1LMKA

The structure of a bivalent diabody
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
238
structure length
238
Chain Sequence
VQLQQSGTELMKPGRSLKISCKTTGYIFSNYWIEWVKQRPGHGLEWIGKILPGGGSNTYNDKFKGKATFTADTSSNIAYMQLSSLTSEDSAVYYCARGEDYYAYWYVLDYWGQGTTVTVSSGGGGSDIELTQSPLSLPVSLGDQASISCRSSQSLVHSNGNTSLHWYLKKPGQSPKLLIYKVSTRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords ANTI-PHOSPHATIDYLINOSITOL SPECIFIC PHOSPHOLIPASE C DIABODY
publication title Crystal structure of a diabody, a bivalent antibody fragment.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 238
sequence length 238
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 1994-08-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lmkA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lmkA02
3SJVE 1NCBL 5DYOA 4PV9A 2DQTH 3F7VB 5DF0A 5J6GA 1FLRL 4ODWB 4PRNB 2DI9A 3L3KB 3G6JF 5K93A 4FFWC 2VKWA 3FT3B 4P3DA 5K9KB 1U92A 3BRDA 4PJCE 5DHVB 1K5NB 3T0XA 4XHQA 3TCLA 1QYGL 2EDDA 1WITA 4O51B 4OLUL 4LVHC 4NO3A 2PCPB 2DQCH 3HZVB 3QFJB 4WUUE 5C0BE 1MCEA 4UTAH 1CICA 1I1AB 5H35B 3FFCA 2WBJA 3V4PH 1FZMA 1T20A 2BCKB 5GS0L 1NL0L 4EJ1C 5HVGB 4ELKB 3EHBC 1CVSC 2WZPD 1P7QD 4JB9H 1CQKA 3VRJA 1EEQA 1QPPA 4GW5A 3R1GL 4JRYA 4CW1B 5KW9H 5HYJA 1QSED 3PWPB 5I9QB 1BZ7A 1E4WH 4EN3B 2D7PA 1J88A 3HI1B 3OJDB 1A1NA 3GI9L 5HY9A 4KZDH 4XMPH 1BJMA 1IM3B 2P5EA 4HS6B 1GGIL 2A9NL 3PP4L 4N0UE 1PG7L 1YNKH 2AEIT 1KLFA 1C5DA 3TNMB 1DBJH 1QBMH 5E9DE 5F6IC 5IJVB 3MLWH 4IOIB 4KRNA 5DC4B 2R2HB 2ZUQB 1ZWIA 4QHKI 3TN0B 2J4WH 1A14L 4L8CA 2FX7L 1ZHKA 3TA3B 2XWJB 3PWVB 3CVIH 2NLJA 1T6WA 3F6IA 3L6FB 1G9EA 1VB9A 2DYPA 3H9YA 3HZKB 4XPHL 4DN4L 2VQ1B 4MA7H 3MMEB 3FHQA 4WI3A 1MJUL 1RZKH 2IADB 1YJDC 2MWCA 3SDDB 4ZFGL 5E5UB 2DMKA 2IPUG 4XNQB 5CCKH 5TF1H 1XGPA 1CFNA 4MAYA 5I66A 4U6YB 5DEFA 4A6YL 1JCKA 5TGBB 2VXVH 3G6AA 4DUXA 2VE6A 3TFKC 4QRUB 3SDAD 3RVXC 3KNBA 2ZKHL 4YBHA 4N90E 4PGJA 5CEXA 4PGDB 4X6EA 4QF1B 3D39B 4GUPA 1IT9H 1U8IA 2QQNL 4PUBL 3DMMD 3O3EB 3O6FB 4DVBB 3GSRB 2B7DT 5L6YL 4K07A 2OM5A 4Z7OE 1BQHA 4QRRB 3J8F7 2VLRD 4WO4D 3ARQA 4Q2ZB 3KYNB 4X4ZA 3IDGB 4PS4L 3U0WH 5JW3H 5DVLA 1IEHA 1HXMA 1PYWA 3FQTA 1G6RB 3CLEH 3QDJB 4TUJB 1F4WL 5KSVA 1XZ0B 2OR9H 4X7TA 3I85A 2B8OT 2KQNA 4MJ5A 4GRLC 1IGFL 3IDYC 4XHJC 1KCSL 1WWBX 4JM2D 3P4OA 1ITCA 3JWNC 2NTFA 1JHTA 4FXGA 1RULH 4JFDB 3U36A 3RIAF 3E6HB 2ICEB 4HUVA 1EHNA 2VXTL 3WFZA 3O8XA 4MAUL 2ATPA 4YXLL 3U7YH 5J1TC 3T0EC 5HHQA 1PQZA 3CH1B 1IC4L 1FNEA 2HFGL 3V5DB 3HNVH 1ZLVH 3NZHL 1MQKL 5F9AC 1EZVY 4GAYB 5HTSA 4OGAC 5DJXB 5F97E 1X5HA 1A0QH 1QLRA 1DLHA 4XCNA 4S10A 2PXYC 2NXZC 2VLMD 4UB0L 4WI5A 3VD5A 3RZCD 3T0BA 1XR8A 5JHDB 1AC6A 5DMIL 2CQVA 3X12B 4FZEH 2BSSB 4ZS6C 3ULUH 2AJSL 3QQ4B 3HC0A 1P7KB 3CD4A 2N7BA 3SBWC 4NKDA 5C0IB 5EU7C 1MCWW 1NCCL 4Z78A 1MCSA 2D7MA 2IANB 1AJ7H 3ARZA 5GGRY 2A9MH 3T65A 4GW4B 4IRSA 2R4SH 3ZT5A 3W9DB 3VU2A 1NLBL 5F96L 1UJTA 5GZNC 2XZAH 4Y2DA 1D6VL 2YD1A 3D3VA 5IFJB 1S7SB 4L8DB 2EEAA 4HUXB 4JQXA 3OKEB 5C08B 3CVHB 4ZXBC 3FB5A 5IBLC 1LHZA 1I3GH 2DM3A 3EOBA 5EO1A 1YNTB 1CXKA 4JFFB 2IMMA 4ETQB 3DYOA 4Y4HC 3VFNA 4U1GC 5D7SL 1EV2E 5BQ7A 4MNGE 1XGUA 1INEH 1I8KB 3VXME 2GJZA 2ATKB 2YZ8A 3KS0J 3VH8A 4WI2A 5HPMA 3HAEH 3B3IA 5AZ2H 5EU5B 1K8IB 4CN1A 4GMSH 3IXAB 1JNLL 5IQ9A 1JHKH 1UXSA 4G6JH 4HAFA 1AP2A 5D1QD 1AR1D 1WEJL 3TWCL 2VJXA 1OF2A 4YGVB 5FO9B 5GZOD 3V8OA 3VXRE 3L5XL 1NEUA 4X4ME 3VDBA 4DN3H 4L29B 2RFXA 1MPAH 5I1CL 5E2WH 1MI5D 2CR3A 4ZD3L 3IAGC 2NYYD 1OPGL 5J89A 1BQLL 4LEOB 5DA0B 3DROB 4U7KA 4NNYA 1C08B 3B9EA 2CRZA 5CINL 3QDMB 3RGVB 1BLNA 1CLOL 4UUJA 1CIDA 5E4EB 3QUYB 4F33A 3EZ8A 4PR5A 4YHPA 1NFKA 4X98B 5F93C 5FHAL 4NZUH 3MCKB 3MUGA 5BVPL 4WTZG 4AENB 3D5OF 1ES0A 2OS7A 3UP1A 3GO1H 4TSBL 1XF2B 2QR0A 3T0DA 2X5PA 4JG0H 4RFNB 4U1JB 2MHAA 4X4YB 5I1DB 3KYMB 4PG2A 1CN4A 1V3LA 3TPUB 4PB0L 1I1FB 2R0KH 4PJAA 4UIMB 2JK5A 5EH1A 3I3BA 5GS1C 3SDXF 1SMOA 3T08A 3JWOH 4Z0BH 4UDTA 4UZGA 1XF3B 2IPTH 5DVKA 3BOVA 1N26A 3CZJA 1UFUA 1GOHA 4BSVA 3QULA 1OP3K 3V4VH 1ZT1A 5ITBH 3DRQA 4P5MB 5J3HD 2ZCLL 4OGYL 3QQ9D 1QNZL 5J11B 2E9BA 1NQBA 2M8XA 4QY8B 3ULVF 5JUEH 4YDVA 5K9JH 3MOAL 2GY5A 3L7FB 5FB8B 3HS0A 4YJZL 5F3HB 3S35X 5FYLE 3VD4A 4YC2C 2VWEE 3MCLH 3RX7A 3FO0L 2NCMA 1MRCH 1P2CA 1LNUA 3V0VB 4LFHD 1CGUA 4JY4A 3RI5F 1WBXA 2GTWA 4NQCE 4YHIA 4HS3A 1P7QA 1LWRA 5DK2B 1CFSA 5CMAB 4LPUA 4G8FB 4NKQB 3TPKA 2EDEA 1DEDA 1GGBL 3SE9L 1U8HA 2XA8L 4JKPL 3WS3A 5IHZB 3SE4C 1NSNH 3ZKQD 1YJDL 3GK8L 4PREB 1N5YL 1I8LA 2GY7B 5E1AB 4DCQA 3MNZB 1AKJD 4WDIA 4K9EH 4ODUA 4MNQD 5DT1L 2QHRL 3KJ6L 3MPCA 1I9IL 1PVHA 4MXVF 4WCYL 3N1GC 1QRND 4MDJB 4G3YL 4TYUA 5D2NC 3MV8B 4OF6A 4XH2A 3RVWC 1I3VA 2MCPL 4M6MH 1ZT4A 3MBXH 3LN5A 1LEIA 4YFLF 4LRNL 3UTQB 4NQEB 3TVMC 3UJIL 3DETD 3RX5A 1YPZF 1VFOA 4DTGL 2GSIB 3TM6A 1RZJH 3SKOB 1PY9A 1OTUD 2XZQL 4GRWH 5BOZG 1U3HB 4IDJL 1J1PH 3GM8A 3HC4H 2D7TH 3OKMA 1CBVL 4QYOA 3MXWH 5DJDB 1PG7W 1T22B 3EFFB 1HHKA 2FJHA 3WDHA 4KQ3L 1NGPL 4OSUL 1GOFA 2AJXH 4NJAL 3HI5L 3O2VH 4QXWA 4NNXA 4O9HL 5KVFH 3CXHK 2UUDK 4NYLB 4R4BA 3HE6D 4Y7MA 5D71L 5MEQA 4WFGD 3DMMA 4LPXA 1G0XA 5I1KL 2FHBA 1I1AC 3ZDXF 1A6ZB 4M6OL 5ILTH 4BFBD 2P8LB 3D69A 1XR9B 2VLRA 3FZUC 1RK1A 4TPRL 3P0VH 1N2RA 3BRFA 3ET9F 3RFZC 1NCWL 5SWSD 3VFMB 3MXVL 3D2UD 3PQYE 5C86A 1W72A 1HILB 4G7VH 4XCFH 3PF2A 2XV6B 1GRWA 1EA9C 4AQ1B 4LAQL 4NQVA 5D9SA 4LQFH 2HJFB 4QRQA 4YHOL 4EN3C 3C08H 4NN7B 3G08A 1G6VK 3EDKA 1KXVC 4CVZA 2VDLL 5DJAB 1XF4B 4JM2A 1MSPA 3MV11 3T2NH 4FQHA 3IRZA 3FQWA 4G8GD 1X7QA 2AI0L 1T1XB 1MJ7L 1A2YA 1D3CA 5DHYA 2EDLA 4NNPH 5IB5B 2ZUQC 1WWCA 4JFYB 3BMWA 3ZMRA 5TFSL 4Y2OA 2VITA 4BQCA 2OTUA 3TN0C 4IHOA 2A77H 3K74B 1V7ML 4L5FH 3M17B 3DVGB 4WEBL 3QIUB 2YD6A 3CDFA 2FLBT 3TO4B 1X5AA 5CWSA 3V79C 3QJFA 3FTGB 3D48R 43CAA 4I18A 4DKFH 5I1AA 1GC1C 5LGJA 1KYOJ 4AEEA 3PXHA 1X5ZA 1W0VB 1CDIA 2Q86B 5KSBB 1C12A 3LKNA 5INDA 2AK4E 1N8ZB 1TZIB 4J3SA 3GEWB 3SDDC 5IIEA 4JHZA 1W0WA 4PJGF 3UPRB 2L4OA 3WFDL 4A2LA 2R23B 5ACZA 1NUNB 3TH2T 1KIQA 1A7BA 3BN9D 4N0FB 4ODVH 3GBMH 2HFFB 4GQ9H 4Y5VA 4NJ9H 5E8DH 4NKOB 3FJTA 3DXAD 3QG7L 4JPVL 1CFQA 1M6OA 3BKJL 2LU4A 3W2DH 5KVGH 3O6FC 3P73B 2VN4A 1MWAH 4LSSH 4JY6B 3IDMA 2PTVA 3T77A 2B1AL 4PGCA 4KMTL 3N0PB 4NUJB 2LE9A 4LVOB 1UVQA 4HZLA 1FO0L 3CFBB 3ZDYE 1GAFL 3QEQE 3TYFA 3ARTA 1RJZB 1MHHA 3WNPA 4CDHA 2P8MB 3OF6D 1U95A 4HKJB 1QSFD 1F4XL 3RWDA 5HYSB 1CGXA 3R06A 1ZT7A 5EBLB 1VENA 3UC0L 1RHFA 5ESAA 2CJUH 1NBZB 5HGBB 2PYFA 3O41A 5GGTL 3GB7A 3MRGB 1Z0MA 3BGMA 3EYQD 2LAGB 3SE8L 1S7UB 2E6JA 3B2UD 4XBGA 1HCVA 5D1QA 1NCDL 4MHHG 2YPLE 1T83A 1NEZB 2J7LA 1QQDA 4GSDH 4N5UA 2BVYA 3VJ6A 3X11A 2DWEB 4JO1L 1J8HD 4G6FD 5E2VH 1WCBA 1CDUA 3S97C 1R5WA 4XPBH 4K2UL 1KBGH 3BJ91 4GG8A 4NUGH 4CAGA 1DN2A 1MI5A 4KKAC 1IAOB 1ZHBB 1S3KL 3FB6A 4QWWD 4CL7A 3KPRB 5DUPH 2R1YB 3DSFH 3O4LD 1IEBB 1DVFD 1FLTX 1KELH 3C2AH 1XGTA 4I0KA 4X6DA 1WC7A 1ZA3A 4KK8C 1A9BB 1F6AB 4G8IB 1FYTA 3MRJB 1MEXH 3CDYA 3OG6B 2Q6WA 4MD0B 4PBVC 1GGCL 2W92A 1E0OB 5E2TL 3EFDL 5M94B 3W82A 1CGYA 4ZPVB 1Z3GH 1A7PL 3C5JA 4XMKL 2OL3H 2WBWB 1CFVL 3KYOA 2Q8BH 3U7WL 2R69L 2D7QA 5MI0C 3KPOB 3MRPA 5DWUH 4O02H 1LE9B 1FL5A 1XEDA 3HR5A 1ZS8A 4OZFH 4P9MH 4WU7B 1JWMB 3FMGL 4I0CC 3FAXA 1LP9F 3L3GB 3NFSH 4OM1L 3QEGL 4HF5L 3ZO0A 4ZUSB 3WN5C 4L4JA 3ORJA 1MCJA 3C2SA 3MRCA 5IJKC 2O61A 3RIAK 1UYWL 4BH7A 1DQJA 4RFEB 4ODHH 4PJHE 4MMXC 4ZMAT 2BDNL 1BVKB 2ZWLT 5CP3A 1BJ1J 1WBZB 3WLBB 1QFUL 5KSAA 4WY7H 2DLEA 2NY4C 3SJVD 2XA3A 4FQQA 4NDMA 5GISL 4CKVX 4X5WA 2R9HD 3ZYJA 4JN2A 4K71B 5F89A 1VGEL 5EU4B 4D0DB 1J1OH 5ALBH 4X6CE 2WK2A 3GSWB 5I18H 4PJEB 4HQQH 4PJXA 3MRBB 3L95A 3ES6A 3GRWH 1JGLL 4TVPD 4F7CA 5EIQA 5JOPE 4LCIH 3PNWB 2GAZA 2AJ3B 4WUUD 2DJSA 3RGVC 3QPQC 4FRWA 5JXAH 1ORQA 4IRJB 3NMEA 1T5XA 2FH6A 2M1KA 4P2QD 5BS0B 1FDLH 3VI4F 4QTHB 3H0TB 1AKJA 1P53A 3F7YB 4KDWA 4MXWH 1HQ4B 1SBSL 2DJUA 2WBKA 5IVNA 5DEGA 5ISZE 4NBZB 2YSSB 4HUWA 1D5ZB 4P5TB 5IVXE 2D7OA 1QRNA 4R90H 4RFNC 4AEFA 3T4YA 3FONB 3PGDA 5BMFL 3DVNB 3FQNA 1U42A 3EO1B 1UQSB 3LMJH 3F7QA 3QT2A 4Z7UF 1CXIA 1AIFB 4QT5A 1H0DB 3DO7A 1C5BL 5HGAA 1CLCA 3BHBA 3KPNA 5E9DD 4DEPC 5GJTL 1E6OL 5B21A 2HLAB 2JJSA 4L8BA 1RMFL 2IALB 4TTDC 2N7AA 4Z0XA 1ZLSH 2OLDA 4JO3L 4YUEL 5ID0B 3VI3E 4CJ1A 1BAFL 2N4IA 1SYVA 4LLQA 5DRXA 3HLAA 3PDGA 3V5HB 1QYGH 3OBAA 4I9WE 5D7KE 4RAHA 3M8OL 3NIFE 2EC8A 4NKMB 3UTTA 2HTLC 3KXFE 2APBA 3QJHB 5J11C 3UX9B 3GJEA 2XTJD 5GS0H 1F13A 4GFTB 4R6UA 1WWAX 3FCTB 3HE6A 2UWEE 1KIRA 5F7NC 5I1GH 5E99L 4CBPA 3WIHA 2VLJB 4NRXB 2NY3B 4IMLB 2Q3AA 3TZVA 3DYMA 3C6LA 1LEKB 3UYOD 5KS9E 5IWLA 4Z18A 5I8EB 5SWSA 4OTXH 1JMXA 4MA1B 3GI9H 4U6VL 4N90D 2RGSA 5HGDA 1MIML 4M7LT 2A9NH 2C3HA 3PP4H 3ROLA 1PG7H 3UAJD 5L9DH 2JCCB 1Q1JL 4L1DA 5CBEB 2ED7A 3VWKD 1GC1L 4S11A 5FXCH 1EO7A 4KFZC 3QDHA 2Y5TA 5E70A 4G8GA 4KDVA 4M62L 4OCXH 5D6CB 3BKCL 2R2BA 2G2RA 5LGKA 4H26A 3QXTA 2G75A 1MLBB 2ADIB 4UOW1 1NCNA 3HPLA 1K8DA 4AG4L 4DN4H 3BYYA 3OKDA 4KKNA 3WUWB 3F62A 3LKRB 1XIWB 1KJ3H 3AREB 1P4BH 4MJIE 1T1YB 1FZOB 4L3EE 5B39G 5DGRA 3WHXA 2GSGA 5JPNB 4UV7H 2R8SH 1YEJL 4JEGB 2OJEB 2X4PA 4RCAA 5DMGD 2GK0A 3S4SA 2HKFL 3SDCA 3JVGC 3SY0B 3WLWC 5MENB 2XKNB 1WZLA 5F7DA 3I75B 1HHHA 1U3HC 4UNTA 1A6PA 1IL1A 4OLZL 4P3CL 1ZLWK 1JGVL 2QQNH 1G6RL 2AXFB 1HWGB 1FPTL 2C1PA 2R29L 3DUUA 3RBSA 5EBWA 5IM7B 2J6EL 1T21B 1P84J 3VE0B 4LCWB 1WIPA 2XWBB 3G5YB 4WWKB 1OWRM 4UBDC 2VMFA 4GKSB 3ZYOA 3IDIA 1A4JA 2GITA 2IH1B 3MGTB 2NXYB 2Z92A 3RI5K 5FGRA 4XXDA 1F4WH 1DQTA 1XH3A 3F6LA 3D1MC 5CJ5A 2B5IC 3KPMA 3KPTA 1EGJH 1OAXL 1IGFH 1XGYL 1QEWA 4RMRA 4M5YL 5JO5A 4KUCF 4WFEE 2BVPA 3OF6A 2EEBA 2F58H 4NO5B 2XFXA 3MJ9L 4NN7C 2X1XR 4EDXA 3ROOB 2VXTH 3QB7C 1U8JB 4EKXA 4MAUH 1DUZA 4XX1G 3OGCB 5DYOB 4PV9B 2WWMD 5D5MA 5DURB 1WAAE 1IC4H 4KPHL 4U1KA 1YMME 5J6GB 1PKQA 2HFGH 1ZEAL 3NZHH 4C56E 1LK2A 4P3DB 1U92B 4Q97A 3V5KA 3QIUC 2ZPKL 3P9MA 2CDGA 4X9HA 3TCLB 1BVLA 2CPCA 1SY6A 3V6OC 4NO3B 3GMOA 1AFVH 1QTYT 5GSVA 3VFRA 1YEGL 4U3HA 1CICB 2AJYL 3FFCB 2WBJB 1FZMB 1T20B 1X5JA 3SOBL 4ELMA 3OKKA 4UT9L 4MS8D 5GRJL 4Z7NF 4HFUL 5SV3A 4JZNA 2FO1A 1DVFA 1AQDA 4PTTA 3CVHL 3VRJB 4GW5B 3VXRD 4JRYB 3G6DL 4K3JH 5HYJB 4HEPG 3LPWA 1DQDH 2R4RH 1BZ7B 3U2SA 4NQUA 1A1NB 5HY9B 1YN7A 4QRPE 1RJYA 1OSPH 2P5EB 2XNAA 1XF1A 2EDQA 4UMGA 1JZ6A 3U30C 5DVOA 2BSRA 1C5DB 1UM5L 3BPOB 4UAOB 4OLVL 2EIBA 1BOYA 1V3MA 1ZWIB 4U3CA 3NCCB 1U8LA 3EDDA 3VFTA 3TH4T 2HT3C 4L8CB 2JJTC 1ZHKB 1S5HA 1QKZL 5FYKU 1PLGL 2NLJB 3RY6A 4WI4A 2ARWA 5TJWK 5HGHA 3FHAA 5D7LD 2DYPB 1JNNL 4NPYA 4XP5L 5KJRL 1E4KC 2E5EA 3BPNB 4DKAA 4BSJA 4J4PD 4OB5L 2EYRA 2H1PL 3HMXA 3K2UL 5FV2A 3IFPA 4G6KL 4Z7WE 1K2DA 1WEJH 3TWCH 4XGZA 3QI9D 1V8HA 4P2RE 2FBJL 1XGPB 4LEXL 4LCCC 2IEPA 1CFNB 4MAYB 1KB5H 1MFCL 4YEFA 5I66B 5DEFB 5EFIA 5C07E 3K3QA 1G7LA 2MKWA 3G6AB 1IAKA 1JUFA 3MACL 5I1CH 2VE6B 1IGCL 3KNBB 3SJVA 2AXJA 5CEXB 4X6EB 5C1MB 1C1EL 3GMMA 1OPGH 3ILQC 4I0PA 1BQLH 2FCBA 4GUPB 2KUTA 4X5LA 1U8IB 5D7IE 2YXFA 1A3LL 4X9GA 4PJIF 2HYMA 5CINH 2HFEA 4K7PY 4HUNB 1BQHB 1KCVL 2QADD 1CLOH 4PJCA 3D0LA 4Q9QL 1VFUA 3O6KH 4WU5A 3SCMA 5A40E 5FYLD 5C0BA 5FHAH 4WUUA 5HYFA 1IMHC 5HHOE 1Q72L 5BVPH 1HXMB 1PYWB 1N0XL 1UH2A 3FQTB 5MEPA 3K4DA 1D5IL 4MVBD 4ZTPL 1MCFA 5KSVB 1OW0A 4X7TB 2OI9B 4MJ5B 2X4SA 1AD9A 5FUCC 4NQCD 4PBXA 3P4OB 1J18A 3VRLE 2NTFB 1JHTB 5FOBA 2NNAA 3U36B 1GOGA 4HUVB 1IEAA 4KHTL 3O8XB 1QFWM 3K1KC 2ATPB 4JFOA 5I19H 1PQZB 2ITCA 3C6SA 5F7YC 1FNEB 1NCAL 4N0UA 4PYGA 3VG9B 5E9DA 5FYJU 2BFVL 5JXED 3TBSA 5LXGH 3U9UA 5FAAA 1DLHB 4YHKL 1F90L 1L0XA 2XI9A 4XCNB 5IP4A 2ZNXA 4OGYH 1JWSA 3U0TA 1IGJA 4KK6D 5I1EL 4PJDE 3MOAH 1XR8B 1EVTC 1FC2D 2F54E 2E9WA 5J9PA 4MLIA 2KBGA 3X3FH 3OJMB 4JR9L 2XG4A 3UTSE 2CR6A 4KI5E 2PW1A 1KGCE 2EE6A 3HC0B 2P47B 3RKPA 1EXUA 1CLZH 4NKDB 4OJFL 1E6JL 4Z78B 2EEDA 4ERSH 5D2LB 1AGBA 3DARA 4NZJA 4K71C 3FQXA 5C2UB 3T65B 4S0TD 1DJSA 1QFOA 2DIBA 2XA8H 2V2XA 4ZUTA 3GMNA 4Y2DB 1HHJA 4JPIA 5B8CA 1YJDH 1IILE 1AC0A 3D3VB 3ZDZE 1N5YH 2J8UF 4AIXA 5E95B 3FB5B 4GW1A 4HWBA 3WS6C 3VWKA 1NMAL 3EOBB 5EO1B 3U4AA 1E4JA 5DT1H 2IBZY 4IRJC 2QHRH 3KJ6H 1R0AL 3VFNB 1OQXA 4OAWA 4OF7A 2GFBA 4HBCH 5DQDL 3VXPA 5BQ7B 1A6VL 4J12A 1XGUB 2VZ1A 1RUPH 1Z5LA 3VMNA 2GJZB 2VXSL 3SGJC 2MCPH 2AKRB 3VH8B 5HPMB 4IMKA 3B3IB 2K7QA 4P5TC 4LRNH 4BK5A 4ETYA 1KLUB 5FGBA 5JR1L 5IQ9B 1DQLH 4YDIL 3WIIH 3ZTJH 3I02A 1UXSB 1AP2B 2DOCA 1GL4B 3FFDA 4LSTH 3VFWA 5E1HB 5J4MA 1CD8A 5ICXA 1OF2B 4IDJH 1L7IH 1S5IL 1GSMA 3QWRD 1CBVH 3QXDA 3BMVA 4HKZA 4OLEA 2RFXB 1TETH 4KQ3H 4OSUH 4NJAH 3TBYA 4ISVA 3MLTA 4AIZA 5AYUL 4NNYB 1CLYL 1AD0A 5D71H 1YN6A 1BLNB 4UUJB 3RWGA 1JGUL 2HRPL 4EBQL 4F33B 4OT1L 4PJAF 4PLKD 4PR5B 3QIWD 1I9RL 5AYQA 1RURL 1NCWH 4DFHA 3MXVH 3L3JA 4RSVA 1ES0B 2NY3C 5CFHA 5J12B 5BRZD 4PLJD 3E8UL 4J3OC 4KDTC 4ZO6A 2QR0B 2BRQA 3I2CH 2MHAB 4TNVK 1YEIL 4KTDH 4MA1C 4Z6AT 5GGUA 5SWZE 4PJAB 4S2SA 2JK5B 2R0LH 5HJ3B 2EE9A 4QTIL 3T4AA 2AI0H 3LRHA 2YKLL 3BXNA 5IB1A 4QHUA 4ZS6D 3BZ4A 2F5AL 1GJIA 3IETA 3N1FC 4PYHA 1P5VA 1RZIA 2ZUVA 4UDTB 2ESVE 4MSWA 5JTWA 2XT1B 2MQ3A 1RU9L 1FCGA 4WEBH 5HDQL 3BQUD 4R4NC 3QCVL 4BSVB 3QULB 3QEQD 3KLHD 1ZT1B 2XTLA 4LVNC 3DRQB 5H37H 3W0WE 4MWFA 2FD6L 5CILL 4YDVB 1XIWC 3AREC 4MNGA 4OLWH 3HS0B 3IT8D 3VXMA 3TP4A 3WKML 2X4RA 3HG1E 2O5XH 3TCXA 3WFDH 4H25A 1ADQA 5IBLD 1P2CB 1LNUB 2FECI 3R8BB 4GLRI 4HC1A 4OFKA 5A3IC 3MRNA 4JY4B 4HEME 5EZIL 5AZEH 1WBXB 5IW3A 2GTWB 2YPLD 4MHHI 1X4XA 4YHIB 2F19L 3EYVA 1P7QB 2DQJL 4HS3B 1CFSB 4Q9CA 2WNGA 3QG7H 4JPVH 3VGBA 3BKJH 3VXRA 4C58B 3WEXA 3K4AA 1U8HB 3JUZA 2IAMA 5CGTA 3WS3B 1XCTA 1JTTA 2P42B 2CDEA 3NABL 1X4ZA 5F21B 4WWKC 3P4NA 3ZKNC 4U7MA 3UTZA 4DCQB 4PPTA 4WDIB 4ODUB 4PJ9C 4P3WA 1HZHL 4F7EA 2XOTA 1AE6H 2VDKH 3K2MC 1EVUA 1F4XH 4XH2B 2YA0A 4DVRL 2IMNA 2PYEE 4QOKE 1ZT4B 4UV4L 3LN5B 3UC0H 2ORBL 3P0YH 1LEIB 1KLGA 1FNSH 5GGTH 2NW3A 4GOSA 4V1DE 5EUKA 4LK4A 3SE8H 1HWHB 4J4PA 4K55A 2G60L 1MFDH 1ONQA 3ZE1E 1NCDH 1HN1A 3CZFA 1A22B 3QI9A 1FNAA 3OKMB 4PY8J 4QYOB 3PHOA 1CDJA 2DKUA 5TDPA 3IVKA 1HHKB 2FJHB 2GI7A 3I6GA 4LCUA 4HT1L 4ODBD 3LB6C 1N64H 1WQVT 3B4NA 4NNXB 3NGBB 1OY3B 2DLIA 2VDML 1MY7A 1S3KH 3NCMA 2WIIA 4R4BB 4G9DA 5MEQB 3DMMB 2DBLL 5EU6B 1NLDH 3QQ3A 2WBJC 1RV6X 4X83A 3D69B 3MROA 2NX5D 2VLRB 1Q8MA 2V5TA 4IIQA 3G5XA 5E2UH 1RK1B 2A1WL 3V95A 1N2RB 1PFCA 2Y6SC 2ZNWA 3QO0A 3V2AR 5EA0L 4QHMA 2MTPA 2HWZL 1W72B 2HJKA 3IYLW 1OGTA 4KK5D 4OQTA 4NQVB 5D9SB 1G7MA 3VG0L 1GGCH 3PXJA 4QRQB 4S1DD 5E2TH 3E3QE 3B8SA 5H94A 1QP1A 4FXLA 1V7NL 3G08B 4M43L 1ACZA 1FNFA 3BO8A 4CVZB 4JM2B 4NOFA 1A7PH 2YD9A 4NQCA 1CFVH 4FQHB 3FQWB 4PRPD 5EUOE 2R69H 3V9FA 3BPOC 1A2YB 5JOPD 2DIJA 3EO0A 4UAOC 5HBBA 2C9AA 5HYSG 2VXUL 4RMSA 3M45A 1FSKB 2LVEA 2VITB 2OTUB 2ENSA 1F58L 4IHOB 1MY5A 3QEGH 4HF5H 2VQTA 3ZLQC 5CWSB 3QJFB 43CAB 5GJSL 4I18B 4BQ8A 1S9WA 5I1AB 3UTOA 5JXEA 3QR2A 3BPNC 2IBGA 5LGJB 2X05A 3EJZD 3A67L 1OARH 5E8PA 1C12B 2BDNH 3LKNB 5INDB 5IIEB 4LKCA 4X0KA 5IR1A 1W0WB 1JPTH 1QFUH 4LSQL 5ACZB 4MAYC 1JRHH 3C9NA 3UJJL 5GISH 1KIQB 1VGEH 4D3CL 5AWNL 4YZFF 1OAYH 3EOYG 1TVHA 4Y5VB 1F8TL 1UZ6F 3NTCH 5CEZL 1CFQB 1JE6A 1M6OB 1Y18A 3IU4L 3GSVA 1G7JA 1DL7H 4W4OA 3FRUA 1HHIA 3KXFD 2V6HA 3VDCA 3IDMB 3T77B 4PGCB 1UCTA 4KRPD 3U48A 2C1OA 1A9EA 3N06B 3U46A 1KF9B 1UVQB 1NAKH 4PJ8D 4HZLB 2DTMH 2KH2B 1NANI 3TYFB 1IAIL 3T3PE 1MHHB 1XCQA 3W39A 2EYSA 3HCVA 3OAYK 3C8KA 4HW6A 3GDBA 4HFWA 4PJ5E 3RWDB 3KPLA 2XZZA 2OI9C 3R06B 1ZT7B 2JLLA 1JI1A 4Q6YA 5HVFB 4JG1L 5IOPA 3B9VA 3V6BR 5ESAB 2V2WA 3PQYA 4U6HA 2PYFB 3O41B 2VYRE 3GB7B 4CRPA 3IS0X 1DE4A 3VCLA 4EDWH 1S9VB 3BGMB 3O8XC 3FOLB 1T7WA 5GJTH 3UEZA 3HMWH 4XBGB 3RPIA 4QNPF 5D1QB 1RMFH 1U8NA 1NDMA 4DGIH 1QQDB 5GGSA 2B1HH 3VJ6B 3X11B 2VZ3A 3VG9C 4ZSOE 1WCBB 4KJWD 4YDJA 1R5WB 2BXZA 1HEZA 5J6HA 2Q3ZA 4GG8B 1HK6A 1MI5B 4N0CC 3SQBA 2VZVA 4HWEH 2C5DC 1QFWL 1U0QA 4L3ED 4WNQA 3BGFB 3ZKSD 1DBKL 5E99H 1XGTB 3T0VA 5DZOA 5HXMA 1FIEA 5LBSL 4X6DB 1WC7B 1ZA3B 4Y8DC 3H7BA 3QIWA 1BD2E 2AK4A 2W91A 3TA3D 1FYTB 5T3ZL 2Q6WB 1ZANL 3F7PC 4Q0XL 4IRSC 3S96A 1CF8H 4L4TE 5K9QG 1MIMH 1ACYH 3CU1A 4YHML 4H1LB 4NZDA 4Y2DC 3SE3A 1J8KA 1OCWH 5FA3A 3C5JB 1OM3L 3KYOB 5FM5O 4RMTA 3SDDD 4PJ7E 4TQEL 1JFQL 3V6FA 4JQXC 4M62H 3BKCH 3MRPB 3AY4A 1FL5B 3HR5B 4RWYH 1ZS8B 1VADA 3TESA 5BCAA 1X3DA 2WLYA 3OHXA 3TT3L 2G9HA 4ZOEA 3MJGX 3MRCB 3EGSA 2EKJA 3D39D 3BQUA 4MCZA 2O61B 1EO8H 2FGZA 1TMCB 3QEQA 3O6FD 3T0EE 4BH7B 1DQJB 3MRFA 3RAJH 1YEJH 2VZSA 4QRRD 3V6ZA 1D5BA 2Z93A 2NTSP 5KSAB 2X4OA 4FN0A 4AY0A 4LLYA 4QXUL 2FWOA 3KPPA 3CSYA 4FQQB 4NDMB 3WIFA 4X5WB 3OR7A 1YMMD 4JN2B 5F89B 4AJ0A 1KFAH 4GKOA 4C56D 1M05A 1JGVH 4WJ5A 5GGQL 2R29H 5GS2H 2J6EH 2YPLA 4PJXB 3L95B 3ES6B 1OAUL 2P4AB 4F7CB 5J1SC 2QHLA 3QXAA 5K59E 4JFHD 4JFDD 2GAZB 1KT2A 4NT6A 2F5BH 3C87A 5BW7A 1M7DB 3AM8C 4LKXA 4LIQL 1UZ8B 2ADJA 1F42A 3OWEA 3D87B 1ORQB 4NM4L 3S3SA 1T5XB 2AQ3A 3MRRA 3CFJA 5HYIA 1AKJB 2PW2A 4YLQT 5GSRA 1TJGH 1V5JA 1A4KA 2DL9A 4M5YH 5DEGB 5FV1L 5TQ0L 4HUWB 3HAEA 3V52L 2W59A 2ZCKH 1I3UA 1MRFH 1QRNB 4G5ZL 4GAJL 3T4YB 3PGDB 2X7LA 3FQNB 4XNMA 4ZFOA 4PRHE 2OR8A 1MUJA 1BQUA 4QT5B 5EZJA 5JHDD 3DO7B 5CGYC 1ZGLM 5HGAB 4U0RB 3BHBB 5DFTA 3LPFA 4K7PH 1UM4H 1SQ2N 3KPNB 5E2JA 3BWAA 3WUWG 4R3SA 1ZEAH 1JGDA 2ZCHL 4L8BB 3RKDC 3PGFH 1CGSL 5CS7A 4Z0XB 5ESQA 3PJSA 1F2QA 4NC1C 1PG7X 1SYVB 2B4CC 4LLQB 1EHLL 2DL2A 5DRXB 3HLAB 4FA8A 1QLFA 3WKNA 1FL6A 4WW2F 1VFAA 7FABL 3UTTB 4HGWA 2APXA 4YXHL 2B20A 5BO1L 3GJEB 2PF6A 4G42A 2FB4L 4UT9H 3HE6B 4IOSD 3MA9H 1KIRB 5C08D 5TE6H 4P2RD 1R3IL 4PRAA 2QSQA 3ARRA 4PJHA 4JFFD 3TZVB 1GVIA 3G6DH 3KPSE 3C6LB 5C07D 5D72L 5I15L 1QOKA 2J5LC 2OK0L 5SWSB 4OFVA 4ORZC 3L3IB 4F2MB 3K8MA 3SEPA 3CSBA 2FSEA 3LN4B 5CZVH 5HGDB 1ERNA 3ROLB 1PJ9A 3B8YA 1JBJA 1UM5H 3L1OL 3HE7A 4OLVH 3BKYL 3HPJA 5GGVY 1PY4A 2Y5TB 4XNUH 5FCSH 1I8LC 4G8GB 5KN5A 1VGKA 2G2RB 2H3NA 4N8VA 1JZ3A 4H26B 1PLGH 2G75B 5IMOA 3BT2H 4FTVE 4OCLC 5HHOD 1MCOH 3HPLB 2FYYA 3WFBH 1K8DB 4XP5H 3WFEH 4LDOB 4K3EH 3OKDB 3MSPA 4OFYD 3GJFA 5HHVH 5ADPL 1HNGA 3U6RA 5A2IH 2D0FA 4OB5H 4DUWA 3BIAX 4DJMA 2ZG3A 3RBGA 4G6KH 3WHXB 2GSGB 2FX8L 5E24E 2R1WA 3QXWA 2FBJH 4WHYH 1Q9KA 5IVXA 2X4PB 1GIGH 2GK0B 1MFCH 3QUYD 3S4SB 4HHAA 3SDCB 5F7DB 5FKPA 5JORA 1HHHB 3WD5L 3MACH 4Z7QF 1IL1B 1KEMH 2Z91A 1C1EH 5T5NF 4MA8L 4YHZH 4H0GA 1A3LH 3JV5A 4YK4C 1AGDA 2C1PB 3DUUB 5IW1A 4LPWA 4GXUN 5EBWB 3RWFA 3OKYA 2R56H 4Y0GA 3B2VH 3DMMC 2F54D 5IHUH 4DK3A 4UI2A 3IDIB 4TVSa 3KXFA 1A4JB 2GITB 1Q72H 2CIKA 2Z92B 1KGCD 1N0XH 1OLLA 4WO4C 4Y16D 3U9PL 3WV0A 4KQ4H 4XXDB 3H3PL 3OAUH 1CZ8L 4XP4H 1XH3B 4PJ8A 1MJ8L 2UWEA 3KPMB 5EZOH 3GSXA 1QEWB 3HNSL 4PRNA 4D0BB 1NCUA 5JO5B 3MLYL 5B39A 12E8L 3JWDL 1Y6KR 4V2CB 2BVPB 4UTBL 4XWOD 2EECA 1FGNH 4URTB 1A64A 3A6CL 2XFXB 4EDXB 5KS9A 1I7UA 4JM2C 3CCHA 1CD1A 1JJUA 1DUZB 3UPCA 3SGKA 5D5MB 1U3ZA 3T04D 5D2NE 1CXFA 1NCAH 1PKQB 1FE8L 3MNVA 1KYOK 3INUL 1LK2B 1FSKC 3SHSA 1TNNA 3V5KB 5J06A 4JJHA 4WUKL 3P9MB 4LHQB 2CDGB 4DZBB 1D5XA 3ULVH 4G6FB 4X9BA 2YD3A 4I18C 3GMOB 4XP1L 2BC4A 4UQ2A 5GSVB 4ZG1A 3VFRB 4QEGA 1SEBA 1GHFL 3AB0B 1MOEA 4MCYA 3PWLA 4HCRA 1ZHNA 4ELMB 3OKKB 3S36L 4OZIE 3RZCC 4PD4J 5DD0L 4OJFH 4BUGA 2ARJQ 4MJIA 1TQBC 4JZNB 4L3EA 1E6JH 1YA5A 1DVFB 2UYLA 4PTTB 2COQA 3D0VA 3GHEH 4DK6A 1BQHG 3RQ3A 3ZTNH 4BH8A 2DDQH 5E7BA 2QLVB 4Y5VC 1B0WA 3U2SB 3MV8D 4GRMA 2VIRA 4CADA 3G6JE 1YN7B 5DVNA 3VXSE 1RJYB 5CHNA 2XNAB 5HD8D 5J56B 2BSRB 3P11H 3TF7C 1KPVA 2EC9U 1KCRH 1RIHL 2DBJA 4LNRA 2H26A 4U1SA 2ADFH 1U8LB 3VFTB 1IGIL 2WUBL 1KB9K 1S5HB 5DQDH 4RMUA 5C7XH 2I26N 4UNVA 4ZNEE 5HGHB 2GK2A 4MXQD 3NCBB 4AL8H 2V5RA 4NPYB 1MCNA 2SEBA 1LK3L 2IFFL 4YQXH 1BVZA 1TITA 5EOCH 5JR1H 2EYRB 4POYA 3IFPB 5DS8A 3UCRA 1K2DB 5SWZD 4XGZB 4UBDD 5JNYA 1LO2L 3MFFA 1OB1A 2NMSA 4GJTB 1S5IH 2F8XC 4WGWB 5EFIB 4U6TA 1G7LB 5D1QC 1AR1C 1IAKB 1IQDA 1JUFB 1UB5A 2EDFA 3RA7L 1B4JL 1IFHL 4M5ZL 3SJVB 1JNHA 3QAZB 5GZOC 3GMMB 1WAAA 5DLMH 5AYUH 4I0PB 3DECA 1YMMA 1WTGT 4M1CD 1R3KA 4LCYB 1Q0YL 4JGJA 4C56A 2HFEB 3S3PA 2BVUA 2MQCA 1X5YA 4KGLA 5C09E 2NYYC 4PJCB 3GIZL 1MCCA 3W0WD 5FDWA 1IQWH 2HRPH 5E7FA 4OT1H 4HLZH 3MV7E 4KROD 4WU5B 1TPXC 5CUSH 3SCMB 4P4KA 4XNZB 5C0BB 4ZOCA 4WUUB 3ZT7A 3HG1D 2OBGA 2VXQL 3MUZ1 5T1LD 3QRGL 4WI6A 2GQHA 5MEPB 1DBBH 4U1LA 3BSZH 4NBXB 4JKLA 4UILH 2M2DA 5L8KB 2X4SB 1AD9B 1MCIA 2B4CL 1Z2KA 3PE9A 3TO4D 1YEIH 1M4KA 2OP4H 1F2XK 4I3GA 3H42L 1WT5C 3QEHA 3EOAA 2B0SL 5FOBB 2APFA 5DRZA 1GXEA 1DBMH 1X5IA 2NNAB 3LH2H 4S1QL 4KZEH 1IEAB 3DVFA 1CE1L 3GBNL 4OZHF 5F7UA 5C9KA 1EFXD 2CO7B 1EBPA 4M48L 4JFOB 4AMKH 2ITCB 3C6SB 2WLZA 4N0UB 1RU9H 5KANI 5HDQH 1QHPA 5E9DB 1MF2L 3QCVH 1RVFL 1KOAA 4QRTB 5JW4R 3TBSB 4KVCH 3U9UB 1ZE3C 1NPUA 1VPOL 4UOW0 1JWSB 2DQIH 5F9JA 3U0TB 3S34H 3GMQA 1LQSR 1IGJB 2DLGA 3LEXB 3Q1SH 4QXGL 5CILH 5T3XH 5D70L 4C83A 2PYED 5TE4L 3RNQB 1F6LL 4JFEE 4EUPH 5J9PB 4LLVA 3WKMH 5J3HC 2C3VA 2PW1B 3CSGA 2OZ4A 2Z8SA 1EXUB 1LO4H 5L8JB 4C59B 3CH8A 4R26L 5IFJA 4Z7WA 1AGBB 3WJJC 1A7RL 5HI3C 3EOTL 4P2RA 3FQXB 1INDL 2DJ4A 1JPST 3AGVA 4DGYL 2CSPA 4OCRL 4ETQA 1CTNA 5C07A 2V2XB 4ZUTB 5MEOA 1HHJB 1MCPL 4JPIB 1LVEA 5B8CB 1KTKE 4OZGF 1G7HA 3B5GA 3NABH 5TE7H 3K46A 5D7IA 4GW1B 4XRCA 3DRTA 1FN4A 3ILPA 4CVWA 3VWKB 4OZFA 1V3KA 2W9LA 3WDJA 1HZHH 1G7PA 2XKUA 4OAWB 5JOEA 2GFBB 3VXPB 1IM9A 1Z5LB 2Y07L 3H3KA 4DVRH 2E27L 5HHOA 4K8RH 2ORBH 4OGZA 3U7AA 2F53E 3U83A 2DLFL 3MJ7A 5JA9A 5JQ6L 3BZEA 3I02B 4OFYA 2NY1D 1HNFA 2G60H 1VACA 3FFDB 3VFWB 5L0QC 5ICXB 3SGDH 3DETC 2P5WE 2P1YA 1S9YA 2JJSC 5MHSE 3QXDB 4HKZB 4LMQE 4CDGC 3MRMA 3NOIA 1OTUC 2XQBL 4CUCA 3TBYB 1FORL 4ISVB 3MLTB 4JDZA 5DJCA 4AIZB 3ARSA 1GPOH 4JQIL 4ZTOL 3GRWA 1W72L 5FGCE 1AD0B 3VGGA 1K6QL 1RAMA 4YHYB 4DOHE 1YN6B 2F15A 5SWQA 4XBPA 3RWGB 2UZXB 2DI8A 4Y4FD 5IMLA 1CDBA 1JF6A 3HE6C 4PJDA 5L7XL 5FM5M 4GMTL 2A6IA 2F54A 4U1NA 3OXRA 1CVRA 2QQKH 4JFZL 5CD5D 3L3JB 2NY0B 3ZHLA 3UTSA 3TZVC 4YHLL 4Y16A 5GS3A 3CSPA 1J87A 1DLFL 3BE1L 3EYUH 3VG0H 3MRKA 5IWLC 2VO5A 3HC3L 4JPKH 1V7NH 5E8EA 5KVDH 5GGUB 2RAMA 4S2SB 1U93B 1YEEL 5C6WH 5I1HH 2VH5L 4HIHB 2E9JA 2OX5A 4MA3A 3T4AB 4R4FH 3BXNB 5IB1B 5IBTL 4P57A 4QHUB 3BZ4B 3CAFA 3IETB 2D4FA 1RZIB 4MSWB 3BRGC 4FS0A 3MGOB 4FABH 2Z31A 4OIIH 1FIGL 3IFNL 4LSPL 3FO2A 3UZEA 4FFYL 4LHUD 2J8HA 3A0OA 1ULVA 1JF1A 3BKML 4MWFB 4CGTA 3E6FA 4MNGB 3RVTD 3VXMB 3UBXA 2X4RB 1JVKA 4CNIA 4H25B 5DJ6A 4LSQH 1Q94A 2HH0L 3ARGD 2BK8A 4HIEA 1Q9OA 4F37F 5B38B 3SDCC 3BH8A 1DQML 5I73C 5F70A 3MRNB 1P84K 4IRZL 5ANME 1F3RB 3T1WA 3SDXE 3EYVB 1FNLA 4L9LA 5GRZA 3O6LL 4RGOL 3LQAL 5CEZH 1HOCB 1IGML 5I1LA 3VXRB 3WEXB 1NDGA 3BN9C 4P5TD 4BK4A 5IHLB 2IAMB 4OFDA 1PSKL 2QQLL 4UT6L 1XCTB 1MCRA 1QFHA 3ME0A 2CDEB 2DQGH 1IC5H 3QNYA 2X1WL 4FQLL 2QEJA 3B9DA 4HJJL 3UTQA 3UTZB 3S88L 3ULVE 1HKFA 3HN3A 4HJGA 4ZO7A 4F7EB 1IAIH 3P4MA 3NPSB 5ID1A 5DD5L 1BD2D 4CJ0A 3KPQA 4R0LA 1JZ4A 5GGRA 4I77H 3LRSA 4BSWA 2VLKE 1KLGB 3GFUA 3L5IA 3LRGA 4GG6F 1J86A 5J13B 1G9ML 2P8PA 4M7JL 2NW3B 4R96A 5TDNB 5EUKB 4A2MA 9CGTA 1N0LA 1WLHA 1ONQB 4FQ2L 1IVLA 5SWZA 1SYSA 4G6ML 3CZFB 3QI9B 4L8SA 1AGFA 1H5BC 1E4XH 4P48A 3EYQC 3PHOB 4JM4L 5C0AE 5IT2H 2NY3D 2P8LA 1I1CA 3B2UC 1KCKA 3NBNA 3I6GB 4TSCH 1GZPA 1JYWA 5SX5K 1T89C 1BGXL 5F1IA 5FUOH 2ESVA 4F57L 4DFIA 4U2YA 1U8KA 1UWEL 4XPTL 4D2NA 4PGZA 1QR4A 2WIIB 4LAJH 4G9DB 4MXVE 1HDMA 2ZOLA 4HD9A 4XP9L 1QR1A 3IKCA 3QQ3B 2QKIA 2ZG1A 1MRDH 1BMGA 3W0WA 3MROB 3HNTL 4QWWC 4O5LH 4IIQB 3G5XB 2WIMA 2GW5A 2W0LA 3QO0B 1DVFC 1EAPA 4QHMB 1YPZE 3CJJA 1EGJA 3HG1A 2HJKB 5T1LA 1OGTB 5T3ZH 1ZANH 2DTSA 3K7UA 4GAFB 2VOTA 1OT1A 1G7MB 4GBXD 1YEFL 4F15B 4HSQA 5H94B 5JMOC 3BO8B 3VXOA 4NQCB 1DFBH 1R3HA 1OM3H 4JDVA 1J12A 4JANA 3EO0B 1YEHL 4X8JA 1ZGLP 3GZKA 2IWGA 2QQQA 2EH8L 1EFXA 3BI9X 1JV5A 4ZDHA 5IEHA 1QFWI 3CK0L 1SJVA 3ZDXE 1LO3L 3RY6C 2Z4QA 1J1XL 1A3RL 4Y5YA 1S9WB 1F4AA 3REWA 5DMKA 5IQ7H 1UGNA 5KG9A 3FKUS 1XGQB 5D1XD 4LP4A 1M71A 5E8PB 3HFML 4PRHD 1KJ2A 2X40A 4LCWD 2PYEA 4MJ2A 5KOMC 4LKCB 4X0KB 5IR1B 1L6ZA 5C2BL 1QLEL 2AEQL 1NKRA 4LOUD 3C9NB 1A1OA 2UZIH 2NXYD 3TO2A 5GGVH 2NY5C 4EI6A 3VGEA 1J5OL 4RGNE 1TVHB 4FQ1L 5GGQH 1NC4D 3QAZC 4ALAL 4HPOL 2R9HC 2VC2L 1KXTB 4IEFB 1Y18B 3GSVB 5TQ2L 4N1EA 3MUY1 1G7JB 2P8MA 3QRFM 4HPYL 3FRUB 1HHIB 3BUYA 4B50A 1BFSA 3T1FA 4LIQH 1A6TA 1YYMH 2C1OB 3DIFA 1A9EB 3NH7L 3U46B 1K9TA 4NM4H 2D7NA 1WZ1L 1CL7H 5MP6L 1F00I 1IKNA 2O5YH 4Y5XA 3LEYL 4H1LG 5CP7A 5T3XE 3ARYA 4JGMA 1XCQB 3CIQA 3W39B 2EYSB 2V9QA 2FBOJ 1AHWA 1R24A 3EYSL 3HCVB 4RQQA 3C8KB 4PJGE 4HFWB 3KPSD 3V52H 3KPLB 5GXBB 5EN2A 5IOPB 2V2WB 3PQYB 4HV8B 2Y7QA 4U6HB 5KAQF 4JO4L 1SJHA 4TOYL 2WP3O 1DE4B 3VCLB 5I6XB 1CICD 1DP0A 5IB4A 3FFCD 1KB5A 2IJ0C 2W60A 1JN6A 5HHPB 3RPIB 1U8NB 3Q6FA 4DAGH 1NDMB 3MLXL 4H5SA 1IEBA 4JCLA 5GGSB 5EUOA 4S1RL 5LCVL 1T2QL 4YDJB 3BDBA 3WIHL 4FG6D 4FTVD 1HEZB 5AD0A 5J6HB 7FABH 3WE6A 5L2KE 4KJYB 4YXHH 1MREH 5BO1H 4FQJL 4KAQL 4H88L 4R97C 5BZWA 6FABL 4HUUA 4FNLH 3BH9A 3VFUA 4PRDA 4WNQB 1CE6A 1A47A 2X1PA 3VFGL 1A5FL 1R3IH 2XTJC 4X6BA 5HHME 4Y4FA 4NM8L 2BOCA 2D03L 3H7BB 3QIWB 2AK4B 2P24A 5D72H 5I15H 3FQRA 2OK0H 3DV6A 3OAYH 3MR9A 1NH6A 4M7KL 2HJLA 3S96B 2H8PA 4Z7VF 3BD4A 3NA4A 4C55A 1RUQL 1NBVL 5C0CE 3SO3B 3L1OH 2YRLA 5FA3B 4UT7L 2GCYA 2IPUK 5B8CC 4WFHE 4X7SL 5D7JD 4XMLL 2YD4A 3V6FB 3OB0K 4HXBL 1JPSH 3UAJC 3PDOA 1OP5K 3O0RH 3KDMA 4ZFFA 4XB8A 3VWKC 5SX4H 5I2IA 1VADB 3LV3A 3MTRA 4XCYA 3OHXB 5D8JL 1YY9D 2G9HB 4AM0A 3V0WL 3BP7A 4JHAH 4Z95L 5KVEL 4RWHA 3CMOL 3EGSB 2NY7L 3BQUB 1MFEL 4MCZB 3CXDH 5ADPH 1NGYA 4D0DA 3QEQB 4IMKC 4LHUA 1EEUA 5ACMA 3MRFB 5FGBC 1MELA 4PJ5A 3V6ZB 3DX9A 2ZUWA 1D5BB 5DD1L 2Z93B 2JELH 2CRYA 3KWWA 5EO0A 2X4OB 3MFGB 4LLYB 2FWOB 3KPPB 3WD5H 3CSYB 1WJ3A 4KV5F 4RX4D 1NCTA 4PGEA 3WIFB 3OR7B 1FAIL 5DMGC 3ARGA 3K4ZA 1M05B 2AABH 3S35L 2E8YA 2YPKA 4WJ5B 3QCTL 3NN8A 2X9YA 2X44D 2YPLB 3EKCA 3FN0L 5BJTA 1TZHA 3WSQL 1A3QA 4N9GA 1LP9E 3F7YA 5T1MA 1M1SA 3KGRA 3QXAB 2ZJSL 4ZSOA 3U1SL 3L3HA 3ULSA 1S7RA 1KT2B 3MLZH 4NT6B 4YHYC 5ALCL 1NUFA 4LKXB 2Q8AH 2CO6B 3BWUC 3TBTA 2ADJB 3AS3A 3U9PH 2W0FA 3KS0H 3MRRB 3WXWL 3CFJB 3CLFL 2CD0A 1MJ8H 25C8H 5CIPH 2PW2B 5GSRB 1A4KB 3RUGF 1FV1A 1JRHI 3HAEB 4UTBH 1BWMA 2C7UA 2X7LB 3EAKA 1S7WA 4ZYKA 4XNMB 1BD2A 4ZFOB 5FYKH 1MUJB 1SY6L 4FQCH 5E6YA 4TNWK 5E6ID 1ORSA 5EZJB 5JHLH 1IBGH 1IZKA 1FNGA 4L4TA 1B2WL 3BWAB 1FE8H 4MZ2A 4R3SB 3BYTA 1JGDB 2H32H 5DD3L 2EDBA 1FGVL 5ESQB 2VDNL 2W07A 3PJSB 2WWMC 3P40A 4PJ7A 1QLFB 5SV4A 1NMBL 1FL6B 4PJHF 3O6MH 1VFAB 3QUMH 4RA0C 3S4SG 4XP1H 4HGWB 3CFIC 2FEEI 5DI8A 3VI4E 4JN1L 1CDGA 3MYZA 3MJ6A 1L0QA 1L4IA 4G42B 5I8EA 4N9OB 35C8H 32C2A 3D3VD 2FL5A 2Z8VC 4OUUA 3RDTD 5DD0H 4OD1H 3KR3L 2DIAA 1MAML 4XCEB 2DQHL 4PRAB 5EB9A 4PJHB 1EIBA 4Z7UE 1IAMA 4MS8C 4HMCA 5EO9A 1RK0A 3P77A 4XNYH 1HYSD 1Z9LA 1EJOL 2PXYA 4LLMB 4M93B 2FSEB 5T5NG 5DJ0A 5I71C 2FNBA 3V7AE 4GBXA 3X3GL 1RZGB 3QHZL 5T1KA 4X6CB 3HE7B 2DQEL 1OAKL 1RIHH 3HPJB 3TBWA 3O4OB 3HMXL 2AXHA 1MFBL 5KN5B 1KN2L 2IBZX 2H3NB 1EHXA 4N8VB 4QHLA 3SBWA 1UKQA 4NFDA 4YWGL 5IMOB 4NQDE 1Y6MR 3I50L 4DQOH 2FYYB 2W9EL 3HTLX 5IF0A 1KXQE 1T04A 3LCYA 3RL2A 2WP3T 1LK3H 3I9GL 2IFFH 3GJFB 2JTDA 2ED9A 2H2PD 3U6RB 5EWIH 4LGSB 5FYJH 5HSFA 2AXFA 2A83A 2FEDD 5ISZB 2R1WB 5D1XA 1Q9KB 5IVXB 4F9PA 4J4PC 3UXFA 1FYHB 4HHAB 3BVNA 4PRHA 1TVBA 1TQCB 3BAEH 3TEUA 1TJHH 5FKPB 5JORB 1IFHH 3QI9C 1U6AL 1NC2D 3LEVL 2Z91B 3WO4B 2HLFC 4YIQA 4UIKL 3VW3H 1KJVA 1AGDB 1UEYA 3B43A 3RWFB 4YX2L 1NC4A 2X09A 3LHPL 3QA3A 4FFVD 3IDXL 3GIZH 4OI9A 1T5WA 1OHQA 5AG9A 3VXUE 4XTRD 4F37K 1A6WL 1G9NC 3KXFB 5HDBE 3GUTA 4TUKL 5KS9F 2QADC 2CIKB 2N1KA 3QRGH 4IIQC 4WI9A 5LGHL 4PJ8B 2AEPL 4HX1A 1OWWA 2UWEB 1C5CL 1KG0A 3GSXB 2B4CH 5ERWA 2J8OA 3X14A 1J10A 1S9XB 5B39B 4MVBC 5I8KL 2B0SH 4F15C 2DKMA 3KPSA 5EOQL 4S1QH 3ZHDA 3IJSA 5KS9B 1I7UB 4K3DL 3PWNA 3GBNH 2NZ9D 1F4YH 1CD1B 3CCHB 2EXYD 3S7GA 3NCEB 5C6TH 4U33A 3MNVB 5F1OB 1MF2H 5I1IL 2CLVA 5DQ9B 1R3LA 4LIQE 1RFDH 1D5XB 5D70H 2BC4B 4OD3L 4UQ2B 4FTVA 5JXEC 2WUCL 1UKTA 1SEBB 1WFTA 2XZCH 1ZHLA 4MCYB 2F53D 4J2XA 3PWLB 2XPGA 4KU1A 1ZHNB 3PL6B 4IJ3C 5GS1A 4KK6C 3WNLA 4KK9D 1IGYA 3SKNA 1JGEA 4NWTL 4MJIB 4GS7B 4L3EB 2UYLB 1A1MA 3LOWA 3D0VB 3KYKH 4HWBL 4RZCA 1Z0NA 2P5WD 3EOTH 4MDIA 1INDH 4BH8B 5KVMC 1J0HA 3NCJL 4HS8L 1X5FA 1G0YR 5MHSD 2PR4L 4DGYH 4OCRH 3LS5L 5LVEA 3U79A 3QCUH 4GRMB 2VIRB 1QG3A 4CADB 1OQOA 5CHNB 2J88H 2X4UA 3GSUA 4O2CA 5TF0A 4CVUA 4W4OC 1KPVB 4HWUA 4DW2L 5DJ2A 4WEMB 4LNRB 2H26B 2XICA 5DJ8A 4U1SB 3OV6A 1AY1L 4WHDA 1BREA 5D7JA 3DOSA 3WYRA 1RZ7L 2A6KA 2IF7A 1L7TL 2LTQC 4FZ8L 3DURA 4FQPA 2VUYA 2Y72A 2M26A 3BP5A 5C3LD 4Z7NE 2E27H 2SEBB 2NPLX 1AXSA 2DLFH 2Z35A 1RZKC 5DS8B 3SE4A 3VGAB 2BSED 4MQ7A 2CKBH 3CPLA 1OGAE 3FQUA 5EU6D 4JKWA 1SBBA 3MFFB 3O9WD 1OB1B 4N0RA 4XPFH 5B3JF 5I6XC 5JNYB 5DO2D 1IQDB 1UB5B 3KLAA 2YD5A 3AC0A 3MLSL 5I30L 1BBDH 3GM0A 2XQBH 1UACH 1JNHB 4RX4A 5D2NA 1YMMB 5KZCB 1R3KB 5IGXL 4X9IA 1W72H 4XPAL 4C56B 4QXTA 2X42A 4W81A 1K6QH 1MWAB 3ZE2F 1N7MH 3NFPA 3TVMA 5FDWB 5JIKA 4P4KB 3HA0A 5F44A 4GMTH 5L2JA 4M7ZB 2FATL 2X4QA 4F3FA 4U1LB 2E7CA 4WV1A 4YHLH 4NFBA 4PLKC 3RX8A 4OKDA 3QIWC 1NFIA 3BE1H 4OZIA 4FFZL 1BJ8A 3ESUF 4PLJC 3QEHB 3EOAB 4DGVL 5DRZB 3QZWA 3SO3C 3SE3C 3ARPA 2E6PA 5IBTH 2PO6D 4C57C 5E4IA 5MEND 1X44A 4M4PA 3G5VA 3V4UH 2HN7A 3G6JA 5E6IA 4QRPB 3VXSA 4PJIE 2PETA 2ZZUT 3AY4C 4QCIA 1ADQL 5JW4Q 3ULVD 4H0IA 4HK3N 2HKHL 2EDYA 1YQVH 4HC1L 3T8XA 3RJDA 1UB6A 4JDTL 2FO4A 4CMHC 5L8LB 4OM0L 2FJGA 3BKMH 4XAWL 5F9JB 3GMQB 4I8DA 5D2LA 3RVUD 3BQUC 1P4LA 4C83B 5FKAA 3NA9L 5ECJE 2XACC 3KLHC 4ZNEA 2VLKD 2VDQH 4LLVB 5KTEL 2C3VB 4TULH 1Q9WA 4J3XA 1I8IA 4Y4KD 2YD8A 2HH0H 1DQMH 2GUOA 1BFTA 1CTOA 4Z7WB 1T66D 3NAAL 3RDTA 1KEGL 5FYKE 4P2RB 4C4KO 4LDEB 1KENL 4RIRA 5C0AD 4RGOH 5C07B 3DBXA 4UT6H 5MEOB 5HGGS 3RRQA 5C0RH 1G7HB 3ZSSA 1B88A 5I1JH 1KV3A 3O2WL 2AKRA 5D1ZD 1Y6NR 4P23D 5CSZA 5D7IB 5GIRA 5BW7C 3U4BL 4XRCB 1KLUA 2ENYA 3DRTB 1FN4B 3ILPB 2X6MA 2I27N 4OZFB 4F58L 4YHNA 1G7PB 4OCYL 5C09A 5F6HI 4LASL 3E1F1 4I1NB 3CU7A 4NKIL 4PB9L 5DD5H 1SMAA 1IM9B 3QWQB 2FX9L 2BVEA 1SVZA 1J05A 3BGAA 5HHOB 3PHSA 3F7RA 4M1GH 4XWGL 1HINH 5FGSA 3MJ7B 4M7JH 5F7WC 3BZEB 2P49B 3MRHA 5C0ND 4F9LC 2LU3A 4N8CH 1KC5H 3PP3K 1VACB 3NIDF 3MRQA 1T1ZA 2HVKB 3LVEA 3JTSA 3LQZA 4NHCH 3LIZH 1YECH 4G6MH 3CGTA 1S9YB 1G9NL 4JM4H 5C0FA 2GEEA 3MRMB 1UXWB 2J8UE 4PJDF 4M8VA 1D7FA 5B4MD 4JDZB 1FYTD 1BGXH 4FQIH 5DJCB 1H3GA 5FYLL 5GRVK 1NC2A 2J6EA 4F57H 4G43A 4X7FC 1BIHA 3SKJH 4GXUM 4L3CA 5B38G 3IDJA 3D85D 4OQTL 4X8XA 2X9XA 5SWQB 4XBPB 3B9KB 4LSVH 4KVNH 5BV7B 5IMLB 3HNTH 3N85H 4PJDB 3UZVB 2A6IB 2DRUA 2F54B 4FMFA 4I2XE 4U1NB 3OXRB 5HJ3A 5DMYA 2DQTL 4E0RA 5FM8A 4WFFE 5FYJE 2H2SD 5EIIA 5FCUL 3UTSB 4Y16B 1EPFA 1Z6JT 2CUIA 3MRKB 4HK3J 4RGND 3H2WA 4M93C 5E8EB 3ARBD 4KK5C 5IKCA 2LAAA 4MA3B 2DQCL 4PLOB 4S1DC 4X9FA 3THML 4P57B 3RU8L 1YEDA 3MOBH 4UTAL 5E5MA 1KSRA 1HSBA 4ODTH 4RBPK 3JWOC 2DQDL 2DMCA 2EH8H 2BNRE 4KHXL 3NCFB 2P43B 5KSAD 4ZPTA 4M1DH 2Z31B 2Q20A 4X80H 5HI3D 3FO2B 4PP2A 1J1XH 1A3RH 3EYOA 3TV3L 3VA6A 1B6DA 3RNKA 5KW9L 1JF1B 2CMRH 1WFNA 2MNUA 3E6FB 4BZ1L 3MV9E 4KZDL 3P2TA 3HFMH 2WV3A 3REVA 3UBXB 1IC7H 4X7DC 1YNKL 4NC1E 4CNIB 4YBQD 5C2BH 2AEQH 5DJ6B 2OXHA 1DBJL 4O4YL 1QBML 2F53A 3EJZC 3MLWL 1Q94B 4HIEB 3VFPA 1Q9OB 3BH8B 3OL2A 4NRZA 1TQCC 3GNML 3UZQA 4FQ1H 1CD0A 3WO4C 4L9LB 4ALAH 4HPOH 3CVIL 2AW2A 2BVTA 2P5WA 3WN5A 1WSST 5I1LB 2D3VA 1NDGB 3HB3D 2AV7A 2P44B 5FHBH 5FO8A 1P6FA 5L2KD 2QSTA 3W9EA 3H9HB 1ZLUK 4J3TA 4APQD 3MCG1 1RZKL 3QNYB 1X6LA 4TRPH 5AG8A 4P59L 5E00A 5EC1A 4TN9A 2V17L 3RWIA 3VMPA 4J23A 4HJGB 3LEYH 3UJTL 5TF1L 5CZXD 5CJ8A 4KRPC 4L3AA 5IG7A 1QSEE 3P4MB 2WANA 5HDOA 5ID1B 3N1MC 4MX7A 4PJ8C 1HXYA 2YMXL 5AEAA 3H9ZA 3KPQB 4R0LB 3S5LA 3MRDA 5GGRB 4BSWB 3LRSB 1IT9L 3CDGA 3UTTD 4JHWL 3GJFK 4NOBA 4JO4H 2P8PB 2CUHA 5CLTA 3H7LA 4R96B 4PGBA 5C0CD 1CQYA 2H41A 4ODXA 5L88H 2DB8A 2HA1A 1D5MA 5SWZB 1MHPL 1SYSB 4L8SB 2BVQA 5J0BA 5EU6A 1AGFB 4XAKE 3U0WL 3O9WA 4S1RH 5KOVC 4EOWH 2YOCA 4JRXE 5LCVH 2PTUA 4ZS7L 3TZVD 3C6LD 1GZPB 4XC1H 1RUML 3QUXB 4DKEH 5F1IB 5T1DL 4LLWA 2ESVB 2ZUXA 2V7NA 2OR9L 1U8KB 4AH2A 4Q58C 4KJWC 1HDMB 2ZOLB 6FABH 1QR1B 3IKCB 5I9QC 4LSUH 2FECL 2QKIB 1ZGLA 3I6LE 4CU8A 4YFDB 3W0WB 4R8WL 4O58L 2RCSL 4KROB 1UM6L 4HULB 1EAPB 4HMEA 4N1CA 3WNOA 1BX2A 3HG1B 3AVEA 5T1LB 3SGDI 2RJMA 4NO0A 5KSBF 3VGHA 1I9JH 5GHWL 3H6JA 1A0QL 2EIZA 3C60D 3TA3C 1W0YT 3C5SA 5TDOA 3VXOB 5ANMA 3O81A 2AQ1A 3NIGF 1HHGA 1R3HB 3SDXA 3NACL 4JDVB 4XMLH 5ICZA 4JANB 1EK3A 3MNWA 3RWHB 4HXBH 4X8JB 3GI8L 5LQBL 4FZEL 4JQVA 4YNYA 1F3JA 2PO6A 3U82B 3PABA 1CFBA 1EFXB 4WI8A 3SDCD 3EDFA 1JV5B 4ZDHB 5IEHB 2CH8A 1L0YA 4R7NA 3V0WH 3UMTA 5KVEH 3CMOH 2Z4QB 2NY7H 4Y5YB 3REWB 5DMKB 5GRVL 5KG9B 2R4SL 1M71B 1R3JA 3GKWH 4KI1A 2XZAL 1H15A 1NAML 3IU3A 1T80A 1KJ2B 3AROA 3VGAC 2PYEB 5DD1H 4QOKB 2ID5A 5KAQG 4JREB 2E7LC 2JE8A 2I9TA 2VLKA 4J8RA 5LWYH 1A1OB 4QGYA 4Y4KA 3TO2B 4EI6B 1I3GL 2DLHA 4V1DB 5E8NA 1XGRA 4PRIE 3MQIA 1BM3H 5GRYA 3QCTH 2NY2B 1EMTH 1T3FB 2VLME 5C0AA 2ZJSH 2DQFA 4LU5H 3QBTB 2ICWI 3BUYB 3ULUE 5ALCH 2GHWB 4G6AD 4GMSL 3T1FB 4ZFOL 1MVFA 1A6TB 1JHKL 3DIFB 1I85A 4G6JL 4P4KC 2I5YH 5D1ZA 4JVUA 4P23A 4Y5XB 5CP7B 4IOFD 1S9VA 1N4XL 3FOLA 1AHWB 1R24B 4RQQB 2XY2A 3TT1L 5IFHL 3QWOA 4WTXA 1TJIH 4ESKA 5EUOF 3DX6A 5IW6A 3CC5A 5EN2B 4XZUB 1YPZA 2Y7QB 4XNXH 1SJHB 2FH8A 3FAWA 5CJQL 5IB4B 4HUMB 1UZ6E 2P46B 1KB5B 1B2WH 2W60B 3SKMA 1JN6B 1PAMA 2NY1B 1FGVH 3Q6FB 1U8OA 4H5SB 1J0KA 3KAAA 5AUMA 2BRRH 5EUOB 1A6UL 4HIJA 5C70A 3P0GB 1CK0L 4XT1C 5F6HJ 4NQDD 5AD0B 2E6QA 1N6QL 3WE6B 3GO1L 1CDHA 1QSVA 1U3YA 3R0MA 5JIPA 1LMKA 1FVDA 3NFNA 3ELAT 5BZWB 5EDXA 2KKQA 3RY4A 4HUUB 2CK0H 5DD6B 3VFUB 3BH9B 3F58L 4PRDB 1CE6B 1IRAY 3D85A 3VMOA 1YMHA 4H1LA 1T0MA 2E7BA 2QBWA 4X6BB 4Y4FB 2BOCB 2CDFA 3JWOL 3WFHA 4JZOA 4Z0BL 2P24B 1AQKH 4TSAL 3FQRB 2IPTL 3DV6B 1J7VR 1BZQK 3MR9B 1OT2A 2BZDA 2HJLB 2H8PB 4QNPE 4U05A 1NUDA 1AGEA 1YUHA 3V4VL 3B5HA 1C16A 4PRBA 2GCYB 5A2LH 3ARBA 3SDYL 4OCWH 1JWUA 3BEVA 5IB3A 1MFBH 3HAEG 3PDOB 3KDMB 3MV01 4ZFFB 4PJEF 1Q0XL 1T7YA 5I2IB 4YWGH 3LV3B 1RUKH 1MRCL 4XCYB 5EOCJ 5EBMA 3I50H 1R5VA 3DLQR 2NY5H 4AM0B 4OLXL 3BP7B 4LARH 3I9GH 4DKDC 1BOGA 43C9A 4I0PD 2DI7A 4LPTA 2KQMA 1NGYB 4EUPA 4LHUB 1FZJA 3CMGA 3GMRA 1FBIL 4PJ5B 3EO9L 3DX9B 4YR6A 2Y06L 5F6IB 5ICYA 3KWWB 3F12A 5EO0B 2AAVA 4TNVF 3SCMD 4TVPH 5C0BD 4Q7DA 4PGEB 1M7DA 1EUTA 2JJTA 3LEVH 1UZ8A 3TJEL 3ARGB 5E4EC 4HIXH 3QUYC 2C3WA 4NZRH 1WVZA 3ZYZA 2YPKB 3NN8B 4NBYB 1A21A 2X2YA 5C0EA 5BJTB 5HHXL 1TZHB 2CUMA 5F88A 5IMMA 4N9GB 5T1MB 3IDXH 4JPWH 4ZSOB 3L3HB 4AT6A 3ULSB 1S7RB 3TBTB 5BV7C 4UU9A 2EH7L 4TUKH 5L2KA 4DWHA 3OB0H 4OBRA 1MAKA 2DMBA 4LCCA 3HHRB 1OP5H 2W0FB 4XC3H 4APQA 4BKLA 5LGHH 1NCBH 2FHCA 2AEPH 3HC4L 1DR9A 2D7TL 5JIIA 1FLRH 3IGAA 2C4FU 3BJLA 3MXWL 1FV1B 4Y16C 5I8KH 3S36X 2C7UB 3X13A 2CGRL 3O11A 3S9DB 1WICA 4PJ7F 1S7WB 4DUVA 4N8VG 5EOQH 1BD2B 4ZYKB 4D8PA 5EBGA 1ORSB 1U8QA 4KC3B 2C3GA 4OLUH 3G04B 1FNGB 4XWOC 4L4TB 1MIEL 2X10A 5C0CA 4HCRL 4MNQE 2RB8A 1I8MA 3MLUL 2X1QA 1NL0H 1EUUA 5IROA 4HIIA 1BP3B 5DFVD 2Z31C 3P0VL 4PJ7B 2LU7A 2JCCF 4IBLT 4XVTL 4L9DA 3DPBA 1QPXA 5HVWA 3R1GH 4G7VL 1U58A 4MNHB 4XCFL 4N8PA 2WUCH 5DI8B 4XBEL 4LQFL 4KWUA 4Y89A 5A2FA 3C08L 3L3IA 4NCDA 4F2MA 3LN4A 4GRWE 4KRMB 1I7ZA 32C2B 2FL5B 1GGIH 4OUUB 3T2NL 4KJPD 3SKUD 3T0EB 3TIEA 3UYPA 4X6FA 1A7OL 4NNPL 4W6YB 4EQ2A 1BWWA 2HT4D 3NCJH 1T2JA 5EO9B 1RK0B 3P77B 3S3JA 5K59F 2A77L 1A14H 2FX7H 4L9LC 3QPXL 2PXYB 5HHNA 1EAJA 5FK9A 5DJ0B 3ISWA 3JTTA 4GBXB 4WFGE 5T1KB 3TIDA 4DW2H 4MQXD 4XPHH 3L5JA 3C60A 5DUML 3TBWB 1MJUH 5DK0A 4OI7A 5HD8C 1AY1H 1LP9A 2EDNA 4KXZI 3AU1A 4M4RA 4ZFGH 4B5EA 4QHLB 4FZ8H 4LLUA 3QH3A 5BVJA 2ICWA 5IF0B 1T04B 3RL2B 4A6YH 2JJVA 3OMZA 3GBML 3WNNA 4OKVA 5DMJB 4R0LC 2ZKHH 5E8DL 4CN4A 4MXQC 4JRWA 2A83B 5KVGL 4PUBH 4AQOA 5L6YH 5D1XB 1REIA 5F7EL 2VKXA 3BVNB 4PRHB 4CVXA 3OG4B 1TVBB 4KJQD 4OD2A 1K3ZA 4L8SC 4XP6L 4PS4H 4HKXA 2IH3A 5F9OL 3CFCL 2NY0D 5TH2A 4ONGL 4YIQB 3STLA 1ZMYA 4FOMA 1KJVB 1U2HA 2AGJL 4XPAH 2YD7A 3SGJA 2A38A 1OSZA 2IGFL 1NC4B 3QA3B 4D94A 1KCSH 1NGZA 1T5WB 4M1CC 4D0BA 2NZIA 1KIPA 3GUTB 1T0NA 4ZQKA 1QFPA 4YXLH 4KROC 3I84A 4ZUVA 3Q5YA 4HX1B 1IC1A 1KG0B 3LKSA 4GSDL 5ERWB 3DXAE 3X14B 1MQKH 4Z7UA 4DGVH 1JZ8A 4Z7QE 3KPSB 3ZSTA 1KBGL 5I74B 1N6VA 5A43C 4GO6B 3IJSB 3PWNB 4DZBA 3GSNA 3KLDA 3TO4C 3GBLA 2YUZA 4UB0H 3VXMD 2ICWJ 2JB6A 3DSFL 2FRGP 5DMIH 3BW9A 1IARB 3CX5J 1ADQH 4YBLB 1KELL 2AJSH 2OZ4L 2XQYK 4YPJA 2CLVB 2LVCA 2WM0A 4JDTH 1R3LB 1A8JH 1QSFE 1W8NA 1NCCH 1UC6A 2VISA 5KSUA 4JFXA 1R6VA 1MEXL 3T0AA 2ZUYA 4FTVB 2MMXA 4NQDA 3VWJD 2IAMD 3DI2B 1ZHLB 4KH2A 3STZA 1NLBH 2XPGB 5F96H 3C8DA 3VFSB 5GS1B 4YH6A 1DUYA 1IGYB 1D6VH 3SKNB 5IHBA 4JREC 1JGEB 1CI5A 1A1MB 2BY3A 1DQQA 3NAAH 3FRPG 4RZCB 4O02L 2D31A 1J8HE 4MDIB 3AS2A 4PY8I 5JIHA 2D2OA 4W70A 1A7NL 3NFSL 4LVOC 5CEYA 5D7SH 4JCMA 1U3JA 2MKLC 2X4UB 3GSUB 3KJ4B 4ONHA 3IFOA 4Y1AE 4O2CB 3WJLC 3O4LE 3MRIA 4NWUL 5DJ2B 3U4BH 1J0ZA 1X4YA 1MLCA 4ODHL 3W11D 1JNLH 5DJ8B 4HJ0D 5D7JB 1RHHA 2A6KB 3DURB 1IKNC 4Y5XC 3V8CA 3T0WA 3VXUA 5HI4D 5CGMA 4NKIH 1UA6L 2VAAB 2HLFD 4FQXD 3BP5B 2PNDA 1N5AA 2AJZA 5J57B 1AHWC 5FYJD 3L5XH 2VZUA 5ALBL 1AXSB 2Z35B 2KDGA 4IM8A 2ZUUA 4HQQL 4ZD3H 4YEEA 2I60L 3GRWL 4MQ7B 2QSCL 3CPLB 4LCYA 3FQUB 1I1YA 4V2BA 3O3AA 5JXAL 5BV7L 1EHAA 2NY1C 4PJ9A 4U49A 3KLAB 5DGQA 4H20L 1FDLL 5D2NB 4MXWL 4QXTB 4HGKC 4TSBH 3ZYIA 1HH9A 5E56A 4OZIF 3VD7A 1B0RA 3NFPB 3H9SE 4R90L 3TVMB 1UJ3A 4TTGA 3LMJL 4PB0H 3L5WA 4AEIL 2ZSWA 5L2JB 2X4QB 4F3FB 1WBYA 1RI8A 4Y4FC 1EEZA 4WV1B 5FCUH 2BSTA 5HPOA 1NFIB 1PW3A 4OZIB 1ZLSL 5FO7A 5CD5C 4OZFG 4TVPE 3F65A 4QRTA 3SPVA 3QZWB 1I7TA 1Q9LA 2ZCLH 3THMH 4Z76A 1QNZH 5DSCA 3RU8H 4O00A 5D2LF 3LEXA 4JLRA 3G5VB 1GGTA 2HN7B 3RWEA 3G6JB 5E6IB 5IK3A 3RNQA 2DQDH 3VXSB 1RIVL 3O2DA 4KHXH 4P2QE 4QCIB 1DEEA 1QSZA 5I1GL 2A6DA 3FO0H 2X9WA 5GRUL 3T8XB 3QDGE 3QIBD 1UB6B 5J8OA 2FO4B 3TV3H 2FJGB 4ONOA 3TGXA 3ALPA 4BZ1H 4OTXL 1P4LB 5FKAB 3H8NA 3U0PA 2JKXA 1H3UA 1X5GA 1GGBH 5L9DL 3SE9H 1Q9WB 1I8IB 3RPKA 4O4YH 4JKPH 3EYFA 4WVRA 3Q5OA 3RVTC 5HI5D 2GUOB 3VD3A 1X6NA 3GK8H 3GNMH 3QG6A 4ZUWA 3RDTB 4OCXL 3IXTA 2QSVA 3V7MA 1OGAA 4OZHE 1M7IA 4ZAKA 4XAKD 3ARGC 4RIRB 4JRXD 4GKNA 1MQ8A 3MZTA 1GGUA 1FFPA 2Y1VA 1I9IH 2APWA 2QL1A 4WCYH 3VXQA 3DBXB 2YZ1A 4G3YH 3OX8A 1EJ6A 4KTYA 4KMQA 2XTJE 4LPVA 3DSNA 2X70A 1KJMA 2VABA 2Y36L 3PQYD 4EXPX 1KJ3L 1P4BL 5CSZB 4P59H 5GIRB 4GQPH 4WI7A 3UJIH 2V17H 3GHBL 4JVPA 3W81A 1T4KA 4UV7L 3I6LD 3ZKMD 2R8SL 3UJTH 1W2KT 4YHNB 1P4IL 5C09B 4DTGH 2GTZA 2XZQH 3MV7B 4Z5RA 5KBNC 2YMXH 3WXVL 1T1WA 3TYGL 1J05B 1EERB 1VSCA 1H3TA 2EYTA 4M3JA 5ADOL 1NGPH 4JHWH 5A2JH 5DXWA 3HI5H 3MRHB 4O9HH 4E5XA 2HMID 2LFGA 3MRQB 3LKPA 1T1ZB 3JTSB 2Y9RT 1MHPH 3LQZB 3DVIA 4PIRF 5I1KH 5C0FB 4M6OH 1AI1L 4OZGE 4ZS7H 4B7IA 2UV3A 1P5UA 4QGTA 1QBBA 2AK4D 4TPRH 3UBXG 1RUMH 4WW1A 3P3YA 3DGCR 4PJIA 5T1DH 1MCQA 1NC2B 4G43B 3VGDA 4Q9RL 1EGJL 5GQBA 4L3CB 1JYXA 3IDJB 3IFLL 4ONFL 1TNMA 4LAQH 2XN9E 4YHOH 1CGWA 2F58L 4GLRH 4YDKL 2VTFA 1NFDE 2O5ZL 1D6EA 1MCLA 2AK1L 2Y4SA 2VDLH 4R8WH 1U93A 4O58H 2RCSH 4HIHA 4MJ4A 4JFEB 5ENWA 3WHE1 3OKOA 1UM6H 4E0RB 2YRPA 1JYVA 1MJ7H 5CIPA 3W5MA 3E2HB 5EIIB 3PG2A 3VDAA 2GKIA 5TFSH 5DRNA 5GHWH 2GT9A 4F7TB 3OTTA 4NCC1 4PRID 4YDLB 3MGOA 1V7MH 4P2OD 5IKCB 3NACH 4GBXC 1AFVL 5ESVA 5K9OA 1HKLL 2XY1A 3ULUD 1CT8A 1YEDB 3GI8H 3PP3H 5E5MB 5LQBH 1HSBB 2H32A 1S78D 4R2GD 1UG9A 1RSFA 5T5FL 1QO3A 5EC2A 3GMPA 1KJ2L 3HUJE 4ZPTB 3Q5TA 3IF1A 1MJJA 4JVWA 4PP2B 4U0QB 2XWTA 3EYOB 3QUMA 3VFVA 5B38A 1NGWA 3RNKB 4K3JL 1DQDL 3T2QA 2R4RL 4NSKA 2XQYG 1NAMH 1OSPL 1HOCA 3REVB 2KZWA 2W1NA 4X4MA 5D1XC 4NQSA 2YEZA 3VWJA 5MI0B 4F9PC 2F53B 3VFPB 1CDCA 2B1AH 4NRZB 3KYAA 1JL8A 1VEPA 4KMTH 1FG2A 5KANG 1FAKT 1JI2A 4LOUC 1FO0H 2Y5EA 4I48B 5DUBA 2P5WB 3WN5B 2NXYC 1GAFH 1P9MC 3DX7A 3CFDA 2G5RA 4UINL 1TDQA 2AV7B 4H0HB 5FO8B 1HSAA 4P9HC 2J8UA 2OQJB 1OP3H 1ODAA 3W9EB 2EZ0C 2CIIA 2APVA 1QA9A 1SM3L 5E00B 5EC1B 2Z8WC 5FGCB 1C7SA 3RWIB 2A0LD 1ND0A 5E0QA 4RBPH 2NY4B 1JF5A 1TFHA 1TXKA 4OCMC 5TDNA 1N4XH 4DOHB 2FDBP 1KB5L 5IG7B 3I3DA 4K3HA 2BNQE 4MX7B 3TT1H 5IFHH 2FZ3A 1HXYB 1B0GA 1ZV5A 3N9GL 4I2XA 3ETBF 3S5LB 3MRDB 1YQ2A 4JO1H 5CD3A 4FQXA 3EJYC 3RHWF 4Z77A 2VERN 4BYHA 3CDGB 1CXEA 2AXGA 4K2UH 5I74C 2VDOL 1UCBL 3OQ3B 5CJQH 5E03A 3VD9A 4PGBB 1HYRC 4ODXB 5GPRA 1EEYA 3AM8A 1VEMA 1D5MB 3MRLA 3O6KL 2YPVL 2BVQB 2X41A 3O9WB 1A6UH 1CICC 5EIVA 1TCRA 4YBLC 2GIYA 1CK0H 4JM2F 2W0KA 4S1SL 1KNOA 1KTLA 5D7LE 4N5ED 1N6QH 1U2CA 4RISL 2BNRA 4LLWB 2Q7YA 2V7NB 8FABA 3SGEH 4AH2B 2HG5A 4FG6C 4I3SL 4E41E 2J12B 3F58H 3O3DA 1UEMA 4ZO9A 5TPWL 1ZGLB 3EFDH 1ZLUH 1OTSD 4HMDA 3HE7D 4DEPB 4XMKH 4GG6E 3U7WH 3MV9A 1VESA 1TTUA 4TSAH 1BX2B 5I19L 2IQAA 4NO0B 3FMGH 3IAPA 3IDNA 1CR9L 4RFOL 4XVJL 5LXGL 4OM1H 2EIZB 3C5SB 4MD5A 5TDOB 3IJYA 5ANMB 3KJ4C 1HHGB 3GJFH 3SDXB 1H8SA 5ICZB 3SDYH 3MNWB 4G9FE 5ISZD 3RWJA 1UYWH 2V7HA 1NANH 1XGQA 2BHYA 4PLNC 5LJYH 2UUDH 3RTQD 1BQSA 4YNYB 3X3FL 1Q0XH 1F3JB 2PO6B 2RR3A 3AMKA 3PABB 4ZNCD 5D7JC 4RAUA 1WGOA 4W4NA 1CLZL 4R7NB 4OLXH 2DF3A 1KN4L 4ERSL 5DJYA 4N68A 3F5WA 1YY9C 3QIBA 2GYSA 1QSEA 1R3JB 1FBIH 4BZYA 3EO9H 2XXCB 1H15B 3IU3B 3JV4A 2Y06H 1JGLH 1NUGA 4I9WD 5D7KD 2I9TB 3L7EA 2VLKB 2FR4A 4J8RB 4YAQA 1FZKA 4OIAA 2C3XA 4Y4KB 4ENEC 4NFCA 1N3NA 3TJEH 1OP9A 5E8NB 1XGRB 2J2ZA 1F3DH 2YS4A 1WFOA 3FOMA 2V2TA 1HIML 4HBCL 4GAGL 5HHXH 4OF5A 1RUPL 3ZE0F 3QISA 1SBSH 5C0AB 1QRKA 4JRXA 4UOJA 2DQFB 4KKLD 4FP8L 5BMFH 2EH7H 3BDYL 1DQLL 5DHVH 3WIIL 2A6JA 2BHUA 2BVOA 4N1HB 4HV8A 5D1ZB 4LSTL 4P23B 1C5BH 4OF8A 1TLKA 1L7IL 3WCYA 4WV1C 1E6OH 2DS4A 5HHPA 4QHKJ 3QWOB 4GH7B 1TETL 4JO3H 4PFEA 4YUEH 2CGRH 4LP5A 4HXAL 1BAFH 2LABA 3DX6B 5IW6B 2VQUA 3DX8A 3CC5B 3SDAA 3DV4A 1YPZB 4BA8A 3JWDC 3R8QA 3M8OH 3Q0HA 4X6DF