1AZRA

Crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHDWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Structure of Pseudomonas aeruginosai zinc azurin mutant Asn47Asp at 2.4 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azrA00
1A3ZA 2JFCA 4BWTA 2BZ7A 1BEXA 2YARA 2UXGA 2J57A 3NJLA 3QJRB 2YAOA 4Q89A 1ASOA 1GR7A 2YAFA 3DTUB 4AX3A 5PCYA 2YAQA 1ET7A 2FT7A 1PNDA 2FQEA 2GC7C 1NZRA 2VM4A 1HAWA 3UGEA 2IAAC 5B7MA 3PAUA 3WI9A 3X2QB 1E67A 3PLYA 1JZIA 1AACA 2XU9A 4GP8B 2XXFA 4ZK8A 4AKQA 4HHWA 2XLLA 2BW4A 3FU9A 3ABKB 1A4AA 2DWTA 4YSPA 5D4JA 1WA2X 4TXVB 3V9CA 3CZUB 2EILB 3C75A 1BXVA 1NIFA 3ABMB 1JOIA 3X1FA 2CCWA 1A65A 2Q9OA 1M9WA 1E30A 2QDVA 4A67A 1BXAA 3DKHA 1AR1B 2I85A 3IBOA 2YXWA 5ANHA 4AZUA 4KO6A 1W6LA 3OMAB 3WNJA 3QJQB 3H56A 4BXVA 1ILUA 4AKOA 1E65A 3FU7B 3CG8A 1L9OA 3FSAA 3N2JA 1KCWA 1NICA 1XMEB 2IWEA 3OMNB 2MTAA 1OCZB 3WKPA 1OE2A 4JKNA 3TBBA 1UATA 2Y1AA 1SJMA 2YAHA 2FT6A 3JTBA 1HAUA 3QQXA 4PCYA 5TK2A 1MDAA 5I5JA 2CAKA 3FU7A 4FAAB 1RCYA 5B7FA 2DYRB 2ZXWB 4P5SA 2E86A 3GDCA 3SQRA 4DP8X 2PPDA 2CBPA 3NP4A 2HXAA 3T6VA 4DPBX 2P80A 4HCIA 2BP0B 2XYBA 2XVBA 3N55A 4CSZA 5AKRA 1SF5A 3TASA 3SBQA 1CC3A 3T71A 4FA7B 2FJSA 6PAZA 4M3HA 1AG0A 5I6MA 1GY2A 1WS8A 3NJKA 5AFAA 1PLBA 4A2EA 3NYKA 3TA4D 3G5WA 3GYRA 3UAEA 4CSPA 3D12B 3PAVA 5B1BB 2BP0A 2HRGA 5F7AA 3CDZB 1GY1A 1ZV2A 4YSCA 2YAPA 2EINB 2DY2A 4DPAX 2GIMA 3KW8A 2DV6A 4KNSA 4KNTA 2BHFA 3UABA 4KO5A 5I5IA 1J9TA 1YLBB 2QT6A 4A2DA 1PAZA 1EHKB 5LDUA 2UXVA 3AW5A 1M57B 3EH5B 3OD3A 2VW6A 1BQKA 2NRDA 2IDUA 1FFTB 1E5YA 4HAKA 4KO9A 1NIDA 2X87A 4E9TA 4KO7A 2QPEB 2RACA 1KBVA 2PCFA 5B7EA 4GP4B 1X9RA 4GXFA 1J9RA 1T5KA 4YSSA 2J55A 1DZ0A 2HRHA 1L9SA 1AANA 3T6XA 2LLNA 2CALA 4A2FA 3NP3A 3SBRA 1QHQA 2H5UA 2EIJB 1AIZA 2AFNA 1TEFA 3MX0B 4N8UA 3BVDB 2PPAA 2JKWA 3T6WA 1V54B 2ZWNA 3AG2B 1L9TA 1OCRB 1V55B 2PPCA 7PAZA 3CVDA 1V10A 1A4CA 1SFDA 1JZEA 2PP9A 3NJIA 4A68A 4L0PB 4BWWA 3QJVB 2AZUA 3FS9A 2WO3B 4F2EA 3S3CB 8PAZA 2GHZA 3X1GA 3S3DB 1E5ZA 1NWOA 2PP7A 2UX6A 1AQ8A 4YVUA 1WA1X 1GW0A 2WSDA 1SFHA 1ET8A 1OCOB 2OV0A 2XX0A 3ZIYA 7PCYA 4WTQA 1AZRA 1NPJA 2PPFA 3EHBB 4E9VA 1IC0A 1KYAA 4A2HA 2GC4C 3FQ2A 4NERA 1PF3A 2VW7A 1TEGA 1X9UA 5I5MA 5FC9A 1XB3A 4JHVA 1AS6A 2PP8A 5B1JA 1ET5A 2VW4A 4KNUA 2B3IA 1QNIA 2HX7A 1JVLA 4G72B 4K9JA 1CUOA 2IDTA 3EF4A 3EH3B 4DP6X 1B3IA 2XX1A 3NSDA 1BYPA 1JXDA 3NJGA 2WO2B 3SBPA 1DYZA 5B1AB 3QPKA 1NWPA 4G7RB 4DP0X 2FNWA 1A8ZA 1OF0A 1OOWA 1OE3A 1MZZA 1A4BA 1OCCB 2HZHA 2Q5BA 3S8FB 1J5CA 4HIPA 5TK4A 1BYOA 1JZFA 3GXUB 1ZIBA 4E9YA 1PMYA 2BP8B 1SF3A 3PCYA 4UAHA 5AZUA 1AZCA 1L9PA 2FQDA 3ABGA 3FYEB 3FU8A 4E9QA 3IN2A 1SHXA 1J9QA 4NB7A 1AS8A 2IWKA 3S3BB 4X4KA 3OMIB 1FA4A 2XV0A 4KOBA 2YQBA 4UF7C 2QPDB 1ASPA 4MFHA 4E9WA 2BP8A 9PCYA 2DYSB 1AG6A 4BDVB 2MRYA 4HCFA 1WS7A 4F2FA 1EZLA 2OJ1A 1ZPUA 2TSBA 1GS6X 2X88A 2XV2A 3AG3B 3HB3B 3FSWA 4M4RB 4BK5C 2DWSA 3IEAA 5A7EA 3T9WA 3BQVA 4NAJA 4YSEA 4BDVA 4DP1X 3PAZA 5I6KA 1AZBA 4YSQA 3NJMA 1GYCA 1TKWA 3ZDWA 1XB8A 3ASOB 4E9XA 2Y69B 1SNRA 3NJHA 3TBCA 2W8CA 4BXSV 2IH8A 2BZCA 4DP5X 1GS7A 1SHWA 1J5DA 1PY0A 4ENZA 3WNIA 3FT0A 1IKOP 4QKTA 3AY2A 1PCSA 3NJNA 4YSAA 1JZGA 4AKPA 4JHUA 5D4IA 4HALA 2J56A 3PXLA 1N68A 2XUWA 2YAMA 3UAAA 2UXTA 3FQYA 3PPSA 3X1BA 3EH4B 2YAEA 1KDJA 1CYWA 3JT2A 2W88A 1J9SA 1RZPA 3NSYA 2XWZA 2YXVA 3AZUA 1AZNA 2VN3A 1KCBA 2IDSA 2GB2A 4A66A 2IDQA 4A2GA 4YSUA 3IN0A 5IY5B 2AZAA 3IE9A 4DPCX 1PLAA 1BAWA 2VSMB 3NSFA 1GS8A 3QJSB 3MBWB 1MG2C 4YSDA 2CUAA 2ZONA 1KBWA 2TSAA 3QJTB 2PCYA 1ZDQA 5EHFA 3UACA 2I7OA 1WA0X 3FYIB 2GI0A 2H47C 1IUZA 2I7SA 2P80D 1ASQA 3NSCA 1ID2A 2A3TA 3T6ZA 4E9RA 1R1CA 3FSZA 2JXMA 3FPYA 4DP4X 2CJ3A 1JXFA 4HHGA 3QJUB 4EF3A 1QLEB 1PLCA 3H4FA 1NPNA 1BXUA 1KGYE 4G7QB 4YL4A 1N70A 5I6LA 1JERA 3NJJA 4G71B 4UANA 3DIVA 1L9QA 1NDTA 2GBAA 3NJFA 4HZ1A 5B1KA 4DP2X 2IDFA 2EIKB 1JVOA 5PAZA 3WG7B 2PLTA 2HX8A 3AG1B 3L45A 3WKQA 1AS7A 4P5RA 4YVNA 5I28A 2VSKB 1F56A 1AAJA 5I26A 1KDIA 2UXFA 3X1NA 1RKRA 1NIAA 1JXGA 1CURA 2XV3A 1JZJA 1W8EA 2N0MA 1BQ5A 2GSMB 1PZCA 2FWLB 2ZOOA 4YSRA 2R7EB 4E9SA 2FTAA 1NIBA 1OV8A 2VMJA 1PZAA 3ZX1A 4GYBA 1XB6A 4AI7A 4Q8BA 4W9ZA 1IBZA 3TU6A 5D4HA 4BWUA 3ZBMA 5I6PA 3ERXA 2R7EA 4N4YB 2EIMB 1PZBA 4G70B 5F7BA 1AZUA 2VM3A 1URIA 1MG3C 3KW7A 4GY4A 4DP7X 1CYXA 1GSKA 1JZHA 2J5WA 2H3XC 1IBYA 1NIEA 2PPEA 1PNCA 3NT0A 1ETJA 4W1TA 1BQRA 5I6OA 1MZYA 2FQGA 4GP5B 2B08A 3WIAA 1RZQA 1ZDSA 2QDWA 3U25A 2XXGA 1WAEA 3UADA 1ZIAA 1NTDA 1FWXA 3OQRA 2AVFA 3S8GB 3FQ1A 2OCCB 4YSOA 3CVCA 1KV7A 2AANA 4RH4A 3CVBA 3ABLB 3ASNB 6PCYA 3CDZA 4QLWA 4HCGA 1HFUA 2BWIA 1ADWA 1M56B 1NINA 5B3SB 4YSTA 1SDDB 2FQFA 3X1EA 2HLEB 2UX7A 2HX9A 3AG4B 4KOCA 5B1JC 3RYMA 4DP9X 4F7KA 5E9NA 1L9RA 1VLXA 3V9EA 1OE1A 2BW5A 1AOZA 2FT8A 2IWFA 1W6WA 1TU2A 1I53A 2BWDA 4PAZA 3FSVA 3HEIB 3H4HA 1SDDA 4WKXA 4G7SB 3OM3B 3FPXA 5I6NA 2IH9A 1ILSA 2BO0A
chains in the Genus database with same CATH superfamily
4Y4HD 2HB0A 3VXUA 5SWQB 2P5WD 3S8WA 3QXAA 1UASA 3EJUA 1MCWM 1TETH 3HE7A 4P46A 2O6EA 1ICTA 3HMXA 4NQVB 4PJBB 5DC2A 4Z0XB 2AQNA 3P30L 5IJVB 1LD9A 4QRTA 1U2HA 2VM4A 2AQPA 4PBDA 2WTOA 4O02L 4R4FL 1EFXD 1XIWB 5EZJB 4HS8H 2NY4C 1N3NA 2H26B 2XXFA 2XLLA 3WDHA 2E9WA 1WA2X 4OQTH 4B9GA 2VN7A 4JZNA 5DT1H 4JNXA 2LGNA 3OKDA 3ZDZF 3X1FA 4M93C 2WBWB 4AYDC 1BPLB 4L18A 3HR5B 1A7QL 2NY4D 2YRZA 3D69B 1I7TA 3UBHA 4U7SA 2DQGH 3QDJB 1HT6A 1CXHA 4OFVA 2CBOA 4LOEA 3RA7L 3VGGA 4LLYB 5F72S 1F2XK 2BFVL 2FX9H 3OMAB 1CDJA 4ONGL 4XCCL 4QTHA 4X7CC 3HRZA 2JH2A 2A6DB 2PW2A 4DN4L 4XO8A 1I8KA 4FABL 5HGBB 2EDWA 3WFCL 3D52A 4X5RA 4ZMLA 2G3NA 4JCWA 1EBAA 4YDIH 4Q2ZB 4AK2A 3GSNB 3HJEA 5ICXA 1U93A 2WXPA 2ZCHL 4QOKB 5CILL 5TK2A 4HF5H 3C5SA 2ODHA 2HJKA 3QA3A 3FU7A 3BPLC 4WWKA 3LZLA 2QVKA 3M7OA 2C4FU 1PIGA 1TTCA 3MJ7A 2D7MA 2DWDB 1GOGA 4IIQB 3VYNA 3CFMA 5KSAB 4KTDH 2J72A 5F88A 4PUBL 2ZWLT 4X7SL 1IAOB 2Z93A 3V4PB 2K0RA 4OZHA 4PJEA 4WIQA 1SF5A 2ATPB 4W81A 5DD5L 3IK2A 2V7NA 5DS1A 1B0RB 2IH3B 3TYFA 2BK8A 3O0LA 1RZGB 2XA8H 3UG3A 4RZKA 2AV1B 2AK4D 2XFXB 2Z0UA 3GYRA 3D12B 5BS0E 4DERA 1AHWA 4ABWA 2GJZB 5DUJA 2GHWB 5FYJH 4HV8A 1WPCA 3DURB 4XP5L 1LO3L 3P11L 3IGAA 4U2YA 4ISVB 4F8TA 1WZKA 4IS6A 1Q8MA 4XC3H 3GBNL 3ZR5A 5IB5A 3MOBL 4XPFH 3WLBA 1IM9A 3ULUH 3ARFD 2JKLA 5I0WA 2K6ZA 1PZDA 2UY6A 4MDIA 3S3JA 4WI0A 5FCUL 3T2NL 4ELMF 3T77B 4GUCA 2QT6A 3UTPE 3N85L 1B4LA 5D1XE 3ATEA 4F3FB 5I1DB 3BH9B 4IIZA 5JR1H 1MCFA 4M7KL 1AHKA 5CUSL 3WE6A 4JG0L 3RKPA 3RNQB 1K5NB 3TNNB 3ECQA 3QT2A 4P2RD 3P4NB 3LNHA 3JV6A 1ETA1 4ZMOA 3MNZA 4GBXC 2YGPA 4X6BA 4ZUUA 2X87A 3RTQA 1A66A 5D7IA 4UM8A 3QGVA 1FN4B 4EIUA 2ZAGA 3CZFA 1CLZH 3ES6B 2HTKC 4HCRA 3B2XA 4N0FB 2CDFB 1MUJB 4FQQB 5B7EA 5ADOL 4L3CA 2CMRH 2J55A 1MJ8H 3RLSA 3T6XA 2VQTA 4X4ZA 5E03A 4L8CB 2AJSH 4GBXD 5I8KL 3C5JB 1UWFA 1JHLH 4LLDB 4M61A 1QHQA 2GK0A 3X14A 2HTKD 5BRQA 4ODSH 2EIJB 1AIZA 1WUZA 3KPRD 4AE1A 1R24B 4KRPC 1QUPA 1YQVH 4IRJD 5E9DB 3I6LE 3QG7L 4EBQL 2Z35A 3RWCA 3V0GA 1HL8A 4WHDA 3MRRB 1RIVL 1WYJA 2PABA 1JXJA 4KRPD 2QHRH 2XTJE 3PJSB 1O5PA 4FZ8L 1J88A 1XL6A 4ONHB 5D7KD 1WAAF 2CLRA 5H35B 4CSTA 4H25B 2VDPL 3P73B 3GSVA 4I88A 3MNWB 3GI9H 1OTSC 2PP7A 3BC9A 3ZJAA 3R19A 5IFAH 2JCCE 2JKIS 3HG2A 4FNLL 2XKSA 1TO5A 2IPKB 1AIFB 3NUKA 2A6JB 1RZKH 5D96C 1BG1A 1F2QA 2ICWJ 2MCMA 2HA1A 2EXWC 3NDZE 4WTQA 4N0UE 5C8JB 5KYXA 2J5LB 2R8SH 5DC4B 1NBVL 1OTSD 1NDGA 1RU9H 4YZFE 1XH3B 3EYVB 5EZLA 5EF0A 3V95A 1XGRA 2VN4A 2PR9A 3UP6A 2B5IB 4TUJB 4I5BA 3O2DL 1XV8A 4Y5VC 3RJQB 1FO0H 2EXWD 1CQYA 5GGRB 1DQQA 5DLLA 1CD0A 2HX7A 1IM3D 5I24A 1GZPB 1JXKA 2H1XA 2Z7ZA 1JXDA 3IE4A 2DAVA 1KCSH 4OD1H 3B8YA 1N8ZB 4FQXA 1F6LL 5C0FB 1QBLH 1FNGA 2ADGB 1I7RB 2W0FA 2XJKA 3QUKB 3GXMA 1OOWA 4F7TA 3TIEA 1A4BA 5CP3H 3BAWA 2ZUTA 2EEAA 3FO2A 1IEAA 1I7ZB 4QPEA 4N2BA 2HPOA 2W5PA 3UJTH 1U0QA 3CIAA 5J13C 1C7TA 4M6NL 5HHXL 4LVHC 3MJ9H 1KBGH 2KZWA 2ZSWB 4JO2H 2IV8A 4V2BA 2IWKA 4OM0H 1I8IA 1FA4A 4FNRA 1U95B 2DTML 3A67H 3ME0A 1RUMH 4XPBH 3KXFA 2EH8H 4Y88A 5E00B 4F7EA 2EDYA 1LEKB 4NT6A 3ZUCA 4HFWB 4XP1L 1G9NL 1GS6X 1UZ8A 3RWEA 3CFDA 2ZAHA 5EWIH 1SXNA 3FXIC 4LDOB 4DK6A 1JWUB 3IEAA 2KQNA 3PNWA 2AEQH 2Z7YA 5FDWA 4MJ6B 3QC5X 2OFQA 2J71A 3D34A 3DV4A 43C9A 1WWCA 3ZE0B 3CZNA 1DP0A 3FT4B 3HW7A 3L16A 4L23A 5GGQL 2YOAA 3DRQA 4IMLA 3R0NA 3MLSL 4JPIA 2H3NB 5SWZA 3NVQA 2Y4SA 3KWWA 2B4CC 1OW0A 3FONA 4NZUH 4JG1L 4JVUA 3TXAA 2H45A 4GMTH 1BF5A 2VLMD 2XRAH 1N5YL 1C5DB 2O5ZL 5BRZB 2QSCL 3W0WA 1QW9A 2CR0A 1LWJA 5A2BA 3ARSA 4GAAA 1BQLL 3KM2A 4I48A 1FAIH 3S98A 5ICZA 2I9LA 4JFHD 2G9HA 3RL2A 5K59E 2EDTA 2WXKA 5EC1B 2ZX8A 5JW3H 2X09A 3IDIB 2G0KA 3BAEH 1N68A 1MJJB 1FNLA 4PJIE 2AK1H 1FL5B 2XWBA 3O3EA 3GMRA 3QQNA 1MXDA 1XEUA 3WN5A 5AW9B 3LIZL 4GKNB 3IU4L 1QYGL 4FYRA 3SHSA 3O2VL 2C7FA 4ESKA 1E9QA 5GRVK 4UI2A 4N2LA 2BM3A 3QCVL 3QE5A 3GSUA 3R18A 3JWDH 4PD4J 1KXVA 2WXGA 1EWHA 4NOFA 2CUAA 4ELMA 1UXLA 4PJAB 2FB4H 1MVYA 5A16A 4L1DA 4UTAH 3AS0A 1WA0X 4WFGE 2ADJA 3B9VA 2P80D 2VYRE 4KAQL 4OQ1A 2AAVA 3EW3B 1OM3L 4WK0B 1WCBB 3NSCA 1LQBC 4FLRA 4DZBA 3T6ZA 1YMME 2VR6A 1WFIA 5MEQB 1E6OH 1RUPH 1CJYA 4O51B 4AZ8B 4HD5A 1TG8A 3DVFA 4M6OL 4NBZB 4PRAA 4J1UB 5B4MC 1ZCRA 3EOAA 3HLAA 4XR8C 1FSKC 1LO2H 1NCJA 2HN7B 4RGMB 4U1GB 5HBBA 1BMWA 2JB5H 3OL2A 1L9QA 3HA0A 3QRGH 4XVJL 5CSGA 3SKMA 4OCNC 3SPIA 5B4MD 2X41A 1E4KA 3MA9L 4NJAL 2CLVB 1QRNE 1QI5A 3L3HB 4MGXA 5EZIL 4AUUA 1FF5A 3D2UD 1RKRA 3HG5A 4XWGL 1U8MA 4LAQL 1RZJC 5ALBL 3RFZC 5ILTL 1JV5B 4OIFA 4QR7A 4L3EA 5IEHA 4UUJB 1HKLH 4PV9A 2R2HB 2BJMH 1Z9OA 3THML 4NO2B 1WAAA 1XCTB 1AD0A 3OR7A 1PKOA 2H6PA 1V7MH 4BWUA 2VISB 3BJ91 4QYOB 4M5TA 4Y9BA 3E7JA 2R7EA 1IFHH 1KIPB 3GMNA 1U58A 4GPVA 5BQDA 5KVDL 1FQ9C 1KLGA 3HAEA 5EBLA 4H2CA 4NQDD 3OKOB 3RX9A 3ZDYB 1IO4C 4AQAB 3SDYH 5J7CC 1CF8L 1Z2KA 5EU4A 3TO4C 1OGAE 5D4QA 5LGJB 4GP5B 1IARB 1DLFH 4ELKB 1A1MB 4RWHA 2X89A 1NA8A 2DL2A 4J3OC 4PG9A 5FGCB 5T1DH 3WNKA 3VFOB 1I7UA 2YD4A 4MCNA 3F12A 2DLFL 2Y7OA 3TO4D 3PWPA 2IBZX 1H3TA 1FCCA 2WLJA 2NUPA 4U6XA 5EN2A 1AXSB 1S7XB 2EIZB 5E2WL 4KK6C 1CU4H 2AANA 2VZ1A 2E6QA 4J3OD 2CIKA 3ASNB 4HGWA 4LE8A 3QDAA 1Q9OB 5KVFE 1CGWA 1KACB 1A1OA 3MRHB 2R69A 1YRKA 1KGJA 4UTBL 1IC1A 1I1RA 4KK6D 3DDGA 1OAXL 2L7UA 3IGFA 3O41A 4RETB 2X38A 4HK0B 5F7MC 4F58H 2IOIA 4OLXH 4LCYB 4FL4B 3HN3A 3RAJH 1MRFL 3VXUB 1KGCD 1NBYA 1VAHA 2ARJA 2DI8A 3QXAB 1FLRH 2YA0A 4P3CH 4S1RH 4LPVA 1AOZA 1R0AL 2IWFA 5L4JA 1TU2A 2BWDA 3NFSH 4P46B 4QHNA 1HXYA 1GMEA 1WEJL 4XN5A 4P3WA 1LD9B 4QRTB 2UVEA 3OF6A 3GT6A 3RZCC 2FNBA 1GHFL 3SDCC 2GJ6D 7TAAA 1JJUA 3UMNA 4YPJA 2YIHA 4I3RL 3GSWA 1Z3RA 2YD8A 3DXAA 1D5BA 3JWOH 3HN5A 5FUZL 5F0PB 4HUVA 3Q48A 3SDCD 3RZCD 4JZNB 4B9IA 2AXFA 2H6OA 3OKDB 4S0SD 3UO1H 4FQHA 1CLVA 2FHCA 1AO7A 1VPOL 3DHPA 3V0DA 4JDTH 1I7TB 3IDMA 4KKLC 1FI8C 4G80B 5F1NA 1MHPL 3TWCH 1DTUA 2R4RH 4NCC2 1KPUA 3BMVA 4HWZA 3C75A 1MAML 1F90L 4LCWD 4ETYA 2OA9A 4QTHB 4GKSA 3SE4C 4TVUA 4MQSB 3HRZB 3NIFE 4W9EC 3MHZA 4XBPA 2PW2B 2Q3ZA 2CJTA 2Q20A 1BF2A 1LEGA 3DKHA 1I8KB 3IAPA 5LO7A 3ROLA 1XGTA 4LSQH 3HUJE 2X4OA 3L2LA 3HFML 5ICXB 1U93B 3V0JA 4D7PA 1LDPL 3Q5TA 4OGYH 4B9YA 3GZQA 3HI6L 3C5SB 2HJKB 4AKOA 2FWSA 3FU7B 4WWKB 3MA7A 4BELD 3HB3C 1DVYA 3MJ7B 5BCAA 4X0KA 2EDBA 3CXDH 4I18A 1JPSH 1ZSDA 4QRPA 2NOYA 3WIHL 5F88B 3N0PB 2DBLH 1D6VL 1H9DA 4H44C 4GUQA 2Z93B 2PTUA 2YAHA 4OZHB 4PJEB 5G2NA 2GTWB 4MKTA 3CVHH 4YLBA 3HB3D 1H8LA 3TYFB 1MHHA 1YPZF 3SQRA 1NAMA 1NUFA 1DBBH 2NY7H 4YWGL 5JHDE 2XYBA 2VZTA 3CBKB 1KN2L 1AHWB 2XC8A 4AC2A 1UC6A 4HV8B 1A9EB 1CXIA 2WBJA 1MW2A 4OY9A 2NY3B 2IO5A 5CMAA 5IBUG 4AQEA 4IS6B 4PJBE 4WUUA 4CKQA 2NNCA 2F6AA 4IKIA 4Z7NB 5I17A 5IB5B 5T5FL 3ZU8A 4YBLB 3TFKC 3A5VA 1WWBX 1IM9B 4LSRL 3WLBB 3N42B 2UY6B 4MDIB 4WI0B 4WSJA 4HLEA 1BZ9A 1N18A 2BNUB 3GJEA 3IS1X 2FLMA 1SOSA 4M43H 3D3VA 1H9VA 3DX6B 4WV1A 4A38A 2RAMA 4JHAH 1IC5H 3TFKD 3ULVE 3VI3A 4EN3A 4GW1A 3WE6B 4LSVL 3RVXC 1MWAL 4N28A 5I5IA 3LS5L 3IMWA 1JNLL 2D7PA 3FTGA 1T21A 3JV6B 4NZRH 5E1IA 3EFDL 3QDJE 4CN1A 1MREL 4HUKB 1BZ7B 5FKAA 4RISH 3MNZB 3FL7A 4X6BB 1YDPA 4ZUUB 3RTQB 1BVOA 5D7IB 4UM8B 4UT7H 3FB5A 4WKZA 3BN9C 3CZFB 3D4GA 5KSBA 4UT6L 4TULH 5E95B 1BQKA 4WGWB 2NRDA 1GGBL 4LSDA 3MRLA 1NCCH 4L3CB 4XAWL 2UYLA 5AG8A 3L81A 1NIDA 5IROD 4PD4K 3X14B 4P2OA 4M61B 2GK0B 1OZUA 3BN9D 3HC4L 2YS4A 4ZFFA 4PRBA 2PCFA 3BOVA 4YEFA 3WJJC 2GBTA 1NCDH 4MJHA 5DZPA 2GW5A 3OPZH 2OR7A 2Z35B 4P5KB 3ULSA 4OCYH 3L3KA 3WFDH 4MCYA 5J3HD 2ZP9A 4FQLH 4PGCA 5TPWH 4Z7IA 3Q01A 3BUYA 2AFNA 2J20A 5D93B 1B2WH 2MTPA 2J44A 4Y9CA 2CLRB 2PPAA 3BYYA 2OK0L 3DGCR 4IKKA 3GSVB 2NXZD 2PPCA 3V6BR 3UTTD 5FO2A 5FV1L 1BEYL 2YZ8A 3BWSA 1Z1WA 3IPBA 4K94L 3EJZD 3QJVB 2WOYA 1ZXQA 4F2EA 1NEZG 2GK2A 1E6JH 5KYXB 5D6DC 5IQNA 4HIEB 1NDGB 4J6RH 4S1QL 2P3YA 4F5CA 1QR1A 5EZLB 1TFHA 4OLVL 3VM7A 4OF7A 1XGRB 1JV2A 4Z76A 3HE6C 4GIPD 3BIKB 4I5BB 1JUFA 2H1PL 2WBXA 2YD7A 3R8BB 1DQQB 4UM9A 5EU6D 5C0JA 1QW8A 1PKQA 2Q86A 4GAJH 4OKVA 3OHXA 4H20L 1Y1DA 5FC9A 1DE4A 4GG6F 3OG6B 3HE6D 2H0EA 4WHYG 5KVFH 4FQXB 4E36A 4Y4HA 3DSNA 1FNGB 4PFEA 2B3IA 2I25N 2BOBA 2W0FB 4KKBC 2P5WA 4FXKA 3UPAA 5D72H 2CM5A 3Q0HA 4F7TB 2X4UA 3GBML 3TIEB 3D4ZA 3WNOA 3FO2B 2EC9T 2HFGL 3EF4A 4EMZA 5C09B 2IANB 3NSDA 1F1AA 4XPAL 1R46A 4MAUH 1ND0A 3SBPA 1MH5A 1DJYA 4OLYL 4KKBD 5D7LD 1DVQA 4QHLA 1XSKA 1EFXA 1OE3A 1I8IB 1OCCB 2VXUH 3T0DA 2HT2C 2HZHA 1L0YA 4LARH 3ZDZB 4N5UA 3X3GH 2V3DA 1XF1A 3PP4L 3PCYA 5AVSB 1CFBA 2YKKA 1LXMA 1NDMA 4F7EB 5KANG 1CD9B 1NMAH 2EYSA 4LIQE 4PHXA 3V6ZB 3LH2H 1UZ8B 4HC1A 2HT2D 3CFDB 4PLOB 2Q7YA 4PWHA 1YJDH 5E9DE 4MCZA 4NN6C 4CVZA 5AVWB 1MLBA 3HJ0A 3PNWB 2DYSB 3EYSH 3LV3A 2IPUG 4NC0B 3S97C 1FYTD 2CDGA 5AB9A 3QARA 2EE3A 4TL4A 1QSVA 2BS9A 1J1PL 4X5PA 3ROOB 2N59A 3DRQB 1LWRA 4IMLB 1F3JA 4JPIB 4ZOAA 4NAJA 5F71A 5SWZB 4MTMA 2Y2TA 2WUCH 3KWWB 3CSBA 3QEUA 3Q2NA 3A23A 3FONB 3WEMA 2WO4A 3L5XL 5DJXB 2RALA 2ZUSA 5C3IA 2OI9C 3IMTA 1WO2A 3W0WB 2WYTA 4GB9A 1RUAH 1FZKB 5TQ0H 3VO0A 3D2TA 2Y7QA 2W8CA 4I48B 5J1AA 4A7TA 5ICZB 4GW5A 2I9LB 1CI5A 2G9HB 3HBZA 3RL2B 1YPZA 3WJLC 2VO8A 3OMZA 2Q3XA 3A6OA 1J0KA 5F7WC 5T1KD 3RWHA 2VDKL 3APDA 3HG1D 3TS8A 2XWBB 4NN5B 1CR9L 3WIIH 3O3EB 2AK4A 3WN5B 3ARDC 2EXYD 5CZVH 1RJZA 1M71B 1K8DA 2VR5A 1E9QB 4BZYA 5BUAA 3UAAA 2GKIA 4QRSA 5AYQA 3GSUB 5I19H 3ARDD 4JHWL 2QGBA 4EZKA 4LVOC 3UEZA 3NSYA 5I66B 4ELMB 2AJ3A 1CD1A 1R47A 3AZUA 3C6SA 3GXPA 4GXUM 5A16B 1KCBA 1QR4A 2Y24A 2M2DA 1UFGA 3ARFA 4RWYL 2ADJB 3P69A 3ENEA 2VDNB 4MNHA 4EI6A 2MOQA 1UM4H 4NN7B 3FH5A 4U1SA 1QASA 2FO4A 4F8QA 1UVQA 2E6JA 4IGBC 4JFFD 1KB3A 2DM4A 1EZVX 4P57A 1QP1A 3GD1C 4U0RB 4X8XA 3LVEA 3O6MH 5DQDH 2ESVD 4P2RA 1E3XA 4PRAB 2BSSA 4YE4H 1OOAA 3EOAB 5DT1L 1NMBH 2MFNA 1UJ3A 4PJHF 1KJMA 4KHTH 4MDJB 1G7PA 3CLEL 3FPYA 4I8DA 4LGRB 1MW0A 2YC1A 2DQGL 2I60H 3MCKA 4IBWA 3ZE0E 1DBAH 1IGIH 4KX8A 4GBXA 1JCVA 3AS2A 1N70A 3JVGC 4N68A 4Q6IC 4XHJD 2WXLA 4NUQA 3ECBA 2HLAA 1UWEH 4JZOA 1U8MB 3KPRA 4EUPA 2EIKB 3H3PL 4L3EB 5IEHB 2BNQD 2HX8A 3AG1B 3P2BA 4IRJA 4PV9B 3SGJC 2YPVA 5BRZE 4W68A 2EXSA 1HNFA 2XETA 5I26A 1AD0B 2CNYA 2VMCA 4HJ0D 4LPTA 2JTDA 4XX1E 3GSNH 1NIAA 3ALWA 2A7BA 5F9JA 3BE1H 1JZJA 2X6MA 3UZEA 3G6JF 1IAMA 2EO9A 2GSMB 4K07A 3CDYA 2R7EB 1JZDC 5I2IB 3GMNB 4JM2C 3QG6A 4HKBB 1SVCP 2OW6A 3HAEB 1KLGB 4XRCA 4MQXC 5EBLB 4A37A 4LSUL 5AALA 4AI7A 5FECA 2IAMC 1F13A 4KY2A 3KS0H 1YNLL 1HH6A 3PIQA 5HVHC 5EU4B 2VLJB 2Y07L 2CGYA 1D5IL 1HN1A 1IU1A 4YHYB 4HETA 1MCKA 4JM2D 5JW4Q 5INCA 1TOXA 4UYPA 4PG9B 2IAMD 4KX9A 1I7UB 2V7HA 1XGYH 1AFVL 1Y6KR 3KW7A 2J1WA 1XCWA 3F7PC 3F12B 4HXBH 4LSSH 2NUPB 3NT0A 2JI1A 4U6XB 3HCVA 5EN2B 4PJAE 5EUKA 1O6SA 1UH2A 3D08A 3IVKA 4GG6A 1IM3A 2CIKB 2XTSA 4HGWB 1DO5A 1E4XH 4YE0A 5AL8A 3BO8A 4ZQTA 3I9IA 4XC3L 5CEXA 5HXMA 1A1OB 4J3OF 3CHOA 3CZKA 4L9DA 4Y5VA 3ULUL 2J6EA 4JB9L 4WCYL 3N9GH 4F37K 1R3IH 2AF2A 3O41B 5GGRY 4H13C 2C8NA 4JM0A 2AEPL 3ABLB 4DPRA 1CE1H 5FO8A 5IBUB 1UOVA 4DHLA 4HOZA 1JHTA 1L0PA 1NFAA 2ARJB 1NBYB 3I50H 3NRFA 4XC1H 3VDBA 1BVZA 1TU2B 4QHNB 2GSGA 1O9VA 3IGLA 1HXYB 4HQQH 4XMWA 3MO1A 4QCIA 3L4VA 4YDNA 3C8DA 3FCBA 1W72H 4ZI8A 5A6IA 5K9OA 3B2VH 1LMKA 1RPKA 1OLZA 1CLZL 2LTQC 3IDJA 3GSWB 1I8MA 4FG4A 3DXAB 1D5BB 2YMXH 1MFUA 3P40A 4HPYH 4FQJH 2KI6A 2JFCA 2AJSL 3G08A 1JPST 1TF4A 5E5UB 2YPKA 4FQHB 3NPSC 3B5HA 4C4KT 1CGSL 1JHLL 2N7AA 5ALCL 3VAEA 4YXHH 4EUPG 1JDAA 4X6CF 3GB7B 4ZAKC 3KPNA 3IDMB 4LIQH 5F1NB 1UOKA 5CIPA 1YQVL 1I3RA 4E5XA 3CHQA 1JZ3A 5AEAA 5SX4H 1KPUB 4HWZB 4I77L 1HAWA 2BRRL 2WQVA 5GGVY 5B7MA 3WI9A 1QLFA 4ZAKD 4GKSB 3ZDYE 3ELAT 3ECVA 3S5YA 2OZ4A 1F45A 3QR0A 3NOIA 3SO3B 3ZQ9A 2H7WA 4YSPA 4M29A 2EUVA 4NBYB 3ROLB 1XGTB 3QQDA 4P9HC 1KY7A 2BFGA 3GI9L 4I9XA 1ES0A 4YUEH 5FGCE 1A65A 3TT3H 1C12A 5JTWA 4JVWA 3MA7B 4HJTA 4EI5D 4X0KB 1HL5A 4I18B 4JZJC 2DBJA 4QRPB 1ZSDB 2R8SL 3QO0B 3KNBA 4XB7A 1YNKL 2XOTA 1SGKA 1W6LA 4YEEA 5KVEL 3VXMD 5CF3A 2CKBA 2Y2WA 1SMAA 1G7MA 4C55A 3NRPA 1ACXA 1MHHB 4UINH 2JKTM 1NAMB 3FZUC 3Q7JA 4KGLA 1PX3A 3MROA 4OCXL 1OCZB 1EMTH 4U6YA 1OE2A 4U1KA 4JE0A 3VXOB 4EXKA 3AXLA 4BZ1A 1TTGA 4X8JA 2V0AA 4KTEL 4ZUTA 2P46B 3VXUE 3IMRA 2WBJB 2D03L 4TLUA 3C5ZD 3E9TA 4FXGC 1RCYA 3FZUD 2EEFA 5CMAB 1Y6MR 3RP1A 3VMOA 3GDCA 5ACZA 2PPDA 1L7TL 3CFJA 4WUUB 2WXRA 4UMSA 5I17B 4DPBX 2P80A 4GW4A 2G30A 4FQ2L 3CMOH 4K9EH 4FMVA 1AG0A 4RMWA 1KBGL 4HA1A 1BZ9B 3GJEB 3NJKA 2XCMC 5L0QC 4CSPA 3D3VB 3K80A 4WV1B 4YHLL 1JHKH 4JFDD 5HVGB 2NW2A 3VI3B 4EN3B 3Q3GA 5CGYC 4OW6A 4XPBL 3D07A 4H8QA 3KYOB 1QBBA 1UZ6F 3FTGB 1T21B 2IEPA 2DI7A 2YAPA 1ORQA 1YDPB 4D94A 3OV6A 1FAKT 3FB5B 4WKZB 5FB8A 3FU3A 5IJKC 2Y3AA 5CGYD 4BQ6A 3FU6A 2AEQL 5CSBA 5KSBB 1CCZA 3FQUA 5DZLA 3OWEA 4CRPA 2Y5TB 4E5XG 2VUKA 3D2UA 1EANA 2UYLB 2YN5A 4PU2A 5IW3A 4PW3A 4QXTB 2BY3A 4Z3HA 4BUGA 4M5YL 4P2OB 5CR1A 2MWCA 4MCMA 4ZFFB 4PRBB 2PCFB 3G6JA 3T2LA 1DJSA 2XWTA 2APVA 3FOLA 1MCNA 1YEHL 2CE6A 1E5YA 4NZUL 4XO5A 3ARBC 3UMTA 4TSCH 5GGTH 4KO9A 1J0ZA 3ULSB 3L3KB 4G6MH 5J56B 4MCYB 3GRWH 4PGCB 3QIBC 5FM8A 1L5GA 5T3ZE 1JNJA 1WLHA 3BUYB 4BQBA 1I1AC 4NQDA 4AEIL 1KGUA 4OZHE 1FAIL 4JRLA 5ACLA 3ARBD 4AL8H 4C8XA 1EHLH 3F5WA 1DUYA 3RWIA 5DUPL 4YGVA 2PF6A 2CALA 5SX5K 1KCVH 2XZAH 4FTDA 3BGFB 3IFNH 1HHJA 3LMJL 3P9LA 2DZEA 3V52L 1PG7H 4P4RA 3KVPA 1CIUA 2FEJA 1COBA 2XNAA 3S4SG 4HOXA 5DCCA 1PD6A 3TO4A 2ZWNA 4FJYA 1QR1B 1SBSH 3FF7A 1JZEA 1JV2B 4Z7NE 3JWDL 1JUFB 3H9SB 1RHHA 3S3PA 3VA2C 4UM9B 1FNAA 2YPLE 1V3KA 1R5VB 5J12C 2FB4L 3PDDA 5C0JB 2Q86B 4OKVB 4UTAL 3P2DA 1YY9C 2WIIA 3STZB 2ZICA 3OHXB 1DSFH 1DE4B 1TMQA 2JJTC 4KTGA 4MB4A 4RFEA 3DSNB 4DWHA 2WLLA 4GKZA 2P5WB 4FXKB 3II3A 4H8WH 1NGXA 5MI0B 3VFTA 1RUPL 2X4UB 2D3JA 2ZOTA 2QVFB 3SYOA 1TJIH 4QXVA 1XEDA 1YY9D 3RGVD 2X05A 1QMUA 4H88H 5I5MA 3B4NA 3DBXA 1XB3A 1ND0B 2X4TA 3VFGH 1O5DT 3Q1SH 4GSQA 1GOHA 5D7IE 2VW4A 4QHLB 4CMHC 1GYAA 1LO2L 1EFXB 3ZTEA 2GJ6A 4G72B 5JIIA 3K6NA 4AY0A 4QRFA 2A38A 4EZLA 2OXHB 5AAMA 4X9FA 5IFHL 4JRXD 1ANUA 4I7ZC 5CZXC 2KZBA 3SDCA 3V9FA 4X6CA 3RZCA 2NTFA 1NDMB 3CC1A 1HS6A 3ZT5A 2EYSB 1IX2A 1DCLA 1KJ2A 2NY4B 4XE0A 5I9QC 2Q7YB 4PVBA 3CHRA 3S8FB 1XTLA 5DMJB 5TK4A 3IT8D 1I3GL 3HS8A 4KVNH 1V27A 3DOSA 4MCZB 5CZXD 1LK3H 5TH2A 5TQ2H 2NSXA 1MLBB 4CVZB 3H2WA 4Z5RA 3LV3B 2BJML 1FNSH 2E47A 4M93B 3MDJA 2CDGB 3IN2A 4R8WH 4LCWA 4UOW1 3LZPA 1A3QA 1ZT4A 1P0SE 1V7ML 4PJDF 3CFTA 3FAWA 1TQBC 4XPGH 1F3JB 1QPPA 1PZ3A 3Q06A 3IFPA 2XY1A 3HZYA 1A6VH 1P1VA 3QEUB 4GFXA 3T3MF 2E5EA 3UTZA 3FB8A 4NX0A 4K8RC 3SE4A 2TSBA 3SDYL 4QYAA 4G6KH 4F20A 2ED6A 3BQVA 1R9FA 2G5UA 2Y7QB 3GMPA 5T1DL 4K71C 4Y2OA 2BCKA 5B22A 5J1AB 1UXSA 3LNGA 4GW5B 4K8RD 5I0ZA 2ADIA 2F9BT 1XBDA 4PS7A 3BPLB 3S5ZA 3AU1A 4WJG3 3B7YA 1VCBC 2CWRA 4J3OG 1OAYL 3K2IA 3ASOB 4K4KA 4JPWH 4TNFA 2AK4B 2CXGA 3S5LG 1RJZB 1M3IA 3D0AA 4KZDH 4DK5A 4IOIB 5ESQA 5IMOA 1JYVA 1BBDL 5DMKA 2EP6A 4LLMA 3RE0A 3TNMA 3V6OC 5C09E 1AKJD 3B7UX 2IANE 5EF1A 1NSNH 4N25A 5SX5H 1RXLA 1YEKL 2AJ3B 1CD1B 3C6SB 2O6PA 4UQIM 3ARFB 4LOUC 1AR1C 1KCUH 2Q8BH 3PXLA 3AT0A 4FDWA 4AVKA 1MFDH 2PN5A 4L1TA 5KZCD 4MNHB 4EI6B 3FQYA 3JZ7A 1NCWH 4YHIA 3SY0A 3ZDZE 4U1SB 2FO4B 2FL5B 3EOBB 3IRCA 1UVQB 2XWZA 4M7JH 4P57B 4XP6H 1XF3B 5F3HA 3F7VA 4D0CA 2H3KA 5IHZA 3NQKA 4LOUD 1AR1D 2ITEA 3BSZA 2J1YA 3IFOA 1WBXA 3KYNB 4P2RB 2MPAH 3JWOL 2BSSB 2BSED 5D2NA 3GI8H 4DPCX 1NMCC 3TURA 5K5YA 1UJ3B 5ENWA 3UO1L 1KJMB 4OD3H 2M83A 2ZOUA 2TSAA 1G7PB 2X4SA 3L3IA 4N2CA 2QVTA 1ZDQA 4KI5D 4JDTL 2YC1B 3HBGA 4W6YB 2AMUA 3ZY7A 3MCKB 1AE6L 5AW2B 4GBXB 4MRCA 4OGAC 2I07A 1O75A 5IROA 1G9ML 4H40A 1Z32X 2QKIC 3SE8H 2E59A 2MCPL 1HEHC 2HLAB 3ECBB 3EDEA 4MAYC 3KPOA 5SWZE 4JZOB 1GGTA 3KPRB 3LPFA 1IAIH 2H32A 4EUPB 3BLBA 3ZXAC 1CLYL 4BFJA 2ZP8A 4WY7H 1HKFA 2KMWA 3GO1L 3QUYC 2O6CA 4UDTA 2DLIA 5KS9F 3W0WE 1M53A 4GQZA 4MAYD 2I32A 2BSDA 2ZKYA 3F64A 5EZOH 4KRPB 5F9JB 4TQHA 3WJJA 1PCXA 1NQBA 1QHPA 1BCIA 3CWGA 3QUYD 1JMZA 3L45A 4JPVL 4RFOH 2AI0L 4FXLA 3CXDL 4UNIA 1INDL 3RI5F 3UTTA 4GLRH 1W8NA 5FYJD 3FTZA 1B2YA 4PJ9D 1HH6B 1JCKA 5BJTB 3AACA 5DD0L 2AXWA 4PLJC 4E9SA 5KYNA 1A1NA 1KEML 4D0BA 3NIDF 3DNKA 3MACL 3ECWA 4ZFOB 4FG2A 4K23L 2V7HB 3ZKQD 1DFBL 2FSEA 4JM2F 5D4HA 5KAQG 2C9SA 3BLKA 4QHKJ 5D96B 3UPRA 5JHAA 2XWRA 3BWZA 3OKEA 3HCVB 4AMXA 4ELME 1UCBL 1O6SB 1KPRA 5EUKB 4QNPE 3QW9A 5HPMA 3VFMA 5D6DA 4GG6B 3IVKB 2OJZH 2VUOA 1IM3B 4HJGA 2XWJA 1MG3C 5CEXB 1I9IH 1YEJH 4IRZH 3NGBB 1JZHA 3HE6A 3K6SA 1IBYA 4Y5VB 3TCLA 3GMMB 3UCQA 1HCFX 1M7UA 3HVDA 4NKOA 2GITA 3OAUL 2NQ3A 5C07E 3IXTA 5FO8B 2JV6A 1XH2A 1E90A 5BVPH 4RMRA 1JHTB 4M43L 3Q2CA 4JHAL 4JAMA 2A9BA 4LGPB 5AWNL 2MIZA 2OMWA 1A6TA 3WXVH 1JDDA 4YSOA 2GSGB 3RBSA 5GZND 4DH2A 3K6FA 3U4AA 4NZRL 2JIXD 2Y3NA 3MO1B 4QCIB 4QLWA 4GOSA 3ML9A 1KJ3H 3CDGA 2CO3A 1WVZA 5GRJH 5K9OB 1XCXA 4UT7L 2V4LA 2VXSL 1ZE3H 4LVHB 5F3BA 1AQKL 1U8PA 3IDJB 4JO4H 5C97A 5MEPA 4TULL 1I8MB 4YHZH 5EU5A 4LP4A 1BYNA 3MV8D 4G7VL 4L3EE 1HWHB 4RRPM 3HR6A 2HH0L 3BWAA 3G08B 4HEMA 4Z8FL 2YPKB 1R17A 3CFUA 3DPBA 3L2MA 4ODTH 1V5JA 4ABVA 4MMZA 4EIZC 3T1WA 2FT8A 3KPNB 3NZ8A 4DGWC 2DWXA 4PJDA 1FYTA 5CIPB 3VU1A 1I3RB 2QMJA 3PHQA 4J2QA 3ZRSA 4NZTL 3B9KA 4E5XB 2CG9X 4Z7OF 1A2YA 3QZWA 1PZUB 3IJSA 4ORGB 2UXGA 4FQLL 4UIMA 4ZG1A 1INEH 1QLFB 4Q89A 2YAFA 1XSOA 4FQCH 4HJJH 1B2WL 1G6RL 2FT7A 3R8QA 4F7PA 3TEXA 2VLJE 4YDMA 4I9WD 2HUEA 3TCTA 4ZS6D 3GZPA 1ES0B 3UGEA 4B7IA 1GCFA 1KN4L 3LQAL 2ZSVA 5IREA 4QDGA 1BJ1J 1JZIA 1C12B 1J1XH 5JUEH 3GSXA 2FATH 2ROXA 1S7RB 2DWTA 3EGXA 1E6JL 2MOVA 4YHMH 1SJVA 4KFZC 3KNBB 4NUGH 1C7SA 4BCXA 5T1KA 5TF1H 1JOIA 4L8SA 3HG1A 4OLZL 4DESA 4LEXH 2OP4H 3WKNA 3KR3H 5D71L 1T1XA 2KPWA 3TBVA 1MFAH 2GG1A 1G7MB 1RFDH 4I0PD 3N50A 3MROB 1DQTA 4U6YB 4GAJL 4KITB 3QNYA 4U1KB 2KC0A 3IFLH 1USZA 3AXLB 4X8JB 3RDJA 4ZUTB 3ARDA 5KVFL 3IYLW 1U9KA 1WIPA 1HJBC 3N2JA 4YFLI 1OM9A 5D72L 2IWEA 5ACZB 5IGXH 2LLLA 4P4KC 5EPMA 2EO7A 3R4RA 4GW4B 1MXGA 2PXYD 4CVUA 2ITCA 3RX5A 4HXAH 2CA4A 4JFFA 4MA7H 4R26H 4PS8A 5IW6A 4AQOA 3RURA 4P4KD 2CHWA 3DXAE 1GCYA 1ZLEA 3TPUB 3SDXF 2ESVA 2BSRA 4ZO7A 4LARL 3Q44A 2NW2B 4CSZA 3PY9A 1JS4A 2FJSA 5C08D 5DMIH 3APFA 1N6QL 2QADC 5CS7A 3LH2L 1YC7A 5GGUA 1ORQB 2AP2A 1TQWA 1G1CA 4LBEA 4LHUG 1DJGA 1I3UA 5FA4B 3O3AA 4TNWF 3GIVA 3EYSL 3FQUB 3LN5A 4LVNC 1ZK5A 2W9LA 3FQWA 1E28A 3D2UB 2QADD 5ADPL 3LXBA 4J39A 3ILDA 4FLOA 5KS9A 2EINB 5KSUA 4M8RA 4WSKA 1TZ8A 2BNQA 3D18A 2DY2A 5DGQA 5IVNA 3MJ8A 1F6FB 3ZL2A 1QI4A 3JVGA 4Q6IA 1TJMA 4K3EL 1NEUA 2XWTB 4POYA 2WP3O 4Q9QH 4R5XA 1RZIB 3ABZA 3BX7C 2ZPKL 2FX7H 2OSWA 2V37A 1L5GB 4YFEA 2ATKA 1DO6A 3UBXI 5SV3A 1RUAL 4ZS7L 5TQ0L 3U7WL 3BAJA 4NQDB 5GRUL 4UU9A 2XN1A 3EJRA 3F5WB 1DUYB 3RWIB 1THAA 2V5TA 3U48A 3LSOA 3FBKA 5IHLB 2DMCA 1HHJB 4JM2A 2HPTA 3I6KB 1JGEA 4IU2A 3VB8A 1CBJA 3P9LB 2IAMA 4FFYA 4P4RB 2XVKA 5CZVL 2XNAB 2QSVA 3TV3H 1YZZA 3TO4B 4Q9CA 1J48A 1OEZW 5J6GB 2V5SA 4TS6A 4YQXH 5KN5A 2CJUH 2GEEA 4JR9H 2XXCB 5AKTA 4WUUE 3L4YA 1T1YA 5AOMA 3T65A 3D85A 4WHCA 5IBTL 5CJOL 2EDHA 1U21A 1XZWA 3H55A 5FA3A 2UZPA 3GMLB 1KTRL 4BHUA 4IW4C 2WIIB 2ETWA 1HL4A 5AYUH 3D3VE 4RFEB 1UM4L 4PJCF 4BWWA 1EO8L 1Z9MA 4TMPA 1KG0B 4GQ9H 2NCEA 2WLLB 3FFDA 3HBQA 4GKZB 3VI3E 4HG4J 1NGXB 3HIZA 3DIDA 3MQIA 4LAJH 4BK4A 3TPKA 4X5QA 5L2KD 3EJPA 1N7MH 5DQDL 3DBXB 3MYZA 2X4TB 5JA9A 1G43A 3OKMA 5I71B 3D9AL 4PJFF 3V10A 5LKNA 3ULVL 3K4AA 4KHTL 2C3WA 2GJ6B 4FI8A 5KSBE 4A2HA 4N26A 4NERA 1UWXK 4KBPA 2DJ4A 2I60L 4RIRA 1DBAL 3SDCB 4X6CB 3RZCB 4YNYA 2NTFB 4WW2F 4Q74A 3SE3C 1KJ2B 2MQ0A 5DURD 4DP6X 5KBKA 4MJJA 2W07A 3T5WA 3C60C 1YYCA 3DOSB 1K3ZA 5K33A 5TH2B 3AQZA 1DYZA 3NAAH 1IV8A 3QDHA 2L0DA 3WXWL 5JOFA 2WYZA 1BIIA 2JKJA 1CT8A 1PS3A 1OQXA 3AT9A 1ORSB 4LCWB 5EULV 4JQXA 1ZT4B 4ZAKA 3VRLF 3GSNL 1MZZA 2X2HA 2FYYA 3BE1L 3C60D 4HIPA 1L6ZA 2DKMA 2IFFL 3MVSA 1EBPA 3DTDA 5HGHA 3U7YL 3TF4A 4IBVA 3LZFL 4AUYA 3ESUF 3IFPB 3VSUA 2J3SA 1Z5HA 5F9AC 3E6FA 3HZYB 3UTZB 1SHXA 2JQMA 3FB8B 1KTKE 3AWGA 3MBEC 4APQA 4KJPC 2L7EA 3V4PL 1WIOA 1KUMA 2R0ZH 4R0LC 4BUHA 2IPTH 3TC9A 12E8L 4EI5A 4ZSOA 5IB3A 9PCYA 2BP8A 2OX5A 2Z1KA 2EVIA 4HLZG 2VDMB 3GMPB 3AQDA 4Y2OB 4AIXA 1NUNB 1UXSB 1XGYL 4HXBL 2RH0A 3MBED 1KULA 1TYJA 2ADIB 1IBBA 4KJPD 1MHCA 1ZKAA 1G87A 3VXMA 3H9SE 1EEQA 4LSSL 3AU1B 3ILPA 3HB3B 3UZQA 5JMOC 4JZJA 2DQIL 2IG2H 1DBMH 2Q10A 3TT1H 4BDVA 5T1MA 4WFFD 5ESQB 5E6ID 5IMOB 1BVKB 5DMKB 3VACA 2N4IA 2P5WE 3TNMB 4OZIF 3C5ZA 2IFGA 5EEVA 3N9GL 4FZEL 1R3IL 3S48A 3V4UL 2CCLA 3O6FC 5DA0B 5CD5C 1X6NA 1CE1L 4N2AA 4RCAA 4BXSV 1MVFA 3H42H 1F11B 4XC1L 5F6HJ 3KCPA 2WVVA 1MEXL 3E8VA 3MUGA 1S3KH 3SDXA 4FXGA 5T33H 1GGIH 3O6FD 5A6LA 5CD5D 4XP4L 4YHIB 3SY0B 3TF7C 1DCEA 1FPTH 1FE8H 1NGYA 4HJUA 3CFBA 2E7LC 1QSZA 3NJNA 1G9HA 1ZOXA 3PGFH 4JFDA 5F3HB 1PX8A 1Z3GL 1KIUA 3F7VB 3OB0H 4EZJA 5IHZB 5I8OL 4XAKD 1EGJH 2R1XA 3IFOB 1WBXB 1WFTA 4R5VA 5LDSA 2DPKA 3QHFL 2IXQB 2YMXL 4HPYL 1ZLSL 1XBRA 4FQJL 3CNKA 3MLYH 3EF7A 2D9CA 2J88L 1OGPA 4PEEA 2CGZA 2X6VA 4GNKB 4EOWH 2X4SB 2YXVA 3L3IB 3OKKA 4KRNA 1JZ2A 2WIMA 2IDSA 5DHDA 3K8LA 3V5DA 1LO0H 4LIQL 3F05A 4C59B 1PLGH 4ZNEA 1ZS2A 2NY2C 4KI5F 3VD3A 2I07B 2Y5QA 5CCKH 2KERA 1ITCA 4FFZA 1SHSA 4KXZI 1D5RA 5DRNB 4BRVA 3KPOB 5IJKA 1CMOA 3O8XC 5I1KH 1FV1B 5IOKA 2H32B 3KEHA 3FYIB 3U0WH 2H47C 1GC1H 2IF7A 2YEZA 5AW8B 5JOPD 4UDTB 4JKPH 3VDCA 4QJ3B 4N0RA 3ZT7A 3O8XD 3VXSD 2JXMA 3AAZA 3TT3L 1JXFA 1P9MC 2EDDA 4N2KA 1N0XH 1S6NA 4HOWA 3UTTB 1KYDA 2AK4E 2PUQT 4K3DH 1J0IA 2WUBH 1O6VA 3OJDA 2EDOA 1MIEL 5HPOA 3MTXA 4L1HA 4JQVA 5FW8A 1A1NB 1CS6A 3T09A 5L8KB 4D0BB 4UINL 4ZFGL 3MI6A 3L3DA 4NFDA 3C2SA 2VSKB 1EMTL 2FSEB 4BFIA 3UPRB 4M7ZC 3A6BL 3BJLA 1OTUC 3OKEB 4BZ2A 3FO1A 4HZLA 4JFOA 1KPRB 4WFGD 3GPSA 4AEHL 5HPMB 3DX9B 4JRWA 5EU6B 4HJGB 2XWJB 4PJCA 3QCTH 1YMMD 3IMUA 1CFVL 1T83A 4WU7A 1P4BH 3HE6B 3K6SB 1OTUD 4PJ5D 1SDYA 1XO8A 3CMOL 5EDXA 4K9EL 3RQ3A 1OANA 1PSKH 4PSRA 1TLMA 4WHYH 1KTLA 2GITB 3F58L 3ZTNH 4NEHB 1T20A 3IXTB 4DTGH 5AW5B 4ZX4A 2G4GA 2QTEA 2C9QA 4P2RE 3RGVA 5E8DL 4PJFA 2UZIH 2EIDA 2DQMA 1DHKA 4JAMB 2OMWB 1CTNA 1A6TB 4YXLH 5D7LB 4UOW0 3MXWL 5AOKA 1JI1A 1X44A 3U25A 2JWYA 4HIXH 4OJDH 4XN2A 4XH2A 2DQTH 3U83A 1DQKA 5FYKL 1MLCA 4WW2A 1NTDA 1YY8B 3CDGB 3ZZQA 4JRXA 2EQDA 4AGPA 3GMQB 5GGVL 2XN9D 4C54A 5F3BB 5MEPB 4M9OA 5MEND 5EU5B 3KPRE 2JLPA 3EKCA 3II1A 2YD9A 5IOPB 3U9WA 5MP6L 3LEYL 4OCRH 3BWAB 3DPBB 2OMXA 2XZQH 3QRBA 4Z3TA 3NZ8B 4GI9A 4PJDB 1BJ1H 3LJ3A 1FYTB 5H37G 4XGZA 2UZXB 4L8DA 5D5MF 5A1AA 5B3JF 3DO7A 3H0TA 1REIA 1A2YB 1NKRA 2V9RA 4TSCL 5D7KE 3SYAA 1M7DA 3RYMA 2HVKA 4G6ML 4ODXA 4HG4K 3GRWL 4R4NC 4L29B 2XA3A 3I6SA 3NN8A 2AJXH 5AYTA 1BQHA 2QGDA 4QRAA 4G6FD 4F7PB 1EDQA 2GUOA 4KDWA 3EGDA 2FIKA 4N87A 5IB2A 4R7VA 4AL8L 2IH9A 3APCA 2H2SC 3JVFC 4L9LA 3LKRA 1KCVL 4R4ND 2XZAL 1ZTMA 2ZSVB 3QI9C 4XNXH 1ASOA 5DD6B 1MRCL 2YQ2A 2MCG1 2QBWA 2VDOB 4O00A 3RFRA 3EGXB 3GLZA 3OZ9L 1AXTH 2Q3AA 1NZRA 3O0RH 4TPRH 3RIAF 4YX2H 2OI9B 3TJEL 4Z7UF 1D7CA 4GG6E 5T1KB 1SBSL 3HG1B 1KSRA 1MCDA 1UT2A 1UOWA 1G1YA 4L2LA 2Y7NA 1AACA 1HU8A 1T1XB 1UB5A 4G8GA 3TBVB 4OZIA 1BQUA 3CFKA 3EYUL 4L1SA 4PY8I 3S36L 5IEKA 3NCXA 3KLDA 1H5BC 3LVTA 3QNYB 2V5YA 4U1NA 3R0MA 4Y5XC 2V9QA 1AKJA 3ARDB 3TO2A 3SE6A 2IMMA 3PGCA 4A67A 1VFUA 3FB6A 4L1LA 4O58L 4ZD3L 2YXWA 5E6RB 5EPMB 2AXHA 4ALAL 4KMQA 1W80A 1RPUA 1NBQA 3V6OA 4HJ1A 4RMUA 2VJ8A 2ITCB 4X4YA 4LVOB 3GUTA 3OJMB 1XF2B 4JFFB 4DSYA 5AAWA 5IW6B 2WW8A 3M1CA 6TAAA 3WFHA 2Z65C 2ESVB 3CN3A 2BSRB 4EXPX 2CDEA 2BSEA 4WI5A 5DEJA 1GZQB 4Y16C 1MY5A 5I5JA 1X5KA 2X0VA 1DQVA 1JFQL 1TTUA 4NM4H 3Q5YA 2FJHB 3ZHLA 5C2UB 1ZY9A 3EOTH 1OD9A 5GGUB 3S34H 2HXAA 2R9HC 1ZLUH 3VWJC 5K69A 3P4LA 1EUUA 4OCSH 3TASA 4WJ5A 4UB0L 3LN5B 2YHGA 1FNSL 3FQWB 1E28B 3VGFA 4R8WL 2WTPA 2QV2A 3H53A 1A3RH 1WS8A 4N1HB 1BQSA 3TA4D 3PDGA 2DIBA 4HSAC 5KSUB 3PAVA 2ZXCA 3VWJD 2BNQB 3GRGA 3D18B 1YAZA 4OU3A 5I75C 3MJ8B 5I8CA 5IKCA 1CK0H 2X70A 4XPGL 2NY0C 4Q6IB 2QKIA 4XMXA 5TTRA 4MAYA 2QVMA 1A6VL 4WTZA 5HTSA 3U2JA 1UT1A 4OJCA 5LHDA 3INUH 1FFNA 2NDFA 1XXFC 2OM5A 4JFHE 3CUPA 5AZ2H 2DI9A 4XI5C 3QUYA 3T8MA 1X9LA 4B0MB 2NY0D 3ZKMC 5GS0L 1EVUA 2VQ1A 5FYKU 4K7PX 4PJ9A 3SKNA 2PKDA 3K2MC 3LSOB 4XI5D 1RK1A 5K39A 1F58H 3O6KL 4K5NA 5JHDD 2QPSA 1NGZB 4FGMA 4JM2B 3ZKMD 4IU2B 4OGZA 1U4EA 1G7JA 2IAMB 2ZUWA 1KCKA 4AQ8A 2EIBA 4UYQA 1XDTT 3U9UA 5HVHB 1BBJA 1OZTG 3G6DH 5KN5B 4U4IA 3M07A 4PSPA 4O4YH 1T1YB 3T65B 3L17A 1KBVA 3GEFA 2CBMA 4PS4H 1XGQA 3MRCA 4G9FE 4X7DC 2JELH 2JMRA 2K9FB 2VR9A 3BCFA 3DV6A 4N85A 4DO4A 3BPOC 1ZLVK 3DVIA 2AJUH 2G2RA 1JPEA 2OMVA 2Q8BL 2WXNA 3NP3A 3OAZK 1UKQA 1F4WL 1MVUA 1MFDL 3HMXL 1QFUH 1EHAA 2BLFA 1NCWL 3TFBA 5KYYA 4BCYA 2JKSA 2LW3A 4M6ML 4M7JL 1CFSA 4XP6L 1MOEA 2DJMA 1ZK9A 2Q8AL 1WGOA 1NGPH 4FG0A 4GRLC 1CVRA 1PEWA 5GZNA 1SFDA 3COOA 5ANMA 2JIXA 5KJ4A 1JN6B 3MX0A 2X1QA 4Z7VF 2FD6L 1BVNT 2ZYSA 3AABA 3TGXA 2E9GA 3L1OH 4IK6A 4N86A 2G5BA 3X1GA 5EO0A 2BCMA 3GSOA 4GRLD 3B56A 3U1SH 4AM0B 4OLWL 4RIRB 3AWEA 2H0PA 1SFHA 1U8JB 3NZHH 3MV8A 3MLTA 4YNYB 1R5WB 3STBA 1ET8A 4XT1C 4ZMVA 4YHKH 2F1EA 3DK2A 5IJDC 5D5MA 5TE6H 5EEYA 3QUHA 2LTQB 5DUMH 1WD8A 2VW7A 1OAQH 4G3YH 2W07B 1QD0A 4EUPH 4OT1H 5CLXA 3IXAB 4DN3H 1UKSA 4JHVA 3U1PA 5F7DB 5JOFB 4WTZG 2IBGA 1BIIB 2LV4A 2YJLA 5AOIA 3NPSB 1CT8B 4ZAKB 4K9JA 1QO3A 2EABA 4NQDE 1A02N 5EZOL 4JFTA 2FYYB 5DVLA 2NNRA 2WLIA 1ERNA 4JFWA 4PRID 1AI1L 1U6AH 3WSQH 3MLVH 5B1AB 1RVFL 1QWUA 2GJPA 3NCCB 4F9PC 3HHSA 3GC3A 4G7RB 2HT4C 4Z0BL 4ACTA 5T3ZL 1H0DA 2F18A 3OG4B 4LEEA 1FO0A 4ZTOL 4RMBA 2C9RA 1K4CA 4Z7UA 3D51A 1BYOA 4TKWA 4ZSOB 5FO9A 3VWKC 2BP8B 2OX5B 1ACZA 4N8CH 2J25A 2HT4D 4NB7A 3CZSA 1MHCB 4UZGA 3VXMB 2YRPA 4PPTA 3AB0C 2XV0A 3NJXA 3ILPB 2R83A 2ZX5A 4I0PA 3UZQB 3VWKD 2G75A 4JZJB 2OJZL 3TP4A 2H9GB 1Z9LA 4BDVB 2DMHA 1WS7A 4GRWF 1NCBL 2NUTA 4K7FA 3E2HC 5B1CA 3MJ9A 4E68A 1KGCE 3BVXA 4M8VA 3VUAA 3C5ZB 2J6EH 3I85A 5E99H 2HAZA 3WUZA 5ABDE 1KXTB 3ZSTA 2VH5L 1CGVA 3WL9A 2QLVB 4YSEA 3B2UC 5LN4A 5HD8C 5BVPL 3QHTC 1DVUA 2D31A 3KCPB 2PXYA 2WVVB 5EORH 5E8PA 3EOYG 2PWEA 4LSTH 4J5VA 4FXGB 2GJ6E 2WZAA 4DGYH 2Y69B 1B3JA 4FFVC 3B2UD 3O45A 4P4KA 4TUOB 5HD8D 3SGKC 1S9XA 3BD3A 3NJHA 4F7CA 1NGYB 3CFBB 1KJ3L 2F2HA 4JFDB 4OAWA 4X6CE 1KIUB 2MNWA 4FEIA 5GRJL 4WWID 2F19L 1GS7A 4PRPD 3P54A 3J27A 2R1XB 3KGTA 5C08A 4JGUA 4HCRL 5CEYA 4JO4L 4FFVD 3WNIA 4TNGA 5JZ7D 5M95B 3QRFM 1Z0NA 1KC5L 4KPHH 1A25A 2NQCA 3J07A 4ODTL 4AV0A 1F5WA 3OKKB 3L9RA 4JHUA 5D4IA 1KENL 3LEVH 4LCWE 4FQPA 3V5DB 4NRYA 2XUWA 4FLSA 5CIPH 3IPEA 4ZTPH 3FU5A 3LZOA 3RDTC 3SKUD 2FO8A 3ZE2F 2QQKH 1CYWA 2X3AA 4MLSA 2WWKO 4KHXL 1RZPA 4HH9A 4MYWB 2F7OA 1I31A 1VRSA 2XKUA 1EHNA 3GS4A 2W9DH 3FCTA 5F9WC 4A66A 1V3LA 3RDTD 2DQJL 4JFSA 2YEZB 4UT9H 3IN0A 4EVNA 4W9CC 1YNTB 4PJGF 2ZCLH 2GBVA 1QWHA 3RB7A 3B2MA 2QHLA 3FUEA 4CC1A 2BVYA 2JXMB 3Q05A 1XFPA 2TRYA 2NLJA 4PCKA 1CLOH 2VITA 2EO1A 5FOBB 4UQ2A 1J1XL 3QXUA 2MNJB 1EVTC 3ARBB 3QEQD 1JPGA 4HFUH 2FATL 3QQ9D 1GOFA 5MHSD 4NUGL 4XOEA 2CIIA 4IDJH 4JKLA 3MOAL 3OJDB 3LDBC 4JFXA 3TIDA 3U4BH 3BZEA 1RFDL 4O2CA 3NTCL 2Q0ZX 3L3DB 3QQ3B 1IC4H 1OT2A 4LPYA 3IFLL 4XNUH 2XVLA 2FWUA 1GSMA 1RUKH 4OJFH 4BZ1H 3FO1B 4HZLB 2R1WA 3ATBA 4JFOB 3BUBA 1F3DJ 3HZVA 1PFOA 3K0YA 4HS6A 4KKAD 5PAZA 3ZHDA 1LO4L 3WTVA 2ZNWA 4P5RA 5AVTB 3TM6A 4JLRB 2CGRH 4OF8A 4PJCB 3KH3A 4WU7B 3WO4C 4OSUH 3F65A 4XBGA 1CURA 3WLWC 3NCFB 1UZ6E 1JWMA 4HXAL 2P5EE 1KTLB 3ESOA 2FTAA 4MA7L 5J12B 1T20B 4R26L 1S9VB 4WI7A 3ET9F 4ZDHA 5L2KA 4GYBA 1PJWA 4PJFB 5EU3B 4Z7VA 1HHKA 3WLWD 3W37A 4YMPA 1E3ZA 1FDLH 5HDLA 5LLIC 1W0WA 2Y6TE 4BH8A 4XH2B 5C0EA 1ZJBA 5T3XE 1MLCB 1URIA 2J6WA 2A9AA 4JRXB 4NYLB 4Q6KA 1CYXA 1KXHA 2PMZA 3CLFH 2YBGA 4JFED 2VMEA 2ZYRA 2VR3A 4CMHB 2J2ZA 3SQBA 4BFEA 3L4TA 4B9PA 3L7FA 4K94C 2JE8A 3WMSA 3LN9A 3S35X 2CQVA 5I1EH 1UM6L 3MLWH 2OMXB 1QFOA 3FQ1A 3RVUD 4Z23A 3SE3A 5D1ZI 1WFJA 3ZYZA 3P0YH 4XGZB 2DOCA 4L8DB 5I30H 3DO7B 3CVBA 2QPFA 5I9QB 1WISA 1ZGLA 1M7DB 4HCGA 3C60A 3EH2A 2HVKB 3IDYC 1DBJH 4ODXB 2FX7L 2NY1C 3MCLL 3J2PA 3NN8B 5L88L 3D06A 3UTTE 2KH2B 3K46A 1BQHB 3K4DA 1IEBA 4R5TA 4MSWB 3E8UL 3MRJA 1OT1A 4CMMA 3EGDB 1LO5A 2FIKB 5IB2B 4N0UA 2GUYA 1A7RL 4ZO8A 5DUBA 2WC7A 5FM5O 3LKRB 2NY1D 4I3SL 4DP9X 2FX8L 1A9BA 3LHAA 3SKJH 1CFMA 1L9RA 5BXFB 3CFNA 3V9EA 5D8JH 3O2WH 4NKIL 5CEZH 1M6OA 3BFOA 4B50A 3C08H 3MBEA 1SDDA 1QWNA 5H2BB 4KKQA 2HJLA 3N1FC 1FVDA 5DDHA 1A3ZA 1J18A 1UD8A 2EE0A 2FJGA 4YQXL 1BEXA 3LYRA 5EU6E 4JR9L 1ZGLP 3QJFA 2WWNA 4MXWH 3G9VA 4ELDA 2DLTA 4J3OH 4K71B 1N2RA 3CFKB 1MNUL 3ARVA 4U1JA 5E6IA 1N26A 4TUUA 2DF3A 5IEKB 3SO5A 1FC1A 3SDAC 5JIKA 1Y07A 1S9WA 1BMZA 3TO2B 2VDNL 4OZ4A 5AVQB 1Z66A 2N01B 5H4ZA 4UDUA 1GGYA 4NI3A 4GQ9L 3HMWL 1Z5YD 3WNNA 4ODUA 2K4WA 3PGCB 2WM0A 5D7LE 2K78A 2QEJA 3FB6B 4N9OB 3SDAD 1ZVNA 1AMYA 4LDEB 1B0IA 1EEZA 1N7ML 1ZTXE 3D6GA 3O6FA 5KZCB 3ZZ1A 4L5FE 4WHTA 4X4YB 1A47A 3GUTB 1CDBA 3W39A 2DH2A 3HNSH 2VQ4A 1TXKA 5EIIG 2YSTA 1E7VA 4ZPVB 3Q8EA 1F1DA 1AR1B 2Q2EB 5IFJB 2I85A 3WFHB 2NY5C 4HSCX 2B1OA 2BNRE 2CDEB 2JCWA 1HCZA 1XD0A 3WNJA 2E7LA 3CG8A 4P23D 2ZXGA 4NJ9H 4A6YB 4PJDE 1FYTE 1KJ2H 2MTAA 3GF8A 4ZNCD 2Z31C 3HN8A 1ACYH 1EPFA 1NMCB 1YEGH 5GS2D 2F7IA 4EN2A 3NAAL 4P5MA 1M7XA 2J4WH 5LCVH 3DDFA 2DYRB 4PJGA 2YD1A 5GRWA 2C9UA 2WAHA 4J3BA 2D8KA 4JO1H 1OSPH 4HDIA 4HKJB 4ANWA 4GO8A 2Z31D 3CV5A 5I8CB 5IKCB 2X70B 3MJWA 4PYHA 4N8VG 4AOFA 2QKIB 4Y7MA 4MJ5A 4EI0A 4MAYB 5ISZD 1TJXA 3O8XA 3DJRA 3TN0C 3VXSA 1GJIA 3CVHA 4BCZA 2CUHA 4L8BA 3L7EA 1FFNB 3RIFF 2I5YH 2K4AA 4A2EA 5HI5C 1NC2D 3MCG1 4RAVA 3CUPB 3MR9A 5B1BB 2BP0A 1O0VA 3QUYB 2IPTL 5E1QA 4K7PH 4F8OA 2B39A 3M45A 2VQ1B 3WY4A 3BUTA 3HG1E 5ID1A 3CDZB 1FZOA 5IT2L 2VDMH 4UAOC 3CTTA 4EO5A 2WINA 3GHBH 2XN0A 3QIUC 5E56A 4LB8A 1P9MA 3SKNB 1BWWA 1QZNA 4J12A 1RK1B 5K39B 1FFOA 2WV3A 4UZUA 4UIKH 1BFOA 1G7JB 2N7BA 2XDHA 4FOMA 5I8EA 1DBML 3U9UB 3QIUD 3M17A 3ZYOA 1BBJB 2R69L 2Y25A 3FO0H 4XZUB 1CICC 1Y1UA 4YFLF 3A4EA 1E2VA 5LDUA 2UXVA 3WUWA 3AW5A 1F41A 2VXTH 1MJUH 3MMEA 4ZUWA 4ANVA 4EKXA 1XGQB 2D73A 1YMMA 3MRCB 3ISRA 2YK1H 5KVGH 5BUGA 3VW3H 4DKFH 3L5HA 3DV6B 4PJ5A 4JFFE 3D7PA 4PY7A 4X4XA 1CICD 2G2RB 2OMVB 3J8F7 2W9EH 1IBGH 3C8HA 1MVUB 5T33L 1GGIL 2ESVE 3FRPG 4JFZH 1OAKH 2EDEA 5D2LB 5KTEL 1FPTL 2E75C 3IAQA 5LGKA 2ADFL 1PPIA 4YSSA 1OO2A 3KYKH 4GO9A 3PGFL 1CFSB 3I2CL 4P04A 1B4JL 5H4YA 3BSZH 4M62L 1E3FA 5ANMB 4JCMA 2JIXB 1KJVA 5EEWA 2K45A 3MX0B 1S7TA 3DJZA 3MLYL 1JDCA 1AGDA 4U31A 2OMBA 3FJTA 4EOWL 2XN9A 5I1HH 2ICES 2FH8A 5EO0B 3EYOB 3GSOB 5EZPA 2PCPA 1A7PH 3VJ6A 7PAZA 5MENA 2LFEA 1EJOH 1LO0L 5E8EA 5T3XH 2Z92B 4Y2DC 2WKGA 1ZT1A 3MV8B 3MLTB 4JFPA 1DJWA 3RNKA 5CCKL 2WO3B 2W60A 5D5MB 5DMGC 2R0LH 4A7UA 2ICWI 5I1KL 2LT9A 3FFOA 3KLKA 4RSVA 3P77B 3QEHA 4Y2DD 5FOJA 3DIFA 1GJUA 3HZ3A 3LQMA 3MLRH 4PG2C 5B39A 3SCMD 2IQ9H 5TDPA 3FDWA 5C0DA 1IC7L 2JI3A 1OIOA 1QO3B 4NNPH 1B0GA 1TYEB 2WLIB 2V2WA 1TVHA 3ZMRA 5FYLL 4ACPA 2G60L 3FT9A 4JG5A 5EO1A 2FGWH 3HHSB 5LBSH 5C0IA 1T4WA 5D9SA 1H0DB 4GH7B 4PGJA 1VFBA 1MQ8A 2BIOA 4F1ZA 1K4CB 5KWYC 3UERA 1LP9F 1Z0MA 5GS3A 1UKTA 3IAGC 2V8LA 4AJVA 2MJWA 5FO9B 5JQHC 5HJBA 2GPZA 4XN4A 1NAML 4KKNA 5GSRB 1G84A 4J4PC 4OB5H 2R0KH 2A6IA 4HU8A 2YPLD 3V79C 3V7AG 5HYSG 3HHRB 3WUWG 4I0PB 2HMIC 4U7KA 2G75B 1EXGA 3MV9D 3QEGL 3QFJD 4P9MH 4M7LH 3MODH 5JW4N 3BRGC 3FU8A 2V33A 4J4PD 5AB2A 1MFEH 2CCVA 2NUTB 5TE4L 1C8QA 1KIRA 4K7FB 2XQYA 4MB5A 3NPZB 3LS4H 2HMID 1FH2A 1MFVA 1SZNA 2IGFL 4LASL 3SOTA 1RH8A 3ZTNL 1QNZH 5FFOA 3WL9B 1H5BA 3WTUA 3U82B 2ZQKA 4Y5XA 4XMTA 4F2FA 1RL1A 3AS1A 2D31B 2CLZA 4LRIC 2PXYB 5E8PB 1IE4A 4FADA 4IHOA 4GSDL 4YXLL 5A2JH 1B90A 2F53E 3O45B 1R3HA 4HIXL 4LPCA 4P4KB 1S9XB 2DQTL 4OJAA 3RWJB 1ZTXH 2CKNA 4L4VD 4F7CB 4FFTA 4P06A 4YSQA 4L5FH 4OAWB 1PY4A 2R1YA 2VDQB 1FH5H 2NYYC 3EGSA 5C08B 3RI5K 5CEYB 2GT9B 4M4RA 1EAJA 2ZG3A 2X9WA 4CADA 5IUCA 1SOQA 4OCRL 3VMNA 2ZUYA 5C9JA 3MN8A 4U1MA 4PLNC 1JZ8A 2C1PA 2NYYD 1Q4NX 3IKCA 1DDTA 1C8PA 3L9RB 5CU9A 1J5DA 1L6PA 4R97C 4M4PA 3V4VH 4NRYB 2BOLA 4ZUVA 3ZO9A 5J11C 2AKRA 2QADB 1Y18A 1NBZA 3GXTA 3VXTA 4Y1SA 5GGSA 1AJ7H 1RZFH 1WC7B 5GJTL 3CN0A 4JY4A 1L3NA 4NZ8A 3VWJA 4X98A 4HH9B 1JGUH 3PL6C 2B1AH 4N2FA 2YQGA 4LVNB 1S7VA 4F27A 3U30C 3UJJH 2YD6A 2EECA 3L5IA 4EVNB 4QRRD 5IESH 2B9AA 3JT2A 1YEIH 3PL6D 2NLJB 3ZL4L 5JPNC 2ERJC 1P6AB 2VITB 3BDYH 1MJ7L 3DUSA 4MZ2A 4UQ2B 5HDBF 3US1A 4Q7DA 1S7WA 3VXME 5AW0B 2F7RA 2ZCKH 1JPGB 3PWUA 1H8NA 2DD8H 3A6CH 4XMVA 2VDOH 2AZAA 4Y9FA 1AXTL 1FIGH 1CL7H 3BHBA 3O0RL 4TPRL 4YX2L 3MBWB 4NBXB 1JGDA 1MG2C 2NPLX 3K8KA 5JHDA 2CIIB 1N6UA 3LPOA 4WWPA 1FG2A 4JDVB 4K5LA 4JFXB 3TIDB 1DJXA 1KELL 3DX3A 3BZEB 1RUQH 3LRSA 4O2CB 4R2GD 1DJZA 1EH9A 4DEUA 4CU7A 1QPXA 5C09D 1ML0A 2IAND 2WWOA 5CD3A 1R1CA 4OCWL 1E5BA 3M46A 4QXGL 4X83A 5DJ2A 5IJVA 5IMKA 1GVIA 2UUDK 4DP4X 4PGBA 3BP6A 2R1WB 3DYOA 5F8RC 4NKMA 1D3CA 2KQMA 4HS6B 3WFBH 4AV4A 1FHGA 2C9AA 1QFWI 4HEPG 2H26A 1KGYE 4G8AC 4G7QB 3NJJA 5JYLA 3DIVA 2ZX7A 4P59H 5LBGA 3MV7D 3QXWA 2J1KA 5B1KA 4JFDE 2IDFA 4HUNB 4RZCA 3ZE1F 2ZZUT 1C08A 5D70H 4QTIH 3I3BA 3QDJA 4ZDHB 5L2KB 3SY6A 4K0OA 1F56A 4Z7VB 1AAJA 5C0CD 5E2UL 1HHKB 3WTWA 4MVBC 3C8KA 3NBNA 4HBCH 5HYEA 3VD1A 3PWLA 1W0WB 2VZUA 4JN2A 4OFIA 4BH8B 1F4XH 5HHQA 3SZ6A 4DAGL 2VMJA 5C0EB 2DICA 1PZAA 1UM5L 4GRLA 4HC1L 2KT6A 2A6DA 3UTSD 4ZNEE 4Q8BA 4W9ZA 1CGUA 3S34L 2FGZA 4BUQA 3FKUS 4QHMB 4Z7QF 2CH8A 4MVBD 1RP8A 3ZE0F 1N5AA 4UQ3A 3SQBB 1BAFH 3S35H 1PZBA 3VFSA 5DURB 1RZ7L 1HEZA 3L7FB 4B9FA 1S7UA 2XVGA 5CO1A 4QXWA 4EAEA 1ECYA 3UBXA 1GSKA 4XCFL 4XVSH 5L2JB 2C9XA 1RLBA 1HXMA 1CK0L 1NIEA 1TZIA 3F00A 4W1TA 2D3VA 5I1GL 4FNPA 2P28B 5F21B 3CFIC 2WJ5A 2IWGA 3GXFA 4HOMA 4B9CA 4XOBA 1ZGLB 3BSGA 2WB1A 3C60B 1UJTA 4XCEA 3VNZA 2VTFA 4PRIA 2A77L 1RZGA 3IJ8A 4R4BB 2AVFA 4L3AA 3QFDA 1BFVH 4OGQC 3EDJA 1LP9A 4H0GA 4XPTL 3MRJB 4NAQA 1DQMH 3Q8AA 2GJZA 4WVRA 1LO5B 3ARZA 3T1FA 4CMMB 1UA6H 3BYTA 1BGXL 4RRPA 5DUBB 4QXUL 1A9BB 4ES9A 1H3GA 4F9PA 2OULB 2VKXA 3OXSA 1M6OB 4RGNC 4MD4A 3MBEB 1SDDB 2HJLB 4HLZH 4DW2H 1DEDA 1FVDB 4R0LB 3QXDA 5DDHB 2FJGB 1U8KA 5D1XC 4CNIA 1VB9A 3G6DL 2P8LA 3VWKA 4GRWB 3L5JA 3WMPA 3QJFB 2F58H 2COQA 4KK5C 4PJCE 4RGND 1N2RB 3BH9A 5GISH 1PYWA 2WXIA 4U05A 1C1EH 2IOMA 4YLQT 5E6IB 4OF5A 4APXA 5J1SC 1DBKL 5C07D 3ZGIA 4TNWK 1NUGA 4PI2A 3P4NA 3LKOA 4KK5D 1BX2A 1S9WB 1W72A 4PJFE 1QFUL 4OZ4B 4IHBA 3CU7A 4UDUB 2MPVA 1A0QH 3ECUA 4ODUB 4XN1A 1R3KA 3GSQA 3JV0A 2ARJQ 3O6FB 4PVLA 5IHHA 4RGOL 5J6HB 2Y36H 4J3TA 1T7WA 5IHUL 1EAQA 4WHTB 4JRXE 4NWUH 3F84A 5D1ZC 5B8CC 1JIBA 3SQOL 3FU9A 4QHUA 4HMDA 2MMXA 5D4JA 3L1OL 3BDBA 4PRPA 2LE9A 4RBPH 5LAXA 5JORA 2UUDH 1J10A 1QBAA 3IMVA 4LCCC 1PU0A 1UENA 3U1SL 3QJHA 4PCSA 5D1ZD 1OK8A 3PU7A 2OS7A 5BV7H 3HG3A 1NOFA 1HIMH 3VRLE 1PFCA 4C4BA 3ZE2B 1MWOA 5TE6L 2DLGA 5DUML 3UBXG 3MNMA 4QUOA 4G3YL 5H35A 4AYFA 1NUDA 4DN3L 1OP5H 3CFQA 1JNHA 4P5MB 2O5XH 4HUUA 4QGYA 2YPVL 1IQWL 2EH7L 2GTQA 3FSAA 4BK8A 32C2A 5HHMD 1Y0LA 2WCPA 1FUNA 1WFNA 2KZ1B 2VXVH 4PJGB 3GBEA 5DJYA 3ZDYF 1RULH 2GQHA 4HDIB 3RDTA 1MCPH 3IJYA 1UATA 1OWRM 1YMHA 1E40A 1U6AL 3WSQL 1JTTA 2QTVA 4Q9BA 1HAUA 3QQXA 3GK8L 1BWMA 4MJ5B 2HTLC 3BT2H 3O8XB 4RRPG 3VXSB 5LXGH 3CVHB 4P5SA 4LU5L 4ZODA 3MUZ1 4L8BB 3L7EB 1I8AA 5C92A 4RAVB 3N3EA 2BP0B 3QEQA 1JWSA 1GZPA 1VERA 4HJSA 1I8UA 1ZVYA 1CZ8H 2XG5A 3KBEA 4N8CL 4FA7B 2HTLD 4QF1A 5ID1B 2AVGA 3OGOE 4DJMA 2WZPD 4Z1PA 3QZLA 1XGUA 2WINB 2XWCA 3EJCA 1GY2A 2HG0A 2WQWA 4AUJA 2ADGA 3QUKA 1FFOB 5EEZA 4FKHA 1BFOB 3M1BB 1UEMA 1I7ZA 1HZHH 5I8EB 3ORJA 2E8ZA 2BDNH 3GKZA 3MLUH 4JL1A 3M17B 2MOGA 2OMTA 5EF3A 2ZUUA 2ZSWA 3FHAA 5IM7A 2J6EL 3WUWB 5J5EA 2JKNA 2N7SA 4TVPE 3MMEB 4ZUWB 3V6OE 1MCRA 1YMMB 2E4TA 4NS0A 4M7ZB 5CLWA 5IQLA 2AXJA 3PFQA 4PJ5B 4PY7B 3GINA 4X4XB 4WNJA 4X4MA 5JDJA 3G04B 5KJ7E 1G9MC 1LEKA 5HYQA 3DX4A 4DGYL 2Y1ZA 1WIUA 1QI3A 5LNDA 4M1DH 2Y6SC 1JPTH 4ABUA 4CSSA 5HY9B 4NRZA 3VGEA 2RQEA 4LEBA 5L9DL 5E70A 1QPKA 5LNGA 4NIYE 4E9TA 3N44F 2E7CA 1KJVB 4HIQA 3RIKA 2HFFA 5JIHA 1GPOL 1S7TB 1Q72L 1Q9LA 1HDMA 5BZWA 1J9RA 2B20A 3JWNG 1AGDB 2XN9B 4JFEA 3DSFH 1JNNL 5D7JC 3T3PF 1RJCA 3VB9A 2PCPB 4JFUA 3VGBA 3VJ6B 3BN3B 5MENB 5DR5L 5E8EB 2ICEC 5GGTA 2H5UA 4WNQA 3LZRA 1E5AA 1ZT1B 4H2AA 3W2DH 4JFPB 1MPAL 1TEFA 2QQKL 4W9LC 1C5DA 1QAWA 1L9MA 5BRZA 3RNKB 1NCIA 2PYED 4R96A 1N4XH 4FFZH 5D7JD 3FT2A 3SPJA 1RURH 5G4MA 5FUOH 4TTGA 3NRQA 3POCA 3OQ3B 2OZ4L 3QEHB 1V10A 4PIBA 4TNVF 1RAMA 3DIFB 3NJIA 4A68A 2EZ0C 1Q1JH 2Z7WA 3HLKA 1UD3A 1M3JA 5H37H 3CSPA 5B39B 4MA8L 5TDPB