1LMKA

The structure of a bivalent diabody
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
238
Chain Sequence
VQLQQSGTELMKPGRSLKISCKTTGYIFSNYWIEWVKQRPGHGLEWIGKILPGGGSNTYNDKFKGKATFTADTSSNIAYMQLSSLTSEDSAVYYCARGEDYYAYWYVLDYWGQGTTVTVSSGGGGSDIELTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTSLHWYLKKPGQSPKLLIYKVSTRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-PHOSPHATIDYLINOSITOL SPECIFIC PHOSPHOLIPASE C DIABODY
publication title Crystal structure of a diabody, a bivalent antibody fragment.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 56
structure length 238
sequence length 238
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1994-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lmkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lmkA02
4XPGH 1MQKL 4MS8C 3H9YA 5ID0B 3RIAK 4I3RL 4FMKA 3P77A 1RZJH 4ZOCA 1UADC 4WWKC 3ZZ1A 4JKWA 3WFHA 1DDHA 3VFTA 2ESVB 2W9DH 4ORGB 4MNQE 2J4WL 2J88H 1G7IB 2F19H 3O2DH 4N1EA 4RZCB 4RWHA 1JPFA 5C09B 3PHOA 3MQIA 4XNMB 1K4CB 1UZ6E 1YYMH 3DMMB 4I18A 1YY8B 5ITBH 2FH8A 3U7WH 1YA5A 4OSUL 3CDYA 4ZTPH 3SGKA 1FZJB 2KZ1B 2PYEE 1KJ2B 3LS5L 5AYUH 2WINB 4P23D 5GRUL 1QO3B 5DD1H 3O6MH 2CKBL 4CKVX 2NR6D 5HVHB 3VXSA 4XP1L 4HAFA 4NZUH 3NIDF 3QQ4B 2DKUA 4OM1H 4PBWD 2E7BA 5DFWH 3KJ4B 5F70A 1GIGH 2YUWA 3DSNA 3P2TA 4C4KO 3ARGC 1GGCL 1MLBB 4OLVH 4EDXB 3E6FB 3BYTA 2FBJL 5DEGB 4LLVB 4JN2A 5CZVH 1A9BB 4XWGH 3G5XB 3TBSA 4H20L 4JQIH 4TOYH 4JVWA 5K9OA 1Z6JT 4POYA 3BD4A 3MA7B 4GW5A 3QUZA 5DWUL 5CUSL 3JUZA 5FCUL 2X4NA 4DK6A 2BOBB 3WFDL 4JRXA 4X6CE 1HHIA 4F3FA 2YD1A 5JPNB 2AS5M 4GW1B 5DRZB 5JW3L 1BLNB 4R26H 1RURH 2BERA 2ADIB 3KYOA 4FOMA 3W0WD 2IWGA 3IFPB 2EE3A 3MA9H 3QPXL 3QDMD 2GTWA 1IAKA 5ESVA 1G7QA 4NGHL 2H9GA 3EUUA 4NRYA 2DQGH 5FK9A 3INUL 3O41B 4IMKA 5GSVA 4LVOC 3S34H 4HJ0D 6FABL 4KTYA 1WWCA 5HHOA 3AMLA 2NW3A 1BP3B 3KPSB 1TZGL 2Z91B 3TWCL 4E42A 4KXZH 4XVSH 2E9IA 4E9LA 3N85L 5I1CL 5DJCB 3FN9A 1LK2A 4Z7NE 4DJMA 4PJ9D 3UCRA 4F7MA 5HI3D 5HGDA 2G75B 5F96L 4P2QE 4Z7QE 1DQLL 4MXWH 5HBBA 3GMOB 2MQCA 2C26A 2HT3C 4YXKH 4L9LB 1QRKA 4QCIA 5SX4H 1HH9A 3UXFA 2JJSA 3V5DA 5BQ7B 2FHBA 1T7ZA 4MNQD 1U8IB 1S9VB 3X3GL 4LCCB 3SQBA 1J10A 1OP3H 1ULVA 2EDBA 4OCYL 1I7ZA 2AEPH 4WJ5A 1LK3H 4QRTB 1LE5A 2PYED 4HIXH 1WWAX 4R7DA 2LQRA 2IQAA 1XF4A 3C6LB 2QADD 4M1GH 2V2TB 4HLZG 3TH2T 1N6VA 3MRHB 2D03L 2ZUQB 2X1PA 3BX7C 5FM4A 1T4KA 2FCBA 3O3DA 1EEZB 1EMTL 3WL9A 1FDLL 1SYVA 4NKOA 4FFYH 4PGCB 3QUYD 2DQTH 1BBDH 3L3DB 1JPTL 5IF0A 1INDH 3KPPB 4RMUA 4MB4A 3HPJB 3V2AR 1YYLH 3RA7H 2EEAA 4JPKL 4ZFZA 3WXWL 2P49B 5HHNB 2Y4SA 3RGVD 1GGUA 4NZRL 4EI5A 5GRVK 3K1KC 2WQRA 1A6UH 4PLNC 1OHQA 1TDQA 1WC7B 4JLRB 1XCQB 2MMXA 1ORSA 1LP9E 2H1PL 1ZTXL 4KKLD 4MQXD 1S8DB 3D39A 1UVQB 2Z4QA 4F80A 2QSVA 2QQNH 1RZJC 1S7VA 1T0MB 3HZMB 2B1HH 3DBXA 1CDUA 4LGPB 4QXUL 2Y07H 5TPWH 1VENA 3O8XD 4EUPH 4NRXB 4HT1L 1N0XH 5HGHB 3T1FB 3HLAA 4V2CB 4CU7A 3W5MA 3WS6A 4YPJA 5HDQH 4RX4D 5C0EB 2F5BL 1MPAH 4OCSL 1CQYA 2HRPH 4PRHA 1HKLH 2GEEA 3B9KD 1CDBA 4NWUL 5H94B 4JRYB 5EU4A 1JHTB 1MCPL 2BP3A 2VXVH 4JAMB 1KCUH 1FZKB 2ICCA 5KVEH 1YUHA 1KN4H 2OYPA 4B53A 5T1DH 4XCYB 1T1XB 4P2QD 4PS4H 2BNRB 5LAXA 3B2UD 3ZKSD 1HQ4A 3BAEL 3UBXI 5HHVH 5DMIH 4OGYH 5HHXH 3OR7B 4ONHA 4QRPA 3SCMB 3MLPA 2BNQB 4ODTH 4U0RC 4LIQE 2OTWA 1TQBC 1AGBB 3BKJH 4YK4B 4XNQB 2HJKA 5KANG 5GS0L 1KG0A 4LMQE 3SDXA 1W72A 4J6RH 1MHHB 3GRWH 3MGTA 1S7TA 3DWTA 4EI6B 3RY6A 5DJAA 5JPMB 4GRWB 4OUUA 4PLOB 4I4WB 4PGZA 5DZOA 2Y06H 2QQLL 1E4KC 4P2RE 4ZO9A 3AS0A 4DKDC 5HHME 1UYWH 2X4RB 2DRUA 4H0IA 4Y5XA 4GSDH 3GSNA 4RGNB 5E2VL 3OZ9H 4KVCL 3LQAH 4LKCA 5SWSD 2YMXL 3GKZA 3MV8E 4GKZA 1SYSA 3PV6A 1GGBL 1FYHB 4RFNB 3V8CA 5IVXE 3EDEA 5LQBH 3VXSD 1WT5A 2IAMD 3TO4D 3OKOB 2NXYB 5JORB 1NAKH 2D7MA 3CUPA 3JWOH 4MJIA 3EYUH 3G5ZB 3ALPA 2AJUH 5MHSE 4MNGE 4NN7C 3OGOE 4U6VL 3L3HA 5J9PB 1LO2H 2WBJC 4HUXB 1TETH 3VXUE 1UWEL 2VH5H 4HWEH 2P46B 3SDAD 4TUKL 1IM9A 3BRFA 4WUKL 4Y2DD 5D7IA 4JRXD 3ZL4L 1KJMB 4F15B 4YE4H 1OY3B 3OGCB 4J4PD 4XHJC 3PG2A 3FJTA 3VG0L 1JYXA 5D6DC 2VXQH 5DI8A 1Q0YL 1J1OL 4E41E 5JHDA 4X7CC 2F54B 4OCRH 3TVMB 2PN5A 4DFHA 2DLGA 5C0CA 5CJ5A 2DQCL 4OZIB 1T7XA 3BT2H 3DGCR 2FX7H 4D9LH 5BOPA 1MRDH 4R3SB 3IU4L 2XTJE 3FZUC 1CVSC 3ABZA 2FX8H 3MLZL 1EH9A 5HHOD 1ZA6B 4R97B 4GS7B 4ZAKD 4KPHH 5EC1A 1LEKB 1YEIL 2HLAB 3UX9B 4H8WH 1IGML 4I0PA 2ICWB 5F7DA 1AC6A 5ANME 3R8BB 1N4XH 2XG5A 1A0QL 1UJ3C 4L4TE 2IH1B 5EBWA 5JR1H 5F6HI 2DD8L 4M6ML 4P99A 2P45B 4JM2C 2XA8H 1CE6B 4I3SH 4FQXC 4LPUA 3IFLH 4JHWL 1U8PB 5FECA 2AXFA 1MVUB 5D7SH 5T5NG 4OZIF 3WKML 4FTVA 1TCMA 1G9NH 1N6QL 4AH2A 5MP6L 4ZOEA 4JCLA 1JYNA 2WUCH 1WWBX 3VFUA 3IF1B 5HGAA 5F7KC 4DUWA 4S10A 5HHMD 2IC2A 3MLUL 3ZE1E 5CLWA 2BY1A 4LAJH 3RZCC 1GSMA 2NX5B 4MA3A 1SM3L 3U4EB 3X3FL 2CH8A 3O11B 3I6LE 1FO0L 1GHFH 4RQQB 3PJSA 3MV8D 2B2XH 2LAGB 1ZLVH 5D7JA 1UACH 4Z7UB 5D72H 4G7YH 1HE7A 4O4YL 2PTUA 3P4NB 4OKVA 3VFVB 3DUSA 3UAJD 3EO0A 4Q58C 4L3EA 1QBML 1P7HL 4JHAH 3RWEB 5MHSD 5F3BA 1RFDH 1H5BA 2AV7B 4PTTB 4F37K 5E24E 3F7QA 1HINL 1MAKA 1D5MB 1VGEH 5A2FA 2UZIL 4YO0A 3TFKC 1WCBB 2UWEE 4XC1L 4MJ5B 5FYLL 1IL1A 1GZQA 3RHWF 2CDFB 4IRSA 1N3NB 3VXUD 5I1JH 1MI5E 5FB8B 1UEMA 3HAEH 3HI1B 4RWYL 2IQ9L 1KPUB 3OAUH 5BVPL 4R96A 2W0FB 3A0OA 1C5DA 3DV6A 5E8EA 2EIZA 2B7DT 5D93B 1CN4A 3PE9A 2C1PA 4PTUA 1VDGA 2BSED 5JUEL 4JZJC 4HDIA 4HC1H 4JFFA 2NY0D 1CLZL 4XP4H 5DHYB 1AO7E 3HG1E 3O4OB 3O4LE 5EZIH 1OPGL 1AXSB 3UC0L 4L8SB 3SY0A 5IFHL 4U2ZA 5SWZB 5T1LD 3ARRA 1IKNC 1VCAA 5DJXB 5H37H 4PJHE 1DP0A 2XTJD 4YXLL 3MRDA 4X4YB 3WSQL 1AGEA 4JO2L 5C8JA 1JHLL 1EHXA 3C09C 2R2CA 2VXUL 3KXFB 1JI2A 4X5LA 1LDPL 3LQAC 3CSBA 4GKSA 4XAWH 5BZDB 3S96A 4QHNA 2V2XB 4WHYH 3O3AB 5ECJE 4HJGA 3QO0B 3LN5B 4L4TD 4MQSB 5B8CB 2ADGA 3JWOC 5CJXC 2CO6B 3LN4A 4XPHH 5INCA 1VFAB 3HNVH 2FIKB 4TULL 4WW2F 3ESUF 5E2WL 3ZE2E 3DUHA 1QSFA 1NCCL 1FH5L 3EO1B 3O0RL 3RI5K 1WV7T 4PJ7B 2EC8A 5EPMB 1LO4L 4JG1H 1FCCA 1NAMA 4ZNEE 3BQUB 3JTTA 1P1ZB 1CWVA 3I6LD 5C0JA 2ARJB 1QHOA 2DJUA 2FEDC 4NO3B 2XN9E 3MGOA 1Z9LA 1IGYB 3C60A 1L9NA 1E6OL 1LO0L 1T3FB 1D5ZA 3TC9A 3UBXA 1VEOA 1WZLA 2VDMH 4KK5D 1ND0A 4W6WB 1Z9OA 4TRPH 3D69B 4PJXB 4QWWD 2VDKH 5IMOB 3RIFK 3GZKA 3V79C 4UQ2B 4OZGA 3TIEA 1S7SB 2NZIA 3UTQA 3O6FC 3L95A 5J1SC 4B0MM 3IJHA 3X11B 1OP5K 3RPKA 3PWPE 2AK4A 4HUVA 4PJFA 3TJHC 1MI5D 2LVCA 5FA3B 3W9EA 4LRNL 2R1WA 4NWTH 4H8WC 1FGVL 4UBDC 1UWXK 5I8OL 1YDPB 4Y4FB 2YKLH 4WTZA 4PJAF 2NY2C 4NKDA 1TVDA 4N5ED 5F1OB 3AAZA 1BAFL 5KVMC 3GIZL 4YZFF 1G9ML 4S1SL 4LCYA 1U8QA 5DVNA 3ZHDA 4B5EA 1G9NC 3HC0B 1I3GH 3HG1D 3LDBC 4Q9CA 1IM9D 1F4HA 1NBYB 3O4LD 4X9BA 3D18A 1A14H 1QFWI 3STLB 1KTKE 3WLBB 3WNLA 1S9WB 1CFBA 1MHPL 3QNYB 2IANA 2R1XA 4KTDL 4YDKH 2PNDA 3GMPB 1KJVA 4FABH 1PGRB 4M62H 4X99B 3QUMH 5FIEA 3CFKB 1DZBA 4UUJB 5T1MB 3RWDA 1HNFA 3T3PF 5CP3A 1I3UA 4U1MA 5C0CD 4DK3A 3W39B 1CVRA 4R90L 4K3EH 3S5LG 3MPCA 2XOTA 5DUML 3QNZA 5IEHB 2DJ4A 2XFXB 4LCUA 5CJBA 3PP4H 5JQ6H 2I9TA 1FYTB 1N64H 4JZOB 1MCOL 3OF6D 3JWNC 4N8PA 5BW7A 2BHYA 2HKFL 4NIKB 5BS0E 3FFCB 3D87B 3MUGA 3FQNB 2G60H 4IIQA 4X98A 5KSBE 1KB5A 4YUEH 4GRLD 5TFSH 4FQQA 1OAXL 4PJCB 2XN9D 1UZ8B 3IXTB 4QRSA 4LL9A 4YEEA 4WO4A 1G7JB 2PYFB 4JANA 4R4BB 5DK2A 3DRTB 1NPUA 3M07A 2P48B 1YC7A 3FRUA 1A2YB 4S2SB 4GW4B 2RCSH 4NQSB 1LE9B 4OF0A 5E9DB 5IW3A 4HIEB 3PWPD 1JYWA 1BOYA 4F9LC 3HZVA 4PG9B 5E7BA 4UIMA 2F74B 1MEXL 1UM5L 5D7JD 4U1KB 2R2HB 4YDLC 3X12B 1U8KB 2VUYA 2VLRA 1INQB 4O9HL 1V7ML 1TIUA 2C1OA 2ILLA 5EO0A 3BPNB 1JRHI 1QZ1A 3QDJA 4OGXH 5JZ7C 4N0UB 5F7YC 3IB4A 1WLHA 1S7WA 3QQNA 4Y19E 3UDWA 3V0AC 5K33A 5A2KH 1RAMA 1T66D 2VLJA 4QOKA 3PL6C 3KPRE 4J3SA 3N1GC 3CCHA 4LCWB 1CK0H 5CINL 1F6AB 3J7HA 1AKJD 4GO6B 2H32H 2XQYG 1T5WB 4AEIH 3WIIL 3E3QE 2Q8BL 1NEZA 3H3PH 1EO8H 1K4DA 1V7NH 5GZNC 4PV9B 3FAXA 1PBYA 2YUZA 3CC5A 1M7IA 4Y5VB 5C71A 1CR9L 4U6HA 3JV4B 3OKKA 4JFFD 1NLBH 5HPOA 4CVXA 4HWNA 3SO3B 5JOFB 5IHLB 5ISZA 2HTKD 4XTRD 3LKRB 2GT9A 3GB7A 1BQHG 2P8MB 4M7KH 4JB9H 1SJHA 1UM6L 3O6LH 5C3TA 1T21B 3L5WA 4WI7A 4CRPA 3AUVA 1BF2A 5I9QB 4G9DB 2C3GA 2P5WA 3H7BA 1FNAA 3QDGE 5KSVA 1KNOA 1PX3A 2X44D 4A6YL 3QJFB 5HDBF 4XMPH 5BS0D 4PR5A 3RWCB 1J8HA 2R0ZL 4MD4A 4X6BB 5B22A 5DD5L 5DEZA 3MREA 3GMNA 4NQXB 3UTOA 2EDWA 2JB6B 4EJ1C 3TN0B 3SDCD 3FQXA 1ROWA 4NZTH 1QSFD 5L2KA 4GBXB 1B6DA 4QRRB 4GQPH 4RMTA 1RZGA 3B3IB 2HT2C 3BZ4B 1L0QA 4E5XA 4U0QB 1JFQL 5JHLL 5F9OH 2CUHA 1FNEB 4N5UA 5IR1B 2YD5A 1JZ3A 1CGVA 3I6GB 4C83B 3RWIB 5JIKA 3QEUA 1TJGL 4L8CA 2EECA 3IDJB 4XI5C 2K7QA 2DN7A 4IMLB 1U2HA 3SE9H 2AABH 1SEQH 2HVJB 3VFSB 3LHPL 1I8MA 2CSPA 5C86A 4M48L 3BEVB 1GGYA 1YECL 3CXHJ 2KUTA 2FEEL 3HR6A 3ARWA 5E03A 5C6TH 3EFDH 1CFNA 3FONA 1EIBA 1YY9C 4EN3C 1XGUB 4BYHA 5DUBB 3NA9L 3DX7A 3SE4C 1CF8H 3BGMA 3QZWG 5HPMA 4PRAA 3SGJA 5GS1B 4KK6D 1MCRA 2F53A 4ONGL 3KPMA 5DC4B 5LJYH 3QXDB 1MH5B 2VC2H 2VLME 3LKPA 1BIHA 4YHNB 2NLJB 3MV7E 3KYKH 1S7RA 3R1GL 4P4KD 4JM4H 2NTFB 3FO2B 3C08H 5TDNB 4J8RA 3VD3A 3LS4L 3QULB 3TBTB 3QEGH 1MIMH 3VJ6B 1DBAH 4LVHC 4WDIB 1B0RA 5E8NA 2AJSL 4X6DE 3RFZC 4PJDF 1IGTA 3LSOA 2VDRL 2VR9A 3RVWD 4WEUD 3BVNA 5T3ZL 3R0MA 3QQ9D 1HIML 3S7GA 1TJHL 3V0WH 1XR9B 3L3JA 2IBBA 3FO9A 2VIRA 1DQJA 5I1AB 1EZVY 1I7TB 5A3IC 3NBNA 2NY1B 2R9HD 3ZDYE 2PO6B 1CXIA 1DLFH 3QDGD 3TYFB 5BO1H 4GMSH 3U83A 3W81A 2X4UA 4NPYB 2MCG1 3ARFD 3GBLA 3T0EC 2YD2A 1RUKL 4KV5E 3SGDH 1A4JA 4G6MH 2ICEA 3C5JA 1B88A 4D0BB 1EHNA 4HXBL 1U91A 4UIKH 5GGSY 1KEML 5DT1L 5DQJB 1KELH 1INEH 1AY1H 4HV8A 5C08B 3C6SA 3RHWK 4HS3B 3L3IA 4D2NA 1JGLH 2W07A 4P3CL 5DSCB 3E8UL 2RR3A 5GSRB 3L1OH 1A3LH 4MVBD 4OCXL 1K6QH 3TO2A 2CGRL 4ELME 5HYFA 3EYFA 1AD9A 3DXAA 4ZUVA 4HW6A 3CVHL 3L3KA 3SJVA 5GGRA 4LARH 1RUPL 1YQVH 3DO7B 2A73A 3ULUC 2J6EL 1HSAA 3SHSA 5HI5C 1HZHL 3N0PB 4LU5H 4HS8H 1FNFA 3LY6A 4MX7A 3KVQA 2HN7B 2VNCA 2R1YA 1MCIA 2CQVA 4ZDHB 3WFCH 4M4RA 2BRRH 3DPBA 4OLEA 3MBEC 2X4TA 5D2LB 4RIRA 5GRWA 5DLML 2EE2A 5LWYL 2MJWA 1YMMB 2GUOB 3QIWB 2YXFA 2BVUA 1JGVH 5A2LH 1RSFA 2VAJA 1UB5A 1UB6A 3WUWA 2F5AL 4HLZH 1I9IH 2VLMD 3DUUA 5I30L 2DI7A 2VLRD 4M7JL 5BMFL 3NAAL 5CCKH 2FO1A 3TA3B 4WHTB 2FGWH 4XP9H 1FJ1A 3KAAA 3T09A 1T1YA 3VWJC 3HPLB 4MD5A 3LV3A 5F1NA 1UA6H 2I5YH 4DGYH 3X13A 2EE6A 2VLJD 4LOUC 3C5SB 2Z93B 4ZPVB 3ECBB 1GPOL 1LDSA 1XF1A 4P3WA 1SBSL 1KXQE 5BVJB 1HI6B 3L5JA 1J0HA 1I9RL 2I07A 2BHZA 3OL2A 5C0FA 2BDNH 4KQ3L 5C0NC 1XIWA 2CIIB 3MNZA 5F9AC 3VFNB 3LEXB 1DUYB 4FQ1H 4HFUL 5ID0A 4JJ5B 4H1LG 3VXOB 2Z0BA 1VPOL 2ENSA 2XRAL 2NY3C 1IAMA 2ESVA 1JGUH 3H3KA 4YC2B 4ORGA 4W4OC 4LPTA 3IETB 4V1DB 2ZUSA 1G7IA 5I18H 3VG9B 5DD0L 4C59B 1C1EL 4RZCA 4KHXL 5C09A 3QI9D 1ADQA 4FFWD 3CLFL 4XNMA 2IPUG 1K4CA 3DMMA 1QBLL 1YY8A 1V3JA 4U1IB 2OP4L 4S1DD 3DYPA 1FZJA 1JPGB 1KJ2A 2WINA 5IROA 1QO3A 3O3BB 3QSKB 2XA3A 4UOW1 1X5AA 3PQYE 2ED7A 2UV3A 5KSAB 1J8HD 1P4BH 1TMCB 5CEZL 4KHTL 4P5TB 4Z9KB 1A6VH 3AU1B 3QQ4A 3HC4L 4IOIA 4KROD 4FG6C 3CFDB 2IFFL 1MOEA 1S9YB 4RBPK 4Z0XB 5EOCL 3GSXB 3EOTL 3OJMB 4NFBA 3UROR 4HWZB 1MLBA 3E6FA 3ZDZF 5DEGA 4LLVA 4P23C 1KIPB 1A9BA 1X3DA 3G5XA 5B3JF 2OZ4A 2NR6C 3OB8A 3HB3D 4DTGL 1NGYB 3MA7A 5IVZB 1BX2B 4YGAB 3QHZL 1WFUA 4FZ8H 2BNUB 5EBMB 2BOBA 2DWDB 3WIHA 1NBZB 1U8OB 2F58H 4Y1AE 2NQCA 5DK3A 5JPNA 1DUZB 3V6FB 4XB8A 2ICWI 5E4EC 2ZPKL 4GW1A 5DRZA 1BLNA 1WBYB 2ADIA 1JZ5A 1MFCL 3ARDD 4I13B 3U9PH 1OLLA 5I16B 4PRPE 3MJ9H 4YWGL 4XP6H 3MV01 2MWCA 1A7OL 4QNPF 1UCBL 1ZMYA 2ATKB 1Y18B 3EW3B 5FUZH 5L88H 3H2WA 4QXGL 2ZSWB 3O41A 4AT6B 4M7ZB 4OFDA 1IJ9A 1XCTB 2F53D 3U7AA 2FD6H 3NACH 1OGAB 3KPSA 3QPQD 2Z91A 1CLYH 2AJXL 3LKSB 4K9EL 1G1YA 2JCCE 2ZJSL 4UB0H 5DJCA 2EH8H 4MZ2A 5GGTL 2UYLB 4DKEH 1EAJA 5EO1B 4NHCH 2G75A 4YHYB 2R4SL 5BV7H 3GMOA 2SEBB 3MYZA 4HJ0C 4UU9B 1WAAA 3CVHB 3QRGL 3U7YL 1LO5B 4L9LA 5BQ7A 1U8IA 1S9VA 5C9KA 1J9CT 4LCCA 1XEDA 2YZ8A 1X5IA 2CLVB 3QEHB 1EJ6A 4PJ9C 4QRTA 5HI3C 5T1KB 4XNYL 3MV9E 1PKQE 2W9EH 3NIDE 3IAGC 3MXWL 4F58L 5AAMA 4MNHB 3UPCA 5ALBH 1F13A 4GKNB 4FRWA 1KC5L 4D94A 1WZ1H 1K5NB 4NJAH 5D96C 2VDLL 1RJYB 3MRHA 3GJFB 1U36A 5C0BB 4JPWL 2X2YA 1DN0B 4P49A 1EEZA 4PB0H 2XXMB 3GSOB 2G9HA 3UYPA 3GSWA 2YPVL 4PGCA 1F4YL 4HCRA 1KN2H 1S9XB 3NGBB 4F9PC 3L3DA 2GJ6B 4K23H 3G08B 3KPPA 1BVLB 2WIIB 1NLDL 3OAZH 2LU3A 4NKMB 3HPJA 2NXZB 1OW0A 3EKCA 1H9VA 2EDRA 5FV2A 2QADC 3OV6A 1M05B 2BJMH 5HHNA 4OZFG 3BDYH 4Y1AD 4JLRA 1WC7A 5F6IC 1XCQA 3ARZA 3NCBB 3C5ZD 1S8DA 5J13C 2L7UA 5FYJE 1UQSB 5KVGL 1T80A 3DECA 1D9KB 1UVQA 4LHQB 1EO5A 3HZMA 4ODHH 3UO1L 2V5RA 2A1WH 4DVRH 3H9SE 1JNNL 3WS3B 4LIQH 4KJPD 1T2QH 4NRXA 3NZ8B 4DKFH 5HGHA 3AY4A 3T1FA 3FTGB 3RGVC 4K71C 3LKNB 1UKSA 2DQUH 3NPSB 5C0EA 4WFGE 1E28B 4KKLC 4MQXC 4MB3A 3I9GL 1PG7W 5H94A 3VA2C 4JRYA 3SKMB 4JAMA 2P8LB 1I85A 1ZLSH 1FZKA 1CBVH 2EXWD 3PXJA 2E7HA 1JNLH 4GRMA 3K4DA 1IC5H 3EHBD 3O8XC 5DVKA 1RUML 1T1XA 4XCYA 2BNRA 4UDUB 1VFOA 2OTUB 3MJ7B 3G6JB 1H3PL 1CGSH 1X5GA 1J5OH 1BWMA 4FZEH 3FO0H 4KZDL 2GI7A 2VERN 4QHKI 1M6OB 4PG2C 1N5YH 3B9KC 3OR7A 3SCMA 4L1DA 4JO3L 4NN5C 4OZHB 5E8PB 5CD3B 4FQCH 5C70A 1AXTL 3RUGB 1AGBA 4WV1B 4XNQA 5I19H 3M45A 4IJ3B 1I1YB 4G6AD 3B2UC 3MV9D 1OP3K 4CU6A 1QR4A 5FHBH 1MHHA 2Q7NA 43CAB 3P40A 1UWGL 4O2EB 5JPMA 4ORZC 1EJOL 5C09D 2LAAA 1EVUA 4XCCL 3NH7L 4UOW0 1OAQH 3CSYB 2X4RA 1B0WA 4HKBB 5CAYB 2BOCB 4YH6A 5IHZB 1NANI 1FAKT 3AREA 1JWSB 12E8L 4PJ5B 4Y4KB 1LWRA 3QXAB 2BSRB 3DX6B 4IDJL 3MRPB 4F7TB 4HQQL 3WFZA 1BJ1H 1BJ1J 5TQ0H 2XKSA 3OKOA 5JORA 4JKLA 1G6RB 4OF5A 3IDMB 2R39A 3LVEA 2FJFB 2ZSVA 5JO5B 3B9VA 3BRGC 5TDOA 2CRZA 2BSTB 2R8SL 3U82B 5C07B 2DWEB 5BV7C 2AKRB 1AGDB 5HDOA 5J9PA 4KAQH 1FVCB 4HUXA 1E6JL 3ZYZA 1JE6A 4UMGA 3T77A 3H9SD 2W59A 1CD9B 1FIGH 3KYMB 1X5FA 4XP5L 2IAMC 3TO4C 5FKAB 1TVHB 3G5VB 1YPZF 3OJVC 2GY5A 1KJMA 4OGAD 5FYKE 4WFGD 3U0PB 4AK1A 2LFGA 4KKCD 4APQB 4OCMC 3ARSA 1A7RH 1IGCL 4ZSOB 4MSWB 3F7PC 4TSCL 2F54A 3CAFA 3TVMA 2IG2H 5LGJB 3SDAC 4R4ND 1UXSB 1ODAA 1QNZL 4OZIA 1R0AL 4PD4J 4S1QH 4Y2DC 1YEKL 1MWAB 1J18A 1UM4L 3MCLL 4NKQB 5KTEL 3WHXB 4R3SA 3B6SB 3N1FC 1ZA6A 4J4PC 2YC1B 4XPFH 4AG4H 2QBWA 3KPSD 4OV5B 4YHZH 1LEKA 2HLAA 4J2XA 1OAYL 2ICWA 4ZFFB 2VR4A 2J5LC 5T33L 3HMWH 3BKCH 4NBXB 4KRLB 3E2HC 3QG7L 4LNRB 2IH1A 1WZMA 5B38A 1CE6A 3QDHA 4FQIH 5F44A 1U8PA 1RK0B 3LKQB 5CIPB 1MVUA 4C58B 4WVRA 4ZAKC 4XCEB 2PCPB 1WFTA 2GAZB 1IGFL 3UTSB 2BNQE 2NPLX 3IF1A 1BFOB 4M6OL 4GAJL 3GK8L 3VMPA 2D2OA 5CILL 5C0AE 4Y2OA 3U4EA 1BM3L 4OLXL 1I1AB 4RQQA 1MSPA 4U1GB 4K3DH 5BCAA 2UY6A 4Z7UA 3C6LD 2F8VA 2YEZB 1XF2B 2JJSC 2MQ0A 3P4NA 5D8JL 4TPRH 3VFVA 3Q0HA 4NSKB 1BVZA 3RVXD 3DTXB 3EBAA 2X4OB 1JZ4A 2D0GA 3ZTNL 3CU7A 2KH2B 3RWEA 5F1IB 4MLSA 2AV7A 3SGEH 3HRPA 2D7PA 2QLVB 3EO9H 1D5MA 4U2YA 4PJBB 1WCBA 4WFHD 1ED3B 1RI8A 4MJ5A 3MRIB 2CDFA 3TNMB 4BK4A 4HEME 5K9KA 1LEIA 3MLYL 1L7IH 3LRSB 5FB8A 3HI1A 2YK1L 1CIUA 1KPUA 1ACYH 4ZUTB 2X4PB 4OLUH 1U41A 1FL6B 2CMRL 1CE1L 2W0FA 3CVIL 4WUUB 1WIOA 3CMGA 2H6PB 1IEBA 4HUWB 1F00I 3BPOC 1CLCA 5HYSG 1MJJB 4BSJA 4ZFGH 5EZOH 1IFHH 2GSGB 5DHYA 1XFPA 2Q8AH 1AXSA 3DX9B 5SWZA 2Z92B 2AGJH 4JFHD 2IGFH 4IRZH 3KPTA 5DJXA 3NFSL 2L4OA 2Q6WB 4NM8L 4X4YA 1ITCA 1X9QA 3BGFB 1GRWA 3THML 4J3VA 3PGFL 4UV7H 4JQVA 4LK4A 1KENH 1RZFL 4MA7L 2QSCL 4BQ9A 1IQDB 4NCC2 3TT3L 2C3XA 5DUPL 2J12B 2NY0C 3BDBA 2IALB 5BZDA 2V2XA 3O3AA 3OKMB 3QO0A 1G7HA 5HVWA 2BNRD 3V8OA 1AQKL 4JFEB 4ZXBC 2P5EE 1VFAA 4G5ZL 2ZKHL 2FIKA 2R29L 1AFVL 1D5IH 1CDGA 2XTJC 3MRLB 3TZVD 4I48B 3PDDA 2J88L 3EO1A 2NY6D 4WWKB 5D6CB 4PJ7A 5L0QC 5EPMA 3IDUA 2BNQD 3Q6GL 4TSBL 3BQUA 5ITBL 1T89C 1R3KB 4J23A 3OKLB 2KL6A 2DQDH 4H88L 2W60B 1MFEH 3LD8C 3ARBD 5IB5B 3O6ML 2OQJB 2ARJA 4FN0A 1NGPL 4MHHG 3B2VL 5DGQA 1IGYA 5T3XL 1T3FA 1YNLL 3IKKA 1A1OB 1XGYH 5B21A 4UTBH 3PWVB 3D69A 4PJXA 2X89A 4WI2A 1EA9C 5DHVB 1CTNA 4JO4L 2I24N 3FN3A 1S7SA 3RVUD 2NX5E 1RIUL 3IDGB 2R2BB 4QHMB 5GQBA 5CZVL 3VW3H 1M71B 3MOBH 1MVFA 3ULSB 5F88A 3NCYP 1NBQA 4OD3L 1C7SA 1H15B 3RY6C 3H9ZA 2Z35B 3QFJB 4E0RB 5D1ZD 4KK5C 3M8OL 4QWWC 1YDPA 4X5XB 4NC2B 4Y4FA 3MR9B 3FQTB 1DQTA 3VRLF 5D7LB 1F45A 2B0SL 2ORBH 5KG9B 4X6FB 4QRQB 4KK8D 2WANA 4LQ1A 3O2VH 5F9JB 3HC0A 4Y8DC 4IHOA 1I3VA 1X44A 3STLA 3WLBA 4WY7H 1S9WA 4LSQL 3QCTL 5E94B 4RGOH 3QNYA 4QO1A 1RMFL 3GMPA 4N5EC 1RIHL 4Q74A 3NTCH 5AZEH 5I1EH 2AK1L 1S7QB 4DGVL 8FABB 4OGZA 1GOFA 4UUJA 5T1MA 2E6JA 5J6HB 3IVKB 2JJTA 5I1IH 5C6WH 4XMKH 3W39A 4XVJH 2FRGP 2X10A 3GM0A 3ILQD 3QEQB 2P5ED 2YPLB 5IEHA 1NKRA 3GNML 4DW2L 4KK9D 2XFXA 4Y4HD 3U0TB 2D7TH 3JVGA 3VFMB 3U1SH 1FYTA 1JTPA 3PWJB 4JZOA 5IFAH 1BGXH 1JP5A 3KXFE 2V9QA 1H3WM 3FFCA 3SKUD 5F7EL 3FQNA 5EUOF 4PJIB 4XCFH 3DROB 3HNSL 4HXAH 3C8KB 5IBLD 4S0SD 3TM6A 1JWMB 4Z7WF 2VR5A 2APFA 1FL3B 4EVNB 5JXED 4PJCA 4ESKA 4RFOH 1UZ8A 1OP9A 3IXTA 4OIIL 1F5WA 1G7JA 2PYFA 3GI9H 1C5BH 4R4BA 3MBXL 3DRTA 3N1MC 5EORL 4EBQH 1T2XA 4DOHB 1IC1A 1A2YA 5I2IB 4S2SA 4GW4A 4NM4H 4FFYL 1LE9A 2VLLB 3S37H 5E9DA 2NX5D 3BKML 2GQHA 4N8VB 4PG9A 4GRLC 2F74A 4IRJB 4TUOB 4JFXB 2R2HA 4KY1H 1ZHNB 4U1KA 4YHKL 1U8KA 3X12A 1A5FH 3MLSH 4G8IB 4PJAE 1INQA 3VXMB 5DF0A 1I7UB 3ROOB 5TE4H 1X6LA 1R5IB 5DA4A 2YSSB 4LHUB 3HE6D 1T6VN 2Q87A 4YZFE 5D1QA 4N0UA 2I9LB 2X40A 1DANT 4M4PA 3HNTL 4NJ9H 5B39G 2B1HL 3D85B 4GG6F 3F12B 4LCWA 5F8RC 1F6AA 1NFDF 5D7JC 4Z0BH 2X42A 3VFRB 2OMBA 2ZCLL 3GDBA 1HSBA 1T5WA 2GFBB 1Q38A 1QRNB 1S5IL 1RZKH 1Q1JL 1AD0B 4NP4H 1I8KB 3VGAC 1NMCC 2CK0H 3E1F1 5CZXD 1RUAL 5I1KH 5FGBA 4D3CH 4LLQB 2X6MA 4PV9A 3T3PE 3B9AA 4Y5VA 3JV4A 5DVOA 5KVEL 2OL3H 1T66C 4OIBA 3D2UB 1K8DB 1KN4L 5E7FA 3HCVB 2VZ1A 5T1DL 1E4WH 5JOFA 5GS0D 4ODWB 2W9LA 4OIAA 3LKRA 3V0VB 4LAQL 5K59F 5SWZD 3FRPG 2P8MA 2WZPD 5SV3A 1OAZH 5J8OA 2A9NH 1T21A 1U8MB 3VD4A 2FSEB 1VEMA 5TQ2L 4DUVA 4KZEL 3AMKA 4ODVH 3KXFD 4M6NL 3QJFA 1Q94B 2FO4B 3K2MC 2OJZH 4EXKA 4GJTB 2JELL 4KI5F 1BIIB 35C8H 3VE0B 3FN0H 2HTKC 4K94H 4NQXA 1P4IH 4XTRC 1HNGA 3L5HA 2JB6A 3NZHH 4G6JH 3L3OB 4TTGA 1DBKH 2GK2A 4YIQB 2Q86B 1DR9A 2X05A 2Y25A 1S3KL 4GBXA 1VEPA 4HAGA 4QRRA 3BZ4A 5IESH 1WTGT 4G6FB 3QUXD 4G8GB 2V5MA 4NO0A 1FNEA 3T2PA 3BQUD 5IR1A 1NSNL 3RAJH 5JMOC 5IWLA 1W72L 3S88L 3I6GA 4H1LH 4RMSA 4C83A 5JIPA 2V9TA 5FYLE 4OF6A 4EDWL 5EOQL 3RWIA 1X5JA 3IDJA 1JN6B 3SDCC 2W91A 4IMLA 3VXQB 3D3VB 1RZ8B 2VKWA 4O02L 1UJTA 2EH7H 1IAIL 3VFSA 2FECL 3TH4T 1NAKL 3BEVA 2GW5A 3GSNL 2CKNA 3QRFM 3T8XA 4DZ8B 3UTTB 4NT6B 1QSZA 1HDMA 1XGUA 2WV3A 2X09A 4HKJB 5DUBA 1JBJA 4HH8A 1QBBA 1HXMB 2VLKE 1DBJL 2HWZL 4NN7B 5GS1A 4TSAL 2C4FT 5GSVB 4ALAL 2DM4A 3QXDA 1MH5A 2QEJA 4UTAH 2WBJB 2NYYD 3BKYL 4YHNA 2NLJA 3G6DH 1P84J 4XX1E 1OTUD 2NTFA 3IYLW 4Y4FD 5TDNA 5HGDB 3QULA 3TBTA 1A3RL 4JFDE 2CLRA 3VJ6A 4WDIA 1YQ2A 2VXQL 3MLRL 1HWGB 3F7VB 4QTIL 3I02B 4KK6C 3LQZB 2VDQH 5E08L 5HXMA 4QCIB 1QTYT 3LIZH 1Z2KA 2R69H 3BT2L 1XR9A 4P4KC 1MCWW 5GGQL 5I1AA 4LGRB 5I76A 5HDBE 5DRNB 1I7TA 4ZOBA 2QQKL 1KJ3L 2PO6A 1RQ5A 3TYFA 1E27B 3BSZH 1F02I 4RA3A 2Y7QB 3VFPB 4NPYA 3N50A 4N68A 3RVWC 3GIVB 1UCTA 4U6XB 1FBIL 1AHWC 5LCVL 3QQ9C 4D0BA 2XA8L 1MCLA 2FB4H 3J8F7 4X7SH 2NZ9D 4NQDB 1UJ3B 5C08A 4UNVA 4HS3A 4Q6YA 3W2DL 1CD8A 2NY4D 4JM2B 5I75C 4PY8J 4FQXB 1YN7B 5D71H 5DSCA 3ES6B 1PW3A 3DJ9A 1ZGLP 2GKIA 3QHFH 4JY5H 3ORJA 2E7LA 3ARFC 4X9GA 5FOBA 2D0FA 1Z9SA 4HZLA 5D2NE 3DO7A 3LRHA 1F4XL 4JY6B 5FYLD 1RZKC 4EI5B 5TGBB 1ZGLB 1DCLA 4G3YH 4OLWH 5I15L 3U4BL 2DBLH 4FFZL 5IK3B 4HPYH 2D7NA 2BSSB 2HN7A 1CGYA 4ZDHA 5T5FH 2PKDA 5BW7C 4M1DL 4C55A 4MVBC 5D2LA 5DJ6B 1VGEL 2EKJA 4K7PH 4K8RL 5E9DD 4OD2B 5F7MC 5ICYB 1YMMA 2GUOA 2PXYC 3CXHK 3QIWA 2MHAB 3V52H 5KVDH 4K7PY 1OTTD 2L0DA 3REWB 1J8KA 4PRHB 1CICD 3ZSSA 3OAUL 4XBGB 1YC8A 3ZYOA 5J6GB 1J0YA 3TA3A 2HKHL 4WHTA 4PJDE 3E0GA 3RWJB 5E8DH 15C8H 3A6CH 4JFZL 4KVNH 3HPLA 5I1HL 3P9MA 1CDJA 1U8NB 1QFUL 4JFDD 3I50L 1CXHA 3C5SA 1KCVH 1NGXB 4ZPVA 3ECBA 1XGPB 2ITCB 1JHKL 2AJYH 3VI4E 3MFFB 4JZJB 1K3IA 5KS9B 4I2XE 4QRPB 4JE4B 2AP2A 1I8LC 3WD5L 4HUMB 5BVJA 1HI6A 4Q0XH 4HGMA 1BZ7B 2CIIA 2E9JA 3VFNA 1L7TL 2YD4A 2GSIB 3LEXA 1DUYA 4XX1G 1FNLA 1KFAL 4YR6B 5HDLA 4JJ5A 4NNPH 3ZKQD 1WEJL 3VXOA 3TJEL 32C2A 3SDYL 2UY7A 2FR4B 1C8PA 2PW1B 2FHCA 1I9EA 3MGTB 3IETA 3PP3K 5KW9L 4MHHI 4EOWH 4M6AA 1OM3H 4U1IA 4XNXH 5HY9B 1XGTB 4TQEH 3V6OA 2NTSP 3EDDA 3GSNB 4TNVF 1JPGA 1TQCC 1R5WB 3MCKB 5HYJB 1P7KA 1WWWX 3O3BA 5C2BL 4QF1B 5KSAA 3DGGB 1YNKL 4OCNC 4P5TA 3V4VL 5CGYD 1Q8MA 2MKLC 3QI9C 4J3XA 3SDXF 5IVOA 4FFWC 3CFDA 3TN0D 4MJIB 4JCMA 1S9YA 4S1DC 4YEFA 3GSXA 4X8JB 2XTLA 1FPTL 1NAML 4ZODA 4UV4H 5IHUH 2AVGA 1RZ7L 4Q9RL 3CK0L 4JHBA 2DAVA 2BFVH 4RAUB 4LDLB 1NGYA 5IVZA 4UINL 3GMQB 1BX2A 1BEYH 2BNUA 5EBMA 4EQ2A 3EAKA 5IIEB 2DWDA 5C0IB 1NBZA 1U8OA 2Y1VA 3G5YB 1F8TL 4KROC 4YX2H 1DUZA 4ZD3H 3O6FB 2YD7A 3NIGF 3GI8L 5E70A 2GK0A 4P59L 1WBYA 3WV0A 2IBZX 4HMEA 5GRJH 2JF1A 5I16A 4JDTL 3VFGH 5LXGL 2E5EA 3HB3C 5LBSH 3O2WH 1CZ8H 1DVFB 1Y18A 2ATKA 4JKPL 5DVMA 3QHTC 2ZSWA 3K4ZA 2NY2B 3OAYK 1XCTA 5DJYB 3P11H 3X17A 1I3GL 1OGAA 1JCKA 2HFGL 5ALCL 3LKSA 3PNWB 3ARDC 1EHLH 5D7IF 1NJ9B 4ISVB 1FRGH 1ADQH 4XBEH 2UYLA 5IT2L 3LDBB 5EO1A 3AROA 1DFBL 1U8JB 1N7MH 1XT5A 1AE6H 3LEVH 2NY5C 2SEBA 3CD4A 4UU9A 3CVHA 1LO5A 4CAGA 5FA4B 1NCTA 3BPCB 3HI6H 3QPQC 4P9HH 1HWHB 5GJTH 2Z8WC 4BKLB 2COQA 2V7NB 2JJVA 2DM7A 2AEWA 2CLVA 4LASL 4M93C 3QEHA 4LEXL 3TH3T 1G0YR 5JQ6L 5T1KA 3WFEH 4EUPG 5E2TL 3EJJX 3MJ8B 1A7QL 4MNHA 4NKIH 5C6PB 3KPOB 2OZ4H 4GKNA 1SQ2N 3LCYA 1OOAA 1UEYA 2E6QA 1K5NA 4V1DE 4YHIB 1RJYA 3GJFA 4LLWB 4LLYB 2N7AA 5C0BA 1OP5H 3TBWB 3WIHH 3CPLB 2ED8A 1DN0A 4NQVB 4G9FE 5C08D 3GSOA 5B3JE 2WP3T 5ILTL 1S9XA 5CSGA 4UOJA 5DURB 4U6TA 3ZKXC 4A2MA 2GJ6A 3G08A 1BVLA 2WIIA 2DYPD 4ZPTB 1KB5L 2JB5H 1CXKA 4HIIB 3NMEA 1ZOXA 1M05A 2ZCKL 5IJVB 5L8KB 1OARH 2ZUXA 3WMSA 3CMOH 3QIUD 4UT6L 4G8FB 1YJDL 1KCRH 2B4CH 5FM8A 1ZAGA 1XZ0B 3DV6B 1G84A 5E8EB 2EIZB 5JW4R 1UQSA 4QNPE 1D9KA 2QHRH 4OJFH 3C2AH 4P48A 2DI8A 3DHMA 4PJ8B 3UJJH 2EKSB 2ADJB 4OGXL 3PHSA 4YDLB 1KEGH 1N0LA 3WS3A 4ZFOB 3NZ8A 1NGQH 5CHNB 1U8LB 3FTGA 1IQWL 3B83A 1DQML 2DMBA 3LKNA 4KQ4L 1E28A 2P4AB 3C5ZC 4XBPB 5T3ZE 4XMLL 2A74B 3U0WL 1MHEB 3UTZA 5I1LB 4JVPA 4OT1H 1PLGL 3PL6B 3SKMA 1CGUA 2P8LA 3ULUL 3OG4B 3BISA 4GKSB 3BE1L 3WIFA 2OM5A 3EJZD 2OK0H 4KJPC 2HFEB 1PY4A 3VGHA 4UDUA 2OTUA 2NY7L 3MJ7A 3G6JA 5EULV 3TP4A 3SBWC 3BZEB 5CJOH 1TTUA 3IDIB 1CU4H 1M6OA 2BY3A 3CFCH 1TNMA 1A7BA 3WXVL 1E4XI 4OZHA 4NN6C 5DDHB 5E8PA 5CD3A 2V2WB 2EXWC 5CP7A 3RUGA 4Z7VB 1MREL 4RAHA 4OLYL 3OJDA 1CLOL 4WV1A 3EHBC 3WLWD 1I1YA 3K2UH 4C56E 4XXCA 4HCRH 1I9JH 4NZDA 4OQTA 5EU6E 3MRGB 3RX7A 5FO7B 43CAA 4O2EA 4G7VL 4WFEE 5BRZE 5DJ0B 4V1DD 2FNBA 4CVZB 1WITA 4RMQA 2O5ZH 1LO3H 4R4FL 2ZUTA 5IW1B 3SDDD 4MA8H 3CSYA 4G9FD 1WICA 2A83B 4GAGH 1F4WL 1LMKA 2BOCA 4HKBA 4X7TB 5IHZA 3QCUL 1WCQA 2NMSA 1JWSA 4G6AC 4Y5YC 4PJ5A 4Y4KA 3QXAA 2AK4B 3DX6A 3GMLB 3T4YB 1FORH 1IILE 2F9BT 3MRPA 1A02N 2AQ1A 5F9OL 2DLEA 4F7TA 5KSAD 2X7LB 3MNVB 1MQKH 5A2IH 8CGTA 3FB7B 4I3RH 1G6RA 1S78D 3IDMA 1DSFL 1MIEL 2FJFA 5JO5A 5J11B 3OAZK 5MENB 2FATL 2YWYA 2BVTA 2R0KL 1YEFL 2FYYB 4JGJA 4BZ1L 3Q6FB 1SEQL 2J4WH 2BSTA 3HN3A 5CZKA 5C07A 2AKRA 3QXVA 5J1TC 4DN3L 1AGDA 1FVCA 1N2RA 5C0RL 5IJKC 4N8CL 2X4SB 4OZGF 4S0TD 4M00A 5F1KC 3KYMA 4OSUH 4P46C 1UH2A 4P9HC 5CEYB 3LS5H 3FT2B 5D5ME 5FKAA 1TVHA 5GRUH 3G5VA 1KLFA 2CKBH 4RDQF 3HTLX 4PJFF 4EN3B 5DRWA 1XF5B 3U0PA 1CL7I 5T3ZD 4XP1H 4H0GA 4APQA 1X4YA 1L4IA 4ZSOA 3MRMB 4MSWA 5F3HB 4P2YA 5JLZB 4YHML 3VI3F 3C08L 5LGJA 1GGCH 1UXSA 3DVFA 4Z95L 1RULL 3RX8A 1NCBL 1ZEAL 2FBJH 4FFVD 1MWAA 1UFUA 3WHXA 2P43B 1EGJA 4H20H 2O93L 4OGAC 3B6SA 4OV5A 5CUSH 4LVHB 2VOTA 4G43B 5FCUH 4KKCC 3WFDH 3RWHB 4QHUB 4ZFFA 1P4LB 2YD9A 4MLIA 5JW3H 4LNRA 4R4NC 1FG2B 4C56D 4HUNB 3VMOA 4PJEA 1DLFL 1X5YA 4WGVB 2O61B 2BVPB 1KBGL 3HAEG 3IDNA 5EU6D 5ERWB 3QPXH 4JDVB 3LKQA 5CIPA 4KMTL 4NGHH 4OF3A 5BRZD 3M1BB 4ERSL 2RQ8A 2PCPA 2B5IC 4IDLA 4XPAL 3MJGX 3INUH 5L8JB 2GAZA 4GFTB 6FABH 3UTSA 2FIRT 1C5CH 3T0EB 1BFOA 5FXCH 4ZNCD 1TZGH 3TWCH 3MZTA 3N85H 5I1CH 5T1KD 5ABDE 3P9LB 1I1AA 1BJMA 2A6IB 3STBA 2FJGB 2VAAB 1AH1A 1NCNA 5F96H 2YEZA 1A4KB 5H37G 1DQLH 4KJQD 1QFWL 3B9DA 4MQTB 1AXIB 1BQLL 4NSKA 3DTXA 2X4OA 5DTFB 1KTRL 5GZOD 3OKEA 5F1IA 3V7MA 2QJDA 1HN1A 3X3GH 4AQ1B 4G42B 4PJBA 2J8UB 2ZCHL 1ED3A 1QSEE 3MRIA 3TNMA 1YPZE 4OCYH 2A0LD 3SPVB 2NXZD 3LRSA 3V7AE 3C6LC 4F7EB 4PRIA 4I77L 4ZUTA 2X4PA 4CBPA 4PPTA 3QISA 2DIAA 1FL6A 2A2QT 4DAGL 3MBEB 4WUUA 5MEPB 3RVXC 3AVEA 3TIDB 1A47A 1BD2A 2H6PA 3NFNB 4HUWA 4NQCB 4POZD 1MJJA 4LPCA 5CCKL 4C57C 1ZGLM 1KYOJ 3OKKB 2OS7A 4JZNB 1LD9B 3KPQB 1EMTH 2XWJB 1DLHB 3E6HB 1FDLH 2H26B 5GGUB 1NBVL 2J8UF 4Z7OF 5EOTB 1JPTH 3DX9A 4TNVK 4BQCA 2Z92A 4ZUSB 1JL8A 4HGKC 2Z8SA 4BK5A 3VWJB 2BVQB 2Q6WA 4JPKH 4RNRB 4YAQB 4KDTC 4PD4K 4BH7A 2Y36L 4OD1L 4ZG1A 4NZRH 1HQRB 1IQDA 3ZYJA 5KSVB 3O81A 2IALA 3HUJA 2H1PH 1ZHLB 1ZTXH 4NNXB 3WJJC 3OKMA 2Q1EA 5J12C 2IFGA 4JFEA 4QXUH 3MRKB 1XF3B 3ESVF 3LH2L 5CEZD 4PB9H 3MRLA 2W65B 4HT1H 4I48A 5L2KB 2VWEE 1ZLUH 4WEBL 5D6CA 4WWKA 1F97A 4RCAA 1A22B 4KXZI 4GLRH 1JRHL 3SE3C 4FNLL 3O9WD 2NY3B 1A9EB 3DARA 2F5BH 4ZTOL 4E5XB 1II4E 1P9MC 1R3KA 4OCSH 3MYJB 3OKLA 2VTFA 1QYGL 4KTEL 1SY6A 4NWUH 4NQEE 1QVOB 5I8KL 2W60A 4LSRL 1MCPH 5IB5A 4UZGA 3OSKA 3PGDA 4AL8H 3GBML 3TZVC 5SX4I 1OQXA 1A1OA 2NY6C 5GS3A 3PWVA 1KJ2L 3BAEH 5DHVA 1CTOA 4JPVL 5IW6B 5F1SA 2CPCA 4D9QE 3IDGA 2R2BA 1XAUA 4QHMA 3ARBC 3BO8A 1M71A 5I71B 4XPBL 3BP4B 5HPMB 3ULSA 1L0XA 4K3HA 4PRAB 1IAIM 5BJTA 3GMRB 4ONFH 5IQ7L 5GS0H 2Z35A 4P23B 2EYSA 3QFJA 3U9UB 4DGIH 4TVSa 3PGCB 2VISA 1TFHA 1W0WA 1YEGL 5IGXH 4X5XA 3MR9A 1NUNB 3V4PL 4TNWK 3FQTA 4KDVA 3X14B 5D7LA 3DLQR 5C07D 3RVUC 5KG9A 3MRRA 4X6FA 4QRQA 2EIEA 2QQLH 3NCEB 4DFIA 2WSKA 5E4EB 1MJUL 5F9JA 4GAYB 4GQ9L 3LZFL 5AG9A 4GMTL 2BY2A 4CMMB 3WBDA 3ARYA 5E2VH 1GVIA 4KVCH 5D1ZC 2YMXH 5LG1A 3LPWA 1IVLA 5E94A 5LVEA 3UJIH 2DTML 3T0VA 1JNHB 4XCNB 4WW1B 5F71A 4APQD 5J06A 5E2UL 1S7QA 8FABA 4KK8C 5FDWB 4F2MA 5J6HA 3FFDB 3IVKA 1CFQB 5DD6B 4U6VH 3DSFL 5BV7L 1IBGL 3QO1B 3L7FB 1B4RA 3QEQA 3DI2B 3RVTD 3QDMB 2YPLA 3BW9B 1UWEH 2Y72A 3U0TA 1ES0B 5GISL 1N6UA 4TUKH 1QUNA 1MAJA 3VFMA 3PWJA 1G1CA 4WUKH 4ELKB 5D9SB 1PQZB 1X6NA 4BQ8A 2XQYK 4ZUUB 2BX5A 1U2CA 5DMYA 4PJIA 4HS6B 4RBPH 1AD9B 4NQED 3DROA 3VG0H 1YMHB 2OI9C 4BFIA 4PUBL 3C8KA 2A73B 1Q0YH 1JWMA 1J1OH 1FL3A 4EVNA 1SHMA 2R0LL 4KK9C 4Y4HC 5DC0A 4WI3A 4WI8A 1P53A 2DQCH 4R97C 1ZS8B 4NJAL 4V2BA 1NQBA 2ERJC 3AM8A 1A6WL 4LPXA 3IU4H 3PWLB 4M7LL 3UTSD 3S4SA 4F33B 1VFBB 4PB0L 3MLZH 4CL7A 1K8IB 4JFYB 4MNQB 5D96B 5C3LD 2VLLA 4P2OD 4D9QD 1YEIH 2XZCL 4LF3B 4JREC 1IGMH 2LABA 4N8VA 2HLFD 5IBLC 1I1AD 4TUOA 4IRJA 1OCWL 3GSQB 1R24B 4DQOL 5JXEC 4YLQT 3ET9F 1A0QH 4JFXA 1ZHNA 2PYEB 4G8IA 1K2DB 1CT8B 2DD8H 3AXLB 4OUOA 3QIBD 2R56L 1I7UA 3VRLE 3W0WE 3FB8B 4QXWA 3ROOA 4JHWH 4X80L 1R5IA 2APWA 2YSSA 4LHUA 5F7FA 4AEFA 3WE6B 4ACPA 3B5GA 3WKMH 5K9QG 1N6QH 1RJZB 3ZMRA 4IEFB 2I9LA 5MP6H 25C8L 4WCYL 3FMGL 5F6IB 3ARTA 1FAIL 3X13B 3D85A 5J13B 3MLUH 3F12A 3VFRA 3MUHL 4DN4L 1SM3H 2GFBA 2PW2B 1EHAA 1UZ6F 3X3FH 3M17B 1GYAA 1FO0H 1QRNA 3P30L 4WUUD 1M7DB 1AD0A 1I8KA 5ESAB 1MFAL 3HE6C 4O4YH 4W70A 4LLQA 1JZ8A 5EBGA 2ENYA 3RGVB 3RGHA 2DQJL 4X6CB 1KLGB 3MC0A 1QBMH 2XY2A 5EO9B 3D2UA 5HHQB 3P0YL 1K8DA 3HCVA 4B41A 1U92A 2EYTA 1X5XA 1HINH 4LSSL 4PYGA 3BWUC 2UZIH 2AQ2A 4ODWA 3V0VA 4XC1H 2WUBL 1D5BB 5FYLH 3K8LA 1J5OL 1F6LL 1U93B 1NMBL 1U8MA 2HMID 4GXUM 3WDHA 2FSEA 1PVHA 5CZXC 5D93C 1BHGA 4RWYH 5EUOE 5HVFB 2IQ9H 1JGDB 3H42L 5EIIB 5BVPH 3D48R 1QFHA 1Q94A 2FO4A 4FQCL 4L4VE 4LSPL 3B9KB 4KH2A 4Z7WE 4WW2C 1RIVL 3JBG7 1BIIA 3VE0A 5GS0C 4OFIA 4X6CF 3IS0X 1QLFA 3VXRE 5JUEH 4L8SC 1CLZH 1HH6B 3L3OA 4IOIB 1PSKL 4ZO7A 2Z31D 4MGXA 2R23B 2XWTB 4YIQA 2Q86A 4P2QB 2E3VA 3PWUB 4DCQB 1OPGH 2OR8A 3UC0H 5IFHH 4MMXC 4OZ4B 4G8GA 2XZQL 9CGTA 1FE8L 4YXLH 4XWOD 2YUXA 3WSQH 3Q48A 1JHLH 4CN6A 5ADOL 4D0DB 2VXUH 4PY7A 3F58H 5B8CC 1E4KA 1JN6A 5AWNL 3VXQA 3D3VA 1TTGA 1RZ8A 4JO1L 3RNKB 5F97E 1JVKA 4TULH 3QUXC 4K55A 3QJHB 5E2WH 4DZ8A 2P7TB 2AJ3B 3BQUC 1NCCH 1Q9WB 3TPUB 4GG6E 3UTTA 3C9NB 4NT6A 1FN4B 4HKJA 1L0YA 4KRPD 1NFDE 4NQUA 4CJ1A 5AYQA 5ITFB 4F57L 1LO4H 1HXMA 1FZOB 1N8ZB 1XGQB 5BV7B 4Q6IC 4YFEA 2AW2A 5I6XC 2VE6B 2WBJA 4PYHA 1P2CA 2GCYB 1ZT7B 3UEZA 4XPTL 1E6OH 1LO0H 4HFWB 1U95B 2IAMB 3GSUB 5CLTA 5D7LD 2FJHB 3D0LB 1KTDB 5HYQB 3MUZ1 3F7VA 5K59E 1LP9B 1IMHC 3I02A 4M5YL 3LQZA 2VUOA 4XAKE 1FFNB 2E7CA 4OLZL 1IAOA 5D6DA 4M8QB 2NYYC 1JI1A 4NRZB 3SDAB 1OTUC 5DRNA 4OBSA 4IOFD 3VDCA 4Y2DB 4LRNH 1MCEA 4KI5E 1FGVH 1E27A 2Y7QA 3VFPA 2BK8A 3FCTA 4L4VD 4NDMB 3VH8G 2DQEL 3RDTB 2GJZB 1MCQA 3GIVA 2VXSL 1QLEL 3U30B 4U6XA 3BEWB 1DQQB 3VXRD 1BAFH 5MI0B 4NBZB 2DQIL 3GIZH 2J5LB 4FQIL 1WAAF 1G9MH 3E2HB 4J3UA 4NQDA 4S1SH 1UJ3A 2I60L 2C4XA 2G9HB 3GSWB 4JM2A 4FQXA 1YN7A 5E4IA 1LEGB 3IJYB 3ES6A 3BP6B 3I84A 3QA3B 5SWSE 4F8TA 5L2JB 4KTDH 3VXSE 2ZG2A 4D9RE 1MJ7L 4RRPA 1FC1A 4JY6A 1GGTA 1GC1C 1R6VA 5TGBA 1ZGLA 4NCDA 4RISL 3IJSB 4K3DL 4MAYD 4XZUB 2OSLA 2MTPA 3RZCA 4KUZL 3O3EB 3KYAA 5IK3A 1MFDL 3JVGC 2BSSA 5AD0B 2NY4C 4R90H 1NC2B 3TEUA 4OFYA 5DUMH 3KLHC 3EFFB 4O2CB 3HI5L 3CNKA 1E0OB 5DJ6A 3RQ3A 3CDFA 4HWBL 3V5HB 1MCOH 5DQDL 2IPUK 4OD2A 5ICYA 3N9GL 4P2RB 3CFBB 1YN6B 2MHAA 4QTHB 5HHMB 2HKFH 4JRXE 5DMKB 4IRJD 4OTXL 1FGNL 3QWRD 4HF5H 3REWA 3NFPB 3U48A 4JR9L 3L9RB 4O51B 4XBGA 3VXMD 2EDOA 3MV8B 5J6GA 1ZT1B 4Y16D 1OAXH 4EIGB 1OTSD 3RWJA 4GRMB 5DMGD 1U8NA 3B4NA 3BPLC 5DRXB 1T03L 1P84K 3K8MA 3MJ6A 4MNGB 1R5VB 1NGXA 2YPKB 3BPOB 2IF7A 4XAKD 1OTTC 1XGPA 2ITCA 4NUJB 5HHOE 5CKAA 3MFFA 3DHJA 4JZJA 4P2CG 5KS9A 2DS4A 2XV6B 2BVOB 1CICC 3C8DA 1UT9A 4GXVL 3TT1L 2UUDH 3VXUB 1MEXH 2OR9L 1BZ7A 1UM5H 2DDQL 5FKPB 3DI3B 5JMRA 2GSIA 5GJSL 3P0GB 4UV7L 4YR6A 1F58L 4O9HH 1IKNA 1V7MH 4KI5D 2R4RL 4Z6AT 3B5HA 2DMCA 4TVPE 2N1KA 1TPXC 2FR4A 2PW1A 4BZ2L 1P7QB 1TZHB 2PTTB 1BFTA 1WBXB 4YJZL 4LPYA 1ZSDB 2NY0B 4PIRF 4E41B 2RB8A 4OF7A 5CINH 3P3YA 5AZ2L 1XGTA 5HY9A 3ZT5A 3WN5B 4X6EB 5CJXA 2VZUA 4ZXBB 5T1LB 3MCKA 1R5WA 3Q1SL 5HYJA 3AREB 1YNTB 2Q8BH 2HT4C 3KLSA 2QQQA 1B9ZA 1NCWL 4QF1A 2CJUL 3MRNB 2YR3A 5CEXB 3DGGA 3VFOB 4YFLI 5L0QB 3S36X 4D9RD 2HVKB 1CR9H 5ANMB 1T04B 5JA9A 2ZSVB 3GBNL 4JRWA 5L9DL 2Y5EA 2B1AL 4L4TB 4L8BB 4BSWB 3LD8B 4X8JA 5TDOB 1P5VA 4GRWF 1NUFA 2ZOKA 1UM6H 4NQTA 4RAUA 3T77B 3GMQA 2K1MA 1X5KA 5D2NC 3QUZD 5CGYC 2DJSA 5IIEA 3CSPA 4A6YH 5C0IA 3G5YA 1QKZH 3B43A 1P6FA 2ZP0T 3TYGL 3TN0C 2R0ZH 3MRQB 5DO2D 5DD5H 3O6FA 5IB4B 3ZKMD 3JSSA 3HMXL 5KZCB 4LSVL 4I0CC 4N90D 1LILA 2WIMA 1WBZB 5I73B 3D39E 4FHBD 3DIFB 1VA9A 2VABB 4LEOB 3P73B 2J8HA 4PJGE 3VD7A 1DVFA 2XQBL 4YFDB 5DJZB 1JFQH 1G9MC 5JHLH 2A38A 4AJ0A 1U3JA 5DJYA 5KSUB 5L6YL 1ZKAA 1WGOA 2UWEB 3RKDD 3PNWA 1TJGH 1NJ9A 4ISVA 4M3KB 1MI5B 2MSPA 1MFBL 4KMLB 3LHPH 4M48H 1U8JA 1YECH 4ZUWB 5B38B 4UT7L 4TVPD 3S97C 5GS1C 4LVEA 4WTWA 3TNNB 2YS4A 4Z18A 5FA4A 3BPCA 3NA9H 4N0CD 4QRPE 3MLWL 1A21A 1QG3A 1Y6KR 4KRMB 4BKLA 1C08B 3MXVL 4MB5A 2V7NA 4ONGH 1JMXA 3S5LB 1AO7B 2ZUVA 1F90L 3O4LB 3S6CA 4C4KT 4M7LT 2FL5B 5HJ3B 5HHPB 4FQJL 4QGTA 3MJ8A 1F3JB 4PJHB 3R1GH 4OI9A 3H8NA 2GYSA 4LBEB 4NCC1 3SDXE 5GXBB 3KPOA 4XCFL 3LS4H 4YHIA 5L7XL 2AJSH 4LLWA 4LLYA 3TBWA 1YEHL 2DIJA 3CPLA 2VDRH 2ZG1A 4NQVA 4EIZC 4NQDD 4JQXC 3GO1L 5T3ZH 3RL1A 1HIMH 1AP2B 2HRLA 1TJHH 2EDEA 2AJVL 2D31B 5I0ZA 3S36L 4ZPTA 3A67L 4HIIA 1ZLWH 5K9QI 5K9KB 1LEIB 1DBML 4MA1C 1QFWM 1H3XA 3MRBB 3NIGE 5IJVA 5ID1A 3MRCA 4F8QA 1QHPA 4G8FA 1KOAA 4EI5D 3RBSA 1TNNA 1XZ0A 4MJIE 5IVNA 4Z7UF 2FX9L 3T2OA 5GGVH 1RUKH 1IEBB 4LP4A 3F8UB 1WK0A 4HXBH 2A9ML 4GRLB 2Y6SD 1KEMH 3D39D 5DT1H 4OFYD 4PJ8A 2EKSA 1EPFA 4K2UL 5GGVY 2XN9B 2ADJA 2AXHA 3MLXL 4ZFOA 5C92A 2H2SC 5CHNA 1U8LA 4P3CH 2BVEA 1IKFL 1NGZB 3E8UH 4WHDA 1BREA 3QIUC 2V5YA 4FXLA 5D7IE 2CGRH 3LEYL 1ZHBB 3HE7C 3CVHH 4XBPA 2A74A 1MHEA 4PRHD 3PWPB 1RUPH 1U8HB 3RTQC 5I1LA 2V17L 3PL6A 2BMKB 1MCDA 2J6EH 3NCYS 5I8EB 1HZHH 2E27L 3CU1A 1JYVA 1RPQA 3JZ7A 1PG7L 2A6DB 5JHDE 4FP8L 2HFEA 3I85A 1WUNT 1G7HB 3VRJB 5C0CE 3QAZC 5E5MB 2O5XL 1TJIL 3RL2A 1NMCB 1U3ZA 4FQPA 3BZEA 3EOAB 3DYMA 2DM2A 3IDIA 5DLMH 4JPIB 4G6KH 5LWYH 3V5KA 5EZLB 4QRPD 4LNVA 4D0CB 3GHEH 5DDHA 4O58H 2V2WA 1AKJB 2F5AH 4Z7VA 3MACL 4L1HA 2YUVA 5D5MA 1KULA 1B0GB 5I30H 3UYOD 5BMFH 3NAAH 2EYRB 4YHLL 3BMWA 3MRGA 3BHBB 4WNQB 5FO7A 2OXHA 5AG8A 4DEPC 1IT9L 5D1XB 3KHQA 4LPVA 1PKOA 2I25N 3L5XL 5DJ0A 5F89B 3FN0L 4FTVE 5JA8B 4Q2ZB 5E6IC 3GJEB 5DD3L 4CVZA 2WBWB 5IW1A 3S35X 5H35B 1GPOH 2A83A 4X7TA 3WLWC 1SBSH 4JY4B 4PJ7F 1Q72L 3C87A 2ED9A 5HYJD 1I9RH 2YD6A 3GMLA 3T4YA 3L5IA 5GRVL 1T20B 4KQ3H 3F7RA 5F88B 2X7LA 3MNVA 4HFUH 1VKXB 3FB7A 2H8PB 2EDJA 1VPOH 1X5LA 3IRPX 5MENA 5BS0B 1MF2H 1A64A 5I1GL 4MJID 2XRAH 3SDDC 2FYYA 4L3EE 4LKXB 3Q6FA 4M61B 1EEYB 2AXGA 5KAQF 5IKCB 2MQ3A 5KSBB 2MPAL 1C1EH 3G9AB 4KHXH 4YBQD 5JW5B 5KN5A 5J56B 4PJXF 3CLFH 1RJLB 1QBLH 3PIQB 2UVEA 4BUGA 2X4SA 2OP4H 3MUY1 5D7KE 5KSAC 4Z5RB 1CYGA 5CEYA 2XG4A 4IHOB 4NOFA 3FT2A 4I1NB 1S78C 1A6ZB 2WQ8A 4PRBB 5IBTL 4EN3A 1XF5A 5CEZH 3QZWB 1NGWB 1CGTA 4KHTH 4UTAL 1TZIA 3SE4A 5GIRB 1HHGB 4X4ZA 3H6JA 1NCAL 4O5LL 4M9PA 3EYQD 3HC4H 1RHFA 4P4RB 3IDXH 2IFFH 3MRMA 4JFFE 5F3HA 5JLZA 4ZQKB 5JHDD 3EOTH 1DVFD 4UBDD 3MODL 5I74C 2RHEA 5DVLA 4HUUB 1RD6A 3AFLA 3WKNA 4DTGH 3QWOB 3QHZH 3QH3B 4G43A 4Y19B 3UTPE 3RWHA 4PFEA 4ODXB 4QHUA 1P4LA 3KPRB 3GSVB 1F2QA 4I0PD 1MELA 1W0YT 3QWQB 3LQMA 3PF2A 1RZIB 4AENB 1BWWA 2ZPKH 1MQ8A 2E7MA 1EFQA 1FG2A 1MFCH 4M8VA 2O61A 2BVPA 4FFVC 4P4KB 4AEHL 5D4QA 1CD1A 2ZG3A 4Y89A 5ERWA 4YWGH 4JDVA 1A7OH 1GH7A 1UCBH 3M1BA 5KJRL 5E00B 3QCVL 1QSFE 3Q5OA 3HRZB 3N1PC 4OAWA 4FTVD 4QXGH 4KGJA 1A3QA 3T0EA 4LSUL 1FV1B 1AHWB 4GOSA 2AJXH 4K9EH 4YHYC 5B4MD 2ZJSH 5IMLB 3P9LA 5GGTH 3F7YB 1FNSL 2A6IA 1JPSL 2FJGA 2Q3AA 2VAAA 5I75B 5IMMB 4K8RD 1A4KA 2R4SH 3S35L 4PBXA 5C0DB 1AI1L 3W9DB 1FLTX 2NY5L 4G3YL 4CNIA 5DTFA 4PJCF 5DC9B 3ARFB 1Q0XL 3QRGH 3U7YH 4L3ED 4JG0L 4UT9H 1CFVL 4U1LB 3VRIA 4XVTL 5ETUB 5FO9B 4OZGE 4G42A 5D1QB 4S1RL 3RPIB 4XNUL 2J8UA 5DURD 2CIKB 2AK4E 1S5HB 2ZUUA 3SPVA 4IRSD 4LCIL 5D7KD 4PJFE 4F7EA 4XNYH 1HSBB 2OL3B 4LVNC 4KJQC 3SQOL 1TCRB 3MXWH 4F58H 3MBEA 5MEPA 3HS0B 1HOCB 3TIDA 3CJJA 1BBJB 5GZOC 1KC5H 3NFNA 3K4AA 4NQCA 3VI3E 2PXYB 3BIAX 2VDLH 3FT3B 1MCKA 4AMKL 1AIFB 5F7HA 3SKJH 4YQXL 7FABL 5EUKB 2F15A 5J4MA 2VZVA 4JPWH 4J3TA 4PJ8D 3RWFB 1EUUA 1LD9A 4JZNA 3KPQA 1DTUA 2XWJA 1DLHA 2A0LC 3E6HA 1A1MB 2H26A 2EDHA 3A6CL 5GGUA 2YPVH 4KMQA 1F4YH 3ZHLA 3B8YA 5A40E 5FF6B 1ZA3B 5EOTA 3D0VB 5KANI 4OCLC 4YNYA 3GKWL 5ACZB 4ZUSA 1XR8B 1NLDH 4BQBA 3VWJA 2BVQA 1S7UA 4FQLL 5JZ7D 4RNRA 4YAQA 2AJYL 3HFML 4POZC 2IANE 3UTPD 1HQRA 3G6AA 1FSKC 1C16B 4FXGB 4RGMC 1ZHLA 4NNXA 1MHCB 1J1PL 5KVGH 4KGLA 3MV7B 1CIDA 3MRKA 3UO1H 1XF3A 4N0RA 5A16B 1OAKL 5TE7L 2D0HA 1BZ9B 2EDXA 4H1LB 5MERB 2W65A 2G5BB 1IGJB 1AR1D 5FFLA 4IS6B 2DQHH 4X6DB 4QHLB 1V3KA 3ZKND 1MCFA 1A9EA 4HHAB 1QEWB 3BYYA 1IC4L 4W4OA 4NO0B 4X4MA 2GTZB 3MYJA 3I9GH 4FMFA 4R6UA 4KRNA 4BSVB 1QVOA 3CZFB 4W6XB 4JN1L 2VL4A 2N7BA 3FKUS 2LTQC 1RUMH 1TQCB 3CH8A 3C60D 1GAFL 1NUDA 1RVFL 4U1SB 1KIQB 1H3PH 3O9WC 4KZDH 4CADB 3T8XB 5IW6A 3VGGA 3VDBA 2W38A 4CN1A 3QI9B 5DR5L 1HDMB 4LDEB 4JO3H 3LMJL 4ETQB 4OM0L 2AK4D 3BP4A 1G0XA 1AXTH 4WI4A 3KR3L 1MRFL 3JV6A 5CD5D 4R0LC 4HK3N 3GMRA 4QYOB 4P23A 4PRDB 3U9UA 2VLRE 3PGCA 5E8OB 1JMZA 3T0BA 4ELMB 3UBXG 1UWGH 3FO1B 3QDJE 4KKNA 3MNWB 3X14A 1EK3A 5IB2B 5F7NC 4MXVE 1OQOA 1B4JL 1EJOH 1KSRA 4Z7OE 2CLRB 5I66B 4KDWA 4XCCH 3NH7H 1D7FA 2VLJE 4KV5F 4QOKE 4GAYA 2CDGB 4CMMA 5IFJB 1IARB 4RDQG 4UDTB 2DQFB 4BFEA 12E8H 1AGCB 2R0WL 4HULB 1KYOK 2BRQA 4IDJH 3VWKC 3QNXB 4QGYA 4EN3D 4C54A 5I76B 2VKXA 3SN6N 1JNHA 4XCNA 4K9EC 4WW1A 3U4AA 4ODUB 2IAND 2VDOH 5E99L 4WTZG 3BN9D 3PP3H 1BQSA 2D9CA 1KB9J 5J3HD 1K9TA 1QOKA 2ADFL 5FDWA 4MXQD 2PTVA 3FFDA 1X5HA 1CFQA 5DD6A 2R8SH 3ZDXF 3ARDB 2C9AA 3QO1A 5ISZE 3L7FA 3HKFA 3QDMA 3BW9A 4LMQI 1ES0A 1CQKA 1T0PB 4I8DA 4XP5H 2VB5A 4ELKA 4P9HL 5GJTL 5D9SA 2P5WE 1OAUL 4WI5A 3EIFA 1PQZA 1EEUA 5KOMC 2FZ3B 4ZUUA 5DHVH 1JK8B 3BP5B 4HS6A 4LLDB 1J8HE 5FYJL 4NOBA 1ZLUK 5FOBB 1OD7A 3HHRB 4HZLB 1YMHA 3K80A 1ZVSB 4IM8A 1U6AH 4M93B 4U05A 3BH8B 4PJ9A 1QSVA 4TSCH 5EWIL 1MNUL 3VDAA 1NCDH 5A3ID 1NL0L 4FQHB 1KCSL 1C12B 1QNZH 2DICA 3ULVL 1ZS8A 1R0AH 3O6KL 5L2KE 2VWEC 1YEKH 1UM4H 4WO4D 3MCLH 5KTEH 2GITB 1X7QB 2APBA 3PWLA 4F33A 4CUCA 1VFBA 2YD3A 5JDJA 1K8IA 4JFYA 4MNQA 1HILB 4X8XA 2VDPL 4LF3A 3ZE0F 2O5YL 1OAYH 3I6KB 4J3WA 3CX2A 3RBGA 3GSQA 5T33H 1R24A 3IT8D 1WSST 4HSQA 3QG7H 1CXEA 2PYEA 4F9PA 2AEQL 1CDYA 5C1MB 3PDOB 1K2DA 1CT8A 3ZKXB 4AM0B 3AXLA 3FOMB 4BQ6A 3FB8A 3PQYB 4TYUA 4OCWL 4UILL 1UKQA 4KJYA 3WE6A 3OAYH 3QDJD 4OZFB 1RJZA 5A2JH 1T83C 5EFIB 1O0VA 4OJFL 4P2OC 3P9MB 4B7LA 1ETZB 1IGFH 2HLFC 2OJEB 5D2LF 2PR4L 4M6OH 4QOKD 3HZKB 2F53E 4GAJH 3GK8H 1I4FB 4PP2B 3DETD 2PW2A 3LB6D 3M17A 1BM3H 3QIBC 4OLXH 4M9OA 3QYCA 5D70L 3EOYG 4M3JA 1M7DA 3K1DA 3ARUA 5ESAA 4YPGB 5K9JL 5D8JH 3RGVA 3VGFA 2FGZA 1NFIB 4X6CA 4Y1AB 1KLGA 1OF2B 5EO9A 3ZTNH 2A77L 1WIPA 32C2B 5HHQA 3C5ZB 4N1HB 4YHOL 4X5WB 3UJTH 2WWKT 2UZYB 2XI9A 5M7QA 5ISZD 5ENWB 1D5BA 5IG7B 4PRPB 1U93A 5CJOL 3MLYH 4U49A 3VWJD 3D9AL 1X4ZA 1MCJA 4LQFL 2YK1H 3KYNA 1JGDA 1NEZG 3MOAL 5EIIA 2CMRH 2IBGA 1CE1H 2P5WD 3CVIH 1P7KB 4RX4A 3V4UH 5C9JB 4L5FH 3T1WA 4PG2A 3B9KA 1U3HB 4JKMA 5CJQH 4YBLB 3MCG1 2JCCB 3MLVH 1HHHB 5BOZG 3SKNB 5GHWL 1DANU 1HH6A 1T22A 2R23A 2XWTA 1PZUB 5I1DB 4P2QA 2HMIC 3PWUA 3OHXB 4DCQA 5ADPL 1XGRB 5L2KD 4H0HB 4LRIC 5EB9A 4OZ4A 4MQ7B 3NFSH 3TV3L 4NM8H 5FYKL 2JIXB 3UYRL 4OQTL 3THMH 2OBGA 4D0DA 3PGFH 3DXAE 4MA7H 2QSCH 2V6HA 3SJVE 3TT3H 1EERB 5DUPH 3MJ9A 3DVGB 4RA0C 3A6BL 3IGAB 1WTLA 2Z31C 4M43L 1YEDB 3TBYA 2XXCB 4Y5YB 2GK0B 3MRFB 3MV9B 1PKQB 5IB1B 1AQKH 3RNKA 3RP1A 4G5ZH 1D6VL 2ZKHH 2R29H 1EO7A 1AFVH 3JTSB 3QJHA 3R06B 3WDJA 2P7TA 4XWOC 2AJ3A 3TPUA 2EZ0D 1Q9WA 3C9NA 1REIA 1FN4A 5DS8B 5ITFA 5JNYB 4FG6D 1ZWIB 1FZOA 3BMVA 3Q6GH 1JJUA 2BC4B 1N8ZA 2VXTL 1G6RL 4TSBH 1XGQA 4OI8A 4H88H 1EXUB 2VE6A 1MY7A 5SWSA 1HCVA 2GCYA 1ZT7A 2AI0L 1NGPH 5IMKB 4P46B 4OKDA 3B2VH 1H3TA 4HFWA 1U95A 2IAMA 3GSUA 3HC3L 1MRCH 1YNLH 5T3XH 3TO4A 3SGEI 4KRPC 2FJHA 2LV4A 3D0LA 1KTDA 5HYQA 1LP9A 1NDGA 3EYSL 4JO4H 1DL7H 4HKXB 3MLTB 1FFNA 3BJLA 1IC7L 1RIUH 4M8QA 1CG9B 2IEPA 4OI7A 3H9HB 3H9SB 1DJSA 1SEBB 3KWWB 4NRZA 2EC9T 4OD3H 3SDAA 1B2WL 3RI5F 4Y2DA 3BFOA 4RFEB 2GIYA 3M8OH 5TF1L 2DL9A 3QG6B 2C3VB 4NDMA 3WFBL 4LHJB 1MWAL 2VO5A 4J4PA 5EU7E 3KPLB 1JF5A 1EGJL 3RDTA 2ESVE 2GJZA 2VDNL 2B0SH 4NO5B 1JPST 1NFKA 3BEWA 1DQQA 2HFFB 1T0NB 5C09E 3BDXA 5CKGA 5ICZB 1I7RB 1RU9L 4IOFC 2C4FU 2X1QA 4ODSL 3LN9A 2RIKA 3RIFF 1LEGA 3IJYA 2YZ1A 1MJ8H 3BP6A 3ULVF 3QA3A 1C5CL 3S9DB 2DI9A 1A6PA 3CLEL 4LSQH 3QCTH 4ZAKA 4X4XB 1A7PL 2VL5A 2B5IB 1RMFH 5L2JA 4JVUA 3OBAA 3DXAD 4U4BA 1RIHH 4WU5B 3SJVD 2AK1H 3BWAB 4DGVH 5I17A 3UZVB 2PUQT 2Q76B 1FFOB 2HH0L 4BH8B 2QKIB 3IJSA 4XZUA 4W4NA 1GGIL 3O3EA 5KVFL 3BN3B 3UZQA 5AD0A 3QUYC 1NC2A 1R3IL 3EFFA 4L29B 4O2CA 2DLIA 2H2PD 2Y9RT 3GNMH 1YEEL 3T04D 4DW2H 3P0VH 2X4QB 4XC3L 3V5HA 1XMWA 4P2RA 3CFBA 1YN6A 5HD8D 4QTHA 5DMKA 2HAZA 4LSDA 4TVPH 2ARJQ 4MAYC 5F7EH 1JV5B 2XZZA 3NFPA 4HPOL 1AJ7L 1W0VB 5H2BB 3HNSH 3UTZB 5BZWB 3L9RA 4O51A 2HJLB 4LPWA 3MV8A 2ITDB 1ZT1A 1EX0A 3AM8C 3SE8H 5IVXA 1QA9B 4B50A 1ZANL 3WIFB 4OIIH 2DBJA 3AC0A 2XZAL 4U1NB 3MBXH 4HBCL 3V9FA 4ZOAA 5EORH 1V05A 4ETYA 5DRXA 5HYSB 3P4OB 4MNGA 1R5VA 1DEDA 4IRJC 3BP7B 2YPKA 4NUJA 4I3GA 1QLRB 3BKMH 3KPSE 2BVOA 5HVGB 3N06B 3WUWG 5IV2B 1Y6NR 3UPAA 3VXUA 4Y16C 3R4DA 1T7VA 5CP7B 4YHKH 5FKPA 4AIXA 1OTSC 3OXRB 3OJDB 1XIWD 5DMGC 2DLFL 1OSZB 4MJ6B 4Q9QL 5IM7B 4EKXA 3BOVA 1G7MA 3NCJL 4NUGL 4P9ML 1P7QA 1TZHA 2PTTA 1WAAE 1WBXA 2ESVD 4P5MB 3G6JF 4AIZB 5GRYA 3HNTH 1ZSDA 4PJGA 5FO8B 4ENED 4E41A 3NABL 4PB9L 3DMMD 3ARVA 4N0YL 1IZJA 2XPGB 3WN5A 4X6EA 5J12B 2ZCLH 4LSTH 4ZXBA 4JGMA 5T1LA 3IXAB 2CLZB 1S5IH 4KI5C 1YNTA 4OZHF 1Q1JH 1P5UA 2XWBA 4LLMB 3RUGF 1SMAA 5B3NA 3TCLB 1RUAH 3MRNA 5CEXA 5JXAL 3VFOA 1FCGA 2HVKA 3RRQA 2GJJA 3O3UN 5ANMA 1T04A 1RUQH 1T89A 4MZ3A 4YXHL 3Q5YA 4AL8L 4I18C 4L4TA 4L8BA 2M2DA 4BSWA 5E6ZA 2CKBB 4LAQH 3NN8B 3SGKC 1SY6L 3H0TB 4MDJA 3G04B 4WFHE 3MROB 1N2RB 5FHAL 2BY0A 3TZVB 2NY6B 1HHKB 5TQ2H 3WHE1 4KZEH 3FQRB 4M6NH 2R2EB 2JJUA 4J12A 5IOPB 1J1XL 4PGEB 2V9RA 3MRQA 5IB4A 3SOBH 2JELH 2XT1B 5DRWB 5C0AB 4ONFL 2HYMA 3ARBB 1E4XL 4DGIL 1WBZA 3DIFA 5HGBB 2VABA 3IDYB 5IGXL 4LEOA 3P73A 5SX5H 1S3KH 1S9KC 4Z76A 1S7XB 4FXKB 3QUZC 4Y7MA 4JFHE 5DJZA 5FUOL 4JFQB 1PEZA 5KSUA 1J12A 1NSNH 5DO2C 1PZ5B 4ZO6A 3R8QA 4PV8B 1W72H 4AY0A 1YEJL 3KS0H 3ZKMC 3KS0J 3ELAT 5F7WC 3S88H 2YXMA 2UWEA 5DJ8A 4EDWH 4Z8FL 1FNGB 5EOQH 4JRYE 1QPXA 2ZNXA 4HMCA 4R2GB 5SV4A 2HJFB 4K3JL 1O5DT 1MI5A 1HHJB 3NA4A 4O02H 1IAIH 3UJIL 1G9EA 5D1ZB 4H26B 3CFIC 3GSNH 4ZUWA 4PJEB 2BNRE 4HIJB 2UUDK 5EC2B 3IDNB 1DBBH 4IMKC 4KKBD 3CXDL 3TNNA 2GY7B 5DYOB 3EOBB 3RKDC 2X70B 1DBJH 2HWZH 1C08A 4TSAH 4ALAH 2IH3B 1H0DB 1NMAH 1AO7A 3S5LA 3HG1A 4MAUL 3O4LA 1FLRL 1A6TB 1BOGB 2FL5A 1PY9A 5AEAA 3BKYH 5HJ3A 2FDBP 5HHPA 1F3JA 3KG5A 2BVYA 3EYVB 4PJHA 3U36B 1GJIA 1H3GA 4LBEA 5CMAB 4KU1A 5SWQB 4HWBA 2BCKB 3RDTD 2JTDA 1A3RH 4PJEF 3TBVB 4N0CC 4PGDB 4GRWE 1ZK9A 3MLRH 4QTIH 1WFNA 2D3VA 1UC6A 3T08A 5E08H 1CL7L 3OKEB 4ZS7L 2OI9B 1CFTB 3T0XA 5TE6L 3T0WA 1AP2A 4RGNE 2H3NB 2P5EB 3OMZA 2D31A 5EA0L 2AJZB 4ZMAT 1JTTA 4Y4HB 3K0WA 5GGQH 2E6PA 4WHCA 1M1SA 4F7CB 2QQKH 3OF6A 1KJ3H 3MRBA 4PRIB 2ERJB 4U7MA 5IEKB 3FAWA 3OB0H 3UAJC 4I9WE 2CR6A 4KUCF 4QT5A 4ZNEA 4NBYB 4YGVB 4HKZA 1E4JA 1BD2B 4JREB 1FBIH 5LCVH 3PDGA 5JW4N 4GRLA 4YDVB 1NC2D 2IPKB 2XN9A 1I1RA 1VSCA 2D4FA 1G6VK 2W1NA 3W2DH 4PJBF 3IFNL 4DKAA 4GT7A 1NGZA 3TF7C 4P2RD 5C7XH 4EI5C 5EG6C 2J2ZA 2F8XC 1KTLB 1ZHBA 5B39B 1TTFA 1NUGA 3PWPA 3OPZL 1F4XH 1U8HA 4BH7B 4CVWA 3BXNB 5INDB 4JRYD 2BMKA 2Y6SC 4R8WL 1GC1L 2VQTA 4YDIH 5I8EA 2IPTL 5I15H