2ADFL

Crystal structure and paratope determination of 82d6a3, an antithrombotic antibody directed against the von willebrand factor a3-domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
209
structure length
209
Chain Sequence
b'DIQMTQSPSSLSASLGGKVTITCKASQDINKYIAWYQHKPGKGPRLLIHYTSTLQPGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCLQYDNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Von Willebrand factor
molecule tags Blood clotting/immune system
source organism Homo sapiens
publication title Paratope determination of the antithrombotic antibody 82D6A3 based on the crystal structure of its complex with the von Willebrand factor A3-domain
pubmed doi rcsb
total genus 51
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2005-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2adfL01
1N59A 3VWJC 1LO3H 3E1F1 2WBJC 1A6UL 3HS0B 4QRQB 4RX4D 4ZD3L 3VXPB 1BGXH 5FO9B 4OM0L 5GRXG 2EH7L 3L1OL 2R29L 3VXTA 4FG6C 4JPIA 5D7LE 1U42A 2NXYD 1UG9A 3G6JA 1LE5B 4H26B 2Y5TB 1KACB 5A2KH 3TO4B 1H8NA 1K85A 1KLUB 1MLCA 3STZB 1RUPL 5I1DB 1G0XA 2BNRE 3PP3K 2VDQL 3SDXE 2BDNH 2B5IC 5L2KE 4NP4L 3T0EB 5BS0E 1JPFA 1B4JL 1M7IB 2OTUB 2Z4QB 3EGSA 3RIFK 1G6RA 5BO1L 1QTYT 1IFHH 2OSLA 1RZ7L 4OZIE 3R1GH 1QLFA 4XCFL 2X4PA 2XZCH 4OLUL 3LKOB 5F3HB 1DN2A 3TGXA 1I1YA 5FK9A 4ZFZB 2J3SA 5T1LB 4KKBD 3B8YA 2IBZX 1EFXB 3KPRB 4OLZH 3VWKB 4C83B 2VN7A 4Y19E 2QADD 4J3OC 5C0EB 4KTEL 4Z7UE 3NIDF 1CQKA 3X14B 5K9KA 3I2CL 3D48R 1XF1A 2VDMH 5KZCB 1M05B 1A9BB 3O6FD 1MSPA 2BSSB 3PNWB 1TITA 4O4YL 1ETZA 1OSZB 3IVKA 1CGUA 1JYWA 4GXVL 5T5FH 3CX5K 4QRSA 4YDVA 1RJLA 3BD5A 1A5FH 2BY2A 4PJFA 5CSZB 4CDGC 2B4CH 1INDL 1OD7A 3AXLA 1G0DA 3MV8E 2OL3L 4JQVA 1MF2L 4YXLL 5E4EC 4F3FB 2PYED 4WU5A 1T21A 1XGTA 4WUKL 3G04A 1Q72L 4HF5H 5HYJB 2VABB 1XF2A 3QXVA 2ZG3A 2BCKA 4P23D 2NXZD 5C71A 2D0GA 3KYMA 1TQCC 2FSEB 4U3CA 3MLPA 2ZJSH 3GGWA 1NGQH 4JFDB 4S0SD 3RL2A 3V6BR 5D1QB 4BSVB 3TWCH 3RZCA 2VXTL 1ZEAH 3ROLA 2VDLL 2VZSA 1D5ZA 1FZMA 2KZ1B 1WCBA 4JKLA 5C09E 2HJKB 4G6ML 4YGVB 1OAKL 4H5SB 5JLZA 1IQDA 1WC7A 5EU3A 4LVOB 3PV6A 4ZUSA 4UQ3B 5FOJA 4LLWB 5IW3A 3UBXG 1MJ7L 4YFDB 5EG6C 4U0RC 4UB0H 3MJ7B 4O5LL 4U6VL 4MXWL 4N8CH 3RTQC 3KYAA 2F54A 3X12B 4P5TA 4R7NB 3L5HA 5F9JA 4OFYA 4X6EB 5D1ZD 1DEEA 1OTSC 3G08A 5CGMA 4HX1B 1NCNA 5FHAH 4L9DA 2I9LB 5ADPL 3BP5A 2EDYA 4DW2H 1GZPA 2XNAA 3TFKD 3NTCL 4WY7L 4MNHA 4M6AA 3BX7C 4X7FC 3REVA 4DGYH 3QULB 1AHWB 4ZUSB 1KCVL 1IQDB 4L3CB 2VAAA 1S9YA 5FV1L 5TF0A 3RWHA 4G8FB 4HIXL 4HWUA 4G6AC 4OB5H 3PUCA 1UM6H 3VFSB 4IHOA 4J3SA 1N4XL 5C70A 1NKRA 5DURD 3B9EA 5EUOA 3D85A 1QHPA 1HHGA 3HAEH 3JTSB 4P4RB 2W0LA 4L3AA 4KK9D 4UT9H 4TQEL 4LSTL 1UCTA 2X5PA 1NGYB 4R2GC 2B0SL 2GJ6A 3V6FB 4ODHH 1U8HA 5DD5H 1MIEL 4WO4B 5AYUH 2VWEE 1T89A 2YA2A 5DGRA 5EZIH 2OR9H 2VQUA 4KI5C 4NPYB 3EJYC 2C9AA 1FRGH 2QKIB 2DQJH 2HFFB 3DGCR 1UJTA 4L8CA 4XP5L 1BJMA 1N7ML 5T1DH 4R96A 4OLYL 3MV9D 4KPHL 2GFBA 2VB5A 3FOLB 1HXYB 3H9ZA 4Y5XB 3T3MF 15C8L 5E9DB 3O4OC 1H5BA 4RWYH 3HC0B 3MFFB 2JJVA 1UKSA 2VE6A 2ZKHH 3PWPE 3D2UA 1QSEE 1OGAE 5FGCB 3RUGA 2Y36L 3TZVD 5IR1A 3P4NB 3HMWH 1IGCH 2YXMA 1NBQA 1T20B 2X4RB 3LEYL 5KANI 2VITB 4OT1L 2W9DH 3KS0H 3O9WB 1VPOL 3FZUC 5CJ5A 1UC6A 3T04D 1HH9B 3QQ3A 1BQUA 4NM4H 1EGJL 1UVQB 1N0XL 5E8PB 1X5LA 1KYOJ 4ZPVB 1A1OB 3ULVL 2WM0A 4Y5XA 3O9WD 3IDYC 5JNYA 1NEZG 4PG2C 3ZE0F 4OUUB 2A83A 1LP9E 3QWQB 2FIRT 3L3DA 3QFDB 4OGAC 5L0QB 1G7MB 3FQUB 4LLDB 3RWEA 4WI6A 4X4XB 4GMSH 4DKAA 4LHUD 4HDIA 4NZUH 4OI9A 1CGTA 2ZUTA 2B1AL 3GO1L 4FFYH 4PS4H 5TE6H 2HJKA 3NMEA 4FTVE 1RK1B 1W0WB 3CFIC 3NIFF 1N8ZA 1XCTB 4PB9L 3VGHA 1PQZA 5CBEB 5KSAB 3TBYB 4UQ3A 4JEGB 4I0PA 4M7LT 4NM8L 4RX4A 3EYUL 5J9PA 5LKNA 1GCFA 2BNUA 2EDQA 2YPLA 2HJFA 4X80L 3ZSSA 1CE6B 4MNQA 1QP1A 1NLDH 4U2YA 5GGRA 3GBMH 2F54E 4MVBC 4AIZA 2ZG1A 3T2PA 3K74B 3VCLA 1KGCE 2R0ZL 1H3WM 3X3FH 5CHNA 5DXWA 3O45A 1HKLH 1A6AB 4HMDA 1YC7A 4LLDA 3RWEB 4JN1H 4P5TB 5FIEA 2DQHL 1HYSC 3FB6A 4IMLA 4OFYD 4FXGA 5E4EB 2NY1D 3NBNA 2KPNA 1QRND 5HDBE 3VXQA 3V7AE 3IJSB 3HRZB 3QZWG 1O5DT 5ISZA 3S5LB 4L8DA 5BVPH 1X9QA 1SYSA 3BRFA 3H8NA 4KGLA 5EO9A 2D4DA 4MJIB 1SJEB 3OGCA 3WFBL 2GUOA 3HB3C 3HI6H 2Z93B 3MO1A 1T1ZA 3KJ4C 4XWOC 4JM4H 1G7PA 2F54B 4QTIL 3TC9A 2NZ9D 1NCTA 5C09B 1WSST 5DJXA 4ONGL 3OJVC 5FXCH 4PJAA 3RJDA 4PRAB 1AJ7H 2H45A 3BIKB 3BWUC 4ERSL 1QBLL 4M00A 4ZFFA 3O2DH 4LLAA 4HFWA 4QGTA 2AK4D 3B2VL 3LRSB 2NX5B 5F9OH 3AU1A 3SGKA 5F96H 1SHMA 3QRGL 4U33A 4NFBA 3BZEA 1AO7E 1VADA 4YHNB 1SBBA 1GPOL 2KDGA 3GJFH 4LGSB 4JFYA 2ZPKH 4X4ME 3I75B 1FNEB 5GGVY 1E4WH 4O2FA 4H88L 1PYWB 3NFNB 2AXFA 4LCCC 4XBGA 4MD0A 4PJ8A 5JDSB 1BQSA 3DX6B 5ETUA 1OLZA 4JDVA 4OIIH 2WW8A 1OAQL 4HSQA 3KNBA 1GXEA 1N64L 3G5YA 2C1PA 2VL5A 5C0DB 4HJGA 1KTLA 5KVEH 2DKMA 2VDRL 5D7IB 3LEVL 1OAZL 1NMBH 1XR9A 3IU3A 5DJ6B 3ARVA 3F7RA 3OKEA 3FFCE 1A9EA 4K7PH 3I3DA 4LSSL 5J8OA 1ADQH 4XMLL 4TUKL 5AZ2L 4OF0A 4UUJB 3W39B 2M1KA 3CMGA 3IDJA 3TNMB 4GW4B 1J11A 2BVPB 2VLMD 4F57H 3TIDA 2AJZB 5I76A 1A6VH 3C60D 4PJEB 1ORQA 4ZUUB 2PF6A 4MGXA 1M6OB 4P23C 4WWKA 4KH2A 1U92A 5J11B 2QQNH 4XHJC 1NBYB 5C3TA 2DWEA 1ULVA 1G6RB 3TPUA 5A2JH 2VZUA 1Z9MA 1PKQE 2BXYA 4GRLA 4WFEE 4PJIA 3DBXA 1BFVL 1OCWH 4NO3A 2GSGA 5F7KC 3MODH 4PJEA 3SGKC 5F7HA 4R4BA 4TUJA 3GI9L 5BV7C 3DO7A 3ULVF 3SPVA 2HFGL 4NYLB 4O51B 1IAIH 1WT5A 3IDJB 3IGAB 3CVHA 4E5XA 3D39E 1A7PH 1MVUB 4ORZC 4QHMA 1KCUL 3B9KC 3ARGD 3DXAA 3T2QA 4Z6AT 4KVNH 5KSBB 1TNMA 2WBJB 2F15A 4JKPL 1KULA 3VDCA 3WXVH 5BRZB 1KCRH 1S7RA 4X7SL 5BJTA 1F6AA 1VENA 3LPGA 3MRQB 1OQOA 1HQRB 3I6GB 5FM5O 1IC4H 3IGAA 6FABL 4RAHA 3BKYH 4FQLL 2Y9RT 2MQCA 3OKDA 2F74B 2Q3AA 3V0VA 5LCVL 4KZEH 1EZVX 1R3IH 5BRZD 2PXYC 2D2OA 3L7FA 3QAZB 1ND0B 1T21B 1XGTB 5SWZD 3SCMC 4S1SH 1Z5LB 2HH0L 3QUKA 5FDWB 2H2SC 1OW0C 1ROWA 3MJGX 1ADQA 1MFNA 3MREA 3U7WH 3MRRA 2KZWA 3W9EB 3G5XA 3IAQA 4AEHL 2W60A 3C09C 3LQMA 3F58H 1TCMA 3MBEC 1WBXA 4G9FA 1AHWC 4D3CH 2VLJA 3UYRL 2HVJA 5DJZB 3BQUC 1Q38A 3MRGB 1YEKL 3WD5L 3NCJL 4RBPK 5JW5A 1S7UA 2LAGB 4ZS6C 2Q7YA 3WN5B 2UZIH 4RAVA 1AD9A 4HJJL 1G9NH 5J57B 4ZFFB 5E8OB 4N0YL 4RQQB 5CLWA 4YLQT 3DV6A 2WWKT 3WL9B 3ZHKA 5E1AB 3SY0A 2VC2L 2VDKL 1BGXL 2RFXB 4OM0H 3MRKA 4PRHB 1LO5B 2VDNL 4XWGL 3MACL 2NYYC 4L4TD 4O02L 5IW6B 4ETQA 4X6CA 2NY4D 3IDGA 3V4PL 5D7IA 5IROC 1XGYH 2PR4H 4MLIA 3O3BA 1U91B 1IEAA 3GRWA 2G75B 5F71A 1A6WH 2VZOA 3T3PE 1DUZB 1DN0B 2CDFA 3T0WA 2DQIL 2FLBT 2PYFB 1CN4A 1IFHL 5M94B 3PHOB 4OSUL 5E2UL 3R1GL 4XCFH 2GQHA 4LF3A 3MRIB 4X4YB 3U79A 3FQTA 2FECL 1A3RL 1T1YB 3NIGF 1AQKH 3B3IB 5E8DH 4OZGF 2DMKA 2JJSA 5DMIL 2VSCA 1MRDL 5J6GA 3GSUB 3PHQA 4OAWB 3VXNA 3TBYA 4XI5D 4V1DB 5CKGA 2BNUB 4XRCB 1LO0H 4YPJA 5JOPD 3TVMA 3ARDC 3BOVA 4LF3B 1A6ZB 5C0GA 2FEDC 4QT5B 5IEHB 3RKDD 1EUUA 5FUCE 4O4YH 2RGSA 3QDHA 3OKYA 1LEKB 1QHOA 3L3KB 4GXVH 4JFED 2PYFA 3GIVA 5KOMC 3VH8A 4LLUB 4NKDB 5FGSA 4LSQH 4DCQA 2B4CL 3FQUA 4NDMB 2V2WB 4L4TE 1MF2H 1TVBA 4U1LA 5B8CA 1JGVH 4YEFA 3MJ8A 4OCRH 3MXWL 4WW2F 2P24A 3E6HB 1OAYL 1KIUA 1XF3B 3AB0C 4K71B 5ICXB 5INDB 5IHBA 2IPTL 1KJ2L 2NZIA 4A6YA 1NGQL 3MNWA 1KPRA 3ZYJA 3DROB 5DD6B 4CBPA 2YRPA 4GBXC 4CU7A 4OD1H 3MUHL 3D2UB 1OHQA 2VITA 1ZA6B 2XICA 4GUPA 5FEBA 4PJ8D 1M7DB 4EN3D 4EUPH 2FSEA 4H8WL 3WIFA 4AMKH 4YEEA 1UB6A 4PY7B 3W81A 2RJMA 1L0QA 4HEPG 3T4AA 35C8H 1HILB 3UZVB 4JM2A 4WUUE 3P77B 2ZCLL 4KJPD 4U6VH 2CLVB 4MXWH 1CTOA 4G5ZH 4NCDA 2Z31B 4DKDC 5E99L 4MA3B 1Z5LA 1X5AA 5GS1A 1M7IA 3EKCA 4NKMB 4N0UE 5DEZA 1D5XB 3LV3A 2H2SD 2NY2B 1RJZB 5FHAL 5INCA 2J5LB 4WFGD 4GKZB 2XWTA 4G43A 1QRKA 4N0FA 3STBA 4DW2L 1RJYA 4YUEH 4XHJD 2X44D 4ETYA 4Z9KB 4LQFH 3EOYG 3MBXH 3GDBA 1KCVH 3IFPB 4BFGA 3QQ9D 4PJGF 2YD5A 2V2XB 3CDFA 3D1MC 4RMWA 3DURA 4HIXH 4C4KO 5IT2L 4OB5L 4WV1A 3RAJL 3V6OC 3OKEB 4U6XB 5IROA 2UVEA 3JTTA 3ARGC 2PW2B 3TBVB 4AZ8A 4HK3J 1JCKA 3EW3B 2DBLL 3NN8A 4FQJL 2QSVA 1T1XB 4PJDA 4X8JB 3DGGA 3QSKB 4LPTA 5I73C 2D3VA 3Q5TA 1YA5A 2CH8A 3DUSA 3HPJA 2VZVA 4GJTB 4J3VA 4YHPA 2B0SH 4GRLB 1KN4H 4WW2A 2BJMH 5CCKH 4JGMA 5E9DD 3T4YB 4PJIB 5AYUL 5BV7H 1I7ZB 2WNGA 1U36A 4U4BA 1QO3A 3P0GB 3MLRL 5D96C 5MHSD 4JQVC 4GKSB 1MELA 3GSNB 2DQJL 2P8PA 1GIGH 3HE7C 1FBIL 1IGFL 1QVOB 3X12A 1R3JB 4MAYD 5F6HI 4BSWB 3C60C 3V5DA 4XP5H 1JPGA 3QDMD 4U1GB 4KMTH 4TPRH 5LGKA 5EOTB 1WWWX 4N8PA 3Q6GH 1A1MA 1MIMH 4Z7OF 15C8H 3OXRA 1QSED 3GSQB 1HXMA 2X41A 4RWYL 4GRWB 4HMCA 1YMMD 4RMQA 4WW1B 1RU9H 4PRDA 4UUJA 3BIKA 1R24B 5CWSA 1BJ1H 4YDJB 3BP6A 2IADB 4OAWA 1ONQA 2BNQE 2BHYA 3HMWL 1I7TA 2EIEA 3I3BA 1JWMB 1FL5A 1CZ8H 1IC7H 4DUXA 4X4MA 1KEML 1HHKA 2YR3A 3MXVH 5IFAL 4ZO8A 1SBSL 3CC5B 4N8VA 3L3HB 2ICEB 1QSFA 3L9RA 2NMSA 4EDXA 3PDDA 1F4HA 2YD3A 4OF8A 4RIRB 3UPRA 5IW1A 1JWSA 5EBMB 4JDVB 2ZCHH 3ULVH 5JUEL 3CK0L 4PJ8B 5JDSA 1U2HA 3JV5A 4JFYB 2A9NH 2AJVL 2HLAB 3GMQB 3ZT5A 4XX1G 4EQ3A 1CXLA 1KF9B 5BQ7B 5DUBB 4U6YB 1BHGA 4GMSL 4HZLB 5DJCB 4HPOH 5EU4B 5IKCB 2IH3B 1NGPL 1OSPL 3O6MH 4NZUL 5EU5A 1K2DB 3FFDB 1QACA 1RZFL 2YUZA 4Q2ZA 2NXZB 5DO2D 1A9BA 3HI5L 3TN0C 5HGAA 3VFWA 5J06A 3SKUD 3OJDA 2CXGA 5DUPH 1R5WB 4XPTL 5IK3B 2OJZH 4OCNC 1F6AB 4FQXC 2KQNA 1RZJL 4NJAL 3EYUH 4XAKD 4MVBD 4X5XA 2WSKA 4NRXA 4TVPL 2GIYA 2W9LA 2FZ3A 4OZ4B 1MCPL 4JAMA 1TENA 1RULL 4OF7A 5HVGB 1NEUA 3X3FL 5IVXB 1QLRB 2JJSC 1J5OH 1F90L 3DYPA 2EZ0C 5F3HA 2CRMA 1HKLL 2HJLB 4I9WD 1OGAB 2FBJL 2AS5M 4KJQD 3WLWD 4B41A 1HCVA 1YMMA 4N1CA 4FXKB 4JN1L 2R23A 5EU4A 3U9UA 2VRAA 2W65B 3VGGA 2OMBA 1D5MA 3W0WD 4Z7OE 3LQAC 5KS9E 3QXAB 1DBAH 3EO0A 3QEHA 2CIIB 1YEDB 4LVOC 3TPUB 1V3LA 1CGWA 2NY7L 4D0CB 5L88H 1HK6A 1F4AA 3HI6L 4LHUB 3DHJA 1AIFB 1U95A 5C0RH 4QRSB 3STZA 4QTIH 2R69L 1KENH 4PLOB 3IDUA 5D1QC 4MA1B 1RUML 1AKJD 1SJHB 3BZFB 4HWZA 4YHKL 5LGJA 2RR3A 3MOAL 1AJ7L 2HFEA 4D9LL 4YXHL 2BOBB 2B7DT 4ELKB 2Z92A 1LP9A 1E4XL 3EAKA 4U1GC 1HDMA 3QUMH 3TT3H 4M7KL 5F9OL 1DR9A 2FEEI 4KRNA 2HTKD 3EBAA 1I1YB 5FK9B 3TO2A 4J8RA 3QUKB 2M8XA 3FO0L 4QO1A 5T3ZD 2XN9B 1ND0A 3P4OA 3VFVA 3GSNA 1WZLA 4MX7A 1NSNH 3H9YA 5I8KL 4H88H 2H6PB 1G7MA 3NA9H 1U3HD 4Y7MA 5B39B 5D1XA 3ESVF 1ZAGA 3B9AA 4XBGB 4OIIL 1OAQH 4JFPA 5IM7A 3C08H 5CP3H 2R8SH 4PRPA 3K46A 5KVEL 2EYSB 2VDRH 3MV01 3RVXD 4JQXA 1W8OA 3Q6FB 4OLXL 5C7XH 2WMPA 3G6JB 2V5RA 2YWYA 2X4TB 2WINB 5IB1A 5DMGD 3ARSA 3FT2B 1V7ML 1QEWA 4NUJA 3VFPA 2AEIT 1U3HB 3GSOA 3QEQB 3EJZD 1ADQL 2N7AA 2ZUUA 2G60H 3CVIH 5MEPB 4K9EH 5AZ2H 3ULUD 2VIRA 3D0LB 4K2UH 4U1HB 5IHZA 5B38G 5DVNA 1TPXC 1MH5B 5DSCB 4OCWL 3HZMB 2EDBA 2BY3A 1NGZB 3FONA 5FM5M 3JWDC 1IKNA 4UDTB 3SDXF 2WUCH 2DKUA 5FYLE 1KJ3L 1LE9B 3UYOD 2P5EB 3NPZB 4NO5A 3C6LD 3PIQB 4IS6A 1ORQB 4OFKA 3BD4A 1B6DA 3VI4F 2FR4B 5GS2D 5ESAA 3R0MA 1MWAB 1FNEA 2IAMC 1J0ZA 1KTRL 2PCPA 2R2HA 5E0QA 4QRUB 1G7LB 3EJYD 3CDCA 3SE4A 1EHNA 5DDHB 3TJHD 2OMNA 1BFVH 1TJIH 4HHAB 2ADFL 3A0OA 3HC4H 2AK4A 2GITA 4XVTH 4HIEA 1A22B 1OT1A 2P7TB 3HG1A 4KQ3L 1RUAH 4ZYKB 3VXUB 2XWBB 1L6XA 3TJEL 2HFGH 2V9TA 1IAIL 3UTSE 1TXKA 5HHPA 1A7QH 1X4YA 2J8UA 2DM7A 4U7KA 1A7PL 3ZYOA 4LSPH 2B2XL 4X98B 3VXNB 5FAAA 3B3IA 5TQ0H 2ICCA 4OCMC 3DXAB 4CL7A 1MJ8H 4WEBH 5HPOA 1Y6NR 2R2CA 2LTQC 5E5MB 4HJGB 2R1WB 5DEGB 1KJVB 2NY4B 3V0AC 5C6TH 4EBQL 2JCCA 3T09A 2AK1L 3EYOB 1XF4A 1FV1A 4K7PY 1EH9A 4IRJC 1R6VA 3BKYL 1F6LL 4IOFC 3U2SA 1F11B 4FFZL 1FE8L 5HI3D 3UX9B 3A67H 4JRYE 1R3IL 5DRZB 1F4XL 2NXZC 2YUXA 2YOCA 4Y0GA 1ZANH 4ZUVA 3T0EC 1W0VA 3MR9B 3CSYB 1UACH 1W72A 5D8JL 2EDXA 2YD8A 1D9KC 4RA3A 2LV4A 2NCMA 4ODWB 1WITA 2DIJA 4AEHH 1LDSA 1A14L 1TLKA 4CUCA 2AEQL 2A74A 3F58L 3HMXL 4MQXC 4LCWA 2WQRA 1EEUA 4GRLC 3LPWA 3O4OB 3DVIA 2ATKA 1C08A 4KJYB 5H37G 4DN4L 5BMFL 2APBA 3IRPX 4R9HA 5CP7B 5KVFH 1S7QA 4KKAC 3ARPA 1UENA 3U2SB 4ZAKB 3MUJA 1KNOB 3S34L 1MFEL 4Y16B 2HFEB 3O6FC 1CYGA 2B4CC 4WWKD 4WWKC 2I9TA 3ARGB 4QRRB 2RBLA 1N8ZB 2OL3B 3CFCH 2CKBH 5I8OL 2OM5A 5TE4L 1HQ4B 4KVCL 1NC2D 4AM0B 1BZQK 3EYQD 3QPXL 4ZO6A 3RPIA 2VDKH 3U7AA 2VDNH 4XWGH 4UMGA 5DJYB 4V2BA 4NQEE 2V5SA 2MNUA 4O02H 3JSSA 1LO4H 2VABA 1KCSL 1FN4B 1D9KD 3BPLC 1XGYL 3EYSL 5IW1B 5KANG 3QCUL 5FUCC 1G9ML 5CD5C 1MCEA 3U46A 2AJSH 2VXQH 1YPZE 5HI4D 3P9WB 1CVSC 5B38B 2BSRB 4XAWL 3QDJE 2DQIH 3LV3B 4ODSL 1UKQA 3FN0H 4J8RB 5D7IF 3PF2A 3TO4D 2DIAA 2P43B 3ZE1F 3CNKA 1UVQA 2F19H 4E0RB 4J4PA 2ENYA 1DE4B 1XZ0B 1RMFH 2Y6SD 5E2UH 3S4SA 1YEJH 1IGML 3B4NA 2I07B 2OZ4A 1B2WL 3ESUF 1A3RH 4QHNB 1AQKL 2LFGA 2C26A 2DBJA 5DZOA 1NH6A 2Y4SA 3EJJX 5DMIH 25C8H 2IPUG 5L8KB 4HIJA 4HIIA 4M6OH 4X7DC 1TZHB 4L29B 2YRLA 4PJAB 4XB7A 1CD9B 4NWUH 4OQTL 3GK8L 4K7FA 1XIWC 4KK5C 1R5VB 4JZJB 4XNQB 1T7XA 4NFDA 4Y2DD 5JW3L 4L3ED 4XX1E 3WXWH 2ARJA 1P9MA 5FYLL 4LOUC 5DJ0A 5ENWB 2ATPA 5MI0C 3VFUB 1C1EL 3G6JF 4Y4FB 3NCEB 2W91A 1BVKB 3L5WA 4J4PC 5IV2B 3K8MA 5FDWA 1NUFA 2ZUVA 4LSQL 4UOW1 3UTTE 4KI5F 3GB7A 2BSTA 3QUYB 4D0BA 3W9EA 5EIIB 5EOTA 4JFHD 4UILH 2UY6A 4M6NL 4MD5A 5ESVB 3GJEA 4ZODA 1EBPA 1R3JA 5KSUB 3BHBA 3O11B 4KROC 1QYGH 1JNHB 1U8IA 5BW7C 2BVPA 5C0CE 4OGXH 1KJ2H 1JMZA 5SWSE 4NRXB 1SQ2N 3ZYIA 1PW3A 3SOBL 3VU2A 5BV7B 4L8BB 3BAEL 4QRPB 3CU1A 1EXUB 3QXUA 4LLMA 3SO5A 4HHAA 3ALXA 5AWNH 1T4KB 4MHHG 4H8WH 4BM7A 4RMUA 4OFPA 4HC1L 2BVYA 4GW5A 1Q94B 4YHLL 3ROOB 3RVXC 2BOCB 4C54A 2IFFL 3FQTB 5MEOA 4L8BA 4OCSL 3BHBB 3IDYB 2X70A 4PJ5B 5I17B 4GO6B 1WAAA 2QTEA 2F9BT 4Y4KC 4Y4KD 5GS1B 1FNGB 3UC0L 1FH5L 2P5WE 1NDMA 1DLFL 3GBLA 4XP9H 2NPLX 3F6LA 3BZ4B 1NCAL 3OSKA 2EECA 3BZEB 4CADB 3PWNA 4N8VG 3WO4B 2VDOH 2Y1VA 2RB8A 3DMMD 4LQFL 3MBXL 5F7DA 1QPXA 1RZ8B 3RI5K 5I1HL 4DFHA 5DYOA 1GAFL 3U4EB 1MWAH 4P46C 3HMXA 3RDTC 5TDNB 1DEDA 4JY6A 2AJUH 3ROLB 4RDQF 3RL1A 3VXUE 4YFEA 4OI8A 1I3RA 2DYPB 1UQSA 3BPNB 1Y6MR 2DBLH 5BZWA 2J8UF 5JHDB 5SV4A 1UB5B 4OM1L 4TOYH 4MJIA 5C0ND 4DVBA 3QNXA 3RNQB 1T1ZB 2H6PA 1CT8B 2BJML 2OX5A 4EUPA 4X9BA 3TT1L 1QLFB 3VXSB 5C09A 5JPNB 3CH8A 3MLRH 4NQSB 2DTSA 1U3HC 3ARUA 3RP1A 2DS4A 1GIGL 4D0DB 1NFDB 4P99A 2IBGA 4C56B 1NCDL 4KI1A 1B0GA 4ZFOB 5JOEA 2EDDA 4Y5VA 4JY4B 3VXMB 4K3JH 3L3IB 5GGVH 4U1KB 4W4OC 4J4PD 3DXAE 1TQBC 1OF2B 3FB7B 3LRSA 1UM5H 3T2NL 1FN4A 5HJ3B 3TA3B 4JM2F 4OGZA 1YEHL 3RX8A 3S37X 3WJJA 2BSSA 4L1HA 1VGEH 2WANA 3QB7C 1CCZA 5KAQG 4JFOB 3F7QA 1SJHA 3BZFA 3CLFL 4HWZB 4ODXB 5HSFA 4MJ6B 3N50A 4N0RA 3KLSA 2JJUA 2X7LA 2ORBH 4O2EB 4F2MA 3BP6B 3WIHL 4OLWH 4PJFE 2J6EL 4JJHA 4LBEA 4WEUD 4Z7VA 1MCBA 4ODVH 2EYTA 5D1QD 1WIPA 2E7HA 1O7SA 3R0NA 3TV3L 2FYYA 3P4MB 3QIBA 5IFAH 1SBSH 1DN0A 4FNLL 1JL8A 3BGAA 4K3EL 4PRDB 1MCLA 1Y18B 4XP6H 2CRIA 4EXPX 4OV5B 4P48A 1LNUB 3D87B 1E6JL 1JPTH 3DETD 1YPZB 2DM4A 5KVDL 2E8ZA 5DZLA 3RWJA 4Y1AB 1RZJC 1S7XA 3MO1B 3TFKC 4GKOA 1JTPA 3PHOA 3GB7B 1HYRC 1JPST 1RK0B 3HAEB 3CK0H 4OZGB 5E7FA 2ESVE 4TSBH 1VFAA 3HZKB 2Z9TA 2A9NL 2B20A 2VSDA 3BO8A 2LU4A 3IDGB 2J8OA 2XPGA 3IDNA 2PO6D 3MRBB 4NQUA 1E6OL 3ARDA 4ZUTB 3U83A 4ELMB 4BFIA 4GMTH 4E42A 4HPOL 2RQ8A 3MRHA 1ZT4B 2IALB 2E9JA 1NGPH 1OSPH 3RWJB 1YNTA 4RRPG 2RIKA 2HP4A 1K6QH 2E7LA 1UJ3C 4QNPE 4X6DA 3LD8C 1Z6JT 3P4MA 4R0LC 4U1HA 3IXAA 3KHOA 2X6MA 4TSCH 4XPTH 2OJZL 5DS8A 5HGAB 1NCUA 3TYGL 4AEIH 5MEPA 3S5LG 2Z31D 1YNKH 5DJCA 1NMCB 1CD1B 1I8MB 5EBWA 4PP2A 1RULH 4U05A 3SCMA 1DBBL 1FFOB 4NWTH 1J5OL 1OGTA 3KXFA 3QQ4A 4ODTL 5IEKB 3IYLW 2Y25A 1OTUC 4PRIE 1FLTX 3LY6A 5GRUH 2FBJH 2AJYH 3QJHB 1J9CT 4R0LB 4K07A 2V5YA 1G7LA 1F3DJ 5I1DA 2E27H 1MWAA 2PCPB 4R90H 4BJLA 5ESAB 3TO4A 4J3UA 2X09A 1X4XA 2E7CA 2JLLA 5I18L 4NO5B 1DBAL 4YX2H 3C2AH 5B3JF 5FA4A 1QSFD 5DI8A 5IVXE 4PJAE 5E2TH 2NY0C 4NKOB 5JXAL 5L88L 3BGFC 2W9EL 3MRQA 5TPWH 5EPMA 4PP2B 3JVGC 3HA0A 5C0RL 4CKVX 3U9PH 3IRZA 3WO3B 3BH9A 2IADA 2R69H 2ARJB 1EUTA 2I26N 3X14A 3CMOH 2BC4B 2WAHA 4MS8C 1YY8A 4PJ8C 2DYPA 4EN3A 2GCYB 3D0VB 3OG6B 2IBZY 1E4XH 4DTGL 1KIQA 3QIUB 3D25A 3QUZC 1RUKL 1MCFA 4Y5YC 4WHTB 2AQ3A 4NO3B 4YZFF 2O5XL 2DQGL 3MNWB 4M02A 2ESVD 1NBYA 4F7PA 4WEMB 5KSBF 5DD3L 4R4BB 3MR9A 2NLJB 4Z7NF 1KB9K 3KXFE 1KOAA 4FTVA 3ZDZE 1GGIH 1NSNL 3X11A 5I8KH 5CILL 3NA9L 5ITFB 1V7NL 3CVHL 3PDOB 5GZNC 3JWDL 3SDDD 1U8JA 4U1JA 3UJTH 3TO2B 2Z91A 4WGWB 1Z3GH 4AT6B 1QA9A 1EZVY 4R6UA 5D1XB 1CWVA 2PW2A 5F7YC 5D72H 3FFCA 4HJ0D 4ENEC 4OLXH 5D71L 4C57C 1BBJB 1I1AA 4F9PC 4EN3C 3ROOA 4XPFL 1I9RH 2X7LB 3MOBH 3N85H 3ZT6A 4HH9B 4OZ4A 5JMOC 3IT8D 5HYEA 3HE7B 4M1CC 2V5MA 1JGLH 4GQ9L 1WT5C 3K81A 3VJ6A 4B53A 4F33B 3UTQB 5JHLL 4X8XA 4K9EL 3NACL 2DWDB 2FIKB 4H5SA 3UJJL 5JLZB 4LHUA 3P9MA 3V4UH 4ELKA 5EOCJ 5IESH 1BZ7A 1K3IA 1MJUL 1HHHA 4YBLC 4LCIL 5DVKA 4O2FB 4HDIB 5D6DC 4PV9B 3U46B 4N5EC 1KJ3H 5IVXF 5GRZA 1IL1B 2NY3C 4HFUL 4WTWA 3WUWG 2QADB 2H9GB 3AGVA 5T1KA 4XC1L 3SE8L 4HX1A 2YD1A 5GGQH 3V79C 5I66B 4PY7A 2XV6B 4E41A 4M61B 4LNRA 1LNUA 4ZFGH 1XGQB 3IFLL 3QHZL 4F3FA 2OI9C 1YYLH 5CJQH 1WZ1H 5DRWA 4BZ2H 1RUAL 2ED7A 2P5EA 5EBLA 2MWCA 3LN5B 5BZWB 5IW6A 2ED8A 3TJEH 1VKXA 3FQRB 5IQ9B 4Z78A 4J7RA 4ZNCD 1A7QL 2OXGA 5FA3A 3DUHA 4ETQB 2I07A 2B2XH 3EO1B 4ONFL 5FKAB 1OARH 3GRWH 2VMFA 1G7QB 1XR8B 2GK2A 5HYIA 4I18B 4K55A 5H2BA 3MRMA 43C9B 5F1NA 2BVOA 4BUHA 4EBQH 4KZDH 5MHSE 3MRDB 2ERJB 3V52L 3BQUD 2AVGA 2H32H 3I9GL 3A67L 3UBXB 2YKLH 4EJ1C 1N26A 2FGZA 1QNZL 1F4XH 3BZ4A 1G7HB 3FFDA 5HHVH 1ZANL 5E6ZA 1JZ6A 1U92B 4NKOA 3GSWA 1KIPB 4P5KA 5D8JH 4WUUB 5CEZD 1F4WH 4PJDB 1DCLA 4X8JA 5EORH 1S78C 5GGTA 1WIUA 3MUY1 4I0PC 4JLRA 5I9QB 4V1DA 4AEEA 1OTUD 4G42B 3B6SA 4HWBA 5JQ6H 1UM4H 1G0YR 1LK3H 4GG6F 1JGUL 3HNTL 4JQIL 4Z7VF 4POZD 4DN3L 1CDYA 1T6VN 1I3RB 4KK5D 2GHWB 5HI5C 4OQ1A 4YH6A 1MFEH 4GRMA 4NBYB 3HR6A 3CU7A 1T0NA 3CFCL 4WFHE 4PJ9B 1Z9OA 1TZGL 4LGPB 1YEDA 3MLVH 4RMTA 1LO4L 2IANA 5EULV 5DJDA 4FTVB 2FR4A 1PYWA 2AJ3A 4LPXA 3K4AA 1YNTB 4F37K 4LPWA 3QCUH 4QXUH 5ITFA 5EDXA 3GMMA 4NQVA 4MQ7B 4P0DA 4ZPVA 4LVHB 4XAWH 3PL6B 2R0LL 3L3DB 2DQCH 4EI6A 2HMID 1AD0B 4ODSH 3VXRE 1W0VB 2X4QA 1B3JA 2DWEB 2D7TL 4MDIB 1HOCB 3OG4B 5DJDB 2BVQA 4ZQKA 3FB8B 1QRNE 3T4AB 4GW4A 4HWBL 4GG6B 3ZTJG 4RGMB 4RAVB 1UB6B 5I75B 1MUJB 3GMNB 3LD8B 4HKJA 1CE6A 1EO8L 5IBTL 1CF8H 25C8L 4P46A 1A0QL 3X3GL 3W39A 4IM8A 1W0WA 4KK6C 4HIIB 3LMJH 4NWUL 1T03H 5IKCA 4NN5C 4XBPB 1R0AH 4LVEA 1PX3A 2FECI 3JUZA 4QHNA 4LAJH 4G43B 4GKZA 3U36A 2W59A 3CZFB 1DBKH 3O6FB 3S35L 5HBBA 2FEEL 4EVNB 3IETB 1P7QD 2PO6C 3T08A 3VXQB 2GJ6E 3DYOA 4Z18A 1RFDH 4HMEA 3IFPA 4GFTB 1PZ5A 4PGJA 5T1KB 1NANI 2F74A 4A6YL 3TH2T 1L6ZA 1WAAF 1AXTH 1FJ1A 4PTUB 5ILTL 1UZ6F 4X9FA 4V1DE 2Z0BA 3KPPA 1U8HB 4MCZB 3MRFA 4JY4A 5DJYA 4WDIB 2KBGA 1JUFA 3BVNA 3RVUD 3MA9H 3ULVC 2EC9T 5ICYA 1ZA3A 1AGEB 4K23H 1GGBH 3WKMH 1KGCD 2RHEA 3PWJB 2E9BA 4YHML 5TDPA 5HHNB 3SQBA 3KYKH 1J0YA 3JBG7 3OB8A 3BD3A 3GSXA 4UNTA 4UQ2B 4HUUB 2MKLC 5I1LB 1RD6A 2JE8A 4HH8A 5TH2B 1RURL 1H5BC 5F7MC 2FHFA 1H9VA 3FT2A 3SDAC 2FL5A 2F5BL 1BP3B 2VQ1B 5C6WH 2EDRA 3SE9H 5DK0A 1HSBB 1VFAB 3KPTA 1MCWW 2OP4L 4MWFA 4QOKE 4ZUWA 4OCSH 1RK0A 3H3PL 3HAEA 1AHWA 5IG7A 3HZKA 5ICZB 2P5WD 4RCAA 5ERWA 1S7XB 4LLUA 1WFTA 3MRLA 1FH5H 4DGIL 1Q0YL 3X11B 1OW0A 1NCWL 3FB6B 1DLFH 2C3HA 3LIZL 2MKWA 4Z7QF 3LHPH 3KGRA 2VQ1A 4HUXA 1P1ZA 5HY9A 2Q8AH 4JFFB 5IJKC 1SM3H 5IG7B 2VDOL 1PG7X 3L3HA 2AXJA 4PRPE 4I4WB 1FDLH 3V0WH 4GAJL 4Y5YA 4R3SA 5EBWB 2A0LC 5E8OA 3MLSL 4NNYB 1WQVT 4TVPE 3WLBB 5IMOA 5FO7A 2IANE 2AJUL 4NC2B 3SBWC 4JO4H 1GC1L 2CMRH 2J4WL 5GSRB 3QPQC 4HIEB 1F3RB 4RRPA 1IKFH 2NY5L 2WK2A 3GMQA 5CEZE 4Y8DC 1XGRA 3ZTNL 1BREA 3TT1H 1YC8A 3KYMB 4LLQB 3JWNC 3PQYD 4JFDE 5KBNC 1CGXA 3LS4H 4PYHA 2Z91B 4EUPB 3QBTB 3K8KA 3T77A 3SE3A 1CFVL 3RBSA 1BBDH 3E2HC 1TETH 4B50A 5MERA 2ADJB 5GGVL 4XCCL 3RNQA 5SX5K 3HLAB 1F6FB 1L0XA 4OFIA 5CUSH 2EDKA 4P23A 2YHGA 4L9LB 1W2KT 4X5XB 4AENA 3T2NH 5AZEH 1YEHH 4I18A 4NFCA 4QNPF 1VGEL 5JXEA 4EN3B 2XKNA 4IDJH 2AK4E 5EO1A 3CVHB 4ZOBA 1IMHC 5IBLC 2IFGA 1T22B 2HWZL 3RY6C 4PJHA 3TH3T 5FA3B 4O9HL 5D2NC 2ORBL 3VRLF 1G7PB 1T80A 3QDGD 1NGWA 4XMPL 3U1SH 3SE3C 2BVQB 3C09B 2X4PB 4J23A 4CADA 2F58H 3PJSB 3WS6C 2DM2A 3CDYA 1ZA6A 5F7DB 4M93C 3GMNA 1GZPB 2EYSA 2BFVH 5E7BA 3TCLA 1IBGL 4BQBA 5J0BA 5HD8D 3F12A 3FTGB 2R1YB 3BGMB 5ICYB 5ESQB 1ZLUH 1TVHB 2V2WA 5KW9L 4NZRH 3G6JE 5EH1A 2UVFA 1P6FA 4GLRH 1CLZH 5I8CB 4TSBL 4KHTH 4AL8L 2Z8RA 1J86A 4PJ7F 4X5WA 4XBPA 2VH5H 2FHCA 4XPHL 5T1KD 2L0DA 1OWWA 4D0DA 2I25N 1JF1A 3P73B 3W0WE 1NDGA 1KLGB 4PREB 2Z92B 4PBWD 1VFOA 1CFQB 2J1KA 4MSWB 1XH3B 3IETA 4GMTL 2IC2A 1XT5A 1PD6A 3RIAK 2R4RH 3AROA 4KMLB 5CWSB 3D6GA 2IH1A 4P2QA 1HILA 1NCBL 4M5YL 2GJ6B 4PJCF 1QFUL 3QH3B 3V6FA 5IJKA 4AIXA 1WFNA 3PQYA 1HDMB 4X6DB 3WUWA 2R9HC 5DQDH 2V2XA 1PBYA 3MRCB 4A2MA 1MVUA 1YNKL 5AEAA 5GGSA 1OQXA 4EI5B 1HWHB 3QCTH 1DBBH 4NWTL 5KSBA 5KSUA 4ZXBA 1IAOA 3QI9B 5J7CC 4XPAL 1GSMA 1P1ZB 5HY9B 5GRUL 3F7YA 3AREC 1RHHA 5KSVA 1S7SB 3GSVB 1HOCA 4BQ6A 4MDJB 1D5XA 2VN4A 1JZ2A 2E27L 2PTTB 3Q2CA 4JLRB 3V5KB 2FD6H 1C16B 2WZPD 4PP1C 5I18H 2A77L 4QXGH 3C2AL 3T8XA 3SGJC 1A2YA 3TBVA 4WI2A 4EOWH 2W9EH 4XNZC 4G9FE 4IRJD 1QFOA 4FQ2L 3T0DA 3RHWF 3U9PL 5TF1L 5E4IA 3FZUD 5E5UB 1N59B 2Y07H 1WFOA 4OIAA 1UZ8A 3OAYK 3CMOL 4KRPD 3RZWA 1I9IH 3OJDB 1MFBH 5CSGA 1AFVL 5SWQB 1AR2A 1AO7A 4JHAL 3GIZH 5L6YH 4KKAD 4KUZH 2V6HA 2VZ3A 2YEZA 1RUKH 3DV4B 3QIWD 5JORA 3RDTA 1UJ3B 1MAJA 4JG0H 5BXFB 1I85C 3BGFB 2VXSL 3KPQA 3BEVB 5HVHB 5JIKA 1KTLB 4P23B 3BXNB 5FM4A 2NY2D 1XR9B 3IU3B 1UWEL 1EEZA 1JHKH 5GJTH 1MCHA 4R0LA 4XTRD 5DDHA 1V7NH 2OJEB 3CVHH 3JWOC 4LSUH 3OKDB 2DI8A 1QFPA 1F8TH 3E8UH 3DMMA 3VDBA 3UJTL 2DQDH 1G9MC 4J6RL 5HVWA 1HCFX 4U3XA 5LGHH 1HHGB 3JTSA 3LDBB 3FHQA 4P4RA 2H32B 3QR2A 3Q48A 2XN9E 1GGCL 3C6SB 3V6ZB 5KG9A 4U6HA 3D9AH 5JORB 1QSFB 4I1NB 5D71H 4LU5H 1UB5A 4PLNC 2O61A 1I9RL 2ITCA 5FOBB 3N85L 4ZFOL 1M05A 5JW4R 3PNWA 4FFVD 3FQNB 1T1YA 5FCUH 5C07D 4F33A 2A6IB 3MLXH 3G5VB 4M8QB 3V4UL 1ZLVK 3QIBC 5F89A 3U48A 1MJUH 5IQ7L 1BJ8A 2V17H 4ZS7L 4LCIH 1JGDB 3U0WH 1RIVH 3SKOA 4MJ4A 4NNPL 3JV6B 2JIXA 1S7VB 3HPLA 1Q9WB 1MVFA 4HC1A 1G84A 3MJ6A 4N90D 2PO6A 4HFUH 4LCCB 1QBML 4XCYB 1JUFB 2C3GA 3FAWA 1A4JB 1S3KL 3BVNB 1MCCA 5A2FA 5E2WL 4MNQD 4XBEH 3MPCA 4XC1H 5HI3C 4PP1D 3SE8H 4QHUB 4X6CB 4AK1A 2H9GA 4NDMA 5B39A 4WHTA 4J3TA 2QSQA 3QHZH 5EA0L 3NABL 3GHEL 3HNSH 2P5WA 5CJQL 2EKSA 3SGEI 5DJ0B 4Z7VB 1BX2A 5HHQA 1AY1H 2AI0L 4PJGE 2CO7B 4P9MH 1JF5A 5DA0B 3MC0A 1K4CB 4ONFH 3UO1L 5DTFB 5LWYH 2VAJA 4YBQD 2NY6D 1EVUA 3TN0A 3JTTB 3U30C 4AT6A 3HG1D 5HYJE 4CDHA 2DJ4A 1A6UH 4OKVA 4Q7DA 5DJAA 4ZD3H 3UJIL 4ZOCA 1IAII 5GRVK 3BH8B 3NGBB 3ABZA 3S96A 1XCTA 2YZ8A 4WFFE 3CXHJ 4OUOA 2NTSP 5EFIA 1JPSH 2X4NA 2YKLL 2DAVA 4X5LA 1CLCA 5HHVL 4GAYB 1MI5B 2MFNA 1G7HA 2WP3O 4IS6B 2RFXA 1B4JH 3AB0B 4MA3A 4QXTA 4JFQA 1OAXH 4WWID 4DVBB 4JRYD 1DVFD 3HE6C 2AXGB 4LCUA 4G8IA 3RTQA 1ED3A 3G5ZA 1PSKL 5IFHH 4X0KB 1WWCA 4Q9RH 2XZCL 4OLUH 3VXUD 3VFUA 2FATH 2ID5A 3HNTH 3ILQC 3BSZL 1BVKA 3L5WB 2BP3A 5IV2A 1OGTB 3H2WA 3ARBD 4Y4FA 5GS3A 4K7FB 4ONOA 4OCYH 2IWGA 3REWB 3RY4A 3V9FA 4WIQA 5JXED 3I2CH 2VLJD 5CZXD 1T0NB 1ED3B 5IMLB 2YSSB 3VWJB 3N1MC 1J05B 3S97C 4NGHL 2HT4C 3OAZH 2O26U 3HHRB 1TZGH 4HS6B 4NT6A 5FYKH 1A6PA 3BN3B 4YE4L 5D1XD 4NCC1 5J12B 3BKJL 1LMKA 3G5ZB 4MNQE 4G8GD 2VL4A 3CXHK 2PETA 4L8CB 4PJHF 2OL3H 1NC2A 4QXUL 3OX8B 4R96B 5JOFA 3BT2L 2VNCA 3AS2A 5BVJA 4HKXB 1A6ZA 3ES6A 1TCRB 2C3XA 2AJZA 5I76B 5BW7A 2QQQA 5HHOA 2D7TH 5EZOH 4GW5B 2Z8VC 2VYRE 1J88A 3PWLB 4LEOA 5DFWH 3G5VA 3QDME 2P4AB 2YMXH 2A6DA 2ZJSL 3WLBA 4H25B 3FONB 4F7MB 4IRJA 2WBJD 3ARGA 3RI5F 1ZEAL 5ALBL 5GSRA 2CLRA 5IMOB 4M1CD 3NOIA 5SWSD 1A0QH 3X3GH 1YJDC 5F1NB 1BOGB 4G6MH 1Q8MA 4GS7C 2I9TB 4JRXE 4LPCA 4ZS6D 5I71C 4OZIF 1CG9A 3C5ZD 2OL3A 3O3AB 3L3OB 1UFUA 1EERB 3T65B 5E6IC 4JO1H 2P24B 4O5LH 1N5YL 3HFML 4MB3A 5H94B 3S35H 4N8CL 5T3XL 6CGTA 4LEOB 1D5MB 3FT3A 3I6LD 2PO6B 4FXKA 3GMOA 3U82B 1RFDL 4V1DD 4YDVB 1A4JA 4R7NA 5EU7C 1URLA 1A3LH 5ILTH 3VFGL 4MAUH 1XCQB 5ADPH 1I4FB 1INEL 3FFCD 2EICA 3NTCH 4WY7H 3EOBA 4HLZH 4RQQA 1I1RA 4F58L 5K9OB 1GZQB 3MA9L 2F8XC 3QIBB 1E0OB 3NCYP 4S1DC 3KR3L 1YJDL 1RI8A 3H9SB 2CIKA 2DOCA 4LIQL 3PWUB 3QNXB 3KYKL 1PLGH 1UM6L 3C6LA 5K9KB 5E00A 4PBXA 3G9VA 1KJVA 5K9OA 3KPSD 1AGEA 1F42A 4UT9L 3L7EA 3L3IA 3UTQA 2EIZA 4HLZG 1OM3L 4JFXB 3MJ9A 5TDPB 3MRGA 1J12A 4DFIA 2FNBA 1V3JA 1RIUH 2YPVH 4ODHL 5DD5L 1VHPA 4YBHA 1JWUA 3IJSA 5HJ3A 3TA3A 4G8IB 2A6KB 3RTQB 1S9VA 1FRGL 3RGVA 4KU1A 3O8XB 1NBZA 1BFOB 1JTTA 3WMSA 5C3LD 3G04B 4M6MH 4EVNA 3DRTB 3MV9A 1I3VA 4QXTB 4TNWK 3BIAX 3ZKNC 4JCMA 3WO4C 5T1DL 3N06B 4OLYH 2H1PL 3I6LE 2LTQB 4POUB 4QEGA 5CD3B 3V0VB 3DUUB 2Q8AL 43C9A 1LWRA 1SM3L 4AM0A 2UYLA 4U0RB 1JZ4A 4JFXA 5I9QC 3SKMB 3IFOB 5C0EA 4PY8J 3QDGB 4YC2C 4GAJH 2XTJD 2NX5A 4Z78B 3MLSH 4Y16C 3OAUL 2HT3C 1MH5A 3BKML 3OB0K 5DRWB 1CGVA 5C0FA 4BK5A 2W9DL 1F00I 5D7KD 5DJZA 2HAZA 1JPGB 3UZEA 3ES6B 5IFJA 4UV4L 1M71B 5F1IB 2NY5H 3MRBA 5FDYA 3ZTNH 1C16A 4ZOEA 2DI7A 5F3BB 3BH9B 4FQIL 3MJ9L 3RWDA 3VDAA 4JFZL 4TSAH 3KPPB 1II4E 4I5BA 4C55A 1IILE 1EBAA 2ITDA 2XN9A 3RIAF 2CDGA 5CS7A 1TETL 3PG2A 1DDHB 2BSTB 1YMMB 3QUYA 1P7HL 5GS0D 2AQ1A 4H20H 4ZO7A 4RNRA 1JRHH 4DCQB 2B1AH 4FQHB 4KDTC 1JZ5A 3RWDB 1OOAA 3O3AA 1TMCB 3R06B 4U3HA 5TE6L 1X5IA 2IAMA 4KRLB 3TIDB 1WCBB 1HNFA 3G6AB 3PGCA 5FFLA 5F1IA 1FSKC 3MV8A 2QADC 4O9HH 5GSVB 3MZTA 4LK4A 1NLDL 2YPLB 4XMPH 1AKJB 1P5UA 3U1SL 1QOKA 2YXFA 4QRPA 5A2LH 4PLJD 4DK3A 2F58L 1MQKH 1DQQB 4UIKH 4XVSH 2L7UA 1S8DB 4U6YA 4UNUA 5K9QG 2EE9A 4M43H 5CEZL 5FGCE 5JZ7C 1DSFH 4RNRB 1JNHA 1U8IB 2DQHH 4AQ1B 5A40E 3STLA 1JVKA 4NZRL 3DO7B 2DL2A 2FO1A 3NCBB 4LVNC 3GKZA 3KPSB 5GHWH 1CLZL 2EEAA 3UTSA 5MENB 1LEIA 5HGDA 4OFDA 3U6RB 2VH5L 5IOPA 4KJPC 4CVWA 1MCRA 2D0HA 4JM2B 2HJLA 1C5BH 3MRPB 5I16A 1F02I 3WFBH 3S3SA 3OKNA 2I5YL 4M48H 1I1AC 4X6DE 4F9PA 4C56E 1QUNA 3UPCA 4JM4L 5ESQA 2IANB 1KSRA 3TA3D 1JJUA 1K4CA 3O6LH 3U9UB 2R4RL 4KKCD 4ZXBC 4OZFG 5E00B 2BXZA 2YC1B 3BPLB 5TJWK 1NCBH 4M3KB 4PJ5E 1BVZA 1IM9D 4X7TB 2VR9A 4LGRB 2W38A 4ZAKA 5IB2B 1I8LA 3D2UD 3I3EA 3KPRA 1EFXA 3VWKA 2XKNB 4FQ1H 4PRAA 3PWVB 2NR6D 3W82A 2V9RA 5C0AE 1QBLH 3GSNH 3AM8A 4NQDA 4Y4KA 1INQB 4G3YH 4WO4D 1MCDA 3NGBC 4YPGB 3HCVA 4W4OA 3WHXA 4HUVB 5I1AB 5D6CA 2ZUQB 4ISVA 4XPAH 1OL0A 1FNSH 1QFHA 3VMPA 1NQBA 1GPOH 5FF6A 1KELL 3C8HA 2HVJB 5K9QI 3PP3H 1E4WL 1DJSA 5IWLA 2D9QB 4G9FB 3O4LE 3ORJA 2WLYA 3MNZA 1EA9C 4OZGA 4I3SH 2W60B 2B8OT 2A77H 4QXGL 1DBML 2MTPA 1MHCB 3QG6A 1N64H 1QSEA 3BUTA 5SX4I 2FX8H 2HT4D 3UTTD 1JWMA 3LEVH 4BK4A 4F15C 1HHHB 5HGHB 4K9EC 1OAZH 3ZDZF 3NIFE 5CBEA 2EEDA 3OR6B 3VA6A 4E41E 1T5XB 2I60L 4N8VB 1MQ8A 1NLBL 4X99A 1BZ7B 5CIPA 2Y07L 4HV8A 1NEZA 4MNQB 1LILA 5DWUL 1PX4A 3ARBC 3VCLB 1OVZA 2Z35B 4FFVC 4I0CC 1ZSDB 4D9QD 1BMGA 2XTJB 4TUKH 5J13C 1DQJA 4FHBD 5ID0B 4JHAH 1I3GL 2XWBA 3PWJA 3L3JA 5D2LF 3PXHA 3IAPA 5B39G 1ZA3B 4KDVA 4PTTB 1IQWL 4H8WC 3P0YL 4B7IA 1P6AB 1QSEB 2IPUK 3V7AG 4LKXA 1C8PA 3FB7A 1QBBA 2X4SA 5GRWA 1DUZA 1B0RA 3FO2A 2DL9A 4MD5B 3ISWA 1CICB 1DP0A 1Z0NA 2CDFB 1UWEH 2IQAB 1DQML 2VISB 4U1MA 1SJEA 3RUGF 3MLTB 1ZHKB 4L4VA 5L0QC 4KI5D 4ZUWB 5TGBB 3M17A 2FL5B 5CEYB 3FT4A 1ZT1B 1NUGA 5BOPA 2ICWA 4RZCA 5I15H 4DZ8A 3C60A 1U8OB 3C8KB 4H26A 2IMMA 5CEXA 2NNAA 2BC4A 1JNNL 4EXKA 4JB9H 4MS8D 3REWA 1KJMB 1S9XB 1JBJA 1SYVB 3DECA 1Q1JH 4RMVA 2PTUA 1FZOA 4PGCA 5A43C 4PRBA 2YD2A 3CFDB 3L95A 4JKPH 5IR1B 4G6AD 4PJDE 5JIPA 1EAPB 1EIBA 3HR5B 3MLZL 4PRNA 3BP4A 4ESKA 5TGBA 4Y2OA 2V17L 4ZS7H 5JMRA 4HS3A 3U0WL 3E6HA 1ZVYA 1RIVL 5LCVH 4KZEL 5HGDB 4W4NA 2AABL 2Y7QA 3PWPB 4WV1C 1HEZA 4WO4A 1NDMB 1NKOA 1TVBB 4JO2L 4U1LB 4RFEA 1U8JB 3VFRB 1QBMH 1TCRA 1S7TA 1JZ8A 5E2WH 2P8LB 5B4MC 4KHXL 1R5IB 2K9UA 1J0JA 5C0CD 1SEQH 3AS3A 4D3CL 3BEVA 3GHEH 3WIFB 3HNSL 3PABB 4JPVL 3LRGA 4KMQA 4LMQI 1A6TA 1B88A 2V7NA 3JV4B 4PIRF 3PWPA 2RCSH 3WJJC 4CN1A 3S36X 1KTDA 4XXCA 5IEKA 4QF1A 1NANH 4BZ1H 4FFWC 1YEKH 3ULUE 4MCYA 4IRSA 4S1QH 1AO7B 3L7EB 4IJ3C 3SPVB 1PGRB 4E41D 3QUYD 5DD1L 4IRSC 4YWGH 3DSFL 4B5EA 4N0YH 5EZJA 3GBNH 4F8QA 1FAIL 2ATKB 3HC0A 3O2WH 2NZ9C 4ZDHA 2F8OA 3MACH 4HGMA 2F54D 4EI5D 4FZ8H 1YN7A 4PUBH 5DF0A 2ICWJ 1JRHI 1JPSL 4RA0C 5J13B 1CBVL 2BSED 3VFMB 2Q86A 3EYFA 3T0ED 2X4QB 2XA8H 1I4FA 1YQ2A 2R4SH 1BECA 3UPAA 2ITDB 4GAYA 2A73A 5F89B 1MHEA 1WEJL 5DK3A 5F6IB 2R23B 3O41A 4DQOH 4JAMB 4NUGH 1KB5H 1RAMA 5DK0B 1CL7L 1DQJB 5E8DL 4MJ6A 2DLFL 4ZMAT 5GS1C 2AP2A 4JFOA 3HZVB 1VEOA 4D0CA 2WIMA 2XN9D 3GSUA 3PHQB 3VGAB 4GKNA 2LQRA 2VERN 1LK2B 3LKQB 4X6FA 4ZO9A 1LO0L 3SDXA 4ACPA 1VERA 2IH1B 4P2QB 1CGYA 2F5AL 4CW1A 1BM3L 3QIWB 4S1DD 3BN9D 4MYWB 4PJGB 2FGWL 2JF1A 3GI8L 5C0BB 5J1TC 1CXEA 4OGAD 2VO5A 4WU7A 3OPZL 2EC8A 2PUQT 4NQED 3BT2H 4F7EB 1V3MA 2ATPB 4UOW0 4OCRL 2YPKA 2QR0A 3SJVA 3T0EE 4YFLF 1UXSA 1FZOB 4PGCB 5EZOL 3HZVA 3O3EA 4FMKA 4OD2A 5C0NC 1EV2E 5TDOA 2DWDA 2FIKA 2QV2A 4I48A 4KXZH 5E95B 2YMXL 4PJXF 2YEZB 3DV4A 3QPQD 3WNLA 3U0PA 3VXRD 3O3UN 4RFOH 3PL6D 3K8LA 2ZOLA 3ARBA 4MZ2A 4OD1L 1GC1C 4Z76A 1U6AL 4MXQD 3L3GA 1NC4D 3NZHL 3OGCB 1BF2A 5GGSY 3RBGA 4AMKL 2ESVB 1EEQA 3QEQE 4Z7UB 4M61A 4KRMB 4AENB 2EKJA 4JO1L 1N5YH 3HFMH 2ZCLH 4LRIA 3O3EB 4OD2B 5T3XH 3O6KH 4G5ZL 4RDQG 2DIBA 3K2MC 4P5MA 5H94A 5IWLC 4WFGE 3S3JA 3VRJA 3MRRB 3W2DL 1F13A 3QXWA 3VH8B 2HLAA 1P2CA 2EDJA 1A3LL 1UEYA 3UTSD 4QYOB 1INEH 3GMMB 3O9WC 3CD4A 1ZHLB 5HPMB 4HKZB 4YUEL 4F58H 3IDXL 5IVOA 1T4KA 2X70B 5CJXA 4TNWF 2N1KA 2YD7A 3GUTA 3QEGL 5EC1A 4MDJA 4F7TA 1TFHA 2BOCA 2BNRB 1WJ3A 2Q76A 2HT2C 5IT2H 4CNIB 3MV9E 3DHMA 3B83A 3H9SE 3LKSB 1YQVH 3INUL 4NN7C 3WE6B 5ANMA 4M1GH 2YRZA 2GJJA 1IGTA 1U8NA 1F2QA 5DK2A 4FQJH 1S7WB 2AEWA 1PKQB 1OM3H 1NDGB 1KCLA 5AD0B 1KN4L 3O3DB 1RIUL 2YPVL 3FO1B 1PZ5B 2ICWI 3NIGE 1MFDL 5BV7L 3MGTA 2CIIA 1NAKH 2HRLA 2H2PC 4ORGA 4DEPC 4HUWA 1IC1A 5IB4B 3RGVB 4EDWL 5ADOL 1UEMA 1M6OA 4WWKB 1CI5A 5JTWA 2A6KA 4IJ3B 4GRWE 3UDWA 3GMOB 3CDGB 2A73B 2XZZA 3TM6A 5CJXC 1ZGLM 4LCCA 4Y1AD 4OLEA 1HH6B 1NGXB 2HRPL 1YN7B 3Q6GL 3F5WA 5F7EH 1Q9WA 2CK0H 1TTFA 3BE1L 1X44A 2EZ0D 4ZUUA 4TTDC 1TQCB 3VRLE 3EDDA 2DB8A 1PDKA 5F9DC 1RU9L 5JW4M 1AQDB 3UBXI 1XMWA 4LOUD 2NNAB 1B90A 1NC4B 4JJ5A 1BFSA 1S7UB 5D7IE 3OAUH 3TBTB 3QA3A 2QBWA 1KJMA 4WV1B 3BKMH 4NHCL 4WI5A 5DO2C 4EQ2A 1FFPB 2D9CA 3M07A 3VXME 3RZCD 1KEMH 3MXVL 3PL6A 3P73A 3SKNA 4U6HB 4QCIB 3KPRE 1R5IA 2IQAA 3U4BH 4JFQB 3ZKSD 4NKMA 3OJ2C 5ACLA 5J11C 5F7WC 2R1XB 1CFQA 1IE5A 2ZCHL 5JUEH 3MJ9H 1ZTXL 2CKBB 1A6TB 2V7NB 4QRTB 4PYGA 3L5IA 1UXSB 3QAZC 3RY5A 3NCFB 4UZGA 4XHQA 4UAOC 4F9LC 2YPKB 5DJAB 5F7NC 1Y18A 2P8LA 3C2SA 1BPVA 5CD5D 4R2GD 1KLFA 3QA3B 1GGYA 4H20L 1L0YA 1U8QA 3KLAA 2I24N 4P57A 4NOFA 3O6ML 1J1PH 5DD6A 2YSSA 2CRZA 4NRYB 1CFSA 4GRWF 4JE4B 2C3VA 4Z8FH 3SKNB 1MY7A 2IAMB 5C08E 1FNFA 4YQXH 1DZBA 2GKIA 3B2UC 4I4WA 1RZJH 4NJAH 4O2CA 1F97A 3EO1A 2EIZB 5I71B 1MAMH 1R24A 4DWHA 4TVPH 1AGBB 1D6VH 1MCWM 3T1FA 3WIIL 3GJFA 3KPLA 1MCPH 5CFHA 3SKJH 3W11D 4XPGL 3HE7A 1H3XA 4KKBC 4PR5B 2P5WB 5J3HC 5EC2B 4BZYA 3ULVD 3CFKA 3CPLA 3I6KB 3BP5B 4KC3B 3UTZB 1TZIA 4FQQA 5DZNA 1L9MA 3IDNB 4MQXD 1E4JA 2DLHA 4X6BA 8FABB 1C7SA 2GY5A 4M43L 4G9DB 1HSAB 3QDGE 5CEZH 2YPLD 2YN3A 1S78D 5HHME 3ZHLA 1A7NH 3BP7A 1NPUA 2MMXA 2D4FA 4YHYB 1LEKA 2VLKD 5JQHC 3E2HB 4U1MB 3SHSA 2ADJA 1V5JA 4JRXB 5HYSB 4EI5C 1ZT1A 3ILPA 3ARQA 3M17B 1EK3A 4IOSD 4OJFH 2NY7H 4NT6B 5DLMH 4YDLC 3EYQC 2H2PD 2R1WA 2NXYB 3C5SB 4MLSA 2OZ4H 1MCSA 4F7CB 3CFKB 3DX7B 4QOKB 3O6LL 4KK6D 5J89A 1KENL 2DYPD 1FCGA 4HUUA 5E5MA 2FBOJ 2P1YA 3P40A 3IXTA 5I1LA 5EBLB 4JO3L 1KG0A 4N9GB 3MOAH 2C4FT 1JP5A 4PRIA 3O8XD 3OKNB 4X7TA 2ZUYA 2OK0L 3M1BA 3GSNL 1BOGA 4G3YL 4P3DB 4HQQL 2K7QA 4F7CA 4ODBD 2V2TB 4M7KH 3AS0A 1I9JH 4YXKL 2IBBA 2LU7A 4PG9B 3DMMB 4LRIC 3TLRA 3FO0H 3QNYA 2GT9A 3QUMA 5ERWB 2EDOA 1NAMH 3OXSA 2ZUWA 4UINL 4I3GA 3KLDA 4NO0A 2ADGA 1LEGA 3CAFA 4RFNC 4NQEB 5DHVB 1AO7D 4I3SL 4PLKC 2IJ0C 4MJ5A 3S37H 1UXWA 5MEOB 5F88B 1GL4B 5BS0D 2FX8L 3F7VA 1J18A 2EO1A 1WZKA 1FFPA 5C7XL 1NC4A 1J7VR 1EO7A 5FYJH 1FHGA 4L3EB 1NGYA 3QQ3B 3GHBH 1NLBH 4ZTPL 4MA1C 5E2VH 3BRGC 1WC7B 5EU3B 1U58B 1H0DB 1NCCL 5DMJB 5T1LA 2PYEB 3KYNA 3CVIL 3DROA 2EIBA 4BELD 2VXUL 4AH2A 5IB2A 1XIWB 4G6FD 1VKXB 2CGRH 1I3UA 1RJCA 5CINL 4PRPD 5EOQH 2IQ9H 4OCWH 2J12B 2DICA 5FO8B 5L8LB 1IQWH 1DFBH 4I8DA 3BDYH 1T7WA 2UY7A 4X0KA 3RUGE 1Z9SA 1ZVHA 4UDUA 5I74C 1R3HB 4MCZA 1B0RB 2V7HB 4DKFL 1ZGLA 3VXOA 3JUYA 1YEGH 3EHBC 3MV8D 3KXFD 1AH1A 4B7LA 4YR6A 2BMKA 4MQ7A 4XVTL 4Y1AA 1HE7A 2J2ZA 4JZJA 2XWJB 1GOFA 1ZVSB 3ULUC 4P2QD 4YHYC 2Z31A 1S7WA 3BN9C 2W0FB 4ONHA 4R26H 5EUOB 4LCWD 1JNNH 3V8CA 4JB9L 5D9SB 5FYJE 4BH7A 2F53B 2EDLA 4YDKH 1UZ8B 2EDNA 1MJ8L 4WEBL 4DEPB 5JR1H 4LDEB 1S9XA 2RAMA 4MJ2A 4XP4L 1EGJA 3EYVA 2AK1H 3MLZH 2FB4L 3VRJB 1BIHA 4FFZH 5CIPB 1FE8H 2A9MH 3GJEB 4R4NC 1DQLL 3QXAA 4NBZB 3V7MA 4OLVL 4JO2H 1N2RA 2KH2B 3JV0A 1FPTH 3MRLB 3HUJE 4KHXH 4OIBA 1S5IH 1SEQL 4C58B 5T5NG 1GHFL 3HMXH 2LE9A 2WWMD 2X4SB 4QRRE 1M7XA 3VXSE 4BSJA 4JKKA 5KVFL 3NVQA 4JVUA 3S34H 3OR7B 5C0IB 3VFWB 3ZO0A 5DD1H 3BDBA 3VFNA 4YWGL 1WBYB 1LD9A 3DSFH 3RRQA 2ZOLB 3ARBB 4PJAF 4ZUTA 4ELMA 3OKMB 1QPPA 4L4TA 4G42A 5TE4H 4UQ2A 1FAIH 2OTPA 5DFVD 3QPXH 5SWZA 1WFUA 5DHVA 5I16B 4K8RL 2X1PA 4FQCH 3BEWB 5IHUL 5KSBE 1A2YB 2QEJA 5INDA 5IOPB 1DVFB 1EDQA 4OBRA 4FZ8L 4PUBL 1KCSH 2X05A 3B6SB 3OXSB 5GZND 5HYQB 5IUSA 5MEND 2O5YH 4NO0B 3RNKA 3EYSH 1I8KB 1ZWIB 4P57B 1W0YT 4HS3B 3H3BC 3TPKA 1G9MH 1JWSB 5EBMA 3NIDE 3RVVD 2WUBL 5B4MD 4NZJA 5B38A 4HWNA 3FN0L 1U8KB 5B21A 3T77B 3P30L 1FORL 3U6RA 1WEJH 1KCKA 2MQ0A 2F19L 2X40A 1RMFL 3L3OA 4DQOL 2N4IA 2PN5A 5I30L 1IGMH 5H8DA 5D6CB 3STLB 5I1CH 3QIUD 3IDMB 1CL7H 3BESR 4YPGA 1UQSB 1JWUB 5C6PB 1XIWA 4JY6B 3H42L 2DLFH 4JY5H 3QQNA 1LO2L 1S7QB 1T22A 3HNVH 4OCLC 2VKWA 4M7JH 2EH8L 3GK8H 4JGUA 3BWAB 3K4DA 4IIQB 4FP8L 3KVQA 5JW3H 2XTJC 5FYLH 1MUJA 5D2LE 1BM3H 1GZQA 1C1EH 1NFDA 2FGWH 3GI8H 4NQSA 1FYTA 1T3FA 1XAUA 1OLLA 3DO3A 3H9SA 1XCQA 1I8LC 3WSQH 1EVTC 5EO0A 2GSIB 3TESA 1NGXA 4UILL 4HXBH 1HH6A 4NRZA 1S5HA 4DK6A 4R7DB 1CLYH 1MOEA 3MV7B 4PJGA 2FLRT 1JGEA 3RA7H 4RSVA 3MYJA 1QYGL 1CVRA 3G9AB 3KAAA 2GK0A 1AE6H 3LDBC 5HGGS 4LLVB 5FOBA 3EYVB 2JJTA 4PTTA 3WFCL 4RFOL 3OR6A 4ZSOE 3BAEH 2VKXA 2XYCA 5HHOE 3GMRA 5F9WB 1U6AH 2H41A 1FCCA 3OJMB 3NZHH 4PJXA 5I2IB 2Z35A 1R3LB 3WYRA 1W8NA 3F62A 4YHLH 1REIA 1I1AB 4GT7A 2P44B 5F6HJ 1H15B 4M93B 2B5IB 3MGOB 4A2LA 2UWEA 2YBRB 3OX8A 3O6KL 4S10A 3DX6A 1AXSB 2NW2B 3S96B 4HBCH 1D9KA 5D2NB 3P4OB 3VFVB 4M1DL 1MHEB 1LEGB 3B8SA 5IVNA 1LE9A 2CKBA 4JVWA 1TVHA 4JCLA 3PGFH 2J6EA 4QRTA 4XPBH 5DUML 2C4FU 2X4NB 4I18C 1E4KA 5I8CA 3RU8H 1NCAH 1NMCC 1CIUA 1EAPA 2UWEB 2YBRA 4AH2B 3LN9A 3CFDA 3QEGH 3A6CH 4OCXL 1YUHA 1H15A 4G6FB 1T66D 3NPSB 3HR5A 1GAFH 4L29A 5F7UA 4JRYA 1HQ4A 2WINA 1AGBA 3T1FB 5IB1B 5EU6B 1YQVL 2MSPA 3INUH 4KKNA 1H0DA 3N0PB 3TZVB 5DMYA 4APQD 2VR5A 4JQXC 4M1GL 3SGEH 1JE6A 3IKKA 3BMVA 4OM1H 3WUZA 4XT1C 3SN6N 4HUXB 1DDHA 1K5NA 3FMGL 4TULL 5SV3A 3BKCL 4KKCC 3ZDXF 4UV7L 3WIHA 4X9HA 4LCUB 1MFDH 4MB4A 1NAKL 2NY6B 3PABA 5DI8B 5EIVA 4FABH 3VW3H 1NCDH 4HT1H 5IB4A 4H1LB 3EOBB 4K3JL 5K59E 2D7MA 1HZHH 1LE5A 5AYQA 2IEPA 1S7TB 5DC4B 4R4ND 3L6FB 4LKXB 5F7EL 3DRQA 3VG9B 4L4VE 5EWIH 4QT5A 5IEHA 5E8NA 4XNMA 1DQQA 3CLFH 1KG0B 3QG7H 5GIRB 1CXHA 4L8SA 4U6TA 2FEDD 5EC1B 2C7UB 3DLQR 2BNRA 3RGVC 5D1QA 3DIFB 4YC2B 5DQ9A 3VXMD 3WIHH 4H25A 1XH3A 4OLWL 2QHRH 2IGFH 4P3DA 4J12A 3AS1A 2OYPA 1FYTE 4LSVH 1WICA 2O61B 4NHCH 3QDJA 1C12A 4UTAL 1ZGLP 1YYMH 4RZCB 5AAMA 1NAMA 3KJ6H 3KYOA 4XP6L 1QSZA 3U4BL 3MCLL 1JPTL 4LNVA 5M7QA 2M26A 4RGNC 5D70H 3DRTA 3MV9B 4PV8B 1NC2B 4S0TD 2E3VA 2GSIA 2XA3A 3WS3B 3ZHDA 1RIHH 1S9VB 2DQUL 2OR8A 5IMMA 4F8TA 4NRZB 4X6EA 2OS7A 2E9WA 1G7JB 3W0WA 5AG8A 4BA8A 1NL0L 3OKLA 2Q8BL 4QOKD 2YD4A 5J4MA 3ZYZA 1E6OH 5F6IC 1CFBA 1FYTB 1KC5H 1T3FB 4GSDL 4NQDB 3HCVB 1PZUB 1G1YA 1IAKA 1J1PL 3WN5C 3O8XC 4K7PX 1INQA 4L9LC 3KYNB 4JHZA 4QHLA 3BJLA 4Z8FL 4LL9A 4Z7WA 1HSBA 4UTBH 3RL1B 4TSCL 3TYGH 4YQXL 5LBSL 4AEIL 1CL7I 3LN4B 3QRFM 4ODXA 2C3VB 4S2SA 1XGUB 2VLKB 5JHDA 3ZDYF 1MAML 3CLEL 1D6VL 5GGRY 1WBYA 2A74B 3WIIH 3FB8A 3SKJL 4XPGH 2D03H 3RY6A 3SQOL 1JF6A 5MEQB 3FQNA 3QCVH 4ODTH 4XP1H 3WCYA 3TA3C 5FHBH 1AD0A 4K71C 3GNMH 3OKLB 2AJYL 3MZGB 4R8WH 1FNGA 1Q0XH 1T5XA 5F7LB 5HGHA 4R90L 4QRPD 2R1XA 3P3YA 1HINH 5E70A 2C5DC 2Q7NA 1F3JB 1KPVB 5BCAA 2CUMA 2DDQL 3L7FB 4YX2L 1PG7H 4PRHE 4G6JL 1DLHA 3VGEA 3MSPA 3BXNA 5C0BA 2ZCKH 3CZFA 4OJFL 3SCMD 5I1IH 5JXAH 2X1OA 1DUYA 3TNNB 3VG9C 3ZT7A 4PJFB 2EDEA 2F53E 2E6JA 5HYJD 1CDBA 2OZ4L 2BVOB 1G7IA 2GTZB 3M45A 5ECJE 1JNLL 1PKOA 2F53A 1FP5A 2Y06H 4N9OB 1MPAH 2HYMA 5C0BE 3G6AA 3PGCB 4Z7NE 5CJOH 3T0XA 1IM3A 3UEZA 5KJRH 4U1SB 3VGDA 2G9HA 1T66C 2OK0H 4Z7WF 4DTGH 1FGNH 1JIBA 4JFDD 1MREL 1FNLA 4CN6A 2BVEA 3NH7H 4DGVH 3H9SD 3HKFA 1I9JL 4YXKH 3QO0A 5ALCH 1LDPH 5I6XB 3GMLB 5IBUB 3SDYH 1ZHLA 2XY1A 4N0CD 4HXAL 3GSQA 4R4FH 3C8KA 5JOFB 5GS2H 2YUVA 4DZ8B 2PXYD 1N2RB 2J88L 3RX7A 2E7BA 4NCC2 1IJ9A 1J87A 4KFZC 5IF0B 1JGDA 5JHDE 5AUMA 1U9KA 4D8PB 3S37L 3QIBD 5ENWA 1Z3GL 1BD2B 3RZCC 4NN6C 1A1NA 5D72L 3EYOA 4PJIF 4KI5E 5FYJL 2NY3B 5MP6L 3SJVE 1PKQA 3FO1A 2C7UA 4XPFH 1J8HD 5LAXA 4ZTPH 2DTML 1JN6B 5GS0L 3U30B 1HIML 4M62H 1JGLL 3QEQD 4GQ9H 1NCCH 2OTWB 1LGVA 4L9LA 1GYAA 2PYEA 2N56A 1T83A 2H32A 4PJFF 4XNUL 2CLRB 3NACH 3EOTL 1KXTB 2CGRL 2MOVA 5GSVA 2IQ9L 4I48B 5HGBB 1FZKB 4FXLA 2FX9L 1WZMA 1DFBL 4XGZB 2ITCB 3ALWA 5L8JB 3NFNA 4Y19B 1JI2A 1X7QA 4FQHA 4D2NA 3V6ZA 1RJZA 1I1FB 3BUYB 4WRLA 4P5TC 2NY2C 3MGAA 1ITBB 2NY1C 5FA4B 2XWTB 3QUMB 1KFAH 4OZFB 5ANME 3W5MA 4H0GA 1SJVA 4WTXA 4EEEA 1DANT 1FYHB 3LOWA 1UA6H 5JIIA 5GGQL 4DVRH 1OY3B 4JM2C 1R3HA 1T2QH 2FRGP 4N5UA 5DT1H 1FFNA 5I75C 1XGRB 5CIPH 4CVUA 2HTLC 4Y4FC 5I1GH 3AM8C 4XXCC 3RPIB 3UTTB 3DETC 4Q6IB 3GKWL 2GT9B 3NAAL 4BZ2L 4P46B 5L2KB 4IOIB 1I7RB 4N68A 4R26L 3L9RB 4ZAKC 1F58H 3RDTD 5IBUG 1CD1A 1I8MA 4YIQB 5IVZA 1DQDH 1UWGL 2R56H 3KHQA 1OARL 3GRWL 4K3DL 2IPKA 4MNGE 5TDNA 2HLFC 4XP4H 3EO0B 3QEHB 4OI7A 1K8DB 3ALPA 5GRJL 5L9DH 1XF5A 3V52H 2FB4H 4I2XB 4P2OA 5BQ7A 3QISA 4LSRL 5TDOB 1CICA 2C1OA 4NC0B 4F37F 2XQYG 2Q87A 4E0RA 2A9ML 4WJ5A 4XWOD 3MLUL 2E6PA 3SDDB 3RVWC 2K7PA 4QWWD 3LQAL 3BZDA 4AQOA 1IAOB 5EORL 1S5IL 5AD0A 1Y0LA 1Y6KR 2LVCA 3TN0B 1GHFH 2FZ3B 5FGBA 4PR5A 3P9LA 4JREB 3Q5YA 1BAFL 3EFDL 3GJFB 5JQ6L 1UM4L 3BH8A 4I2XE 3ZE1E 2YK1H 1BWMA 1TZIB 4FQQB 2CD0A 2X4OA 4J1UB 4PRBB 4GW1B 1XGPA 1CGSL 1KT2B 1YN6A 1YPZF 3ARFA 4Z95H 3D85D 3MV7E 1NEZB 5H35A 5F1SA 1SMAA 4O2CB 5IGXL 3P9LB 4NHUA 3HE6D 1U8QB 1LD9B 1ZS8B 4XCEA 5IBLD 4JRXA 5HYSA 5HPMA 4G8GA 3QG6B 1A4KA 4K8RH 5IHUH 4FQCL 1CFSB 3WFDH 3QH3A 4HGWA 4JFFA 3VI4E 4C83A 4QWWC 3UMTA 4OQTA 1QKZL 1H3TA 2O5YL 4GS7B 2DLTA 3VFOB 1FVDB 1IGYB 2F53D 4GG6E 2WUBH 1YEEH 1QA9B 1ZWIA 5D5MA 5IMMB 1DBJH 3IKCB 4N90E 1RJLB 3P30H 4P5TD 5EU7E 4OV5A 4BQCA 1ETZB 4WENB 5KSVB 3SDAD 1P84J 2H3NA 3VWJA 5T5NF 1CFTA 1J05A 1OD9A 4HWBH 3P11H 4ZNEA 5I30H 5I1CL 2CR3A 4FQPA 2ARJQ 4XC3L 5CZXC 3TZVA 2APVA 3MROB 1IC5H 3SGJA 3N9GL 1P4LB 5EZJB 2V9QA 1JFQH 1CF8L 1RY7B 3IDMA 4JY5L 3UXFA 3ZE0E 5ID0A 1LO2H 1J8HB 1T2JA 5C2BH 1VFBA 3LMJL 3A6BH 3QFJE 4M7JL 2EH8H 1A1NB 1CR9H 1T03L 1ZT4A 2IALA 4RGOH 3BQUB 1BJ1J 5FGRA 4XAKE 5I0DA 1BEYL 1P7QA 2D7QA 4NRYA 3T8XB 4JPWL 3THML 4PRPB 1CU4H 1E27B 4XNYL 5JW4N 4P59L 1DANU 3PWNB 3NCCB 1OWRM 1S8DA 1E4KC 4A6YH 3RVWD 4RMRA 3E6FB 1UJ3A 4HXBL 3HLAA 5FCSH 5TQ2H 4CVZB 3Q3GA 4WVRA 3RTQD 3RVTC 3CFEB 5L2JB 1IGJB 2M2DA 5SWQA 3VG0L 4MXVF 4TTGA 3QJHA 4K23L 2MCPL 3VXTB 2DD8H 3HN3A 1X5FA 1AE6L 2B1HL 3EZ8A 1NFIB 2YD9A 4KK9C 1EJ6A 5BXFA 2DJSA 2CDEA 4FQXD 5EB9A 1J10A 4GH7B 3WBDA 2X9YA 1VGKB 5F93C 1IGTB 1MRFH 4OGYL 1NGWB 1JV5B 4JGJA 4FOMA 1C7TA 4KY1H 1N6QL 5A1AA 5DJ2B 1IAMA 1RURH 4TUJB 1U93B 1L9NA 2XZAL 2F8VA 3W9DB 1R3KA 5C9JA 4OTXL 2F5BH 4WI9A 2E9IA 4HKBB 1JF1B 4PJCE 3FRPG 4HUWB 3D3VD 3S98A 1L7IL 4U7MA 5DEFB 3H3PH 2ZNXA 3FO9B 3MBEA 4PLKD 5DD0H 4WUUA 1AI1H 2ZOKA 3L5XH 4EI6B 5HDOA 4HBCL 4DGIH 1T1WB 1Q0YH 1ZHBB 3ETBF 5D2NA 4ZNEE 2NW2A 4PGDB 5EO0B 2G75A 1RUQH 2PXYA 3RU8L 2ZUQC 3O4LD 3JV6A 5KS9F 1GRWA 1UH2A 5LJYH 3W9DA 4RBPH 4M8QA 1IM3B 4ZXBB 1UWXK 1JMXA 1YPZA 3UCRA 4ZTOL 4S2SB 2VOTA 4LKCA 2NX5D 3LN4A 3VFTA 1YNLL 3C5ZA 4I13B 1KT2A 4HV8B 3E0GA 4PBVC 3U0PB 5HHNA 4Z7WB 3GFUA 3MMEA 1I8IB 5EZLB 5FYKE 4W70A 4DAGH 3DUUA 4POZC 2Q20A 1GC1H 2CMRL 2J4WH 2P8MA 8CGTA 1ACZA 1ZSDA 5D5MB 5EU6E 3S3PA 1WBZB 4QY8A 3FMGH 4TULH 1FVDA 1RV6X 4FA8A 2O5ZH 3CXDH 2BRQA 1F3JA 1KPVA 5T3XE 5D1ZC 4WI8A 2EKSB 3LS4L 2EXWC 1IRAY 2OLDA 3K2UH 4QYOA 1ZLVH 4C56D 3VD7A 5E8EA 1BBDL 1KB9J 5CZVL 3H9HA 4YHOL 1HZHL 1JHLH 4Z7WE 1A7RH 5CUSL 2NXYC 5FB8A 5IMKB 1MFAL 3OKMA 2QQKH 1G9EA 4R2GB 2P8MB 3VWJD 3EO9H 1BLNA 2JB5H 4IDJL 2FJFB 4HAGA 1J8HA 2HWZH 1CDJA 3EOAA 3LKNA 1Z2KA 4LPVA 1FVEA 4RAUA 4KTDH 4LSVL 4JZJC 4YNYB 4UTAH 1XR8A 4YDIL 1IARB 4QXWA 3KJ6L 3LN5A 5F97E 4WCYL 1C5CH 1YY9C 2N7BA 1IBGH 4JFFD 4PRHD 1WUNT 4GLRI 5F72S 5D70L 3ILPB 3LZFL 3CZJA 4HCRA 4NQDE 4WGVB 1HKFA 5LG1A 5HD8C 1KXQE 2IAMD 2QJDA 5BZDB 3SBWA 4AL8H 4W6WB 1LO5A 3T65A 2GAZB 3C6LC 3DSNA 4LLYB 1NL0H 3OTTA 5DRNA 3U4AA 5HYQA 1QZ1A 4IMLB 1VCAA 2NYYD 1KC5L 4GSDH 2A38A 2GY7B 1KPUB 4DOHE 1KJ2A 5KVGH 5ITBL 4LARL 4YAQA 1RZKH 4BH8B 4UTBL 4OZHB 1FL5B 1HWGB 3BPOB 4IRSB 3WJLA 1J0KA 4LDLB 4PJBA 2R9HD 1GJIA 3PQYB 1W72H 1R3KB 1KTDB 2X4OB 5C9JB 1KN2L 5DQDL 4L8SB 1P53A 2EXYC 3WUWB 4M4PA 3PWLA 2BVTA 4OZFH 2APWA 4HCRH 1FVCA 4WNQB 5JA9A 2D03L 3QCTL 2W0KA 2CIKB 3QCVL 3FOLA 2G5BB 4XXDA 2YA1A 3QI9D 4U1JB 2VUOA 3IB4A 5FHBL 3FFCB 2XWJA 4RISH 5HHOB 1I1FA 3GNML 4XZUA 4H1LA 3WFHB 4L1DA 1P2CB 3DYMA 4L4JA 1IT9L 5CJ8A 1HINL 1FFRA 5DRZA 3MNVB 3WJLC 2DDQH 1QVOA 4ZPTA 1J8HE 5C86A 5I1AA 3VFRA 4JPKH 2DQEL 3DVGB 4AJ0A 2NY3D 1JTOA 3RKDC 4EOWL 2HKHH 3SDCB 4FQ2H 1HH9A 5FO8A 4PJXB 5TF1H 3MLYL 1QSVA 5IFJB 1U58A 3LRHA 1IVLA 1TZHA 3ARWA 5D7KE 2Y06L 4KXZI 4NNXB 3JV4A 2UUDK 1S9KC 4XH2B 4HKJB 3S36L 3LS5H 1U8LA 5CP7A 2J8HA 4M7ZC 1AFVH 2XQYK 2AEPL 3FN3A 4MCYB 3GIZL 5L6YL 2JKXA 1FGNL 5CSBA 4UT6H 4ZAKD 4KUZL 1MREH 2OCFD 4JG0L 1ZV5A 3ZL4H 4JVPA 4CMHB 4HULB 2VXSH 3KPNA 2AKRA 5I66A 1MI5A 3NCYS 3QDGA 3LKPA 1LDPL