1AZRA

Crystal structure of pseudomonas aeruginosa zinc azurin mutant asp47asp at 2.4 angstroms resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AQCSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHDWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transfer(cuproprotein)
molecule keywords AZURIN
publication title Structure of Pseudomonas aeruginosai zinc azurin mutant Asn47Asp at 2.4 A resolution.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1993-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1azrA00
1SDDA 2QDVA 3AG1B 2IAAC 3X1GA 4FA7B 1BAWA 3NSYA 3IBOA 2A3TA 1VLXA 3GDCA 4DPCX 1NDTA 4E9QA 2XU9A 3SBQA 1NINA 4M3HA 1ILUA 4KNUA 2FWLB 4JKNA 4KO6A 3AY2A 2HX8A 3AW5A 2PLTA 2UXFA 2YAQA 4AI7A 2FT8A 3ZX1A 4BXSV 3NJLA 2W8CA 2WO2B 2CAKA 2ZXWB 3GXUB 3JTBA 3UACA 4WKXA 3DKHA 1RZPA 2EILB 5I6KA 3N55A 2PPDA 2XXGA 4YSEA 3CDZB 1PMYA 3BVDB 3T6ZA 2ZONA 1JZFA 3AG4B 3X1NA 2DV6A 4YVNA 1KV7A 5IY5B 4BXVA 3NYKA 1FWXA 2H47C 2IDFA 2GIMA 1ZDQA 3EH4B 3ZBMA 1GS8A 3V9CA 2BHFA 2OCCB 1ZDSA 2X87A 3X2QB 1W8EA 1NIEA 3T71A 3G5WA 3CVBA 2MTAA 4YSAA 4G7QB 3FSWA 2VN3A 3PAVA 1E5YA 1GS6X 1RKRA 3DTUB 3TU6A 3ZIYA 6PAZA 1AZUA 2YAMA 3IN0A 1IC0A 1NIDA 4YSQA 1AS8A 2QDWA 2IDUA 5D4IA 5B1KA 3AG2B 4A67A 3TA4D 1A4CA 1PZCA 5I5JA 4FAAB 2FNWA 3CZUB 2EIJB 1BXAA 3FU7B 3QJTB 1L9TA 1IBZA 2VM3A 1CYWA 2DWSA 2XX0A 4BWWA 4A2EA 4DP8X 1AZRA 4X4KA 1HAWA 1OE2A 3FPXA 1GYCA 2E86A 5I5IA 2YAFA 4QKTA 2VSKB 4Q89A 5I26A 2NRDA 1PCSA 2YAEA 1J9TA 1AG0A 5B1BB 3MX0B 4W9ZA 2PPFA 2VW6A 4HALA 7PAZA 3V9EA 4MFHA 1BYOA 2CUAA 2FT6A 3FT0A 4E9SA 2CCWA 3FQYA 3WNIA 4E9YA 1GR7A 4JHVA 3HEIB 2GC4C 4BDVA 3PAUA 4DP7X 1RZQA 2EIKB 3PCYA 1OCRB 2IDSA 2BP0A 2QPDB 2AFNA 2YAOA 3QJSB 5I6MA 4G70B 1SHWA 3KW7A 3WKPA 3NJIA 2JKWA 4RH4A 3FSVA 3PAZA 3NJGA 1DYZA 4ENZA 3QPKA 1GW0A 2Y69B 1DZ0A 5B1AB 1M57B 1AACA 2VMJA 2HX9A 1GY1A 2XWZA 5AZUA 2BO0A 2WO3B 2X88A 1MZYA 1OOWA 2HXAA 1SNRA 1CUOA 2XYBA 2H3XC 2HX7A 3CG8A 3T9WA 2FT7A 3NJMA 2BWIA 1B3IA 4HIPA 5E9NA 5I6NA 1ASPA 1J9SA 1A4BA 4WTQA 3FPYA 2XV0A 4GP5B 4HHGA 5AKRA 4HCGA 4GP4B 3UGEA 1HFUA 1NICA 2BP8A 2R7EB 4NERA 2PPCA 3FS9A 3PXLA 5B3SB 1AIZA 3UAAA 1XMEB 1L9SA 1SFHA 2JXMA 3NJHA 6PCYA 2MRYA 2YQBA 2QT6A 3SBRA 5TK4A 4L0PB 2PCFA 4KOCA 4PAZA 3S3CB 2TSAA 1WAEA 2AVFA 4KO7A 1L9PA 2B08A 1NTDA 1E65A 3AZUA 3SQRA 3U25A 4GP8B 3NP4A 1EHKB 1ZPUA 1AS6A 5I6PA 3QJRB 3TASA 1NZRA 2GI0A 2OV0A 3NJKA 4HAKA 3IN2A 2BZ7A 1KCBA 1OCCB 3NSDA 2LLNA 2HZHA 3WKQA 1URIA 4AZUA 1ET5A 2IH9A 1L9OA 2YXWA 3FYEB 3H4HA 2FTAA 7PCYA 1L9QA 4QLWA 1JVOA 3ERXA 1FFTB 1ILSA 1ZIBA 3WNJA 1R1CA 1QNIA 4F7KA 1KGYE 1V54B 1OV8A 1N70A 8PAZA 3GYRA 1CC3A 3KW8A 5FC9A 3D12B 3CVCA 3QJUB 2DYSB 3FU8A 5EHFA 1E5ZA 2H5UA 2XV2A 4KNSA 1OF0A 1RCYA 2BW5A 4YSSA 5A7EA 1SDDB 2PPAA 1AS7A 1ID2A 1T5KA 2J5WA 2XV3A 2CBPA 2DY2A 1TU2A 4KO5A 2AZAA 4UAHA 1ZV2A 4NB7A 5B1JA 4YSUA 3NJJA 1OE3A 3X1BA 1E67A 4YL4A 1OE1A 2UX6A 5I6OA 3ABMB 5I5MA 1JZIA 1JOIA 2BZCA 1GS7A 5PCYA 1AZNA 2UXGA 1PLBA 1IUZA 3AG3B 1CYXA 3ASOB 4GY4A 5D4JA 1WS7A 2UXTA 1ADWA 2XLLA 1J9RA 1PF3A 3OQRA 2CJ3A 3SBPA 4DP2X 1OCOB 2JFCA 4JHUA 4AX3A 1MG3C 4G7RB 2IWEA 1XB3A 2IWKA 4A2DA 1JZGA 5I28A 3RYMA 2PP9A 4AKQA 2WSDA 4N8UA 1NIFA 4YSTA 5PAZA 1TKWA 4A2FA 2ZOOA 1TEGA 2DWTA 3QQXA 1AQ8A 3OD3A 2EINB 5TK2A 1BYPA 3UAEA 1SFDA 4P5SA 2J57A 1QLEB 1IKOP 5ANHA 2P80A 2XVBA 3CDZA 3S3BB 1MDAA 3T6WA 3HB3B 1J5CA 2YAPA 4DPBX 3T6XA 1NIBA 3OMAB 1F56A 1BXVA 2BWDA 3ABGA 2BW4A 1GY2A 3C75A 1WA1X 4HZ1A 4M4RB 4TXVB 4E9XA 2N0MA 3N2JA 3L45A 1NPNA 4NAJA 3QJVB 4Q8BA 4E9WA 1NWPA 1E30A 2TSBA 1PZAA 3UABA 3OMNB 2GC7C 3X1EA 2FJSA 2FQEA 4F2EA 1CURA 1PLAA 2PCYA 1OCZB 1AG6A 4YSCA 5I6LA 1BQ5A 3FU9A 2W88A 3EHBB 3JT2A 4CSPA 1UATA 4AKPA 1ASQA 4GYBA 3OM3B 2FQGA 3OMIB 4W1TA 1PNCA 2FQDA 1M9WA 2IWFA 3X1FA 1KDIA 3S8FB 1JXDA 1JXFA 1KBWA 2IH8A 1KCWA 2FQFA 1SF3A 2YARA 1NPJA 2IDQA 4YVUA 1MG2C 1X9RA 1ASOA 2UXVA 3FU7A 4YSOA 4A2GA 4YSRA 1ET8A 4BDVB 4AKOA 1JERA 2HRGA 2I85A 2BP0B 1A65A 2GHZA 2GBAA 1GSKA 4G71B 3EH3B 1I53A 4F2FA 1A4AA 1W6LA 2P80D 5F7BA 2B3IA 1AZCA 2HLEB 1PAZA 3H56A 4GXFA 1WA0X 4DP6X 1WS8A 2Y1AA 3ABKB 1SF5A 3IEAA 3FQ1A 3ZDWA 5F7AA 4BWUA 2PPEA 1A8ZA 3NT0A 2I7SA 1BEXA 1JVLA 4HCIA 4DP9X 1EZLA 2XX1A 4DP4X 2VW7A 3UADA 2IDTA 2RACA 3FSAA 3NSFA 1L9RA 2Q5BA 4DP1X 4K9JA 9PCYA 2BP8B 1JZJA 3NJFA 3T6VA 1ZIAA 1PLCA 2J55A 1QHQA 2EIMB 4E9VA 1PZBA 4EF3A 3QJQB 5B7MA 1PNDA 3S3DB 1N68A 2AZUA 3DIVA 1AOZA 2XXFA 1NIAA 5B7EA 3WI9A 5AFAA 3FSZA 3S8GB 2Q9OA 2DYRB 1SJMA 3ABLB 3EF4A 5B1JC 1JXGA 2XUWA 3IE9A 1JZEA 4BWTA 1YLBB 1BQRA 3NSCA 3TBBA 1KBVA 2VW4A 2R7EA 1WA2X 4HHWA 1V55B 4KOBA 4ZK8A 2ZWNA 1AAJA 1MZZA 1XB6A 4CSZA 2YAHA 1BXUA 1V10A 5D4HA 4G72B 1FA4A 4P5RA 4E9RA 1ETJA 1AR1B 2HRHA 3PPSA 1PY0A 3NP3A 4A2HA 1J9QA 1W6WA 3WG7B 4UANA 2PP8A 4A68A 2QPEB 1KDJA 2UX7A 3WIAA 1AANA 4YSDA 4N4YB 1TEFA 4KNTA 2YXVA 3ASNB 1XB8A 2CALA 1HAUA 4HCFA 3EH5B 5B7FA 4YSPA 1M56B 3FYIB 3CVDA 2VM4A 2GB2A 2J56A 2VSMB 4G7SB 1AZBA 4KO9A 4DPAX 4DP5X 2PP7A 1BQKA 3BQVA 1A3ZA 4BK5C 4DP0X 1J5DA 2GSMB 2I7OA 1JZHA 4A66A 4UF7C 3FQ2A 1ET7A 4PCYA 1SHXA 5LDUA 1NWOA 3PLYA 1X9UA 3NJNA 3TBCA 3MBWB 1IBYA 1KYAA 3H4FA 4E9TA 2AANA 2OJ1A
chains in the Genus database with same CATH superfamily
2WNWA 1L5GB 1OHQA 2P1YA 4AQ1B 5DURB 4MJ2A 3CFEB 4JDZA 4BK8A 4TV3A 3CDYA 4AQEB 2BNUB 5J56B 3JUZA 3WMQA 3VX0A 1NDMA 3EKCA 4PJGA 5FIEA 4GKZA 4XN4A 2OXHB 1KIQA 1VACB 4X6DE 5GS1C 4E42B 5I0WA 3RIFK 5C7XH 2HX8A 4QXGH 3G04A 4UDTA 3T4YB 3BPLC 3M07A 1C5BH 1HL4A 2FT8A 1EZSA 4R96A 2CAKA 3PFQA 4YHML 1G6RH 3MA9L 2CJTA 1ZHNB 3T65B 1CXKA 2C9SA 3ARED 4WKXA 4IKLA 1CI5A 2VR4A 3S2AA 5MEND 3VW3H 3KYKH 5T3XL 5CCGE 2A6JA 4P07A 2X38A 1PFCA 1M9SA 1WGVA 4U1JA 3PGCB 1QHOA 2V9UA 1BJMA 1PG7W 1EV2E 3EO1A 1BD2A 3EJPA 1XCQA 2DLFH 1REIA 1BQHA 3RVVC 3HE7D 1QASA 3GKWL 1WK0A 3MYJA 1KGCD 1F4HA 3U2JA 5DQ9A 1I1RA 1YECL 2XJLA 3AQXA 2OSLA 4WU5B 1YO4A 4X0KA 4AGPA 2BLFA 5ISZA 2ICEC 3CSGA 3SN6N 2FK9A 2Z1PA 3LN4A 4GRMA 1YCSA 3LQAL 2IV8A 4P4RA 5IVXF 2E9WA 1QR4A 5J13B 4GMSL 1C8QA 2VDPL 5IR1B 2P5EA 3TT3L 2XXCB 3EYVA 1XGPB 3EJQA 3QXDB 1UKSA 1E4WL 2PXYA 3JWOL 4N22A 5F7LB 2IGFH 5CS7A 5D4IA 3RWGB 4PJ8C 4XTRC 2C9UA 3KVDD 2F1AA 4CNIB 4TNFA 3U9UB 5JLZA 4FAAB 2FNWA 4IIQA 5J57B 4DK5A 2EIJB 4NQSB 4LVEA 4ODVH 3W0WD 1XH3A 4UT6A 1AHKA 4YE0A 3BIKA 3IAGC 4H8QA 4TVPL 3LEXB 5I6XB 4IBTA 4X4KA 2F7RA 4OZHE 1K85A 3MXWH 4Z5RA 2RR3A 4XO4A 3H9HA 3UJIL 4HG4K 3BDBA 3TJHC 4WFHD 4Y5XC 3L3OC 4LQ1A 4MD4B 4QXUH 3LKNA 3ARTA 1NMAH 4NLAA 3VXMD 4KY1L 2DEXX 5IJCC 4F24A 1DQDL 3VGDA 4RFEB 4OM1L 4HW6A 4X6DA 2D03H 1U91A 2FO4A 4TUUA 4P23A 4KXBA 1KPUA 3G5XB 3ULAB 3AQDA 4DQAA 5T5NG 1YQVL 3M7OA 4ODSL 5DYFA 4WI0A 3T8XB 1N6UA 3S36L 3PWVA 3DV6B 4HIJA 3PCYA 2DM4A 1BIIA 2F5BL 4W9KC 2AV1A 2VXUL 3C8KB 3QJHA 2CXGA 5E1QA 4HKBB 1HHKA 1QNZH 1SY6H 3KNBA 2I60H 4Q6IA 5I19L 1MIMH 3DECA 4EN3B 4G7YL 4HOZA 3VM7A 5AYQA 1RK7A 2DTMH 1MW2A 1OSZB 2EQDA 3D39B 3N9GH 4PRDA 4XCEA 2PWHA 2RB8A 1AACA 1OGAB 4LLQB 4LLWB 4LEOA 1OPGL 5AB2A 3WTWA 5I1IL 5IUCA 1SNRA 3WTXA 2EUZA 1K3IA 3FRUA 2HX7A 4WCYH 4NN5C 4ALAL 5FW6A 4PJCB 3ECVA 3QZLA 2Z4TA 3CK0L 1FC1A 3IDYC 1MCEA 4O9HL 2NOYA 1MHCA 4GP5B 3LXCA 2Y7LA 4Z3HA 2CCLA 2N7BA 3LCYA 4PFEA 3SKNA 3K7UA 3UGEA 2V5TA 3UBXI 4EVNB 3TO4C 1KYOK 3FO1A 5DJ2A 5BRZD 1HHJA 3VGFA 2Y1ZA 1D7BA 2J88L 1ZLWH 4GG8A 2QELA 5LWYH 3H85A 3S37L 3KAAA 3GSUA 3MLWL 1KTLA 1IM9D 5DJ0B 5HJDA 3KBHE 4K3DL 5L9DH 2NYKA 2X1OA 1E5BA 1GYWA 1JMXA 4HGWA 4Y2DB 4WW2B 4DKFH 2VZ3A 1U3ZA 2PUQT 4HUUA 1IGTA 5HGAA 5EO0A 4M7LL 4OZHA 3WO3B 4CMMA 3NBNA 3NCYP 1ZPUA 4Y9GA 1HKLL 4JHAH 5F9WC 3FXIC 3UTTB 1O0VA 4IS6B 4D7PA 2KUTA 4QTFA 3TTYA 3H3PL 2PR4L 3T0EE 3R06B 1G7LB 2JQZA 3O2DH 1A7NH 1RSFA 4P59L 5I1GL 4GAYA 4JVWA 3MOQA 3GPEA 4L29B 4KK5D 5E2VH 3MV7D 4HH9B 3FH7A 4P2QD 4DZ8B 3BE1L 1KBPA 1Z5YD 4KROC 5AW1B 4XVUC 4LU5H 1ZIBA 4JO2L 4ODXB 4JDTL 3UL4A 2ZCHH 1CC3A 2GSIB 1T7VA 1XH2A 4JDVA 4N2BA 5HHOA 5C0AB 4ZTPH 3WXVH 5T3ZD 4Z7VE 5BZDA 3QNXA 3V0VB 2FD6L 4MZRA 1M05A 3CSBA 3TPUA 2X2YA 3WHE0 4FQPA 1BFTA 2LOEA 2DIAA 2ALAA 3DIFB 3HI5L 3Q8AA 4K3GA 5CINH 2GJRA 5D7IE 4JN1L 3E3QE 1R3LB 5HVFB 2TRYA 1DR9A 4JZNA 3FDWA 1TU2A 1A9BB 4UTAL 1E3XA 5DEZA 3UTSA 1U2HA 1C16B 1E5AA 4NM4L 5AYUL 2K9FB 1HC1A 2J72A 3QQ3B 1BZQK 2NW2B 5DD1L 3C2SA 2VAJA 5INCB 5I1HH 3FH5A 1PLBA 1XEUA 4PWFA 4R84A 4TNEA 5AWNL 4RLDA 1FC2D 1DJYA 2UXTA 5ABDE 3EXLA 1OOAA 2ADGB 2P8PA 1ZA6B 4IK7A 2IANB 4PJGF 4QHLB 3WN5B 1J9RA 3ARFB 5D1QA 3D06A 4DGIH 1JRHL 4RAUA 3VJ6A 4S1QL 2NDFA 2R51A 5FF6A 1ZT7A 3C6LB 2VXVL 3QFGA 1NAMB 1P7QD 1SYVA 3GO1H 4WRLA 4L3ED 3U4EA 3VXUA 3ZE1E 1U2YA 4MNGE 4DKEL 4DO5A 1ZLDA 5AOLA 3CPLA 1MLBB 1SMDA 1X3DA 2BK8A 4L0YA 4TOYL 3H54A 2VDLB 3WY2A 1RFDL 3DDGA 3P02A 1IQWH 1AQ8A 1Y6MR 4P23C 3ZO0A 3FFCE 1S9YB 2J57A 3I9IA 3MREA 4LFHD 3HB3D 4YC2B 5F44A 4WY7H 5TDNB 4WFGE 3JWNE 4NQCE 5D5ME 4S1RH 1TVHB 2YAPA 1IL1A 1J5CA 5DK0A 1ADQA 4G6FB 1UM5L 4FFWC 4M4RB 4B9GA 2N0MA 4N0UE 4Q6IC 3L45A 3P9LB 2WTRA 4JHZA 5CEYA 2A4EA 1J0HA 1OD7A 3KYMB 2MCAA 5FWRA 2FJHB 4DN3L 2Z7UA 2V7HA 4MMZB 1DJGA 4IOSA 2VDNB 3WFEH 1ZS8B 4OIIL 4PJEA 4ATWA 2DF3A 2MEJB 3IGUA 4R5XA 3MLVH 4OZIA 3NDYE 4IGBB 1NFKA 4QXTB 3FU9A 2HT2D 3K71A 3NZ8B 4ZODA 3LRKA 4DTGH 3STBA 4F80A 4JHWH 3ARBB 1IFHL 4BKLB 4B9IA 3FQXA 4HWBL 5DURD 1NAKL 4J3TA 1M9WA 1AIFA 2CHDA 1UH2A 4CC0A 1KBWA 1AE6L 3M8OH 4XNZC 3HZMA 1S7UB 1XGQB 3P2BA 2NTFA 5DJAA 4M7KL 4Q2ZA 4NZFA 1WYJA 1YY8B 4KRNA 2Y7QB 3LX9A 2R69A 4ENEC 3BSZL 4YDKL 1PLGH 2X6BA 2DQDH 3KLSA 1AMXA 3CVHH 5MEOB 1A65A 2V2WB 3DVFA 1DFBL 1CVRA 1K8IB 1N5YL 1USQA 4I5BB 3DUSB 2DQHH 3VFGL 5KYUA 2GPZA 1LL1A 2HLEB 1AGEB 1UENA 3VA6A 5GS2D 1MQKL 5JPNB 4XNYL 1GA2A 2G0KA 2G5BB 4WTZA 4HHAB 4P2RA 4BCXA 1QFUL 3ESNA 3FFCA 4U1NB 3Q43A 4YXLH 3CFCL 5DJ8A 1L3NA 2X53A 4N6QA 3NSFA 3N1QC 1CR9L 1GGBL 2OCFD 4ZFOL 1PLCA 3NCJL 5A16A 4L8SA 4TN9A 4QNPF 3S0PA 2ZOKB 2J4WL 2BHYA 1XF5B 3U30C 2Y6SD 4RQQA 2E6PA 4M8UA 4MNHB 2CDFB 1ZGLA 1TSRA 4QRRE 2XUWA 4Q0XH 4M93B 3KJ6L 4LP4A 3ZMEA 3MJ9L 1HSAB 3NSCA 4TRPH 1WA2X 1UHVA 4CGUB 3PWPE 4KOBA 4XC1L 1TQUA 4PY7B 5D7JA 1PDKA 5DWUL 3L3JA 3T1FA 1BWWA 5F8QC 2YAHA 1RMFL 1EWHA 5FOBB 4KKCC 3QHZH 4OZHF 5D1QC 1KIUB 3KYOA 3PPSA 1LE9A 4JPIA 1RZ8B 5HYJA 1ORQB 1RUQL 2QMJA 2XNAB 3L3GB 4OV6F 4QHNA 3MLRH 4Z3GA 1LP9A 2Q2EB 1N0LA 1KCSL 4TLSA 4F9LA 1JPTH 3O4OB 1EGJA 4C54A 5J9PA 5IF0A 4WNQA 4AYFB 2WY3B 4FQIL 1UH3A 1XB8A 4KAQL 2A74B 5HTSA 4G9FA 4U6VL 4HKXA 2R1WB 4PWGA 4XPGL 3EDKA 2HYMA 5HDOA 4PJBE 3V0WH 5CJ5A 3MO1B 4EN3D 5I15L 1ACYH 3K2UL 2OL3B 1WZ1H 2R39A 4UZSA 2VC2H 3D39D 2W9LA 1TQBB 1EX0A 3V4PH 4WUKL 4K73A 3TURA 4M5ZH 1T2QL 1CGWA 4WJG3 4DP5X 4KNQA 3LZNA 1OGAD 5C0FB 2VRQA 1F4XL 3PG2A 3ZQXA 2XG5A 2XSKA 1N2RB 2EICA 5GGRA 5IHBA 3FONA 1OEZW 5FO9A 4AEHH 4F2ME 4YZWA 3BPOC 4PVNA 3DVNA 4TS6A 4NKQB 3O2VH 2APWA 2Z3FA 3FUEA 1DVFB 1ZPLA 2C9RA 2JF1A 3CN0A 3CN4A 2ZNXA 5DYOB 4N5UA 1FG2B 4JFSA 1RLWA 3IBOA 1OK8A 5IW6A 1ETZA 1QSVA 2XN0A 3D1MC 1X4YA 3DROB 2FE0A 1NGPH 2JH2A 4OUUB 3GDCA 3TF7C 1IE5A 4XGZB 3DHPA 5K59E 1K3ZA 3B8YA 4R26L 3KHOA 2X0WA 4PW3A 3O6LL 1LEKA 4Z7IA 5F89A 3BDXA 2FWLB 1NCDL 1TKWB 4Z7NB 1FORL 3GSQA 2CUHA 3VD2A 2WNKA 4JM4H 1JYNA 4Y2DD 3VGGA 1MRDL 2ZUSA 3N44B 2E9BA 4ODTH 1KGJA 4G1EB 1VF5C 3L16A 5TDOB 4KRLB 4NN7C 2LU7A 5EULV 3MU3A 2C9PA 3P4LA 3UTTD 4R2GB 4JJHA 4LPVA 1I9EA 3CFDA 1ML0A 3MMEA 4DPRA 1NFDA 4TLKA 5DJZB 1TPXB 5CJQH 4LBEB 3TT1H 4HWZA 1TTCA 4OZFA 3NEOA 4F8TA 3VD1A 4X5XA 1U30A 5E2UL 3HBZA 4HD9A 3L5IA 1YEIH 3B6SB 2XQYG 3CFKA 1IC1A 1H6TA 2HG0A 4D8PB 5T1JA 5LBSA 5LXGH 2VN3A 5E6SB 5C0AD 4U7KA 1XGUA 5JORB 5K39B 1G9EA 3DWTA 4JFFA 4PP1D 3VH8G 4QRPE 1QSEE 4FXKA 1P9MA 1I31A 4E68A 1GAFH 1LILA 5DJDB 5FDWB 2Y72A 1K8DB 1ZJAA 3P9MB 3GJFA 4PJEF 4KJWD 4OZIF 3DO3A 3ZUCA 3HNVH 2KH2B 5K33A 4YLQT 2YZ1A 4UT6H 4F2MA 1OY3B 1BBDH 2X9ZA 5F1SA 4Q4EA 2LU3A 1FCCA 3SYCA 4L8SC 2IPKB 2K9UA 5DJ6A 5C0BE 4HPHA 4GMTL 3LHPL 4X7EC 2ADJB 3EYSL 4L2YA 4HJGB 1T7XA 2XIIA 3RVWD 4AJ0A 2GG1A 3I3EA 4XI5D 2AQSA 2FJGA 4FZEL 1AGBA 1ZKAA 5HDLA 4HQQL 2JJUA 4HSAC 1TZHB 4ZW5A 4HDIB 3ARFD 5HPMA 2PNDA 5IFHH 4XMZA 2XWJB 1AG0A 2AGJH 1AQMA 1QBLH 2CNZA 4ZFFA 5EMYA 4O02A 3C6LD 1J5OH 4O5LL 5D7JC 5DGRA 1RU9H 1BGXH 3P3TA 3R7QA 4ZOEA 2Q7NA 3FQYA 4R5VA 3W39B 4N0FA 3HI1B 2EYRA 1ND0A 1EDQA 2BOCB 4UQ2A 5FKAA 4BSWB 4EZMA 3WFHA 1FNEB 3ASWA 5DEFB 2NNFA 4YUEH 1Z66A 4ZYKB 2BP0A 2OPCA 3SOBL 3DBXB 5HHMD 3KW7A 4LCYA 4JY6A 2L04A 2CBMA 4UTBL 1B0RA 1C5CH 1CE1H 3NJGA 4IBYA 2A9MH 4JZJA 4F9LC 1VZGA 2Y06H 1E9OA 1MRFH 4QUOA 4HK0B 1JWUA 2HWZH 3W2DH 4G6FD 4X98A 5GQBA 4L4JA 4OGZA 1VZHA 1U92A 3NIFB 3MJ8A 1CGVA 1S3KL 1JGUH 3CXFA 3IMUA 3KH3A 4H1LA 3FU6A 2FECI 3BDYH 4LNVA 3WFZA 3DA0A 1XTLA 1JNNL 1MI5B 5GZND 1VGKA 4NNYA 4BQ9A 4IGBD 4Z0BH 2B0SH 2BRRL 4Y1TA 2UVFA 1IGFH 3Q2NA 4LSPH 4WFFE 3WKML 2J6EA 1KEGL 4KTGA 2J20A 4WW1B 2ZG2A 3LMJH 2QSTA 3H3KA 1T2XA 4L8CB 3BAIA 1NBYB 3OL2A 3IXAA 4G7VH 4X99A 4Y4FB 2AKRA 3TEYA 5ILTH 4GAGL 1PSKH 3GQFA 2EADA 2EEDA 4KRPD 4KO7A 1WBZA 1L9PA 3MLSH 4Z0XA 1ORSB 1V8HA 2OMVB 1BAFL 3L3KA 4G6ML 1E65A 1QRKA 3L9RA 3N43B 5DI8A 2AJUH 3QUKA 3IRCA 4X4ZA 3CE1A 4PRHD 4KKAD 2OV0A 3OPZL 4HYTB 4BSVB 4NO0B 1OCCB 1WFJA 1VERA 2LLNA 3SDAA 4JFDB 4C83B 1DBJL 2IH9A 5E1AB 3G6AB 3QI9A 5KYWB 4MHHG 5F7FA 3IFPB 4M6NH 1LP9F 5J0BA 1ILSA 2KC0A 4KUZH 4XNXL 1QNIA 1GZPA 3DX8B 3WKNA 1BZDA 5DD5L 3UIYA 2IPUG 1BX2B 1DQTA 3KPLA 3W82A 1TVBB 3F6JA 3FCTB 3RNQA 4F91B 4HXAH 3L1OL 2F7QA 3ISYA 3D12B 4FMVA 2A9NH 3QSKB 4YHLH 3UJTL 4CL7A 4GQPH 2XV2A 4KNSA 1F1DA 4OZGA 4WI8A 3ZSTA 3HZKB 2PPAA 3IB4A 1UT9A 2FGZA 1AY1H 4P9MH 1NEZB 4XPBH 4GXUM 1GYVA 3DMMB 4EZJA 1IKNA 1DBBH 1XIWA 2OM5A 4NB7A 2Q7AA 3NJJA 4GLRI 1P9MC 2E6QA 3BVNA 3OKEB 1OM3L 1LGVA 5JMOC 1RL1A 5I6OA 1YPZE 3F7RA 1G87A 1IJ9A 1Z0MA 2AJVH 4WSJA 1AZNA 5FFGA 3R1GL 5D1ZD 3V7MA 1MWAL 3AQYA 4YIQA 5IFJA 4P3WA 4IRJB 4D94A 5CEZL 2RD0A 4OCSL 4AEIL 5I8CA 1IX2A 1TXKA 3MRBB 4CC1A 2K70A 5LAXA 4I0CC 1KJ3H 1F6AA 2NUPB 3MJ7B 4ISVB 2RFXA 4FYSA 4JUTA 3WO4C 4DP2X 3VI3B 4QHPA 1FH5H 1DO5A 1WIUA 1T22A 1ZHKA 5DK2A 4JPKL 5I28A 5I73B 5JR1H 2YKKA 1G7QB 2XG4B 2ZSWA 1HH6A 3GK8H 4H88L 4LEBA 4A2FA 1VZIA 3SE6A 5JZ7C 3U4BH 4MA8H 4DVRL 2YRZA 3MV8E 5HDQH 3ZR6A 2EINB 1B0GB 1BYPA 2BVPA 1AXSB 2HCZX 5D70H 3U2IA 1QLEB 5D1XB 5JHDE 1GGUA 1NFDF 1VIWA 2AABL 2P80A 2NY2C 4LCCB 4OLVL 4KV5E 1IGYB 2A9CA 1BVOA 1YYML 4MJIB 1ZVYA 3BRGC 1AHMA 1T20A 3K1DA 3UZEA 1HXMB 3IDJB 1T04B 4HZ1A 4OAWA 4TXVB 4YHOL 3ZDXB 3QO0A 4ZD3H 5E8NB 3VFTB 1JNHA 3WBDA 2M26A 5HVWA 3MRHB 4JZJC 3MA7A 2WXIA 3TCTA 4AGLA 5LLIC 2IG2H 3E6HA 4MMXA 4NQVB 4RISL 1J05A 3REWA 1UA6L 4NT6B 1T0OA 5DGQA 4BFEA 4YX2H 1LE5A 1CURA 4OLZH 2DQEH 2EDHA 5JUEL 3SDXA 1I8IA 3FB6B 3Q8BA 1HNFA 2R23B 3AROA 4MS8C 4B7LA 1JGDA 1I7TA 1DVFD 3IS1X 1W0WB 4OCNC 3GSRB 3DRTA 3BZFB 1Z3GL 1RJLB 1S7SA 3BZDA 5DD3H 1BOGA 2FQDA 3V52L 3VFMB 4JQIL 2AXFA 3ILDA 1QLEL 2CIKA 2WQSA 3M6DA 1II4E 5A6IA 1TITA 1J10A 5TQ0H 3WFBL 3CZNA 2EH7L 4P5MB 5FR3A 3Q9QA 3WU1A 2P26A 3S5ZA 1KEMH 2UXVA 4HWNA 1PW3A 3F7YA 4U3SA 3U46A 1ZMYA 1JDAA 4HK3N 3WLBA 4BFOA 3KPSA 3ES6B 4JY4A 5IMOA 5K59F 1H5BA 4KX7A 3OJMB 4H8WC 4MTMA 4NCC1 1J7VR 5D7KD 4FXLA 2VDOH 1B3JA 5C09A 3IJ9A 1QATA 2A6DB 1FSKB 3F7PC 4XMPL 3ILQD 4LVHB 3QRGL 5KANG 4R2GD 1RHHA 2ED6A 4H0LC 4KTDL 5E6IA 2EDNA 3D0VB 2BVOB 1E9QA 2OMZA 5AVWB 1PPIA 3MNDA 1YUHB 3W5MA 1CN4A 1E7VA 3SDAC 3MV8A 4QY8A 5DRWA 4ZS6D 3NT0A 3CDGB 5K9JH 3QI9C 3QG7L 2K7QA 1ACCA 1FVDB 2VW7A 3HMXL 3X12B 5FCUH 4AIZB 3S4SG 4HEMA 4OD2A 1Y6NR 3RDTD 3UG4A 2ZKHL 4JRXA 1JIBA 2XFXA 1E6OL 2BX5A 5AW2B 4B9KC 4MYPA 1B6DA 2Q7YB 3DO7A 3U7AA 1F4WL 4M48H 3RVTC 3O8XA 4NC1C 4ZFGL 2WCGA 8CGTA 4Y4HB 1J5IA 4PSPA 1FLTX 1IBFA 4ZDHA 3VDAA 4EF3A 5DFVC 1A6WL 1IC7L 3O4LA 2B9BA 2HKAA 4FA8A 2NUTA 2EVHA 2BSED 1RUPL 3VFPA 3CD4A 3JVFC 4K07A 2YPKA 5B7EA 1GC1L 4PJAA 5C7ZA 3FSZA 4QHMB 3C5JA 1IKNC 1XIWC 3IE9A 2DWYA 2R4RH 4UI2A 3FUDA 4EI5A 1M7XA 2R29L 3SD2A 1A1OA 3WUWG 2ZZUT 4UM8A 1IGML 3U4KA 2WXFA 4GRWB 4Z76B 2DQFA 4IU2B 4LKCA 3CFIC 1A02N 4Z7UB 4YHPA 3HG1A 3IU4L 5DR5L 5KZCD 3A6CL 3QW9A 4LDOB 3TA3B 2OQJB 5D4HA 2I27N 1RURH 5CGMA 3N85L 3A0OA 3F58L 3MUZ1 3MROB 3PWNB 4ELKB 1JZ7A 4RRPA 3Q9PA 4H20H 4M7JH 5FGRA 4H8UA 3GSVA 1CFSA 2E27L 1MFBH 2GK0B 4J3OD 1U8HA 5DUML 4U6XA 3MRFA 5CN1A 5T1LB 4P9HC 1OWWA 2CBQA 1NLDH 1EGJH 2FBRA 2GJZA 2UX7A 2HT4D 4DQOH 1AANA 4QR7A 1W8NA 4GRLA 4N4YB 1JPST 4U33A 3SY6A 4NX0A 2DPKA 1NCAL 4R7NA 1SLWA 4NKOA 2YPLB 4GO8A 3TXAA 1U9KA 2ODIA 1SJVA 4M1CD 4OCWL 2UVEA 3ME0B 4L2LA 1JGIA 5E2TH 4AH2A 7FABH 3DHUA 3V0HA 3NIDB 2XZAL 3Q6GL 1GIGL 3WTYA 5C0EA 3LIZL 1UA7A 4PJ5B 1U8KA 3DARA 1J8HB 2I7OA 4P46D 2APFA 3BD4A 3UZEC 4A66A 1QFOA 4FQ2H 4OZGF 3MRCA 3GXIA 3KZ8A 4K23L 5J8OA 3F85A 2HTKD 2L4OA 5AVZB 3EJZC 1MI5D 5EBLB 4MMXC 4JFYB 1JYWA 1JMZA 1EZUA 2NZIA 3NSYA 5FYJD 5GZOA 1QYGL 3FRPA 1MKFA 2YMXL 4N3UA 5C0IB 1KG0A 2P9RA 4XOEA 4U1MA 3MRMA 2GUOB 3Q6FA 3SDDB 1U8OB 4HIXH 1CFVL 3LAFA 3F65A 1FGNH 4Y4FD 3QPXL 3LYRA 5A2AA 1D5IH 5GGUA 5B8CB 4XP9H 5CEXA 2GSGA 4FS0A 5A2JH 1A3LL 1FO0B 1KPRA 1M2OA 2DAVA 2W8CA 4EOWH 5EF3A 3PHOB 3BMWA 2F5AH 3KLAA 4H0HB 1JGLH 3RWJA 1ZRUA 3ZPDA 3X1NA 3FMGL 1H5BC 2QGBA 4PVMA 1BQHG 1KV7A 4OZFH 3ROOA 3U1QA 5KWYC 1YJDC 1B6UA 4NO0D 1LK2A 1N18A 4JPQA 5D2NB 1M6UA 1CG9B 2ZX5A 2HRLA 2V3FA 1J5HA 4N1EA 5B4MC 3V0EA 3BWUC 2JKIS 5BV7B 2X87A 5E6IC 3P2DA 4IW4C 4U7MA 3V0IA 5IV2B 4MXVF 4QWWD 3GI9L 1U3HA 4TUKH 4KQ3L 3B2PA 2GJ6E 3P4OA 1KFAL 2AMGA 4KWUA 3MGTB 3GJFH 1RKRA 2ZSVB 3KCPA 1JV2B 2VSCA 3L4XA 3KR3H 4N2EA 1FL6A 4LPUA 1S7TA 3TIDB 3GBNH 2SODB 3SJVE 4L9LA 4DK6A 4NHUB 4UOW1 3ZZLA 3O8XC 4H0IA 5DO2D 5TF0A 1U8CB 3SDXF 5EEUA 3C09B 5ACZB 2P5PA 5E5MB 4GBXB 1I7ZA 5DLMH 1SYSB 2V2XA 2CMRL 4MD0A 4A2EA 1KTBA 4AG4H 1T7YA 1I3VA 1JV5A 3EDFA 3WYRA 4IRJD 1D6EA 2DJSA 3O3EB 1CE6B 25C8L 1WRFA 3L2NA 4EI5C 2VLLB 3IDIA 1JHKH 4O02H 5I26A 2XRAH 3M1OA 5I1DB 2ZPKL 2VABB 5ADPL 4L0ZA 1N6QL 2EIZB 3V5KA 4HU2A 1U33A 1I1YA 3ARXA 2H0EA 3H55A 3M1BA 3D9AH 1VJSA 4IDJH 3GMNA 2PO6A 2Z91B 2ESVA 4WI6A 1IAIM 1IQDA 4HUXA 2ZXDA 4DUWA 2WJ5A 3BWUF 1S8DB 3IPBA 4MAYD 4JZOA 3I9GH 1RK0B 1ZLVK 1LWHA 2UZIH 2EDYA 4FQXB 2BVEA 4JFVA 3VGAC 1B0WA 3PAZA 4Z7OF 1NFIA 2Z93A 3BGAA 2BNRB 4GRLC 4RMVA 2MKLC 1W9XA 5D7LE 3GXPA 5AEAA 2B5IB 2VJ8A 3JTSA 4MVBC 3EOAB 2XWZA 5AZUA 4H1LH 1Z1WA 5J6HA 4MX7B 1OOWA 4HIHB 5C0DB 2VDKH 4FQHA 3VRJA 5C7XL 5IWLA 4QXGL 4LL1A 1MCRA 3FQ4A 5EZPA 2EEXA 1J0ZA 4J7RA 2EDBA 2JNZA 1F00I 1R5WA 1U8MA 1NMCC 3ZK0A 3ZL4H 1C5BL 1KGIA 1KGXA 2WM0A 2GJ6A 3LSOB 1G6RL 3T0DA 1H19A 5GHWH 5F0JB 4OUOA 2P46B 1D7CA 3FT3A 1HFUA 1EXUB 5IB2B 4JL2A 4GQQA 1VEPA 3KYKL 1AO7A 3VW3L 4U1SA 2NYYD 2QPUA 3FO0H 1AIZA 2F54E 4G59C 4AMXA 2AQNA 5CM1A 4FG6C 2QKSA 1CK0H 1XMEB 2GFBA 2VDQB 1A64A 2UUDK 4PJAF 2NNAA 1HI6A 1O6SA 4H8WH 1JGEA 2KDGA 4L8BA 3IETB 1PZ2A 2DLFL 5GZOC 2IFFH 2Y5TB 4ILDA 4ODBD 1AFVH 4XOBA 5IFAH 3F7VA 1J1PH 4AV5A 4EN2A 3K4DA 4N68A 2AVFA 2W65B 2JCCA 1XR9B 1FVEA 1T1XB 3ZQ9A 4TL5A 1JZ8A 5J1SC 4JDEA 4FLSA 4XH2A 2MQ0A 4DKAA 2XXMB 3V0DA 3QJRB 2AJSH 2GI0A 2R15A 2Z8SA 1U8QB 2BZ7A 5B3NA 2VL5A 4X6BA 3FSOA 1ECYA 3WKQA 3ZE2E 1KELH 5KJRH 1JXJA 2IGFL 4OGAC 4B27A 5HI5D 3FYEB 2L3BA 3HKZA 7PCYA 4QRSB 4HVBA 2BSTB 4E41A 1Y18B 1D5MB 3VUAA 4G8IB 3Q8FA 2ZX7A 3B9KA 4ODVL 3O3BA 5EIIA 3HRZA 3LZPA 4RZKA 1UUNA 5FK9B 1ZVNA 4PLKD 1H0DA 3FU8A 4MXQD 3OLGA 3MXWL 5FDYA 2DD8H 2A73A 4M9OA 4DOHE 1KB5A 5TGBB 1G6VK 1W72B 4BH7A 5G4OA 1ID2A 3ENEA 4QXUL 1EHNA 4WFED 1NMAL 3MOBH 5GRZA 1IM3B 4ONFH 3RBSA 1GZHA 3QYCA 2DY2A 1FZJB 4MQTB 1MCDA 2D03L 4Y4HD 3ZTEA 4M43H 3KDPB 5B1JA 3GTVA 1OE3A 5I1LA 4YL4A 4ADIA 3H2WA 4I48A 4H26B 2A0LC 2BZCA 2OP4H 4ZOCA 4RBPK 1THAA 3UO8B 1CFQB 4PV8B 2C4FU 3LNDA 1OPOA 3MBWA 4L9LC 1X4XA 2LU5A 4EQ2A 3VI4A 4GLRH 3M17A 1QNZL 1SY6L 1HOCA 2C7UA 1RULH 2XVKA 3CC1A 2BNQB 2F54A 2I60L 1MIML 2JB6A 5E08H 4WO4A 2BIPA 1OK0A 3IGAB 3M45A 4P9HH 1PF3A 5E2WH 3RKPA 4KK6D 4WI4A 3E6FB 2DTML 5AVSB 3DJTA 4PV9A 4B7IA 1T0PB 3N9GL 3MRPA 3VG9B 2ITCA 4PH8A 4ZSOA 2YOAA 3LRMA 4N5EC 4G7RB 4S0SD 5IMKA 2B77A 5AUMB 4Y1AB 3R4DA 2WYIA 4CN6A 3GT6A 2ZOOA 4WCYL 4IOIA 5DS8A 3MJWA 5T1LD 3C5ZB 3FN0H 5ANHA 5L7XH 3TYFB 4OJEH 5GRYA 1FAIH 2F15A 1DN0A 4GW1A 2PO6C 2YPLD 4LLYA 4K5MA 4AUJA 4DPBX 4F7EB 5I1CH 3IMTA 4TYUA 5LWYL 1VFMA 1EJFA 1UVQA 1MIEH 3OAZH 4K94C 4F15C 4Z6AT 3UOAB 4X5PA 2P44B 2WCPA 5DU7A 5L9DL 1KULA 3CXDH 1P1VA 4DN4H 2XKSA 4DVBB 3SKJH 1M7DA 3SGDI 1IAOA 2G9HB 3TJEH 1B9KA 4X7CC 4PJ5D 4DKFL 2MOQA 3KPQA 3IF1A 3EZJB 1KGUA 5J3HD 3RI5F 3M86A 1XBRA 3BGFB 4JHAL 5IWLC 5DEGA 4HUWB 3ESPA 4U49A 2Y0SA 5AAPA 5G5DB 3MV01 4ZPTA 1RVFH 5I1JH 4AKPA 3E8UH 4KH9A 1M1SA 4HPYH 5D8JH 3S3SA 3L3IB 5DHDA 2BPBA 5J12B 1MCWM 3O2DL 1A7NL 1FZOA 2LAAA 2NR6D 5E2VL 5KYYB 4PLJC 4J3BA 2VITB 3FQUB 1MHEA 4X9YA 4LU5L 1SF3A 1NGYA 4U6YA 1JZ6A 2VLJE 3ZLQC 1ASOA 4DAGH 1EANA 1JZ2A 3SDDD 2ZCHL 3FAWA 4ZTPL 3WXVL 3TEWA 2D0HA 2ROYA 4DK3A 2X1PA 3UC0H 1X4ZA 2JJSA 1PEWA 2BCKB 3QWNA 5E6YA 2ZOLB 2GHZA 1UKQA 3GS7A 4X6CE 4YEEA 3G9VA 4R0LA 5MENE 3FTSA 5E95B 5ENWB 1A4AA 3ULUC 1G7MB 5CINL 2J8UB 4UQIM 3HR6A 3Q8EA 1L9NA 3KWTA 4WTZG 1EBPA 2IALA 1WA0X 4JFXA 4NN6C 3G5ZA 3ESVF 2ATKB 3IEAA 4PRID 3RUGB 3LV3A 4UAOC 5EH1A 1QSFD 5K93A 4QTHB 1KGCE 4HIIB 3G7TA 1SM3H 5I1HL 1HE7A 3QE5A 1AR1C 1A6VH 1UH4A 5DC9B 2QV4A 5AD0B 1NJ9A 3OR6A 4MA1B 5E8OA 3L5WB 4ABUA 1L9RA 4S11A 3B9KC 1QEWA 4FMKA 4DGIL 3HRZC 3II2A 2XWBA 1ZTXE 5JHLL 3QFDB 3GO1L 5T1DH 5I0YA 3T6QC 1A4JA 2JXMB 1NH6A 1EQWA 3HNTH 3P11H 4GQZA 3VYPA 4BQBA 3ETSA 3PDDA 2A1WH 3K2IA 4WEMB 3SGEH 3Q2CA 4EUPB 2N59A 2D7OA 3BH9A 5EZIH 1GZHC 1L6ZA 3IDGA 1IQWL 1QX1A 2CLZB 5CCKH 5K9KA 3W0WE 5B1JC 2Q6WA 3SZKC 1Z9SA 1YLBB 1LO5A 4WY7L 4WKZA 4QRBA 1U4FA 3U1SH 3H6JA 3FUFA 5I74B 2ZWNA 4S1RL 1EMTH 3BVXA 1ZWIB 4AT6B 1BW8A 1JL8A 2E8ZA 4Z23A 5J11C 5IBLC 4HS6A 3VXME 2WOBA 4H25B 1PJ9A 1V10A 4S1DC 2JCCF 1KJMA 2X9XA 3C5XA 2RIKA 4KMTH 4XWOC 3ULUF 4J3UA 4WO4C 3KPPB 2HJKB 3L9BA 1F8TH 5D93C 4NO3B 3NP3A 4Q97A 3WFEL 4HEPA 3T2NH 3RQ3A 3MLVL 3B56A 2QQQA 3AREA 5KYXA 4X6CA 5HGGS 5MENA 1RUAH 1GHFH 3FQNB 4X80H 1UZ6F 4J3VA 1L0YA 2YSTA 4DTGL 4JHWL 3RKDD 2FJFA 2GAZB 2I32A 3POCA 4TQ8A 2J6WA 2UV3A 4FQXD 3UFIA 5EU5B 1WWWX 5DRNB 5H94A 2J44A 4BE6A 4FX5A 1DDHB 4ZQKB 4RGMB 5ICYB 1GGIH 2BNRD 3MUGA 3M8OL 5I66A 4PS4H 3HE7A 4PJ8B 3GBMH 5IJDC 3A22A 3L4TA 5A2KH 2HLAA 2QR0A 4A7GA 5EU4A 2NDGA 2ZKWA 3IPEA 4FQJH 1UJTA 1PLGL 1MAMH 2DQDL 3CVHL 5E7FA 3ARSA 1LEIB 4FLRA 4XPHH 2WWMC 1HWGB 4PCTA 1KT2B 1P4UA 1WF5A 2JB5H 1NCWH 2DQHL 1KZYA 4R5TA 4C56D 3VU2A 5BRZE 3L3OB 2FO1A 4Y1SA 5TD4A 5CSGA 5D96C 4U0QB 3IKKA 4DPCX 4LSUH 3T0AA 4G8AC 4KQ4H 4A6YA 2WLKA 1BJ8A 3RVUD 2A6KA 3IJ8A 5C9KA 3FOMB 3FQTB 3SKMA 3VI4F 3W0WA 2NY1C 4TQHA 4YHYC 2Y36H 3VFUB 3OZKA 5CF3A 2B1OA 1WISA 4POUB 5DMIH 3OKNB 4XXDB 4YXLL 2BVQB 4BXSV 4KFZC 4IRSB 4FG0A 3N0AA 2QGEA 4L5FE 1W2KT 3N55A 2H0PA 3VXMA 1QAWA 2R2HB 3L2MA 3L3HA 1PX4A 2DQMA 4AGMA 4HC1H 2NXYD 4LSQH 4OZFG 4NRXB 2IC2A 5DXWA 2JJSC 4OFDA 3MCKB 2DLEA 3QZWA 5F7DA 3TX4A 5BO0D 3AMKA 1I7UA 5A2FA 4W9JC 4P2QE 2PW2B 1LHZA 3GIZH 3PQYB 5EN3A 4TQEH 2FIKB 1CJYA 5AW9B 4CVZA 1ONQB 2P24A 2D2CC 4NN5B 5KBMA 1TVDA 4U1GC 4Y2LA 4O2CB 4Q0XL 4YDVB 3B5HA 2MTAA 3SO5A 1KB3A 1CD1A 3B2VH 3IM1A 3T77B 4TRPL 1FJ1A 3L3DB 2J1ZA 5ICXB 3QIUA 1FNHA 3PAVA 3EJTA 3QEQB 3SCMD 1COBA 1F90H 4HJSA 4DKDC 1FL3B 1AYOA 5GSVB 2DKSA 3S5YA 3H7LA 2G2RB 3UG5A 4UINH 1O7DC 1SDAB 3UZQA 3W9DA 2Q3AA 4W81A 1MW3A 3QHZL 2OI9B 1NGZB 1OP3H 3KXFB 2TAAA 4HOWA 1YC8A 3PU7A 1VRSA 1W80A 2F7PA 3FU7B 1R4XA 3QJTB 2G4EA 4HUCA 2MNJB 3II3A 2VISB 3MLRL 4M1GH 2WXNA 1CYWA 4K8RC 5ITFB 3CZFA 4R83A 4NQQA 1JPTL 4DP8X 1OXYA 4OLEA 2N1TE 2RTTA 3QWOB 3ULVE 1Q9WA 2V8LA 1MAJA 4WSKA 5FGSA 2BNQD 3VXTB 3V0WL 3G3LA 1N5AA 2JK5A 1IM9A 5C0RH 1ACYL 1WZ1L 4KH2A 2VC2L 2DYPB 3VE0A 1VESA 2WB1A 3I9AA 3QCVH 3GJEB 4L3EE 4M5ZL 3V4PL 3UBHA 5SWQB 5A3ID 2R4SH 1JHTA 4U7SA 1FFNB 3ISRA 5DHVH 3TM6A 1LEGA 3WL9A 4Y1AD 4PHZA 2WWKT 4F8LA 4HJ1A 3C12A 2X1XR 4AEHL 2ZICA 4K94H 4AMWA 2CO6B 3ZKND 3O2VL 1HINH 2YA2A 3KPOB 1K9TA 2YAOA 3C5ZD 2CRZA 3PHQB 4ONHA 4YFDB 3X3FH 3L4ZA 3SZ6A 4I1RA 5ABAA 1N7MH 4LLMA 4B0MB 2NMSA 2NZ9D 2XN1A 3AREC 4W4NA 3VXRB 3RJQB 4F3FA 1NGPL 1YEWA 2PWGA 3MV7A 2Y4SA 3U6RA 1MFEH 1EERB 5CBEA 4P4RB 4H1LG 4PV1C 1DO6A 4Y16B 1OTUD 3QS2A 1ZLSH 3CCHB 4BFBD 4XNUH 4FQ1H 2AK1H 1KF9B 4ODWB 4WZ9A 5I75B 4JM4L 2JI1A 1JGVH 1SHSA 3HE7C 4JFED 3H2QA 1A7RH 4ODTL 1ZLEA 5J1TC 1HOEA 2F61A 1OP5H 4GAJH 2YOCA 1TG8A 4QEGA 3SE4A 1JF1A 1XGRA 4X50A 4YHIA 5B3SB 1CS6A 4J3WA 1OT4A 2XA3A 4JJ5A 4NLHA 5CR8A 1W0VB 2UZYB 2KYIA 3FO2B 4F33A 5CJQL 1DSFH 3TT1L 1NPUA 5JW4R 4JFTA 2BMKB 2Z4QB 2X4QB 4UM9A 4PVBA 5FECA 3ULUH 1ZVSA 1UM6H 1EJ6A 2RQEA 4LCWE 1YEIL 5JDSA 4XVSH 3IMWA 3BUPA 4NOFA 1ANUA 1MNUH 2ZXEB 5LXGL 5EO1B 4G1MA 5TDPA 4GP8B 3QAZB 4JO8A 3GFUA 1T03H 3B3IA 5F6HJ 3BP6A 4MSWA 3F7LA 4FJYA 2YD9A 3L4WA 5EN2A 1S6NA 2JSFA 1GAFL 1P7QA 2C1OB 3NSDA 1QR1B 4L3EA 3MKKA 3EW3B 3VMPA 4L3CB 1AJ7H 3IJEA 1OP9A 1VSCA 2JIXB 3V6FB 3ZDYF 3HNVL 5DQJB 1MFVA 3H9YA 4UT6L 4APQA 1BBDL 4M02A 3LKPB 1V54B 4F7KA 1AHWA 4ESKA 1E27B 5GSRB 3GSXB 2AI0H 4YBQD 1YN7A 4UNTA 3ZR5A 3QO1A 3QJXA 1JWSA 3UPRA 1KB5H 3M46A 5HYSA 1XF3B 1E5ZA 3NJXA 1EHAA 1I4FA 3V5HB 5HHPA 2X1WL 4BFJA 4YSSA 3GMLB 3UP6A 4A7GF 5IFHL 2BFGA 2WB7A 4WHTB 2CPCA 2AGJL 1QWNA 1QBLL 4QIRA 5IOKA 3QIUC 3I6GB 4KO5A 2WBKA 5HBBA 1J5OL 2GBVA 3X1BA 2BOBB 1RU9L 1BGXL 1N59A 3O6FB 3VO0A 1OE1A 1V05A 1UZGA 4WGVB 4XB3A 3GHBH 5LXVA 1WLHA 4PGJA 4HOMA 5C9JB 5DHXB 1YEDB 2JKTM 2P45B 3EJJX 5E99H 4YUEL 3BEWB 1L5GA 1ZSHA 2GI7A 3AWFA 4UQAA 3RX8A 4AQ1A 1I9IH 4XHQA 5C07E 1UADC 3CFEA 1I3RB 3O3DA 5L2JB 1C5CL 4ODHH 1CE1L 2V9TA 4AQEA 2A9ML 2BNUA 1LO2H 2Y06L 1MRFL 3VXQB 2ZWYA 2HWZL 2YPVA 4R97C 3W2DL 4AXWB 3UPAA 2W0FB 2OXHA 1HHGB 1YY9D 2R1YB 1VACA 1WC7B 4E42A 1JGUL 2M1KA 4DNLA 3DGDA 3T4YA 1TUPA 3BDYL 2L7QA 3AM8A 3S6CA 3V4VH 4G6AD 4O4YH 1ZHNA 3BN3B 3HZVB 5TJWK 3T65A 4Z0BL 2B0SL 2FUTA 3UO1H 3OC5A 4ZOAA 1IGFL 2XVGA 4LSPL 1A6ZB 4XO9A 3T6XA 3BQUB 3GD1C 3LMJL 3PGCA 4MS6A 3IDMB 4GW4A 4YDLC 4G7VL 2DEWX 2HMID 1A5FH 5ILTL 1PSKL 2YN3A 1IILE 4TNWF 4KK5C 3FT4B 4HJ0D 2F1BA 3RURA 3U30B 5AG8A 1AZZC 3OMNB 1TZ8A 3MLSL 2GC7C 2QVFB 3IMVA 4CILA 4EDWH 4WU5A 2F9BT 4ZOBA 2JKXA 3PNWB 5I0ZA 2R0LH 1RP9A 3TCXA 3WY4A 1EXHA 5D7HA 1IGCH 2H41A 2OMXB 3EHBB 3JT2A 3L1GA 2AJUL 4TL4A 5LG6A 5FYLH 5K9QG 3SPCA 3EGXB 3IBEA 5IR1A 5KSBE 1XGPA 3QXDA 4HKJB 4NO5B 3TWYA 4NWTH 1CXLA 3AGVA 4CDGC 2IWFA 5LGKA 3RWGA 1M7IB 3SE4C 5AKVA 2G5UA 4M6NL 1F1AA 4CNIA 2WZ6A 2YXFA 3BCDA 4L1SA 4KUZL 3U9UA 1MCWW 3ZRSA 1MG2C 4NQSA 4MXWH 2YWYA 3K8LA 3X17A 5L4MA 4PWKA 4HXAL 3LEXA 2VYRE 2A9NL 1XXFC 2EH8H 3N40F 3TIEB 4YHLL 2VN7A 4GQ9H 1ULVA 4IRSD 2Z0UA 3BKJH 3GS0A 1A6TB 1XL4A 4OT1H 3L54A 2DDQH 1AY1L 4P9ML 4MD4A 4XPBL 2B3IA 3CQPA 3N1FC 2NX5D 4RFEA 1VCAA 4H40A 5HI4D 3T0EB 1DBBL 1PZ5B 3X3GH 4WQOA 3V95A 3I6LD 3G5XA 4LMQE 3PQYD 3T8XA 2AJVL 1IGJB 3B9AA 3GHPA 4JVPA 3DV6A 4F57H 4DESA 5C0AE 3C8KA 4HKBA 3OZ9H 1AHWC 2O4EA 4Z7VB 1CTNA 5C2BH 3LXAA 4EN3A 1JZJA 4V1DD 1KJ3L 5KW9H 3T6VA 1OSZA 3D39A 3RRQA 1X7QB 1FH5L 2QBWA 4K8RH 4OI7A 3QEQD 4DCQA 1OGAA 4LLQA 4LLWA 5D7IB 3E8VA 5JR1L 4P2CG 3GK8L 3WFDH 2XXFA 2FLRT 4A2LA 1NIAA 4QYOB 3U4BL 4MA8L 3VQ2C 2HFTA 2AK4E 3KXFD 4PJCA 1PIFA 2YUVA 5HDQL 1HJCA 3EF4A 2WLZA 1I8MB 4N87A 4FEMA 5E9DD 5EBMB 5D70L 3VB8A 3DVIA 3LDBB 4EVNA 4EIZC 1T5WB 4C8XA 1ZV5A 1NC2B 2BC4B 4PJ7E 4IMKA 4FLOA 2HT2C 3LPPA 4RRPG 8FABB 3FCBA 2DM7A 4G72B 1J1XH 1AGFB 5DJ0A 4AQ1C 5EIQA 4ZD3L 1BREA 1A8JH 3K4ZA 5F9JB 2DYPD 2YUZA 3EADA 3ZL1A 1OIOA 4ES8A 2DMGA 4Y2DA 5FUOH 3ZKXB 1IBGH 1X9QA 3QQDB 4WW2A 3ZE1B 4A2HA 2IG2L 3PWLB 4MNGB 4I9XA 4A7TA 4YX2L 2WBWB 4MCYB 2BY1A 4OLZL 5AOKA 2DQEL 4YSDA 3VB9A 3UTOA 3UTTA 1G4RA 1IEBB 2K45A 4IS6A 1QW9A 5HHME 4QJ5B 3WDJA 1JRHI 2C9XA 3AM8C 3UX9B 3R06A 3P0VH 2YUWA 1G7LA 5K1NA 5DD3L 4NQCB 5D5MB 4LCUB 3CVDA 5CO1A 1RZ7H 1DQJB 2VM4A 4L29A 4DZ8A 4HH9A 3OLDA 2VSMB 5TQ0L 1Z0NA 1AZBA 5CJOH 2WXOA 5DUBB 1D2OA 2P49B 4N0UB 5LN4A 1KEML 4Y16D 4ODXA 3QR0A 1J48A 3IMRA 1TQVA 2KKQA 5EOTB 5KG9B 2GSIA 3NFSH 1FFOB 2DB8A 5C0AA 1BG9A 4URTB 4WNSA 1ZTXH 3FRPG 3LZLA 4C4BA 3MLTB 3N0PB 1JS4A 1LQBC 2VDOL 3OGCB 3DIFA 2ZKYA 1R3LA 1CTMA 5F3HB 4A6YH 3LB6D 3U1PA 1B2WH 5LNGA 3US0A 4ZS7H 1A9BA 5J13C 1C16A 4AYEC 3QQ3A 1I82A 3NCXA 4KNUA 2ENQA 4JKNA 1JK9B 3BFWA 3NOIA 2H4EA 2NW2A 1MW1A 2XBZA 5K9JL 5INCA 1O7SA 2Y6SC 5FCUL 3ZX1A 4XAKD 4ZMPA 1MELA 1G9NH 2CNYA 4V2CB 4D9RD 4Y0GA 2WLIB 3UACA 4E0RB 1OAZH 2R2EB 1ETB1 3OAYH 4HMDA 5BUGA 2ADGA 3WN5A 1ZA6A 4Z1PA 2IANA 1H6UA 4PRHE 4QHLA 3ARFA 3Q5TA 3TH3T 4M48L 3T6ZA 2JKLA 2ZONA 1JZFA 2BVUA 3OF6D 5I6XC 3B7TA 3C6LA 1B2YA 5DRXB 4FG4A 1NAMA 4BXVA 3Q5OA 1RJYB 2JIXD 1MLBA 3ECBB 3ZDZE 3EH4B 3ZBMA 4GOSA 4H5SB 5A6LA 2R4RL 1YZZA 1MFMA 3CVBA 3MRKB 1S9YA 5TDNA 1INQB 2ADFH 3OV6A 3RGVB 3MLXH 4B0MM 1C12B 2VJ0A 2QQKH 1TVHA 3UROR 4FMFA 3RWFB 2EEFA 4QAWA 2NQDA 1DJZA 4M4RA 1RURL 2ROXA 1L4IA 3BSZA 3P9LA 2P8MB 4EN3C 4H20L 4M7JL 5FO8B 3KYMA 2FJHA 3EF7A 1MFBL 4MMZA 2WQ8A 5GXBB 4NNPH 4W4OA 3FCGA 3O6FD 3M7FB 1ZS8A 4MAUH 2W9EH 2LAGB 1NLDL 1EGJL 4IGBA 5AW8B 4DQOL 4QXTA 4QRRB 2YMTA 3NZ8A 3ARBA 4BKLA 3PWPB 2VJXA 5E2TL 7FABL 2MHAB 2OSWA 1CLOH 3QRLA 3PV6B 1S7UA 1XGQA 4IMKC 1QKZH 2EP6A 4GS7C 1LWJA 1YY8A 2FT6A 2Y7QA 3E38A 5ID0A 4KI1A 3NQKA 4L5FH 3WNIA 4FQ2L 1YN6B 4GIAA 4BYHA 2WLYA 4M7ZC 3TYGH 2IGTA 3RVXD 3ZKMD 5AVQB 3TONA 1NGWB 1F2QA 5MEOA 4Y2DC 3LKRB 3NCEB 2V2WA 1CI3M 4WW2C 3X13B 2PW1B 1K8IA 4ETYA 1MWOA 3DUSA 4I5BA 2YLHA 3ZE0E 5FB8B 1M53A 2NQ3A 4TTDD 3FSVA 2C9VA 1AGEA 1X5IA 3BQUD 4A63A 1UCTA 4PJBB 4MDJB 4EI6B 2HVBA 2VMJA 1GY1A 2WLLB 4FP8H 5T3ZH 5JPNA 2G5BA 5JHLH 3KE0A 1F42A 1HHHB 3NN8B 4HHAA 3ZTCC 1H6FA 4HIXL 1FGNL 1D5IL 4YPGB 3GJFB 3JTTB 4XP9L 4U6TA 4U1NA 5DVPA 3E7JA 3CHSA 1HQRB 3IK2A 1WVZA 2MNUA 1U0QA 4HHGA 4EOWL 4M56A 2CKBB 1FYHB 2F5AL 3WXWH 3QARA 1JGLL 3EHBD 1SEBB 3PXLA 4YDMA 3R8QA 1PG7X 2OTUB 4PP1C 4XPFH 4HLZH 2Y7OA 3GM0A 3HNSH 4PJCF 3NJHA 1YEGH 6PCYA 3DV4B 4M6MH 2ZOKA 3MUUA 5JIKA 4JCLA 5EWIH 4F92B 1XF5A 4KJWC 4UQ3B 1UM4H 2WO4A 3CLEH 4MNHA 2CDFA 4FG2A 1XD1A 3II1A 1Z7JA 1RV6X 3QZNA 2B08A 4GKSA 2WN3A 4Y2NA 1HSAA 2FWSA 3D3VD 3HUJE 4TUKL 2JE8A 2NY2B 4PY7A 4PS8A 1HDMB 1RPUA 2V3EA 2ZOWA 3KR3L 4GUPB 4HAKA 5CJ8A 3RVWC 1GOGA 5AG9A 4XI5C 1N8OE 1JPFB 3ULSB 3WAKA 2HZHA 3D34A 4WW2F 4WUUB 5FOBA 4ZUWB 4YHZH 3GBNL 5DSCA 3WN5C 3ARFC 3T0ED 1KIUA 1WD8A 5EIIG 3WEMA 4QLWA 4M7LT 2C8NA 3VGHA 5DVMA 1RZ8A 2XWXA 4UCFA 1OWRM 3C6LC 2EXWD 3QA3B 1ORQA 4BCZA 1D7DA 8PAZA 3MNWB 4JGUA 3VGBA 5HPOA 5DLML 1GOHA 2XNAA 3L3GA 5EEWA 2AEPH 5D6DA 3UAJD 4OFKA 3ZZSA 1MDTA 3WN6A 4NIYE 4AG4L 3KYAA 4AYFA 2B16A 2A74A 2VDKB 2EDFA 2R1WA 1P5UB 4JBSA 1AS7A 3MO1A 4O02L 1JHKL 1VENA 2XRAL 2XV3A 4NNYB 2VXTH 4YC2C 2OL3A 4QRPB 1QSEB 4LAJH 5AOIA 4EMZA 4QHKI 4JAMA 3VMNA 1TLKA 2FHBA 1FDLH 1JNLH 3LD8B 4S2SB 3J7HA 5C0FA 4XODA 3RPIB 2J1WA 2NY4B 3MAWA 1N2RA 3LN5B 1JOIA 3D9AL 4IDJL 2E59A 4IJ3B 4X99B 3WJMB 1M1XB 4F37F 1DVFA 2E7BA 4MMZC 1CYXA 1Z3RA 4RMTA 4W4OC 5DYOA 3I9GL 1FG2A 2X6MA 2UZIL 5C0BB 2TRHA 1K4CA 4IGBC 1A14H 1OM9A 2YPVH 1NC2D 3DROA 1LLAA 1OCOB 4OUUA 1M6OB 3BYYA 4XGZA 5CJBA 3VNZA 1MG3C 2VMCA 4DEWA 1XB3A 4NDMB 2IBZY 2ODHA 2ZKXA 2RAMA 3EYQD 5DF0A 2VDKL 1HWWA 5PAZA 1TKWA 1S7VB 4A39A 1FNFA 4MCNA 3ZL4L 2X3AA 4QPEA 4OIFA 5M95B 4WI7A 4FTVB 1KYUA 2MH4A 4G1EA 4XXWA 2D3VA 5GHWL 5TDOA 3BT2H 1DP0A 1MJ8H 3BH8B 2DH3A 1F3JB 1LMIA 5GS2H 2E6JA 4G8FA 3MRQB 5JPMB 3FO0L 1JTPA 4EZKA 5F6IB 5A2IH 2B4CC 1CK0L 4KKAC 5KYNA 5DJZA 4FEIA 2PWDA 4NQCD 1WA1X 4LBEA 4H8WL 3NQIA 3KWVA 4G83A 1GJIA 2UWEE 1N67A 2IFFL 4N2MA 3RX9A 5IFAL 1AFVL 2CO7B 4BUGA 1J1PL 1PZAA 1VPOH 3NIFE 4BZYA 3B6SA 1E90A 3EFFB 3OKOB 4M3JA 2WVVB 4D8PA 3WTUA 1DVZA 2JELH 2O5NA 5K39A 5JORA 4HFWB 1UB5B 2OS7A 4MKMA 2H1PH 1RZIB 2AJSL 4BUHA 4P49A 5HGDB 3CBKB 5AKTA 5FYJE 3ZKSD 2IEPA 3WS3B 5DJDA 5FDWA 1K8DA 1KELL 1QUNB 3P9MA 5CFAA 5KJRL 3X1FA 2X0UA 4JG1H 1JXDA 2BSEA 3C87A 4DUXA 1TETH 2P3YA 5HJ3B 3WNPA 1WUZA 4ZFQA 3ZVVA 2IDQA 5T1KD 1GYAA 3UYPB 4YSOA 4A2GA 2IPKA 2P5WE 4B5EA 1G7IB 5LCVA 4WIQA 1J11A 3DOSB 2WUBH 2ADJA 4HJGA 5D1ZC 2DD8L 1A1MB 4HX1B 5F7NC 2XQYK 2B59B 5E2JA 2NY0B 1GSKA 2XFGB 1I53A 1TZHA 4J8RB 3RY5A 1ACXA 4HDIA 3MOBL 4ONFL 4NKDB 4ZZKA 2XWJA 1CDHA 3RTLA 5I16B 4M43L 4LF3B 2Y1AA 3ABKB 3TBTB 2XCMC 5EORH 4OSUH 1E5CA 3W39A 2EO7A 3HI1A 1I8LA 2GABA 2OP4L 2BOCA 4BSWA 3HG2A 4HSCX 1FNEA 1U8PB 5DEFA 2FAUA 4DP4X 1OSEA 4ZYKA 4OVUA 2KL6A 3MV9E 3N41B 5IQ7H 3ELQA 3DBXA 2VT0A 1RULL 2G3ZA 1MFNA 1MSPA 3E6HB 5CU9A 2BIQA 2W92A 3RGVD 1QG3A 3SKUD 5E08L 4P9HL 2X4UA 5E2WL 4I3GA 3HR5B 5D6DC 1SMOA 1PY9A 3O4OC 2X2UA 4E9VA 3WNNA 4HK0A 3NCWA 1PNDA 2A74C 4LIQE 3MLPA 2HAZA 1M3JA 1SLUA 2YBGA 5DS2A 2B1HH 3WI9A 3TESA 1TQBC 2Y24A 9CGTA 2IBZX 1YPZB 43CAB 4F8OA 2V5SA 1E4JA 1MI5A 3FN0L 1LMKA 1PX8A 1QACA 2QGCA 5L7XL 5KBPA 4KI5E 3CXHK 3LEYH 1FAIL 1IO4C 4NKIH 2MMXA 1T0MB 5I1CL 4WW1A 4QT5B 1OHZA 1DVFC 1MIEL 4PBWD 4L8CA 1NBYA 3MCLH 4HEPG 4YWGH 4P5RA 1ETJA 3CXDL 4Y4FA 4DN4L 4KKLD 3SKJL 2DQ6A 4XNQB 1BYNA 3RPKA 4ZW3A 3QDMB 1N64H 3TJEL 4MD5B 3TTSA 1NBVH 1WTGT 4L23A 4N8VB 1ORSA 4OKVB 4Y4KB 2OMVA 3B2UD 2FX7H 4HGKC 4OQTH 3S34H 3FUJA 1S4IA 3P69A 4TM9A 3FZUD 4ATTA 2CIIB 1QVOB 2QZQA 4MJ4A 4Z9KB 1RVFL 3CC5B 5I1JL 1UOWA 3E8UL 5D8JL 4HPYL 4BSVA 5JHDB 4NO0A 2AEIT 4HCFA 4GQRA 3BPNB 4JFDA 4XXWC 3WAJA 3VQLA 4NQTA 4ZAKB 5E1AA 3G6AA 5EEXA 5KYWA 1ZLWK 3ILQC 2WQRA 2COQA 3IFPA 4R2GC 4X8JB 2QVTA 4KO9A 3WDHA 4DPAX 3LKOB 4Y2OB 3ZDXE 3OB0H 1BWMA 3DX8A 1BQKA 4WK0B 5DZAA 4DAGL 1BX2A 1TVBA 4KDWA 1TPXC 3FCTA 1WFNA 4HXBH 4ZS6C 1OSPH 4MB4A 3UC0L 2C3HA 2W0LA 3TVMB 5J6SA 3C5JB 3HZKA 3RDTC 1I1FB 1SGKA 2OMUB 1NEZA 3V6OE 2FB4H 3DMMA 1UACH 4K7PY 1GRWA 3OKEA 3Q2WA 5DTFB 1LO0H 4X4XA 4IYKA 4UOJA 4ZMLA 2ARJB 4J4PD 4WVRA 3TJPA 1T4KB 1SM3L 2OYLA 1A6VL 4Y8DC 4IRJA 4OW6A 3IKCB 3NJLA 3QH3B 5D9SB 2XN2A 2IPUK 1T66D 2ZCZA 4XXCA 3MRBA 1A21A 4JREB 4KXZI 2CBOA 3L9EA 3QZWG 1Y6KR 2XXGA 2NUPA 3MJ7A 1NAMH 4ISVA 4J3XA 4C47A 3VI3A 5E6RB 4Z7NF 5SWZE 3IGFA 1T1WB 2E76C 5T1DL 4AVHA 4FULA 2C1PB 2VDLH 4LSSH 3HNTL 1MVUA 1OCWH 1G7QA 2XG4A 3GSNB 3P11L 4GFXA 3PRZA 4WUUD 3TBVB 5KVEH 2H47C 2A1WL 2VR7A 3KWXA 3FUNA 3L5JA 4K7FB 3RAJH 1GS8A 1L6XA 4R7VA 5EZIL 4Y19B 1XSOA 3BSHA 2MPAH 1OGSA 5CCKL 4J3OC 1B0GA 2E9GA 3T71A 3EYFB 1WITA 1AXSA 4OCYH 3GB7B 5D1XA 1DE4B 3QDGB 4UOW0 1QSZA 1FZMB 4LCCA 1G7PB 1XL6A 2HT4C 2NY6D 1IGYA 3L6FB 3SO3B 3U1SL 1EMTL 3QPQC 2XPGB 3DGCR 3GLAA 4MJIA 2NNXA 3TU6A 2G9KA 1HXMA 3CU7A 2X4SB 1FNLA 1T04A 3IDJA 4P5KB 4M1CC 4KMTL 3W57A 5E8NA 1DLFH 1QSED 2VDNH 4QRPD 5F71A 1BQSA 3VFTA 1F8TL 1ZV9A 1F4AA 3MRHA 1A4CA 4XMWA 3SQOH 4DGWC 3T2NL 3HPLB 4NQVA 5EEZA 1SXZA 2NY4D 4NT6A 3GKZA 2ZUQB 2F53E 4PJFE 2BXZA 1RUAL 2V9RA 3FB6A 3K46A 1GHFL 3BISA 2UZXB 1JI1A 1AZRA 2R23A 4X80L 1HAWA 1SEQH 1OE2A 1OF2B 3UAFA 3V6OA 2HTKC 3S88H 3KLHD 3BZFA 1RJLA 1CIDA 2EUVA 3RJDA 3VFMA 3ECQA 2K6WA 4XMKH 2CE6A 1GGIL 3RWEB 4PS4L 4X4MA 4JFUA 5B1BB 3GBML 1QFWM 5MI0B 1FL5A 4AGNA 4P5MA 4FA6A 3MRGB 3D4YA 2CUAA 2VNCA 2YKLH 3K6NA 1CBJA 2B4CH 5G4NA 3BUBA 4N85A 3MRDB 3ES6A 4FQJL 1QZ1A 4Y4FC 3MBEB 5EV7A 3ZJAA 1MAML 3A23A 5F7HA 2FJUB 4X7TB 4MA7H 2QPDB 4FTVD 4XPHL 5AZ2H 1FFQA 4C59B 2JB5L 4J3OF 1NCWL 3V7AG 3DX1A 2A6DA 3RX5A 1NEPA 2YPLE 2WSKA 2IPTH 3DJ9A 2WVSA 4RH4A 2KZBA 3T8MA 4HP5A 3QR1A 3I9PA 4I1NB 3LVEA 2EKJA 4HAGA 2W94A 4LSUL 4OF8A 3D0VA 2BVOA 1DVUA 2DN7A 4KQ4L 2R29A 3S35X 2OMNA 1YUHA 4ZUVB 1PYWB 1MZYA 2X88A 2YS4A 4D0DB 1XF2A 2Y2TA 2Y36L 3VRIB 4PJ5E 4ABVA 3CDGA 3T9WA 3NJMA 2BWIA 1B3IA 3EO0B 5DMIL 5CUSH 3UP1A 1FVDA 2EKSB 4K7PX 3X12A 1ASPA 4AIZA 1ZY9A 3HBPA 3IDXH 4WHDA 43C9B 2Q7YA 2D4DA 2OMTB 1Q9KB 2CUMA 3FS9A 3TBSB 4HC1L 3NABH 3NIFF 4LSQL 4HLZG 4Y4HA 2VUYA 3G6JE 3GZOA 3MACH 3VFSB 4JFPB 4ES9A 4WEBH 1URZA 3QIWB 3SBRA 1QTPA 3GIZL 4KX8A 4TQEL 1W16A 3P3SA 2X5PA 4QHMA 3S3CB 3DMMC 4UBDD 3VQ1C 5DO2C 2LLLA 2G3MA 3TNMB 1PFOA 1F4YH 3B2VL 1QI3A 1E2VA 4NQED 3D0LB 3E9TA 4QXVA 4Z76A 2AQQA 4IU2A 5DHVB 4Z7UA 5BVJB 1F90L 2NY0D 4IRJC 1CL7H 3TA3A 2OQJA 4XXCC 1TZIB 5L8KB 4UINL 3MROA 3PWNA 4ELKA 4FNRA 2YXWA 1G1OA 3LS4H 4GSRA 3T3ME 4QRAA 4FE9A 3SDYH 3MGOB 1L9QA 2GK0A 2V4LA 4LFHG 4PRIE 3OWRA 4A37A 1QSFE 2GCYB 3RP1A 3BGMB 1VFAB 2DLIA 2EDTA 5T1LA 5HYSG 1N70A 2A38A 3BKCH 4UNIA 5I73C 4M1GL 5CP7A 3DXAD 3KJ4B 3FFOA 2XOTA 3MUY1 1MCLA 2CSPA 3CFQA 2D9QB 2AEWA 2YPLA 2OL3H 1FE8H 4MAYC 3ME0A 4XCYB 4IBQA 5D1XC 5C0RL 2JLPA 2G60H 5GIRB 2JV6A 2VWEC 4LCCC 1SBBA 2CRMA 4O51B 2CU9A 3QCVL 3EGSB 2W5PA 4PJ5A 5JIHA 5KBDA 2R4SL 1CDCA 1J8HA 1V7NH 2J7LA 1I1AB 1I7RB 1T0NB 2FYYB 3SJVB 2AXWA 2VUKA 4OCMC 4PRAB 5PCYA 2ZX6A 4K94L 4MRCA 4FF9A 4YFLI 4MNQD 1HINL 5CGYD 3VSTA 2WGXA 4NRYA 3AG3B 5D6CB 1O5DT 1WQVT 3I85A 5EBLA 3X3FL 5IK3B 4EIGB 4JFYA 3GZPA 5D4JA 5TE7H 1NEUA 3D18B 4RZCB 1N7ML 1AMYA 1Q4NX 1JK8B 5DEJA 5EUOE 1O7VA 2NR6A 1TQWA 3COOA 4JDEB 4JMNA 1BCIA 4OJYA 1MFEL 5C0IA 3V6OC 4NJAH 1F18A 2IWKA 1NOAA 4A2DA 2GUOA 1MCSA 3P3YA 3SDDA 1NIFA 4NCC2 2B1AH 5AVTB 1U8OA 4XNUL 4FQ1L 1ZLSL 2AK1L 5B8CA 3K8MA 4PI2A 3D7PA 2FEJA 1JGVL 2WIIA 3QDMD 2O6CA 1RUKH 1FO0A 5AOMA 1A7RL 4Y4KD 3VI3F 4MA3B 1H3GA 3UAEA 2D73A 4L1DA 5GGSB 5A2LH 2V0AA 4GAJL 1GMIA 3TFKD 5C0JB 3V4UH 4LLUA 4P0DA 4RFNB 5DVLA 3L5HA 4CMHB 5CD5D 1VKXB 2FR4B 3SGJA 2DL2A 2YGVA 1KLGB 2BY0A 4OGXH 5JHDD 2JWYA 4AQ8C 1MREH 1DSFL 2BNRE 4PW9A 4E9XA 4LLVB 4AQAB 5D2NA 2X4PB 1ZJBA 4UIKH 5D7LB 4ZAKD 1CG9A 1FSKC 1YVLA 3ULUL 3T09A 4LVHC 1UM6L 5HI5C 4XVSL 5FYKD 1RI8A 4NC0B 5IV2A 1MNUL 2JTDA 1U8IB 4OI9A 5DZ9A 3T0XA 4JEGB 1A1NB 4FI6A 2DIJA 5EZLB 3ZDXF 3HVDA 1T03L 4CKVX 3MGTA 1UATA 3V6BR 2EYSB 2ZSVA 4PLKC 1JV2A 4MXQC 4C56E 3TVMD 1ASQA 1AJ7L 3TIDA 2KLTA 4BBWA 4KXCA 4NHUA 4BGDA 4N2LA 1C8PA 2X05A 2RALA 1U8CA 4NBZB 5D93B 4Y4HC 4YVUA 1KXQE 4R9HA 5LCVH 5ACZA 4AC4A 1I9JH 2JKNA 1DEDA 3KL3A 5E5MA 2AI0L 4GBXA 3HBGA 1SYSA 1RPKA 4YSRA 4OFIA 1KB5L 2HRGA 1XXDC 1UURA 1FNSH 3A6BH 1WBYB 3O3EA 5DS8B 1CE6A 3BW9B 5JQHC 3QJZA 4WJ5B 4K3EH 4X5LA 2VLLA 1L0PA 4J3OH 1IKFH 3NDZE 4RMRA 3QRFM 3D07A 4NP4H 4P5TB 5I1DA 1HXKA 4KK6C 1OB1B 3V4VB 2VABA 3ZE2B 2V3DA 3GNMH 2QQNH 4FI8A 3B2DC 1ACZA 2EIZA 2CQVA 1AP2B 3GHBL 4TMPA 2R27A 3ZHDA 3TA3C 1WWCA 1CFNB 4RMSA 2E75C 1G43A 4LL4A 4PGEB 5E99L 4Y19D 1RSYA 2Z91A 2BP3A 4JE0A 1FVCB 2VLKD 3CMOH 2FO8A 1IBBA 1X5XA 1S8DA 1ZXKA 1RK0A 2WZ5A 1I9IL 1OQXA 3QDGD 4FQXA 2BP8B 4ODHL 4W6WB 1XV8A 4X0NA 2EIEA 1VEOA 4Z77B 1M2VB 1HKFA 1R24B 2BNRA 5KOVC 4DOHB 1LO2L 2J55A 4K4KA 4AEFA 3EOAA 4AENB 4MX7A 4HIHA 5C0DA 3S3DB 1N68A 2CGZA 2PCFB 3ZIMA 1JNJA 2G30A 2GIYA 3JYCA 2N4IA 5CSZB 5E1HB 5CWSB 5FYJH 2YA1A 4CN4A 1S5HB 3V4VL 1RERA 3LSOA 1JZ5A 4O4YL 1NGYB 4X8XA 5AAMA 3GUTB 5J3HC 2MCG1 4TUJB 2NYZA 1EXUA 3UO1L 5IB2A 5ID1B 3CDCA 3FB7B 3SIKA 1NLBH 1V7MH 1AAJA 5J1AB 1H3XA 4OIBA 4GJTB 4HUMB 5M94B 1ZHLB 1HZLA 1G0YR 3IETA 1A5FL 3MRLB 2Y5TA 2NR6C 4H8VA 4QO1B 2HRHA 1A0QH 2W65A 3HG5A 4GRWF 4Y7MA 4AM0B 2XTJD 5GS0D 1XR9A 2YFNA 3B2MA 4EDWL 4P57B 4Z7UF 1IAIH 1YQ2A 2W59A 5GRJH 1T1XA 3SY0B 1KDJA 1UWGH 2L7EA 3DHMA 2R0LL 4UYQA 3SDDC 1IGCL 5L4JA 3MBED 5B8CC 3QORB 5FYLL 4FFYH 1ZT1B 3N06B 3ZHNA 1U8QA 4HSQA 3PJLA 2Z35B 4NWTL 1UWXH 5B7FA 4YSPA 5T3XE 3REVB 3PDOB 3WIIH 4QRSA 2BSTA 3GXFA 3SGJC 1Y18A 1D5MA 3WTTA 2XWBB 1KJ2B 2KMWA 2XDHA 3QXWA 4G8IA 4CU7A 4UMSA 4MXWL 2VN4A 1ET7A 1KB9K 4JFEE 5FK9A 3OXRB 4W9IC 2EH8L 1KYAA 3N5AA 5KUKA 3NIDF 4GQ9L 4AYGA 5BV7C 4NGHH 2DS4A 3BKJL 3MOAH 4OT1L 5TGBA 1W72A 2DDQL 3BI9X 3O3AB 4H7VA 3HPJB 1IM3A 3KGSA 4MCZB 4ZZFA 1FZJA 4OLUH 4E9QA 4FKKA 3SBQA 3X3GL 3CZGA 4PGCB 1UFGA 1R3HB 3E1ZA 4H26A 3QIWD 4LDEB 5FCSH 5JXAH 4LSTH 3B83A 4S0HA 5FS5A 1B0IA 4F57L 4GIPD 1CFQA 2X3CA 4PV8A 2FL5B 4BIKA 2VLJB 5KVDH 2WBJB 2CR6A 3NK3A 2JCWA 2UXFA 1QEXA 5F70A 3GXUB 2ZXWB 3UGUA 2Q86B 3C09C 3OZ9L 5AB1A 2BNQA 5C2BL 3UEQA 1RZPA 2A9BA 3IGAA 5KW9L 3J07A 3C08H 4YFLF 3E6FA 5CLTA 4K8RL 5CIPB 3WE1A 2B2XH 1V27A 4PS3A 4MHHI 3NEXA 5AUMA 4TQIA 2HT3D 4Y1AA 3WFDL 4YLBA 3BVWA 3NFNB 4P4KB 3APDA 5B3JF 5F7WC 3C5ZA 2NQCA 4N2HA 5TTRA 2ETWA 1PD0A 1H3UA 3TYFA 1ZA3B 4Z3TA 2C5DC 2XZQH 5AVYB 1FQ9C 4F7EA 3V2AR 2CXKA 3RKDC 3LNFA 1J1XL 2F19H 4EQ3A 4FQXC 5IJKA 1X5HA 2I26N 3D51A 4DVBA 5BRQA 3UBXB 5FUOL 3FB8B 2G9HA 1IBGL 3CX5J 4OGYH 4B60A 4JR9H 3D33A 1JFQH 2B5IC 1I1AD 3SJVD 3SHSA 2OA9A 4L8DB 4LOUD 1CF1A 1DHKA 2EZ0D 1CD9B 3ESUF 3H7BB 4HUWA 3MCG1 5EBWB 2RH0A 5G5DA 1F2XK 3I02B 4YZFE 2E86A 1HESA 5MERB 3P54A 3GRWH 3L3IA 3P0VL 2EE0A 2NCMA 4JLRB 5AAMC 1RZFH 1RZ7L 4ZNEA 5KYYA 4U1KB 1CBVH 2AMUA 2VITA 3FQUA 5CJOL 2D3NA 3EBAA 4N86A 2ZQKA 4AEEA 2AJ3B 4L1LA 3UCQA 1WBXA 2PR9A 3NFSL 4RWYH 2QHRH 3FH8A 1ODUA 4K5PA 3WIFB 1ZTXL 1OCRB 5JHLA 2BCKA 2W38A 2ZOLA 5INDB 1WE5A 2AFNA 3FBQA 4F20A 1EUUA 3NVQA 5ENWA 5E0FA 4NUPA 1G7MA 2B20A 2J8UA 1U8LB 4FN0A 5SX4H 2JKWA 5DMKB 3CSFA 3GSWB 4M4PA 1WSST 4A6YL 3VTMA 1B2WL 3S36X 4YL9A 4LE8A 5DJYA 4ZS7L 5B1AB 3P0GB 4GH7B 5E9AA 2ATKA 3AS1A 4XMUA 3RUGA 4QTHA 3WJJA 4TNGA 4HIIA 2K78A 3DYOA 4KXAA 3S35H 4AYSA 4PP2B 4HT1H 3WNMA 1G9NL 1DSYA 2HSIA 1T80A 5AD0A 2XV0A 5I23A 1E28B 1CICB 1OAZL 4GP4B 1J8RA 5FW8A 1YMME 3EOYG 2QQLH 1PQZB 4K7PH 3V0GA 2BOLA 2V5RA 4LAQH 4LKXB 4X8GA 3QFDA 1CGSH 5BRZB 2H3NB 4WEUD 1XGTB 2JXMA 5TK4A 3AACA 3W38A 4EUPA 3DLQR 1IM9B 5CKGA 4YLCA 2CLZA 5DD0H 4GRWH 1G4MA 2K1MA 2ADFL 1LEGB 4PGZA 4ZMOA 3MLXL 2QQKL 3K0WA 3OQ3B 5G4MA 4NM8H 4AV0A 5CGTA 1ZWIA 5ESVB 4AT6A 5I8KH 4WK4B 2WTOA 1JZDC 4H25A 4B50A 2NX5E 1SPDA 3KLLA 3DK0A 5IHLB 1BQLH 3VFNB 2Y07H 3KPPA 2HJKA 4P5TD 2W80C 4NO3A 3WEXB 3AU0A 2Z7ZA 3WNJA 4NNPL 4P2QB 1UOVA 4AYBA 4MAUL 2W9EL 3GHEH 4UQ9A