 5HHPA 1BFVH 4FQPA 4X5WA 5DSCA 3S36L 4LCWD 2PW2A 2VQ1B 1K5NB 4YZFF 3S4SA 3AMKA 4D0DB 4N8PA 4P46D 1RURH 3VGGA 5KSVB 1IGCH 3F62A 3UJTL 2DYPD 1OSPH 3DX6B 1U8IB 1LP9F 1U6AH 3QNZA 1S7UB 1JV5A 4YDLC 3PG2A 3CGTA 4IRJC 5F6HJ 1T7VA 1DL7H 4P48A 1BQHB 1Q1JL 3H7LA 1EXUA 4C56D 1OB1B 2X89A 4FTVD 5JW4N 3JWDL 4BSJA 5ESVA 1KJMA 1IMHC 3HPJA 5J9PA 1G9NC 3PJSB 2DBLH 1K9TA 4JM4H 4LLAA 4JFEE 4S1SH 3MRFA 4JANB 4KJQD 1PG7L 3QG6A 2DQTH 1FL3A 3CJJA 1W0WB 5HYJA 3MRJA 1JRHI 3B2UC