1AZRA

Crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHDWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas aeruginosai zinc azurin mutant Asn47Asp at 2.4 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azrA00
3UAAA 2PPDA 4DP0X 4G71B 3S3CB 2YAMA 2OCCB 3BQVA 4E9QA 2UXGA 1SHXA 3HEIB 2BW4A 3D12B 3NJMA 2IDSA 1N70A 5I28A 2H3XC 3QJVB 2H5UA 4QLWA 1KV7A 2XXFA 4UANA 3FYEB 4GYBA 1BQRA 1ILSA 1ASQA 1PZAA 2JKWA 4E9VA 1J9TA 3IE9A 1L9TA 2YAEA 1CURA 3N55A 2VW4A 4GXFA 2VW7A 1ID2A 3IN2A 2DWSA 1M57B 1SF5A 3ABMB 5I6KA 4N4YB 1AS6A 2IDUA 1IC0A 2IDFA 3C75A 2FT6A 3DIVA 1AOZA 4KOBA 1GW0A 2JFCA 1JVOA 5EHFA 1BXVA 4P5RA 2GB2A 3OMAB 2BZCA 1BQKA 1J9RA 5PCYA 3QJTB 5AKRA 3TU6A 2P80D 3PAUA 3X1FA 3NJGA 4Q8BA 3NP4A 2BP0A 2BO0A 4UF7C 3UADA 3ASNB 5B7FA 5D4HA 3UABA 1ZDQA 1N68A 1ZPUA 2Y69B 4HCIA 2J55A 1TU2A 3MBWB 6PCYA 3OM3B 1RCYA 1NWOA 1ZDSA 2FWLB 1AG6A 4W1TA 1CYXA 2YXWA 3NSDA 1OCOB 4HHWA 1SF3A 1ZV2A 3NJLA 1CC3A 3PAVA 8PAZA 4BWWA 2WO2B 4HCFA 4F7KA 2HRHA 2HX8A 2UX6A 3ZBMA 4A2FA 1KCWA 5PAZA 4K9JA 2VW6A 1W6WA 3NJFA 4KNTA 3T6VA 4RH4A 2X87A 3OMIB 3BVDB 2DYRB 4A67A 3S3DB 4HIPA 4YSCA 1FA4A 2GIMA 2QT6A 4GY4A 4AKPA 4BXVA 3CVDA 1DZ0A 5AZUA 4N8UA 4BK5C 1JZFA 2LLNA 1JZJA 1A4AA 2XX0A 1PCSA 1M9WA 1TEGA 3SBPA 3AG2B 4G7QB 3SBRA 4DP2X 2EIJB 5F7BA 1J9QA 2IDQA 2PCYA 1GR7A 2AZUA 3IN0A 2EIKB 4YSAA 1AG0A 4M3HA 2VSKB 4YL4A 1W8EA 4NAJA 5D4JA 2H47C 1NIDA 3IEAA 3MX0B 3NT0A 1L9RA 3EH4B 1NIFA 4HCGA 1WS7A 5I5IA 2MTAA 5I5JA 3NSCA 2BP0B 2FQDA 1SDDB 2Q5BA 2XLLA 3CZUB 4KNSA 4FAAB 1V10A 3ZDWA 1E67A 4E9SA 2JXMA 3FU7B 2YXVA 4A68A 1PAZA 1XB6A 6PAZA 3S8FB 2W88A 1A65A 1ET7A 2CUAA 4A66A 4DP8X 1PZBA 4YSSA 1AR1B 4G7SB 1PY0A 5F7AA 4YSPA 1ILUA 1PLAA 1EHKB 1GS6X 4DP7X 2VM4A 3QQXA 2I7SA 2Q9OA 2XVBA 1DYZA 2EIMB 3HB3B 5B1JC 4G72B 4ZK8A 1B3IA 2FJSA 2ZONA 4E9TA 1AIZA 3PPSA 2XU9A 4NERA 2XUWA 2HLEB 1BYOA 1E5YA 4AI7A 2J5WA 3FSVA 3GYRA 4AKQA 1AQ8A 5I26A 2YQBA 3WI9A 4DPCX 1QNIA 2PLTA 2AVFA 2IH8A 2FQGA 1L9SA 3FQ2A 1GSKA 1KBVA 2BWDA 5D4IA 3S8GB 5IY5B 3NSYA 2VSMB 4A2EA 4Q89A 1V54B 2XV2A 3EH3B 1QLEB 2PCFA 4DP5X 4PAZA 1ETJA 1ET8A 4YVNA 2GC4C 1T5KA 1NWPA 4GP5B 3EH5B 3PXLA 4KNUA 4KO7A 3H4FA 2PP7A 5I6PA 1IUZA 1JERA 5B7MA 2EILB 4JHVA 3NYKA 2HXAA 3ZIYA 2IWEA 2PP9A 2IH9A 2QDVA 3T6XA 1OCCB 4HZ1A 1ASPA 2FQEA 4E9XA 3NSFA 4DPBX 3WNIA 5B1BB 2N0MA 2VM3A 1AZBA 5ANHA 1OE1A 1IKOP 4DP6X 1BAWA 4P5SA 2IDTA 3ABLB 2Y1AA 4YSUA 3AG3B 4E9WA 2YAPA 3KW7A 1AS8A 2BZ7A 2HZHA 1MG3C 2E86A 3S3BB 5B7EA 1A3ZA 1ASOA 2UXFA 1MDAA 1NPJA 3T9WA 3X1GA 3H56A 3DTUB 2FT7A 1NZRA 4JHUA 2VN3A 1QHQA 1GY2A 4W9ZA 1A4BA 4YSRA 4KO9A 2IWKA 2YAQA 2J56A 2AANA 1WAEA 3L45A 4KO5A 1FWXA 5FC9A 3UAEA 2I7OA 4CSZA 1TEFA 3UACA 2UXTA 2WSDA 2XYBA 7PCYA 3T6ZA 1E5ZA 1RZQA 2FT8A 2TSAA 2GC7C 3FS9A 4G70B 2P80A 4YSTA 2AFNA 5A7EA 2NRDA 1JVLA 1TKWA 4FA7B 4X4KA 1SHWA 3TBCA 1XMEB 2EINB 3X1BA 3AZUA 1BQ5A 2BHFA 2XWZA 1CYWA 4BWUA 1AANA 2A3TA 2DYSB 3PAZA 3UGEA 2B3IA 3OQRA 2BP8A 3QJSB 3TA4D 9PCYA 1NIAA 3CDZB 4QKTA 4A2GA 3AG1B 2BWIA 1KBWA 2DWTA 2ZWNA 1ET5A 1AACA 2TSBA 3NP3A 1HAWA 1A8ZA 1SFHA 1GS8A 3TASA 3FU7A 1NPNA 3QJRB 5B1JA 3WKQA 1E30A 2WO3B 1IBYA 3IBOA 1AS7A 3NJJA 1NINA 2QPEB 3FU9A 2BP8B 3FSAA 3NJKA 3X2QB 2VMJA 3RYMA 3FQYA 5I6NA 3QPKA 2UX7A 4YVUA 4YSEA 2OV0A 2FNWA 5I5MA 4G7RB 4KO6A 1OCRB 2PPCA 2YARA 4BWTA 4KOCA 3CG8A 1EZLA 1GY1A 3FPXA 1OCZB 5I6MA 1BXAA 4DP4X 1KCBA 3FU8A 1JXFA 1SJMA 2DY2A 1PMYA 3V9EA 1AZUA 4TXVB 4A2HA 3GXUB 2QPDB 3EF4A 3GDCA 1OOWA 2RACA 2B08A 4YSOA 5E9NA 5I6LA 2W8CA 3WKPA 3AY2A 1NTDA 2PPEA 2FQFA 1J5CA 2PPFA 1JZEA 2ZOOA 1KDJA 2XV0A 1PF3A 4ENZA 4DPAX 5B3SB 2DV6A 1WS8A 2YAOA 1ADWA 1UATA 3T71A 1HAUA 2IWFA 3H4HA 3WIAA 4WTQA 3FSZA 4EF3A 1RZPA 1MZZA 1KYAA 1WA2X 3ABKB 3AG4B 5B1KA 1BYPA 5TK2A 1J9SA 1KDIA 2MRYA 4WKXA 3N2JA 2PPAA 1PNCA 1NIEA 2OJ1A 3G5WA 1L9QA 3FQ1A 2QDWA 3KW8A 2CBPA 3CDZA 1JZIA 1IBZA 3U25A 1SNRA 3EHBB 1PLBA 3PCYA 2BW5A 4DP1X 1NDTA 2PP8A 2GBAA 1PZCA 1CUOA 4NB7A 3ASOB 2R7EA 1VLXA 1SDDA 1JZGA 2ZXWB 3PLYA 1HFUA 2J57A 3FSWA 4BDVB 1OV8A 1I53A 3DKHA 3OD3A 2HX9A 2IAAC 3CVBA 3WG7B 4F2EA 3QJUB 1FFTB 4JKNA 5B1AB 3NJNA 1GS7A 3FT0A 4YSQA 4YSDA 4MFHA 2FTAA 1YLBB 4HHGA 3AW5A 1XB3A 3NJHA 3TBBA 1X9RA 3OMNB 4AKOA 1PNDA 4HALA 5LDUA 1GYCA 1X9UA 4A2DA 2AZAA 5I6OA 1AAJA 2CALA 2XX1A 1BEXA 2X88A 1W6LA 4PCYA 4DP9X 1AZCA 2CCWA 3JTBA 2UXVA 4HAKA 7PAZA 1AZRA 4E9YA 2XXGA 1M56B 3X1NA 1JXGA 3SQRA 3T6WA 3CVCA 1MZYA 1J5DA 1V55B 5TK4A 3NJIA 3SBQA 2CAKA 1OF0A 3FYIB 1URIA 4L0PB 1AZNA 1F56A 1E65A 2GSMB 2YAHA 4AX3A 1SFDA 1JZHA 2YAFA 1A4CA 1XB8A 4BDVA 2HX7A 1MG2C 4AZUA 1OE2A 1NIBA 1WA1X 3ABGA 1WA0X 2GI0A 4BXSV 1JXDA 1RKRA 2GHZA 1KGYE 1JOIA 1L9PA 1BXUA 4E9RA 1L9OA 2HRGA 4CSPA 2I85A 1PLCA 2R7EB 3FPYA 1ZIBA 3ERXA 3JT2A 4GP8B 1OE3A 3QJQB 3ZX1A 3V9CA 3X1EA 3WNJA 2CJ3A 1NICA 4M4RB 5AFAA 4GP4B 1ZIAA 2XV3A 1R1CA 4UAHA 4F2FA
chains in the Genus database with same CATH superfamily
4BK5A 2EYRB 2Q8AH 1M7UA 2BNUA 1T6BX 2JMRA 2HPOA 2ZG1A 2E9WA 3Q44A 1WITA 1WIPA 3O3BB 4TUJA 4Y5VA 3PNWA 1AJ7L 1MY7A 5D1ZB 3GC3A 3K5RA 2H1PH 5FYKU 2AJZA 3EJSA 4MCYA 4XMLH 1JBJA 2ZCHH 3C5JA 5A2JH 2R1XA 3HG3A 1KZYA 3MLZL 5LDSA 2JKWA 3ZDXF 1FP5A 4MAYC 4N2BA 1GZHC 2VDRB 3MRDA 3RUGE 3QO0A 3RUGB 1EGJH 1N5AA 4XPBL 4HKJA 3IN2A 1M57B 5HI4C 4LEXH 2C1OB 2CHNA 2Q8BH 2IDUA 5C0IB 3P4LA 5KJRL 3C6LA 2I9TB 3RVTC 3WY4A 5IJVA 1KOAA 2X4TB 5PCYA 1V3MA 2R8SL 1CFTB 3K4AA 3QUYC 4IK7A 5CJOL 2Z93A 4CKVX 3HBQA 3QNXA 1EHLL 3AROA 1W0WB 3I6LE 1KIRB 5T1LA 3NP4A 3QA3B 3ZHFA 5KAQG 2BO0A 3QPQC 5EIIA 2CA4A 5E2WL 2F7IA 1R47A 4MDRA 5D1XC 1A2YA 3PXJA 1XGPA 3FO9B 1YUKB 1N19A 3B2VL 3MBWB 4WI7A 1IMHC 4FC3E 5IB4A 2K1MA 2GHWB 1IAKB 4FTVB 5DMKA 4PS4H 3TEUA 5INDA 5DMGC 3TBTA 2XT1B 5K9OA 3T1FB 1HWWA 5TDOB 3DNKA 2NT0A 2P5EB 3CSYA 4X4ZA 3QRGL 3FQRB 4NUQA 3GXFA 2O61A 3JTSA 1I1CA 4WSKA 5HY9B 2YRPA 4M6OL 4IJ3B 5L0QB 2NNCA 3C2AH 3OMIB 4HU8A 3C8KB 3LH2L 4LGSB 4KFZC 5DHVB 5BUGA 3IT8D 4NO2A 4XWOD 3AC0A 2EE0A 5I5RA 1QQDA 1P4BL 5G55A 3JWDL 5FV2A 1BLIA 1IC7H 3M8OL 3SO5A 2BVEA 3O41A 1BFTA 1BECA 1DL7H 2PCYA 3FUMA 2X70A 4OV6F 4U33A 4DQOH 4UOW1 4KPHH 4XNXH 1DANT 4LLMB 2F1EA 1U33A 1HNGA 2A9DA 4JM4H 4K71C 4Q6IA 2WCGA 4A39A 5E03A 1YN6B 2J8UE 4H0GA 4NOBA 6TAAA 1C16A 3BPOB 3NT0A 4HCGA 1W72H 2A77H 2ZOKB 2H32H 4Y8DC 3ZE1B 3WUZA 2DWEA 5AW4B 1ACXA 5EORH 3F6IA 5GGTL 3ARBA 4JCWA 4YHOL 2Q5BA 1P9MC 3TONA 5LGHH 1MLBA 5MERB 2FEDC 3BAEH 2EZ0C 4PRHA 5IT2H 2Q10A 2ADYA 4Z7AA 1PAZA 1BOGA 1XB6A 2QJDA 4AJVA 1M42A 4KZ0A 3O3DB 4EZKA 1EHXA 4KMQA 1ZLVH 3ZKSD 4BFRA 1PZBA 3RKDC 5B39G 2NTFA 4H44C 5KEZA 4XZUB 3QUZA 1SY6L 1CD0A 2XTSA 3MA9H 5E4OA 4CNIB 1OAXL 3MTXA 3KDPB 1E4XL 5ITFB 1ZOXA 4LCYB 2QQLH 4FA8A 3MLZH 1QUNA 3BESR 4OD1L 3HR6A 5ES4B 3KJ6L 4FMFA 2E74C 3QIWB 5BZZA 3FHEA 2ZWSA 2QHLA 2IH1A 5L2JB 1SMDA 3SDDA 4GLRI 2VDML 5CU9A 3L5WA 1I8MA 5FM4A 5IKCB 2VDPH 2OTUA 3HS0C 2HLEB 1BREA 1IEBA 4UDUA 1OWWA 3ARDB 3OGOE 3JVGA 4NPKA 4Z9KB 3ARXA 2F7RA 1E6JL 1KTDA 2FIRT 1CK0H 3AABA 4I3SL 1CDBA 5EU6E 4Y2DC 5JQ6H 3CMOL 1T0OA 2OSYA 3FQ2A 2QSQA 1XGUA 5GS2H 1XCQA 2OL3B 4OJYA 3F58L 5E8NA 2DQHL 3E2HB 4RRPG 3BWAA 3IJ7A 1CTNA 1IE5A 4TVPL 5C0BA 1NWPA 3LNGA 1LD9A 5HHXL 2R1WB 3LKPA 4JFOA 5I15H 5JZ7C 4QDGA 2KDGA 2CO6A 3TA3C 4HS6A 2R51A 3CVHB 1IUZA 1E9OA 1LK3H 1X5JA 1JF1A 3PWVA 5EO0A 4JREC 1GGBH 3RZWA 4AQ1C 1KBKA 3MLRH 3ZIYA 2IWEA 5T33L 3FU5A 3KWVA 2C3HA 3MJGX 1T4KA 4O2FA 1Q9KA 2DF3A 4MKTA 1X7SA 3ZY7A 1PFOA 1W0WA 3QRGH 5HD8D 4FQXB 3RJQB 3UPRB 4KKAC 5I76B 1H3VA 2ZT9C 2YAPA 3DYOA 1XGTB 3UBXG 4UNUA 4JANA 4HIJB 1IC5H 1WBXB 3AS2A 3K6SA 4LHQB 1Z32X 2VCOA 3AGWA 1WISA 3BZ4B 5HGDA 1QPPA 4R84A 3BIKA 3QH3A 4JPKH 3OHXA 1NZRA 3T2QA 2O5XH 5EIIB 1AMYA 4JRXB 3VD4A 3PJSB 1SXCA 3DX9B 4LHUA 2R2BB 4KO9A 5F7DB 2B1AH 4YHYC 4GQ9H 5FA3B 2V8MA 2J2ZB 3MUUA 2FO4A 1QFWI 2Q6WA 2UXTA 5KSUB 1JMXA 1MCLA 3HZKA 1EZUA 2IFGA 1XF5A 3OLIA 2CO4A 3V5DA 4K3EH 3F2LA 4M5ZH 3BGFB 3RVVC 5EWIH 5E94B 5GGRY 4EXKA 3CZGA 4MQXD 3HVNA 4ICWA 3MRJA 5HDLA 4X7EC 1L6XA 4HWZB 1OQOA 4M5SA 4WENB 5AKTA 3TCLA 4Z3TA 1X6NA 3DUSA 3QORB 4ZFZA 2EC9T 4HWEL 1CPUA 3CZFA 3CDYA 5F9DC 3SB3A 3CPUA 3IU4H 2KZKA 1UM5L 1IAIM 3DC0A 1U3JA 2MPAL 3V6FB 3OB0K 4BSVA 2Q0ZX 2VWEC 3EZ8A 1SBBA 3PAZA 4XMLL 3WIHH 5ACZB 4R26H 4ZTEA 5H37H 1JF6A 2H0EA 1A9EA 1V5JA 4MD0B 5LAXA 4OZIF 2UWEE 3VXSD 3O8XB 3ESVF 4PJGA 4F8TA 1HAWA 1A8ZA 5D6CB 1A7OL 2RFXB 4XXWA 5AB9A 1GS8A 3NIDE 3UTTA 5ICZA 2APBA 3NIDB 1NPNA 3MSPA 5GGSB 1GTFA 4LVHC 4P49A 5J1AA 3O6FA 4JFTA 1KXVA 3CFDA 1U95A 1H0DA 2ZUUA 3KLLA 1JV5B 3P4NA 1NLDL 5IK3A 3RNQB 2A9CA 4MNGE 2Z8VC 2FHBA 2Z93B 1IJ9A 2GUYA 1QBML 5LWYH 5J11C 1OZTG 2HFFB 1FHNA 1UJTA 4YSEA 3BLBA 3FO0H 1TJGL 3PHOB 1RLBA 1N6VA 1F5WA 2VLJB 2F2HA 4U0RC 4YHZH 1YJDL 1OGAA 2QADC 2EH8L 1FYTD 1QTSA 2BSED 2CA3A 4ODVH 2VR9A 4MS6A 4IRSC 1EHAA 4FGMA 4G7VL 3E6FA 3NAAL 3JV4A 3NPZB 4M43L 3V9EA 1OP9A 1RI8A 1BD2D 5TDOA 3G6AB 3GDCA 1OOWA 3A23A 2B08A 4YSOA 5E9NA 4WWOA 4A2LA 4ODBD 3CH1B 1DVFB 4G5ZL 4Q6YA 3QIWA 4TVPD 1MHEB 3MV8B 3C6LC 4DTGL 4Z7VE 3INOA 3L3JA 1WLHA 3OXRA 3QS2A 2MHAB 3HE7C 1JPSH 1CK0L 4I3SH 3ULVF 4GAAA 3PREA 1DHKA 4ZPTB 4NJAL 5IJKA 1XEDA 4ETYA 4RDQF 3IFLH 4JKMA 4MMYA 3IPFA 4P3DB 4I1PA 3BEWA 3QDMB 1HSBA 2WIIA 4PBDA 3U0TA 2OTWA 4IOIA 4MWFA 4DPRA 2AJSH 2Z7UA 1NUDA 2YWYA 5J6SA 1S3KL 3V5KA 4IJTA 2FSEB 2R1WA 1XXDC 4GO9A 2P5WB 3HE7D 1KELL 4OGZA 5CKGA 1QPKA 3IDGB 4KJYB 3QUZC 2GBAA 4WV1A 4OF0A 1WAAF 2CMRH 3AM8C 4LNRA 4M8RA 3WAKA 3LPGA 4RLDA 1HJCA 2H3NA 5E51A 3IGKA 2XQYA 4DZBA 3OHXC 3MREA 4M8QB 2OFQA 1HU8A 1VZIA 3IGAB 1Z0NA 4F2EA 2VC2H 1DQJB 1HHIB 3BH9A 4F8OA 3LSOA 1AR2A 2P43B 3VXRA 4PRDB 4ZG1A 1QATA 4CJ0A 4XXDB 3FB5B 1ZTXL 3L9RB 7TAAA 2EUZA 2ZCKH 3BZFB 4NDMA 5I0XA 2EVHA 1G7MA 3QR1A 2YD6A 4R0LC 4WSJA 3VXTA 3PXHA 3W9DB 3IGUA 1JZ8A 1EERB 2WANA 4TN9A 2EEFA 4O5LH 2VDQH 4AYID 4NCC1 3OHMB 4DHLA 3QIBD 1H3WM 2WSKA 3GMRB 4R4NC 5AL8A 4E9YA 5HHMB 2VXUH 3CVCA 2Z1PA 2CZNA 4LDOB 1QACA 4PLJC 4AGMA 3Q5YA 4DN3L 4AG4H 5BMFH 3V5HB 3ARBC 4L0PB 4M6NH 4XPAL 2HSIA 2J1ZA 2XN9E 3D2UB 2GSMB 3DBXB 4GAGL 2WUCL 3JWOC 2Y2YA 4CU6A 2OL3A 3H7LA 3T0BA 5MEOA 1J0KA 4RA3A 5F7UA 5E9AA 3ZDZF 3U83A 1OE2A 1DBML 1WA0X 4OD3H 3IMTA 2D7TH 4L1LA 4C47A 5F44A 1KYFA 4ANXA 3T77B 2HRGA 4YJZL 5MENB 5C7XH 1IEHA 4GNKB 4HSAC 2AEPH 3MLTA 2WKLA 3H0TB 3AB0B 3TPUA 4NEHB 3ZT6A 2ROXA 2K78A 4GEJA 1FQ9C 2Q20A 5IB1B 5H37A 5FW6A 4ELME 5ACZA 2BFVL 2PPDA 1NC2B 2VO8A 4MKMA 4TSAH 2YAMA 3JWOL 2I60L 3HBPA 3X13B 3EJPA 1KJ2A 1THCA 1Z66A 2W9DL 1E4XI 2LLLA 3D7PA 3OF6A 3SGJC 1A5FL 4R3SB 2YRLA 1DVYA 2H5UA 5SV4A 3KPMA 4GQPH 4XCYB 4PJAE 1SPDA 4AH2B 4FQ1L 2R29A 2FCBA 3PYCA 5E8OA 3TEXA 4F37F 3WNOA 1A9VA 2IQAB 1J9TA 4P4KD 3THMH 5AVVB 2QR0A 1DQQB 1TSHA 3D4ZA 4MAUH 2O5ZH 1KELH 5J8OA 5C07D 2CUIA 3GTTA 3RWGA 4R6UA 5C8JB 1UACH 2OLDA 1TITA 5E70A 3QQDA 5GS0H 1MJJB 3TESA 3VFSB 4W4NA 1BXVA 1F8TL 1U8KB 1RHFA 4CAGA 1MWAL 3TN0B 3WUWG 4HUUA 2ATPA 2OKMA 5GGVL 4F7EB 2XBZA 4OD2B 3RDJA 1VIWA 5IQ7L 3QUMH 4G6AC 3GSWB 1AD9B 3Q2NA 1E2WA 4KHTH 2BP0A 3SZKC 2WD0A 1CZ8L 3UADA 1JNNH 2VLRE 4W9DC 3CHXA 3ZZ1A 4BZ1L 1KY6A 3NIFB 5F6HI 1TU2A 1AQDA 3Q3GA 4I0CC 6PCYA 1ZDSA 4L48A 4W1TA 2GY5A 5E6YA 2BVUA 4JG0H 4PB9H 1KIQA 4PJFE 4OKDA 3I50L 3WGUB 5L2KA 4TLTA 4BWWA 4WV1C 3WE6B 1TVBB 4TM9A 4OZGF 1KEGH 2BWQA 3IDJA 1A9EB 4F57L 4NENA 5H2BA 4MXWH 3SGDI 4CA4A 3QYCA 4NSKA 5CD5D 4G7VH 2DIEA 1A0QH 2DYRB 3C5JB 3EJZD 2VLLB 5IT2L 1ZJAA 2V3DA 4YHPA 4OF7A 1FCCA 2GIMA 5EU6A 4QY8A 1YY8B 4AKPA 4BXVA 2GJ6B 3KBEA 4LASH 4HSQA 1DZ0A 4X5LA 5CEZL 5BQDA 2JELH 2P26A 5E24E 4I0PB 3U9PH 1TTAA 1WICA 4HEPG 4K71B 4UBDC 2V17L 1C5BL 2BP3A 2DEXX 2WINA 2HP4A 5JNYA 1JVKA 3RY5A 3LKQB 2YFOA 1R19A 3DURA 4NXSA 5DD6A 1ETZA 2Z7WA 3DDFA 3MRDB 2IXQA 5JW4Q 1YZZA 3CFTA 2VDPL 3GEFA 4ZPVA 4Z3FA 2G75A 3NEXA 1FI8C 2WUBH 1B4LA 3PWUA 4NQDD 3RI5K 2W0KA 1JHTB 2NY2D 4H40A 1RZJC 3X11A 2QQQA 2XN9D 4PJ8B 3EJYC 5K93A 3GBNH 4G8EA 1NFIB 1MFEL 5F93C 5GIRB 5EV7A 2DI7A 1U93B 3OZ9L 4TLSA 4PRIA 2CKNA 5D7JD 3TJPA 4DP8X 2VITA 2NDFA 4FLOA 4Z7WA 1RLWA 4HPOH 4UT9H 3T3PF 1BLNA 1EDYA 2BNUB 1CGSL 3TIDA 1CXKA 4XB3A 2BOBA 4OZFA 5K33A 2I7SA 5C0BD 2X10A 2EEXA 3MJ7B 5MENA 3F7PC 3EBIA 4NNYA 1MLCA 1VDGA 3MRKB 2V9UA 3F7VA 5DWUL 2CH8A 3UTSD 3N6YA 4IQHA 4JO1H 3STLB 2R83A 2HTKC 4ISVA 3TIEA 2EKSB 2IV9A 5BS0B 2YMOA 3BCDA 1QAWA 1FL5B 3G5VA 3I9GH 5TGBA 3LVEA 3EOAA 4YDKH 3QORD 1U3HB 4U1IA 4IMLA 4TNFA 1H5BA 4J3WA 2FHFA 5IESH 5DRWB 4JPKL 3BH8B 2B39A 1W72B 1M05B 4OFDA 3D39A 5GGQH 1X9LA 3O0RL 2AEPL 5AOJA 1OAYL 3B2DC 1XFPA 3N85H 5IHUL 2H3NB 4A2EA 2VXQH 1OCWL 4R0LA 3P0VH 4XT1C 2XV6B 1ETJA 3I3BA 2EXYD 4FF9A 5EO1B 4KTYA 1K4CA 3UTPE 1Q0XL 2VLME 1IQDB 1WEJH 4QYOB 5F0MB 3H4FA 3WFEL 4B7IA 2ICWJ 3HRZC 1F00I 4KJPD 3GSQA 1QW8A 2X1WL 3BZEA 3L2MA 1JHLH 4MGXA 3FMGH 2EILB 4N0YL 3S48A 4ZFQA 1BOGB 1SOSA 4OW6A 4U6YA 3SKMB 4POUB 3PWLB 4V1DE 1HQRB 1Z9SB 3Q43A 4PCKA 1D7FA 2ETWA 3NCEB 4XN7A 2X6CA 2NTSP 3AM8A 3GTVA 1TTCA 3EO9L 1JRHH 5AUMB 5C6TH 3RDTC 4XMWA 4FXGC 3S5YA 3SQOH 1IB5A 1MNUH 2F6AA 2F8VA 3FFDB 3VXMB 4JKWA 3ARUA 4Y2DD 1CXLA 2VRKA 4K3JH 3NABH 1CE1H 1Q8MA 2A0LD 4KJPC 3DIFA 3BC9A 3WNMA 5JORA 3LN4A 1ADQH 2P5PA 4JRYD 3KEDA 2MWCA 1RJLB 4NWUL 1CR9L 4C56B 4YE4H 3S3BB 5E5RB 5HBBA 1BD2E 5CEZH 3QXDB 1RSFA 4BH7B 3VDCA 5CJOH 2FRGP 3CMOH 2OXHA 4MRBA 4KKBC 5E2JA 3L4CA 3D85B 3ULUL 1G7IA 3BIAX 4JHUA 1AKJD 3D33A 4I77H 3IDMB 3HZVB 3C9NA 2A9NH 2NYYD 4W9ZA 4Q4IA 4PRBB 3BAIA 1QI3A 3AQXA 4DEWA 2X1OA 2W60A 4ZUSB 4AQEB 1LWHA 3ATEA 5K1JA 1TJGH 1C5DB 3WFEH 2X4NA 1UKQA 2IIJA 2VQ1B 5CR1A 3L5XL 4UUJB 5BUPA 3SY0B 4X6EB 1G0XA 3RA7L 4QHLA 1BQ5A 3NIFF 1FG2B 1SYSB 3EYQC 2ZOLB 2BHFA 4G11A 4W9HC 2WVVA 2C3VA 4HJGB 2PR4H 1E43A 4L3EB 3WU1A 4F7PA 5E6IA 4K5LA 1MQKL 5KS9F 3LKPB 1XIWD 2E56A 1UD5A 2WAHA 4JDZB 4NC0B 4QR7A 5CLWA 3O2VH 5E5MB 4HJIA 3G6JA 1BWWA 9CGTA 5EUOE 4CDHA 3E8UL 1MCWW 5ETUB 2CPCA 2LW3A 3QQDB 4K7FA 5K39B 4AM0B 1A6UH 4ATWA 1X5YA 4RFEB 4MAYB 1TZ8A 5I74B 1WGOA 5L6YH 1BVNT 5C6WH 1FVEB 4JHAH 1KXQE 4HUUB 2UZYA 4FULA 3ME0A 1EXGA 3NSXA 4HWNA 4OLWL 1MIMH 3CFBB 2QADB 5IGXL 4RGNB 4B9YA 1TTRA 3WMSA 2NNFA 4NGHH 2AK4A 3UPCA 4DKEL 4F7MB 2HN7A 3NACH 2DMBA 4UYPA 4S0SD 4RWHA 2FYYA 2PPCA 4W9EC 2GJJA 4PTUA 2APXA 4DKFL 4L1HA 5J57B 4BUHA 3K6SB 1QBMH 3ARQA 2OMXB 3MV11 3GMMA 3MRGA 1FSKC 2DLHA 4KZDH 3TH3T 1R3IH 4PREA 2TRHA 4HLJA 3V7AE 1UT1A 1VFBA 3ELAT 4ZMXA 3FONB 4LSUH 3VI4F 3BQUC 2DQCL 1UB5A 3DI3B 1MHHA 3TV3H 4HS3B 4HPYH 2PTUA 1E4WH 2BIQA 2EUVA 2FEEL 4NAMA 1JPEA 3MYZA 3A5VA 4OBSA 1EEUA 1S7RB 4PJCE 5FGBA 4L3FA 4N2DA 5MEQB 5D70L 5HHOE 4HXBH 4KI5E 4AZ8A 1HEZB 1IQDA 1XAKA 1P1VA 4BKLA 1U4EA 2KKQA 1QBLL 3Q8BA 2OJZH 3AG4B 4Y4FA 5D7HA 5F7FA 1KDIA 1MIML 4GEIA 5IIEB 1RZKC 1AGEA 3NACL 3LMJL 1NIEA 5IR1A 1MVUA 4HV8A 2ADJA 3T0AA 1G94A 1NC4D 1T66D 1B0GA 3H7BB 3D87B 2G75B 4XWGL 4A6YA 4U1LB 3L7FB 2HFFA 1UWXK 5HDBF 1F2QA 1NDTA 4FFYH 4JFZL 2PP8A 4QTIL 1E7VA 3K8MA 4L1TA 3X12A 4CC4C 4LPXA 2ODIA 3UTTB 3KLQA 5C0RH 1UGKA 2YRBA 4PJ8A 4L29B 1EPFA 5EEVA 1NGWB 2EH7L 2MQGA 3RKDD 4U3HA 5FS5A 1PZ2A 4PRHD 5DJ0A 3KHOA 1K3ZA 2PCXA 3DKHA 2IAAC 1WSST 3CVBA 1J86A 5DLML 5KOMC 1VGKA 4I85A 4X8JA 3UO8B 5HTSA 5A1AA 1IBFA 5IQ7H 1IFRA 1HE8A 4Z8FL 4TPRL 4JO8A 1QWUA 3MROA 5I82A 5DLMH 4E2OA 4H1LB 3G04A 4YHML 1NBVH 2WC7A 2ZQKA 3PJLA 1DVFA 3NZSA 1BJ1J 2J4WH 1XZWA 4HBCH 3GF8A 1EAQA 4PQXA 1GYCA 3ZO9A 1BM7A 1DCEA 1XZ0A 2QQLL 1F6AB 2VDQB 1I8LA 4KJWD 4ZFGL 1U9KA 5I8OL 5IVXA 2KBGA 3FDWA 4ENEC 1T1ZA 5JYMA 4PGDA 3EXLA 1B0WA 2AS5M 3BVVA 2XNAB 2M26A 1A0QL 3O8XA 2I07B 5DFWH 3N1QC 1NEPA 1U92B 1PU0A 4Y88A 4E41B 5EPMB 1MFBH 1UCTA 2YPKA 3OPUA 4J1UB 2HT2D 3ARDC 1FLRH 4BFOA 4KI5D 5CJQL 4AZUA 1WA1X 5IK3B 2V7HB 2GI0A 1ZEAL 4HKJB 1Q9LA 3H2QA 3GHEH 4E9RA 1ITCA 1CT8A 5CS7A 3EJYD 1HINL 5SX4I 2JLPA 1VRSA 4NRZB 4KKPA 3UFIA 3E2HC 5JR1H 4EZLA 3UIYA 3GGWA 5AFAA 4YAQA 4MAYA 4UB0H 2KI6A 5DJ8B 1M6UA 2VR5A 2FX9H 2DQCH 2VLRD 1IT9L 5C7XL 3QULB 4F15C 1J11A 3LZOA 3HUJE 1A7RL 2EDMA 5C6TL 3K6IA 4YXLH 3FMGL 4N0YH 3UXFA 2DDQH 3TBWB 3CH1A 4PBWD 5F1NB 1DLHA 2WWKO 2GTZA 4UT7H 5DK0A 4FTVA 4JZNB 4YUEH 1ZLUH 5IW1B 2AVGA 1ORSA 1RJYB 5IEHA 3PGCA 3DVGA 4PRDA 1PDKB 3KE0A 3VA2C 4XHQA 1MEXH 2KQMA 2I32A 1I85A 4FZEH 4GRMB 2A9BA 4RMRA 5IQMA 5JXAH 4KRPD 4U4IA 3VRIA 1MHHB 3WIFB 4C4BA 2EUXA 4BZ1A 2CGYA 4PJXB 1GW0A 2EC9U 3MUJA 5A2AA 4Z95H 1OHZA 3MRNA 1QLEH 1YMMB 2BVYA 3ZN6A 5DSCB 4LCIL 2Z0UA 4N2MA 4OZHB 4R7XA 5KANG 4S2SB 3PAUA 1HEZA 1WFIA 1NCGA 1RZ8B 2KH2B 2R2EB 5IW3A 4B9JA 1BG1A 1DBKL 1TZAA 3NJXA 3MLTB 3G6JF 2KMWA 3NCJL 5JW3L 1R5WA 5CO1A 3Q2LA 3NH7L 1XH3B 1YNKL 3EYFA 4NZTH 4WIQA 2CUHA 3C08L 4LLQB 2E3VA 5IMLA 3K2UL 4AZ8B 4GT7A 4HULB 3OWRA 2UX6A 5ITBL 3SGKA 1PX8A 4PGCB 5AB1A 3K0YA 1KCWA 2G5BB 1R3HA 4K3GA 2ZSWB 4XVJH 3SE6A 3N0PB 4W6XB 5JPMC 4LT7A 4UT7L 3WBDA 4B5ZA 4B53A 4QRTB 1KIUB 1NEZA 3BRGC 1AJ7H 4P2QE 1OW0A 3ZUNC 2BCKA 1JPSL 4HGMA 1TEGA 5J6HA 3CK0L 1G7LA 3DVFA 3DI2B 2EIJB 1HNYA 4WTZG 3V9FA 4LCWB 3RZCD 3KVPA 2EIKB 3ALXA 4V2CB 4YE4L 2EEDA 3PV6A 3MV8E 5TFSH 1F3JB 4FFWD 3DROB 1XIWB 1FUNA 3ZHKA 1UWGL 4YL4A 2OZ4A 4B0MM 5AYUL 3MX0B 4JRWA 4NKQB 2WWKT 4NAQA 3RWFB 4Y4KA 3MRFB 5J11B 2XRAH 3G08A 5T33H 3EDJA 1IARB 2BP0B 4NZUH 5JZ7D 2ZIDA 3KWWB 5KVEH 4U0RB 4HDIA 3JZ7A 2NY2B 2FQDA 5HYJB 2J88H 1BEYL 4I5BA 5EOTB 1EHNA 5SX4H 3RWCA 2QV4A 5CUSL 1RULL 4QXUH 4AGLA 1CBVL 1T03L 5IKCA 4IBSA 4XMXA 1EAPA 4N0CD 1THAA 1HS6A 3KPLA 5FHBL 1XGQA 2WSPA 1Q0XH 3HB3C 3KPPA 2OMZA 4I3RL 4X8XA 4UNVA 5LN8A 1D7BA 5C2UB 4PW9A 3UO1L 5DFVC 4TF4A 1GW6A 5CEYB 4JFXB 2EIMB 1N18A 5BQ7B 1E6JH 2AXFB 3ESUF 4NJAH 4G72B 2VRAA 5E2TH 5AEAA 3GGWB 4AH2A 3OX8A 4XMPL 2LOEA 1BYOA 4JN2A 5HI4D 2GT9B 5E2TL 2J5WA 4OCSH 3CBRA 3STBA 4NBXB 3BAXA 2BXZA 3HB3D 5GS0L 5KANI 3HE7A 2PLTA 3WDJA 2D03L 1T6WA 3K7UA 4UOW0 4ZMYA 5I2IA 2EACA 2N3JA 2W59A 2BWDA 4XC1H 3SKOA 2P46B 1A9BA 1I7TB 3DO3A 3QUYD 4JKPL 5GS2D 4F3FA 4L3CA 3FTSA 1I1YA 1ET8A 4E42A 4J39A 4IRZH 1JYWA 4U1SB 3EJTA 3CU1A 4PWHA 3QUZB 2XWEA 2DWXA 3UBXA 5CUSH 2YXFA 2PW1B 1RK1A 2WINB 1B4JH 1RIVL 4O9HL 4U1JA 3V4UH 2HJKA 4OZIE 2PF6A 4OQ1A 2WZPD 3VGGA 3OGCB 1BBDL 3ETBF 2KHAA 1UOKA 1DANU 2D31B 4Q52A 4NM4H 2I60H 1OCCB 3BLPX 1UM6L 5BV7H 1ORSB 1I8MB 3QEHB 1F58L 3ULSA 4X5RA 5B1BB 2WLKA 3LEVL 5AWNL 3MLVL 1KT2A 2P8PA 4I1NB 1J18A 4FLHA 4BINA 2B14A 1DQKA 3FQWA 5MP6L 3V0GA 2UZXA 2NPLX 3D30A 4YHIB 5EULV 3LIZL 1K2DA 3S88L 1P4BH 2OX5A 3FB7B 3S96A 4O02A 3UGUA 2AEIT 1CGYA 3H3BC 2DH3A 3GMPA 2MCAA 1A3ZA 2UXFA 4OZHA 3T8XA 2BSSB 1NJ9B 2YMXL 3CFJA 3TPKA 4KQ0A 4TNVF 5AG9A 3N1PC 1U8PA 4DNLA 1IBBA 1A1OA 1XSOA 3F3HA 4HS6B 3QI9D 1SGKA 4WEBL 3CE1A 1MI5E 4Z78A 4NGHL 1ZD6A 2AANA 1IC1A 1UQSB 3LKQA 4M8UA 3BN9C 3Q9PA 4LSRH 1EFXA 4Y1AD 1E27A 2XYBA 1Z7JA 1OVZA 3EOBA 2R29L 3U46B 1CLOH 1FF5A 3UZVB 1P7QA 5DVLA 4W9IC 5E8DL 5DUPL 5KVFE 2FLRT 5C0NC 3BVWA 1MRCL 3V4VA 2VAJA 1T4WA 4XRCB 4XP6L 4J3VA 2FUQA 2YJLA 3RIFF 4WW1B 5KVGE 4ZXBB 3TZVD 4PB9L 5CBAA 4WHYH 2BVTA 3RX9A 1NH6A 3BUTA 1YEJL 1HQRA 1Z9SA 2NX5A 2A3TA 3EFOB 4QRTA 2W9EH 3LIZA 3P9LA 3VVWA 2CPUA 3FZUC 1FVCB 3AAZA 2R2HB 2YD1A 4OVUA 4U7SA 4LAQL 4X7FC 1JN6B 3NESA 2C9SA 1J48A 1JMZA 2ARJA 4P4KA 1T66C 2PN5A 4ZDHB 3TBSA 5DTFA 2GVYA 1DEEA 3OKDA 4K15A 1BFOB 1N12A 3E38A 1PG7H 3MN8A 2V7NA 4QO1B 3QZWA 3ZE2B 3NIDF 3IFPB 4R7LA 3CZSA 5AVQB 1SEQH 3MXWH 4BRJA 4X0KB 3BUQA 3PJNA 1SYVB 1N2RA 4JPIB 2QPEB 4PJAA 2Z3FA 3H9HA 2FEJA 4G6MH 4WWKB 3BKYL 3VD9A 1A3RL 5I6NA 1MFCL 2WXGA 5C0EB 4D9LL 1JZ5A 1HWGB 2OV0A 4FYRA 5I8EB 2ARWA 5EC2A 1OCRB 2COQA 1MRFH 4OCXL 3PQYB 4JO3L 3OTTA 1RULH 1A7RH 1YPZE 4QXUL 2JQZA 4RA0C 1VADA 5HI3D 4ELMA 4APQC 1S7WA 3T4AA 4DJMA 5CFAA 5I6MA 5HYIA 3L4VA 4W6WB 2F54B 5IMLB 5GGTH 2IQ9H 3ZE0F 3D85A 1XGQB 3KPPB 4PGBA 3RLSA 1WD8A 4Y5XC 5CLXA 1YEEH 4LL1A 4KTDH 3O0LA 1NC4A 1D3CA 4XCFH 2ZG3A 1CGTA 3N9GL 3AY2A 1KBGH 4O02H 3VX0A 1PZUB 1KGCD 2C3VB 1NPUA 3FQUA 2XCMC 1TQCB 1HK6A 2XV0A 1NFAA 1J05A 2CXKA 2YPVH 5DVNA 1LE5A 2M8XA 1W8OA 4KK5D 1A6TA 3LRMA 1L5GB 4HEMA 2E59A 2WY3B 4OLUL 3FQTB 5ISZE 4B9GA 3REWA 2DQEL 4JFDD 3BW9B 4JLRB 1GIGL 2DQTH 2R0ZH 1S46A 4G1MA 4HETA 3MYJB 3SEPA 4ANVA 5IB2A 2IANA 4WW2B 3GSOA 4XH2A 5BVPH 3UDWC 5EZIH 15C8L 5D4QA 3LH2H 5IQLA 3BKYH 3PV6B 2D31A 4G6ML 3KCWA 1MHEA 4M8QA 4YGAB 3D08A 4D0BA 4OLXL 5CZXD 5T1KD 5DF0A 2H8PB 4PJIE 2F5BL 2X89A 4PJIB 4UV4L 5AW9B 1KIRA 1ML0A 3DTDA 4KV5E 3U25A 5A2CA 2PW1A 5DFAA 2JKTM 4I87A 1OAUH 2DN7A 1A47A 4NB7A 4YXHH 4WU7B 3WEMA 1BX2B 4JRXE 1HE7A 1XT5A 3SCMB 1IAOB 2KC0A 3S36L 4MQSB 4KI1A 1IGIH 4H88H 2NY5H 3BISA 4A7SA 3MRHA 4QCIB 2LABA 4KDWA 4LIQL 1DDHB 3EYUH 3ZL2A 4PTTA 5EZLB 1X6LA 1U8PB 3RGVA 4APXA 4G1EA 5F7HA 2XZAH 4ZPTA 4YIQA 5FO7B 4GIOA 1T6VN 3BSZH 2C1OA 3NJHA 2C3WA 2HKHH 5IB5B 4LLWB 1A25A 2XFXB 5MEND 1ACYL 4QD2E 4OJFL 4EUPH 3H0TA 3NA9L 1UH3A 4WJKB 5I1DA 2R0LL 1NQBA 2GJ6D 2AXFA 1AAJA 3QDAA 3PL6C 1X5HA 3D69B 1ZCRA 5L88L 4HH8A 4Y7OC 4Z7VF 3CSPA 1LP9F 1R24B 3D52A 4DGIH 3EBGA 5LBVA 5GRYA 1F0LA 4JQVC 3W11C 4ZMZA 2E4TA 3WKMH 1I7UB 4WHCA 1OF0A 5C3TA 5TE6L 3WXWL 1LEKA 3SDXA 1MCPH 2FBJL 3PHSA 1OAKL 2ZX7A 2A6KB 4BQ6A 3FW6A 5HHVL 1N67A 1T0MB 4IDLA 4WDIB 3HPJA 3FF7A 2LFEA 4MNGB 4A6YB 4X99B 3UBXB 4RX4D 4ZUWB 1P53A 5H4YA 1G6VK 5IVNA 1M7DB 3VSQA 1Q9OB 2ZUWA 2GITA 3II1A 2XA8L 5DTFB 4Y19A 1AC6A 3WNJA 4F15B 5IM7A 1ZVNA 5GRJH 2ICWB 3IGFA 4HZLB 1NANI 4N2GA 5DLLA 1BD2B 4G8FB 3IVKB 1DJIA 2CGRH 3D2UD 2HJLB 4G71B 4F9LA 5BV7L 1FL6A 4IKIA 2JE8A 1CI5A 1UVQA 2HH0H 3ULVD 3A4EA 1RL1A 4AT6B 1GGBL 2B20A 2PABA 2CKBH 3D12B 4UIKL 1JNJA 1I7ZB 5GS1A 2DQIL 3BZ5A 3QJVB 1EZSA 2X1PA 2B5IC 3BXNB 2X9WA 4N0FA 4Y2NA 3W2DH 1KV7A 4JY4B 4QLWA 2V2TA 4G9FE 3MLRL 4G6JH 1TXKA 3ATDA 4JR9L 1AHKA 5F1IA 4N2FA 5D1QC 2N4IA 2BNQD 2OX5B 2EXWC 1IKFH 4KX8A 5SWZD 4AMXA 2W65A 3I9AA 5L6YL 5L9DL 1KZQA 5T1KA 5C09A 3FUIA 2BNRD 1PX4A 3C09C 3ULVC 3D0VA 5D7KE 1FVDB 1QSFE 2FJFB 4U6VH 5BRQA 3GIZL 1JDDA 1SLWA 5BV7C 3ZTNH 5I19L 4JKLA 5FYLL 4Z78B 3B7RL 2JFCA 1CF1A 2XQYG 5TF1L 4N0UE 3VWJA 1A7PH 4R5XA 1WZAA 1YN6A 4GW1A 4XBGA 4A7VA 4AC2A 1TQVA 1L7TH 2OMWB 3QJXA 1J5HA 2ZX5A 2NY7H 1T89C 3WTUA 1CXEA 3UCQA 1BMZA 4NRZA 1ZDQA 3RL1A 5KG9B 2P8LA 2DI8A 3IF1A 3I9IA 2VN5A 2C4FT 3DXAE 4K4KA 2WZAA 1NWOA 4NP4H 2PO6D 1CYXA 2BPBA 4FTVE 5FECB 1FIGL 2X3BA 2OK0H 2XPGA 1YDPB 5ICYA 4Y2DB 3R4DA 3GSXA 4NQCB 2QR0B 3VXNB 3CN4A 5L8KB 3CHQA 5D7LD 3W2DL 2EDYA 1Z9OA 5C08E 3U9UA 4KNTA 3S37X 3QJFA 1XEUA 5HHOD 4R90L 1LQSR 3MRLB 5KUMA 1FNSL 1DQIA 3VD0A 3QUMA 4OZ4B 3V4PB 4U1GB 3SPGA 4AK1A 3AT8A 1U30A 5C0CD 1DE4A 2E7LC 4ALAH 5DRZA 3JSSA 3RIKA 3F04A 2XWTB 1P2CA 4L0YA 1JZJA 4J3OF 1USQA 4XN1A 1KIPB 2BOBB 3RUGF 3SBPA 4DUXA 1YAZA 3K80A 1R3JB 4F33B 3P4OB 4OZIB 2DRUA 4HOMA 1VSCA 3DBSA 5K1NA 1IGML 4AEIL 2OR9H 1I9JH 1XCQB 3QEGH 3ZIMA 3PQYA 5HGHB 5HDQH 2CLZB 2VSKB 1DBMH 4J2QA 3EO1B 5KYXA 2NLJA 3SE8H 2F9BT 1WFOA 5L7XH 2ZUQB 1T4KB 3ENEA 1S7XB 4DGVH 5ERWB 2JKIS 4RGOL 3F12B 4FOMA 3KXFA 5D2NB 3RBSA 3NSCA 4GAGH 3CFMA 3L48A 4Y5YA 4KZDL 2VNCA 4GSDH 4QHMA 1JUFB 4QT5A 3NZ8B 3DWTA 1OWRM 3MRNB 4M1CD 4X4XB 1PG7X 1TT6A 1OTTD 2X4UB 2ADGB 3FOMB 1LK3L 4A66A 3T0DA 3O9WB 3ULUF 2J12B 2QSTA 1T0MA 1OCWH 1EHKB 1YNKH 4NZTL 2VM4A 3QNYB 3VFRA 3S88H 4PG2C 4P46B 3QQ9C 3N40F 2VMDA 4YL9A 1SOKA 2WLHA 2IANB 4WW2A 2H4EA 2WQXA 2X3CA 2WNKA 4AYDC 2J2ZA 2VXTL 3VYPA 4LLQA 3WHE1 2ZONA 4LIQH 2B1OA 5LKNA 1KIUA 1NEZB 3E8UH 2YEZB 3QRFM 2DB8A 1ZLWH 4Z7OE 3QDJB 4OTXL 4NERA 2YUWA 2PXYD 5AW2B 3VFOA 4HXAL 1K8DA 2B4CC 1PD1A 5D9SB 1NLBH 3EZJB 3KLSA 4JO1L 3BZEB 4PWFA 3LZNA 3KDMA 1M2VA 2FX7L 2XVLA 3DIFB 2FQGA 5IFAL 4XMPH 3MRCA 4PYGA 5JA8B 3B6SA 4LL4A 3QWRD 5IOPB 3LXAA 2ZXQA 4PS3A 3MV7D 1OSEA 3I6KA 4XPBH 2CUMA 3TURA 4KTEH 5AW3B 5GIRA 2ESVB 4OD1H 4CSSA 3MU3A 4DP5X 4PAZA 4AV5A 1TQUA 2BVQA 3C8DA 2JNZA 3MRHB 3JWNG 4ZD3H 4GP5B 4QRQB 1UVQB 3IS0X 2FSDA 4Z5RB 2I27N 4L5FH 2ALWA 3KG5A 3C5ZC 3SDXF 2O93L 2QGEA 3CHSA 4PRBA 1PJ9A 2WQVA 3IFNL 1E4HA 1HCZA 5CN1A 4HIXH 4R2GD 5A40E 2ZP0T 3DV4A 4QPEA 5ICZB 2Q2EB 3CN3A 2V5MA 1A7QH 3TWCL 3U2JA 2XG4B 3OKLA 1RZIA 4WWNA 2CCVA 5DHYB 4NWUH 2MCMA 3MBEA 5HYQB 1AP2A 1ITBB 1FFNA 1GPOL 3E9TA 3OJ2C 2W95A 3BEWB 3QDMA 3QPXL 5F96L 2F8XC 1QYGH 1U58B 1TO4A 2BZ7A 1MG3C 2GSGA 3U7YL 4N2KA 1R33A 4TUKL 2A73A 4QHUB 5DWPA 1FNAA 3ZDXB 4QRAA 5DO2D 3DVIA 3VGEA 1Z9PA 4KKAD 2AJXH 5I71B 2YEVB 4K07A 3QCVL 4WTZA 1QHQA 3FT9A 1H6FA 1GY2A 4FXKC 2OS7A 3FL7A 4QHLB 5IFHH 3KPOA 1WPCA 4KH2A 5D1XB 4WUUD 1UYWH 2K4WA 1NUNB 2HG5A 3S9DB 4BZ2L 1MCOL 2LLGA 1TEFA 1MHCB 3MJWA 2X4TA 3DSFH 1XF4A 2BIHA 1I9EA 1OTSD 2ZKWA 4JFFB 2CBTA 4R9HA 1NCAL 1NCDH 3V0JA 1ZHKB 1J0YA 5BNXD 5C0GB 5ITBH 2ARJQ 1P4IH 2Z8WC 3GPSA 4L4TA 5I0ZA 4BZ1H 2IBBA 1AI1H 2QVIA 1KTBA 1IKNC 2CM6A 3BGFC 3QHFL 3MRLA 2NNRA 3WGVB 3IAPA 4FXGA 3U2SB 4ZW7A 1ES0A 5ESVB 4L9LB 4P5MA 1FO0A 3KPRE 5C07E 3BUDA 4P5TC 2XWTA 1GJIA 3T3PB 4EI5D 3QG6B 3P0YL 2P5EA 3PP3H 3MBXH 1KCUL 1ZHBB 4WFEE 5BZXA 2WV3A 5JIHA 3SODB 3QIBA 3EGXB 3QQNA 4ZS7L 5HDBE 4C4KO 2ZYRA 1O9VA 1KBWA 4HBQA 4HWEH 1N6QH 2DWTA 2ZWNA 3NP3A 4LP4A 1ZA3A 2F15A 3FFCB 5HY9A 5IROA 2NY3C 4CVZB 3H6JA 2KZ1B 3FU7A 3TF7C 2FGWH 2APWA 2O5YH 4KX7A 2JCCB 5KBPA 1OSPL 3UP6A 2HUHA 3QXAA 3HZMB 3WO4C 1D9KC 1D6EA 2D4FA 3IXTB 5E9DE 4FFZL 2VXVH 1FYTE 1RZJL 3FCUB 4D0DA 1XV8A 4MA7H 4M7ZB 1A7NL 1U8LB 3PNWB 1BVLB 2B1AL 3KHQA 4QHMB 3LRGA 4WGVB 3VU1A 5CMAA 3T04D 1CXHA 3A4FA 2BY2A 2RA1A 3BGMA 4KOCA 1W0VB 5D93C 3SOTA 5LXGH 3FTVA 4DZBB 3LEYH 1URZA 1BXAA 1U2HA 5T1MA 2ICEC 4M29A 1JXFA 5IMOB 3F7YA 2XOTA 1G7QB 3FT4B 3UMTA 4TXVB 3HR5B 4ZMLA 1MAJA 3CDGA 3CFKB 3HG1B 4L8SB 4OM1L 4X98A 1A6PA 4DCQA 4Z7QE 3BKJL 3LRKA 4IRSB 1LVEA 4BFJA 3JT0A 2UYLB 4P2RB 3GBMH 5A2LH 2V5SA 2FYYB 3DIDA 4IEFB 2QQKH 3GJFB 1YYCA 5AWNH 1AGEB 2O72A 1JZ3A 4MHHG 1R9FA 1GAFL 1DJHA 1F58H 1WUZA 4V1DA 4DGWC 1QKZH 2UY6B 3ES6B 1LWJA 1ZT7B 4KKQA 1QEWA 2WXLA 3IRPX 4ZDHA 4BQ8A 3HJEA 3KWXA 2LV4A 3UAJC 5ITFA 3RWGB 3H4HA 3OPZH 5C8JA 4EF3A 1A1MA 1R17A 4XO8A 1GYWA 2QELA 1JNHB 3D34A 5D96B 1G9EA 1J9SA 4WUUA 1NM9A 1NCBL 5CXPA 3PGDA 4B3EA 1I1AC 3ARED 4K7PY 1QSZA 1RUKL 2A6IA 4R7NA 4C56E 4X9YA 2ZUVA 1N64L 3KW8A 4AENB 4H20H 3KPQA 4FQ2H 1A66A 2ARJB 1T5XA 2Y7NA 1J1OL 4GOSA 4P4KB 3LQZB 1VF5C 1WD9A 4C58B 4FI7A 4B5EA 2ADFH 4AEEA 1HHHB 3SDDD 1MXDA 4Y5YB 1PD6A 1VLXA 4FZ8L 4XZ4A 5E7FA 5E8DH 4PGEB 3VYOA 1QNZH 1V7ML 2VAAB 1N8OE 1VKXB 1U2YA 1HFUA 1JGLL 3ZT7A 1E27B 4PRAA 3QIUA 4NUGH 2JCWA 1NBVL 4AUYA 1C16B 2BIIA 5FCSH 2E7LA 1RPKA 5DHEA 4PV9B 1LXMA 3NJNA 3QFDB 1XGYL 3C5ZA 3V10A 4A1RA 3IAQA 4PB0L 2FTAA 1WHOA 2QQKL 5IW6B 2D7QA 3AADB 2X4RB 3ZSSA 1DVSA 1UXLA 4R96A 4EBQL 1JZ2A 3BYTA 4JX0A 5HHMD 2B4CH 2VWEE 2G5UA 3W56A 4Z7UA 5AYTA 4PJ9B 1EXUB 3JWNE 4BK4A 5F72S 3NEOA 4PRIE 4Y19D 1BSIA 2FJGB 4RDBA 1RUAH 1LE9A 3LHPH 5CGYD 3U0WL 2OMVB 5KYUB 4WO0A 1KLGA 3SQRA 5JHLH 4F8PA 2NUTB 4MJIE 1QSEA 5AALA 4Q9QL 5TK4A 4MNHB 4EZJA 3WLBA 5BRZB 2CAKA 1T0PB 4YFEA 5HYSG 4FABH 1AQMA 1RJZA 3F05A 4M61B 2CQVA 5T3XD 3AT0A 1FN4B 4NQSA 4A7UA 5D1XD 4HD9A 2L8AA 3DMMC 1C08B 3K91A 1MPAH 1ZLUK 1J05B 4N8VA 2BY1A 4FQHB 1GGTA 4YR6B 3NZHH 3AMKA 4XZUA 4NHCL 3BDBA 3VFVA 3LXCA 1JTTA 1RKRA 3QIBB 4KAQH 5EBLA 1BXUA 2GEQA 2FJUB 1URLA 3DX9A 2DM3A 1RPQA 4LHUB 2I85A 1KJ2H 1FG9C 5C09D 3CXFA 3JT2A 3VI4A 2AW2A 3DJTA 5I6XB 3WKNA 2VR7A 3MLWH 5ESVA 3UBXI 1MWAA 5SWQA 1UD4A 1UA6H 3PL6D 1GYUA 1QI5A 4I0PC 4M7KH 4MCZA 7FABL 3D5OF 3MBXL 4K3HA 4XOEA 3D0AA 3S5LB 2UZIL 3PFQA 2GPZA 4WU5A 2D7TL 2OCCB 2WYHA 4K94C 1YNLH 1OALA 1YJDH 4TULH 4V11A 3VAEA 1J5IA 2IAMA 4PLOB 2BW4A 5HHNB 2IDSA 1PSKH 4X2UA 1KN4L 3SE4A 4PJXA 4NQED 3FTXA 2IJ0C 3LRSB 2QEJA 5BZDA 1DJZA 3GB7B 4MNQE 3TIEB 2ZPKH 1OK8A 2VLLA 2JCCA 3C2AL 5L2KE 4G6FB 3FYEB 5BJTA 2YQGA 3VXSE 5K59F 1LYQA 2V2XB 1J5OL 2QPFA 1YEHH 3DSNB 2JB6A 2K6WA 2QKIA 3D3VA 3RX7A 1BQHG 3IU3B 4L8BB 2G5BA 2VLRA 4X98B 1IM9B 1N64H 3H53A 3PV7A 4OZFG 3IFOA 4XE5B 3ILPB 1R5IB 4JGNA 3BPCB 5EOCL 1EVTC 4ZYKB 4YDZA 4KWUA 3LDBB 4YOKA 4ADJA 2Q7YB 4W68A 3GXDA 5HDOA 2C9VA 3F84A 1YECH 2WO4A 1NKOA 2X38A 3HE6C 4LAJH 4X99A 3D4GA 2YQ2A 2PWGA 3O6FD 1Q9OA 5FYKD 1U6AL 1UWFA 4OT1L 1D5IH 1M7IB 2NMSA 2GSIA 3OM3B 4WKZB 2WJ5A 3WDIA 2YGOA 5TFSL 4Z1PA 5EEZA 2PYFA 2NX5D 3NJLA 1G6RB 1MN4A 2AF2A 3D51A 4OFPA 3K2IA 5AUMA 3VH8B 1X5GA 2ENSA 5HVHC 2JB5H 4U1GC 4LARH 6CGTA 1F4WL 5DK2B 2ZTBA 4FCAA 4FKHA 4P23D 3ZE1F 5DRWA 4JHWL 3NJFA 4U1NA 3DROA 2VDKL 3EFFA 3W0WE 4L9LC 1EUTA 1XGZA 5DEFB 2IV8A 2RGSA 1FZMB 2QT6A 1TQBB 4YHNB 4ERSH 2YPVL 3FC8A 3QXAB 4G80B 3NIGB 2OR8A 5TTRA 3QCTL 4CL7A 1UGNA 1R3LB 2DJSA 3KM1A 4G5ZH 3F7LA 1E4KC 4MA7L 5BRPA 3GSRB 1AHWB 1D7DA 4P5KB 1CLZH 5KSBF 1J9QA 3IN0A 5DJXB 4ESKA 2V2TB 2R4SH 5BQ7A 1OSPH 4IGBC 4ZW5A 3I6SA 3QUHA 2V37A 4XXCA 3MJ9A 1D9KB 3W5NA 1HDMB 1L9RA 1NIFA 3UJJH 4OTXH 4NRXA 5CHNA 2MTAA 3D0VB 2OSLB 2ED7A 1BIIB 3T0WA 1BJ8A 3R06A 3FO0L 1V10A 2X4SB 3EOYG 3VQMA 4GKZA 2YXVA 3WTTA 4LNVA 1T2JA 4NN5B 5CNHA 5TE4L 5AOZA 4IGBD 3GDBA 1ET7A 2CUAA 2NNAB 3IJ9A 1AIFB 1HXMB 3P2BA 1NBZB 1CQKA 4JQIA 4HZAA 3D3VD 3L9RA 4UQDA 3QQXA 2J4WL 1BFSA 2P28B 4WI2A 4B41A 5T3ZD 1AE6L 1A1MB 3VI4B 3RY4A 1ZT1B 3JV6A 1ZK5A 3VXOA 1DE4B 3HFML 1F4YL 2L7JA 4C56A 3P3UA 4KK8D 3EHBD 3V6BR 3QEHA 2HMIC 1MCFA 3UX9B 3TZVB 3WXVL 4LMQE 3BP5A 3QIUC 3WSQL 5EEUA 5ACMA 3FSVA 4XVTH 2PTTB 2MJWA 1HTYA 2JIXA 4G6KL 3A6BL 4MQ7A 1H8LA 3WI9A 3QFJE 1K5NA 4AXWA 1U3NA 4NCDA 5D7IE 3OGCA 3A4AA 4HQQH 2J72A 3UJJL 3MBED 2HTKD 3EYOB 4CMMA 1II4E 1RURH 4FQQB 2BHUA 4CRPA 1MWAB 5SWQB 2F54D 1ZTXE 3NSYA 3TNMB 1Q0EA 2VDRH 1SLXA 3TT3H 3T0EA 5E2UL 4PREB 1ZLSL 2BSSA 3QDGE 4XVOA 1T5KA 1BJMA 3MPCA 4JFDE 4JO2H 3LPWA 1JK9A 3O3AB 1FLTX 4O58L 3BAEL 3O3EA 5HJBA 5HDBB 3D1MC 2ICEA 5CEYA 1IGYA 5E08L 4ELMF 2D7PA 3FFCE 4L4VE 4TKWA 3EO1A 4ABQA 3H2WA 5B3JF 4XVSL 5IJVB 4AQ8C 4HIHB 2WB1A 3T8XB 4ONFL 4X6DB 3PNRB 4XNQA 1FVEA 2Q7YA 2EC8A 3IE4A 3H3PH 4JFPA 3HE6D 1OT4A 4HK3N 2MNUA 3ZTCC 1F4WH 4AWJC 2Y1AA 3P9MB 4P46A 2WKOA 4OVVA 3AG3B 1PY4A 4MSWB 4J8RA 2LR4A 4JGJA 2NOYA 1AS8A 1FN4A 5IWLA 3PABA 4OR1A 3G5YA 3MLVH 2E86A 5A2FA 4TUUA 2V6HA 2WZPA 1UA7A 2CBQA 3QDJA 5JIKA 3GKWH 1BOYA 3K1KC 4I1RA 4MASA 3FHQA 4WNQA 2IC2A 3CAFA 3HHSA 3K1DA 1XD0A 4CBZA 1V3KA 4WEMB 5C92A 4XMTA 1SBSL 4N6RB 1VFBB 1L0QA 4WW1A 1A6WH 1TPXB 1JJUA 2VZOA 1ZXKA 1NA8A 4KDTC 3SIKA 4KMLB 3T2PA 2J56A 4HEPA 2O26U 4LCWE 1DSWA 1NCWH 4HT1L 4NOFA 3KYOB 2TSAA 4P2OC 1VCAA 5F9OL 5IUSA 4RVBA 2LT9A 1TZIB 3I75B 3NG5A 2P80A 4HAFA 4CDGC 3Q6GL 3ZTJH 1OPGL 5EZPA 4Z0XA 2CHWA 1JVLA 2UUDK 1T83A 4KKBD 5EZOL 4ZO9A 5I9QC 1AHWA 4P5KA 4CN1A 3Q6GH 3BSHA 1XCWA 4ODUB 5IROC 4PGZA 2H32A 3ILEA 3QZWB 4XN5A 3ZTEA 4LLAA 1WCQA 1R0AL 2YOAA 5DHVA 5MEOB 4HKBA 5CINL 3UGEA 3GMPB 4EJ1C 1N5YH 2ZAGA 2V2XA 5E6IC 1CZ8H 1HSAA 1T1YB 4GUPA 1L9NA 4MJIB 1CFNA 3CDZB 4KV5F 4PGDB 3PPEA 5ALCH 3IDYC 3OG6B 3K2KA 2BNRA 4LU5H 1P6AB 3Q01A 1KCLA 2TSBA 4L8DA 5LBSH 4H25A 3SDDC 1SFHA 3DMMD 5D1QB 1JWSA 5B1JA 1FH5H 1FRGH 5FHBH 3S98A 2CLVA 1IAMA 1VENA 2LHAA 1IBYA 3CSBA 3HC0A 2L7UA 3VB8A 1LMIA 1RZIB 2AJVH 1H3XA 5K5YA 3WE1A 2E75C 2NSMA 2R2HA 3NJKA 4W70A 1RU9L 4NZ8A 1JE6A 3RYMA 4EMZA 4CVUA 4UOJA 5GRUH 3BP7B 5E99H 1NFDF 1AHMA 4QJ4B 1WWBX 5I5MA 3OKOB 2R59A 2X9YA 4XBMA 3F7KA 2Z4QB 2V7NB 4QO1A 4HIIB 4EOWL 4NBZB 2EDXA 3GSNH 2ZNWA 2DLFL 4ZFFA 1BVNP 1PMYA 2VISB 4H26B 5CGYC 2W92A 4KY2A 5J13C 2AXHA 3HRZA 3RU8H 2EABA 5B4MC 1PBYA 3OKMA 4AMKL 5FUCE 1T1ZB 3T08A 1XR8B 1QWHA 3T0EC 5FLUA 3RWIA 1YY9D 3DHJA 4HHAB 5CGBA 3V55A 2Y7QA 3EH1A 2DMHA 3LRLA 2ZOOA 2D2OA 3M1OA 2WLIA 3SQBA 4LVOC 5DJZA 3VFPB 3WENA 5JPNB 1IQWH 1RVFL 4MJ6B 3CN1A 4PWEA 1GOFA 3QIUD 4GUQA 3EGXA 1B90A 5TQ0H 4CN4A 1G84A 4I18A 3HC4L 4WTQA 4HKXA 3E3QC 4PRID 2VJXA 5D7JA 4XVJL 3TM6A 1E8ZA 1WA2X 1BYPA 3KPSE 4N5UA 3FN0L 1FO0B 4EIZC 1JPGA 1OAUL 5GHWH 4WFED 2WXKA 3MZGB 2CK0H 5D2LE 1J87A 1S5HB 4XR8C 4AG4L 2EE9A 3U7AA 1YY8A 4X7SL 3T2LA 3FKUS 5DC0A 3GFUA 1B0RA 1VACB 3DO7A 5CHNB 2AXGB 4JFOB 3T2NL 3UZQB 4YGVB 3PWPD 1PYWB 1MCOH 1KEMH 1VCBC 3WLWC 1DQLL 1M1SA 3FRPB 5AW6B 2WGNB 3SJVA 1FFRA 1RJCA 5EF3A 4LO9A 3O3UN 1MKFA 1DQML 1MJ7L 2AI0L 4U1HB 4MAZA 1O0VA 5EO1A 2WNWA 4FFVC 2CHXA 3A0OA 3FBKA 3QJUB 4MLSA 1G7QA 4HJTA 3K72B 4NKOB 3FT0A 3HZYA 4UILH 1J1PH 1OSYA 4OZFH 4AMWA 4N26A 1X5FA 4RMQA 2DKSA 4LBAA 1R5VB 4JO4H 3L3IB 5CINH 2HB0A 1HCVA 3B1TA 1F1GA 2QADD 4PBVC 5I17A 1LK2B 1CD1A 4X6FB 2WQAA 1I8KA 2AZAA 1CGSH 4P5MB 1BEXA 1QFUH 2H0JA 2Z35A 1DQDL 3GLEA 4JQXC 1RJYA 4ORZC 3IMRA 5GXBB 1PKQB 2XXGA 3NABL 4NUMA 4BIKA 4L1BA 4XCNA 1YQVH 5D7SH 2JKSA 4M7JH 4WO4C 2GBTA 2VDKH 1K5NB 4QRRA 1NGYB 3QUXB 1MLCB 2ZCLL 3MRKA 1CQYA 1MUJB 3CUPA 3NGBC 2EEAA 3RGVD 1FZKA 3IDIB 2VUKA 2IMMA 2ZCHL 4YLBA 2YAFA 4GUCA 1DUZB 5JDSB 4G3YL 4BSVB 2WBJB 2ZCLH 3S3PA 1QFOA 1VFAB 5TE6H 5EUKA 2OP4L 1REIA 4AYGA 1OAZH 3LKNA 5T1JA 1CFNB 4BXSV 2ICWI 2JTYA 3VGDA 4L5FL 1FDLH 4E5XB 1BVLA 1ZIBA 1ZHNB 5EU4A 4LMQI 5D6CA 4PRAB 3ISYA 4F2FA 3QCUL 5D1ZC 4QLRA 1D5IL 2YC1B 4JAMA 2V9QA 4X6DA 1USZA 3NIGE 5F9WC 5ID0A 4E9QA 3O9WD 4RISL 1YEJH 3E9UA 4V33A 4HFWB 1EV2E 3ECWA 3HI5L 3HIZA 2Q2LA 1OP4A 1ZHLA 1SXZA 2NY4B 1U4FA 2V4LA 3HN3A 3C60C 1NGXA 2C1PB 2BXYA 5I8OH 3W39A 1EO8H 1DFBL 1N7ML 1TMQA 2C3GA 3W37A 3FRUB 4ZFGH 1XF2A 1CFBA 3RTLA 5F0PB 3VO0A 2VZ3A 4X6CA 3N55A 4OZGB 3R1GH 5GHWL 1I1FA 1KGUA 1X4ZA 5ANMA 5E2UH 3DV6B 2HFGH 1XL4A 1SJHA 3KS0H 4X7SH 5GS1B 5F7DA 4FNQA 1A6WL 4P3WA 3SKMA 1XIWA 1JYNA 1ZANH 3UC2A 4YQXL 2DQMA 4MVBC 3HCVB 3KD4A 3NQIA 3IDNA 5H35A 4IMKC 1FSKB 2HLFC 4HUKB 4XOCA 2XWCA 1DN0B 1MH5B 3ME0B 1VEOA 3A6BH 3JBG7 1EAPB 4TQIA 5DVOA 3W0WA 1KWGA 1E3FA 1F8TH 2BNQB 2VM9A 2Y23A 2R23A 2JKXA 5LNEA 5I23A 5A7BA 2X53A 4MQXC 3ECVA 1CN4A 2R2CA 3SO3B 2ED9A 3CZEA 1F4XH 1ZPUA 4G43B 2E6PA 3FHAA 4NWTH 2Y7OA 2FL5B 2G60L 2V33A 4IJ3C 4EI5A 4IRJD 3FOLA 4L8CB 1EJFA 1M7XA 4YMPA 4X5WB 3O3BA 1ZEAH 3C9NB 3OLDA 3VE0A 5LCVL 4YHOH 1BW8A 1EDHA 2WKGA 4NKMA 1ECYA 2P44B 4JFWA 2K3TA 4YSCA 4TYUA 3UP1A 5B22A 2WZ6A 3CV5A 4RWYH 1FBIL 4GY4A 3BD5A 4YO0B 5E6IB 3U0WH 2B15A 3HG2A 3P3TA 1P69B 3QWNA 4NQVB 7CGTA 4FABL 1P4UA 3ISWA 1BAFH 1I9IH 2WN2A 4EI6A 2I9LB 1WH0A 1YA5A 1HHKA 5HGBA 1XDTT 1YEWA 4M48L 1I3RA 1E9PB 4BCZA 4JQXA 1IC5L 2WWNA 1RUMH 5EF2A 2B1HH 4XAWL 4FYQA 2OSWA 1DCLA 4LLDA 1AGDA 4NAJA 3ROOA 4NM8H 2YFNA 3POCA 4M7ZC 1A4KA 2CO7B 3GXTA 1DQJA 1HHIA 3BH9B 4WEUD 3WN6A 5KW9L 3HUJF 3TO4D 1XHHA 5D6DA 5J1TC 3UTTD 2J7LA 1TLKA 1RK1B 1SJVA 5D7IA 4GH7B 5CBAB 3S35H 5JHLA 5JIDA 2XLLA 2HN7B 3BX7C 1UXWA 4P2OA 1XBRA 4FZ8H 2IWGA 1E67A 3MNZB 3ZDWA 5EEXA 4R2GC 1T21B 1AO7A 5JUEH 1JGLH 35C8H 2O1AA 6PAZA 3S8FB 2W88A 4I3RH 4H4NA 5FPIA 1GGCL 1AR1B 3FB7A 4LGPB 1GZPB 4TLKA 1VGKB 4OQTH 4RFNB 4KGLA 4X8JB 3OR6B 5LJYH 2AQNA 4MA1B 1ILUA 5TDPB 3UAJD 2IPTL 3A67H 3QIWC 4NNXA 1J8RA 1IL1B 4PWJA 5HHXH 3JTTA 5GJSL 5BO1H 3OR7A 3HC2A 1I9RH 2KZBA 5INCA 3ECQA 1BEYH 3OKDB 4HMDA 4J3OH 5DZOA 1M7IA 4DVRH 5D1QE 4JN1L 2X0UA 4QKXB 4KXAA 4HJJH 5I24A 4G82A 4Z76B 3QO1A 1F2XK 1FL3B 1LTXA 2XG4A 3PPSA 4OLZL 4PJHE 3VXME 3J7HA 5MEQA 4ES9A 1Y7VA 3GKWL 1X5KA 5T5NG 3QNZB 3OKEA 4PVMA 3U1QA 2YQBA 4OIAA 3B5HA 4OFYA 4QUOA 2VDMH 3GEWB 4OFQA 1QSEE 1RHHB 2AQPA 1UQSA 4P46D 2IPUG 1PS3A 4WI4A 1CMOA 4QWWC 3D18B 1EGJL 1YUHB 3T3MF 4ZNCD 5HYJE 1QTPA 1S3KH 4I48B 4RAUB 3ZJAA 5JW4M 1MFDH 3ZDZB 5CIPA 1O75A 1B0GB 4KNUA 3MNVB 5T1DH 4ZTOL 1CT8B 2GFBB 3D85D 2YOCA 4HMEA 4YBLB 12E8H 3GI9H 3TFKC 1M2VB 5AB0A 2A9NL 4NS0A 3RFZA 25C8H 2PO6C 1SY6A 1I3GH 4AE0A 3IJEB 5HJ3B 4FQXC 4PJHA 1XH1A 1HDMA 2DQJH 2JB5L 2YK1H 4QHUA 4G7YL 4UIMB 5AVZB 1CBJA 2Q8AL 1BYNA 4XNZB 1XD1A 4BBWA 5K9OB 1OE1A 1JF5A 1PEWA 4UZUA 3V4UL 2R23B 3QHZH 2MIZA 3WFHA 1MCIA 5B3NA 4HUWB 1Y1UA 3F01A 1MCJA 4GPVA 5I1IL 1SVBA 2OM5A 4YHKH 1LEIA 3JTSB 4FFZH 4J2XA 4MZ2A 5BRZD 2HLAA 1JFQH 3QUXA 3U2SA 2AAAA 1GXEA 2D0HA 2ZXDA 4AGPA 4JZNA 1FO0L 5JW4N 1RV6X 1H8NA 4L3ED 1U91A 5D2LF 2ZWKA 1MDAA 1A02N 1VFMA 5DQ9B 1NL0H 4B0MB 1ZTXH 4P2RD 1MAML 3QZPA 4H8WC 4IHBA 4XNUL 1HH9A 5DJDA 1DQMH 1MJ7H 2JIXB 3BE1H 5DQDH 4BQBA 4CNIA 4E5XA 1KTKE 4U6XB 1UG9A 1G7HB 2DTSA 2IWKA 3FCSB 5F97E 1FGNH 1NCIA 2EDJA 4P5TA 1FWXA 4G83A 5GGSY 1A6ZA 1FFPB 2MOQA 1IGIL 1IGFL 1TFPA 1BFVL 4NUPA 4P2AA 4ACPA 4Z7OB 2EJ1A 1JK8B 3FS9A 4BZ2A 2YMTA 1D9KA 2F5BH 3F62A 5A7EA 1DDHA 1F90H 4ZTOH 5KVDH 4EIBA 4X5XB 4FA7B 1DJSA 1IGFH 2XWBA 3KBHE 4GLRH 1CWVA 2DQGH 4GO6B 3TBCA 4P9MH 5J12C 1E5UI 2ZICA 4UQ3A 5DS2A 5EB9A 5JPMB 4P8QA 3O45B 5LGYA 2VRQA 3DGGB 4BWUA 4XPTH 5KVFH 2NY4D 1EQWA 4XX1G 5E8OB 3EYVA 3SE3C 2GJ6A 1ZLDA 5JLZA 1JXKA 5FGSA 1IT9H 1IQWL 3LS5L 1FAIL 1Q9LB 2CRYA 3BW9A 1S7TB 3HI1B 4LVEA 5GGRB 4UYQA 5A6LA 1I7UA 4UTBL 43CAA 2PW2A 5HGBB 5KJ7E 1JFQL 1DVTA 3P3YA 1MJUH 2JXMB 4G42B 1Q94B 4EE2A 4LKCB 2ZD0A 1NSNL 2VDLL 4PN6A 2XETA 4BGLA 5J3HC 4XCEA 1NINA 4NXKA 2PCPB 1CLZL 3L95A 5SWSD 5K9JH 3FU9A 3X2QB 1DTUA 2ZUQC 2WWMC 3NIGF 4N6QA 4L8SA 4F2MA 3ZZLA 3L3KB 4KK6C 4OZFB 2GITB 1JRHL 2EIZB 4X9BA 2HKAA 4XI5D 2VSDA 3L1OH 2JKJA 4G7RB 25C8L 1JNHA 1EH9A 1KYDA 4WSGA 4G3YH 4JANB 3LB6D 1ZVYA 4UWQB 3HLKA 5E99L 5T1DL 1XR9A 4A7GF 5I0DA 2R56L 2ZP8A 4HFUL 4Y4KB 5SV3A 4BHUI 3ES6A 1T1XB 2V3EA 4Y8AA 4URTB 1T80A 3HUJB 3SPVA 4M1GH 4F92B 4AT6A 1H5BB 1M4KA 4A2HA 4LBEB 1EUUA 1TJXA 2NW2B 1D2OA 3SKNA 5I6LA 4OI8A 4PY7B 4Z0BL 4PUBH 4PJGF 4K23H 1FGVH 3RNKA 3L1EA 4ICXA 4Y5XB 5E8PA 5F7MC 1OANA 3G5VB 4Z0BH 1BF5A 1ACYH 3D69A 4ONHB 2V8LA 4Y4HB 4PJFF 5EU6B 3DRTA 1I4FA 5IMOA 1OXYA 3UTPD 3T71A 1G7JB 5ECGA 1FVDA 4XP5H 3V6OA 3DUSB 2VXTH 5JO5A 4KVCH 5FYKE 3WIAA 4F8NA 4R26L 2VYRE 3KNBB 3GMQB 1KGIA 2OI9C 4CJ1A 3GS7A 1ZV9A 1K5WA 5DYOB 1KGWA 3VXUD 5DS8A 3ARFA 3OLEA 1JTPA 1FV1B 3IJHB 1TZOA 2VL5B 3QDGD 4JRFA 1ACZA 1TZHB 3QUKB 4Q6IC 4W81A 5C08D 4FA6A 5JA9A 3MGOA 4JPVL 2AK1H 5J9PA 4GXUM 1MEXL 2VDLB 4LHUD 1G9NH 4HT1H 2F54E 2B5IB 1BGXL 5FDWA 1DSYA 4LFHG 4MJJA 4X6BB 3G9AB 3IDYB 4K94H 3MRIB 4PJ9A 3S35L 2G2RA 2ZXWB 2D9QB 1RJLA 1ZK9A 2KUTA 4ONOA 4HZLA 3FU6A 3FTUA 3KYOA 5EZIL 3WG7B 1KPVB 2RR3A 2G2NA 2LVCA 1MWAH 4LVHB 1ZT4B 3MMEA 4YSQA 1S9VB 4XB7A 2ILLA 1HH9B 5DJDB 4I8DA 3VWKC 3D8MA 4CVWA 5BW7C 1C8QA 1OGAB 4OZ4A 3V4PA 1KJ2L 3FSOA 1UA6L 4PGEA 4IDJH 4L37A 3K71A 4EI5C 2J20A 5I6OA 1RPUA 2IH3A 2K7QA 5C0CA 4NQDA 4HAKA 4PJEB 2ENQA 3TT1H 1LDPL 5SWSA 5DJYA 3LPOA 5LAXB 3JVGC 5J7CC 4CW1A 1F18A 1Z9NA 5EF0A 1XVSA 3I02A 4DKAA 2W9DH 4NP9A 5LCVH 1YNTF 1I3VA 5SWZE 4E0RB 3GWJA 3ATBA 3B5GA 1JWSB 3CZKA 5IGXH 1DVFC 3B2MA 1GSMA 3L3JB 3U6RB 3Q5OA 3FH8A 4K8RD 1RFDL 5DT1L 4JUTA 1BPVA 5HPOA 1EBPA 5DVKA 5GPRA 4J5VA 1HZLA 2OXGB 2PYEB 3ESMA 2EYTB 1A1OB 1L9PA 5CIPB 4UUJA 4Q9QH 4UQ3B 3EYSL 2N01B 3LPPA 4ZUTB 2ADIB 3W11D 3M07A 2E4FA 4ADGA 3QJQB 5KG9A 3VA6A 3MO1B 5IBTH 1FGVL 4CC1A 3QC5X 1S5HA 1P7QB 1ZMYA 2J21A 3BKML 2WN3A 4M3JA 4NQQA 4P05A 3ZT5A 1E5CA 2J6EH 1WAPA 3D25B 4FLSA 5JIMA 2DQJL 2ZXCA 1DJXA 3VTTA 5JXED 2KLRA 4G8GD 3LPFA 4FQIH 3RVWD 2CM5A 5F9JA 5IHBA 3HE6A 2V5YA 3O4LB 2G9HA 4KHTL 5DI8A 3SCMD 1IM9A 1ZY9A 1N70A 1S7QA 4Z7QB 4Y1SA 4NDMB 4DO4A 4HC1A 2KPNA 1N5YL 1UC6A 2KL6A 4HIXL 1OLLA 1LNUA 4DN4L 1HHJB 2AMUA 4X6CF 1P2CB 5DHDA 1WK0A 3CFQA 1A8JH 1QOKA 1CURA 2VW7A 3ZUCA 1EO8L 4DOHE 4U1JB 3FQRA 5ABDE 5KS9B 1S7UA 43C9A 4FL4B 1IC0A 1DQDH 5LBSL 3RTQB 1AFVH 1XTLA 5SX5K 4U1NB 1NCTA 2ALAA 1HCYA 4M5YH 1DLFH 3KPNA 3LKRA 4JR9H 5EHFA 3WUWB 3B9AA 1IAKA 2G0LA 1MVYA 2R0KH 4KBPA 2YKLH 4X4XA 1UKTA 2SEBA 3TNNA 4F1ZA 3J2PA 5ACLA 4LCCB 5BV7B 5IJBC 4A2MA 3CLEH 2P80D 2JQMA 3FRPG 1SBSH 4UM9D 2P52A 3MCYA 3GUTA 4F3FB 4G59C 2BVOA 2R4SL 3CN0A 1H6TA 4WV1B 2FBOJ 2Q8BL 2MCG1 2AGJL 4LEXL 3JV0A 2E8ZA 4XC3H 4UAOB 2G0KA 3NQKA 4Y7MA 3QAZB 4KI5F 4LZKA 3C2SA 4PRPB 3V4VL 4QIRA 1VFAA 5IG7A 8PAZA 2VR6A 4I13B 3U2IA 1CFTA 4QOKE 1NM4A 2HRHA 2DQGL 3IMVA 2R4RL 4S1SL 2YA2A 2QKIB 3D3VB 4A2FA 4LLUA 5I18H 3T6QC 4ODTH 4PRNB 5E5MA 2WM0A 2X89D 5JHDE 43CAB 5E23A 5JW5B 3VD1A 4Z6AT 1JHLL 3E3QE 3BSGA 3KPMB 4XCYA 1RERA 3FN0H 3VXTB 4NM4L 4LARL 1TTBA 4Y16C 1OGSA 1QASA 2G3ZA 3HC4H 4YDLB 5AZUA 3O8XC 1JZFA 2V5TA 5J9PB 4PLKC 1PCSA 1M9WA 1BAGA 1U8MA 2TRYA 2FECL 2AAVA 2FGWL 3SE3A 2ORBL 3BMVA 1MJUL 4DP2X 2A6DA 4NRYA 3KCPA 4LLYB 2I26N 1BAFL 3Q2WA 4GS7B 4Y5YC 1JP5A 3FFOA 5L4IA 4X4YA 4XC1L 3D9AL 4NUJA 4TUOA 1XR9B 4NZRH 3M17B 4QRPA 1ZT4A 3BP5B 3TV8A 5I5JA 5F89A 4AYMC 3HAEB 4OUUA 4P3CH 4JZOA 1AXSB 4OGQC 2DLFH 5TDNA 3SCMA 4CMHB 3SKNB 3W38A 4Z7UF 2DQ6A 1RAMA 1CL7L 1BVKA 2JJWA 5EPMA 3UOAB 1HVXA 3RWHA 2WXJA 3CHRA 4HIQA 4EUPA 12E8L 3GI9L 1OB1A 2A73B 2XTJE 5F7AA 5FAAA 4YXHL 2AKRA 1PLAA 2E9JA 4OLVL 3O3AA 1VFOA 3SYCA 1YYMH 3QZLA 4YS4A 1Y6KR 1Q9WB 1NCCL 2B9BA 1LO0L 1NGXB 2C1PA 2FGZA 4YHPB 1AGCA 1GCYA 2NXYD 2DQEH 3PP4H 1LO5A 1T20A 4OH2A 3US9A 3ZPDA 3IETB 4OLUH 5IIEA 2ED8A 3RG1C 1L5GA 4NRXB 3RWEA 5T3ZL 4WHYG 2Q7NA 2CSPA 5HDQL 5I26A 4AYFB 4DPCX 2AVFA 2G2PA 4MSWA 5EO0B 3RIAF 2OR9L 1I3RB 1DJYA 2UY7A 2DIBA 4NKMB 3WY3A 5AYUH 4BYHA 3HOGA 3HHRB 3W57A 5BZWB 2X1XR 3C12A 3QFGA 3UC0L 3ARZA 4EN2A 2XTJC 4FXLA 4AVKA 4Y9BA 3QULA 4QGYA 1G9NL 1TOXA 2CHDA 3S8WA 1SZNA 3EH5B 3PXLA 5FEBA 4IIQC 1EA9C 1AGBA 4GRLD 2ITCB 1E28B 3RL2A 3VQ1C 3BD4A 4P0DA 2Y2WA 3N3EA 2R2BA 2UYLA 4P2RA 2ZUTA 4U1KB 4FNUA 4JPQA 2WLZA 1QUNB 2YA0A 3S4SG 3RGHA 5FR3A 1AQDB 3Q3GB 3AGVA 4AUJA 2WBXA 2IPKB 2ZKHH 4Y1AE 4DGYH 4F57H 3VXUB 5LGKA 4M8VA 4F9PA 3NSFA 5D72L 2AJUH 1FL6B 3PFUA 4KDVA 1SDAB 3BEVB 3DETC 4P23B 3S7GA 2VE6B 5ANHA 3UAFA 2ZNXA 3VFWB 4BFGA 1T7XA 2UUDH 2ZXAA 5KS9A 1JGVL 4NP4L 4YSUA 1EDQA 1N4XH 4XOBA 1JNLL