1AZRA

Crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHDWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Pseudomonas aeruginosai zinc azurin mutant Asn47Asp at 2.4 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azrA00
1AZCA 1N68A 2BP8A 2EILB 2XXFA 3AG3B 1CYWA 2BZ7A 3IBOA 2W8CA 1XB6A 2R7EB 3H56A 2B3IA 1WA2X 4BWWA 1EHKB 3SBRA 1PY0A 2BP8B 4EF3A 5B3SB 1NTDA 1AS8A 1ET5A 2VM4A 3UACA 3S3DB 1BAWA 2VSKB 1WA1X 5F7AA 4A66A 1OCZB 2QT6A 1AG0A 1OE1A 2HX8A 3QJRB 1E5YA 2UXVA 1BYOA 1IC0A 2GIMA 4HALA 4M4RB 1GY1A 2JKWA 1L9TA 2GC4C 2FQGA 3IN0A 5B1AB 1SFHA 1JZFA 4E9YA 4E9VA 1ILSA 3CZUB 3WKPA 4KO5A 1AQ8A 1QHQA 4DP9X 4QLWA 4HHWA 3T6VA 1AOZA 4CSPA 2Y69B 2I7OA 4KNSA 5E9NA 1BQRA 4NAJA 2A3TA 5B7EA 1BQKA 4QKTA 5B7FA 2PCYA 4G7SB 3X1FA 2HX7A 2HLEB 4YSPA 1BXUA 1NZRA 1ASOA 1PZAA 3T6XA 4PAZA 1KBWA 1J5DA 3AG2B 1BXVA 4A68A 3NJGA 3NSCA 4G7QB 1OCCB 3ZDWA 5TK2A 3FSAA 3PAVA 1UATA 5I6OA 5AKRA 1OF0A 2HZHA 1KYAA 1E67A 2IH8A 3PPSA 5I5MA 1PCSA 1A3ZA 3NSFA 3PAUA 1DZ0A 1JZJA 1X9UA 3PCYA 3SBQA 3FS9A 1IBZA 1JOIA 1NIDA 2AVFA 2PP8A 2BP0A 1NIFA 1ZDSA 3NJJA 4WTQA 2YAOA 3V9CA 4YSUA 5PAZA 3FSZA 2N0MA 2QDVA 2Y1AA 3PLYA 4G71B 1PLCA 1EZLA 2ZWNA 1GS7A 5EHFA 1ET7A 3NJFA 4F7KA 2JFCA 2NRDA 2IDFA 3GDCA 5B1JC 1KCBA 3EHBB 1GS6X 1GYCA 2VM3A 4HCFA 4AZUA 3PAZA 3CG8A 1WS7A 2FJSA 3L45A 1A65A 1PF3A 2PPEA 2QDWA 3QJSB 4W9ZA 1IBYA 4DP2X 3ABLB 1AZNA 2I85A 2EIKB 1AACA 3OQRA 1ZV2A 5I5JA 1A4BA 1BXAA 4AKQA 1NIEA 4UF7C 4DP7X 2DWSA 1L9PA 2FT8A 1SDDB 4DPBX 3SBPA 8PAZA 5I5IA 4A2EA 3FU7A 4JHUA 1SDDA 3ERXA 4K9JA 1R1CA 2GC7C 3FPXA 1JVLA 4TXVB 1JERA 3C75A 1M57B 2GI0A 1B3IA 2IH9A 1OCRB 1ZIAA 3ABGA 1VLXA 1OV8A 1ZDQA 2CAKA 3FQYA 4AKOA 2AFNA 3FSWA 1JXFA 2XV2A 1E65A 1HAUA 2J56A 2WSDA 3IE9A 1KGYE 2I7SA 5TK4A 2J57A 3JT2A 3U25A 2IAAC 1WA0X 3UGEA 7PAZA 3MX0B 2H3XC 2FQEA 2BWDA 1NPNA 2XV3A 6PAZA 2YAPA 3UABA 1MG2C 1L9QA 1SNRA 4L0PB 2VMJA 1GS8A 1SHWA 3KW7A 2VW4A 2W88A 1M9WA 3S8FB 1GR7A 2YXVA 1L9SA 3N2JA 2YARA 1J9QA 1HAWA 1JZHA 3ASNB 1PMYA 3AZUA 3BQVA 1BQ5A 2UXTA 2YAHA 3NP3A 4HIPA 5B7MA 3X1NA 5D4JA 2XWZA 4AI7A 1GSKA 3CDZA 1TEFA 1E30A 2MTAA 4KNTA 2CALA 3DTUB 1WS8A 3CDZB 1W6LA 4DP0X 1L9OA 2YQBA 2BZCA 3ZIYA 7PCYA 5AZUA 2Q9OA 2FTAA 2IWKA 4BXSV 1F56A 3ZX1A 2OJ1A 1IKOP 1JZEA 1NWPA 4ENZA 3NSYA 4P5RA 3NJKA 1QNIA 5B1KA 4DP4X 4YSRA 4UAHA 1KBVA 2CBPA 5D4HA 3ZBMA 4HHGA 4BDVB 2UXGA 2DY2A 1T5KA 3TBBA 1NINA 1AIZA 3AY2A 3FYEB 1ILUA 1NIBA 1E5ZA 3ASOB 2XVBA 4YSQA 5I6KA 4KNUA 1RZPA 2XV0A 1AS7A 4FA7B 2R7EA 1BYPA 3NJIA 3NT0A 4E9RA 3WNIA 2IWEA 2XX0A 3NJHA 1FFTB 3BVDB 2EINB 2FWLB 3FQ1A 3NJMA 4DPAX 5FC9A 4GYBA 2IWFA 3CVBA 2TSBA 1NDTA 1KDJA 1URIA 3TASA 5F7BA 4N4YB 2OV0A 3UAEA 2ZXWB 2TSAA 4Q89A 2HRGA 2IDQA 4G72B 2X88A 2QPDB 4BXVA 3QJTB 2IDUA 2AANA 1AANA 5B1JA 2BP0B 3FYIB 1A4CA 4E9SA 1DYZA 4A2GA 3FPYA 1ADWA 2GHZA 3CVDA 2BW4A 3DKHA 1V54B 3H4HA 3HB3B 3ABKB 2PPDA 4YSEA 4YSDA 1J9SA 3GXUB 2J55A 2B08A 1CURA 1X9RA 2WO2B 1J5CA 4A2FA 2BO0A 2FQFA 3IEAA 5A7EA 5ANHA 1ET8A 1V55B 4X4KA 1KCWA 4DP8X 3ABMB 2FQDA 4AKPA 4YSSA 1SF5A 4HAKA 1KDIA 1BEXA 1KV7A 2YXWA 4DP6X 3NJLA 2QPEB 3TA4D 3EH5B 1AG6A 2OCCB 4KOCA 2PPCA 1PNCA 2EIJB 4WKXA 1V10A 1ID2A 2ZONA 1J9RA 1IUZA 3HEIB 4G70B 4A2DA 3D12B 1SF3A 1OCOB 1XB3A 2X87A 2DWTA 3NJNA 1XMEB 4DP5X 2IDTA 1JXDA 2HXAA 1AS6A 3QJQB 2DYRB 1XB8A 1JZGA 4KO6A 4P5SA 4F2FA 1NWOA 1PNDA 4BWTA 2DV6A 4PCYA 4YSCA 2P80D 1PZCA 2LLNA 1AAJA 4MFHA 2IDSA 4KO7A 2GB2A 3OMNB 6PCYA 1SFDA 3WIAA 4AX3A 5IY5B 2JXMA 4GP4B 1A8ZA 1HFUA 4HCIA 4KO9A 4BWUA 2BWIA 3FSVA 3X2QB 1GW0A 1MG3C 1MDAA 3S8GB 1GY2A 2WO3B 3GYRA 4NB7A 3X1BA 4GY4A 2GBAA 2YAMA 5I6PA 3TU6A 2H47C 2Q5BA 3EH4B 4CSZA 3QQXA 2VSMB 4HCGA 3SQRA 2FT6A 3EH3B 3NYKA 3NSDA 3WKQA 1AZBA 2XUWA 1OE2A 3FU7B 3WG7B 1JVOA 4JHVA 1MZZA 4KOBA 4NERA 3OD3A 4YVUA 4FAAB 4GXFA 1TEGA 3OMAB 1J9TA 2E86A 2XXGA 3FT0A 3H4FA 1CC3A 5B1BB 1M56B 3CVCA 4ZK8A 2XX1A 2MRYA 2UX7A 2BW5A 1TU2A 2HX9A 4GP5B 4YSAA 3QJVB 5I26A 1YLBB 3T6ZA 1FWXA 5I6LA 2CJ3A 3TBCA 5I28A 2XU9A 3OMIB 1SJMA 3T9WA 1W6WA 4A67A 1ASPA 4BK5C 5I6MA 3AG4B 9PCYA 1FA4A 1N70A 3KW8A 2GSMB 5AFAA 4DPCX 5PCYA 2CUAA 4N8UA 3AG1B 4YL4A 2PCFA 3S3BB 2VN3A 1ETJA 3UAAA 3S3CB 5LDUA 2CCWA 1SHXA 4BDVA 1PAZA 3FQ2A 2AZUA 2FNWA 2PP9A 2UXFA 3QJUB 3T6WA 2HRHA 4YSOA 1AZUA 2FT7A 2XLLA 2VW7A 2YAQA 4YVNA 1PZBA 1W8EA 1RCYA 1NPJA 3WNJA 3FU8A 2YAFA 3PXLA 3G5WA 1PLAA 1MZYA 4DP1X 2H5UA 3NP4A 4HZ1A 1A4AA 2ZOOA 4G7RB 1OOWA 4GP8B 4UANA 3T71A 3X1GA 4YSTA 2P80A 4E9WA 4M3HA 3JTBA 2J5WA 1QLEB 5I6NA 2XYBA 2PPAA 1NICA 3IN2A 2UX6A 2DYSB 1NIAA 3RYMA 3DIVA 1WAEA 2RACA 4JKNA 1AR1B 5D4IA 1AZRA 1RZQA 2PPFA 3MBWB 3N55A 4A2HA 2PLTA 4Q8BA 1CUOA 1ASQA 1ZIBA 1I53A 1TKWA 1L9RA 2EIMB 3X1EA 1ZPUA 3OM3B 3V9EA 3EF4A 1RKRA 4E9XA 4RH4A 1CYXA 2BHFA 1JXGA 1JZIA 2PP7A 3UADA 3FU9A 2YAEA 2AZAA 1PLBA 4E9QA 2VW6A 3QPKA 4F2EA 1OE3A 3AW5A 4E9TA 4W1TA 3WI9A
chains in the Genus database with same CATH superfamily
3QNZA 3NZHL 1IGIL 4P06A 2FWUA 2XXFA 4RRPA 5HHMB 5DURB 3OKDA 2NUPB 3IBOA 1EFXA 3UJIH 3QDGD 1T0NA 4X7SH 4FFWD 1OY3B 1EHKB 5EOCL 2YZ1A 1ET5A 2AJZB 4JM2B 1VEOA 3UACA 4MQXD 5GZND 2VQTA 5JQ6L 4S0HA 1GVIA 3TONA 3CD4A 1Y1UA 1P53A 1MF2H 4MCMA 4LLVA 5TQ0H 2I5YL 4R9HA 1YYLL 3D0LA 3OXSB 4Z7UA 3K6OA 3TO2B 3BAJA 5E99H 2GBTA 4JPIA 1ZY9A 4KUCF 4AYMC 2XG5A 2HRLA 3VRLF 4BFIB 3H42H 3HI1B 3QG6A 4JFHE 3ZTDC 1P7HL 5L8KB 1B0GB 4EDWL 4FQJH 3CLFL 2JCCB 4WU7B 4XWGH 4ZI8A 2NZ9D 1KUMA 2W9DL 4XXCC 4M7LL 1JN6B 5E9NA 3LQAC 5F6IB 3TBWA 2ZOKA 5B7EA 4QKTA 3CFEA 1IL1A 1M6OB 1PS3A 2OTWB 3LPWA 2PTTB 3OJDA 3WFCH 2F8VA 3EGSA 3QCTH 4FMFA 4R0LC 5T33H 4G3YH 2IXQB 1A0QL 3CK0L 3HMXA 4X4MA 5LLIC 1OTUC 1WWAX 1KBWA 4NFCA 3U7AA 3RA7L 1LK3L 3LS4H 2BHUA 1K5NA 1ZAGA 3MBXH 4KK9D 3IMVA 5EC2A 3UYRH 5E8NA 2IV9A 3VXUD 4PLNC 5AD0A 1WZAA 5I6OA 1OF0A 3MLRL 3FUIA 3ATEA 3OKLB 4KRLB 2IH8A 1DBJL 3N06B 4Y1AB 4X9GA 3TN0A 1DL7H 5C7ZA 4L3ED 5GZNC 3SY0A 2JJSC 4LVHC 4OFKA 3K6IA 3CFDB 5F7LB 3FHEA 4JFZL 3OXRB 3QRGH 2EDTA 1DZ0A 2XWCA 1DDHB 3PCYA 5CKAA 3RDTD 3GMMB 4UQ3A 1KTDB 3K8KA 1BVNP 2X0WA 4LDOB 5ESQA 1SEQL 1GIGH 4JHBA 4OZGE 2E27L 3GTVA 5A16A 2ZUUA 3NDYE 4RGMC 4NQCA 3U6XS 3NJJA 1BLNA 3CNKA 2WJ5A 4YSUA 1AQHA 3O6FD 5E8DH 5PAZA 3TWCH 5D7LD 1F86A 5AB2A 3LN5A 4H8UA 4Z7VF 5MEOA 4NQCB 5KYUA 2KI6A 1DFBL 3BUQA 1W2KT 2JFCA 4PY8I 2JKRM 5HYEA 1SQMA 1J1OH 4FTVE 4J7RA 2VZOA 3LIZL 3TT3L 3L3GB 3TTSA 4DGYL 1SBBA 3LNIA 2VM3A 2WMPB 4H13C 3I6KB 3UBXG 1LD9B 1UACL 3L45A 1LDSA 2ITDA 1XL6A 2V3DA 3MO1A 3SOBH 2EXWD 1NUNB 1X5MA 3F6IA 5LQBH 1WPCA 3RJOA 1F4WH 1L6PA 1IAIM 5AVRB 1C08B 2NY7H 1P84K 4PJIE 5KSAC 1KCRL 2DICA 5GJTL 4LCWD 5GSRB 1M4KA 2R29A 32C2A 2FSEA 3LRKA 4JM4H 2CLZA 1PG7L 1NAMB 2PWEA 5TDNA 5KZCD 1W72A 2YRBA 3ARZA 4KTDL 4HUXA 4G8GE 3O4LD 1TLKA 2HVJB 2ZSVA 2FYYB 2HT3C 2ZKWA 2DIAA 1VIWA 3BPCA 3FUFA 1X5ZA 3WSQL 1PX4A 3LKNB 4XP9L 2F15A 4P2RB 1AHWC 4KRMB 1OKEA 3I6GA 1OCRB 4PJ5E 7FABH 3UROR 1BX2A 1UB5B 4MXQD 2VDOL 1F0LA 3RKDC 3UEZA 2UY7B 2BINA 4YDIL 3PG2A 1U8KB 1N7MH 2LVEA 3WLWC 3FDWA 1BDYA 1CPUA 2OMVA 5I16A 3IM1A 3U25A 3LQZB 3UGEA 2AJXH 3HRZB 3GSNA 3D2TA 5DMGD 4R8WH 4XOAA 3MGTA 5I0XA 3KPPB 5IF0B 2P8MA 1IC7H 1MG2C 3BI9X 5FB8A 4FERA 1SLUA 3HB3D 4B9IA 1URZA 1F1GA 4P3CH 4AYSA 3ASNB 3DOHA 1PMYA 2A38A 2P5WE 3UPRA 2VN6A 3QUXA 4TRPL 3DYPA 3LMJH 1M42A 3CDZA 2AXFB 4MMXC 1LEKB 2FO4A 5F93C 4XAKE 4E5XA 3VXRB 1T0MB 1YMMD 3RBSA 5J13B 3VRJB 5HJ3B 3CUPA 2XDHA 2K78A 1KBGL 3NPSB 4CDGC 1TU2B 2Z65C 3VVWA 3HRZC 4F7EB 3UAJC 1TENA 2V5TA 2HN7A 2MKLC 3P4NB 3GPSA 4U1GC 1NC2B 2VC2B 1EJ6A 3BVXA 4OM1L 2YA2A 4UINH 1DTUA 4M4RA 4PRHA 3E1F1 4Z0XA 4KK8C 1JZEA 1GTFA 1DUZB 1QUPA 4K2UH 4FQIH 4H25A 3TYFA 3BJLA 1ZA6B 2H0PA 3BGMA 3QI9B 4JGMA 1UQSB 1AHWB 2CBPA 4LLUA 3K2UL 4HD5A 2WXHA 4UT6L 5I75C 1KENL 3MKGA 3T1FA 1YUKB 3UBGA 4MAYC 1BPVA 2CKBA 2NXZB 3ASOB 4MNHB 1XF2A 4NCC1 1RZIB 1BGXH 4GW1A 3N1MC 5DZNA 5D6DA 1AS7A 2RD0A 2R7EA 3TGXA 4MNHA 2B16A 1Q8MA 4IGBD 4XC1L 3VFMB 4BSVB 5CJQH 4XC3L 4WSKA 1IJ9A 3BVDB 3EYSL 4X8XA 5JO5B 3UAJA 2J73A 1KN4L 3ML9A 1E28B 3D85A 3EUDA 4Y4HB 5E8NB 4ZPVA 1BZQK 1NDTA 1OIOA 5JW3H 3TCLB 3BQUC 5C09A 2Q3XA 4XVJH 1DJGA 3KR3L 4KQ4L 5F7UA 1RAMA 3FTWA 2X88A 2CCLA 3A24A 1TJGL 5J12B 1YEJH 3OLIA 1RZGB 3ROLA 5L2JB 3U46B 1LP9F 4CKQA 1CFNA 2VN4A 2WQUA 5F7YC 4U49A 3CLWA 3EDJA 4BFOA 3QZWA 3SE9H 4ESKA 5J1TC 3U46A 1P1ZB 3D4CA 1KCVH 5IB5A 3V0HA 2XKUA 4M5ZL 4YFLF 3CVDA 3FRUA 1C7TA 3D4YA 4TVPL 5D1QE 2GSIB 3U6RA 4ECNA 4QRRA 3QNYB 1OQXA 4OCMC 3SJVE 4YSEA 3ZE0B 5E2UH 4Q0XL 1CURA 1X9RA 3EYVA 3QDJD 3CH8A 3QQ4A 3HE6C 4S0TD 3T0XA 4KRPB 3A4FA 3GSRA 2VAJA 1YN6A 2X9YA 3MTRA 2XWJB 1MFCL 3HKFA 3Q5TA 3SGJA 3VRIA 5L4FA 4ZFGL 1NGQH 1KCWA 3GMNA 3NVQA 4U3SB 2FHCA 4RGNB 2FO1A 1OF2A 3DVIA 3FQNA 4NZDA 4RFNC 3EH2A 5GS0H 1LEIA 5EOTB 1NC4D 4V1DB 3VM5A 4OCRH 1ZLSH 2Y7OA 3QNXA 5AVQB 3DGDA 3OKMA 2J72A 1Y6KR 1LWHA 3D12B 5IMMB 3T0EE 2WP3O 2DWTA 4DP5X 2DYRB 1ONQA 1MJJB 3CSFA 3VI3B 2P8LB 3FB8B 2Y6SD 3VFUB 1MCRA 4N0RA 2OZ4H 4FJZA 2NT0A 5ITFB 4JFUA 4RAUA 2DV6A 1FAIL 4PCYA 3OAUH 3MXVL 1MFUA 1AAJA 2UWEF 3LVEA 3FHQA 5LCVA 1AO7A 1CLOH 4G8AC 3UPAA 2NY4C 3TNNB 2X41A 4PJCA 4PJIF 1TSHA 2QKSA 3Q2NA 1EVTC 3IWVA 3B9KC 1FSKB 3TU6A 4C59B 1OLZA 3ULAB 3MLSL 3O4LE 3QWRD 4GQPH 5E2TL 3RAJH 5I66B 5DJAA 5EBGA 4NQED 1TVHB 5ACLA 4NQDD 3QJFA 1D6EB 2Z35B 2PXYC 2WCPA 2ZWYA 3B7YA 1A8JH 2PWDA 3BCDA 2J1KA 1OAYL 1JS4A 2QQQA 5HGBB 4EDXA 2VMFA 4JFDA 4O2EA 1A1OB 1MZZA 1NM4A 1TTRA 2VXVL 4H8PA 4X4XA 4HLEA 1HQ4B 1T1YB 1MREH 1ZHLA 3MLXL 4JFWA 4M7LT 4O2EB 3V5KA 2VR5A 1QEWB 1F1AA 4DJMA 3MOQA 1JHLL 2Z8WC 3MMEB 4IBYA 1SUJA 4U0RC 4QHLA 5TPWL 3N43B 4O4YL 5FUOH 4NZFA 2B4CH 5C6PB 3QDHA 2XJLA 3T1WA 4XMPH 4KK6D 3ZYIA 5ADOH 4KFZC 3DWTA 2NY5H 4HIXH 3WIHH 5FV1L 4NQEB 3QEUA 4FFYL 4IEFA 1FL6B 4G11A 4FKKA 1QLFA 1WO2A 2J3SA 4ONHA 3VRLE 1LD9A 1BZ9B 3P3YA 4WHDA 2PWGA 3TYGH 1DR9A 2G3ZA 1CGXA 5EZIL 3L5HA 3HZMB 1KY6A 4PS3A 1FH5L 4IKIA 1N5YL 3WE1A 2AXWA 2BM3A 1IEBA 4K7PH 3SKNB 2C3HA 1A25A 2YD2A 5D7IE 3QO1B 3S9DB 2CK0L 2AZUA 4L05A 3ARUA 1L0QA 4OFYA 3KYNB 5FDWB 4I18B 1I1AB 4P5TA 2OP4H 1I7UA 5CKGA 4YXHL 5CO1A 4ZQTA 5DD6B 4QRPD 1KBPA 1GL4B 2EACA 2Z7UA 2Z7WA 3WJLC 2ZUQC 3HMXH 4PBDA 2GTZB 2ZXGA 3X1GA 1FPTH 4OQTH 4XRCA 2B0SL 2FK9A 3V0VB 3VFGH 1JK9B 2XKNA 1BZ7B 5FGRA 1ZWIB 2WXOA 3ZE2B 2XYBA 3L4UA 1KIPA 1NC4B 2AXGB 1NICA 3M7OA 4GKNB 4ZS7H 2EVGA 2WGXA 1W15A 5GS2D 3FTSA 5I9QB 1IM9A 3M6DA 1QR1A 2EDWA 3JWDH 3PIQA 1YCSA 4CSTA 3HC2A 1TPXC 4HU8A 3UCRA 4CGTA 4QXTA 1UKQA 4KMTH 3UZQA 1A64A 1QPXA 1YNLL 4I1PA 5JUEL 4L5FE 4I18C 3NK3A 2BIIA 1MNNA 2X6VA 1U8MB 1ZTMA 5IROC 4AOFA 2WLMA 4AIOA 5L9DH 3UTTB 4QRBA 2VW6A 3CHOA 3FO9B 5C92A 5L2KE 3K91A 3QYCA 5JDSB 4ELDA 4KTYA 2W65B 3VFOB 4MAYA 2XXMB 4S10A 2AK1L 2BCKA 3DTXA 1NANH 1F3DJ 3WEXA 1WUNT 1Q9KA 4M43H 1VSCA 3UC2A 1LDPH 2R69A 2DJ4A 1MFDL 2BY2A 1EHLL 2YPVL 4AG4H 3WEXB 4TSCL 1ZA3A 3ZT6A 4D9RD 5CIPH 4NHCH 1T03L 3KYOA 5BZZA 1ITCA 2VXQL 2WGNB 3UO1H 2DQHH 4OJFL 4IDJH 1DCEA 1UM6H 2AJZA 1CF8H 2X4UA 1DE4B 3L5WB 4HIHB 4FFTA 4U0RB 3RWHB 3IFPB 2FHBA 3U4KA 1ORSA 2VDNB 3EDEA 3OXRA 2C1OB 1W8OA 3KEHA 1NFIB 3L3IB 1A7QH 4PRDA 3UTSD 2AK4B 4FQHA 4W4NA 2A9NH 5DJ2A 5E94B 1N0XL 3FTVA 2AHIA 4NPYA 5FLUA 3SJVD 4WEBL 5D1QC 2Y23A 1XVSA 4LDEB 1K3IA 5DT1L 1HILA 1QLRB 2DIEA 3FTGA 1PLGL 4CSPA 2DQTH 1AP2B 1LP9B 1IEAA 4EBQL 1A3LL 1EEZB 2NQCA 4FXGC 1P5UB 5EU3A 3UTQB 4FL4C 1RPQA 5DJZA 3GBNH 1DFXA 3V0EA 3JWOL 4XMUA 3UEQA 3IMSA 3LXAA 3G6DH 3QE5A 4PJ9C 1NLDH 4D8OA 1LQBC 2BY0A 4DW2L 1N19A 4E41D 3OBAA 4OB5H 4UTAH 3MRRA 4OFYD 1IIKA 2EYTB 4OD3H 5CEYB 5IB3B 3NRPA 2AK4D 3K72B 1W72H 1AXTL 3NUKA 4R7NB 5D6DC 4AEHL 3EFDH 2ZTBA 2EC8A 3P9LA 1T6WA 4HUCA 2XWBB 4PCKA 3PFQA 1C5DB 2OK0L 4ZOCA 4ZMVA 2F7RA 4DK6A 4Z7UB 4CJ1A 3ULUD 2PR9A 2JKSA 2Z8SA 1S7VA 2C4FU 2QADD 1VPOH 3JWNH 1P4IH 3L8QA 5G4OA 2AJXL 5I1LA 1PD0A 4R8WL 5IVXB 2Y1VA 1WWBX 5CWSB 2UWEE 4WJ5B 1TR7A 4YHOH 1OO2A 3STBA 2E9IA 3MV8E 4CMHB 1UB6A 5GRWA 1L3NA 1VFBB 1CFBA 5INCA 3DX9A 1QSEB 2J8UF 3GKWL 3NA4A 2F7OA 4MMYB 4KUZL 1CU4L 3QPXH 5DLML 1RHHA 2YD9A 2X2JA 3B9EA 3HS0C 3LN5B 3LEYH 4HEMA 4EAEA 3SSGA 5GRUL 3UYPA 2FRGP 4JDZA 4Y16C 2FJHB 1FBIL 4HIJB 1DN0B 2J88H 4GINA 1CWVA 4OTXH 4ZUSB 1IT9H 5TTRA 4PJBF 3ZL4H 4ZMQA 5I8KH 3KLHD 3ECQA 5H4YA 1NMBL 1E5AA 3MCLL 2AJVH 3OKLA 4HPYH 4F8NA 3HVDA 5DVKA 1BXAA 1L3WA 2BNRB 2FT8A 3RFZC 2CHNA 2E8YA 2NCEA 3LIZA 4JS7A 4P5TB 1DANU 5HD8D 2F1AA 4LMQE 5HGDA 1IC5H 1MVUA 2CIKB 4AJVA 5HGHA 4H8WL 4GFTB 4HJIA 1C5BL 2BNQB 1Z5HA 1EO8H 4YHIA 1ZRUA 3SPCA 1SJVA 1ZV9A 4H1LG 5CXPA 5D1XB 4EOWH 2FO4B 3BQUB 1AGCB 5ABZA 4AYFA 4KZEH 1F02I 5CGMA 2G30A 2NLJA 3INUL 4U7SA 2HWZL 2G2RB 3KJ4C 3R06B 2IBGA 5FR3A 1KJ3H 3L4ZA 3ZE1B 1MWAA 4Y16A 4AYFB 5A6MA 1FNEB 2CAKA 2X38A 4JY5L 5HYJA 3I6GB 3CHRA 1Q1JH 4Z3EA 4XP4L 1X44A 2JI1A 2W92A 3B9AA 3CMGA 4FQLL 1RVFL 3ZKSD 1NEPA 5CJQL 4GXUN 5E0QA 1B90A 3JT2A 4LRNL 1W0WB 5BO0D 4JR9H 3SZKC 3WTUA 5C07E 2ZXQA 1T2JA 4CA4A 1VCBC 1OP5H 2H26B 2JKNA 1KBBA 3VDCA 1T20B 1BQSA 3KVQA 3BP4A 1TVHA 3QC5X 1GPOH 3LQZA 4TUJB 1T6VN 3CMOL 6PAZA 3EDDA 3I6LD 4QGTA 3CWGA 1U95B 1NOAA 3KW7A 5JW5B 3CGTA 4QGYA 4U05A 3PDDA 1RPKA 1Y1DA 4HUVB 1D5MA 1JNLL 5E1AA 1NBYA 3HBZA 1KIQA 3ET9F 4LU5L 4XBGB 4Z76A 3AZUA 2QKIC 4X4YA 1G9NL 1MIML 2CCVA 4J8RB 1NBYB 4NQSB 1JPSH 3X1NA 2R8SL 3JBG7 4MJIE 1UXWA 1E5CA 3VXSE 3ETBF 4H44C 4ONGH 3QXTA 4QHNA 3W81A 1ACYH 4YHZH 5TE7L 2IFFH 3CCHB 4MJ2A 3BLPX 5J13C 1FL3A 5E2UL 2OMXA 4OLZH 3TCLA 1YDPB 3NA9L 4UM9D 2X4UB 2CLVB 3CCHA 1YN7A 3STZA 2DMKA 7PCYA 3CBKB 3DTDA 3BVWA 1KZQA 3FQTB 5T3XH 1KB9K 1ZLUK 2OL3H 1ODAA 4ENZA 5KVDH 2VQ1A 4Q9QL 1TZGH 4R4FH 2W80C 1QNIA 2XZQL 2WOBA 3AITA 4APQD 3FN3A 5C0RH 1HZHH 1SXNA 4PJAA 4AENA 2ALWA 3NG5A 4XB8A 3S34H 1QLRA 3FTGB 4CVXA 4OF5A 5D93B 5A3ID 4ORGA 4GKZB 4O2FA 5DVLA 3VXSD 3E9TA 5JIMA 1A6PA 3GSVB 4OD1L 3VACA 4M8QB 3VXUA 1G7QA 3C60A 1H3TA 1PVHA 4JMXA 3BKCL 2GI7A 3T2OA 2ZUWA 5F0JB 1D5XB 1EEQA 2WXRA 1UJTA 5FFLA 3BT2L 3FQ1A 3E6HA 4M6OH 2UZYA 2WLLA 3MXVH 4QHUA 1X7TA 1T2QL 3ZXAC 5SWQB 5E6RB 2CWRA 2OXGA 3QUMH 2VM9A 1CLYH 4NNYB 5ADPL 4UQ2B 5KW9H 5SWZA 4GJTB 4LSVL 1MLCA 4KKCD 1OW0A 2GEEA 3UAEA 2RIKA 1HKLL 3ZSSA 1I8LC 1M1XB 2AJYL 1LO0L 1WP6A 1F2QA 3WO4C 3FU5A 1D2OA 5I1EL 4BZYA 4ZZFA 2Q86A 3LCYA 5AZEL 3OL2A 3IU4L 2YEQA 2GK2A 5D7LB 4TLUA 1QWUA 5CLXA 1YEIH 2JCCF 12E8L 2FGWH 1PGRB 4HEME 3VGDA 5CEZE 2OFQA 3KPRD 4F20A 2F5AH 3DX9B 4PRNB 2RAMA 3TJPA 2AQPA 1D5ZB 3F6JA 4FI8A 4L5FH 2EAEA 3RDTC 3ZW3A 1QFUH 4Y2DA 3QUXD 3OB0H 2EIZA 3P2DA 5HDOA 2N4IA 5AW0B 1DVTA 4Q97A 4Z7NF 2GQHA 1I9IL 4A2FA 4HPOL 3KDPB 3P77A 2X4QB 3PXHA 3FCSA 5EZPA 4B9FA 1Q9KB 3BIBX 2ARJA 2R0LL 3ULVL 4XVOA 3QCVL 5ECGA 3VXSB 4DETA 1BW8A 4NP9A 1EDQA 3TBSA 4ZSOE 3DUSA 2OCCB 1H3VA 4Q6IB 1DE4A 5D72H 4QRQA 3PHQA 1OP3K 3KE0A 2EDMA 1KELL 1TCMA 1FP5A 2IH1B 3Q2VA 4NO2B 4XMTA 1VB9A 1CICA 5AW2B 1WBXA 1CVRA 2BZDA 4D8PB 2V17L 1XMEB 2V5MA 3C5ZC 5GGQL 4W9LC 5FUZH 2HXAA 4RAVA 2B20A 3IJYB 4CILA 4G82A 1HHJA 1KN2H 4N68A 4P5SA 2WTOA 4Y5VA 3GSUA 4N2AA 3O3BB 4ES9A 4X4ME 1OB1B 2BH0A 2IG2L 3IJYA 1M1SA 4U1LA 3RA7H 5GZOD 3E2HC 5TF0A 4ILDA 5B4MC 2ZSWA 1KF9B 4OKVB 5CU9A 4YMPA 4JBSA 4JFDD 3WIAA 1KCUL 3SDXB 1B2WH 2QBWA 1FL6A 1IBGL 4R97C 1KB5B 1NCWL 3MYJA 1ZT7A 1MDAA 5L8JB 4ZQKB 3FFCB 3F3HA 3B5GA 1JPTH 1EUUA 1X7QB 5MENA 1B3JA 5K9KA 3FT2A 1DVZA 4NEHB 1KLFB 2X53A 2NTFB 3IMWA 5CJXC 4OZGA 3B7TA 5KJ4A 3MOBH 4JUSA 5IFAL 2GEQA 2I9LA 5TQ2L 3U30B 3VFTB 4N8CL 1KJ2L 4P2OB 4GRMB 4DO4A 5I1JH 3K5RA 4UOJA 5GGTH 3ZQXA 4AL8H 4M6ML 1CTNA 4XCEB 3G5YB 3TT3H 2AITA 3EBIA 4J8RA 1HQ4A 3ARFD 4NQSA 2FYYA 5I75B 2VR3A 3B1TA 5D7KD 5CD3A 3OX8A 3GXFA 1QSVA 2XKNB 3UJTL 5DR5H 5IW6A 2XX1A 3U4EA 4E42A 4F7MA 4XNXH 2R27A 1MRCL 4HSAC 3GJFA 4WWKB 2DBLL 2HX9A 4DKFL 3ARQA 5C0FB 1SUHA 4S1RH 5FO9A 4U31A 3BH9A 5AAMC 3OJMB 2OCFD 2R2HB 2UY6B 1GCYA 4JJOA 3ISWA 4NN7C 1BX2B 4A67A 4M48H 5DS8B 4PV9A 1GA2A 4QXTB 1UOLA 1CYGA 3BMVA 4ZTPL 5CBAB 2XZAL 4XPHL 4FZEL 2VUYA 3RTLA 3X3FH 2D73A 4AXWB 3S3CB 4XHQA 4ZBJA 1TJXA 1X6LA 2JMRA 1PKQA 1KJVB 3DROA 3L4TA 1OM3L 4N2DA 5HVHB 2F68X 3DMMB 2P7TA 1E9PA 1R5WA 5AQ0A 3PXLA 5IG7A 1I1YA 1I1AA 2XYCA 5IVOA 5DJCB 4HZ1A 3KWTA 5I71B 2JF1A 3KEDA 3OLDA 5IG7B 3WNKA 1G7MA 2WVVA 2XNAB 3B6SA 1XH3A 3JWNC 3WFBH 1NANI 3JTBA 1MFEL 4PJEE 3EJZD 2NLJB 1SPDA 3SE3A 1A6VH 2W9EH 4RDQG 5C0JB 2MPAH 1UXMA 3RQ3A 4Z78A 3NESA 5C0CA 1KIPB 1NC4A 4OLUL 1MRFH 1G6RA 3JWOC 3RTQD 4F7EA 1U36A 5I6XB 3A67H 5LXVA 3OB8A 1P6FA 1BZ9A 1WHPA 3OPZH 1XXFC 5F9DC 1W0WA 2ZXAA 2XN2A 1B0GA 1RV6X 2IDCA 4LSTL 4N3TA 4E9XA 5FOBB 5I1HL 1Q9LB 1SMDA 1CYXA 2ZNWA 3UZVB 2BHFA 2J8UE 4CRPA 4PJ7B 4XNYH 1KC5H 4HWEL 3KPLB 3WD5H 4NKQB 2H1PL 4UT7L 2D3JA 1X7SA 2NNXA 5ID0A 3QZBA 3BWUF 3MNZB 1OE3A 1U8QB 1AFVH 2CNYA 4Y4FB 4E9TA 5IV2B 3BVNB 2F54E 1B88A 3H1ZA 3AXLA 4LLWA 2VIRA 5HHQA 2RTTA 4EUPA 2EILB 2R56L 1HOEA 2X4QA 4DQOH 1H8SA 3ARDD 4HXBL 1FHNA 5ALCL 4EI0A 4UQIM 1U2HA 1YYLH 3I3EA 4UMSA 2XFGB 3SQOH 4WUKL 5EBMB 3V4LA 3L1OH 4J3WA 1CLCA 4Y4HA 1E5YA 3EO1A 3PHQB 4YE4L 5H2BB 1OEZW 4QXGL 2J88L 5CMAA 1RH8A 3S3PA 1BVKA 1U2YA 4WTWA 1UH2A 4RMVA 2GC4C 3KM2A 3BKYH 3IN0A 1CD0A 3IDJA 4FLRA 5FYLH 5CMAB 4C4KO 3MLYH 2XRAL 2XA8L 1JYVA 4ONOA 5KBNC 1U33A 3K6FA 1NCJA 4D3CH 1GRWA 4X5PA 2ROXA 1IAIL 2FL5A 2BVYA 5T3XE 5JPMB 5CUSL 2FEDC 1F6LL 3FFCE 2I7OA 4KNSA 4WZ9A 4RLDA 2YJQA 5FWRA 2DLGA 5JNYA 1TO5A 2A9DA 2BRRH 2ALAA 2K4AA 3HS8A 3G9VA 1GYVA 3AU1B 1GC1L 4NKIH 4YE0A 1QMUA 1J0HA 3QNZB 4B9GA 1J9CT 1WFUA 1HESA 5F9WB 3CZSA 1NCTA 4HJ1A 3D39E 3FQNB 3T0EA 5FKPB 2HTLC 3FKUS 1A9BA 2A0LC 3VXME 3F00A 1BF8A 4U6VL 4XPFH 2Y3NA 1S7UA 2IGFH 4RNRA 1S7QA 5I5RA 5CM1A 3H2WA 1GIGL 4QHMA 5JLZB 5FECB 3QCUH 4XVTL 4R96A 3VFNA 2ICWB 4LNVA 3GS0A 1EQWA 1QBLH 4OIAA 3QO0A 5F3BA 3TO2A 3LPGA 1D7DA 2FUQA 3LQAH 2EXYC 1WIPA 2JNZA 2FD6L 3LKOB 4ZSOB 3KD4A 4P5MB 2Q2EB 2D0GA 2GUOB 1UWXK 5DFTA 4B50A 2EIEA 4P2QE 3MGAA 2DEXX 2ZXBA 4OFDA 4WEMB 3BH8B 2LHAA 1EZLA 1YEEH 4I1NB 3GJFB 1H5BC 1I4FA 1IEAB 1U91B 1NFDA 4R7VA 3ARYA 3NJFA 2NRDA 1FL5B 4LAJH 1MUJA 1I8MB 2BLFA 2CH8A 5DRWB 4FLQA 5F89A 5HHNB 2I27N 3VG0L 5AVSB 2V2XB 1QYGH 2WZAA 2FIRT 3BWAB 5D1XE 4JFSA 4DNLA 4FTVD 3GSWB 3GZPA 2FIKA 3QUYD 4ONGL 2VERN 2MEJB 3HE7C 3HZYA 4FXGB 4CW1A 1IBYA 3TZVC 1JWMA 3O4OC 5J4MA 1IM3A 2I85A 3PHOB 3K8MA 5MEND 4DEPB 3FQXB 4NFBA 1N4XL 1CE6B 1YECH 2JJVA 5CGTA 4KK5D 4MLIA 1ZHKB 1ZS2A 4K5LA 4MNGE 3WMSA 2BNRE 3ZKMC 4UF7C 2JJWA 4DP7X 5IGXL 4LQFL 1YEGH 2RR3A 3D39D 1ZHKA 1DVXA 5GGVY 1DQDH 2NY1B 4FHJA 5LNEA 5K9OA 5I1LB 5EU7C 2ZOUA 4JFDB 4RA0C 4GKSB 2YSSB 3CQFA 3BVVA 2Q3ZA 3EUUA 4JDTL 5LBGA 1OPOA 3FTXA 1S6NA 2DTML 1NOFA 1UXWB 3N42F 4MNQA 4NUGL 4G8IB 1JERA 3CSYA 2CRIA 3A6BH 4NDMA 5EU5A 3QT2A 2VDNH 2A5UA 5A1AA 4IRJA 4R90H 3TVMC 2Q6WA 5FX3A 2F54D 2AFNA 1JXFA 4QR7A 4L4VD 4OSUL 4N9GB 5FM4A 3TN0D 3WXWH 2DPKA 4GQRA 4B96A 4WHYH 3HCVB 2J57A 1S7XA 4KAQH 1TZIA 4WCYH 4JAMA 4KI5D 4W9HC 4YK4B 3MJWA 3OKNB 2DI9A 2ITCB 3SDCA 2WM0A 1OT1A 3MX0A 4H20L 4AQ8C 4QAWA 3S37X 1U93B 1W72B 3PXJA 3ESPA 2QVKA 3CJJA 2I60H 2IADB 4E36A 1MFBL 1MJ7H 1U6AH 3PABA 4K94H 5GRVL 1L9SA 2BWQA 3LD8C 3PGCB 2H45A 2CHZA 2XC8A 4OH2A 3RWJA 5TE6L 3FH8A 4I0PD 3OKYA 1BBJB 5F2FA 1V3JA 3F85A 5FYKH 2EVFA 4PW4A 5DD5L 3CFBB 3KYMA 5DRNA 3TPKA 4QHUB 1VKXB 3RVXC 2UUDH 4FGMA 1E9QA 4AYGA 4WKZA 3A5VA 4U6YB 4K7PL 1BIIB 1QEXA 1SHSA 4Z3GA 4LARH 3AT0A 5LN8A 2QQLH 3ZE0E 4XCFH 5HYSB 4AUUA 4D0BB 4IU2B 2OMVB 4HWEH 1MW0A 1CGTA 1ETB1 2Q86B 3ZUCA 3VE0A 5JHDB 2VLJD 1Q90A 1GYWA 3IDJB 3P3SA 5F0MB 4OM0H 5B1KA 1UXSB 4N2CA 4C8XA 5EFIB 2D0HA 5A2LH 2B0SH 1XH2A 3AY2A 3I9IA 1UXSA 3FUNA 3VMPA 4AL8C 1NIBA 1GZQB 5AYTA 5LGHL 2ZCLL 1LE9A 2OMTB 3VXOB 4RDQF 2P7TB 4AITA 2G5RA 2XQBL 2JKJA 5MEQA 2C9QA 1Y6NR 3PV6B 4DF9A 1PBYA 3IGFA 5E24E 1JXKA 5EOQL 2XTJB 4MCYA 1O9WA 1DBMH 2R9HD 1N6QL 4K23L 2EINB 1QFPA 4TUKH 5GRJH 2BS71 3ZDYF 1ZT4A 3V0GA 4WLCA 3DIFB 1T0NB 4I0PA 2F5BH 3STLA 2K9UA 1S9YB 1TVBA 3LKRB 2OQJA 1KEMH 3SY0B 3VH8G 2R0ZL 4K5OA 5DYOA 2QPDB 3X3GH 4HMCA 2EXSA 5DTFB 5IMMA 3FQRA 1Y0LB 4DWHA 5CEZH 3GMOB 2AANA 5E6IB 4PCSA 3VGAC 1LMIA 2BP0B 1UQSA 3FYIB 1UZ6E 5TQ2H 4B9YA 1A6TB 5ICUA 4Z3IA 2AERT 2W59A 1R24A 3NFSH 2E76C 5ISZA 1B9KA 2DJMA 5BUPA 2PPDA 2P5EB 4NWUL 4F7CB 2ZD0A 1T4WA 2D7NA 2VXQH 1AP2A 3U36A 5D7JB 4GQ9L 1HINH 3L6FA 1P9MA 2J12B 3RGHA 1P5UA 5EU3B 3UTQA 4GKLA 4AEEA 4P5TD 1QO3B 3II3A 1CXHA 1E4HA 4YR6A 4UU9A 35C8L 1EGJA 3EOYG 3TF4A 2DQUL 4AEIH 4KROC 4DP8X 5F1IB 2NSMA 2ZF9A 4GRLA 4W9KC 2ARJB 3PP4H 2OCJA 5BOPA 4LK4A 2FECI 5C09B 1R46A 2EE9A 1BV8A 5ESAA 3TO4A 4ODUB 5FFGA 4BHUA 1IUZA 3SKMB 3KVPA 5CWSA 1RZGA 3AQYA 3NJNA 3P11L 3MQIA 4EN3A 2CPUA 1CB4A 2BPBA 2IALA 3FU0A 3T3PB 4H26B 1CICB 1E8YA 1QHOA 2BSCA 4AT6B 4KO6A 4PJEF 1IM3D 5ESQB 1TLMA 1T2XA 2FBJH 2JCWA 3OGOE 1S7WB 5KS9E 2O5YL 3CBJB 1JN6A 4OB5L 3SDAB 4IGBC 3ULUF 4YSCA 5BZWB 2LLNA 5C0ND 1HNYA 1BQUA 3FO0H 2XWTB 4RMQA 1HEJC 4UTBA 4B7IA 4MMYA 2BS8A 2WB7A 1TQCB 1CTOA 3IJHB 4YHKH 5DQDH 5DZAA 4K71B 2EEXA 3O81A 4CSZA 1KEGL 2K1MA 5JHDE 4BCYA 1INQB 4R3SB 2JB6B 3Q8BA 4GUQA 5GZOA 4J3VA 4PWGA 5L4MA 4KK8D 3BGAA 3O3EB 3S2CA 4IMKA 3IF1A 5DVOA 3VAEA 2JV6A 4RWYL 5KBLA 2I9LB 3KAAA 2WV3A 3MV7B 1RI8A 4Q2ZB 1AQMA 4RZKA 5TDNB 2E86A 3CBRA 1NCCL 1UWGL 4HJ0D 3H4FA 2AEWA 3I50H 5DJ0B 4U1JB 2XVLA 3WBDA 4M1GL 5CAYB 1FVEA 4I77L 3PWJA 2ESVE 1MNUL 3ULVC 1NFDB 2FLBT 2B1AH 4OLXL 5I26A 3RIFK 1QRNE 1PDKA 1RP9A 2E7HA 4P3DB 2GITB 2XU9A 5AVWB 3V6FA 2YPVA 5I28A 1I8IA 3M7FB 3DX8B 1T83A 1X4YA 2C3VB 4K3EH 2LTQB 4QTHB 4DGIL 1BLIA 1N70A 3NCMA 4G9DA 4DPCX 1G9EA 4QTHA 3AG1B 4MRBA 4PIRF 5E7BA 3S3BB 2YKLL 3LS4L 4HKXB 3F7KA 2ICWJ 5DD1L 3T77B 3EJCA 5L8LB 4EOWL 2PCXA 5KN5B 2HLFD 3O6KH 3QJUB 3MGTB 5AOKA 2HRHA 4OT1L 4J6RH 5SWZE 2HUHA 3UTTA 3HE7A 5ID0B 3VD1A 1TTUA 2ZUQB 5F7FA 2YAQA 5AVYB 5KN5A 4XP1L 2J4WL 3SDDB 5AKVA 3NCEB 3G5WA 4NNPL 4YC2C 1K3ZA 4Q4EA 2HA1A 8CGTA 3RIAK 2BY3A 3DMMA 4XODA 4EZJA 5JXAH 2IQAA 1F1DA 2NUTA 4K3JH 3N3EA 1M6UA 2VDKB 1OGAD 1WWWX 4P4KA 2OX5A 1NAKL 2ZNXA 2Z31C 5D71L 1ITBB 4F3FB 1G94A 2DM2A 3HZKB 1BEYL 4LIQH 4D9QE 2VC2H 1OANA 3HG5A 3GS7A 3LZQA 4J23A 4P23A 5C08A 1IGYA 1HOCA 1QSED 2DMBA 1ZANH 3VD4A 1TQUA 1CUOA 1BVKB 4PV9B 4UOW1 4YDVB 2AK4A 3DMMC 4FQHB 3DXAA 4NLAA 3UYRL 4CC4A 1C5CH 3NJVA 1NDMA 2RALA 5GGRA 5E8PB 1FO0B 3KVDD 3NAAL 1M05B 4MVBD 4B9KC 1SEBB 4AYDC 1BFOB 2XETA 4A38A 3NEOA 1DQML 1KPUB 4KY1H 2JVUA 4YHZL 4O51B 3P4MB 4IGBA 1AGDB 5C0BE 3HE6D 1JXJA 2E7DA 3CDYA 3AREA 1INEH 5JR1L 2WLLB 4PLKC 2XFXB 1HHKA 4ENED 3T8XA 1HSAB 3G5VB 4NM4L 5CR1A 5GXBB 3UGUA 3TWCL 2R7EB 3AXLB 3H56A 1JG9A 3PPEA 5HHQB 3OR7B 2XA3A 1QHPA 2VDPB 3ELQA 1EFXB 3QH3B 2VM4A 4OLVL 5J56B 4HOZA 1C7SA 3FW6A 4GBXB 2NY1C 7FABL 2R1XA 4EEEA 3AT8A 4OGYH 1ZD6A 2HX8A 2DDQH 3S36H 3SPJA 1YZZA 2B59B 1IC0A 3QWQB 5GISL 3V0JA 3QZMA 4YDIH 1G0XA 2D7TL 2JKWA 1MCCA 2DWEB 4UQAA 3KBHE 5GS2H 1LO5A 2VDRB 3O4OB 4U1KA 1CCZA 1KCRH 2NX5B 4OAWB 3SGKC 5CLWA 1E43A 1VESA 1AXSA 2IPTL 3OC8A 2PYEB 4AYEC 4POYA 3B9VA 1XZ0A 4JO2H 4QLWA 3BH8A 1MI5A 1LO5B 2R0WH 2WWKT 4XE5B 3ZKND 4LO9A 3VGHA 4QRPA 3MR9A 2X4PB 2VZVA 3VXTA 4Y4FA 3IDMB 3LN4B 4BCZA 2Y24A 3WNPA 3D0VB 5AB1A 3HR5B 1DUYB 3QUYB 1UCBL 2YMOA 3TT1L 3EYOA 3P30H 3QNFA 5AW8B 3US9A 2GYSA 4TQPA 4PLJC 3KWXA 5IK3A 2ZOTA 3TPUB 2R2BB 2E46A 3LDBB 2VR9A 4PRIE 3L13A 3HC3L 3IU4H 4XNMA 4C4KT 3LX9A 1ZLWK 3STLB 3T0EB 1AC6A 2VAAA 3ECWA 3RWHA 1AR1C 4PJXF 1A1OA 2ZWKA 4NZRL 1EAPA 3FCUB 3KCWA 1XR8A 4WK2B 3HI5L 1LYQA 5JYLA 4WCYL 3DSFH 1B4LA 2OMYA 2ZXEB 5DSCB 3FN0L 1BFVL 3QQ9C 1HT6A 1A5FL 4RGNE 4WUUD 4Z0BH 3QPXL 2BC4B 2PP8A 4PR5B 2P3YA 4JO5A 2H3NB 2JK5B 4D8PA 5J5EA 4PW3A 5E6ZA 1O7SA 3CSYB 5A16B 5E7FA 2LR4A 4JANB 4N0CD 2QADB 3FRUB 3BAEL 3QDGB 4G43A 5LCVL 3S5ZA 5KVEL 4XNDA 2XVGA 4PJ5B 1RIHH 3UH8A 4J4PC 2I9TB 4XNZC 4P2RE 4JQXA 1BGXL 3L7EA 2LE9A 3VH8B 2ZP9A 3SKJH 2FJSA 2J8UB 5LAXB 4TPRH 2Y3AA 2L4OA 3BZDA 3Q06A 2VN7A 2WUBL 4G9DB 3VRIB 3BFWA 4PGCA 1T20A 3T04D 4BUQA 1I3GH 1JWMB 4L8SB 5LBSA 3T0WA 1IQDB 4WY7L 3D6GA 1ZV5A 1JPEA 2VZTA 3FMGL 3S35L 1A9EB 4JVUA 1MXDA 4IU3B 1ID5I 1NUGA 3PQYB 1XF3A 2NY4D 3INUH 1S2EA 1KCUH 3M88A 1QQDA 4OD2A 7TAAA 2ZCHL 3MRJB 3NN8B 2NX5D 2EADA 4ODWA 2H2PC 1QSFB 1TZ8A 3OSVA 1KXTB 4TXVB 4Y1TA 3C75A 4HJSA 2FEEL 4X83A 4XP4H 3B3IA 2K70A 2PF6A 3Q6FA 3CVHH 2VJ8A 3IXTB 1P5VB 5I9QC 4AK1A 3QEHA 2BJMH 1MUJB 5T1KB 2NXYC 3U9PH 3IPFA 2VLRA 4NT6B 5DQJA 3S6CA 3LKQB 4E41A 2E6JA 4Q0XH 1T22B 4H88H 4E5XG 3RVVC 1HZLA 5EBLA 1CR9L 4AQ1B 3P9MB 4JM2D 4X5WA 4HFUH 1U8IA 4RX4D 3IMRA 4L8DA 4FQJL 4TLKA 5FXCH 3UMTA 3V0DA 3NPSC 4FABH 1NPNA 3CSBA 5T1LD 5GS0D 4J5VA 1WT5C 1RUQL 1KEML 1P1VA 2OSLA 2M8XA 3WFDL 2KL6A 1GS8A 2VH5L 2IBZY 4ORGB 1N6VA 2V2WB 2D03L 3LH2H 3T0EC 1T1XA 2NZIA 4TUUA 1OWWA 3QIBD 4NOBA 4PG9B 2QFPA 1TTAA 3A6CH 5JDSA 4KDTC 5F1NB 1E4WH 1K4DB 3BAKA 4EQ2A 4D9QD 3FB7A 5JIPA 4LSQL 1BQ5A 1F4YH 1G7HA 2BSTA 3RVVD 4IMKC 4I5BB 2VABB 3WTWA 1JGLH 1FNGA 3O2VL 2CALA 3FT4A 1XXDC 1R34A 5AYUH 1MH5B 1JD7A 2APWA 3BN3B 5DZVA 4YHLL 4XMLH 4BA8A 5E4EB 4M61A 1BOYA 1ZWIA 2OL3L 3CUPB 5HDWA 3QUGA 4YPGA 2C3XA 1OTTD 3RPIA 3UOAB 1BFTA 1JF5A 1X5AA 2HT2D 2DQCL 4BFIA 1H9VA 2CJSA 2RHEA 1MHPL 4X0NA 2Q10A 3Q48A 5CHNA 5KSUB 1QVOB 2B7DT 3NRFA 3WHE1 2YN5A 5E4AA 4QRUA 1IAKB 1TTFA 3H6AA 4PG2A 5DDHA 4TNGA 3ULUE 3K3QA 3V4VL 1U9KA 3DXAD 3QI9A 3OC5A 1VA9A 3FFDB 1U95A 5JW5A 4XP6L 1E5ZA 3QWOA 4GBXC 5FYJL 1JVKA 5DD6A 4HAFA 4KNUA 5I6KA 1F41A 4YIQB 4EIBA 1XGRB 3CSPA 4AGQA 2JELH 1UZGA 2FBJL 2VN5A 3FB6A 3NJHA 2EH8L 1JGUH 5I1DB 4YEFA 2R69L 4CC0A 5J06A 5DRNB 2IWFA 4J12A 2AJYH 3DI3B 3SODB 3AXIA 4N2IA 4WWKD 4PU2A 5F7BA 3SE4A 4Z77B 5FLVA 4OCXL 4JQVC 4G8GB 4ANUA 5KYYB 2H32B 2DRUA 4MZ2A 3CFDA 4Q89A 3ZL2A 1XF4B 4JO8A 3RGVD 2NW2A 5C6WH 4F15C 4WF7A 2OL3A 1JZ6A 4YHKL 5DQDL 3FQTA 4BXVA 3L5WA 3LKRA 4HIHA 4O58L 4F8PA 1RURH 4H0HB 1T04A 3JZ7A 4NC1C 3TYGL 1FAKT 2AQQA 5BVJA 1IGIH 3G5XA 3DSNB 5HDBB 3EYFA 5EO1A 3ZLQC 5T1MB 1OB1A 4JKKA 4IJ3B 4RGMB 5BVJB 2VGLM 4GKZA 3TEZA 1H6UA 2FL5B 3AADB 1HE7A 3I02A 3R4DA 3GXUB 2XWDA 4N1HB 4HWBH 3QDMB 4FMKA 4Y16D 1CFQB 4NQCE 4F9PC 4MCZB 1DEEA 3ROOB 3DRQA 1JCKA 1EEYA 5FKPA 4AJYV 1FV1B 4OZ4B 2BNQE 2C7FA 2ZWLT 3ES6A 1CBJA 2PW2A 4ZMOA 1FPTL 4YHPB 3OR7A 2F74A 1KELH 1EEYB 4HMEA 4ZYKB 2X1PA 3ALWA 3QQ3B 4P46B 1LO3L 2Y2YA 3DIFA 2QV4A 1VADA 3IDUA 2W95A 3NFPB 4FEIA 5EBWB 5LXGL 1PNCA 4HUMB 4MNQD 2DQGH 2F2HA 2R4SH 2YRZA 2R59A 3BEWB 4APQC 2PYED 2HVJA 2FJFB 3AS0A 2CO3A 1MWAL 3IDNB 2V5YA 3NCFB 3AGWA 5JOEA 3RJQB 1WZKA 2Z91B 4A7VA 3B9KA 4NKDA 5LO7A 4OZIF 3SBWA 4HOMA 2AC0A 2DLFL 1BVNT 2X42A 2PO6D 1OZTG 3KGSA 1BJ1H 2DWDB 1LK3H 1MCSA 2JXMB 2Q1EA 2DKMA 1AD9B 4HISA 4H0LC 4EPSA 5T3ZD 5JW4M 1JPTL 4KXZI 4F7PA 1EXHA 3BWAA 1A6WL 2FZ3A 1SM3L 3FUHA 2CMRH 4ZMAT 1JF1B 2BWIA 3QUYA 4U33A 1XEDA 2UWEB 2VR8A 3MRGB 3PL6D 3I9PA 1YMMB 5GSVA 3RWIB 1KG0B 1FO0H 1HNGA 1QR4A 2C5DC 2NY3D 3FCSB 4A1RA 4OZIA 3H3KA 4FQIL 4K5PA 2Q5BA 3HG1E 3LQAL 2H26A 3VI4A 4F5CE 2FT6A 4AXWA 4IBVA 5D2LB 4J3BA 5IJVA 1AZBA 2QMKA 3HBQA 5G2NA 2ZWZA 3FQXA 4GUCA 2C3WA 3CAFA 4KV5F 3TO4B 4AMKH 4B0MB 4DK3A 1DDHA 3KZ8A 4FAAB 1T5WB 2Y36L 3FNKA 5T3ZE 3T6QC 4F24A 2CQVA 1Q72H 5DJCA 5JIHA 2EDDA 4PJ6A 5F88B 2A9NL 5AWNL 2J2ZB 1UUNA 3GXMA 2ZKHL 2DWYA 2VCOA 3CZNA 1SXSA 1S5HB 3TCTA 3C5ZA 3QUHA 1M7IA 4U1GB 4U1NA 3S88L 1HN1A 2MOGA 3ISYA 4P23B 3MXWL 1TZIB 1Z9LA 4GRWB 2TRYA 4ZUVA 4QRFA 4X80L 2PN5A 2NW3B 3K4DA 5F21B 1KV3A 4N9GA 3BFQG 2PXYA 3RVXD 3P3TA 4N8UA 1OM3H 3OKEB 4NHCL 1T03H 4LOEA 4HJGA 3LNGA 4Y19A 1Q9LA 4NJAH 1AXTH 2IH3B 1NCDH 2UXFA 5C08E 2DDQL 3S36L 3WSQH 1K6QH 5EIIB 4CVXB 4NUMA 1AZUA 2J7LA 4Y19B 1WDAA 5HYQB 4LPTA 3KPOA 4FQXA 1AQDA 4UTAA 1W8EA 2XPGA 2GTZA 4GH7B 5IQLA 1V8HA 2VERA 1RSYA 4X50A 2CR6A 5CEZD 2A83A 2XFXA 4K4KA 4IK7A 4JLRA 5I17B 4JO2L 1N7ML 2WYTA 1E7VA 3D18B 5I74C 4HJUA 1NKOA 4F37K 1I7TA 5L6YL 1L7IH 4M7KH 3UTPE 5IHLB 3EO0A 1P5VA 2PPAA 3OPUA 2P46B 3IN2A 1A7NL 1MVFA 4JVWA 4IBZA 1NDGB 1V7NL 3UTTE 4A6YA 4FFZH 2OZNA 4P3DA 3REWB 5ANMA 2WNWA 1RZQA 3ZZLA 1FI8C 2A6KA 1PAMA 2PPFA 5FW8A 4F27A 4Q8BA 1T3FB 1L9RA 4BQ6A 4D9RE 5C0DA 4UAOB 3SKOB 2VR4A 5DJXB 1EFXD 1RKRA 4JN2B 5FM5M 1JAEA 2P28B 4PW9A 3C8HA 5IW1B 3BPOC 4NRYA 4HH8A 4MBOA 4XNUH 2H9GA 4N2LA 3NZHH 5H4ZA 2YAEA 4W6YB 4PG2C 5DS1A 5IP4A 1E42A 4F2EA 3UERA 3T4YA 4MJ6B 3VYPA 3DTXB 4HQQH 5EOCH 4E9LA 1UURA 5KSAB 1ADQA 1P6WA 1Y6MR 3GSVA 4EUPH 4WK4B 4TVSa 1EO8L 5HPMA 1BQLH 3FOMB 4KXZH 4MD0A 5F9OL 4A2MA 4RFOH 4X7DC 1J48A 1MFNA 2X3BA 5AG8A 5J3HC 3RTQB 3WLWD 4JFVA 3GZOA 4WI8A 1XSJA 4AM0Q 4WO4C 3S3DB 3QULA 5D96C 3V0WH 4B0MM 1NFIA 1E4KC 3KPTA 5EORH 4BJLA 2Y1YA 4U6HA 2UV3A 1WF5A 4J3OC 5GZNA 3CLFH 3BPOB 5FYKD 2ATPB 1IT9L 5IVZA 5DQ9B 3SGKA 1UCTA 3IDNA 4HJJL 2EZ0D 2MCG1 4QIRA 3VWKB 2P47B 4PTTA 3PDOA 5BPPA 2NY2B 1SFHA 2NR6C 4E9YA 1UYWL 2BC4A 1JD9A 2LU4A 2FDBP 2W9LA 2SEBB 2ZX8A 3C8KA 3IDYC 3LPPA 3BAWA 1OK8A 4NNXB 4S1DC 4RAUB 3JWNG 1JPGB 2NX5A 3PNRB 1M2VB 2ZUSA 4HZLA 2AW2A 5DHDA 1RJYB 2Q76A 4LOUD 4XCNB 4ZXBC 4TUKL 1GXEA 2MCAA 1XZ0B 1E8ZA 2WNKA 3AU0A 4PJ5A 4RETB 3X1FA 4NZUH 2YN3A 3SDXA 3N43F 1X4ZA 3O3AA 4YSPA 3WFEL 5DVPA 2UWEA 1T4KB 4LHUG 4J3UA 3T6XA 5I8CA 1IFHL 2ICEC 5J9PA 5F1IA 1YEWA 5F3FA 1BXVA 1B9ZA 3P40A 1E3ZA 4X6DE 5E4OA 5C07D 3LXUX 4WAFA 3JWDC 4S1SH 4HIEA 3FSAA 1KPVA 3F62A 1IV8A 3R0NA 4KY2A 5CEYA 5IB3A 2EC9T 3DUUA 3M17B 4WO4D 4PBXA 4GAGH 1YY8A 3NZ8B 2WTRA 3MGOB 4UIKH 3ARFA 3HHRB 2VZUA 4PJIA 2QHLA 4IRSB 1TZAA 3B4NA 3DUUB 2CA3A 4LRNH 4FXTA 2WTRB 3MGOA 3GBLA 2CGZA 4LSSL 1NIDA 2QQKH 4H40A 3X11A 4U1KB 1N26A 4GAYA 2K7PA 3BRGC 3U2JA 4XCCH 1HEZA 1XCQA 2BCMA 5F7EL 2OMZA 4NIYE 2AV1A 1YQ2A 3H3BC 3RPBA 2XWTA 4HFWB 3GQFA 1AGFA 3O6MH 3TH4T 4UQEA 4WU5A 1GS7A 4PJCE 3ZGIA 3CFQA 4ZUTA 4CC4C 1IAOB 1MSPA 2AAVA 3BXNA 4HFWA 1E4WL 5L2KB 4AQEB 3ULUH 1ZJAA 3HR5A 4LEEA 5KVFE 1N0LA 3DX0A 3HE6B 4HCFA 4PJAF 1DEEB 3ROOA 3GMPA 2CUIA 4EN3D 4PP2B 3L3GA 2WZ5A 1UWXH 4BZ1H 1RJCA 2Y06L 4GSXA 1DSFL 3M1BB 4PP2A 3EDFA 1UOWA 5BQ7A 1KXQE 5J6GB 2CBOA 2Q8AL 3ILQC 4AKQA 1AGBB 1S3KL 1I7ZB 1AQKH 1S3RA 2A73A 5FGBA 2F53B 2XY1A 5GSRA 5HHOB 2ZJSL 1NAMH 2IANE 4KJWC 4K7FB 3RGBA 2E47A 2EYRA 3SE3C 2F53A 2ZWSA 1WVZA 3VSQA 2AXJA 5EN2A 5FYJU 1YHPA 3PNWB 3C5SB 1J12A 3B34A 2YPVH 4AG4L 3ZE0F 4IRZH 1JZ4A 2FGWL 3L4YA 1U8PA 4YL9A 5D1XA 5GHWL 3KLAB 2PWHA 1OV8A 4HDIB 3REWA 3AM8C 5T5NF 1DDTA 1M7UA 2V5RA 3B5HA 3MRGA 4XNAA 3HBGA 4QRRD 1I9IH 4LASH 3L7FB 2Y7QA 1H5BA 2HRPL 1WA0X 2W0KA 5FCUL 3FT2B 4C57C 2C3VA 2YD5A 3BD5A 1ES0B 2IAND 5IIEA 3K2MC 1JHLH 4H8QA 4YUEH 5EIIG 4URTB 4BFNA 4NRYB 1QW9A 3ZMNA 4AGNA 3MNVA 4JO1H 3GK8L 4G9FD 3SDDA 3BKML 2JIXA 3EIFA 5DCCA 2R23A 2ZG3A 1UM4H 4APXB 4LHJB 3P0YH 3LZPA 3II1A 5KTEH 3Q7JA 2AF2A 3EBGA 2EDHA 3HG1B 5EEYA 3FOLA 2VR7A 4DW2H 3UAFA 3NP3A 1GMIA 4WFEE 5D4JA 4GUPB 2E4FA 2NT1A 5AL8A 4LL1A 4GSDH 3O0LA 4QUOA 4LGRB 4L4VB 3QFJD 4NGHL 4ZPVB 4OUUB 1FN4B 1JNNL 1GHFL 4PGDA 4TRPH 4DCQA 1GKEA 3QULB 5FO9B 4EI6A 4TTDC 3WE6A 1XSIA 3OB0K 2IMMA 3KWWB 2CK0H 2YQBA 3MUY1 5JA8B 3SDAD 1LM8V 3ZTNL 2ICCA 3O6KL 1QLFB 2C1OA 4LCUA 1T1ZB 4F1SA 1G9ML 4LOFA 1NEZB 4TNVK 4YDJA 3KWWA 3T09A 5IQ7L 4K8RH 4S1QL 1ODUA 4YHMH 4YXHH 1RZ8A 3N91A 1Z2KA 5J11B 3BH4A 2X89A 3ZZSA 5LXGH 1A14L 2BDNL 3SDCB 1X5IA 2UXGA 3NCCB 3IKCA 1A4KA 3POHA 1IBHA 2I5YH 1DVFC 5EOQH 5DD0H 3WNNA 1UWFA 4QRRB 3WJMA 4PJHF 4G6JL 4M9OA 1DO5A 4OF6A 5B3JF 2VC2L 3JVGC 3FQUA 4GXVH 1BYPA 3EOBB 1HL5A 1NEZG 1FBIH 4GG8A 2QTVA 4MBRA 2FWLB 2P8PA 4FQPA 2G9HA 1S4IA 3NJMA 2I26N 4GIPD 3MLWL 3PAYA 1Q0YH 5DU7A 4XC1H 1UJ3B 4YDKH 1S7QB 4QRTB 5BUAA 3F65A 1OTSD 3SBWC 1YAZA 5ANMB 4CN1A 5DYFA 2LQRA 5JQHC 1U8NB 4QEGA 4P4RA 5F71A 2OR8A 2K6YA 1TKWB 5D7HA 3MNDA 3MTXA 5DFVD 2NMSA 3NABL 3MOBL 4FG4A 3QG7H 1FSKC 2GUOA 4FZEH 4E9SA 1SY6A 2VKWA 2J44A 5FHBL 4ZFFB 4NM4H 3VNYA 3H2QA 4JFYA 2BW4A 3L9YA 4RGOL 3L1EA 3RI5F 3VSVA 2JCCA 1MFDH 4YDZA 5BVPH 5JPMA 2EDFA 5KVGH 4MWFA 3RFRA 1O5DT 3V0IA 4L9LA 2DZEA 1D5RA 3SDCC 5A7EA 4IBWA 1LE5A 3GI8H 4FE9A 4MA8H 2ADIA 4XNXL 3ARBB 3WY4A 5AYQA 1AZVA 2B39A 4GXUM 2AMGA 2YXWA 1OSZA 5AW3B 3EH5B 1AG6A 4YLBA 1G9NC 5B39B 2XZZA 5C0GA 5IZ7A 5EF0A 1OAZH 1FFQA 1V10A 1UACH 3GLZA 3GM8A 4L9DA 3M1OA 2H6PA 4F8TA 1GSMA 1DBAL 1EXUB 3GXIA 4I89A 1BFSA 3VWKA 3WNOA 4PJBA 1AS6A 3EOAA 4WFGD 3I9AA 1M3IA 2CSPA 1MHHA 1JHTB 2J1WA 5HY9B 5K9JL 2GK0B 2VDLL 1G6RH 3MA7B 4DUVA 5BJTB 1RXLA 1XT5A 2AMUA 4LP4A 4KK9C 1FE8L 4N90D 1L4IA 1YEKL 2LFEA 4J3OF 4AEHH 1CF1A 4NQXB 5DWPA 4MS8C 4BWUA 3HG3A 3D87B 1CFQA 1GW0A 3OG6B 3DGCR 3GXTA 5HI5D 4LCWE 1RU9L 3D9AL 1EGJH 4MJID 5KOMC 4ZOEA 2UZIL 5GJSH 4KZCA 43C9A 4LVOC 2XZQH 3QQXA 1ZLWH 3VFTA 4LSUH 4YHYC 4XBEL 4OZIB 5HDRA 3HAEG 4Q9RL 4PS4L 2Y6SC 3IPBA 4FP8L 2DYPB 3W2DH 1G5GA 1E0OB 4HS6B 4QOKA 1CICD 5DVMA 4JY4B 4AQ8A 1IGJB 2IJ0C 2R83A 3VB9A 4HUVA 1ZEAH 4X6CA 5TQ0L 1U21A 3DOIA 1RZJC 5CD3B 4XBGA 1NCAH 2X9ZA 3MV9D 4TNWK 4Z1PA 1A9EA 1E9OA 4OLXH 3HG0A 2DQIH 3VXRE 1FFPB 2MHAB 4W4OA 5F7HA 4L1DA 3I3DA 1J8HE 4GEJA 4P2AA 4FFYH 1SYVB 4XWGL 4BBWA 3SDAA 5C97A 2HJFA 1X3DA 4QWWD 3QJVB 3LNHA 4HU2A 1YDPA 2X1XR 5TPWH 2QPSA 3KPSA 5I6LA 3E3QE 4O4YH 2CHDA 3L9EA 3L08A 1SYSB 5C0FA 3HLAA 2APXA 4HWUA 1D5BA 3KPRA 1ZXQA 2YK1L 1EJFA 4IKLA 2WY3B 3GNMH 4ANXA 4CAGA 2BNUB 1U8MA 1RZFH 2PP9A 3RHWF 5JW4Q 3MN8A 1I8UA 2E5EA 3SCMD 4O5LL 4IKNA 3NIGF 2IGFL 2YBRB 5C3LD 1FYHB 1CDUA 5TJWK 3BYTA 5A6IA 4JM2F 3W37A 5K9OB 2YAFA 2ENQA 3IB4A 1MJUL 4N20A 2O26U 2X9WA 5DHYB 1B4JH 1KB3A 2ADFH 1A4AA 1BEYH 3FT4B 3T8XB 3WS6A 5I30H 1A6AA 3GPEA 2QVIA 1YPZF 2UZYB 1CFVH 2A83B 2HN7B 3P4NA 4NBZB 2VSCA 4XRCB 3QORC 2MJWA 2N01B 2Z4TA 1XH3B 2E8ZA 2AEIT 2ZCKL 1JDCA 2Q6WB 3OV6A 2B59A 1G7JA 4LBEA 1P0SE 3Q3GA 5KSUA 2VL5B 1JTTA 4EI5A 1CXKA 3FQRB 1O6SB 2Z34A 4Z7AA 3OM3B 4LU5H 4NUPA 4QNPF 5JOPD 5JDJA 2BOCB 3D3VA 5SX4I 4RMSA 5BOJA 3V79C 4OI8A 2N7AA 1R5IB 2DYPD 3NGBB 1D5ZA 3O3UN 4J3OG 2X9XA 4FG0A 1EEZA 1UJ3C 5A7BA 3NTCH 4L1BA 5C6TH 5I5MA 5F1OB 1EHLH 2Z92B 1S7SB 1UWEL 4L9LB 3RWJB 2I07A 4WGKA 3IFOB 2X3AA 1A21A 4JDTH 5DI8A 1XB6A 3O6ML 3U4AA 1SJEB 1MHPH 4NN5B 3WEAA 5F44A 4G8EA 3DX3A 3WE6B 1N0XH 4XMZA 1ETA1 3V8OA 3GUTB 3HG4A 1QG3A 1OE1A 1X4XA 5AG9A 4P57B 2GIMA 3A21A 4AWJC 2NY0B 4JL1A 5DFWH 2YLHA 1X5KA 2QGEA 4MYWB 4NAMA 4OJFH 4YBQC 4MA1B 1H8OA 4G6ML 5HD8C 4JHWL 3WKPA 3U9WA 4GRWF 5KZCB 4OCRL 4GUOA 2JELL 2GKIA 1A2YB 2DM3A 1JYNA 2DBLH 2WXMA 2D0FA 4LCWB 1EIBA 4L8CA 5E8OB 4O2FB 5BV7L 4D9LH 1BQKA 4TMPA 4ZPTB 4P0DA 2PCYA 4TS6A 1RZKL 1JV2A 5ADPH 2HX7A 4ZRGA 1FGVH 2PW2B 1GOFA 3EOBA 1PLGH 1R3JB 1JI1A 3DK2A 3GMNB 2RQEA 3EHBC 2ITDB 4GAFB 4PWEA 4GEIA 2YPLD 1ECZA 4LHUB 1QSFE 1VACB 5HJBA 3JWOH 4BUGA 3OTTA 2GJPA 2NNAA 1QBBA 3I2CL 3KHOA 4P5KB 3EYUH 1NBCA 5C0BB 3NCXA 2V7NB 5F3BB 4L8SA 2D3LA 4FXKC 1PCSA 4ZSOA 1PX3A 4IIQB 5AZ2L 2VZ3A 1EHNA 5C9JB 3CZLA 2DB8A 4PMEA 3N41B 4ES8A 1Y0LA 3MLSH 2ICWA 1EFQA 5GGSY 2OK0H 3R0MA 2L0DA 1MHEB 6FABL 3C5XA 3WFBL 1NFKA 3UP6A 4PJ9D 3TJEL 2FEEI 1OAYH 2X40A 2FO8A 5C0IB 2WQAA 4P2RA 3QEGL 1J1PL 1JNHA 2Y1AA 4URKA 1URLA 3S8WA 1K72A 3BVTA 3H7BB 2ZT9C 2COQA 1YNTA 4N8VB 1RK1B 2JJTC 3DV6B 4YFEA 2RCSH 5B1JC 3VDAA 4CNIA 3RWGA 4ZW7A 2IOIA 1XD1A 1E2WA 2WXJA 1RHHB 3SGJC 4WFFD 3Q1SH 4PI0A 2Q87A 3Q2CA 3MRLB 5I1AA 5DLMH 3WXVH 3CFMA 3Q43A 4N2FA 3QJSB 4BK5A 5IJVB 3U1SH 3PFUA 4L8SC 3S35H 4BIKA 5HGBA 3ISRA 3KPPA 4XNMB 1AOHA 2HH0H 1KYFA 4JVPA 5CP3H 1PIGA 1AKPA 5IBLC 4L48A 1IC4H 5DJAB 1ETZB 1BVLB 4L2YA 2Y5TA 2VQ4A 1J05A 1N3NA 2R0ZH 1INDL 1I9EA 2RGSA 4XNQA 3R7QA 1YJDC 3FU7A 3L3JA 4AQZA 4B60A 3MRQB 3CVHL 3UPRB 3EOAB 1RUMH 3MV7A 4MAUH 3QCTL 3HJ0A 4OZHB 1D9KB 1D9KC 3BE1L 4X6FB 3FPXA 2OMZB 1DJZA 4LL9A 4LEBA 1F3JA 4LVNC 1LL1A 1M57B 1IKNC 4HMDA 3P2TA 4GI8A 1FORH 4IM8A 4XGZA 5DC9B 5EA0H 5F7WC 1RVFH 3NZUA 4W68A 1QRNB 4BK8A 4TVPH 5D1QA 5ICZA 4UBDD 4QRPE 3B43A 4AQEA 3EJTA 5IBLD 4DEWA 4N8CH 3R06A 2ENJA 4KC3B 2P1YA 3JUZA 4ZOBA 1RUQH 2XKSA 5DHVH 3WGVB 3B2UD 3X14A 4OKDA 1U2CA 4IEFB 3VU1A 5G5DA 3T2LA 3NIGE 5CHNB 2ENSA 1HL9A 5EDXA 1C08A 2OYMA 1O0VA 2W0PA 4FQLH 2WLKA 3UABA 2CUHA 4XPBH 3PP4L 4DAGL 1WSST 2K8MA 3ARDA 4AC2A 4CBZA 2JJUA 3Q5OA 4JRYA 1ZLSL 4NKIL 2CDFB 3BOVA 3GMRA 1MRCH 4G42B 2VKXA 1KIRA 1F4XH 3MOAH 3MHZA 1D5XA 4DGYH 2ZKYA 4PRAA 5FHBH 1QA9A 4PJ9B 3CLEL 3DPBA 2A6IA 1XIWC 4GT0A 1TITA 3APMA 4N2OA 5C1MB 4Y2OB 4P4KB 3MBWA 2TRHA 1UJ3A 2VUKA 3KYMB 1X6NA 2JWYA 3T0AA 3GUTA 2GITA 3V6FB 5EDSA 4Y2OA 1IGFL 1A6ZB 5EOCJ 3ZDZF 3P3RA 2NW2B 2W38A 3J07A 4L4JA 1LNUA 5C0CD 3DETC 3U1QA 3MYZA 1RL1A 4LF3B 5DZOA 2YD6A 3L5JA 5F9JA 4Y4KC 1UD3A 4XP5L 3NJKA 5FYJH 2LLLA 2BSED 4B95C 3NCYP 4BH8B 3QDAA 4YSRA 1KBVA 5J1SC 4HHGA 3RWEA 4XE0A 2G5UA 2OTUA 1MY7A 4ZUUB 1XIWD 3FBKA 1JDAA 4IBQA 1A4KB 1LO4H 1T5XA 3EJSA 4RWYH 4M6OL 2XVBA 1J5IA 3D51A 1J8HB 4JFED 4JPVL 5CNHA 3HPLB 4JG1H 2IFGA 7CGTA 4OLUH 1PU0A 2NOYA 2PXYD 3LB6C 2OJEB 2VDPH 2SODB 5D1XC 2ADIB 2DQTL 4J1UA 4ZFZB 5HBBA 3TA3C 1T0MA 4PSRA 3T65B 4G6AC 4GG8B 3TP4A 2OJEA 2TSBA 3IFPA 5HPMB 4M5SA 5I23A 5I1EH 3DUSB 3GBNL 3ZK0A 1RURL 1RP8A 4DK5A 3I6SA 4QF1B 2VITB 1E3XA 3BZFB 1FYTE 1QOKA 4XNYL 1DQDL 3BEWA 1MCQA 1YEIL 2NCMA 12E8H 3JTSB 3N40F 4XB3A 5B22A 3ARTA 3GUFA 3ZHNA 4M3JA 2IDUA 4JKWA 5D7KE 4Z7WB 3EH1A 2AQSA 3QXUA 3PUUA 4UAOC 4XBEH 5FOJA 1P7QB 1TETH 2DLEA 1OSYA 3K71A 1LO0H 4M1CC 2FJGA 1M05A 5FAAA 4J6IA 4NPYB 3H9SB 2A77L 3ZTJG 1MJ8L 1F58H 4LEXL 3D30A 3DKHA 5F9OH 1V54B 3PGDB 3BDYL 4ICXA 3ABKB 4RFOL 5IFJB 3UPCA 1XAKA 2DLTA 3SQOL 2ROYA 4K5MA 4AIZA 2X4TA 3OJVC 1B0IA 1O6TA 2JTYA 2YHGA 2FAUA 1NFDF 3GHEL 5GS1C 5D2NA 4OIIH 4LCIL 5DI8B 1DUYA 2P8PB 3L6FB 4KV5E 2Z93B 4JPWH 4HJJH 4KUZH 2CBTA 3P77B 5DZPA 2QPFA 1P84J 2FQDA 4JREC 5DEZA 1R3KA 4PWJA 1J8HD 3M07A 2RBLA 4LKCB 4K3EL 4DGIH 5CEXA 5EU4A 4EN3B 4F2MB 1N2RA 2UZXA 2Y25A 4JK0D 4BQ8A 4JZJC 5IW3A 3M17A 4BH7B 1P2CB 3ZHFA 2N3JA 4QRQB 5B8CC 1WEJH 3GNML 1XF3B 5AAWC 4MDIA 2VDQB 1E27A 2VLME 3G04B 3QJQB 1NUDA 4OZHA 4O02B 1FFPA 1GOGA 5BZWA 4F2FA 4MNQB 3F7LA 4GRWE 4BWTA 5IOPB 5HGGS 3G04A 2E9WA 1K8IB 3EFFB 4LCWA 3NBNA 4L8CB 2C4FT 2CD0A 1HVXA 5JZ7C 2GJJA 1E90A 1O5PA 1S5IL 4H8WH 1IGCL 5FFOA 4KO7A 3RWCA 2A9MH 2CBQA 1SFDA 3EG9B 3RFZA 4KY1L 2LLGA 1OQOA 2WNXA 4A55A 5JXAL 3FCBA 1EAJA 4K3JL 4UILL 2YC1B 1J10A 2EO9A 4TNVF 4ZAKA 4G5AA 4GY4A 4PB9H 2C9AA 3MRBB 4XN4A 5CBAA 3BEVB 2D7QA 2J6EL 1ED3B 4M43L 5DVNA 5IKCA 2PUQT 5AW1B 5FW7A 1VADB 2IH3A 2XQ0A 3NFPA 3T3PF 3TO4C 3VXQA 4B9ZA 5BJTA 4HWBA 1NCUA 5FECA 3N1GC 4M5ZH 4OLYL 2AEQL 3HS0A 1TQWA 3MLPA 4TULL 1UUSA 4MQXC 1SY6L 5BO1H 1I7ZA 3BLKA 4GXFA 4DEPC 5HHXH 5IFAH 3K6SB 1SXCA 1UD5A 1A7QL 3CPUA 4MMZA 4JY4A 4BYHA 3MRNA 5E1HB 3RWDB 3NSXA 3BSGA 1XQ4A 3MNMA 3S88H 2AGJL 3TWYA 5B1BB 1KN4H 1WTLA 4UTCA 1RULL 1TOXA 3BUPA 4YHIB 1YJDL 4AJWA 4OZFB 4XX5A 3BPCB 3QAZC 2UX7A 2A1WL 1I3RA 4WKZB 1AD0B 2BK8A 1SYVA 2CXKA 3Q9QA 3OMIB 4ZNCD 5IQOA 1RERA 5B38B 2V2XA 4G7YH 2B9BA 3BH9B 1JP5A 1EA9C 3GRGA 3BSZH 4LF3A 5AFAA 1OAQH 1XIWA 4X98A 4E68A 2P43B 1NMAL 1QLEL 5F8RC 3OHXC 5E08L 1ZOXA 3FQ2A 3S98A 5E1AB 2D4FA 3MBED 3QIBA 4CN4A 3NACH 5DK2B 3OAUL 5MERB 4DGUA 1AE6H 2P8MB 1MFAH 3VG9B 4AUJA 1DCLA 4GUPA 2QVMA 1D6VL 3EJJX 3Q05A 1UENA 5LG6A 2Z1PA 3DX7A 4XAWH 4QHNB 2OX5B 5DD3H 4TOYH 2MPAL 2ZOOA 25C8H 5K33A 1UVQB 1IFGA 2VDLB 4YSTA 4YPJA 3SPIA 1P7BA 3PHAA 1QP1A 4NO0A 2OMWA 3ZDZE 5I1CL 3KL5A 5I6NA 4BZ2H 2K6WA 3O3DB 1EPFA 3KPSD 4IRJB 3RYMA 4POZC 4YQXH 3G6AA 2K4WA 2OMWB 4YDVA 2NY0D 3UTPD 2AV7B 1TG8A 4JO1L 2Y7SA 2O93L 2OMUA 1MCWW 3IFNH 1BOGB 4PY7A 2H2SC 5C08B 4Y8DC 4PJ8A 5F97E 4UM9A 1UGNA 2HJKA 1MFBH 2D3NA 4UT7H 5E1GA 3Q1EA 1R3LB 2GTWB 2QV2A 3QPQC 3OKEA 2YGPA 3TA3A 4C56D 3G5XB 3L4CA 4XXDB 3S37H 1LEGA 4PHZA 1I9JH 3QO1A 1HZKA 4EMZA 1CGSH 4OGZA 3QUYC 1CD8A 2AKRB 1PY4A 3TA3B 3GKZA 5IB4A 3VFVA 3QAQA 2C7UB 4OJCA 1VEPA 3GMRB 5EZJA 3HUJB 4N1EA 4W1TA 4MA1C 2W0LA 4KWUA 4ZMYA 4KJQD 2P5WD 1AZCA 4KXAA 5B1CA 1OPGH 4WUKH 2XPZA 4BEIA 3B8YA 3QXAA 4XN7A 3UIYA 2WXNA 4PQXA 1KCLA 4TQ8A 2F5AL 2YGVA 1ZHBA 4MJIA 5I73B 1ZGLA 1YC8A 5DHXB 3VI4F 4DVBA 3K72A 3FT9A 3FB6B 4XZUB 3ZTEA 1JYXA 1RIHL 4F7TA 3P9LB 1BAWA 2Z7ZA 1WA1X 4WO0A 3BUIA 4NC0B 3W56A 1OCZB 4U6TA 4U2YA 4WFHD 2XA8H 4G8GD 3KHQA 1WC7B 1H3XA 1ZS8A 2EXYD 4JZOB 3BGFC 3F6LA 3UDWA 2J25A 5I15H 4OJAA 2IAMD 5D5ME 1D2PA 2KZBA 3DX6A 4YO0B 4JN2A 3UTZB 4QRUB 2YXMA 4Z3FA 3TBWB 3NGBC 4FABL 3D2UA 1CFNB 2VTFA 3CMOH 2Y69B 1AO7E 1P4LB 2BOBA 3EYOB 2XV6B 4KVCL 4JJHA 4G7SB 1UEYA 5KSAA 4N0YH 1BXUA 3ZY7A 4YIQA 3ARRA 2FYVA 1K5NB 1MCJA 1EEUA 4MMXB 1K4CB 3IGAA 4GMTL 3RGVC 2Y07L 4PAZA 4A68A 5I71C 2LVCA 1MIMH 2R8SH 4ZW6A 3LXBA 2OSWA 4JZNA 3BEVA 3EJRA 2KHAA 3QDMD 1BJ1J 2VO8A 3DHMA 4P2RD 4JZNB 1KXVC 3FTUA 2K9FB 4JFDE 4OQTA 4KJPD 3BP7B 3RL2A 1QFWM 2JH2A 5AVZB 5KSBB 5BXFA 3EGXB 5F7EH 4QHMB 1EERB 5J1AA 1CQKA 2QJDA 2GVYA 1JHTA 4XTRC 5DJ2B 4CBPA 5JHBA 1DL7L 1BMGA 4HVBA 2VLLA 1UA7A 1G9HA 2WCGA 4Z7OB 2AK1H 4Q9QH 4KQ3L 1H3PL 2ERJB 2YAOA 2GBVA 3H9SA 3PLYA 3GI8L 2ZWNA 1CL7H 3DJ9A 2ZP8A 4ZS7L 5EHFA 1QRNA 2HFTA 4TSCH 3QFDA 4JL2A 4IHOB 4TN9A 4F7CA 4F7KA 5ITFA 1HS6A 1HCFX 4WI5A 4MAZA 5T1DL 1GS6X 4XWOD 2VWEC 4LSQH 4N8VG 4PJEB 5E0FA 4D7BA 3SYCA 3U7WL 5IHZA 4X7TA 3MRPA 5EV7A 3PAZA 3JWNE 3WDJA 4ZOAA 1QWHA 1NBZB 3S96A 3OZLA 5BZDB 1FZOA 2FSEB 3JYBA 3TFKC 2X5PA 2FIKB 3Q8FA 3ESUF 4ZD3L 4J27A 2X6UA 2PYFB 2E9GA 2FLMA 4ONFH 5I5JA 1XZWA 4ABUA 1IGFH 2EIBA 5D2NC 5HVFB 3TIDB 2R23B 1SDDB 2EUZA 3MLUL 1M71B 5TFSL 1QQDB 1XBRA 4ZTPH 1D5MB 4DGVH 1G1KA 3QAZB