1AZRA

Crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHDWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of Pseudomonas aeruginosai zinc azurin mutant Asn47Asp at 2.4 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azrA00
1MG3C 1VLXA 4GYBA 2JFCA 2GC7C 1GS7A 1PZBA 2DY2A 1PLCA 1X9RA 7PAZA 3OMIB 4N8UA 3NP3A 1GW0A 1OCZB 3GYRA 4YSUA 1BAWA 1PNCA 2FT8A 1ASPA 4ENZA 1ZDQA 2HRGA 3H56A 1KCWA 3SBPA 1BEXA 4AX3A 1NICA 2AZAA 1EZLA 2UXTA 5B1KA 3NJGA 4MFHA 4A67A 1TKWA 2VSMB 4CSZA 2ZWNA 1MG2C 1AZUA 2AANA 5IY5B 4JHUA 2J5WA 1HAWA 3FSZA 4KO5A 3ERXA 3FQ2A 3FYIB 4A2DA 1ILSA 4M4RB 2HRHA 2AZUA 3UAEA 4A68A 4YSDA 3IEAA 3D12B 2BW5A 2BP8A 2P80D 5D4HA 2GC4C 2IDTA 4G71B 4BXVA 3EH3B 1BXUA 3CVBA 1ASQA 2XV2A 3IN0A 1KYAA 5B7MA 2H3XC 1WS8A 5I5IA 1AZCA 3T6ZA 2Q9OA 3T6XA 3UAAA 4N4YB 3V9EA 1BQRA 1W6LA 1BXVA 3CG8A 5F7BA 1FFTB 2YAPA 3H4FA 2DV6A 3PAVA 2HLEB 4E9VA 2PCYA 2OJ1A 2PPDA 2VMJA 1ETJA 2YAOA 3QQXA 2FNWA 4BWUA 4KNSA 5I6OA 1DZ0A 2PLTA 1L9SA 3CVCA 1ZIBA 2XWZA 1ILUA 2I7OA 4YSAA 1WA2X 1NPJA 2HXAA 5TK4A 3CZUB 2LLNA 3AG1B 3L45A 3RYMA 1ID2A 2BW4A 2DWSA 3OMNB 1AS7A 5LDUA 4YSSA 5E9NA 2DWTA 3S3BB 4QLWA 4P5RA 2FQDA 1SFHA 5AKRA 1SJMA 1NIBA 1WA0X 1KGYE 1ZIAA 4YSRA 1JZJA 3ZDWA 4DP9X 1I53A 1OV8A 2A3TA 1BXAA 2CCWA 1NINA 1L9QA 2IDSA 2XLLA 5B1JC 2CJ3A 2GIMA 3OMAB 4TXVB 1BQKA 4E9QA 2CUAA 2XYBA 4M3HA 1PY0A 3NSCA 2PPFA 1L9PA 2UXVA 4E9YA 2Y1AA 4G70B 2TSAA 2DYSB 4A2EA 4PAZA 4CSPA 3NT0A 3NJLA 4JHVA 4YSCA 4DPCX 1L9TA 2J56A 5FC9A 5I6NA 1MZZA 4DP4X 3AW5A 3BQVA 3WNJA 2R7EA 1AS6A 2VW4A 4NERA 2VW7A 1KDIA 5I6LA 1ET7A 1JXDA 3OQRA 1A8ZA 1JZFA 4GY4A 1KV7A 4JKNA 1W6WA 1NPNA 4K9JA 2XV3A 5D4IA 3ZX1A 2VN3A 1ZPUA 1PCSA 3EH4B 4X4KA 3S8GB 1PAZA 4YSEA 1SDDB 4UF7C 5I5MA 3NJKA 2OCCB 3NYKA 3WIAA 2XU9A 2XVBA 2QT6A 1PZCA 4Q8BA 3PAUA 2YAMA 1AOZA 1NWOA 3EHBB 1NIFA 5B7EA 5TK2A 1BQ5A 1T5KA 1XB6A 4A2HA 1OCCB 1PZAA 3G5WA 2VW6A 4KOBA 1AZBA 1CUOA 4FAAB 3QJTB 2XX1A 2FQEA 1N68A 2AVFA 3GXUB 3QJVB 5I6MA 2EIMB 3OD3A 3QJSB 6PAZA 1JOIA 2YXVA 4HCGA 2PPEA 4L0PB 4A2FA 1UATA 1RKRA 3SBRA 3NJHA 4BDVB 1AIZA 2YAHA 4E9SA 1E67A 4RH4A 3N55A 1A4AA 3TA4D 4KO9A 4KO6A 4DP6X 2JKWA 1KCBA 1GS8A 1XB8A 3UADA 3X2QB 5I6PA 3IN2A 3S3DB 2IDQA 3NSDA 3PLYA 3X1BA 1A4CA 3WKPA 4DP2X 2IWFA 2EIKB 5D4JA 2B08A 2YAQA 5B1AB 2PPAA 2XXGA 8PAZA 4WKXA 2VM3A 3WNIA 1NZRA 1XMEB 3FU7B 5PAZA 1IBZA 6PCYA 3AZUA 3FYEB 3GDCA 3ABKB 2MRYA 3TASA 1PNDA 3WG7B 1BYOA 5ANHA 3V9CA 3TU6A 3NJJA 2FQFA 3ABLB 3CDZB 2MTAA 1ET8A 2X88A 3QJRB 3FQ1A 3ASOB 1DYZA 1GSKA 3QJUB 2BWDA 4W1TA 2YAEA 2IH9A 1MZYA 2XXFA 3WKQA 3X1NA 7PCYA 4F7KA 4HZ1A 4HHGA 3ZBMA 3HB3B 4DPAX 1V10A 1AACA 1SF5A 3NP4A 1AG0A 2GB2A 1E65A 2EILB 3DIVA 1OCOB 2UXGA 2YARA 2WO2B 5A7EA 1TEGA 4F2FA 3PCYA 2HX7A 1GYCA 3UACA 4DP8X 4P5SA 1ZV2A 3NSFA 4HCIA 4BWTA 1SF3A 4W9ZA 5B1JA 4KOCA 4UAHA 2YQBA 2UXFA 1CYWA 1AANA 1J9SA 1A3ZA 1B3IA 2QPEB 1SHWA 1WA1X 1E30A 4E9XA 5B3SB 4G7SB 2HX8A 3NSYA 2UX7A 3T71A 3JT2A 4WTQA 3T6WA 4DP1X 4NAJA 2XUWA 1BYPA 2GHZA 1JXFA 2CALA 2QDWA 2EINB 1J5DA 3FU9A 4A2GA 4G72B 2HX9A 1KBWA 4KNUA 1MDAA 5AFAA 2ZXWB 1CURA 3FT0A 4AKQA 1NDTA 1AQ8A 1PLAA 1R1CA 4HALA 1JERA 1WS7A 1ET5A 2WO3B 5F7AA 4BWWA 2VM4A 3HEIB 1CC3A 2W8CA 3PXLA 4PCYA 4DP5X 2FT7A 4HHWA 4AKOA 3CVDA 1AS8A 3FSAA 2BO0A 1IBYA 3UABA 4E9WA 2P80A 3NJNA 2JXMA 3JTBA 1AR1B 4KO7A 3MBWB 2BP8B 4ZK8A 3SQRA 1YLBB 1V55B 3EH5B 2GBAA 4E9TA 5I28A 2BP0B 5PCYA 1NWPA 1TU2A 2B3IA 3AG3B 2BWIA 2QPDB 2NRDA 1HAUA 3S8FB 1QHQA 3FU8A 3PAZA 1GS6X 3T9WA 3IE9A 5B7FA 4GP5B 1N70A 1CYXA 1OOWA 3SBQA 3TBCA 2H47C 3EF4A 1SFDA 2IDUA 1RZQA 1AG6A 1RZPA 4HCFA 3NJMA 5B1BB 3DTUB 4YVUA 3NJIA 3X1GA 1ZDSA 3C75A 1OE1A 3FSWA 4YSPA 2H5UA 2PCFA 2E86A 1FWXA 4G7RB 4NB7A 4Q89A 1SDDA 3TBBA 2GI0A 1F56A 1EHKB 2YXWA 1NIEA 1JZHA 4GXFA 4YVNA 3H4HA 3FS9A 3AY2A 2ZONA 1JVOA 1RCYA 2BZCA 4DP0X 1KDJA 4HAKA 1V54B 1M56B 2CBPA 3QJQB 1IUZA 2IWEA 4KNTA 3IBOA 3ZIYA 2X87A 2OV0A 1L9OA 2BP0A 1J9RA 2GSMB 2UX6A 4YSOA 1FA4A 3UGEA 1AZRA 4DP7X 1HFUA 2QDVA 4G7QB 3WI9A 4BDVA 9PCYA 1IKOP 1A65A 3FPXA 1QNIA 3N2JA 3T6VA 2IWKA 2CAKA 2AFNA 2FTAA 3ABGA 2R7EB 1OCRB 1NIAA 3FSVA 3PPSA 2PP8A 3AG4B 5I6KA 2FT6A 2XX0A 1J9TA 1JVLA 2Y69B 1AAJA 4BK5C 4GP8B 3X1EA 1ASOA 1WAEA 4HIPA 1NIDA 2W88A 2PP9A 3FU7A 2XV0A 4YSQA 1XB3A 3U25A 1SNRA 3AG2B 3KW7A 2BZ7A 1E5ZA 2IAAC 2J57A 1PF3A 4EF3A 1M57B 1JZGA 3DKHA 3QPKA 2IH8A 3CDZA 4UANA 1QLEB 2N0MA 1M9WA 4BXSV 1TEFA 1JZIA 2RACA 2ZOOA 3BVDB 2PP7A 4AZUA 4FA7B 1OF0A 1W8EA 1KBVA 4A66A 1J9QA 1URIA 3MX0B 5AZUA 1J5CA 2I85A 1A4BA 2IDFA 4YSTA 1GR7A 4E9RA 2VSKB 2Q5BA 1L9RA 3NJFA 1JXGA 2J55A 5EHFA 1GY1A 3X1FA 1IC0A 5I5JA 2WSDA 1AZNA 1ADWA 4YL4A 4AI7A 3OM3B 1SHXA 4QKTA 1PLBA 2YAFA 2I7SA 5I26A 2BHFA 2DYRB 1GY2A 3FPYA 3S3CB 1OE2A 4F2EA 2FJSA 3FQYA 1PMYA 3ASNB 1JZEA 4GP4B 1X9UA 4DPBX 3KW8A 2FQGA 2FWLB 2HZHA 1E5YA 1OE3A 2PPCA 4AKPA 1NTDA 3ABMB 2EIJB 2TSBA
chains in the Genus database with same CATH superfamily
3MLXL 5D7JA 4N8PA 1S9XB 3EXJA 4BHUI 3HE7B 1MCIA 4Y4FA 2DY2A 5FYKU 5IKCB 1B4JH 1FNEA 2X53A 3KPRB 4MNQA 2P28B 3L3KB 2WLMA 1R3KB 3CZEA 3VXUE 2CM6A 2AABH 3JV6A 1WZ1H 4LPUA 4TUJA 5D1ZD 3RB5A 2VDNL 2DQJL 2O1AA 2OMWB 2FO1A 1E8XA 2WIIA 2FT8A 1OD9A 1R3JB 4YHYB 1PY4A 5FO9A 1U92A 4FTVD 3CFBA 4ANUA 2XVLA 2HT2D 5CO1A 1EO7A 4TNFA 3B5GA 2AC0A 3QORD 1YY8B 2WLKA 4A7QA 3ULUE 4XBPA 1BAFH 2UUDK 2VE6A 1B0RB 1KLFB 1C08A 3B9KC 1QWNA 4KO5A 3SJVB 4WUKH 1M1SA 1P6AB 2UVFA 4JVWA 1NBVH 3IEAA 3EYVB 4L3CA 3D2UD 3RB7A 5JTWA 1IBFA 1L0YA 1LO2L 1MCOL 1E28B 2F53A 1U6AL 1THCA 2B2XL 3F5WA 5DK2A 2GFBA 3RNQA 5KVFH 4L8CA 5DD6B 5I5IA 4RGOH 4WTZA 5AG8A 1ND0A 4Z7UB 4LSVL 4UI2A 5MENA 5HYSA 4IRJB 3I3BA 4J8QA 4FFYA 1FFTB 1T5XA 4HK0B 1ZLSH 2NW2A 4Y2OB 1U8HA 2IPUG 4XPBH 1NANH 3SCMC 2Z91B 3VW3H 2ZWYA 4LE8A 3N3EA 5EEVA 4I87A 2NY7H 4HWUA 4XWGL 4XO3A 3SN6N 2OMVB 4L4TD 1AXSB 2XWZA 5FKAA 2I7OA 2VDQL 2HXAA 1C5CL 4PJ5D 2FL5A 2FX7L 5DLLA 4UIMA 5E8NA 4OLVH 3BAJA 1ERNA 2Y2TA 2IVFC 1AS7A 2VCOA 4O2CB 4P0DA 1DO6A 4O58H 2XZAL 5HYQA 4URKA 2W95A 3IKCA 2IIJA 4NNXB 3L3OB 2CXGA 2VLJE 1LEGB 4XCEA 1I1CA 4P5MA 5KG9A 2CIIA 4JHWL 2QTEA 2YSTA 3QEQB 3EYSL 4K8RD 1FL3B 4N0YL 1ZMYA 3HZKB 3QH3B 1JGUH 1XHHA 5F3FA 4IDJL 2NZ1A 2A73B 2DLTA 4LGPB 3BMVA 4M5ZL 3T0ED 4HWNA 3SO5A 2YBRA 4U6XA 4JPIB 3OJDA 1FV1B 4X4ME 1N64L 5HI4C 5E6RB 4NO2B 3PV7A 5JHLA 5GGTH 1H6FA 4NKQB 4M61A 1ZGLA 3T2LA 3TBTA 1I8AA 4U1MB 1KJMA 1QOKA 4IGBD 2XKSA 3IFPA 3DBSA 3DVGB 4LP4A 1MJ7L 3Q5YA 1JXDA 2FJFA 2ATPB 2YD6A 4BJLA 5HHPA 5IMKB 2VDRB 4JY6A 5JHAA 4A39A 4LSUL 4XX1E 3FO1B 4X7SL 1IE5A 1AIFB 1XSKA 3TN0A 1UM6H 3MNVA 1NDGA 4QLRA 4X5QA 5ID1A 3GDBA 4E41D 4JRFA 3NZHL 5E7FA 1H3PH 4RMUA 3NYKA 5C0GB 4OT1L 3V4PB 3CQFA 2CKBL 1OIOA 3H7BA 3KPRE 3VXTA 5TE4H 1T5KA 2ESVD 5FHBL 1N8OE 1XEUA 4QKXB 4XP5H 2HKHH 4ADJA 4YOKA 3ISWA 5KEZA 1R47A 1KPUA 5DO2C 1NMBL 2IAND 3RWIA 1V7NL 5I0XA 3EBAA 3G5YB 5CLYA 1OP3K 5IIEA 4NZFA 3DRTB 1W0VB 4G7VH 4GIOA 4L37A 4BFIA 1Y6MR 1ZLWK 5BMFL 3G9AB 3N44F 3S3SA 2BIMA 1OF2B 5HHVH 1XGTA 4L8SB 4YC2B 2Y0SA 3NJHA 2YAHA 3Q13A 4RH4A 5A2LH 4X4XA 3SJVE 4PWHA 4YIQB 2R2HB 5AVTB 5F6HJ 4MX7A 3SO3C 5CLWA 3NFSH 2VJXA 3VFNB 3KPSA 4RMVA 3X2QB 2A1WH 4H8WH 4R90L 2BVQA 3KGSA 4G6KL 1FG9C 5E0QA 3B3IB 3TL5A 3W0WA 1CPUA 5A2IH 4MLSA 2GABA 3GUFA 1VERA 2QVFB 2WQUA 4FFZH 3AACA 5I6XC 4MQXD 1HINL 3KS0H 3FN0L 1PKOA 4EUPB 2C1OA 4Z7UE 3S5ZA 1IO4C 4JPWL 1XL4A 2DJ4A 4KTDL 1I8MA 3ARFD 5E6ZA 3AZUA 4W4NA 1CBVH 4O51B 2MCAA 5C2BH 3QCUL 5JIIA 5BUAA 3DPDA 3RNKA 3ABLB 3GFUA 1ZK5A 2WNGA 5D7JD 2FX9L 2AW2A 4JZNA 4DGIH 4PGZA 2FK9A 4Y4FD 2Z34A 1AY1L 2BWDA 1MRCL 4BH7B 3QIUD 4JQVA 2ZT9C 5C6WH 4R97B 1RVFL 2ILLA 4MNQD 3FTYA 4Y0GA 4H7VA 5D1ZB 3WKMH 5EEWA 2OULB 2Q8AH 1AGBB 1T66C 4L9LA 2P4AB 1IGTA 1KIRB 2WAHA 3O9WA 4OCWL 4ZO7A 4Y2DA 1QD0A 5DJ6B 3TO2A 4M8QB 1SOSA 3PNRB 3T2QA 1SF5A 2EICA 3SOTA 4LEOB 4OJFL 3FO0L 2DL9A 3QORB 2XRAH 5IB3A 5JO5A 5E03A 1IAIL 1V7ML 1WDAA 5DD3H 4NN5C 4LCIH 5HD8D 3X14A 3UACA 4R84A 2WBJC 12E8H 3MMEA 2WUBH 4TLTA 3FRPA 2E0PA 3JUZA 2WXMA 4ZMLA 2OR8A 3M8OH 3TIEB 1OHQA 3NTCL 4WHCA 4F8LA 1BQHA 5J9PA 3RRQA 4I3RL 3QYCA 1SBSL 3GXTA 1CZ8L 3C09B 4JO4L 4JR9H 5H37H 1KXHA 3NQIA 2F53D 1PG7W 5DRXA 1OCWH 3AU0A 1ID5I 3EO0B 3ARBB 3H0TB 1V27A 2PWFA 4M1GL 2V33A 4IJ3B 4KDWA 1PG7L 3H9ZA 2LOEA 4MDJA 1ZHKB 2GIYA 3OKEB 2HFGH 2H3KA 4BQ6A 1NGQH 5ACLA 5MEND 2EEFA 2X42A 4PRDA 2XUWA 1DSFH 4Z1PA 4U49A 3OKOB 4IKLA 2WC7A 4OZGA 4FDWA 4JL1A 4PTUB 4L4TB 4TVSa 4JO1H 1NDTA 2X4SA 4YR6A 4XHJC 4HIHA 5D93B 4PJ5B 3ARDC 2E8YA 1FVEA 2C7UA 1V3KA 1JZ8A 3NFNA 5BRPA 1NCNA 5LQBH 3H3KA 3BO8B 2X10A 3ZL2A 4XNMA 1ZVHA 4FNUA 3WENA 2DLFH 3FQWB 2EEAA 2KBGA 1IEHA 2ZUXA 5E1QA 2GCYA 2ZXAA 3Q6GL 2K70A 4U7MA 4I18C 2C26A 5F88A 1HQRB 4NHCL 3SD5A 5L4FA 2ADFH 3OLEA 3LD8B 3HS8A 4XX5A 5DWUH 5C7XL 1XD0A 2XFXB 5CILL 3FB8A 4JDTH 3DRQB 3CHQA 4ZFZA 2NRDA 3JTTB 1Y6NR 1H0DB 4FG2A 4KXCA 3FU8A 4XXWC 2F9BT 3CZLA 3LMJL 2BIIA 5EIQA 4B53A 4BK8A 3CUPB 3BFWA 3GMRA 2JK5B 3L1OL 3FT3B 4JFWA 3ZDYB 4F37F 4AGQA 1HT6A 5MEQB 4IGBB 3EJSA 1J5OH 2VXQL 1RZ8A 1FL6B 4JKLA 3ZZQA 1I1FB 2KLRA 3UJTH 3SKNA 3SQBB 3ZDZF 4LDCA 3MV9E 2VMEA 1MKFA 2L4OA 4JLRA 1ZDSA 2FSEA 2ED6A 4N2FA 4RIRB 4Y8DC 4BQ9A 4YSPA 4C4KT 4Z78A 1N5AB 2H8PB 4JN2A 3A6OA 1R9FA 4E41B 4XP4H 1VESA 2E7HA 3TN0D 1SM3H 2F54E 2XC8A 4X6CA 4ABQA 1KIQA 2V7NA 4L3FA 4PREB 5BZXA 2FJGB 2P8LA 3LB6C 2F15A 3QJFB 1K4CB 2ESVB 2VL5A 1YECH 1BBDH 2C3WA 1KC5H 3BLBA 4UQIM 4K5PA 3VG9C 2WKLA 2GVYA 4XPFL 5ALCL 2IANB 3G5ZB 4I88A 1C12A 1AXTH 2P5WA 4FTVE 4P57A 1JV2A 4U1SB 5M94B 1SJHA 3BP6B 1EGJA 1ZSDA 4YN3A 3C5SB 4IKNA 4A6YB 1ZS8A 4XVUD 3RX8A 3I6SA 4ZQKB 5DRWA 2QDVA 5KAQG 3MUUA 5ILTH 1B4LA 1FYTB 3LRSB 4RZKA 3T4AB 5G4MA 5GIRA 3RI5K 5L88H 5F71A 1NFDB 1HVXA 2IWKA 3DUHA 2IOMA 4IBUA 3QS3A 2ZOUA 4R0LA 2BHZA 3BWAB 1KY7A 2CZNA 4OZ4A 4LSPH 2BSEA 5FDYA 2XNAB 5G2NA 5K5YA 3QNXB 4IMLA 4XPHH 3KPSD 2FRGP 4NENB 1AMYA 4PG9A 5A16B 4D0BA 3W0WD 3M1CA 2NNFA 1YYML 1YDPB 2WQ8A 2YUXA 1I3RA 3FO9A 2K6ZA 4HUKB 4LF3A 4B5ZA 4F7TB 3ARFB 1ESOA 1SY6A 4XMKL 3RDTA 2BZ7A 1TZHB 2J57A 4LAQH 2B7DT 2O61A 3DK0A 3ARGA 3ULUL 1LE5A 4Q9QH 5D7JB 3DX9A 3EYUH 2IH1B 2IJ0C 4UQ9A 4OJCA 1A6UL 3P3TA 4UDTA 4Y4FB 4L4TE 1E4XL 1FNEB 3QIUB 4Q6YA 4YBLB 4MNQB 5IREA 2XQYA 4PJ5E 4AZUA 4H0HB 4MVBD 3JV6B 4TUJB 4WUUA 3KYKH 3U1SL 1F6AA 1WFOA 2D3JA 2UVEA 5ICZA 1XGQA 2WIIB 4NWUH 4LKCA 3O8XA 3BCFA 1F6LL 1DJSA 3FMGH 3O9WD 2XWJA 5FO9B 4LU5H 1P4IH 1BAGA 1YQVL 4PWIA 1MEXH 1DQJA 1YNTF 5EHFA 3U7AA 1Z3GH 5DGQA 2X44D 4ZMAT 2WSDA 3HC0A 1BIHA 2GPZA 4HKJA 4KQ4L 4XCCH 4XBPB 5E95B 3ZL4L 5IR1A 3K6SB 4KZEL 3TVMA 2JKTM 1OAQH 2DW5A 4XNXH 4X99A 4FI8A 3ZL1A 3RJOA 3QVAA 4L3CB 3T0EE 2EUVA 1DDTA 2CDEA 4OB5H 2F53B 3BIBX 3F5WB 4F15C 1KEGL 1O6VA 3SYOA 3FU0A 3L5HA 4FNSA 1Q0EA 1FJ1A 2GFBB 1PJWA 4S11A 3L1EA 4DQOL 2FR4B 4L8CB 4LPXA 3WHE1 1TQBB 1TZIA 1WFJA 3ZDYE 4M7KH 5IVXA 1B0GA 1RUKH 2R4RH 4WJ5B 3SKUD 2ZUUA 3OHMB 5LLIC 1LO5A 3HE6A 2OYKA 5H8DA 3IFNL 1BM7A 1T5XB 4NQVA 7PAZA 3KR3L 2BP3A 3D4CA 2NUPA 3CU7A 2NW2B 5F2FA 1U8HB 3GMOB 2HRPH 4IK7A 5IB4A 5F1NB 1EA9C 2NTFA 3DO4A 5D2LA 4NN7C 4E41E 1RJLA 1RFDH 2F19L 2XWTA 2XZZA 5FKAB 4OLYL 4EI6A 1TMQA 4OJEH 3IJSA 4WI2A 3VXNA 2FL5B 3JV4A 4L1LA 3RIAF 4UIMB 5E8NB 2Q6WA 1ECZA 4RA3A 3SQOH 2L3BA 4FFWC 2EH8H 2H26A 4BUGA 1P53A 1KCVH 1UWEL 2WINA 4HMDA 2ESVE 4JHUA 5EZIH 3DLQR 4XCEB 2JCWA 1FH2A 4P5MB 3T3MB 5KG9B 2CIIB 2ICCA 2HA1A 1LO4L 2IANE 3L1GA 4JO2L 1ZCRA 4UM8A 2WVTA 3QJZA 3RL2B 3M46A 3WDHA 3CVBA 3UBXI 2OYPA 1FRGH 1R3HB 1OLLA 1TJGL 2YBRB 1NFDE 5EBWA 1X6LA 2OW6A 4PTTA 3X11A 2APBA 2ZOTA 3OJDB 4N85A 1ZHLA 3V9EA 4DK3A 4RMTA 5LGJB 2WWKT 3VFGH 5AD0A 1T80A 2X1PA 3E3QE 2DV6A 1FFOA 4M61B 2PWEA 1ZGLB 3TBTB 4D0CA 1BPVA 1KJMB 1NEPA 1FAIL 1MCRA 3IFPB 5F3BA 3RIFF 3FCGA 4M02A 2PLTA 4KC3B 2FATL 2Y7OA 3CZFA 5J13B 4F20A 2FJFB 3O81A 1IGJA 4O4YL 3IDGA 5HHPB 3SKJL 4JY6B 3NG5A 4QY8A 3VFUA 5DXWA 3TN0B 5ID1B 3MNVB 4MA8H 1K72A 2C3GA 1M7XA 2AQ3A 1TYEB 5IB2A 5AW0B 3ZK0A 5AKRA 5E7BA 4GXUM 3UIZA 1SN0A 4IK6A 2D0HA 4WNQA 4XB8A 1ETZA 5I18H 4OQTA 2EDDA 4MNQE 5IGXH 4ZXBC 4L29B 3U30B 2I9TA 1E7VA 2IDSA 3F01A 4HHAB 4F33A 4E9QA 5EDXA 1KPUB 3NSCA 1FFNA 1XIWB 4GEIA 3RWIB 3WCYA 2P5WD 5L0QB 5IB1B 1CVRA 4X6FB 4PY7B 2AQSA 3LZNA 3HIZA 4A2EA 5J8OA 1USQA 4BFIB 1PDKA 3HRZC 4L37B 2X05A 1BG9A 4L1DA 4ZUSA 2ATAA 1EJFA 1XGTB 1D6EA 1X5XA 1UEMA 3VD9A 1LYQA 4MAUL 2EXSA 4X4XB 4AYID 1BW8A 4MX7B 1GGBH 5DHYA 1T1WB 1L7IH 3HS0C 5EOQH 4K94C 5L4JA 5I30L 2BSED 2X4OA 1VCBC 1IT9H 4GRWH 4E5XG 1DQQA 2OMTA 2Y06H 2BVQB 2F53E 3OQRA 2TRHA 4K9EC 1P4BH 3UMNA 4JKNA 1DFBL 4HLZH 3SZKC 4RRPA 1YEFH 5C6PB 1RZ7H 5KSAC 1DUZA 4KMTH 1QFWL 3D87B 2JQMA 2D4FA 1PCSA 1KEMH 1MCHA 5D6DA 4U1IA 4ZSOA 4YSEA 3AQZA 4Q6IC 3NJKA 1LWJA 5I5MA 5E94B 2XVBA 1DVTA 4ZMYA 1GYAA 1I8MB 4I1NB 1PZSA 3QS2A 5MENE 4AYFB 4BFEA 5B3JE 3RDTD 5HJ3A 2CD0A 5HJDA 4U7KA 3S8WA 4ZW3A 3D85A 3ARGD 3LEYL 4UAOB 3RNKB 5F70A 2C3XA 3LOWA 4JZNB 3QWNA 4LNRA 4K07A 1AE6H 4XMPH 1YEEL 2IAMA 3B9EA 3HR5A 2AVFA 5I0VA 3ARRA 1C7SA 4YHZH 4L9LB 4PS4H 4ODHH 1IGTB 1T83A 4WUUD 3O9WB 2QGDA 3J27A 3UJIH 5FO2A 3O8XD 4MQ7A 4JK0D 3SODB 4A1RA 3BE1L 4IQHA 3T3ME 1N9PA 2JJWA 2W38A 3NEXA 4YHOH 4N26A 3UADA 2Y5TA 3VFOA 3GLZA 5DJZA 1QBBA 2F5AL 2IDQA 3MMEB 3QXWA 3FRPB 3TVMD 4Z3JA 1CFVH 1GYVA 2CJUL 2ARJQ 2IWFA 3ARTA 3G6AB 3HBQA 3O3AA 3DGGA 5J9PB 4HJGA 1QR1A 4WFGE 1YY9C 4FXGB 1PY9A 2MNJB 3P4NB 3C5ZA 3LCYA 5MP6H 5DMIL 5SWQA 4PY8J 5ESAB 3ABKB 3D06A 5M95B 2MTPA 3ZKXB 4IMKC 4KDTA 4RBPH 3V4PL 3V9CA 3JWNC 5B1CA 4DN4L 5DFAA 4MDJB 3W56A 1OY3B 1I8LA 3QDHA 3B2VL 1I9RH 3FNKA 2JB5H 3L3HB 5F89B 3HE6D 4M1DL 4PRDB 4CN1A 3IGKA 1KZYA 2IH9A 3WKNA 4XXDA 2XXFA 4ELMB 3DPBA 4OZGB 5IMLB 5HYJA 3MCLL 5GQBA 1G9HA 2X4SB 3L2MA 4HIHB 1VRSA 4Z76B 1T4KB 1EAOA 1FVEB 1T6VN 3H1ZA 2DLEA 4TL4A 4HULB 2YRPA 3NFNB 1JNHA 1TEGA 1XT5A 2ENYA 5DZNA 2P7TA 2NNXA 2CQVA 4U0QB 2OR9L 2F6AA 2FO8A 4HCIA 4QPEA 4HD5A 4WU7A 5IW1A 4GQ9H 3SDDC 3LPGA 5F88B 3GSWA 4KNQA 1F4YL 2DQ6A 5EC2A 5BVPL 1AYOA 1UD6A 2CLRB 5BOZG 1NEZA 3NA9L 1U2YA 3ESMA 5CCJA 2J8UA 5DJXA 2N59A 5KS9A 3WEMA 3WY4A 1OGAB 4LPCA 2Q2LA 1BMWA 1F42A 3UEZA 4EQ3A 2AXHA 4JE0A 1XR8A 2HMID 1NOAA 3KPSE 3GMRB 3BRFA 1AGFA 4ZUTA 3W0WE 1VKXB 3QUZC 4JCMA 1FP5A 1M05A 2N1KA 3O6LH 1CXKA 1MQKH 3OKLA 5JORB 1QW8A 3SKNB 4AKQA 3LRHA 2H0PA 3WD5H 5DI8B 2VT0A 4OQ1A 2FSEB 4QRSA 1U3ZA 3IRZA 5IMOA 1KXQA 5KYWA 2Y9RT 4BWWA 4Z78B 2ZKWA 4JN2B 1MPAH 4PS3A 2ZX6A 4HHWA 3ZT6A 1A9BA 2FJHA 1KIQB 1MVUA 5L6YH 2V7NB 2BVTA 5SX5K 4AVIA 1S9VB 2P8LB 4H4NA 3PL6B 5IOPA 1JIBA 4OCYH 1OAZL 2OK0H 1G0DA 3CBKB 4FE9A 4HUXA 5KZCD 1MHPL 1CQYA 4E9TA 1MF2H 1A3RL 3LRMA 2O93L 1PPIA 5I28A 2AJXL 1C16A 2YPVL 1C12B 3CU1A 3L4UA 4P57B 4PJIB 4DO6A 1GYUA 4YE4L 3O6KL 1SJHB 4UTBA 1ZSDB 2VKWA 1TZGH 1ZS8B 1A7OH 3VI4B 2UUDH 4BFJA 2VDMB 2WN3A 4GQQA 5DRWB 3TT3H 4NHUA 3T9WA 3SDYH 4GP5B 4U1GB 1NCBL 1QPPA 3QWRA 6CGTA 4NZ8A 4YFDB 4OZ4B 3BZFB 1SOKA 1WYJA 4HCFA 1ZWIA 3GLAA 5ISZA 2Z31A 2VN5A 4JM2A 4N2HA 3LPPA 2ID5A 3WO4B 3ESVF 4D0BB 1YG9A 1YEJL 1IC7L 3BWUC 3TBYA 4JPSA 3FHQA 5BVJA 4YDJB 4NJAL 1I3RB 1SVCP 3FO9B 1IV8A 3MUGA 4MMZA 1BGXL 4LF3B 5HVFB 3H4HA 4PJGF 3MLRL 4R4NC 1KFGA 1I7ZA 3RDTB 1T7XA 1U8NA 4HKXB 4MCZB 1EO5A 2O61B 3Q3GB 1EHLH 3MZGB 3JWOC 3R06B 3D18A 4ELME 3D85D 3P4OA 4OZGE 5I1GH 4UDTB 1L9OA 4GKLA 3ZHFA 2ADIB 3O4OC 2IADA 5KYNA 4YLBA 1RZIA 3JT0A 2IAMD 2CO4A 2NW3B 3AITA 1NFIB 4WUUB 3WTVA 5ICZB 3MOAL 1EERB 2F8VA 4FZEL 4UT7L 4LKCB 1KTKE 3O8XB 5KSUA 3STBA 2VAAA 2WNXA 2XWJB 4G6MH 3TX4A 3FPXA 1IFHH 1BM3L 4ODVL 5LBSH 3GZKA 4NJ9H 1DQJB 4HISA 4LRNH 4HKJB 3M7OA 5I1HL 4JL2A 1LK2A 1W72A 1GZHC 2PP8A 3AG4B 4PJ8C 1JPEA 4XVTH 4ZFGH 5I0DA 3D05A 4RFOH 4Y1TA 4X99B 4ETQA 1NCAH 3UC2A 1T7ZA 4HUCA 1MQ8A 4W9KC 2CDEB 4QGYA 1HIML 1XZWA 3O45A 5E6IC 2WVVA 1FJ1B 1BVZA 1N6UA 4ZUVA 3RL1A 4ZMTA 5DEJA 2IAAC 4EF3A 1BZ9B 4QCIA 1JZGA 1TZIB 5H35A 1FBIL 2IGLA 1B0GB 2BHYA 2ZWSA 4H0LC 2ORBH 3AAZB 1VACA 3LQMA 2N0MA 1LO5B 3HE6B 3U1QA 3LN5A 1DQIA 2GK2A 3O3DA 1R0AL 4G9DA 4NQVB 1KTJA 4UBDD 5I0YA 2NUPB 1W8EA 3DHMA 1I7TA 1TQTA 5IB4B 3VRLF 4AW7A 2NTFB 5T1MA 5D2LB 5HYJD 1RJLB 2XWTB 4KI5C 4DETA 3IJSB 4P59H 3JV4B 2DQUH 4X6CE 2Q6WB 3NEOA 3EJUA 2IMMA 1HI6B 4ZMQA 3TPKA 2H26B 4ODSL 3II2A 1D6VH 5CZXD 3P3RA 4ZX4A 1F2QA 5I19H 2PW2A 1GY2A 5GJSL 4XWOC 2P5WE 1XXFC 4PJIE 5FXCH 3MRIA 1BQLH 4Q97A 3QYNA 4UM8B 4QHUB 3P02A 4E36A 1P4LA 2BSDA 4OTXH 2CWRA 3L54A 1LDPL 2W9DH 1G7LB 1ZGLM 2NY0C 3WNNA 2QADD 1N12A 1VLXA 2J8HA 4GYBA 4PTTB 4R2GB 3X11B 4DH2A 4HWBA 5DZLA 3C8KA 2EDHA 4GI8A 4ZD3L 3FUHA 4GT7A 5AD0B 2EQDA 1G7IA 2G5RA 1FFOB 3K2UL 4R96B 1ROWA 3LS5H 4D0CB 3NP3A 2E47A 3T5WA 3QDJA 4IBVA 5EMYA 4FZ8L 1PNCA 5LGKA 2F7IA 3VSQA 4HD9A 1IGJB 3GJEA 1HZLA 2AZAA 1ACZA 2Z93A 3EDFA 4FL4B 3VFUB 3KZ8A 4EN2A 1FVDA 1LHZA 5GGQH 3UZEC 5B3NA 1CD0A 3ZGHA 2J5WA 5C7ZA 5IB2B 1HSAB 3FSZA 4HLJA 4UTAA 1HJBC 1UM4H 4UIKL 4WNQB 1ETZB 1KMGA 3OLIA 5GRUL 1JNLL 4FI6A 3W3BA 2IGFL 4M00A 5KZCB 1HXYA 4OIIL 2N0KA 4WUUE 5IFHL 5AKTA 3RWCA 3GSOA 2EDFA 2VIRA 2XV2A 4NLAA 4M6AA 4MMXC 3KVPA 1KIUA 3K81A 3M45A 4RDQG 1SN2A 5LNEA 3DUSB 3RFRA 4P23C 1A6WH 1Y7VA 4XCFL 3LKSA 4R7NA 1JGIA 3S2CA 1TPXB 4JFZH 4PRAA 5DUML 3FAXA 4XPTH 1D6EB 1I1YA 5IUCA 3QHZL 4D0DA 1YJDL 4FFYL 4BA0A 3QWRD 3GSVB 2FNWA 4LCYB 5CAYB 1TJIL 3T0EC 5EUOF 3N42B 2KDGA 5C08A 1D7FA 4BSVA 4N2CA 2F5BH 1DQQB 5ISZD 2Z31D 1QZ1A 2OL3H 1MRFL 5TK4A 2Q8BL 3SPHA 1DUZB 1T7VA 3DROA 2P44B 3UJJL 1E8WA 1BZ7B 1SHMA 3ZMEA 5FLVA 4U1IB 4ZSOB 3S3BB 1SXSA 4GBXA 2FQDA 1SFHA 4N2EA 4NOFA 5IVXE 2I60H 4EZLA 5IWLC 1N6QL 5HJ3B 1NINA 2EDRA 3EDJA 4G8GD 5C8JA 2CJ3A 3D85B 2NYKA 5I82A 2K3TA 2EH7H 1DEDA 2GIMA 2JXMB 4AEHH 4ZZKA 3C87A 3MROB 2B39A 3S34H 4WI9A 4FP8H 5D2LE 1QFUH 3QDAA 2PPFA 4XX1G 2IAMB 3HR5B 2XQBH 3VVWA 3D34A 4HP5A 3C6LC 4PAZA 3I2CH 1ETB1 3CZNA 4KITB 3QG7H 4YHKH 2ODHA 1QTSA 3RWEB 2YEQA 2R0WL 1Z5YD 5IBLD 4MQ7B 2FWSA 3OR6A 3IVKA 5JHLL 4JPKH 3LXCA 2DJUA 1MHHA 4P2AA 3SPIA 1N5YH 2Y5TB 5H94B 3VFOB 2YGVA 5DJZB 1J05A 3VRJB 3THMH 5JUEH 1U91B 4FJYA 1SUJA 2AITA 4OUUA 3ZYJA 4K9JA 2WQVA 1Z6JT 2FYYA 3DGGB 1RJZA 3IK2A 3PS6A 1QR1B 2D9CA 1VFMA 5F6HI 5KW9L 2BZDA 6TAAA 2X9YA 2Z3FA 3CXHJ 3WS6C 3WV0A 5I1AA 1OHZA 2XY1A 2QT6A 4KJYB 4KV5F 5SWQB 3TESA 3CLEL 5DUPH 1LEKA 4X5XA 3ZHDA 3LZFL 5TE7L 1PX3A 1XB6A 1ZT4A 5LJYH 5I1KL 4OR1A 1A7RH 1FF5A 3UPCA 4UZGA 4HIJB 2Y6TE 3KPNA 2QKSA 2KLSA 1RP8A 1AQHA 3A5VA 3BGFB 1HK6A 1YC8A 4TUKH 5TQ2H 3QULB 4ZTEA 1NGZB 5HYJB 3VH8A 1FORL 2WQWA 4MZRA 2ZOLA 4XBGB 3II3A 4NXKA 5J89A 3M6DA 1GHFL 2ALAA 4A55A 3UXFA 5I0ZA 2FECI 1I7UA 2P46B 3QQNA 3UBXB 1M3IA 1JNHB 1XB8A 1EBPA 1JJUA 5I15H 4WTXA 2WIMA 4DEPB 5CGMA 3DX6A 5HGBA 3FDWA 5E4EC 5L2JB 1T22A 3ULAB 2CCLA 2EIKB 3D69A 5D4JA 1UZGA 4WU7B 2KZ1B 1X9QA 5IW1B 4X8GA 1LK3L 2RJMA 3GSWB 3PHAA 1NZRA 5CN2A 2CLZA 2P48B 5EC2B 2FB4L 3D50A 4YNYA 5HD8C 5KVDH 1Q0YH 2J8UB 2ZTBA 5DJXB 1U30A 3H42H 2DIEA 2QADB 2XJKA 3WG7B 4YS4A 1EXHA 4C4BA 4XT1C 2BS8A 3V6FA 4CGTA 2X1OA 3KH4A 1UZ6F 1LM8V 1FE8H 1WPCA 2WO4A 4QHLA 4FHKA 1XR8B 4RGNC 3QJUB 1U8IA 2ALWA 1USZA 5I9QC 1AGFB 4ZUTB 4DWHA 1P4UA 2OZ4H 1M05B 1JGEB 3OKLB 3QDJD 5GS1A 3EUDA 1R46A 1TVHA 1MFEH 2BDNH 1CGTA 4ZSOE 4QRSB 3ORJA 5IMOB 2OQJA 5KYWB 1I9EA 4RGMB 1FZMA 4RETB 1CL7L 3VYNA 2UXGA 1RZJH 4QGTA 4KRNA 3D51A 4GSXA 4MDIA 4I0PB 2BNUA 1A9BB 1K8IA 2FJHB 1MVUB 2RCSH 2QQQA 2GJZA 1E4KC 5HDLA 2Z1KA 5CSBA 5B1JA 5IOPB 3TZVC 2UXFA 1AANA 3GK8L 1E9OA 1ZV5A 1H3VA 1B3IA 3DYPA 3VD7A 2DDQL 1HH9A 4XVSH 1MFBL 1ZXQA 1C16B 1IILE 4E9XA 1IGYA 1QTPA 3MA9H 1T6WA 4PGCA 1J1PH 1UXWB 2EXWD 4NAQA 5B38A 5I1JL 1HXKA 1I4FB 3HBGA 3A67H 3M07A 4MS8D 4NHUB 5LXVA 3K0WA 4Y9GA 2CALA 1N10A 2WPGA 3FCBA 3WSQH 4GO8A 4J6RH 5HI5D 3VMOA 2Z6FA 2AV1B 4AQAA 5EOCL 3EFFA 1B6DA 3VWKA 1CF1A 1W0YT 1ZWIB 5C1MB 1OGTA 2Z31B 5ISZB 1GPOH 3K1DA 1ZK9A 3H9HB 1WWBX 4NNPL 4ZRGA 5C08D 4HIIB 2IQAA 3F7LA 3U9WA 5BW7C 1Z2KA 2XN1A 4YGAB 4YGVA 3HAEA 2H1PL 4HS3A 3TBYB 2VL4A 3IJYB 5KBPA 3HEIB 2VM9A 5DHXB 5BVJB 25C8H 2LW3A 3CLFL 4NDMA 5T5NG 4RVBA 3U82B 3MUGB 1HKLL 1RUML 4MMZB 2ZSVA 3RWFA 2L7QA 4GBXD 4OGYH 4PWFA 5AB2A 4D9LL 1I7ZB 1P7KA 5AYTA 1U8NB 1E9QA 3NJNA 3OKNA 4G8GB 3NCJL 4MS6A 3NK3A 3CFNA 2OMYA 2W92A 1AR1B 4EUPG 4EVNA 3P4OB 1NCUA 1HKFA 3NCWA 4R26H 1CE1H 5HYJE 2NLJA 1Z5LA 2IADB 3T2OA 3BVNA 5IW6B 1CO1A 1EBAA 4Z7AA 3DJ9A 1IFGA 2RMNA 3EJRA 4TNWF 2GAZB 2B4CH 5LGHL 4D9RD 4G3YH 4X4YA 2CA4A 2DQIL 4L2YA 1P84J 3G04A 5CEYA 5HDRA 4P2RA 3IBEA 2MIZA 4OJYA 4XMLH 4ISVB 3PAYA 4Z7QF 1I8IA 3NJIA 1G7HA 1W72B 4P8QA 5KVEH 3K4ZA 5ICXA 1A1NA 4KPHH 5JNYB 1WC7A 1SJEA 4U0RC 4ETQB 5HHOA 3QA3B 2J8UE 3BKYL 4U3HA 5KS9E 2E76C 5AZ2H 2DB8A 2YLKA 2AEPH 3S88H 3TYGH 3O45B 5GGUB 2WVVB 4YVNA 4PN6A 4ZUVB 1YYLL 4IBLT 4HEMA 3SGJA 4BYHA 1EQWA 3V0FA 5C92A 2NY3D 5EC1A 1I8UA 2N7BA 3VXQA 3DXAB 4FNLL 3MRCA 2ED8A 4HKZB 1HE7A 2BP0A 2DQMA 3LN5B 3MBEA 3ZXAC 5GZNC 2R2BB 2WD0A 2A38A 1ZT7B 1KXQE 1OP5K 4PYGA 1I7TB 3QEGH 1YNTA 2E9JA 1EGJL 1ES0A 3MA7A 4WI7A 1EANA 5T1MB 3ZKSD 4OM1L 3QPXL 3S7GA 1S46A 2W60B 4X7TB 4GXVL 1BA9A 2DQHL 3IJEA 5IG7B 2HJLA 3BI9X 4YHLH 1XGYL 2XPGB 4CNIB 4F9PC 3O2DH 1OSPL 2ICES 1AKJA 5GISL 5DHVH 2KHAA 1DJIA 1RZKH 4JQVC 5KSVA 1XGPA 2F1EA 4X2UA 1RUQH 3E80A 4R5TA 3SE3C 1B6UA 4BE6A 3HRPA 2CK2A 3LNIA 5DSCB 1MNUL 2ADJA 4Y2DC 5HY9A 3JVGC 2PW2B 3I6KA 4JJHA 4WV1B 4FGMA 3MRIB 4G8FB 2BOCA 3NRQA 3TT1H 4EI5A 2XV0A 3GMNA 4QR7A 4S1DD 3L3DA 1CG9A 1SNRA 4DVRL 4IS6B 3ZTCC 3P0GB 1JS4A 3O0RH 1SY6L 1LWHA 3QPKA 4R7DB 2C7FA 5BRZA 1QNZH 3LYRA 3FU3A 5ID0A 4PM1A 2ICEA 5LXGH 3UCRA 4MCYA 4NAMA 5EEYA 1G7IB 4M43H 5ISZE 1XO8A 2YMXH 5ANMA 2VO5A 5EF0A 1KYUA 2AS5M 4FA7B 1Q1JL 2DIAA 3G3LA 1OF0A 4QRRD 3Q7JA 4XBEL 2GITA 3T8XA 4K71B 2X6BA 2I85A 3GJEB 2V9RA 4HKBA 1U95B 1I3GL 3KHQA 1IM3A 2ZCHH 3MNMA 2YGQA 1F0LA 4FG6D 4G8GE 2AI0L 4CDGC 1CCZA 4ANWA 1QRNA 3QO1A 2NY1D 2OXHA 4U1HA 2NY4C 5DMGD 2JLPA 3V0DA 1JPTL 4ZAKC 2DYRB 3FPYA 3ETTA 4WVRA 4KY1L 1W8OA 3IMRA 4QTHA 5DTFB 3IGFA 1HXYB 5D7LD 5HDBE 4TULH 3X3GL 1H8OA 4DPBX 4GI9A 3GSOB 3RWCB 3QZNA 3D1MC 1KIUB 3OKYA 4EDXB 5I8OH 4JZJC 2B1HL 1DHKA 4GSDH 3W1ZA 5E2TL 4XOBA 5EZLA 1DJWA 4R7NB 1TLKA 1D7DA 5E51A 2VNCA 3SE9L 1BFTA 5JOPD 1F90L 2XCMC 2O5XH 4YQXL 2VJ0A 2D03H 1I1YB 6FABL 3NIFF 4D0DB 2W5PA 5CEZH 4RRPM 2B0SH 5ETUA 1TENA 5AOIA 1TSRA 1EHXA 2R8SH 3L9YA 3MX0A 1BZQK 5C08B 5IQ7L 1DLFL 2DPKA 2HRGA 4BSVB 5L8KB 3ME0A 5GS0L 1C1EH 2I25N 3RWHB 4UT9H 3DROB 1MXGA 2PR9A 2PTTA 4WHDA 1BX2A 5EO0B 5EIIA 1INQB 3APDA 5FHAH 3VB9A 4GAYA 1PD1A 2GSIA 2ZKXA 4F9LA 5T3ZD 1CFQA 1N0XL 2OM5A 4F3FA 3RHWF 2HRHA 3S4SA 3X3FH 1S7TA 3TF4A 4GW1A 1OAUL 2VR5A 2CH8A 2IDTA 2WMPB 3MV01 4KQ3H 4W81A 5EU7C 2EZ0D 3CGTA 3D4ZA 4B95C 4DVBA 1KTDA 3CPLA 1QLRA 1MH5A 2XXCB 3EJQA 3N44B 3MGOA 5JMOC 3WUWA 2A74B 4AWJC 2R39A 1AZCA 2E9IA 2D3VA 2Q9OA 3DVIA 3PGFL 4L05A 5E8DL 5AEAA 4MBRA 4TS6A 2QQLL 3O6ML 1FZOA 1BXVA 1LTXA 1U8MA 2ITFA 2GY7B 3DIFB 4BELD 1CD9B 2YAPA 3PAVA 5F7BA 3V0GA 2HLEB 2NY6D 4DGYL 3GXFA 3IVKB 4HC1H 5D72H 7CGTA 1ETJA 1WFTA 4K3JL 3DBXA 2L7JA 3FOLB 4JDZA 4IIQC 4WFED 4Z77A 1RZFL 4P2RD 1MHHB 2PYFA 2R9HC 5IVZA 2FH6A 2Y6SD 4Z7WF 4XOEA 1J05B 1DL7L 3AXLB 1WA2X 1UD2A 1KV3A 4OUUB 2WZPA 1JGLH 1ID2A 3OKMA 1G0YR 2FYYB 3DI2B 5HHOD 3MLZL 3T8VA 2WYHA 4APQC 2OL3A 3Q8EA 1RJZB 3RZWA 1JV5A 5BV7B 5E24E 5C0NC 4R0LC 1FNFA 1FVCA 1PQZB 1W16A 1NIBA 5I1AB 4YSRA 5T1DH 4JRWA 4X5XB 2V2WB 4OQTL 3VGEA 2AEWA 3BVWA 2XLLA 3BJLA 4ZOEA 5CBEB 1ZSHA 3OZ9L 3HI6L 1ZT4B 4S2SA 1BECA 3QDJE 2YR3A 4LQFH 4PLJD 4TTDD 1ETA1 2XYBA 1FG2A 1H5BC 3KPNB 3MBED 3BC9A 2BVOA 4WTZG 3BQUB 3I50L 4CSPA 2DD8H 1CFNA 1B0IA 3NJLA 2WZ5A 3RVXD 1HYSD 3BD4A 3DSNA 2ZOLB 5HYSG 2KPNA 4XO9A 3ARGC 2J56A 1EDYA 1YEDA 5SX5H 4M5YL 1OW0A 2V3FA 2QSTA 3CFCH 1GOFA 1I7UB 3JZ7A 2VDKL 1AKJD 1BCIA 1ET7A 5FYJU 1A6PA 5EORH 4TUUA 1NCWH 3WFBL 4S0HA 4MYWB 1A8ZA 1WE5A 1H3WM 3MV8B 4GRMA 5I8KL 1H3UA 1NPNA 5HGBB 2EUXA 2A9DA 3R4RA 3ZRSA 5F7HA 2ZNWA 1T22B 3CN3A 5D1XA 3D69B 2D31B 3ARVA 1IGCL 2BFVH 2HSIA 1PAZA 3BZ4B 4FX5A 1QSFA 4CA4A 4EI5D 2XU9A 4I48A 4YNYB 1P2CA 2HUEA 3INUL 2G60H 4LGSB 2Y7NA 1KELL 1VGEH 2DQCH 3TVMC 2XBDA 4HJEA 4WO4A 3PWUB 3RVTC 1DBAH 3V6FB 4UWQB 2DKSA 5BRZD 2QZ5A 4GKOA 4I1RA 4KOBA 4DUXA 4QHLB 4PGBA 4DAGH 4HPOL 4OIFA 1U8IB 5C08E 2AQPA 1FNAA 4WIQA 3U6RA 4QRRB 3Q05A 3I9GH 6PAZA 3NH7L 4PY8I 4OCLC 5M7QA 4TQEH 4PJHF 3EDKA 5GS1B 5AVVB 2DQGH 3QZOA 1WZAA 1DSYA 3G5XA 3E38A 1O7DE 3L4TA 4H25A 2Z8VC 3BUDA 1D5XB 3CSTA 1FZMB 4HCRA 1KFAL 1IM3D 3V0HA 1QKZL 4DP6X 4M7JL 1IGML 3LEXA 4QTIH 4MDIB 4QRUA 2NY1B 1A14L 2X3BA 3SBWC 3PLYA 3X1BA 1A4CA 1QRND 4YMPA 2BNUB 3UZQB 4HS8H 3TBWB 1AGEA 1F4XH 2GJZB 5GS0C 1XCTB 4FJZA 1T0NA 1ZS2A 2F2HA 3B5HA 3O2WH 3V95A 1DVFD 5D7LB 1E9OB 1FSKC 4I0CC 4P9HL 4W6XB 3RTQC 1CGWA 5GRJL 1XH2A 1XGUA 1BVNT 1DVYA 3D48R 3E8UH 4HX1A 3HG1A 4B9CA 1IGYB 2YS4A 4HF5L 4PGCB 2B1AH 4AYDC 5ANHA 5I75C 4OI7A 2BMKB 1ACYH 5B38B 3FQXA 4N0RA 1IGIL 5FFGA 3FQ1A 4JHZA 3DHPA 5MI0B 2A4CA 2SODB 3D3VA 3OL2A 4IW4C 3RFZC 5E2UL 2BXYA 5MHSD 4AQAB 4WTWA 1PGRB 3BUBA 4K0OA 4PD4K 1OGTB 5K9QI 1NDMA 3N41F 4AE0A 3NP4A 3Q8FA 2AVGA 2DWYA 2IQAB 1HU8A 2WWKO 3QPQD 4MA3B 1OCOB 3E1ZA 1MWAA 3JQOB 3HAEB 4YGVB 1LO0L 1KBGH 3DGCR 3QQ4A 5DVKA 1MAKA 4NDMB 1I9JH 2VLLA 4OD3L 5KTEH 3ELAT 4QHPA 3RWFB 1G7QA 2O6PA 1W91A 3IETA 5D70H 1P7KB 3A21A 1E9QB 1VEMA 3TA3C 4XTRC 5T1LB 2RBLA 5DZ9A 3CDYA 4FERA 3F65A 3MYZA 1EDQA 4EVNB 3FOMA 4L1SA 5IBTL 2VR9A 1DBBL 2Y07H 2ZXCA 1WUNT 1Z5LB 2WV3A 3BVNB 5F9OL 3ZTNH 4QT5B 2UX7A 4AC4A 2FEEI 4WTQA 2Z92B 4Y16C 3SZ6A 1XF2B 2KC0A 2K1MA 2OI9B 4X4YB 3WOVA 3FU9A 2EDJA 4ZS7L 3G04B 5CEYB 1F5WA 3GM0A 3WFEH 4P2RB 2X4TB 4HGMA 5JW4N 2IMNA 4KTEL 1YPZB 1I8IB 3WFHA 5DVNA 1G7HB 3AREA 4TNEA 1VFBA 3CDFA 5DO8A 1A1NB 1CK0L 1QFOA 5ICXB 1WITA 2D3LA 2OCFD 4LHJB 5HDBF 4KWUA 1WC7B 5HHOB 2WZPD 3VWJA 4ZBJA 1QHPA 4RMQA 3PHQA 5DT1L 5C0BA 3ZKMD 2AQRA 2AK1L 4ZQTA 3DMMA 3FRPG 4G83A 4HFUH 4LBAA 3FSAA 3KE0A 1YNLL 3L3JB 2NXYC 1BQHG 4ONFH 4PJEF 1SZNA 5EC1B 1BVKA 4Y5XA 3VXQB 3UTZA 2A9BA 1KJ3H 4G6JL 4HUVA 4U1LB 5DS1A 5I1CL 2BP0B 3MLXH 3MBEB 3BD3A 1SYVA 4OZHF 4NQCA 2L8AA 3S8FB 1MDTA 4UTBL 3N5AA 5CR1A 1YNTB 1ES0B 3MA7B 2RR3A 5J3HC 5E8EA 5DCCA 3KDMA 3TBVA 2VDNH 1N70A 2DQJH 2QMKA 5E00A 3TBCA 2R1XA 3IJEB 4R8WL 3UL4A 2GW5A 4FQ2L 4YZFE 3UERA 1NCHA 4HUMB 1UA3A 2OTWA 1TQUA 4M8UA 2R15A 4OF8A 5KSVB 4RMWA 1A6AA 5D7LE 3I6GA 4OIBA 1UB5A 3OAZK 2WBKA 3F12B 1MFUA 1O5PA 4AEIL 2E5EA 5AAPA 3QR0A 3T3PF 2R0LL 5D1XD 1YUHB 2BOCB 1KY6A 5JR1L 2NZ9D 4FKEA 4EI5B 3E2HB 3GMNB 1G7MA 3L3DB 4JB9L 1QSFD 4GXFA 4Q52A 1LO2H 1MCOH 5CCGE 5CJXA 1U6AH 2EDNA 2B2XH 5JOPE 3IJ8A 2QGCA 3VTMA 3GZOA 4HOXA 3STLB 1H15A 1BJMA 1OARL 1Z9NA 5BRZB 1I1RA 2WP3T 2WQSA 4WO4D 4JQIA 2WXFA 3ZIYA 3CDGB 2ICEB 5ID0B 1IARB 3JWDL 3WFCL 4MCYB 4LCVA 1UOKA 2X4NA 4LSVH 4P3WA 4HZLA 1UZ8A 5ANMB 4PD4J 4C55A 4PJBF 3C5ZC 4HS6A 3VTTA 4G7QB 1T0PB 3BWSA 2DM2A 3ILQD 2GITB 1IKOP 2QLVB 5MERA 5F0JB 5DRNB 4XWGH 5T3ZE 4Y2NA 4HKBB 4CKQA 5ABAA 1IM3B 3REVA 5JQ6L 1H19A 4OZIF 2AFNA 5CSZA 2VDQH 3MLYL 1MCPL 5JQIB 1C5CH 1D9KA 2FX7H 1XXDC 4QWWD 1NIAA 1OKEA 3EJYD 3HG5A 3KXFA 1IL1A 4ABWA 2W94A 4UTCA 4IEFB 1QRNB 3QO1B 1CIUA 1XAUA 1TYJA 2FT6A 3KWTA 3MKGA 5F3BB 1L3NA 3ES6A 2XZAH 3MKKA 1W72L 4CU8A 5EG6C 1M42A 4P3DA 4KKQA 1MAML 5EF2A 3FBKA 3QISA 1DVFB 4M6NL 5E99L 3MGTB 3AUWB 4FLSA 2ZXDA 3LIUA 4MB3A 3UOAB 4LLUA 4N0YH 3DOHA 3HVDA 1QBML 2GTZB 3QP3A 3RVWC 1JZ5A 3HG1D 5BQ7A 4MAZA 3A6BL 4UANA 2V17L 4WFEE 4M5ZH 4OCMC 2ZNXA 4P2RE 5SWSA 4JHAL 2E9WA 3QQ9D 1JTOA 4XN4A 3U4EA 4ZYKA 2EVHA 3CBRA 1M9WA 5HGHB 1AR2A 2DEYX 2RACA 2Y25A 1N64H 5HHMD 2F7OA 5EU6A 3D3VD 5JHDA 1WBZB 4M9PA 5LVEA 4QF1A 2ENPA 4A66A 3T65B 3CN0A 4YZWA 5ETUB 2DEWX 5HHOE 4ZNCD 3HUJA 3MX0B 3S97C 4X0NA 3ARQA 4AYMC 1HHHB 2EE2A 1L6PA 4HAFA 1MJ7H 1EVUA 2NXZB 1S6NA 2UYLA 4HEME 5EIIB 2X1WL 3KYNA 4YL4A 2YWZA 1RERA 4LSUH 3EJZC 2GSIB 3QBTB 1CDCA 3IDYC 1OD7A 1CXIA 4IRZA 5ESVA 5C97A 2BVEA 3S4SB 1L5GA 4L1HA 5D71H 2NNAA 4L1TA 4YH6A 1S7TB 2GYSA 4OT1H 4DGUA 3MCKB 4NZUL 2CKBH 4DVBB 1ZVYA 5K33A 1KTDB 5CD5C 4NZTL 3APNA 1QLRB 1MH5B 5FHBH 3MGOB 2Q0ZX 3WUWB 2ICWJ 1KLUB 4MSWB 4QRPA 4WZ9A 1TFPA 1NCTA 1MG3C 5DUBA 1NMBH 3ARPA 5DQ9A 1V7NH 1F00I 1T7WA 3QRFM 3LIZA 1FZOB 1TYRA 5HVHC 1TCMA 1U8MB 5BMFH 4HWBL 2JKRM 2OSLA 2X4QA 4PJ7F 1X9RA 2XQYG 3MLVL 3WJJA 3VYOA 3BWZA 3IAQA 4W9EC 4JDZB 3QE5A 4NN6B 4LASH 5IVZB 2PYFB 3P9LB 4A63A 1ASPA 3V4VA 4FHBD 3PUUA 1BEXA 3T0VA 3ARED 3UZVB 3OAWA 4R90H 4G6KH 1U3HC 4WWKA 4TTGA 1DUYB 3VWJD 4QYOB 2OL3B 1JV5B 1MSPA 4J4PD 5E2WH 2EIEA 5C0BD 2D7MA 5DDHB 1FVCB 5BRZE 2C4XA 1HINH 3FN0H 2AZUA 2PNDA 4NCC2 3DMMD 4UTAL 3D12B 4JPWH 1V8HA 2E3VA 4JM2C 1Z0MA 4KTDH 3GRWA 4JDEA 5ANME 2VRAA 2CRZA 1TUPA 3SDCA 4S2SB 3QCUH 1ASQA 5K9OA 5B7MA 4PRPD 3SB3A 3O41B 4G11A 4TSCL 2ED9A 3CFDA 1G9ML 2VXSL 1AY1H 1EEZB 1MRCH 4N4YB 4NQCD 4FULA 1RVFH 3HE7C 3DSNB 4LSQL 1UKSA 3NESA 1YEDB 4N1HB 5F1IA 1QRNE 4OCWH 5GSVA 4P5TC 4MA1C 3LZPA 3UCQA 4OJFH 1DZ0A 2YIHA 3FO0H 3ASWA 1IQWL 2F18A 2CU9A 3EO9L 1V7MH 1EVTC 4YSAA 2O5ZL 5BPPA 2KT6A 4ZOBA 4N5ED 3UPRA 3Q8BA 5SX4H 4Y89A 4KJPD 4YSSA 3MLTA 2ZZUT 1DE4A 2CDGA 1ZHNA 3KPOA 3BWUF 3NTCH 1QSFB 2CHDA 4FXLA 4B3EA 3OB8A 4WEBL 4I3RH 4I48B 5DC4B 1P2CB 1SBSH 1CZ8H 5INCB 4JO4H 4FLHA 1I53A 1HQ4A 5DJYA 3MRDA 5E9DA 3VGAC 4FA6A 4NM4L 4J8RA 4WO4B 3RTLA 5MHSE 5I1LA 2D7NA 4YDKL 1SMOA 5JPMC 1BIIB 3IXAA 1PG7H 5A6LA 2FH8A 3WE6A 1DQVA 4HWZB 1YMMA 4JFYA 3L5IA 3DJSA 3U6RB 4FQ1H 2HTLC 4FF9A 2OMBA 2HVKA 5D7IF 2WWNA 1SRDA 4YSCA 3D0AA 4JFQB 5FYLD 4TVPD 4NQQA 4H8HA 4PW4A 1ORQA 3QJHA 1MZZA 1U8PB 3G5XB 4H25B 1WFIA 4QHNA 2CGRL 2XG4B 3WNJA 4JY4A 3VM5A 3K8LA 3F6LA 3CX5J 4HJIA 4K4KA 4YDVA 1IU1A 3LEXB 4JKMA 1G7PA 1D9KD 1LD9A 4QRUB 4MXWL 3HB3C 4N2DA 3KXFD 4PJ9A 3RGVA 4TQHA 1N7ML 3X12A 4H1LG 1XEDA 3DX8A 2WUCL 1T89A 3EBIA 3V5DB 1T0NB 4WGVB 2BVPB 1M2OA 2OR7A 1QEXA 3Q6GH 1UUNA 1RPQA 2GUOB 3AWFA 1IM9D 1J8RA 3QFGA 2EUZA 4AVHA 4GT0A 4LMQI 1FNHA 5GHWL 2WNWA 3QUXA 3LKOA 1TOXA 1NPUA 4PJ6A 7FABL 3R4DA 4ZMXA 3N50A 5C7XH 1JNJA 1E3FA 2YLHA 1UG9A 3LQZA 5CILH 3FQXB 4BD4A 2W0PA 3BISA 3UC0L 4YAQB 2K45A 5EUKA 3D3VB 3T08A 5JPNB 3LMJH 4PWGA 1N68A 2JE8A 3L1OH 4FQPA 2WAQA 3TO4C 1NA8A 3JZYA 4L0PB 1RKRA 2VXQH 3IFLL 1N18A 2BNQA 4YPGA 4E9SA 5DFVC 1NCIA 4AT6A 5DS2A 1TITA 4LEBA 1T03L 1MJJA 2R83A 2R59A 2H45A 3B9KA 4KI5F 4Y19A 2VZUA 3FUNA 1IIKA 1EZSA 4CKVX 5TDOB 2OSWA 1VPOL 2VLLB 4JE4B 4B3VA 2E27L 2MNUA 1G7QB 3MPCA 2NCEA 3IETB 4RRPG 1A2YA 3V9FA 3T0XA 3LKQA 4UV7L 3ZJAA 2CJTA 5H2BA 3TURA 1TTAA 1P5UB 2PXYA 3ULSA 3VXOA 3LXAA 4X7FC 3FU7B 2FLBT 4NC1E 4MTMA 4F24A 2EADA 2AGJL 3HCVB 1KJVA 2X1XR 5FF6A 4N0UB 4J3BA 4WI4A 4XPFH 5ALCH 3NJJA 4QRPD 4O00A 2UWEF 4U4BA 4OBRA 2EE9A 2ZAGA 4IIZA 1FN4B 3MLUL 4C59B 3SCMA 5JA9A 2AQ1A 1XSOA 2IFFL 1E6JL 1TTFA 4R3SA 2JCCF 1JZ2A 3T0WA 1G9MC 3QZPA 5D1XE 5LBVA 1A25A 1KYDA 4GKZA 4ZNEA 1VFBB 1DDHB 1QSFE 1E65A 2J20A 3DIVA 1KYFA 4Q9RL 2F7RA 1QW9A 5DLML 1NMCC 3VWJB 2QTVA 2R51A 3BH4A 3OV6A 4K7PL 4WWKD 5C0BB 3PCYA 5LDSA 4LVNB 2KQNA 3OSVA 4GSRA 1YYMH 3P2BA 4HMCA 4AIZA 4W9ZA 3ZQXA 1KSRA 4HZAA 1CFTA 2D73A 5AZEL 1XSIA 4I3GA 5T5FA 4XMKH 2P49B 2E6JA 4Y1SA 2RAMA 4HUVB 4BKTC 3LQAL 3SDCD 1SHWA 3VFSA 3WAJA 3ULUH 4PRPB 4OGAC 3PREA 1HZKA 4J3OC 3K46A 1A6UH 4GBXC 1SYVB 2HX8A 2NYZA 3HPJB 1UHVA 1E4XH 3OC5A 5E1AA 2EVJA 3CFMA 2WY3B 1N6VA 5KYXB 1JDAA 3X13A 3L2LA 3EGXA 5E8EB 5J1TC 3GLDA 3U1SH 1M6OA 3KDMB 1P7BA 4M5TA 4P4KB 1BYPA 2R1XB 3B2XA 4GXUN 2UZIL 4JAMB 5AOKA 4DT2A 2V3DA 2F0CA 5DD0L 3MC0A 1YQVH 2QV2A 5AFAA 2OTWB 4NC2B 4P06A 4AJYV 1MW1A 1O9VA 3ML9A 3C2AL 3OLDA 1A6AB 1P7QA 2HFFB 3I6GB 3L17A 2XJLA 3ZL4H 3UTPD 5C0FB 4KZEH 1QVOA 1UB5B 3HG2A 3NZ8B 2Q1EA 5F7DA 3AGWA 3M17A 2WQAA 2ZWLT 3HG1E 2OMZB 5C70A 1G7MB 5LN8A 3HMWL 4L5FE 5T3ZL 2ERJC 1KEGH 4TNVF 2P45B 2EAEA 2QBWA 3FQ4A 1ZT1A 4MD0A 5HHME 1H15B 3D3VE 5E9DD 5ERWA 4LLYA 5A2AA 5C07A 3KBHE 4D8OA 4DQOH 2VB5A 1YLBB 5AVWB 4KK5C 3QDGA 4QAMB 2YC1A 1INDL 1NEZG 1O9WA 1UM5L 2FEJA 4AE1A 5HI3D 1JN6A 1TXKA 5DEZA 1YMMD 2DBLL 4PG2A 4Z7VA 3IFNH 5DVPA 3U7WL 4HS6B 3KR3H 1ZOXA 2FE0A 3HNVL 1CI5A 5MERB 4XP6L 2BY1A 1G87A 3IRCA 1Q9KB 4RAUA 4H26A 3QRBA 4AH2A 3MJGX 2F19H 3MV7A 3PXJA 4TQIA 1OO2A 2WLLA 3L2NA 4OLYH 2AV7A 5CSZB 3RDJA 1SJVA 3SKOB 1D9KB 4WO0A 5HGDA 1AQKL 3KXFB 2A6IA 4PWJA 5GGVY 5I8EB 2V2XA 2OXGA 2HRLA 5DHVB 4PJ9D 3RGVD 4JCLA 1UWEH 2H5UA 2BRQA 2DQDL 4EKXA 3TBBA 4UUJA 1ULVA 4N0UE 1OTSD 2O5YL 3NIDF 5IROC 1IM9B 3UEQA 1LO4H 4FQLL 4YFLI 4JO2H 1YEKL 1QAWA 4KMLB 4LLUB 4LSRL 2ARJB 5FA3A 4PJCF 4HK3N 4M5SA 3QUXD 1BJ1H 1TIUA 5BQ7B 2I69A 1IIIA 4LCUA 3FKUS 1TJGH 2KMWA 1IAII 3OR7B 1Y0LA 1XBDA 4P2OC 3R8QA 1T21B 4NRZB 4YSOA 2QMJA 5SX4I 3ZDXB 1TQSA 2GJPA 3HUJB 4FS0A 1FAIH 4M93C 3V7AE 2P47B 5C0BE 4NRYA 4TSBL 2BNQD 3UTSD 2FATH 5DFWH 2V4LA 1PTZA 2UYLB 4O4YH 5AW4B 3SKJH 5D96B 1F18A 2WBJA 2CR6A 3FSVA 3KYNB 4RMBA 4XXCC 3B9KD 4Y19D 1F45A 4ESKA 1J9TA 1MFCL 4M8RA 5CCKL 3OXSB 4ZOAA 3GT6A 1L5GB 2UY6A 2BOBA 2Y22A 2NNAB 3T0BA 3R19A 4HIPA 1NIDA 2WXHA 2COVD 4LRIC 4NQCE 1QQDA 3VSVA 1A7PL 2PXYD 4XP9L 5J1SC 3GPEA 1F6FB 4ZT1A 5A6MA 1VSCA 3D33A 4WI8A 5DUBB 2XV6B 4YXLL 5DQ9B 3CHPA 3K71A 2JQZA 4OKVB 4H13C 3LQAC 1W9XA 2OSLB 2X4QB 1N4XL 1T3FB 1WHOA 3FB6B 4UT6A 3SCMD 4K5OA 1DEEB 5F72S 4MAUH 2L7UA 1CI3M 4ZUWA 3T4AC 3ARDA 4GLRH 1F11A 1BD2A 1U8LA 1DBML 1UVQB 5F7EL 3GUTA 1A6ZA 2VSKB 5I30H 3K74B 1DJZA 3IFOA 1SEBB 4M6ML 1S4IA 1IC0A 2O4EA 4WWKB 4PHXA 1DFBH 5EOCJ 1OAKL 1AZNA 3TV8A 4CL7A 1ADWA 4C56A 1QFWH 1MCWM 3OM3B 2YAFA 2XQYK 3VWKC 5J06A 4NZDA 4I18A 2J73A 3FJTA 2A9CA 2A9NL 3L4CA 3PNWA 1XTMA 4JDEB 1NCJA 2GKIA 1PMYA 4X9FA 5IFJB 2B59A 4GP4B 3SDCB 1L3WA 2ZUQB 5FYLE 4TVPE 5K9OB 3LEYH 2GEQA 1OE3A 1JDCA 1JWUB 4RQQA 2EIJB 1Z7JA 2X38A 4XXWA 3ATFA 2WKOF 1YEEH 4GAFB 2BNRA 2VLMD 4LARL 1GS7A 4X6BA 5HI4D 2O26U 2XKUA 3BEVA 3NDYE 3A4AA 1UURA 4Z7WA 3KXFE 5F1IB 3MRJA 4L48A 1F4WL 2OFQA 4QOKD 3BP5B 4FLRA 3RZCC 2NDFA 3BE1H 2J4WL 4QRQB 4WW2F 3SBPA 2UZXA 4AX3A 1DLHA 3HJ0A 1P7QD 4KH2A 1VB9A 2FO4A 4R6UA 3UPRB 5KN5A 2F5AH 3L9RA 1UFGA 3RPBA 2J3SA 2NY6C 1VA9A 3FT2A 1EUTA 2C1PB 2CDGB 1HAWA 2YJLA 2FGWL 3KPOB 4A68A 3NJVA 4M1CC 1HXMA 1HQ4B 2BP8A 1NLBL 1LL1A 3P30L 3ZKNC 2PO6B 5JHDE 4BXVA 5C07D 1URZA 5I1LB 1FYHB 3ZDXE 1PG7X 1VF5C 3V4PH 2G9HA 3ZIMA 5DO2D 3QDGD 5F9JB 3HUJE 2AJUL 3DHUA 4DN4H 1YMMB 1YMHB 4ODUA 3R7QA 3EYOA 3HS9A 3B2VH 4ZW8A 1QACA 4NUPA 4M1DH 3CN4A 5DK0A 1QA9A 2YD2A 5IMMA 2DEXX 5TQ0L 2CK0L 3QJHB 5KAQF 2OJ1A 3MCLH 3MV11 2FUQA 4DO4A 4EDWL 3IB4A 4QHNB 4JX0A 3MV7D 4YDVB 1K5NA 3MRKA 1L9SA 4U3CA 1G7PB 4YO0A 1LD9B 3VVVA 3RGVB 1Z32X 3X12B 2FLMA 1FZKA 2GG1A 1CXHA 2X6UA 3DX8B 5AVRB 1KB5A 3HI5L 5K59E 1E4XI 5G4OA 1KCRL 1LP9F 5IW3A 2OR9H 3CN1A 5HJBA 5CZVL 3LV3B 4QRPE 4NPKA 5DURD 2UY7B 15C8L 3D09A 1HC1A 1F4YH 4JFPA 1OV8A 1Y07A 3QUXB 3V2AR 3LKOB 3LAFA 5BVPH 3NA9H 3VX0A 2X4UA 1X7QA 4EUPH 3LQZB 1HCVA 4PJHA 5AL8A 4I9WD 1LILA 1HHGA 4Z3EA 4E9YA 2DYSB 1AVAA 1T66D 2XTLA 3LVTA 3KYMA 2BNQB 3PGDA 3A3YB 3UTSB 3ETBF 4YPGB 1A6TB 3FB5A 4AT6B 1AS6A 2VW4A 3FCUB 3WL9A 2N01B 1MJJB 4FRWA 3B9KB 3KPQB 4H2AA 4RLDA 4Y19B 2WBJD 1PKQA 2ATKA 2CBQA 1WFMA 3VJ6A 1D5BA 3LSOA 4F5CA 3FULA 1KCLA 4GOSA 3J2PA 4LEEA 1PD6A 2AEQL 1I1AC 4TRPL 4HOWA 3KPPA 1SDDB 3VXOB 5LCVA 3BVTA 1GAFL 1OAZH 4AM0A 1KJVB 1MHPH 2J6WA 5AALA 1A3RH 1WGVA 1SLVA 4BZ1A 3U30C 1NGXA 3A22A 3LKRA 3T2NL 3ULVC 2AJXH 2YPVH 2J7LA 4HGWA 3NPSC 2VC2B 1XFPA 3GINA 1OCCB 2N7SA 3O6KH 1QLFA 4JFUA 4YE4H 4AEFA 2GT9A 3WNPA 4E42B 3VD0A 5FK9B 2YD5A 1XIWC 3OAZH 3SCMB 5CEXA 1NGYA 3UTPE 2ZOKB 2EIMB 3OD3A 4PYHA 4HCGA 1NCBH 1J0HA 2Q7NA 4KV5E 4Y5VC 4XHJD 3JYBA 2X70A 3WNOA 3ARDD 4I77L 4CVUA 5C71A 1BD2D 2HJKA 3EZJB 3N55A 3QUKA 3TA4D 1AFVH 5T3XD 4XCNA 3S9DB 3BH8B 4HCRL 5E9DE 1YEJH 2ZUWA 1IC7H 3IN2A 2X28A 4C56D 3KWWA 1WWWX 3QRGL 4NJAH 4H88L 4BKLA 1BGXH 4FABL 3WHXA 1CD8A 1CFTB 2CRMA 1YMME 3QPQC 1UH4A 1CR9L 4XP1L 3MLRH 1CXEA 3FTXA 4WKXA 5F9WC 1J0ZA 3TBSA 1CLOL 3DV4A 1IQDA 2P43B 3GSUA 5T1KB 3VFSB 3O3BA 4MDRA 2VQTA 4ANKA 2A4ZA 1YEGH 5TGBA 4NQEB 5E1AB 1EPFA 2F74B 4I2XA 2A7BA 3S48A 3CDZB 1OVZA 2BNRD 2X88A 3X13B 3ZTJG 4X80L 2EC9U 1M6OB 4FXTA 3MRMA 4FZEH 4EJ1C 1CICC 4HJ0C 4UT7H 4KBPA 4QOKB 3ISYA 5FM5O 1G1CA 3GSNA 1BM3H 4ODVH 2LU5A 2X4PA 2YN3A 2DQFB 3NIGB 3VH8G 3G5VB 2AKRA 4F8PA 4W9DC 1N3NA 2B9BA 4LBEA 1P7QB 1YC7A 5I1HH 5HHQA 1QVOB 2Y4SA 4DW2L 1O5DT 1UZ6E 3KL0A 5F7DB 3UGXA 1RIUL 5EO1A 4AMKL 1GL4B 1NOLA 1MWAL 5EA0L 1EFXA 3N0PB 1HIMH 1XCQB 3LB6D 2FBJL 4XH2A 3WIFB 4ZXBA 4BWTA 4LT7A 4WWOA 4MD0B 1ZT1B 1I8KA 2BS9A 4WFFE 5ERWB 3D0LB 1A3ZA 4LLYB 4OZHA 5C07B 3UTTA 2B5IC 4I3SH 5CP3A 1MIEL 32C2A 3QDGB 1IB5A 1FBIH 2YC1B 3F62A 3GJFK 1H3TA 2LTQC 4BINA 5B3SB 2BNQE 4Y9EA 3UTSE 3HRZA 3ZKXC 5CJ5A 1XSJA 4Z7VB 3GXIA 3S36L 1R0AH 3T6WA 1BF2A 2QLYA 1QFWI 3NJXA 2VMDA 1S7XB 4Y19E 3S96A 3I75A 5D9SA 5GGRA 3SO3B 3VFWB 4NUJA 1KACB 5KUKA 5FV2A 3HS0A 4H26B 4RAUB 4KVNL 1OT2A 3OGCA 2WLLB 2AV7B 4OLZL 3FT0A 1NLDL 3CC5A 5DD1L 5KSAA 2V2XB 1VJSA 2OXGB 4NC1C 4ZTOL 3HZ3A 4DCQA 4UILL 4ODSH 5H4YA 5I6XB 4KHXL 4XGZB 2BK8A 1CC3A 2K6WA 1J0YA 4KVCL 4Q6IA 1GJIA 4DP5X 3OPUA 3OF6D 2FT7A 3KG5A 1OPOA 4DO5A 5DURB 3HHMA 5GJSH 1M7DA 2OP4L 3BHBB 4FD0A 1AS8A 1A0QL 1EAQA 4M48L 5FA3B 4K5LA 4U3XA 4P9ML 4PJBA 4JM4L 5IVNA 4GMTL 2HVBA 5D1XC 4MMYB 1QZNA 3VA2C 3DK2A 1Y0LB 4LPYA 4APXA 1B4JL 3TH4T 1FIEA 5EOTB 1ZLDA 1Y1DA 1X9LA 4ZD3H 4ZNEE 3GKZA 2ITEA 1MFAL 2O6EA 2KZKA 1HNGA 3K2UH 2WYTA 5B38G 4OZIA 3JSSA 4MJ5A 3ZPDA 1GS6X 5CIPA 1IFRA 1II4E 3W9EA 3GSRA 4NRYB 2H1LM 4FZ8H 3KCPA 1B4RA 1D3CA 3GC3A 4NN5B 3QQDA 3VRIA 2WBJB 3K8KA 4EIGB 1HNYA 1R24A 4MYPA 1A3LL 3BAEL 4YHNA 3FSWA 4E5XB 3GBML 1XBRA 4WUKL 1ITCA 2UY6B 2BOBB 3HAEG 2CBTA 4M7LL 4RSYA 1JRHL 4U1JA 2B9AA 4UIKH 4UQDA 4IDLA 3MQIA 1GC1L 5GRUH 1JNLH 2DQTL 2VLME 3FAWA 3KWXA 5D7EA 1NIEA 2IGFH 1F8TL 4JCWA 3U46B 2TRYA 5FX3A 4EXKA 4IMKA 4OIIH 4Z7QE 1A1OA 1S5IL 3LNEA 3PL6C 5IFHH 3MJ8A 5TJWK 3NCBB 1IC5L 4LLDB 4QOKE 1A4JA 3QEHA 3K71B 2OV0A 4LLVA 1MCJA 3AXHA 4N0CC 4XCFH 3RGHA 5FO7A 1Z1WA 4JQIL 5EFIB 5EH1A 2R4SL 1HHIA 1ONQA 4IKKA 5DUMH 5TFSL 4N2OA 1GGYA 3QHZH 5EWIL 3ZR5A 2MEJB 1YJDH 4FFYH 1RI8A 1F58L 5FYLL 2AK4A 1TJIH 4TVPL 4XMXA 2K8MA 5KSBF 4KFZC 4GUPA 1A6ZB 1CTOA 3NCYS 2VUKA 3IFOB 4FFWD 1FDLH 4DSYA 5IZ7A 1MRFH 1H3GA 2OSYA 2SEBA 3IU4L 2Q8BH 3UPAA 4C56B 5C07E 2AAVA 3UJJH 3WO4C 1NCCL 1DJXA 3MJWA 3P73A 1AAJA 3QDGE 4BK5C 4GP8B 4I18B 3SDDA 2JI3A 2JKSA 3PNWB 4OSUL 2M1KA 3OAYK 3OXRA 2B59B 1FC1A 4Z7VE 1N6QH 2GTWA 5AW9B 2AXJA 3WGUB 1BWMA 2DH2A 3B83A 3NOIA 2HLAA 4PJ7A 4ZMVA 3PWLA 5HYFA 4F8QA 2BNRB 1A64A 3MV7E 3BGMA 4LMQE 3BEVB 4D94A 1MREL 4Z7WB 1B3JA 3P1VA 4MXVF 3P4LA 2MHAA 3ILDA 2R0WH 3BN9C 2QL1A 3MODL 1WVZA 1J9QA 2ICWI 5JHLH 4F57L 4GPVA 5AZUA 1MCNA 1D5ZA 2P9RA 3EFDL 3QXDA 4ZG1A 2VOTA 3NJFA 2FO4B 4I85A 1M7IB 1RUPL 3L9RB 3HNSL 5JW3L 4Q0XL 3B4NA 2Z4TA 4IYKA 1OQXA 1SHXA 4OJDH 5I26A 2PCPA 4IRZL 1EFXD 4NYLA 1HXMB 2HYMA 4ELDA 1AH1A 3AREC 3BSHA 4ZXBD 3VMPA 4CMMA 3DOSB 2FJSA 4AC2A 2ADGA 3B7YA 3VG9B 1A4KA 4MWFB 1UKTA 3CLEH 3UTTD 3MJ9A 2Q7YB 3LZFH 2G9HB 5TE7H 3VCLA 3HLAB 5I1KH 4OD1L 2WWMC 4LKXA 4AJVA 4LCWA 5CJQL 3B9DA 3DMMC 2C9RA 3FSOA 4FQQB 1G1YA 3ZO9A 1QA9B 2Y7LA 5IMMB 5HHVL 5F3HA 4Y5XC 3LIZL 4JRYA 1LNUA 1PLCA 3LZOA 1KPRB 5IJKA 1FORH 4TQ8A 3E6HA 3RX5A 3N40F 2EXTA 2J1XA 5G5DA 1GHFH 1YN6B 5C9JA 1WTLA 4LPTA 1K5NB 3MRKB 3I9IA 1KULA 4YO0B 3LKNA 4GH7B 1EX0A 1TT6A 3LXUX 5KSAD 4KK8C 3V4VL 1FZKB 4RMRA 5B1KA 3CSYA 1JPSL 3QAZC 3WEBA 3QFDB 5FB8B 3NIFE 5HHNA 1ZJBA 2E9GA 5HVGB 1G5GA 2X9XA 1GTFA 1LK3H 3NABL 1J7VR 3N85L 3D6GA 3HMXA 2FB4H 4F2MA 4PRNB 4N5EC 2YSSB 2X4UB 1CBVL 1QI3A 1E27A 3VQ2C 1GC1C 5I24A 1F4AA 5D7IA 1EH9A 3IN0A 3F83A 2OPCA 1WS8A 1BD2E 3NSJA 2HN7A 1Y18A 4UV4L 1BZ8A 4HJJH 4CC1A 3BT2L 4L0ZA 5C0CA 5T3XE 3UMTA 3G6JA 3V8OA 5EU3A 3CDCA 2WP3O 3H4FA 4C56E 4FQCL 4UOQA 1SN5A 3RPIB 3ZGIA 3FB5B 4DUWA 4WK0B 2L7EA 2VMJA 2X12A 5A3IC 3UBFA 4FC3E 1GZHA 3WL9B 1WG3A 2LVEA 3KNBB 1CL7H 1PKQB 2ATKB 3OX8B 1KYOK 2ZKMX 3VJ6B 1NPJA 3Q6FA 1D5BB 3BUQA 3LSOB 4K23L 1ZVNA 4IOFC 3AG1B 3ZT7A 2B20A 3QFJA 2VJ8A 3LJ3A 4FL4C 3RUGB 3UP6A 4EN3B 4MQSB 1CMOA 1VZHA 4CN6A 2OTUB 4ONOA 5E6IA 5EIIG 3PWPA 1YY9D 3S0PA 2QGBA 1WZMA 4ONGL 4A2LA 3CN2A 1BYNA 1KGYE 1JK8A 2BNRE 3GK8H 5JIKA 3S4SG 4DP9X 4AM0B 2EE3A 4Z7WE 1AI1H 1BFOA 4DZ8A 1J11A 2AJYL 1R5WA 2DDQH 1NGXB 2ZQKA 3LKRB 5IB5B 1MFBH 2J1YA 1UJ3B 1BEYL 3EBHA 1HEZA 1LEIB 3IS0X 3RY6C 3RKPA 1EXUA 4GFXA 4ZFFA 2GT9B 3FQTA 4KHTL 4FXKC 3KH3A 4PJXF 1FGNL 1L9PA 3WUWG 5I1JH 4TF4A 5CEXB 1NGYB 1DSFL 2BXZA 2ZWKA 5B4MC 1TPXC 4NN7B 3B3BA 3UAFA 2VZ1A 2YK1L 5EOCH 2X70B 2AK4D 2J72A 2HJKB 5D7KD 3G6DL 3QUKB 4NNPH 1MVYA 3SYPA 1WCBB 2J1KA 2V5TA 2Z35B 2Z0UA 4F8OA 3PP4H 3HZMA 1UQSB 3LNFA 3VDAA 3KWWB 1JK9A 1TTUA 3HHRB 4X8CA 3F7QA 5ALBL 1HKLH 1RUMH 2DLFL 2IH3A 5BRQA 4BKLB 3BYTA 5J4MA 2ZXEB 3SDDD 3DOIA 4BCYA 4D9LH 4GG6A 1UXLA 3NCJH 1R5VA 2UWEA 4LVOC 3TBSB 1IQDB 3GSUB 4RX4A 2CXKA 1DQDL 1MW2A 3EOBB 2E6QA 5TGBB 2IALB 4LVHC 1BQ5A 5ADOL 4JDTL 4I2XB 1CXFA 2JCCA 4OFYA 5K1JA 3QW9A 1JDDA 4ICXA 3WLBB 4YHML 4BZYA 3MRMB 1RIVL 1AHKA 1AD0A 3QUZD 3UG4A 5FCUL 5LGHH 5HDBB 4PMFA 2DQIH 1KGWA 4PLKD 3K0YA 5CP7A 2XOTA 2AKRB 4PVNA 3SBRA 1N3NB 1DQTA 4LBEB 1NGPL 2YBGA 1MCKA 5HHQB 1ROCA 3SDAC 3UZEA 5J11C 1K8DB 5EO1B 4K73A 1GS8A 2C3VA 1MXDA 3IMVA 5I6PA 4GIPD 5ITBL 3BKMH 5DR5L 1XH1A 3BKYH