2H2PC

Crystal structure of clc-ec1 in complex with fab fragment in secn-
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
221
structure length
221
Chain Sequence
VRLLESGGGLVQPGGSLKLSCAASGFDYSRYWMSWVRQAPGKGLKWIGEINPVSSTINYTPSLKDKFIISRDNAKDTLYLQISKVRSEDTALYYCARLYYGYGYWYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAAAASMVTLGCLVKGYFPEPVTVTWNSGSLAAGVHTFPAVLQAALYTLSSSVTVPSSSWPSETVTCNVAHPASSTKVDKKIVPRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ion transport
molecule keywords CLC Cl transporter
publication title Uncoupling of a CLC Cl(-)/H(+) Exchange Transporter by Polyatomic Anions
pubmed doi rcsb
source organism Escherichia coli
total genus 38
structure length 221
sequence length 221
chains with identical sequence E
ec nomenclature
pdb deposition date 2006-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07654 C1-set Immunoglobulin C1-set domain
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2h2pC01
1WC7B 2R4SL 2R2EA 4YHYC 4GQ9L 4P57A 3FB7B 2BSRB 2FO1A 2ICWJ 5B3JE 4HJGA 3EOTL 1MCCA 2YWYA 2QBWA 4YZFF 1B0GB 1OB1B 4JR9H 5T1MA 4JFED 4G6MH 1LO3H 1RZGB 1T1YB 3PHQA 1JHLH 3MXWL 1TQCC 1JGLH 4BYHA 3PWUB 3QDMB 2VXTH 4TTGA 3VFNB 1LD9B 3QAZC 2HTLD 2FGWH 1RZIA 4Z8FH 3QUKA 1ODAA 4LLVA 5EBWB 1KPUA 1VB9A 2EDTA 2GFBB 2AXJA 3DX7B 1A7PH 1TJGL 4M6OH 3VRLF 5D72H 3QR2A 4M93C 2ATPA 4GFTB 1WBZB 5HI5C 2VLRB 2YXFA 1QUNA 2FBJH 5JIIA 2Q8AL 3VMNA 4LVNB 2OL3A 3CZJA 5DJ6B 1LILA 4OM0H 3MCKB 3PWNB 3S4SG 3OJDA 4D0BB 3GKWL 4QNPF 2EECA 4TN9A 1CXFA 3M17B 1BBDH 4MAYB 5H37H 5GRXG 2BSED 4JFEE 3VE0B 3TO4D 1KULA 2AGJL 2LFGA 3MX0A 5IFAH 5I0DA 4QRRD 5F1NB 2ZCKH 5DA0B 4XP9L 3V6OE 4BSWB 1XR8B 1RV6X 1UJ3C 3MGOA 4WWKC 3D0VB 3KDMB 2JJTC 4P23C 4OF5A 4JFHD 5J12B 1EMTL 5EO9B 4GXVH 1QBLL 1T7YA 3SKJL 3HNSL 3MZGB 1MHHB 1I3GH 3QT2A 2D7PA 2F5BH 4OLYL 5I71C 3UTTD 4W4OA 4BH8A 3BJLA 1CWVA 4DZ8A 4KKAD 4AEIH 5HVHC 3WS6C 1FFNB 1QA9A 5CD3A 1AGDB 2ID5A 1J8HB 2VERN 2EEBA 4KROC 4CGTA 1S8DA 2E7HA 3ROLA 3FQUA 1FZOA 3RWGB 1WZKA 1UVQB 4QRRE 3P9MA 3ARVA 5F96L 2XICA 1KT2A 4X6EB 1R5WB 3IKCB 3L5XL 4DOHB 5D93C 3QUXC 4OLVH 3MLRH 4YDVB 1NCNA 1BQUA 1P53A 3GSRB 4Y4KA 4Y5XB 2AABL 3UCRA 4JFHE 4NQEA 4LNRB 5GGVH 4TNWK 4TSBL 1BREA 3S96A 3SDYL 1UCBH 4AG4L 3AB0C 2HKFL 1P7QD 3QQ3B 1FLRH 4PLJC 5CD5D 1TLKA 4Z0BL 1ACYH 1EHXA 3LKNA 3CVHB 3OKKA 2ARJA 1XCTA 2BX5A 2EE3A 2P44B 3O6ML 4QKXB 3TIDA 1FN4B 2HWZL 2L0DA 4Q9CA 3MA9L 4KVCH 5SX5K 5T3ZH 4WTZA 5FF6A 1LEGB 3TO2A 4FQJH 3R4DA 5E1AB 4M7JH 4LEOA 4PJAB 1H8OA 3EYSL 2YPLA 3HR5A 3GSUB 5CKAA 3A6OA 4NQCA 3I6LD 3QWOB 4KHXH 4LPWA 5D7IF 2DQGH 4FZ8L 1CE6A 1QRNB 4POZD 1IEBA 2X4PB 3OGCA 1DBAL 1QFWL 3WFCL 3DX6B 5DJCB 1ZHBA 2VO5A 3G5VA 3VFVB 1MVUA 3CD4A 3GI8H 2X1OA 5FIEA 1WCBA 5GGRB 3C60A 2GHWB 4N8PA 4IMKC 4QHNB 1TVHA 3G6JF 4HXBH 3RUGA 5ALCH 3C5ZA 4JO3H 1OTTD 3VMPA 1U8NB 5DJZA 4R26L 3DURB 1FNAA 4PRIB 1URLA 2BVEA 2G2RA 1XF2A 4V1DE 1WAAE 3ZSSA 1B0RB 3V0VA 3T4YA 1C16B 2BNRD 3JV4A 2COQA 4KJPD 3BIBX 3ZKMC 1U3HD 2VL4A 3X3GL 4NM8H 3I75B 2ILLA 3I6LE 5LXGH 1D3CA 1IAII 3VXNB 2X44D 2Q7NA 3I02A 3RI5F 1L7TL 3MRNA 4RAVA 4ZPTB 5F7EH 1L7IH 5KAQF 2F19L 3F7YA 5INDB 5I1LA 4GBXA 3HE6B 3OX8B 1MRFH 2EZ0D 3TVMC 4LSRL 2IFFH 3GKZA 4NO3B 3ELAT 2VITB 2AJVH 4FQHA 1F97A 1GHFL 3B5GA 2GSIA 5I30L 7FABH 4PGEB 4WNQB 3D0LB 1SM3L 3BIAX 4RRPG 1IGYA 5TE7L 2Z8SA 4MXWH 4XX1E 3QJFB 3ARFB 43CAB 2ZUUA 4HUWA 1IGTA 4YC2C 3RTQB 4GAYB 1IM9B 4WUKH 3N1PC 4G9FA 3KPMA 5F6IC 3F8UB 3BPLC 2BNRE 4HJ0C 3AGVA 1T6VN 2NX5B 3QA3A 1OL0A 1VEMA 2Z8VC 3SPVA 1G7MB 2W9EL 4H88L 2CUMA 4LSSL 5JXED 3LKSB 3FO9A 5TDNB 3QFJA 2V9QA 3QUMH 3FRPA 3CXDL 1S7QA 3O3EB 4K7PL 4O2EA 4XZUB 4RWHA 4ZMAT 2B4CH 3RWDA 3TA3C 3V95A 4AEFA 5C0FB 3KNBB 5KVDL 5LGHH 3T0BA 1JK8A 3IU4H 3K2UH 5CEZH 4BSVB 2F54E 4XMPH 1JFQH 2FD6L 3R06B 4K9EC 4NO5A 1MHEA 2P5EA 3VDBA 4NNPL 1BGXL 4G8IA 2WZPD 3WFDH 5D8JH 4LLYA 2V2XA 5BZDB 2GJZB 4YBHA 3ZHKA 1E27A 3GI9L 3O4OC 2XPGB 1ND0B 1VA9A 3X17A 3DV4A 3GNMH 4HUUA 3O9WB 1IM3B 4HCRH 5BQ7B 1IBGL 1D9KD 1MFCH 2DQFA 3JWNC 2NMSA 3EZJB 4NKMB 1CK0L 4X7DC 3UYPA 4KRPB 1LO5B 5IBTL 4YDLB 3ARUA 3ZYOA 4WV1C 5F1SA 2YWZA 3BPCA 4PTUA 1N6QL 4GMTH 4IM8A 3RIFK 3S5LA 4X6FB 5DJ0B 3RY6A 1ES0B 1NMCC 4PFEA 1VEOA 5D6CA 5LWYL 2WNGA 5F9AC 1MJ8H 2IBBA 4WJ5A 2AEIT 2R56L 3NFSH 2PR4L 4JRXB 3DIFA 3KWWB 3IDMB 4ELMB 3SKOB 1CTOA 3U7YL 1JPSL 2HN7B 4RFEB 3B2VH 1KXVC 1G7QB 5FO7A 2E7MA 4UAOC 5EFIB 3MQIA 5D1QD 5E8NA 4M4RA 1TVDA 2ZSWB 4WIQA 3BDYH 3ECBB 3O4LB 3TBTA 1IILE 1M7DB 5IVXE 5BVPL 2WANA 4YK4B 3QPXL 2GK2A 3PHSA 4JGJA 4NKOB 1OAYH 5DEGA 4Z95H 1DSFH 3TESA 5DWUL 4KDVA 5F6HI 5CJOL 1I9JH 3Q3GA 4NZRL 1FG2B 4HH8A 5EIIA 3P77A 3CUPA 5T5FH 4JFEA 4ZUSA 3Q6GL 5ID0B 4NNYB 5KS9A 1CE1H 4ZFOB 1OP5K 1JZ6A 1CDCA 3WHE1 4J4PD 3EDJA 2HTKC 3GHEL 4OM1L 5JPMB 1VFAB 3MRMB 3WMSA 4F9PC 4MNQD 1I4FB 1KEML 2BVUA 1Q9OA 4XCYB 2G5BA 2R69L 1DQLH 2FRGP 1TCRB 1HXYB 3IAGC 2DTSA 4U6VL 1FG9C 4X6BB 5DJ8A 4JFOA 2X41A 9CGTA 1BHGA 2GYSA 4M8QB 1DANT 4MHHG 1N5AB 4PJIB 1AHWC 3QIBC 4MJIB 1L9MA 1FNGA 1RUMH 3FQNA 4A6YB 5HHMD 5AZEH 1M71B 2NXYB 1D5BB 1RULL 4YDJB 3TO4A 3UJJL 4S2SA 4K07A 5KSAB 3JSSA 3NFNB 4JRYD 1BZ9A 2VLLB 5LQBH 3HNVL 5AZ2L 4MSWA 3O6KL 1NKOA 5B39A 1UM6H 2P8MB 4ERSL 5EOCL 4XP5L 4M7KL 3OJVC 1KXTB 2DKUA 5TF1H 1GZPA 1CXHA 1NBZB 2JE8A 4HJJH 1MF2H 4NT6A 4YHYB 3MJ7B 4K23L 4OD3H 1S9VA 2H1PH 2BMKA 4MVBD 4HPYL 3IXAB 2NZ9D 1S9YB 3ROOA 1HZHH 1DQDL 5AAMA 4WFGD 3BGMB 3UTTA 3MLZH 5FO8A 2O5XH 2HFGL 4JVWA 5T3XH 1XT5A 5GHWL 1N0LA 2FDBP 3QNYA 5CP3A 5J8OA 2AJZB 1A1MB 4DAGL 1HN1A 4MD4A 3OMZA 3F65A 4YFDB 5HHME 1G1YA 3QUYC 4GG8A 5HHOB 3H9ZA 1SEQL 2GTWB 3QXDA 3DBXB 4M5ZL 3SQOH 2KKQA 5IP4A 1NDMB 2DLFH 2XA3A 3K4AA 1I1YB 5CFHA 3O3BB 1DDHA 3IDIB 1HWGB 3LCYA 2VABA 2NQCA 2ZP0T 4GRMA 1YMHB 3I9GH 4PJ8C 5C0AD 5IESH 2GUOB 4CNIA 5T1LB 1T5XB 4BFEA 2V7NA 1MQKL 4WW1A 2V5MA 3O0RH 4JFQB 1QVOA 5C6TH 2IQAA 3DI2B 4NKIL 4UV7H 5TE4L 4RGMC 4XPHL 1P7QA 3HB3D 3AS2A 1CXIA 1U8KA 1U2HA 1DUYA 4EBQH 1WAAA 2CIIA 2P1YA 2J8OA 3BPNC 4OCLC 3AUVA 1DBJH 4P2RB 3AXLB 4R8WH 4CVZA 5JR1H 1HK6A 3H42H 2UV3A 3EYOB 5IHUH 1VGEH 3PXHA 5HHQA 4MZ3A 1NGZB 1DE4B 5DURD 1FNLA 4WWKB 4P23B 3QWRA 3BUYB 5DK3A 4XXCA 2VLJE 4H26B 4P46C 2MCPH 5EO0A 3FMGH 3ZTJH 2OTUB 4L9LA 5D7KD 5FYKH 2D03L 4HS8H 4X8JA 2FEDC 5HD8C 3UTSB 4AH2A 1YEDA 4XNUL 5I71B 3QDGB 3MRPA 1H3TA 4K7PY 1PX4A 5EA0H 1R0AL 4HZLB 4N5ED 5EORH 1A4JB 5HVHB 2YA1A 4M9PA 2X10A 3MROA 4OAWB 1E4XI 4FQPA 1LO2H 2CSPA 2ZZUT 4WFED 1KJVA 3NZHL 4LFHG 3NABH 5DHVB 3FFDB 4HUVA 1DANU 3DI3B 1OP9A 1RJYB 3KPLB 5D5MF 3X3FL 2AXHA 3QBTB 1K4DA 3TYFB 5ESVA 1RHHB 5DQJB 2IPKA 3MBEC 1FSKB 5C0NC 2FHFA 3UC0H 2EDBA 4ZXBB 1D6VL 1I7TB 1RMFL 2R4SH 2WV3A 2YN3A 5T33L 4OD2B 5C2BH 3L5WB 2ZUWA 5D93B 3QUXB 1ZLSL 2AV1A 1R3LB 3NN8B 4GKZB 4XCNB 3EBAA 1L0XA 3EOTH 5GIRA 5AUMB 3QEGL 3WBDA 1RUAL 1Y6NR 5DJYA 3WNLA 4IRJD 5D7KE 4OUUA 3MXWH 5KSUB 4O02H 2CKBA 3PL6D 3UPAA 3U0WL 2XQYG 4QRQA 5EU6B 3UEZA 3BXNB 2LVCA 5DJDA 2VN7A 5FYJL 4Z7WE 3O11B 3WYRA 3U83A 3UBXI 1M6OA 5IK3A 3S6CA 2DM7A 1W0YT 2NTFA 3KXFB 4YLQT 5HHPB 3K1KC 1D7FA 1VHPA 3IGAB 3BZ4A 5CGYC 1TJGH 3FB6A 1FVCA 4D0DA 3TZVC 1HSAB 3LQAC 1WWWX 1FHGA 1W0VA 1YEFL 3SDDC 2Q8AH 4HMCA 1CG9A 3MNWB 4C56D 1LHZA 5I17A 4I8DA 3WJLC 3E3QE 2WBKA 1OVZA 3DGGA 1ZOXA 4KH2A 1N5YL 5JXEA 3NACL 2NY6B 3GKWH 5B22A 3U4BL 3UDWC 3MJ9L 3EYVB 5GGSB 1MELA 2AGJH 4Z7NE 1XIWD 4HIHA 3D85B 1KBGL 3GMLB 1HHKB 4U6HB 5IB1A 5JHDD 1S5HA 1G7LA 4LKXB 1WITA 3V7AE 2D31B 3MYZA 3OKNB 1FNEB 4NPYA 4XP9H 4D9RD 1G7IA 1OT1A 1U8IA 4PLKC 4UIMB 2XN9D 1KYOK 3GSWB 1YN7A 3RP1A 4LP4A 5JMRA 3THML 5JW4M 4XCEA 5DK2B 1EMTH 4KTYA 2DQJL 1T04B 1QBLH 4JKMA 5DJAB 3SKJH 3HNSH 2CPCA 1KGCD 4OLYH 1D9KA 4HUNB 4C56E 4LKCB 4PJ7E 3DROA 1IARB 1KC5L 2DMCA 4PJDB 4CADB 2E27L 4WFFD 4UOJA 5FA4A 4TUJB 5LVEA 1HE7A 4YPGA 3QG7L 4Y1AB 4LPUA 4WO4B 4Q6IC 2XNAA 1AP2A 2NXZC 2QSVA 5JHDE 3NFPB 4XPGL 4XXDA 4ZODA 5D1QA 2A0LC 5F96H 1I8IB 3WV0A 3G04A 3L5XH 1AR1C 2YD8A 3BPLB 2MHAB 4X0KA 4U1HB 2XN9E 4HX1B 4OCNC 4YHPA 3KJ6L 2AABH 3B5HA 1JNLL 3TYGL 2NY4B 1MH5A 2A2QT 1G7PA 4TSBH 5D7JC 3SDYH 1OTSD 4AG4H 2YC1B 3IFLL 2FATL 4U1MB 1KJ2L 2HKFH 1HQ4A 4N0YH 4TTDD 1PKQB 1KF9B 1CD1B 4Z0BH 4NO0B 2FECL 3O6MH 1ZSDA 4JVPA 5CWSA 3D25A 2HWZH 5ESAB 1I1FA 3WFZA 4Z7UE 3STBA 2W0KA 4HKZA 5GRUL 3H9SD 2HAZA 2Z31C 2UVFA 3EYSH 4XI5D 5E6IC 2VRAA 2XKUA 3EOBA 4J4PA 5HYJB 2Z92A 4HFWA 1R3JA 5F7UA 1UZ6E 2B0SL 4FZ8H 3RVWD 4IMLA 1MAKA 4D0CA 4MNQA 1JBJA 3CFCL 3MTRA 1DBAH 3KPQA 5T3ZD 1ORQB 1QFWH 1R3HA 3WFCH 2AXGA 3ZE1F 4UINL 3MRJB 4XPAL 2XZCL 5ESQB 4HK0A 3BHBA 4NBXB 1EBAA 3GSNA 1I85A 3MGAA 1WVZA 1MCWW 2IGFL 2RJMA 4BK5A 1O7VA 3K7UA 4R26H 2HT3C 3DMMB 1KLGA 3TPKA 3L95A 5MEPB 5D7LB 2ENSA 4L3EB 4V2CB 4JRYA 4UAOB 4DGYL 3PWPE 1X5XA 3IXTB 3LZFL 4JZNB 4OFPA 3X3GH 4C58B 4M6NL 1GYAA 3AU1A 1LE5A 4PJFB 1Z2KA 3SDAC 2ZCLL 4OCWL 2HFEA 3N85L 4OV5B 1HHIB 1L7TH 1UYWL 2NYYD 4DN4L 2CIKA 5T3ZE 5D1XC 2ATKB 3VI3E 1Z9MA 2F19H 1S7UB 3QFDB 4I4WA 1HILB 5C0BB 1VKXB 4F7MA 2VZVA 4JVUA 1DN2A 4K9EL 4LSRH 2YRLA 1GHFH 3LN4A 5I30H 1H8NA 2AJYL 3RVVD 4XBGA 1SM3H 5BV7C 1WBYA 3RNQA 1H3GA 2ITDB 1G6RA 1P4LB 2X4NB 4WY7L 3S37L 5FUZL 4WI7A 1MLCB 1X4ZA 4L4VB 3QHFL 3U46B 1KTLA 3G9AB 1RZKC 4XNYL 5JW5A 1HKFA 3BO8B 4LSSH 1UCTA 2BSTA 3TPUA 3MLSL 5HI3D 1QSEB 4Y4KC 3HRZA 5C0AA 3CXDH 4IOIB 3W5MA 3GSXA 2NR6C 2BNQD 1QYGL 4NQDD 4K7PH 1FAKT 4HUXA 3F7RA 1I8MB 3GB7B 2Z9TA 3NCFB 4IJ3C 4Y5VA 3WNOA 2JK5B 5KVDH 4LIQL 5HY9A 4U0QB 5ICZA 4PTTB 4QOKB 4U6XA 3O81A 3S35X 1DVFA 3FO1B 2FD6H 3IFOA 4NNPH 1BGXH 3HI5L 4IOFD 3JWDL 1FL3A 3DLQR 1I7UA 3BZFB 4Z76B 3U9UA 2D7TH 4MXVF 3GI9H 4QXTB 2DLHA 1IGJB 2PYED 5CEZD 1XCQA 5J06A 5HHXL 1IBGH 2YPKB 5E00B 3UPRA 1ZT1B 1HQRA 1CK0H 5B4MC 3T0AA 1D5XB 1I3RB 3FOLB 3QB7C 5IBTH 3RZCD 4KJWC 1JNJA 1BLNA 1HH6B 1WF5A 1N6QH 4F9LA 1A6TB 3BZEB 3DUHA 1XR9B 5TGBA 3VXSD 5LWYH 3MRBA 4WHTA 4PJ5B 5FOBA 2BNQE 4DJMA 2R56H 2PR4H 3C5ZC 3TBWB 3RVTD 2Q20A 4ORGA 3U7YH 4Z7WA 1JPSH 3RQ3A 1ETZB 1UXWB 3GDBA 3ME0A 4I77L 3ARDD 4H25A 1J11A 3SEPA 4QF1A 5BVPH 4PJCE 1CDJA 3QPXH 4NCDA 4PJAF 4KXZH 3WIHL 5E2VL 4NRXB 3IDYC 3QZWB 1BOYA 2C3VA 3W0WA 5DWUH 1NFDF 5CEZE 3KGRA 4ELKB 3QRFM 2OZ4L 3CXHJ 5CJOH 4UB0L 3IFPB 4NZRH 2DJSA 1LO4L 5MP6L 1HWHB 3CZFA 1E4WL 2VWEE 3MR9A 4FQXD 4BA8A 3ARBD 5C0JB 1W72L 4I9WD 4IRJA 3Q6GH 3QUZC 4Y5YA 2AW2A 1A8JH 5EUKA 5CEYB 4HF5L 3PL6A 4Y19A 5D71L 3KJ4B 3H6JA 3G5XA 3T09A 3RZWA 1OSZA 1PD6A 2A6KB 4GUPA 1V3JA 3BPNB 3KYNA 3GHEH 3CU7A 4OM1H 4P4KB 4P5KB 4ZO7A 2ICWB 2R0ZL 1BBJB 3QZWG 2BCKA 4F37K 1KEMH 4RFOL 2IBZX 2R69H 1N0XL 5HYQA 4AJ0A 4LPYA 5J6GA 4JB9L 3LEXB 2J5LB 4U6VH 4XRCB 5F1IB 4PJEB 4KK6D 1GZQB 3CXHK 1PX3A 1X9QA 3UP1A 3VFOA 4GRLB 2ZOLA 4LPXA 5FKAB 2CDFA 1EAPB 5B38A 5J56B 3MRKB 4I9WE 3UJJH 1RULH 2HA1A 3V6FB 4LCYB 1XIWA 4P99A 4QHKJ 5J3HD 3HNVH 5AZ2H 4RGNB 1RJLB 4PP1C 3OAZK 1CFBA 2NY0B 2PO6D 3GMOA 3O6KH 4L1DA 4ERSH 4MCYA 3VXQB 5EOCH 1J0HA 4MJ6B 4XP5H 4L8SB 2WUBL 3AS0A 3MBEB 1CL7L 3SGEI 4PJHB 5IG7A 1FVDA 4KUCF 2XN9A 1Q9KB 3WUWG 1UB6B 5DLML 3PDDA 2HP4A 2CLVB 3PP4L 3ULSB 2VH5L 3BGFB 1FFOA 5J1AB 2OLDA 4HPYH 5FK9A 1DQDH 2X4SB 2IQ9H 4LLDB 1U8LB 3LAFA 2X7LA 4G8GE 5BOZG 3O8XC 3GMMA 5I74C 2HFGH 3BQUC 4I0PC 1KJMB 3G6JA 2BVTA 2MCG1 2UWEB 3CX5J 5GHWH 3RY6C 4QRPB 3TF7C 1FIGL 1F6LL 1CICD 2LTQC 4S0SD 4CJ0A 3OXSB 2CK0L 1AGFA 4Z7UA 3GEWB 5DD3L 1SEQH 3NIFE 3HPLB 4M5ZH 3SDCC 3GUTA 3HAEH 1CFVL 2VDOL 5T3XD 1R3KA 4MNHA 4ONFL 2P47B 4P2OD 4NJ9L 5F70A 1BJ8A 5DYOB 4MD0A 4JY5L 4ESKA 4E5XB 3RBSA 2AQ3A 3QO0A 5DI8B 1HCVA 5DSCB 1MQKH 3KVQA 3QIWD 1JPGA 4O2CB 4Q6YA 5I16B 4NKIH 5TE4H 4QLRA 4LHUD 5F88B 4XPHH 5GS0C 3TN0B 3FCTB 2WINB 3CX5K 3GSOA 4L3CA 4UNUA 4ENED 2UY7A 3B9KB 2BVQB 1U8MA 1OY3B 2CGRL 4OLWL 3T0XA 4C4KT 3SJVD 1KPVA 1OGTB 4KI5C 5F9WC 4ELMF 1V7MH 2HFTA 4EQ2A 3H9SA 5KSVB 1AC6A 4LVOC 3HZYB 4R3SA 2H6PB 2EIEA 3RAJL 2EIBA 4DK3A 5T3XE 3H3PL 5DFVD 3IJSA 1Z5LB 5ACZA 1S7TB 5JPNB 2BXYA 2D03H 5I18L 4XNUH 1TTUA 2E9JA 1R0AH 2BFVL 2O5ZH 3FHQA 1ZWIB 1V7NL 2Y5TA 4RAHA 5FA3A 4LF3B 3NZHH 3EGSA 2WBJD 3X3FH 2EE2A 5FYKD 1HYSD 1WJ3A 2AEPL 2DQCL 1SYSB 3KS0H 1KG0B 3LQAL 4NC2B 4OKVA 3MV7B 4Q6IB 3HFMH 3CSGA 2C3XA 1YY8B 4C59B 4LP5A 3SJVE 1N3NA 2V5TA 1G7HA 1D6VH 1RMFH 3ZHLA 1GCFA 5T33H 2APTA 3VXUE 4MQXC 4KMLB 1ZLSH 4KFZC 4JGMA 1L0QA 1XH3B 5KTEL 3OHXB 2HVJB 3UAJD 1UM4L 3FN9A 2A83B 3QEGH 4ZAKD 3RJDA 1RUAH 3H7BB 3BVNA 3O41A 4L8BB 5D7JB 1ZTXL 3LPWA 2FR4A 3GMRB 2Y5EA 3CSYB 4K94C 3U0WH 4PJIF 4U7KA 3M1BB 5FYJH 2G9HA 1CFSB 1H3PL 4PJGB 1J9CT 3TBYA 3ET9F 3KHOA 4EI5B 5FYKE 3OKYA 4APQD 1I8KB 5E9DB 5JW3L 2I9TA 1PDKA 3O3UN 3CDGA 2Z31B 3MRCA 3LIZL 3IDJB 1YEFH 4LLQA 4EIGB 4OFIA 3IJHA 1XGRB 2E7CA 3V4VL 1J0ZA 2XTJD 1V3MA 3RU8L 4OF7A 1TVBA 1F6AA 1N5YH 1FE8L 3NACH 3P2TA 3U4BH 5E2WL 1KLUB 4HHAB 3MJ9H 4PV8B 4PB9L 4NQDA 3AREC 3PGCB 4EDWL 3FQRA 3DOSA 3PABB 3L3KA 5LCVL 4P2QD 3N9GL 1KBGH 1YA5A 1DQJB 5CD5C 3NIDE 3D39B 1KNOB 3QUMA 3NZ8A 2RGSA 3D18A 5E6ZA 4H5SB 1CIUA 1RD6A 4JFPB 4OZ4B 3THMH 5J6HA 1UH4A 2FCBA 3U36A 2DQJH 2DTML 2PYEA 3OR7B 3D1MC 3M8OL 1RI8A 1HNFA 3SDAB 2DM2A 4XXCC 3WIFB 3X12A 2XTJE 5HGHB 3RZCA 1HEZB 4L4TA 1KC5H 5CGMA 1B2WL 1AE6L 2R2HA 3T1FB 1FZKB 3VXSA 4LASL 1LK3L 1OAUL 4HCRA 3ZTNL 3AAZB 1ZHNB 3QG7H 4Z7OF 1IC4L 2ADFL 1VFBB 4NC1C 4V2BA 4XPGH 3PQYB 2EKSA 3O6FB 3ARDA 1S7XB 2DMBA 2OL3L 4J3UA 1CZ8L 1CT8A 3KJ6H 5IM7B 3PV7A 2CO7B 4KJPC 1JNLH 3TYGH 2VLRD 3UTQA 4ZPVB 3HE7B 1TENA 5L2KB 3QHTC 3IFLH 2FATH 3IRPX 1KJ2H 3MNVA 3X13A 5DD1L 4DW2L 1CU4L 3T2OA 4MLIA 4R2GC 2CDGA 3F7QA 1JNHB 4TVPL 3S3JA 2Q1EA 5IKCB 1MHPL 2XG4A 2W0FB 4KKLD 2EZ0C 4DFIA 3L5HA 5GRUH 3BWAB 2YUWA 3OAUL 4KJYB 1FPTL 4K3JL 3ESVF 1NBYB 3D5OF 4XAWL 5IB2A 2B0SH 3QXAB 5IFHL 1W0WA 2Z93B 5IEKA 3LMJL 4LHJB 5KOMC 5HPOA 2WW8A 3T3ME 4KHTL 4UINH 5ADPH 4XPAH 2XZCH 4TRPL 1MHCA 3E8UL 3RWCB 3FN3A 1JPTL 5TFSL 2IGFH 5C9JA 1GGIH 3K46A 5J89A 2R4RL 3L3DB 5BV7L 1ZE3C 3MJ8A 3JWOC 3L3IB 3ZE0E 1EV2E 4TNVF 1J8HD 1CGSL 5ENWA 4OIIL 1ZT7B 3UTZA 3HG1B 5I9QB 1AY1H 5E70A 2Z4QB 3BP4A 5L6YH 1EO8L 5DS8A 5IJVB 4DGYH 1RZKL 3LZFH 4L29A 2YBRA 1ZA3A 1QSZA 2PO6A 1LEKB 1A1OA 4GRWH 5DQ9B 3MRGB 3OTTA 4YHOL 4M6NH 3N50A 4GW4A 3ZKXB 1X3DA 1K2DA 5EC2B 4HH9A 2P5WB 2ZCLH 4MJ5A 4OCWH 3N85H 1MLBB 4DN4H 1UYWH 2KZWA 3ABZA 3T3PF 1ZAGA 1ROWA 4H1LG 1D9KC 3OJMB 1FCCA 4NUJB 4K9EH 4YGVA 4HS6B 1T80A 1MOEA 1NDGA 2AJYH 4LSPL 1GGTA 2GCYB 4NM4H 3P30L 4LNVA 1CICA 3HZKB 5D5MA 2H26B 5JA9A 1F3DJ 4KKBD 4EXKA 3N1GC 1CYGA 2W0LA 5HPMA 3NCYS 4WY7H 3S37H 2P8PA 2DIBA 4OBSA 1OW0A 4LCCA 3TFKC 4I2XE 5FUZH 3QHFH 3EO1B 2A9NL 2YRPA 5D1QC 4ONHA 4MS8D 5JW4R 1JYVA 4HKXB 5H35B 4XNYH 1QRND 1XGQB 4P2OA 2QQQA 2P8LB 1JWSB 2XYCA 5IOPA 3MLSH 2A38A 4LPTA 32C2B 2FH8A 4RIRA 5F89B 2B20A 5AD0B 3OKMB 4HAGA 5E8EB 1DN0B 1CXKA 1MJUL 4LIQH 2EIZB 2CQVA 4EI6A 3SO3C 2J4WL 1AO7B 4JFFB 2VE6B 3HI5H 2DKSA 3FB8A 3FOMB 3OB0H 3JWDH 3QNZA 3S3SA 1NEUA 3U6RA 1IAKB 4P3DA 4GJTB 3QXWA 4ODXA 4S0TD 5K59F 2VQTA 4F57L 1JRHI 1MCLA 5SWSD 5HHXH 4J4PC 3X11A 3STZA 5J9PA 1DLHB 4U3CA 3T77A 1WIPA 1QRNE 3MV8B 2X70A 3O3DA 1INEL 5HJ3A 1FC2D 1ZLUK 4UDTA 3IDGA 1GAFL 4I18B 3V52L 1OGAB 4JM2B 1U8HA 1PVHA 4WI8A 3O8XB 4NKDA 4IIQA 4JRWA 2K9UA 2X6MA 3ULVC 2QTEA 3JV5A 5B21A 4XTRD 2YRZA 5CCKL 3QWQB 2LTQB 1JV5A 1HOCB 2Z35B 4GG6B 1D5IL 3QP3A 3RWIA 1W8NA 2WBJA 4MWFB 4I77H 3VWJA 3VWKC 5C0IA 1T2XA 5GGUB 2IBGA 3A6BL 3RTQD 1KIPB 1IM9D 5HVFB 3CFBA 4J3VA 3EO0B 2UY6A 3WIHH 3P4NB 5E2VH 4UQ3B 1KOAA 2NX5D 1KIQB 3UBXB 5SWSE 3GSQB 2Y1VA 1H15B 4ZUVA 1V3KA 2OZ4H 5ACLA 4UB0H 3FN0L 4HWNA 1CDUA 2E3VA 5IWLA 1LO4H 4DEPC 5MP6H 1JWMA 1OAZL 4ZAKA 1J1PL 1W72H 4MVBC 1DQQA 1UZ8A 2Y4SA 2QR0B 1MI5D 3U4EB 4U6YA 3STLB 5D7SL 5IQ9A 1T03L 2MFNA 4HF5H 5D71H 4I48B 5DO2C 2DM3A 1UXSB 1RY7B 2PXYD 3CAFA 5GRWA 3QO1B 4ODUA 4JANB 5HHVL 2R0ZH 3UBXG 1MCKA 4X7TA 4RFOH 4APQA 1MCHA 1SJHA 3NGBB 1MCJA 2V5RA 2AP2A 1Z6JT 3VXRB 4LVOB 3A0OA 1N0XH 4ZD3H 1NAMB 1YECL 1VADB 2ZUQC 4JB9H 3RRQA 3O9WD 1FJ1A 1JUFB 4F8QA 3ISWA 1VSCA 2PYFB 5ECJE 4PJFF 3TIEA 1MCEA 1XF4A 5D70L 1PEWA 3QH3B 1OHQA 3BEWA 3C8DA 2XXMB 4X7FC 3RNKB 5BVJB 1UWGL 4GAJL 4O4YL 1MVFA 3PGDB 5D2LE 4BQBA 4GAFB 3PIQB 5AG8A 1WUNT 4LBEA 4Y5VC 1NAKL 1NMAL 1MI5E 3UTPE 4JRXD 3JV6A 2IAMC 1ULVA 4P2QA 4CL7A 1DVFC 1J05B 4WTXA 3CIQA 5EU3B 3BP5A 1NFKA 1KIUA 3GMQA 2WUBH 1CL7H 3WSQL 3O4LD 1P84J 1VERA 4R96B 1KPRA 3HS0B 3NCJL 4JDZA 1CGXA 4OLEA 4U1SB 5DLMH 2CLRA 3CMGA 4HIXL 3PP4H 2VH5H 3T65B 4Z7QE 2AV7B 1L9NA 4QRSB 2ERJB 1WC7A 4X6DB 1NQBA 4JDVB 2DAVA 3FB7A 5EG6C 2BSRA 3MBXL 5GS0L 1C8PA 2EO1A 3GK8L 3TP4A 3MV9D 1OT2A 4FOMA 4HDIB 3MOAL 3C08L 4F9LC 3KLHD 4YEFA 4PLNC 1B0GA 1FIGH 1OB1A 3HTLX 4K71B 4EKXA 1DQTA 1RZGA 4YUEL 1T1YA 1M05B 2E6JA 2WIMA 3MCLL 1ZGLP 3PWUA 1JHKL 5EUOB 2VSCA 2QHRL 5DD3H 1LD9A 2OTPA 1CFVH 2VDOH 5E8PB 5EBWA 4ONFH 1SEBA 4WTWA 4NJ9H 1P84K 4PGCB 3DX7A 2H32H 4JY5H 3O4LE 4YQXL 4OBRA 4NWTL 2H2SC 4WEUD 5BS0D 4X4MA 4BK4A 1WBZA 1A14L 1WLHA 2VLRA 3WKML 3TJEL 4D9LH 4NZTL 3NCBB 5DJ6A 3VU2A 3NCEB 1JZ3A 1QOKA 3MV9E 4TQEL 3M17A 4MAYA 5GQBA 2NLJB 3GMPB 4FRWA 4R7DB 5C86A 3IVKB 3VE0A 2CGRH 2NXYD 5F21B 2BC4A 4B53A 2Y6SD 3D9AL 2X89A 3MLXL 1AIFB 3WHXB 3T08A 1NCTA 4W6YB 4PR5B 5F1NA 2EDWA 3RAJH 2WK2A 4LMQE 4M1CD 4BSWA 3H3PH 4PJXE 1XR8A 4XNXL 1X44A 3D0VA 3KDMA 1OP3H 5I18H 4UUJB 2BOBB 3T0EB 5BS0E 4M48L 2BFVH 3HZMA 4K94L 4YBLC 3DPBA 1MHHA 1V7NH 1Q0YL 4U1KA 4Z18A 1HDMB 1IGFL 2VKXA 3BP6B 4DGIL 2OXGA 2C3GA 1FFNA 2AEPH 2DQCH 1AGDA 1KTKE 1J8HA 2IANE 4PRPD 1A1NA 2XG5A 4B41A 5CMAB 5J1TC 1RUKL 3RWGA 1U8OB 5DD6A 5C08B 4X80L 1UVQA 5SX5H 4ONOA 4KPHL 4X6EA 1R5WA 5KTEH 3PWJB 5HI5D 3IKCA 5I1DB 3LB6C 1YNKL 1UM4H 1C7SA 3RWHB 4CDGC 3GSRA 3M45A 4HS3A 4Y5XA 1AGCB 1ZTXH 2X4RB 4PJEF 2JCCB 4LNRA 5EU5B 1RIHL 2YD7A 1N2RB 3SE3A 1FL6B 1TDQA 3OG6B 4N0UE 2VLMD 1H3PH 3CVHA 1G9MC 5D2NE 3S34L 5T5NG 5JW3H 1FN4A 5ALBL 3KR3L 4P2RD 1FZJA 4PRPE 2FH6A 1U8PB 2Z0BA 4QEGA 2JF1A 3LIZH 4PJAA 3S35L 3HPJB 1U3ZA 1UB5B 1JVKA 3V4VH 3GSUA 4FTVE 4P23D 4WWKD 3QWOA 3RU8H 3PG2A 1QRNA 3OKOB 2DICA 1DL7L 2X4PA 1FE8H 3TNNB 4LL9A 4Z77B 2VJXA 3UTSD 1Y18B 5E2WH 3DX6A 3QDGD 5DJCA 1U58A 4PB9H 4P4RB 3VFVA 1XGPB 4ODWA 3U30B 3B5TA 2GY7B 3MMEB 4Y2DB 4QHNA 5LCVH 3N9GH 4P59L 4ZSOE 2UWEF 2BHYA 4RZCB 2HLAB 1U8NA 3VFSB 2CMRL 3NPSC 3DURA 4PRIA 4OLUH 5F3BB 2VLME 1KB5B 5I75C 2YPVL 1BF2A 1V3LA 2QL1A 1B0RA 1C16A 1A6UL 4M3KB 4PRNB 4P2RE 1TNNA 4KGJA 2DTMH 4WEBL 4FXKA 4JHWL 2WQ8A 4XI5C 3M8OH 3MV11 5GSVA 1N8ZB 3QUXD 5FYJE 2YMXL 3Q48A 5IJKA 1T2QL 3I75A 4OZHE 4XNZC 3SKMB 3VXNA 2LQRA 1NBVL 3KPOB 2CKBL 1B2WH 5MENE 1AE6H 4ZPTA 2E8ZA 3BWUC 4LASH 5INDA 1LK3H 1OAUH 3HE6A 4PLJD 3ZTNH 2EDQA 2VITA 5EU6D 1A3QA 1IC4H 5FM8A 4PGEA 1X6NA 2ADFH 2IALB 4WNQA 3D0LA 3KXFD 2BRRL 3VFUB 4GOSA 1YMMB 3QJFA 43CAA 2VXQL 2DQDL 3RTQA 1IM9A 2OL3H 1CZ8H 5TJWK 1PW3A 4A2MA 2NY3C 2PNDA 2NX5A 1ZKAA 3JWOL 3FONA 2AEWA 1OPGL 1G7MA 5DD1H 4DW2H 1CU4H 4NIKB 1EEUA 1WV7T 3LKSA 5TDNA 4TVPH 1F8TL 4XH2B 1OCWL 25C8L 3AFLA 1MHPH 3O3EA 1MJJB 3T3MF 4LLAA 1UWXK 5C0FA 2V6HA 3KNBA 1JZ8A 4NQXB 4ZTOL 3P9WB 3QPQC 3OAUH 1FPTH 4K3JH 5HDQL 4BSVA 1A9BB 4XAWH 5IFHH 5IIEB 4G6JL 2VYRE 1EPFA 3KPRD 2GJZA 1OLZA 1N59B 5EPMB 3ZKMD 3K0WA 1J18A 3PHOB 4JGUA 4KHTH 4UT9L 2DL2A 1ND0A 4TRPH 3BP7B 3C2AL 3O9WA 5DT1L 3E8UH 1IM3A 4KU1A 1JPTH 5TFSH 4GS7C 4NKMA 3MUZ1 5LGJB 2C1OB 2R4RH 1LO5A 3LRSB 5BV7H 2FO4B 3RL1B 3VD5A 3RWFA 5DJ0A 4U1IB 2VZ3A 1ES0A 1CGSH 2X2YA 4MA3B 2M2DA 5LJYH 4OIIH 4TOYL 2VQ1B 5F7DB 3HRPA 2JJVA 3ZDXE 5A2KH 3WNMA 1EO8H 4JRXA 4Y1AD 4Y88A 5D9SA 3KWWA 5F8QC 1KFAL 3IDMA 3SKOA 1RZKH 5J4MA 4PJGF 3VWKB 4ACPA 2ZUXA 2HN7A 1UKQA 5I8EB 4RFEA 1G7QA 4YHOH 4IOFC 3QDAA 1OP5H 4PBXA 2ZSWA 2MWCA 3MV01 4XP1L 3ECBA 2R2CA 3O4LA 5EIQA 3KPRE 1M7DA 2LAGB 3C6LB 4NKOA 4YHKL 1A6AB 3B9VA 1NCCL 3MV9A 2GI7A 5DD0L 2ADIB 1JF5A 1HI6B 1FG2A 3LHPH 4LSPH 3EKCA 4NO0D 1KV3A 4CN4A 3P30H 2L7JA 1YEKL 1Q9WB 4WHYH 4PJDE 2V17L 5ID0A 4NNYA 3UMTA 4S1RL 4Y89A 3GJFK 4XC3L 2OR7A 3MACL 3MZTA 4ZFOA 2M1KA 4UQ2B 2X1WL 1KCRL 4R0LB 5J13C 1VENA 3VXMD 5HYJD 2A9NH 5GS1B 1VFAA 3ARDC 3QULB 3MRMA 2R1XB 1I4FA 1S9KC 3GSNL 2IMNA 3SE4A 3TGXA 4BFGA 3ULVL 5BS0A 3F5WB 4NRYA 1TCRA 1HXYA 1WISA 4TSCL 4WI9A 4X6BA 1NUFA 3HAEA 3WO4C 4RISL 2DOCA 4GRWE 5FO9B 2J4WH 2Z91B 2NZIA 4PRBB 1XF1A 4M8QA 5BRZB 3HCVB 1N5AA 4RA3A 1AGEB 3WE6B 4PJIA 4MJIA 3DMMD 4A6YA 2YD5A 3LOWA 2IAMB 4HWZB 5LAXB 1M71A 1D5BA 4YDJA 1WFUA 3ARYA 4KZEL 3N0PB 4L3ED 3NFNA 5KSAA 4BQCA 2OJEB 4GKSA 4Q58C 4I0KA 2XV6B 2VLLA 5L8JB 5FGCB 4F57H 3QEUB 3E1F1 4NYLB 2P8MA 3MJ6A 3QDJB 3VXME 3U9PL 1T7VA 1T7WA 1NSNL 3S97C 1NBZA 5CBEB 1INEH 3MJ7A 3ZDZF 1GAFH 4GLRI 5F7YC 5C0BD 3V52H 1WFTA 3IXAA 1S9YA 1RZFL 2ZWLT 3BGMA 5CCKH 1GGCL 1DBBL 4CW1A 4PJBB 3KYMB 1D5IH 4JO1L 1MWAB 2E9WA 2ESVB 4F3FB 4CN1A 2AJZA 1A7NL 1A1MA 3A6BH 4RDQG 4PRPA 1KENL 3DSFL 2HTKD 3P3YA 1INDL 1FO0B 2GTWA 4LIQE 3DBXA 1LO0L 3MLYL 3C09B 1NDMA 1I1YA 2ZPKL 4JFDD 3O3BA 2DWEA 2CXGA 3IDIA 3OSKA 3FN0H 1YEHL 2QLVB 1EGJL 1JZ7A 5DA4A 1FYTB 4QTHB 3VRIA 1P7KB 1OAZH 2XWTB 2GUOA 1J1PH 2QHLA 2PKDA 3OV6A 5F7NC 1EVUA 5D7SH 5HGBB 5C0CE 4CKVX 1T03H 3ZKSD 4QOKD 3QIBD 5BO1L 1KSRA 1X5HA 4HC1A 4HLJA 4GSDL 1CICC 1YQVL 5BZWB 5HHVH 5B8CC 3FFCB 1PYWB 1H3VA 3WUZA 2Z8RA 3LDBC 4M7LH 2W65B 4P2RA 4LCCC 2HG5B 4TUOB 3VDAA 1YECH 3TLRA 3EYOA 1K5NB 4FQQA 1DE4A 4WWKA 2JJTA 4P23A 3BUYA 4JFDE 3DNKA 4JJ5B 5D70H 3ZLQC 4H26A 4PB0L 2OXHA 4X6CB 1UWGH 2IBZY 1NH6A 4GAJH 1DZBA 2OTUA 1MWAL 4O4YH 4YBLB 3CLEL 3DXAB 3UTSA 4EN3B 2FEEI 3QDGA 4Q97A 3QJHB 4Z7VE 4HZLA 1AKJB 1NAKH 1A4JA 1NMAH 1EZVX 3NIGE 4NHUB 4OAWA 2D7NA 1FO0L 3WS6A 3FFDA 2X4TB 4UT7L 1GH7A 3B6SB 3G5ZB 4HAFA 4N0FB 1GPOL 3TYFA 3WSQH 3MJ9A 1UWEL 2CJUL 4PGDA 1RHHA 5DQJA 3IB4A 5BXFB 3EYUL 3W11C 4TUKH 1IRAY 4HIXH 2R2BB 1EX0A 4YPJA 3MLTB 1I7TA 2PW2A 3WDJA 5D7IB 4ZNEE 3VW3L 3ALWA 4OD2A 2YA2A 3L5WA 3MBXH 4FFWC 5GS0H 4PJ8D 3QUXA 3NN8A 1R3LA 4GKZA 1HHHB 4XCNA 3MOAH 5LGKA 1KACB 1PSKL 1S7WB 3C08H 3FL7A 5AUMA 1IL1B 3U7AA 5ID1B 1IEHA 3V6OC 1VFMA 2WBWB 2HJLA 4YUEH 3EYQC 4IIQC 2Q3ZA 3CFIC 3MCLH 2CDEB 1JHKH 1KTDB 2QHRH 1D5ZB 5SWZE 5C0EB 1I3VA 5EU6A 2GSGB 3BXNA 1UH2A 4FABL 2H9GA 3O11A 4URTB 3VWJC 1U8QB 3KXFA 5AAWA 5HHPA 3IGAA 1FFPB 2WIIB 4YQXH 4NWTH 43C9B 4C55A 4JPWL 5DTFB 1A14H 1HSAA 3WKMH 1OAKL 1BFTA 1EUUA 3KPSB 3S36X 3TJEH 4NZTH 3VCLB 1YC7A 1A3RL 3VFPA 3MNWA 4PRHE 2GITB 3RKPA 2FEDD 5HD8D 5IWLC 4GRLD 4TQEH 1JI2A 4MDJB 2AJXL 3VGDA 2I27N 4JM2F 4M4PA 4IMKA 3EYVA 3ESUF 5CUSL 2F53B 3BPOC 5GGSA 1JGVL 4ZS7L 4U1LB 3D9AH 3I6GB 1ED3B 3MLXH 5TQ2L 4RGND 4G5ZH 4GG6F 1HHKA 4U6HA 1I1AC 2GW5A 1NC2B 4LKXA 5GRYA 3FT3B 2VISB 3TV3L 3OKNA 1FNEA 1RK0B 4RMSA 3MBED 5C0ND 4P3CL 4APQC 4XNXH 1BWWA 3LKPB 4UIMA 4KI1A 3KPRA 3GSWA 5DK2A 4RBPH 1QO3A 1NC4B 1BZQK 4M48H 5FCSH 5DJAA 1TZHB 1Q0YH 4NUGL 1RZIB 1XFPA 5FHBL 5CP3H 5FGSA 3RL2B 2DRUA 4JCMA 1G9ML 4YHZL 1KPUB 4DGIH 1BQHB 5KSBE 4QRPD 4W6XB 4LCWB 2B5IC 5F93C 3FAWA 4PJDA 1C08B 4M6AA 4CADA 3ZYIA 5HGDB 1CLCA 4LSVL 4Y1AA 1RUKH 3OWEA 1BD2E 4X80H 2VR4A 5CGYD 3NFPA 4KPHH 1I8IA 3OJDB 3TZVD 2HT4D 1V8HA 2NY3B 2DYPB 2MHAA 4U1HA 2DB8A 1FV1B 1YNKH 4HX1A 2X1QA 1YNTB 3U82B 3TCLB 3HUJF 1JCKA 2DLIA 1MY7A 2PTTB 3FQWA 1H0DB 2YC1A 4U1MA 4IRSB 1NCBL 1PKQA 1CD1A 2AK4B 4NO0A 5C09B 5F8RC 1QPPA 5FUCE 2FX7L 2W38A 3CSPA 2O26U 1DR9A 1EERB 3QYCA 4JZJB 3S34H 5DMKB 4ODTL 5ALBH 3EYFA 3KR3H 4I3GA 5ESAA 5IVZB 1AD0B 4PY7B 4B7IA 3S35H 2YR3A 4PLKD 3RIAF 3UPCA 1CXLA 3VXMA 5HYJA 4OB5L 4UMGA 3N1FC 1QSFB 1O7SA 2DF3A 4FQCL 1DL7H 3BRDA 3VD3A 1ORQA 4M1DL 4LVEA 1T4KB 4M7ZB 4X6DF 4OCXH 3MRJA 1P4IL 5E5MB 1BVKB 4LVNC 4P59H 1J12A 5HYIA 4M9OA 2ZUVA 2CMRH 2EXWC 1RK1B 4MAYC 4OZHF 3AC0A 3WO3B 4UTAL 3SGJC 3DMMA 2YPVH 3MV7D 1A6UH 2NXZD 2ADJB 1B88A 4NQEB 1EEQA 5MEPA 3W9DB 4L3EA 5GGTA 4WEBH 4XAKD 1ZLVK 2A0LD 3IXTA 4JHWH 4JZNA 5FECB 5IW3A 1I3UA 1S7VB 2YMXH 4MQSB 2IH1B 1T2QH 4PJFA 1OD7A 3OKKB 4WI5A 1NBVH 3NCYP 5J12C 3P73B 4OV5A 2CKBH 1HHIA 5D7JD 1EHLL 1GRWA 1Q38A 5IQ7L 2EDYA 2VLKB 1CDBA 2ATKA 3QFDA 5C0BA 1S7UA 3JV0A 5DRWB 1HILA 5FF6B 3RY4A 5IVNA 2XQYK 1RFDL 1DFBL 3LKOB 1DQML 4GT7A 4ZOAA 3Q2CA 2L4OA 3VXTA 5K9OB 5L9DL 3DECA 4WGVB 4JREB 2BRRH 3MUHL 3MRHA 3MO1B 3CFDB 5E9DD 1S3KL 2VXQH 4IRZL 2DQDH 2RFXB 3DVFA 2ITDA 2Z31D 1EH9A 1P4LA 4BJLA 2VXSL 2X4NA 5E6ID 4F2MB 1Z9LA 3C60B 2XY2A 4G7YL 1KXQE 1FAIL 4TNVK 1TVHB 4F9PA 2IPUG 4XAKE 3JWOH 3U46A 3HN3A 1OPGH 3VH8B 4WTZG 5C6PB 3BO8A 2D9QB 4CU6A 5E99L 4HGWB 2G2RB 4HWBA 1F8TH 3WO4B 1OCWH 4IOIA 25C8H 5IW6B 4ZO6A 3JV4B 1I8MA 4WUUB 3UO1L 3GB7A 3BSZL 2JK5A 3SE3C 1MFEL 4ZTOH 4PTTA 4WU5B 4GH7B 4QOKA 1AHWA 4MNGB 3QIBA 5HDQH 2HT3D 1GJIA 3FO1A 4JQXA 5E24E 3ARZA 1JMZA 3WCYA 2ZG2A 1A2YB 2QADC 4WI4A 5FKPB 2GJJA 4G6JH 1PLGH 1GXEA 3BZFA 5E9DE 3VH8G 3WJJA 2EYTA 1N4XL 1JP5A 1IGJA 4KDWA 1NKRA 5IBUG 3C2AH 4JN1L 5DT1H 2MKWA 3SDAD 1UEYA 2YPKA 3ZT5A 5E00A 4MQ7B 4FQHB 2BRQA 4W70A 1ZT1A 5IROA 1G9NC 1D5XA 1I3RA 3ARWA 3FOLA 4KDTA 4BUGA 2DIJA 4RMTA 3H3BC 5D1XD 3UJTL 1HH6A 3U0PA 5HDBF 1JIBA 1A6TA 2VDKL 4HUWB 3BZEA 1NGYA 3SO5A 2PCPB 2RR3A 1XR9A 2XQBL 4G9FB 3KPMB 4TOYH 4RMWA 5H94A 3TBWA 1KFAH 3D2UD 3RPKA 1BIHA 5DD5L 1UXWA 1LP9E 4OFYA 3PQYD 3O6FD 3QQ9C 2EEAA 1CXEA 4TVPE 1OTUC 3IDUA 4XP1H 5JDSB 2FL5A 5ILTL 3JUZA 2VUOA 5CIPB 2GAZB 4YHKH 3RWDB 1X5AA 1DEDA 3PDOB 1NCCH 4X9FA 5IJKC 1II4E 4ELKA 2YSSB 2MQ3A 3HMXA 4Y4KD 4MB3A 4NO5B 4PJ8A 1MHEB 2P5EB 3IFPA 5DD0H 2NR6D 4EDXB 3SDXB 4OZIB 3L5JA 1A6WL 5L88L 3B9DA 2V17H 2EDHA 3HE6C 1EJOL 4S1RH 3DV4B 3LEVL 4XTRC 5CEYA 4XC3H 3MPCA 3MACH 3FRPG 4Y8AA 1VCAA 1KCRH 5B8CB 1S9WB 2A6KA 2A1WL 5ADOL 4P4KA 1QBBA 4P5KA 3GM8A 5I66B 2ICWA 3ARFC 3MC0A 1BBJA 3QIUB 3CH1B 5LKNA 3GSNH 3MUJA 5D6CB 3INUL 3ULVH 1TQBC 3IKKA 4AEEA 3NPZB 5B4MD 4TSCH 2DJUA 3LEXA 4YFEA 1YYML 4KJWD 5F7FA 1AD9A 4LLUB 4RISH 1L6XA 4YR6B 1GZQA 1NUGA 2CR3A 3HZVB 3G08A 4IEFB 1IJ9A 3VGHA 5KSBA 5E8NB 4GRLA 3QQ4B 5FKAA 1GIGL 2F8OA 4FNLL 3TBTB 1ADQA 3MRKA 4AQOA 5J11C 2EE9A 4KZEH 5KOVC 1B4JL 3RA7L 4JHAL 4LCYA 3V6FA 5DEGB 1LEIB 3BZDA 1RJLA 2NTSP 4ZOEA 3IF1B 3VXQA 5HI4D 2E8YA 4MJ6A 2P5WD 1BAFL 4L8SA 3U9PH 3MBEA 4PJHA 1NSNH 3WXVL 5E03A 1J10A 1A7OL 4NFCA 5FDWB 1UB6A 2YPLE 3ULSA 4NQCE 1NGXB 3O9WC 4X9BA 5J1AA 1MEXL 2KQMA 3VRJB 1JL8A 3ARQA 1RZFH 2X4SA 4LLDA 1U8LA 4KRPC 4YDLC 1GGCH 1DBBH 3R8QA 3NA9L 4ZYKB 1KJMA 1G0XA 1G6RH 3QUZD 4F15B 4JO1H 4QRPA 3H8NA 2G5BB 3RX8A 3OXSA 3V5KB 2I9LA 1FNFA 1KENH 2YD3A 3DSFH 2N4IA 1INDH 5BMFL 3HPLA 4FFYL 4OCRL 3MLYH 3RGHA 2ZPKH 1AXIB 1FNSL 4OCMC 1JGDB 1M1SA 1QFPA 1U6AL 1YEHH 5T1KB 1EGJH 2P5WE 3TT1L 5DYOA 1ZANL 4YK4C 3FQNB 4E5XA 3BDBA 5J7CC 3MRIA 4UOW1 4HBCL 1UADC 3TO4B 5DSCA 4NN5C 4LRNL 4BFIB 1BJ1J 1NJ9B 4O2CA 5DK0B 1EUTA 1EO7A 2W60B 5I16A 4QRRB 5BO1H 2YZ1A 1Q9LA 4WENB 5F88A 1AO7D 4GSDH 4JFFD 3KLHC 2X42A 4X5WB 3BPOB 1K4CB 2WINA 1YQVH 2V2TB 1QTYT 2BVQA 3WS3B 4PP1D 4IOSD 1SVCP 3KLSA 4CBPA 5IMMB 1I1AB 1OGTA 2BVOB 3IRZA 2F9BT 5FGBC 2OYPA 4N1EA 5EBLB 3HZYA 2AVGA 3LD8B 2H6PA 4N68A 3OL2A 3VFWA 4PB0H 3REWB 3QNYB 1S7TA 1OQOA 5B39G 1MWAH 3CLEH 5IW1B 1OGAD 4OZGE 4JY4A 2IC2A 3O8XD 2OK0L 2FBOJ 3BQUD 4JO2L 4I0PD 3B2UC 2KPNA 3QXDB 4LF3A 1F45A 1FO0H 3QFJE 4WHCA 2B5IB 2FLRT 4UT7H 5EZOH 1T21B 2QV2A 2VABB 1GPOH 1SYSA 3JBG7 1UWEH 1KG0A 3SDCD 1K9TA 3EYUH 3MV7A 2KUTA 3I84A 4Q6IA 5KSAC 4X4YB 1CVRA 1YY8A 1T3FB 1OSPL 3HKFA 2YUVA 4LQ1A 4ODHL 3VW3H 3GBML 4QTIL 4M1CC 4G9DB 1LWRA 1XH3A 4V1DB 5AEAA 3OHXA 3KPNB 2HVJA 2WP3T 4K8RC 1C1EL 2A83A 2FIRT 3H7BA 4L8BA 5D7JA 4FN0A 5EIVA 4CVZB 3GMRA 5GS0D 3CSYA 2VZUA 2FYYB 5IFJB 1WFOA 1NCDH 3T0VA 4FABH 2OJZL 3M1BA 1CFQA 3BN9C 1CFSA 2J8UE 4WFHD 4PJGA 1H5BC 4KI5D 1S7RB 2P42B 5EO0B 1JGEB 3S4SB 5AG9A 4WRLA 1I8KA 3BYYA 5E9DA 4AH2B 1YEDB 3VXRD 3U2SA 2Z31A 1S7SB 4FMKA 3MRFB 5E6IA 4JPWH 2Q7YB 3IDJA 4RDQF 4HUVB 1A3RH 3Q5TA 4F7PB 5JA8B 4FA8A 3VI4E 1C5CL 2AJXH 3MRDB 5E8DL 5A43C 2AXFB 7CGTA 1KLUA 4HHAA 4PV8A 4UNTA 2B7DT 3QCTH 5CUSH 1WIUA 5IVOA 2BNRB 3PGCA 3ZDYE 1JGVH 3NH7L 1K8DB 4ZS7H 4JAMB 4JJHA 3PABA 2EEDA 5TQ2H 4PJBF 2EDNA 1U3HB 1DQJA 3MLVL 4U7SA 1LP9A 2XY1A 2BDNL 3WN5C 2QSCL 3D39A 3TV3H 2J7LA 1BMGA 1KNOA 4H8WC 5KS9E 3I6KB 4P3CH 4PG9B 3DGCR 3FB5B 4KI5E 4H5SA 4OZ4A 5GXBB 4BH7A 3ILQC 2OMBA 4MQXD 2W1NA 3QI9B 4X99B 3VXRE 2QSTA 3QISA 4XX1G 1Q1JL 4NUGH 3TNMB 3SDAA 2D0FA 2F54B 5FHBH 5DJDB 2ARWA 1G9MH 5HGHA 4YHZH 1UQSB 4MB5A 5IK3B 5D1XA 4MYWB 3L3OA 2R1WB 2F74B 1FZKA 5CJBA 4D0DB 2A73B 3DYOA 1RURL 1ZHNA 4LSVH 1JPST 4XWOC 3TJHC 3D2UA 4PGJA 2PTVA 3MOQA 4MCZA 1VFBA 2D4FA 5ICYA 3PQYA 4FFVC 3O6FA 3UX9B 1S7XA 3QXUA 5GRZA 1FSKC 3CFKB 1P9MA 1LDSA 5IM7A 3G5YB 4ZXBC 3O2WL 4X4XB 2UVEA 4ZPVA 3HE7A 4HGKC 3W5NA 1X5IA 5FV1L 5JO5B 5JW4Q 5L2KA 2F8XC 3GJFB 4X6CF 1YDPB 1NCBH 4NPYB 2JTDA 3BE1L 2FJGB 3RVXC 4YDKL 3ARED 1T1WB 3BN3B 1JNHA 1OARL 2FX7H 5IVXB 5IKCA 3UTTE 4ODTH 1SJEB 2W0FA 2X4OB 2CR6A 1OQXA 1HNGA 5EUOE 3BWAA 2IEPA 4KJYA 2QADB 5CP7A 2WSKA 5M7QA 1NBYA 4OB5H 3DROB 1CF8L 3QXAA 1IGCL 4FQCH 1S78C 2DQTL 3ES6B 1Y0LB 2B8OT 4M1DH 3QWRD 3BESR 1NFDB 1P4IH 4YXHL 5MERB 4YPGB 4BZ1L 3RWCA 5E8OB 1MFDL 4EUPB 1AP2B 4ODBD 3ZYJA 4KAQL 2NY6C 4UOW0 3L3IA 1A9EB 4OQ1A 2BY2A 5FV2A 4NOFA 2ADGB 4UTAH 1ZT7A 4UTBL 1DEEB 2Z4QA 2FZ3B 3DVNA 4FMFA 1YPZE 2J6EA 4U3HA 5IJVA 1IKFL 2VDRL 3BI9X 5C08D 4F33B 3ETBF 4OZFH 1LEKA 1H3XA 5DQ9A 3MRGA 3U0TB 1HQ4B 3T0DA 5EC2A 1EHNA 2P5WA 4CRPA 5IMLB 4EUPG 3SGDH 1MLBA 4X98B 3D25B 1EHLH 2E9BA 5IQ7H 3H9YA 1BZ7B 2XA8L 4G6FB 3FQTB 1OF2B 1RFDH 1DFBH 1ZA6B 3BW9B 4R2GD 3CVHL 4NUJA 5EC1B 1T1ZB 3QSKB 4UBDC 3T8XB 4HS6A 4PRDB 1DQMH 2R9HD 5A2IH 5A2FA 6FABL 1HSBB 3EO9L 1I9EA 2DD8L 5L9DH 3QUZA 1CFTB 5F3HB 3HZKA 1S3KH 1BFSA 2H26A 2IWGA 3VFMB 4IRZH 2AXGB 5DC4B 2NY1C 4HMEA 4U1JB 2VXSH 4JE4B 1RSFA 2EH8L 4G7YH 4WO4C 2HH0L 4AQ1B 1F3DH 1FAIH 1G9NL 3GBLA 3GHBL 2D4DA 4NC1E 1P1ZB 1UM5L 2GTZB 3EO1A 5C08E 4AM0B 4LAQL 4HKXA 5H35A 1XGQA 4FQLL 4B5EA 1TQBB 1JWSA 1IAIM 3ARGC 5E99H 3RDTC 4Q9RL 32C2A 1WICA 5F89A 4OZGA 3QRGL 3OKMA 5HHMB 2NY4C 1QP1A 4X7SL 4PUBL 3UO1H 4CDHA 4G8EB 1DN0A 1XF3B 2JCCE 3BSZH 2K1MA 4UIKL 2OTWB 1T0NA 3F7VB 1ZLUH 1MFEH 1C12B 2VXUL 3AU1B 5E2UL 5JZ7C 1AO7A 3EDDA 4JFFA 5J11B 3CU1A 2VE6A 1YEGL 5I6XB 1YZZA 1UKTA 2R29L 4C83A 1IAKA 2VWEC 1N4XH 1QFWI 1RUPL 4F7MB 3LV3B 1MSPA 4JN1H 2JJSC 4JZOB 5F6HJ 4CJ1A 3KLDA 3UXFA 3OR6B 5IB5B 1WWBX 3OG4B 1DLHA 2Q76B 5IF0B 3UJTH 3MV8A 2B2XL 4ODVL 5DXWA 15C8L 2BP3A 2YOCA 2VDKH 1WBYB 1RZ8A 4YGAB 2XQBH 4I18A 1OGAA 4BSJA 3RHWF 3G6AB 3O8XA 2JIXB 3BQUA 4I0PA 2VDLL 3DJ9A 3BH8B 1IKNA 2WQRA 1V05A 4ETQB 2VLJB 5DD5H 2Z35A 1HOCA 3CMOL 5DJXB 2J8UA 4GG6A 5EWIL 3GZKA 3S9DB 3DMMC 4KRMB 1YMMD 2I5YL 5GGUA 3HRZB 3RBGA 5ILTH 1KIPA 3TFKD 3SDCA 1YEJL 3IDNB 1Y6KR 4HUXB 4JFYB 3EO0A 1CIDA 1N64L 3P4NA 3UBXA 1J87A 4Z78B 1MREL 3GSQA 1H15A 1W8OA 3O3AB 2VZOA 1KN4L 5I2IB 1ZHKB 4NN5B 4A2LA 5HVGB 1A6WH 1I7UB 5L88H 3P4OB 1P4BL 4XPBL 1A6VL 2QR0A 3U4EA 3I3EA 3STLA 1EJOH 3S36L 3HC3L 3MUGA 3LEVH 3ZE2F 5FUOL 2ZSVB 3NMEA 1UKSA 4FZEL 1PGRB 5A1AA 1LNUA 5HGAB 5ADOH 1JF1B 3QO1A 4JANA 2I25N 2XTLA 1YY9D 1CDYA 3JUYA 5JNYA 3VJ6B 3V5HB 1ZVHA 5TGBB 3VXRA 3WEXB 2OBGA 3INUH 1NAMA 4DTGL 3SKNB 1SYVB 1VADA 1JUFA 1YYMH 5BJTA 4RX4D 3VG9C 3H3KA 3HC0A 1X5GA 4Z7WB 3QH3A 2N7BA 3RNKA 5BVJA 1GIGH 4H25B 1F4XL 1XMWA 3ULVD 4XNMB 4FNLH 2AKRB 3PIQA 3T04D 1MAJA 3OB8A 3FQXA 2YKLL 1B4JH 4HXAH 4JHAH 3RA7H 1FCGA 2C3VB 5TH2B 3SQBA 4JQXC 2VAJA 3VWKD 3H7LA 1J05A 4J1UB 5EU3A 3WFHB 4JKLA 3ZT7A 4FXGB 1T83A 1AXSB 5J1SC 1BAFH 3CZFB 3WXVH 3WJJC 5C07D 1A7OH 4R96A 5DJ2B 3HS0A 4IRJB 3AROA 1A47A 3VDCA 1AH1A 4U1SA 4KV5E 4GKOA 3JVGA 4YXKL 3RUGF 3H0TB 2RB8A 5EUKB 1MEXH 4JDVA 3AS1A 4KUZL 4MNQE 5IROC 4NQVB 2K7PA 1KIRB 4KDTC 2CK2A 3KYOB 4HDIA 2OI9B 3NA9H 5C0GB 1GVIA 1PG7X 3GMNA 4WU7B 5I8KL 2P7TB 4ZFOL 4QGTA 1M05A 4EVNB 3ULVE 5JLZB 3U4AA 1MRCL 4C57C 4W68A 5DO2D 5IB4B 3VA2C 5F9OL 2PUQT 5EUOA 3IYLW 4QYOB 4KXZI 5BMFH 1H5BB 4FFYH 3V79C 4OCRH 4OIAA 5EZJB 4C56B 4PJ7B 2WM0A 1FNSH 1PY4A 4XVTL 5ETUB 2D2OA 4PGCA 3TT1H 4JRYE 1ZANH 2M8XA 1LGVA 5F7MC 5INCB 3V7AG 5C07E 2A6DA 4HBCH 4PYGA 5EOCJ 4LRNH 5DRXB 1P2CA 4X9HA 5K9QI 3MODL 4RWYL 3FRUB 5JHDB 4A6YL 5CBAB 3MREA 2XT1B 1K8IB 3AREA 1T1XB 5CZXC 4OFDA 5D96B 4R7DA 3IVKA 4WFGE 2IAMD 1DVFD 5I76A 1YPZA 3WN5B 3KJ4C 1AIFA 5FYJU 3WD5L 4PBVC 3WHXA 4N9GB 1BVLB 3K4ZA 4Y8DC 3AVEA 4PR5A 4P4KC 1ZGLB 4K8RL 3QDJD 4NCC2 4FP8L 5GGRY 3ULUF 3IU3A 2XZQL 1F42A 1RJZB 4MMXC 4UUJA 5GZOC 3L3JA 2J5LC 4KTDL 1J7VR 2JB5L 4Z7UB 3T0EA 4ZFGL 5H37G 2OK0H 4JO2H 3AY4A 4K3GA 2HKHL 8FABB 3FTGA 1HDMA 4S1DD 3BP6A 3SDXF 4OZIF 1IEAA 1R3KB 5C0AE 4GRLC 4YZFE 1ITCA 1QEWB 1PZUB 1FP5A 4M3JA 1KTRL 4X5LA 3PJSB 4YFLI 2EC8A 3O45B 1EZVY 5B3JF 3SY0B 3EFDL 5I1GL 4RGNC 1JPGB 1OSPH 5CMAA 2BSSB 2NY0C 4I3RL 5FGCE 4ODHH 1U8OA 12E8L 5C08A 5EU4A 5EDXA 3GBMH 4L8SC 4QTIH 1AXTL 2H2SD 2MOVA 3CDFA 4AL8H 3ORJA 4L3CB 3PWJA 3W0WD 4LMQI 5I1DA 2J3SA 3KAAA 4GQ9H 4RGOL 3VRLE 1C1EH 3BGFC 3RWHA 1U8MB 2H45A 2R0WL 1AGCA 1KPVB 2JCCA 5EU5A 4HC1L 3UZEA 3PWPB 3MRRB 1N2RA 4H8WL 1FL6A 2OJZH 2V5SA 5ACMA 4QNPE 3M07A 4Y19D 4WFEE 4WW2B 1QFOA 1QQDB 1RU9L 1ZV5A 3F62A 1U8PA 2BHZA 4ZS6D 4XVUD 1KYOJ 3B43A 4HW6A 3HPJA 1KUMA 1UB5A 2V9TA 2OSLB 5DHXB 3DYMA 2AJUL 3VGBA 4ZQKB 3KS0J 5F1KC 4PP2B 2UUDH 3WFBL 2HT4C 1C5CH 3OKOA 3HI6L 5E8DH 3TNNA 5T1DL 4Z77A 3PNWB 4RAUA 3W0WE 1Y18A 3CH8A 4OKVB 3E6HB 3BGAA 2DM4A 1AKJD 1XGPA 2RHEA 5IV2B 1X5YA 1ZVYA 2X4QB 3OKDB 3WNKA 3ZYZA 3NH7H 3MLPA 1U9KA 3WLBB 3QCVL 2Q6WB 3MMEA 1TPXB 3MLVH 4N8VB 3TN0C 4S10A 2BDNH 4PGBB 2QSCH 1CDIA 3VFSA 5B3NA 4DCQA 5FCUL 1A6ZB 3B9KC 4DKDC 5F3BA 3MGTB 4Y19E 2GKIA 1UT9A 5KVFL 2CRYA 4PRNA 2G75B 2APBA 2Y7QA 3CLFL 2XZZA 1GC1C 1Q1JH 1WBXB 1UCBL 2LVEA 2N56A 3Q6FB 1T7XA 1N8ZA 3LB6D 5JOPD 1XF5A 2FWOB 3WHE0 3SKMA 3V9FA 4RFNB 4S1SL 2JB6B 3KPOA 3RIAK 4N8VG 4NQTA 5E6YA 4YIQB 2FSEB 4J3XA 4U7MA 2NW2B 2DWDB 4XBPB 2DMKA 2D0GA 3K2MC 3QDHA 1N26A 2DQUL 2IALA 1UWXH 2NY1B 3JTSB 1F6AB 3WL9B 1TXKA 3VFUA 4U49A 1YMMA 4Q7DA 2ITCB 2P43B 2BNQB 3DETD 3OBAA 3O2WH 1UFUA 4D9RE 3KPSD 5DQDL 2Y9RT 5D7IE 2NPLX 4JO3L 3ARGB 5CJ5A 3RDTB 1G7JB 3TCXA 4R97C 3BE1H 4YDKH 3QUMB 3QEQB 1OARH 3D3VD 4PJCB 4XH2A 4PJ9B 1KGCE 4WI6A 2F53D 1MJJA 3U36B 3MFGB 3G6JE 4NQXA 2G5RA 2GK0B 1VFUA 2CXKA 1GOFA 1NC2D 5IHLB 3X12B 4WFFE 5E08L 1A9BA 3MA9H 3RZCB 4EI5C 1I7ZB 1CF8H 5IIEA 1IGCH 1ZMYA 2BK8A 2DQTH 4UV4L 4E42A 1N59A 5EPMA 2R2HB 3PHOA 4OQTA 1BWMA 1SMAA 3BP7A 4KRLB 4KKCD 3IS1X 1FYHB 4BZ1H 1A3LL 4RX4A 5LGJA 2C1OA 3A6CL 3LH2L 1WAAF 3LN9A 4OF3A 3LRSA 4NDMB 3K1DA 4KAQH 2FO4A 2EKSB 4LCWD 3RL1A 1E4JA 4BQ6A 4U1IA 3QNXA 3D3VE 3S98A 2VQ1A 2R15A 4UTBH 1X7QB 2F53E 4NNXB 5MEOA 2VUYA 4LLMB 1A7QL 4O2FB 1MRDL 1IKFH 2VDRH 4R4BB 3VWKA 5I8EA 1TCMA 4JG1L 3K74B 4R7NB 5HHNB 1NGPL 4ZTPL 2LE9A 2NY3D 2ZUYA 4FQXB 3ARBB 5C07A 3H9SE 5IBLC 5IHZA 3C6LA 4RNRB 1A6AA 5EU7C 3L7FA 3VFRB 2XA8H 3OKLB 1NCAL 1YQ2A 3V6BR 3K2UL 3CVHH 4OF8A 5I1CL 3AM8A 2IG2L 4HD9A 4IRSD 5DZLA 6FABH 4LGPB 2ADIA 1HI6A 3EO9H 1T0MB 5D8JL 2DD8H 4N5UA 1JWUB 1PEZA 3FHAA 2EDXA 1Q9WA 5D6DC 1FGVL 3QPQD 1BFOA 2CD0A 4I13B 2EH8H 4UQ2A 4G8GB 2HH0H 5TE7H 4B50A 1G9NH 3D6GA 3GHBH 4R0LA 1UM5H 1QLFB 1ZVSB 3GSVB 3I3BA 2BZDA 4LAQH 3O6FC 5GS1A 4EIZC 3QULA 1QSFD 4CVUA 2R1XA 4FQLH 3HR6A 1BOGB 4Q9RH 1P9MC 2X4UB 4WI3A 1P6AB 3UTZB 3DUSB 2FECI 3ILPA 3QRGH 3VG9B 3F5WA 3HE7C 3CSBA 4X7SH 2W9EH 1WIOA 4H88H 4PUBH 4U3XA 3Q5OA 4UIKH 4ZDHB 1NMBL 2F8VA 1SY6A 4JPIB 3PP3K 2PO6B 5L8KB 3B2VL 4PRBA 2VXUH 4MX7B 3V4PL 4M6ML 1WGOA 5E2UH 2EYSB 1EGJA 5H2BB 5BRZA 3WE6A 1AGEA 3SGKC 1ZHLB 3D48R 2AAVA 1YEGH 3CC5B 5GGTL 2R29H 2IAMA 5LAXA 3L9RB 2OM5A 4DZBB 1RUPH 3K8KA 2HJFB 3QG6A 1T89A 3QEUA 5D1ZC 4YGVB 3DX9B 3TH4T 3LQZB 4NYLA 4Z9KB 2WLZA 4ISVB 1NDGB 3QDJA 3H9HB 2IADA 1M7IA 5L2JB 4F8TA 1EBPA 3BDXA 5CBEA 5JQ6L 1J0YA 2B2XH 2C3WA 2H2PC 15C8H 4KK5C 4ODVH 4GXUM 5JMOC 3NTCL 5C0DB 4X7EC 3EZ8A 4L4TD 4HK3J 1UA6L 2VDLH 3BAEL 3EFFA 4HKBA 1IMHC 1J5OL 3CMOH 4PJBA 3KYMA 5IVXF 5EWIH 4NQDE 4P2OB 1MWAA 3N1MC 5IOPB 2BHUA 2ESVA 4F3FA 5I9QC 4FQ2L 2I5YH 4LHQB 5EULV 2ICEB 2KZ1B 4OSUL 1YEJH 4OI8A 2MMXA 1BIIB 1N64H 3QIWB 1DTUA 1FO0A 4Y4HB 1FFRA 2MKLC 2AJ3B 4UU9A 1XAUA 4AIXA 3VXOB 3ZKXC 4BFBD 1MREH 4HWBL 5HI4C 4YHML 4GW5A 2EYRB 4LHUB 1KN4H 4TPRL 2PYEE 1TNMA 4QTHA 4R4NC 3UJIL 2XWTA 1YN6B 4C4KO 1P4BH 1A6VH 4HKJB 3SJVB 5HGBA 3S36H 3HC3H 5E1HB 4L4TE 5FUOH 1X5LA 3VXUB 5KG9B 1UM6L 4JFXB 4FZEH 1A21A 2IH3B 2Z8WC 3VXSE 4HIIB 1WQVT 4OGXL 1YC8A 3FFCA 5KVMC 1PYWA 1TJHL 4H20L 4XCCL 3MFFB 5CSZA 4LHUG 2W65A 4NSKB 4DTGH 2VDPL 4TUOA 2HG5A 2VXVL 3T4AB 4U4BA 1K5NA 1HHGB 4D9QD 4JJ5A 5GGSY 2WBJB 2XKNB 3O6LL 4X6CA 5M94B 1HH9A 1TMCB 1F4XH 3DXAA 1WZ1L 3WUWB 1RQ5A 3QJHA 3C8KA 4YHIB 1AKJA 2YKLH 2C7UB 3R8BB 4LU5L 5E5UB 2X4TA 2AEQL 3ZT6A 3VXPB 3WNNA 3B6SA 2A6IB 3G5ZA 3SN6N 4N0FA 4OGAC 1QRKA 4WEMB 4ZAKB 4ZFZB 3ULUD 2R2BA 3HMXL 1FC1A 4PG2C 3ZTJG 1IAOB 3BRGC 5I8CB 4M7KH 4YXKH 3LRGA 5D7IA 4KUZH 2ICES 4K23H 4W6WB 1WCQA 1HHHA 3BFOA 1E6OL 4M61A 2UZYB 4ODUB 1S7WA 3QQNA 3HA0A 2GT9B 1IL1A 4I18C 5ID1A 5I8KH 1J0IA 1JGUL 5IT2L 3LN5B 4Y16C 4JM2C 1MRCH 5CAYB 2CDEA 1IKNC 1PAMA 5F9OH 1FJ1B 1KTDA 1HKLL 4XC1L 1D5ZA 5C0EA 4WHDA 2GSGA 4DAGH 2XI9A 1NBQA 2XTJB 1XF4B 5TDOB 3PWLB 1X4XA 1U8QA 2AQ1A 3DV6B 4XVTH 1QFUL 4HULB 1FFPA 2RQ8A 5CHNB 2WIIA 5JOEA 1WEJL 43C9A 4CVXB 5DTFA 1E4KA 3BISA 3B3IA 3KPSA 3MODH 4RWYH 1X5FA 1QBAA 1ADQL 3P4MB 4A6YH 2R1YB 2DLTA 4MDJA 4Y4FB 3WNPA 1NUNB 5CJXA 1HYRC 3O2VL 3D3VA 1XGTB 3HLAB 2F53A 2CLRB 4L8CB 2OR8A 2I07B 4U1LA 1YEIL 3I6GA 4K3EL 3WD5H 5KVGL 5C2BL 3RY5A 5D5ME 3D69B 5KANG 4NC0B 1NC2A 2QQKL 1SBBA 3FT3A 4K8RH 2VISA 4NBYB 1RK0A 3W11D 2BOCB 4ONGL 4XGZB 5CZKA 4FP8H 4G8FB 1YYLL 3LKPA 1JN6B 3NGBC 1LDPL 2HLFC 4Q2ZB 2XZQH 1CLYL 3FT4B 4IBLT 3VD4A 4YXLL 5IMOB 1H8SA 3RGVC 1J0JA 5D2NC 4FFWD 1D6EB 1NC4A 2JB5H 4KTDH 1R24B 2F58L 2Y23A 4O02L 3CCHB 4ZFGH 1TZHA 2HKHH 5GJTL 4J6RL 2A74B 3MNZB 4PS4L 3QXVA 3RL2A 3E6FB 4BZ2L 3EYQD 1BQHA 1SEBB 4LCWA 1T5WB 2EDFA 5DMGC 4DQOL 3HI1A 1CL7I 1NGWA 1C08A 1T20B 3G9VA 1KCVL 3QXTA 5HGDA 3RFZC 3EFDH 5I1GH 3VWJD 5I1JL 1MFBL 1S5IL 4I3RH 4E41D 1TTFA 1T83C 12E8H 1AXTH 4HWEL 2OX5A 5T1KD 4RMRA 2ZNXA 2DYPA 4RGOH 2H3NA 1FV1A 2ICWI 3JVGC 5CKGA 1YNTA 3BIKB 2R0WH 2ERJC 1LMKA 3TCLA 3C9NB 2BC4B 4PRAA 4HC1H 3CPLB 4R97B 4Z7WF 5EBMB 4OZFA 2PTTA 4NZDA 1H0DA 1FORL 3WDIA 4H8WH 4IRSA 4K71C 2AK4A 5C09A 3RX7A 3BKJL 2Q86B 4JZJA 5DMKA 1FRGL 1L4IA 1BF8A 2AJSL 1GC1L 4AIZA 1JI1A 1I1AD 1RU9H 3HZMB 4HIJB 2O61B 3CFJB 2UZXB 4D8PB 4CMMB 2I60L 3B4NA 1BJMA 5IVZA 1AD0A 4U1KB 4PY7A 1BP3B 1Q72L 4PGZA 3K81A 5F71A 5IMKB 4G42B 3V7MA 4E41E 2AJUH 2DDQL 4LPVA 4EZMA 4NOBA 1DLFL 3WFBH 2DBJA 1QSFA 1ZLVH 4G3YL 3HI6H 5DVLA 4Z7NF 1NEZB 5T1DH 4YNYB 2A77L 2YD2A 4IS6B 1T4KA 1IAIL 1A1NB 5DHVH 4RQQB 5E5MA 1BVKA 4K55A 2PW1B 4I2XB 3QCVH 1ORSB 5DD6B 1OP3K 3RKDD 1G0YR 5M95B 1RK1A 3TEUA 5C2UB 5FCUH 5C71A 2E7LA 2FJFB 3V6ZB 1AQDB 4U31A 2HMIC 4HS3B 4TULL 4WCYL 5KVFH 2ADJA 2YXMA 3W9DA 3CLFH 5C3TA 4PJ7F 3PWVB 1NEZG 3MOBL 4J8RA 5FECA 3DVIA 4NWUL 4PV9B 3SKUD 4N0YL 1S7VA 2IH1A 4JKPL 1JPFA 4K2UL 1PG7W 4V1DD 3B9EA 5GSRA 4MA7L 3P73A 4S1SH 3BUTA 3T0EC 4X9GA 3DHJA 2VLKA 1EDQA 1GL4B 4HEME 2VTFA 3JTTB 5A3IC 3AY4C 1FZJB 3EDKA 5DRWA 5F9JB 4GKNA 3BH9B 1MCNA 3P4LA 2ZNWA 3LKOA 4P2CG 2E27H 4JHZA 4YHLL 5K9OA 2DQUH 4JDTL 1RZJC 1PQZB 2APFA 3QDMD 3LKRA 2APVA 3MRLB 3MO1A 3CFDA 3C5SB 1CD9B 2RFXA 4P2QE 4PREB 1U58B 1X5KA 2R23B 4DKAA 1CD8A 4ODWB 4F2MA 2EE6A 1A7BA 4RMQA 5C70A 5DQDH 2R39A 4KK9C 4JKKA 4LLWB 3VH8A 4FQIL 4QXWA 5IR1B 4HGWA 3ZE1E 4Z7UF 2ENYA 2CUHA 1XGUB 3IJYB 5IW6A 5SX4H 4WUUA 4NZJA 3UZVB 4FXKB 2EXWD 5SWSB 1UZ6F 3CFEB 2R9HC 4MAYD 3C6SB 3H2WA 4WU5A 5GSVB 4MNGA 3T2NL 1F11B 2YUZA 1QLRB 2YZ8A 5E56A 2P45B 5E08H 1SVZA 2X89D 1A2YA 5KBNC 5FKPA 3QDME 4M7LT 4KMQA 3BJ91 5HDLA 4UV4H 2P4AB 3BKYL 5F7HA 5D1ZB 5EBGA 3QI9D 1PZ5A 2NY2B 4Q9QL 1Q0XL 2A6JB 3MLWL 3WLWC 2X9WA 3ARPA 3CFCH 1MUJB 3VG0L 1A3LH 2F54D 4MQ7A 5DRZA 1BX2B 4JQVC 4MJ4A 3A6CH 3LH2H 1DUZB 4X4ME 3RX5A 5ICXB 2VLRE 1REIA 4ZG1A 4XT1C 4YAQB 1PFCA 1I7RB 2PCPA 3U30C 1D5MB 4Y2DC 1A7QH 2WWMC 4H1LB 4NO2B 1MRDH 4POUB 3L7EB 3FONB 1KCLA 1PG7L 1P5VA 4JG1H 1GOGA 1NGPH 1U95B 4WW2F 3VI3F 4ZTPH 4BUHA 4XHJC 5JDSA 1N6VA 5D2LB 4XP4L 4KTEL 5CIPA 3T1WA 1G1CA 1MI5B 2GAZA 4QHMB 2XWJB 3PDOA 4Z5RB 1JJUA 3OXRB 1FZMA 1NCAH 5TDPB 5I1CH 2VB5A 3DX8B 2YSSA 4QWWC 2IG2H 4ZUTB 2PXYB 1JNNL 4QT5B 5C9KA 4CN6A 4EDXA 3SDXA 4OZIA 1MQ8A 2D7TL 4NZUL 1EO5A 1FGVH 1IFHL 4S1QL 4I3SL 3L3GB 2ZG1A 3UROR 4YE4L 2QADD 3PV6B 3V5DB 5B8CA 1S9WA 1J8HE 1OWRM 5FM4A 3RHWK 2XWBB 5I66A 4L5FL 3QIUA 1XZ0B 2XXCB 3CH1A 4D3CL 5CEXB 3RWFB 1I9RL 4L8DB 4MXVE 4LRIC 1EJ6A 3TBSB 3ALXA 4G6AC 1A64A 4LOUC 5GRJL 4I5BB 2RCSL 4LLUA 1NMBH 5D9SB 4YBQC 4YR6A 5K9QG 4DOHE 5I73B 3HZVA 3L3HB 3V4PH 1QYGH 4L4JA 4M6MH 2Y72A 1ONQB 3QQ4A 3VFTB 2J6EL 5GGTH 4DK6A 2BVPB 2FX9L 4QHLB 2E5EA 1E0OB 3JWDC 5GZNC 4P5MA 4PRID 2I26N 1LEIA 4MGXA 3QQ9D 4X5XB 1OTUD 1J88A 3IF1A 3MV9B 4P5TB 1AFVL 1BQLL 3IETB 1NANI 1YY9C 5JQ6H 5FDWA 4PJAE 3FO0L 3NTCH 1NGXA 2ZUTA 2E6QA 4G6FD 1SMOA 1WWAX 1KJ3L 1NFDE 3GIVB 3VRJA 1UA6H 2VDNL 3BAEH 5JOFB 3FZUC 1XGYL 3FO2B 1J5OH 3V6OA 4Y16B 4ZYKA 4PJXB 4PJCF 3GRWA 3HE6D 5E2TL 4DUWA 4NQSB 4P9HC 3CGTA 4FQ2H 4JPKL 5F7WC 5BS0B 3V5KA 2FHBA 3EOAB 3KPTA 4NRYB 4OSUH 5DDHB 2IPUK 5CS7A 3HAEB 4PRIE 3ARFD 1VGKB 4PY8J 3X14B 4E41A 5SV3A 4DKFL 4HWBH 4YHMH 4P3WA 5HGGS 4KUCD 2VOTA 4QRTB 4JN2B 4BELD 1JGDA 3RPIB 5T1KA 4TPRH 2B1AL 2X05A 4RSVA 4ZUUB 2J1KA 3C6LC 2IANB 1F3JB 1CQYA 1RUQL 3UJIH 4BFIA 4GKSB 4RA0C 3AM8C 1NJ9A 5FB8B 1E4WH 4LSTL 5DK0A 4JLRB 2W60A 4JKWA 5EZIL 4QRRA 5AWNL 4CMHB 3RWEB 1BJ1H 1E4XL 3HAEG 4X5WA 3MA7B 1K4CA 1JZ5A 2V2TA 2GJ6B 4OGXH 4P48A 1TJHH 3WS3A 4H20H 4OTXL 4XCCH 4KWUA 1C5DB 5IMMA 1I1AA 1JF6A 3PF2A 2BVOA 2VDPH 3CDYA 3CX2A 2VXVH 4R0LC 2IQ9L 5EBLA 5HXMA 5GS1C 4N0UB 2C1PA 4CW1B 2FLBT 4CU7A 3TWCL 3REWA 1UH3A 3RGVB 1TQCB 2SEBB 5D2NB 3O6LH 2NX5E 3HUJB 5IW1A 4PY8I 3QAZB 1TJIL 3WXWL 1VEPA 1WZ1H 4KRPD 4PRPB 5EO1B 2WAHA 1W2KT 5GRVK 2JIXD