2KQMA

Solution structure of the ki o18/o8 y87h immunoglobulin light chain variable domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYHCQQYDNLPYTFGQGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig kappa chain V-I region AU
publication title A single mutation promotes amyloidogenicity through a highly promiscuous dimer interface.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kqmA00
4NO2A 4KUZH 3V52H 1BLNB 4PJCE 3VXRA 3EJZD 5IEKB 2BNUA 2QJDA 3M07A 1S9XB 4FTVA 5DD1L 4OF3A 3MV8A 4Q9CA 4G9FA 2OXGA 1LD9A 1JN6A 3FB8B 4TQEL 1KACB 1E6OL 5EO9B 5C08E 4TOYL 3W82A 1UVQB 4LCYB 5IGXL 1L9MA 4R4NC 1UZ8A 3FRPA 4LSDA 3RWEA 5HDBE 2A74B 4HH8A 1FYTD 4I0PC 3D39B 5H35B 3BKML 4NBXB 1W72L 1KGCD 4BFGA 1PG7X 2LFGA 3KJ6L 1EZVY 3CMGA 1S7UB 3TO2A 5GZND 4ETQA 1VB9A 3G6JA 3IRPX 1UB5B 3KWWB 4N5UA 5FK9A 5AAWA 3NTCH 2H1PH 3W2DL 2R1YB 4U49A 1KC5L 3KPNA 5DUPL 3QAZC 4GKNA 4J3UA 3I02A 3RPKA 3FMGH 3V95A 1XFPA 3L6FB 2CPCA 3EYSL 3H9HA 3MRHB 1HE7A 1T66D 4KWUA 4EIZC 1SVZA 5IOPB 2I60H 2X5PA 3GBNL 5BRZB 3LRSB 3BUYA 1ZAGA 4MD5A 5MENA 3QO1B 3CVIH 1CDIA 4TSCH 4UV7H 4ZSOB 3VXOB 5MP6H 1QHOA 3ALPA 5IF0B 3QG6A 3SDCC 3CC5B 4GLRH 2XWBA 4JZOB 3QUYC 3K1DA 3VXPA 1Y18A 2NY1B 4FZ8H 1J05B 5GZNC 1NMBL 1G7JA 2WIMA 4PGEA 2R0KL 4KJYB 3OXRA 1BM3L 4XX1G 5IB1A 1YMHA 2PUQT 3TT3H 2PCPB 3PWJA 4MD4A 1MFCL 3FB5A 1IZKA 1QSFE 2V7HB 3OJMB 5D7IA 5LBSL 1QBBA 4U3CA 4RFEA 2R69H 5DGRA 3L3KA 4HPYH 2I07B 1IM9B 2IJ0C 4AT6B 4M9PA 4C57C 5LJYH 3THML 3C2AH 1FSKB 3CLEH 2DKMA 2R23B 3JV6B 4GQPH 3LS4L 3NCCB 4UQ2A 3DXAA 3SGEI 4LQFL 3B8YA 3MCLL 4KK6D 4L1HA 2F58L 4DAGH 3TNMB 4JM2A 4P2QD 1SJEB 3QCVL 4M6NH 1A47A 5I15L 4NHCL 4CU8A 2OP4H 1YEFL 3MNWA 1OAUH 2EYSB 4CU7A 3QUXA 5DMJB 3FO1A 3TYGL 3B5GA 3ROOA 3T2QA 1CTOA 1G9EA 1T5XB 3UROR 2VLRE 4GXVL 5H94A 1Q9OB 2YA0A 4HX1A 3QJHB 4JRXA 1OARL 3FOMB 5FA3B 4J8RB 1T2QL 1OTTD 1Z3GH 5DJ2B 2BC4B 3BEVB 1AKJA 5C0JA 3U2SA 3C9NB 1NGQL 3ARGB 4KZEH 2XV6B 4MQXC 1JPSH 1K4CB 2BHUA 3QEQE 2IPKA 4M5ZH 1AGCB 2E6PA 1DBBH 4EVNB 5DK2B 5ESVB 1A1MA 2K3TA 3PE9A 5IMLB 4HWZB 1WZ1L 3ZE0E 1T20A 2EXWD 4ZUSA 4WCYL 4D8PB 5CBEB 4P23A 4AY0A 4XP6L 4F15C 1BQLL 5BO1L 3T4AB 1WZLA 2VXQL 1FAKT 1DVFA 5SWQB 1ED3A 4S2SA 4P99A 4YPJA 5DJXA 3VXSB 4OCMC 3RHWF 5D96B 1TQCB 2PTVA 3EJJX 1TQBC 2ICWA 5K33A 1RUPH 3WJJA 4DKFL 4ELMA 1UXSB 5HYSG 3AS3A 5TQ0L 1S7WA 3V7MA 4JAMB 1F3DH 3K2MC 4EI5D 1HIMH 2CK0H 3BD5A 5HHOB 2DAVA 4P0DA 4QHLA 4X5WA 1QA9A 1QD0A 1FIGH 1RZJC 5ANMB 1QR1B 1JZ5A 3QDMB 4Z5RA 2F54D 2HKHL 4ELKB 5F6IC 3H9YA 2ZSVA 3T04D 1FVEA 5DT1H 1INDH 1I7RB 1JYVA 3JXAA 3T2PA 1JYXA 4PP1D 3I6LE 3SPVB 2G5BA 3BP7A 2BVEA 2Y7QA 3MRQA 3PJSA 1BX2A 4K8RL 1UJ3A 4M6OH 5GRZA 5D7JC 1GGCL 4OKVA 2AI0H 4UMGA 3RX8A 4IRSD 4I3RL 3O0RH 1CT8A 1XH3A 3WS6A 4MAYB 3JTSB 4P2YA 5HI3D 1JHLH 1SEBB 1FFOA 3R1GH 4Z95L 2WMPA 3VRJB 3LKPA 1RZFH 5D7LA 4PG2A 3LQZB 1WBXA 4PRDA 4X5XA 3QDGA 3S37L 4MXWL 3N1FC 3STZA 1R0AH 4U1HB 1F5WA 3VGBA 5EIVA 3WL9A 2W0FA 1FBIH 2I26N 2VDLL 1AP2B 4YDLC 1M4KA 3DLQR 1S7TA 3OJDA 2JJWA 4HUWB 2APBA 4LAQH 4EXPX 1KXVC 4JQXA 1UH2A 1XGQA 4R90H 2YN3A 5ACZB 5EZIL 3ETBF 3MRJA 3LMJL 3ELAT 4PD4K 5TPWL 4BELD 3KHOA 5GSRB 1DQML 4X99A 2CUHA 2N7BA 2AABH 4JJ5A 4U0QB 1CD0A 5D9SB 1NFIA 1CLOH 1K2DB 2XIDA 3B3IA 1RFDH 3P0VL 2J8UF 2IFFH 3QQNA 4HWNA 2R8SL 1EDQA 1A7NL 4DVRH 4MJIB 5F97E 1D5IL 3NCMA 4LCIH 1MHEB 1RPQA 3QRGL 4KK9D 1AY1L 4O2CB 3HI5L 3O3UN 3NIGF 1U2CA 1VGEH 3HMXL 2ZCKL 4Q6IC 3BOVA 2EO1A 5HVGB 2Z9TA 1MSPA 5E2WH 3SDYH 3Q0HA 3SGKA 1EA9C 4PJHE 1YUHB 3IJYA 4CW1B 1A14H 5HHOE 4WWKD 2X7LA 2GT9A 3QQ9D 1IFHL 4KTYA 3LKRB 5ANME 2GUOB 4PJ8A 3LDBB 2YMXH 2D9QB 5JHLH 2P1YA 4NQEE 2SEBB 1UEMA 3E6FB 1BZ9A 1QEWA 1KPUB 5FYJU 3FCTB 3OXSB 4APQA 2F53D 1MJUH 3QXUA 1HYSC 1IE5A 4LCCC 3TBWB 1F58L 2ZNWA 3RAJH 2HT4D 3BDXA 4XHQA 2V5SA 4NJAL 3WJLA 3JWOC 3EOAB 2EICA 4RQQA 3GRWL 4N5EC 1HEZA 2AJZA 4Z76B 5ETUB 4M1GH 5EO1B 5AD0A 2ZUQB 2V2XB 1TVHB 2QL1A 4WI4A 4WHTB 4BJLA 1DQLH 1WWCA 3AAZB 4C83A 5F88B 3L9RA 5A3ID 1RQ5A 4X98B 1ZV5A 3MRPB 1V7ML 1B0GA 4FQ2H 5DO2D 5FYLL 3X12B 4LSQL 4PB0L 3MJ7A 3VCLB 4XNUL 5JIPA 3VXMA 4JRYB 4JKKA 4M5YL 2B1AH 1DQQB 5GGVY 2Q87A 3DVIA 2NW3A 1RVFH 5AG8A 4K71B 1BFTA 1SMOA 2D4FA 1EPFA 1RU9L 4LLUA 1WEJL 2OTPA 1MH5B 1S9WB 2NZ9D 3SDXF 1JNLL 2HRPL 1K8DA 1QSEB 3GMOA 3VFVA 5E00B 1JK8A 2FX8H 4NJ9L 1H3VA 3M17A 2E9IA 2DQIH 5CSBA 5CJQL 3SJVD 4ENED 1PLGH 3DO3A 1W72B 1KT2B 5F7EH 1CF8L 4JDZA 1CXFA 2J88L 4AIZA 2AAVA 4KY1H 4YHML 4YK4B 3V6FA 2MCPH 3B2UC 1GH7A 4JEGB 3O6FB 3EO0A 3QIBD 3PDDA 2GIYA 3H3PL 1PY4A 5IB5B 2OJEB 1I75A 3P4MB 5DUBB 5CKGA 1A3RH 5I76A 1X6NA 4N0FB 1S5HA 4Y5XC 2DQHH 4I2XB 4IJ3C 4KKLD 4O00A 3HMWH 4HPOH 4RA0C 5KVFH 3HG1D 3E3QC 3MRKB 4OAWB 5E8EA 2PTTB 1Q9KA 4PRHA 2BSRA 2VDPL 3V4PH 3AUVA 5IV2B 4NKIL 4LBEB 4OLWL 2NZ9C 1MCWM 4OT1L 1QNZL 5LGJA 4U31A 3UYRL 1UYWH 2P49B 1HHHB 4LEOA 3DJ9A 1ZT7B 4I18A 2FH8A 4X9GA 4DK6A 3PDOA 3REWB 4GG6B 1WFOA 1VFOA 1IQDB 4B41A 1GHFH 1F8TL 1E6JH 1K5NB 2FGWH 4EUPB 1RZKL 3KYMB 1KCSL 1KIUA 3UYOD 4JY6A 2YR3A 5JPMB 4X6CE 3MV7E 1FFPA 1BBDH 2DM4A 5IVZA 4RAVB 5A43C 3FB7A 4YAQB 4OJFL 4NKOB 3OR6A 1S9VA 3Q6FA 4JRYE 3IU3B 2PR4L 3CD4A 4TVSa 4LLAA 3E1F1 2A77L 1CL7L 3OKOB 2HJFA 4ZS6C 3OGCA 4QHKJ 1CD1B 5D1ZA 3EYFB 4X9BA 1FG9C 2YRPA 1U8IB 2GTWA 4HLJA 3HHRB 5GZOC 3L3GB 5FB8B 5DR5L 5DMYA 4ZOEA 1F6FB 1RD6A 2P8MB 5E8NA 4QO1A 3GJFH 3GI8L 3RZCD 5I71C 3R4DA 5ICYA 1P9MC 5HDQL 2UZIL 5EIIB 4HUVB 1HDMB 3HTLX 4YDJA 2DWDB 1G6RL 4NNPH 1A1OA 4OM1L 3IXTB 1LNUB 5HSFA 3T2OA 4TULH 1TJGL 2H8PB 4M7ZB 3ZYZA 1ZLSH 1T89C 3O4OB 3VI3F 1QACA 4IIQA 4Z8FH 4Q74A 2VTFA 3MJ9H 1S5IL 4F9LC 3SY0B 4QRRB 1JVKA 3JV4A 3VFNA 2YKLH 4LLWA 1R24B 2OXHA 4HAFA 4NRYB 2GK2A 4V2BA 4JN2A 3TLRA 5BQ7A 2PXYA 3FO0L 3QIUB 1JHTA 4XPHH 2W1NA 3MLWH 5DRNB 2FEEI 4H5SB 1OAKL 3NZ8A 1IGTB 1H3PL 5A2KH 4OIAA 5C0RL 5HI4C 1C1EL 4NCC2 1NBYA 5I66A 1JRHI 4UBDD 1AGEB 3DARA 5DLML 4OF0A 3RTQC 4R2GD 4CNIA 5HYSA 3GHBH 4LASH 3MA7A 3VWJC 2FBJL 4G8IB 3QUMH 4GAYB 4OCYL 4UU9A 5ID1A 3IDXL 1MIML 4RWYH 2DJUA 3O45B 2BK8A 4TUOA 3WNNA 1G7MB 3WN5B 2ZZUT 7FABL 3IVKA 2X4RB 2X89D 4H0GA 1YNLH 4UOJA 3U0WH 5IEHB 5KS9B 1KPVA 4XCEB 2DQGH 4WUUA 4GOSA 4JCLA 3K4ZA 3L7FA 1QTYT 1E4XH 1VACB 3RVTC 4J3TA 4NM4L 3L3JA 1IAOA 4PJ7A 5HJ3B 3RUGA 1U8KB 1OAZL 2ZOKA 5GJSH 2NMSA 1CVSC 2C3WA 3QDJB 1BLNA 1C7TA 2MFNA 4D0CA 4YC2C 3RIAK 5IEKA 5F7YC 5EUKB 3QEHB 5CJBA 1S9XA 3C60B 5FYJD 4AEIH 2IBGA 1QQDB 4HDIA 4LEXL 3QULB 3DV6A 1YN7B 1KLGB 3FB8A 1IBGL 5EU7E 4XP4L 1A3LL 4RIRA 3O3DB 2NLJA 4IRJB 4HHAB 4LCYA 5HGGS 5ID0B 4G7YL 3WUWB 3K2UL 4AIOA 4Y1AA 1KIPA 2XTLA 2DQCH 2A74A 2FJFA 4GSDH 1T7YA 4U1GB 1BWWA 3D39A 5H35A 1KLFA 3Q5YA 2BDNH 1JZ3A 3LHPH 4CVUA 4MAUL 5D93C 3SQBA 3SOBL 2DTML 5TE4H 2AK4B 3CU1A 3Q3GA 4NO0D 4XCCL 5IUSA 2IPTH 32C2B 4BSJA 2R1YA 1T3FB 4J6RL 3AS0A 2A9ML 2IAMA 2EH7H 3QWOB 4EDWL 1T1WA 4NZUL 3L6FA 5L0QB 4QRRE 5I9QB 1N5YL 1J8KA 1U91B 2BY0A 3MRHA 4M8QB 5IOPA 4BFIB 1LO0H 1LE9B 1C16B 3LRSA 5BRZA 4L29B 1T21B 2AQ2A 2ZUXA 4WENB 4QRTB 2W60A 3N85L 3AM8C 3P4OA 4M62L 3QO1A 4WGVB 4L8DA 2OK0H 1WGOA 1H0DB 5KJRH 3TJHC 5E2JA 4ZSOA 3VXOA 25C8L 3GMRB 3QEGL 4PYHA 3VFUB 5C0ND 2WW8A 5F89A 3UEZA 3CC5A 3IFNL 1ZGLA 1RZIB 5FIEA 5KG9B 4JZOA 3OPZL 4HLZH 2JJTA 4K9EL 5DMGD 3ZKMC 3EOBB 4OLUH 5C2UB 1J05A 5D5MA 3MLPA 2Z35B 4X9FA 5CD5C 1G7QB 1A64A 4UNVA 4F7CB 4KJYA 1JUFB 1LO5B 1FE8H 2UVFA 3QCTH 2PCPA 4OV5B 1EO8H 4DJMA 4HT1H 1MNUL 2V7HA 1LO2L 3QUZD 4H1LG 4EUPG 4MXQC 3QDJE 4PUBL 1RSFA 2I07A 4XP1L 1MWAL 2PO6B 1IM9A 4AT6A 3UTSD 3TIEB 4BKLB 2FX7L 1OP3K 3PV6A 5I1CH 1ZTXH 3WO4C 1GC1C 2R23A 3ES6B 3JV6A 2YRZA 1GGUA 1UM4L 4R4BB 3DMMD 1I1FB 3TNMA 2NY5L 1SJEA 3W9DB 2OSLA 5ALBH 1YEJH 1YMMD 1PEZA 2DYPD 4NWUL 5AZEH 3WFEH 1AO7E 1DSFL 3ARXA 3SCMB 4ZNEA 4PTTB 1NGXA 2FJGA 3C6SB 4MDIA 2R0LH 1JPST 3DSNA 5L6YL 1T5XA 4GH7B 2YPVL 4FQ1H 3B9KD 1HHKA 3U48A 3GEWB 4HXAL 1KIQA 4XCYB 2WUCH 5EORH 3VRLF 5KSUB 2KUTA 3Q5TA 3U9PL 4ODTH 3SO5A 3UJTL 4OGZA 5FA3A 2XNAB 4J8RA 5AYQA 5DJ2A 3AREA 5FUOL 2X4TB 1HINH 4QNPF 3BEVA 2VDKH 2GY5A 2VN4A 3C9NA 3ARGA 4YXLH 4Y5YB 2XZAH 5E6IC 4ZYKB 1B6UA 1K4CA 3FTGB 1V3KA 1HQRB 3OG6B 1KTKE 4GT7A 2H41A 4EVNA 2KZ1B 5ESVA 4U6YB 4YXKH 4HWZA 1NKOA 5CBEA 4PLNC 4NO5B 2HFGH 3PL6C 3T4AA 1BIHA 2P5WD 2DM3A 4QWWC 1OM3L 5DJDA 4DEPC 5DJYB 5LGKA 4OLEA 2P43B 1R3KB 4P3DB 3VXSA 3MV9E 2B20A 2DLGA 2AK1L 3HC0B 4N90E 2LU3A 2GY7B 5DA4A 1AGDB 1ITBB 1UXSA 4X7CC 1CTNA 5L7XL 4HK3J 5MEOB 3BZDA 4L4TE 3SDXB 3NCJL 1REIA 1U3YA 2PW2B 1B4RA 5EU5B 5IFJA 2FHBA 3ARDB 3BYYA 4KGLA 1X5KA 1QR1A 3QDMA 1KBGH 3QFJD 3O3BB 2J8UE 5E0QA 1XT5A 4WIQA 3WUZA 2C1OB 3LN5A 5GSVB 2H32B 5DZNA 4ISVB 4K7FB 4E42A 3SPVA 4RDQG 4DGYH 3NIGE 1MI5D 2X4OB 1TMCB 5ESQB 4EOWH 5SWZD 43C9B 4DCQA 1DL7L 3MXVL 3QJFB 1MJ8H 2DKSA 5GHWH 3WFDL 1YNKH 5BXFA 5JORB 4MAYA 1F2QA 3SGDI 2P42B 1SEBA 3VRJA 3G08B 2WBJD 1MJJB 1UM5H 3CJJA 3P4NB 4UT6L 5FYLE 5LXGH 1OAYH 1RAMA 3WUWG 3ARBD 4JANB 1G7LA 4U1HA 1WCQA 2AQ3A 1GAFH 1MRDH 2Y36H 3BT2H 2XTJD 1ES0B 3VDCA 2XN9D 4KUZL 3S8WA 3EO1B 3V52L 2OBGA 2ADGB 3RVVD 1K9TA 5T5NF 2OMNA 5ACZA 4FOMA 1CDYA 5GSRA 1MHHB 4KMLB 3ULUD 2YRLA 2EDJA 1MRFH 5J13C 3RIAF 4C55A 3MYJB 4JO1H 2DI7A 5IK3B 5D9SA 4KMQA 4XNQB 2ED7A 1G6RB 4XMPH 4WFED 5CAYB 3OHXB 2BY1A 2CRYA 2F19H 1AQKH 2YUWA 4XZUB 3O2VL 5GISH 1RUQH 3CAFA 3FQRA 4CN6A 4MJIA 5ERWA 3D2UB 2DM2A 5I6XC 1MHEA 3TCLA 5GRWA 5K9QI 4O2CA 4BQBA 3S96B 3B8SA 4L4JA 3NTCL 4JM2C 3PQYB 2H1PL 4B7LA 5INDB 3WLBA 5L2KD 1YUHA 3SDXE 4G6FD 4U0RB 4Q2ZA 1EEUA 2CR6A 3FMGL 4PJDF 3EOYG 3QUXC 2GUOA 3FL7A 4KROB 2I60L 1CGXA 4HIJA 5JQHC 2SEBA 3E6FA 2QQNH 1KPUA 3FCTA 1VDGA 2Q76A 3OXSA 4QXWA 4WI9A 4S1DC 5ESAB 1MCLA 3TN0D 2P8PB 3CPLB 4HS3B 3CVIL 1EEZA 4TSCL 1QRKA 3IETB 4UV7L 5F96H 4QRUB 1ZLWK 1SHMA 1DEEA 3TBWA 4JY4A 1IGIH 5MP6L 1NC4D 4HK3N 4F2MB 2ITCB 3W0WE 3T0EB 3EOAA 4L3EB 1U8HB 4JGJA 4HJ0D 4Z76A 5ETUA 3TCXA 4JKWA 3IGAB 2V2XA 1TVHA 4WHTA 1YPZF 4DK3A 3P11H 3AAZA 4FZ8L 5F88A 1F42A 5HHMD 3MRPA 1S7VB 4J12A 3TT3L 5D1XB 2IADB 4P23C 1DN2A 3X12A 4J4PA 3VCLA 5D8JH 1DVFC 3OKNA 2GJJA 2R69L 4JRYA 4NUJB 1DQQA 3LIZH 1ZK9A 3NCFB 4HPYL 1MEXH 5IMKB 3IDYB 5EC1B 4G42A 3C2AL 3CLEL 3WJJC 5T3XE 2I9TB 4YHOH 3HLAB 3MXWH 4RX4A 3I50H 4LMQE 1MH5A 1S9WA 1QSEA 2J8OA 4OZGB 4DAGL 1MLBB 4G5ZH 3ULVH 5SWSD 5I1AB 3S36X 1W72A 2FZ3B 3LD8C 4M6NL 1KT2A 4Y4HB 2EDWA 2A83A 2WZPD 4O4YH 4CMHB 3AMLA 2OP4L 2AERT 1BD2B 1P69B 2L7UA 1OAUL 2OS7A 3O6FA 4M4RA 2JJVA 2NX5B 4NN5B 4XMLH 2RHEA 1P6AB 3AC0A 1DANT 3PF2A 3KNBB 5IB5A 3MMEB 3M1BA 2OJEA 2EEBA 3P4MA 5JO5B 5DUBA 4L9LB 5J12C 2DQFB 4NQCA 1UJ3C 4F57H 2ZNXA 4HGKC 4WI3A 1LILA 2WAHA 4I2XA 5IJKA 5DGQA 3CFJB 5GJTH 1G0DA 1Z3GL 3ULUH 3WS6C 3MRRB 3MRKA 1OGAB 2PTTA 3Q1SH 1BECA 4PG2C 4KZEL 5IV2A 1JPSL 3WKNA 1AR1C 5DC9B 3CGTA 4LBEA 4M5ZL 3I6GB 1DBBL 4ZUUB 4C56D 4V1DE 3BGFC 3MRFB 1WF5A 4HW6A 3HAEB 1HHHA 2VH5H 3VI3E 2BHZA 3DUSB 4JQXC 1JTTA 3T0EE 3REWA 4L3EE 3TYFB 5C0CD 4GG6A 1FO0H 4P4RB 1IQDA 4QHNA 2P5EA 4OZFG 5ITFB 4U7MA 4MNQB 4NQSA 4HS8H 4H1LA 4EUPA 1S7XB 2AJYH 2Z8RA 1IMHC 3KYMA 3NFNB 4RFOH 5IVNA 4CJ1A 1RUPL 4KTDH 4JFEE 4Z0BH 3MRGB 5JPMA 5I2IA 5CP3A 1MWAB 4ZO7A 3V0AC 4RAVA 4OD1H 1HIML 1NC2D 2CK0L 4MA1C 4NKOA 4PJXF 4CVXB 5GPRA 5B3NA 4UIMB 4LSPH 3HKFA 4ZFOB 2IH3B 1GSMA 3IU3A 3ZT6A 4X5LA 3NPZB 1FIGL 3UTTB 4HUXB 4O58H 3KGRA 3OKOA 2EIZA 4Y4KD 1CD1A 4KKAC 3EYFA 1U8IA 3IRZA 3QG7H 4MJ6B 1B0WA 3L3GA 2X40A 2D7PA 5DT1L 1INDL 2QSQA 5EZLB 4QRSB 2D7TH 3CU7A 3SE4A 3SGKC 2P8MA 4HEPG 3EDKA 1DP0A 2Y4SA 4M6OL 5EIIA 4PJ8C 2BMKA 1HDMA 2AI0L 3RGVD 5CKAA 5JW4N 3LH2H 3IXTA 3O0RL 1BD2E 5CIPH 5E6ZA 1LNUA 4WU7B 3I6KB 1JHLL 1V3JA 3R1GL 4UV4H 4M7LT 3QI9B 5FECB 1RZFL 2H8PA 4APQC 5C0AB 4M03A 1LE5B 2AXJA 2Y6SD 3IJSB 1A21A 2Z0BA 1HN1A 5D2LE 1R0AL 4HJJH 2HJKB 5DDHB 2HFEA 5GRXG 2B8OT 1FBIL 2Y9RT 3WJLC 4HH9B 2VQ1A 5I73C 4QTHB 2BNRE 3IB4A 3L3HB 3UO1H 4LAQL 4QRRA 4M6MH 4PV9B 3RVXC 4U7KA 1R24A 1AIFA 1OB1A 4R90L 3L5HA 3JSSA 4H8WH 4ZO8A 3KJ4B 4X80H 4P2RD 1S78D 3QIUA 3WFHB 2PF6A 5DRNA 3BQUC 1EIBA 1IGTA 2Z92B 2L4OA 2AABL 1CLOL 5GGTA 1AGEA 1RFDL 4O2FA 2IFFL 2BY3A 2ZP0T 4DVRL 4GAYA 4HS6B 5C09A 5ISZB 3DUUB 3O45A 1IKFH 3WN5A 5CEZD 4LCIL 4X6BB 4RGMB 5IEHA 5KS9A 4X6DF 3ARFB 4XCEA 5DS8A 1NLBH 1NAMH 1VGEL 4K3JH 4OBSA 1JPTH 5HJ3A 1U8KA 5E2WL 3ROLA 3SDYL 4PY8J 2RJMA 1N4XH 3B4NA 1A14L 3TNNB 1NMAH 1X9QA 4QHMA 5EUKA 3V9FA 3UTTE 3QEHA 3VI4E 2Y1VA 2YMXL 1NDMB 5JHLL 2NXYC 1MIEH 3V4VH 3U79A 1QQDA 4UAOC 4PJIB 1XZ0B 3QULA 1IAIH 1CDJA 3NH7H 3N1PC 4G3YH 1KLGA 4UDUB 1MJUL 3O3DA 4IMKA 3MUGB 5CINH 4F8QA 4IRJA 1FRGH 3OZ9H 5CZVH 4HHAA 3RAJL 3VGAC 3MCKB 3WUWA 4I3SH 5DHYB 1EEYB 1R3IH 4YEFA 5BS0A 3GMLA 5C6PB 4M1GL 1C5DB 2GEEA 1V5JA 1DQLL 4HAGA 1PW3A 2AK4A 5C0AE 3O41A 4KC3B 5C8JB 2MKWA 5C08D 3BP4B 32C2A 4FQ2L 5D2NB 1CD9B 1T3FA 4RGNC 1ODAA 4I18C 3P77B 1HQ4B 2NY0D 3VWKD 2NXZC 1XCQB 4HWEH 4PBVC 2P45B 3VXUA 2B1AL 2V5RA 3QA3B 3RGHA 1RVFL 1U91A 1E27A 3DURA 4NC2B 4FFVD 4BFIA 1LE9A 1C16A 1TZHA 4L29A 1T21A 4QRPB 1A3QA 3T4YB 4I0CC 3D0LA 5HGAB 1H0DA 4NRXB 5L2JB 4KKBC 2FX8L 3GMRA 3PV7A 3MO1B 2DQIL 3VFUA 1PLGL 3HE7B 3KPLB 2GKIA 5F7EL 1E4KA 1RZIA 3VD5A 3VRLE 3A6OA 1J1PH 3A0OA 4KY1L 4MSWB 5KG9A 5D1ZC 2XFXB 5C9JB 3ZTJH 4FS0A 2D03H 4U1MB 3HMXA 3MA9H 3MNVB 4PJ9D 1T0MB 4QNPE 3RFZC 4CUCA 4M02A 4F7CA 2CGRH 1JUFA 1LO5A 3H9SA 1A3RL 1HXMB 2NY4C 5J56B 4OV5A 2VZSA 3F5WB 4G7VH 1AE6H 2DQHL 2N4IA 4LQ1A 4OGYH 3RWJB 3HMWL 4HPOL 5KANI 3TIEA 4BKLA 5KVFL 4PY7B 5C71A 3VD4A 4FN0A 3V4PL 2BXZA 3WDIA 1ZVHA 4LCWE 4NSKB 1KLUB 3ES6A 4NC0B 2CIKA 5KSAB 4Y0GA 4IIQC 5C0BE 4PS4H 4R4BA 2V17H 4L3AA 1I1FA 3ZT7A 1QSFD 1UYWL 3IDIB 4LCUB 1FZKB 1LK2B 5H2BB 3W9DA 2ED8A 1QFWM 1Q0YH 2EIEA 3BO8B 1OGTB 2PXYC 1GHFL 5I19H 1DZBA 1E6JL 2FGWL 3QPQC 3C6SA 4PJDB 5FYKU 5GGVH 1T6VN 3HE6C 2NQCA 4YZFF 3SKNB 2W07A 2JKXA 4GRMB 1BBDL 2EEDA 5KSUA 2FR4B 3O8XD 1CDCA 2XNAA 2YD3A 3LPWA 1Q0XH 2X4TA 1DQJB 4GKSB 5DSCB 4PRPE 1O7VA 1G84A 4HKZB 4LK4A 4P46B 4P57B 4QGTA 4KJPC 4KPHH 1OPGH 4QRPE 4ZYKA 4P2OB 2R56H 3FTGA 1YEHH 3NPSB 4MVBC 1EGJA 1HQRA 2QADD 2VLRD 4X6EB 1CU4H 1YPZB 2AXGB 3FQUB 1MCHA 4NO5A 3O2WH 4JHBA 3SDAD 4PJGB 4NNPL 1CXKA 1RZJH 5DJYA 2QR0B 1HK6A 1YEIH 4JQIH 1CIUA 4P3DA 3RVUD 3QEQD 4TULL 3MX0A 4MYWB 3SGEH 3HC0A 5SX4I 1ZLSL 1AGDA 3D0VB 1EO5A 3BZEB 4WI2A 3CSGA 4Z8FL 4R3SB 3MJ9L 5EU5A 1G7PB 1G9NC 1ZLUH 2YPLD 3ARDA 3O2DH 2YKLL 1TCRA 3O3BA 3KPRE 2JF1A 4X7FC 3DBXB 5JUEH 1FYTB 2RB8A 4XPHL 1C08B 2YHGA 2C1OA 1OTSD 1LEIB 2JLLA 2NY6B 5GSVA 3MLWL 5BW7A 2H32A 2Z8VC 3C5SB 1EVTC 2IG2H 4ISVA 4K7FA 3RWGB 2IAMC 1PZUB 4GBXD 3MLVH 5ESQA 2ADJB 43C9A 3GHBL 2RCSH 4LASL 3LAFA 3QUML 5KW9H 5EFIB 3H0TB 4ZPVB 2GAZB 5JORA 4RWYL 3G08A 1MJJA 2XY2A 3P4NA 5JW5B 4MQ7B 1RUAH 1YNLL 3U0WL 4JANA 3I6LD 4U1NA 2DQGL 1E4XL 4GFTB 3BH8B 5MHSE 3MODH 1ES0A 5GJSL 1AQDB 2DJSA 2ADGA 2JJTC 1A5FH 4RBPK 1NJ9B 2CO7B 1UJTA 4WI7A 2NY1C 2NTSP 4WHCA 4AEIL 3ZHLA 1OSZB 4PB9H 4P2CG 1MHHA 4XNZC 2DRUA 1Q9WB 3MYJA 5DTFA 5IK3A 3R06A 1UEYA 2HMIC 3TP4A 2VLKE 4B0MM 2Q1EA 1FNHA 2IAND 2DQCL 2X10A 4XZUA 1FSKC 4GSDL 1CGTA 2CRMA 2F15A 1FORH 1NUDA 2BDNL 2DLEA 3R0MA 3LCYA 3LHPL 3D2UA 2W0KA 5TE4L 4EN3D 3ARWA 4JO3H 1TPXB 3S96A 4NQDA 5C3LD 1HI6B 2YK1H 2X1WL 2IPTL 3PQYA 5L9DH 3VE0A 1GYAA 5INDA 1A7QH 4NN7B 2EH7L 1U58B 3T3ME 5IMMB 1A6PA 3W5MA 5T5NG 1U8NB 5JA8B 4AEFA 4P2QB 5D72H 3PGFH 4YBHA 3GM0A 1LO0L 5J9PB 4F7MB 5ESAA 2VKXA 4QLRA 3CPLA 4E41E 3CFCH 5KSBF 2OK0L 4HS3A 5IR1A 3PWVA 1SY6H 5KJRL 3IETA 5FO7A 5F6HJ 1GZPB 5HHOD 3VFPB 3AREC 2CUIA 3BUTA 3RBSA 4F2MA 2ITCA 2QSCH 1ZKAA 5E95B 4YBQD 1U8HA 3ARGC 3D5OF 3WLWD 4DUVA 4NQED 1BGXH 3IGAA 4RMUA 1A6AB 3GKZA 4OLUL 1QVOB 3RX5A 1EVUA 1EUUA 3FQXA 1FE8L 2IADA 3B2VH 2JJUA 3QCTL 3RDTD 1EO8L 2EDOA 4FG6D 4AL8H 4HT1L 1MOEA 5EBMB 5I1IH 2LQRA 3OX8A 4NUJA 2Z31D 5IMKA 5IROA 1CICD 5EC1A 4W4NA 1TQCC 3MLSH 4UQ3B 1PSKH 5I1CL 1ZTXL 3VFTB 1FG2A 5HI5D 2I9TA 3HLAA 4RWHA 4PJFF 3KXFE 3V5DB 2A1WH 4LPYA 4OZGA 1MLBA 2FZ3A 4Y4HA 1YEJL 5ALBL 4D9RE 1AH1A 4RCAA 4EI5B 1MFAH 4PJXE 5AZEL 3WFEL 1QBLH 2NX5A 1EHLH 1I1AA 1ZGLP 1I8IB 4OZHE 2RIKA 2R0LL 4OGAC 2P47B 2F54B 4IDJH 3KNBA 3LKOB 1NCAH 2ZUYA 3MMEA 3X13B 4FQ1L 5JO5A 1BZ7B 2HH0H 2WWKT 4L9LA 2A6KB 4YWGH 2DQFA 5EORL 2WUCL 3MRLB 5HPMB 4ZFGH 3KDMB 3F58H 4HKXB 4CN4A 1M7IA 4ODTL 3QRFM 3CFJA 4MAYC 1HINL 2VDKL 4P2QE 1OGAA 4JQVA 4XAWH 3RWHB 4K94H 4YXLL 3LV3A 2D2OA 2XZAL 4IRSB 3A6BH 2IQAB 1CFQB 2UYLA 3I6GA 2BVOB 4ZUUA 1A6VH 4MHHG 2AGJH 4YXKL 4OCNC 1J0HA 2HFGL 4OFVA 3TYFA 4P4RA 3GB7B 3L7EB 3LY6A 1DEDA 2V9RA 5ITFA 1X5ZA 4MNQA 2K7QA 1Z9MA 5J8OA 3NFNA 2E6QA 5CSGA 4MNGB 3MRGA 4GAGH 3ULSB 2H2PC 1MWAA 4WFFE 5ECJE 2PYFA 2W0LA 4CVXA 2AKRB 5TH2B 43CAB 4ZFOA 4OM0H 2IH3A 2MHAB 3BHBB 2VDQH 4HUXA 1K3ZA 1KBGL 2GK0A 3O9WA 4TPRH 4WO4D 5IFHH 1AHWB 4MJ6A 1OD9A 1MCIA 3WNOA 5EZLA 4QRSA 2CKNA 3MV7D 4LKCA 4MS8C 4DGYL 4X6DE 2QQLH 5DMIH 1FL5A 4I5BB 2BOBB 3IXAB 4N68A 4EOWL 3P3YA 3K81A 2FEDD 3LDBC 3TBSB 1MJ8L 1RJCA 5GHWL 2ATPA 2CSPA 4WWKB 1H3UA 1MRCH 1YNKL 2Y5EA 5EZOH 3UZEA 4WU7A 3I6KA 5FECA 2I5YH 1FN4B 3QI9A 3TA3A 1QFWI 1UM5L 3RVWC 5GRVK 3UTOA 4UT9H 1YA5A 3KAAA 1LE5A 5LXGL 1NDGB 1OAYL 3IJSA 2DICA 3WHE1 4IDLA 2HJKA 5DDHA 1GAFL 1F4HA 1MRDL 1VFAA 2Y36L 2F53B 2V9TA 3BT2L 3LQMA 4I4WB 4N1HB 3DYPA 4HH9A 4QTHA 1FVDB 4DOHE 1NBZB 2ZUQC 4PV9A 3OKKA 4XH2B 5JOFB 3BP5B 1N0XH 4D3CH 3T0DA 4NDMB 1JE6A 3WFHA 1T7ZA 1YY8A 3GJFB 2EC9T 2VZOA 1MRFL 3MROB 4J4PC 4G6KH 2Z92A 4JO1L 1H15B 4OLXH 12E8H 5FOJA 4XMPL 5BVPH 1A6UH 2B7DT 3PP3K 4LVOB 3SDDB 3N0PB 2JCCF 5C0IB 4AQ1B 2W65A 4K71C 3ZYIA 2F19L 1AQKL 2CKBA 5GISL 1RUQL 5ISZA 3DUUA 1GIGH 4FQHB 2HTKD 2BRRH 1T1ZB 4X6BA 2G60H 1P7HL 4K23H 4KI5C 3ARFA 3FO2A 3DVFA 1N6UA 1KSRA 2WBKA 4S11A 2HT2D 4NKDB 4K55A 4X4YB 1WZKA 1YY9C 5HYQB 3BYTA 2CDGB 1SYSB 4KV5F 1WBYB 2VITB 3B9VA 4YK4C 3C08H 3O6FC 4F37K 1NDMA 3PXHA 4X7SH 1WWAX 3VXRD 2QQNL 1XF5B 4PJIA 2OR9H 2ID5A 3FFCD 4UDUA 3QIBB 1KEMH 3MUGA 5F96L 3HB3D 3MRIB 4KXZI 5T1LA 1T1YB 1U3JA 3QUMB 5IJKC 1IGIL 5FHBH 3ARYA 2UWEF 1KNOB 3BVNA 3MCKA 5CGYD 4P5TA 5DHYA 2CQVA 2DOCA 3J7HA 4GW1B 3ULVF 3AU1B 3VGEA 3V6OA 3P11L 4TVPH 3HG1B 4PBXA 2IBBA 5C8JA 1DFBH 3L95A 3BP4A 1JRHH 4JFPA 4XBEH 3CDFA 2XRAH 1JF1B 4TSAH 5D2NA 5DEZA 5D8JL 1HQ4A 2E8ZA 1XCQA 4HBCH 4LL9A 3LIZL 4J3VA 1MEXL 3QA3A 4XVUC 4YE4H 5HHVH 1CXHA 4NCC1 3HNSH 2FYYB 3BIKA 1L0QA 4RA3A 2VXVL 4YHOL 1CFBA 3MXWL 3T4YA 3MREB 3I50L 5HGAA 5HTSA 4NRXA 4X7TA 5L2JA 3UBXI 4ODSH 4KDVA 3T0BA 5KVDH 4G5ZL 4NWTH 3ULVL 4JPVH 3CDYA 2W91A 2NTFA 3KPLA 5EA0H 4UOW1 3RJDA 4O4YL 5MEQB 4IOFD 4MSWA 1PG7H 1U8PB 2XFXA 2GJ6B 4U1MA 3MNVA 2ICCA 1EZVX 5LCVH 4XMLL 4H26B 1MQKH 3RPIA 2OR8A 3SE4C 2EDFA 3KPSE 3IF1B 4JLRB 1HXMA 3F5WA 4XTRC 4OFPA 4F57L 3JWDC 5J0BA 1J87A 4G6AC 3LSOB 3EHBD 5GJTL 1QBMH 2GFBB 3K80A 3ULUL 3HC3H 3TC9A 4WHYH 4HFWB 3BRFA 2UZXB 3Q1SL 1R3JB 4M7ZC 3T0WA 1QBAA 4PP2B 3O4OC 5GS2D 4LVNB 5J06A 4NSKA 1ADQA 1RV6X 1ZA6B 5KSAA 4M8VA 4K3HA 4QOKE 4OCSH 1DUZB 3WNMA 3IDIA 3CNKA 5GIRB 4K3EH 2VH5L 1FZKA 5B4MD 1LK2A 5H2BA 3QDJD 1L0YA 5IVXF 4M1CC 1X5HA 2Q86B 5EBLB 2OR7A 3BO8A 1LVEA 1FFNB 1OGTA 5JDJA 1FO0L 2V5MA 3FB6A 2OLDA 4I13B 3C60D 3QIUC 3C5JB 4QGYA 4HS8L 4N8CH 4PJDA 2AJYL 4MJ4A 4POYA 3IFPA 3FFDA 4RFOL 4K8RD 1U95A 4KTDL 4L8CB 2DM7A 2P8LB 4Z0BL 4P9MH 1CG9B 2PYEA 1MHPH 4GRMA 5IJVB 3WFZA 3VXNB 1ZLUK 2VSDA 2E7MA 2VR4A 3L1OH 2E9BA 4OD1L 2FR4A 1QG3A 2DQUH 4LSPL 1DQJA 4GKSA 4NQTA 5DSCA 3OKLB 4WW1B 4O58L 2F8OA 1AO7D 4HKZA 4X4ZA 3WN5C 4R2GB 3OAYH 1RIVH 2M8XA 4GG8A 1W8OA 3QG7L 1B6DA 1U92A 1MCSA 1AKJD 1BJ8A 1YPZA 4GS7C 4M3KB 2HLFD 2D7TL 3I2CH 3GMNA 1QYGH 4OQTH 3GGWB 1P84K 5B4MC 3RZCB 3WHXB 1FLTX 5FDWB 4Y2DB 3BPLB 4PJGA 3LH2L 1S9KC 2GJ6E 2QR0A 4UV4L 2JELH 4Y7MA 3FONA 3D0VA 4IMKC 2FD6H 4IRJC 1VERA 4HJJL 4XCFH 4OZ4B 3X11B 1BJ1J 4FXGB 1SBSH 4PJFB 3BZEA 4JG1H 1SJHB 2YSSB 3WSQH 5EN2B 4TTDC 4R3SA 3MJ8A 1G7PA 4U1GC 1T7XA 5CWSB 3OKEB 3P9WB 4QHKI 3UO1L 1DBAH 4M6ML 3RL2A 1J1XH 5T33H 2NW2B 3MV9D 4H8WL 4XGZA 3DBXA 3TFKD 5EBWB 3EUUA 5IW3A 4X80L 3EJYC 4HC1H 1FYTA 4N90D 1SQ2N 2BOCB 2J6EA 1LEIA 4PJAF 4YFDB 3EOTH 3C5SA 1XGYH 4NIKB 1JPGB 1O5DT 1RURH 4NHUB 5JW3H 1P1ZB 4L4TD 2R4SH 3QBTB 2ADJA 5IQ7H 5L0QC 3HS0B 5I9QC 3BH9B 1MREH 2DBLH 2R2HB 3H0TA 1TTGA 5FGCE 1IKFL 5TDOB 1UADC 5JW5A 1YEEH 4MQ7A 3BWUC 1NLBL 5GRVL 3LN9A 3TBTA 1NAML 3T08A 4K3JL 3BH8A 1JPTL 3NCEB 2CIIB 5KSBE 2IEPA 1E4KC 1N4XL 4NNYB 1I4FB 5GS2H 1AQDA 4LVHC 3GSXB 1NMAL 3EDEA 1JFQH 4P5MB 4XVSH 1D6VH 1NJ9A 1P7QD 5CZXD 5BZWB 1NLDH 3GM8A 3SCMD 3VFGH 3KPPA 4BZ2H 1MIEL 1OSZA 3V4VL 8FABB 4Y4FD 5FYLD 4A2MA 1SEQH 4JFDE 1Q38A 1IAIL 4HWBH 4JFFD 3NH7L 3QXVA 4G3YL 3OQ3B 2MOVA 1Q9WA 4RMVA 2HVKB 4ZD3H 3V6BR 4F37F 5CINL 1UZ6E 3MUY1 2DI9A 2W9DH 1FRGL 2XA3A 3OZ9L 5CZVL 2AV1B 3K46A 2PO6C 3AY4A 4I3SL 2ZUSA 1KENH 5BV7C 2ICWJ 3QUZB 4KQ3H 5CGMA 1R3IL 5JW4M 4IS6B 5FEBA 3UTSB 1XGUB 3O11B 1U3HD 1ND0B 1HI6A 5DJ8A 1C5BH 2HTLC 4CVZB 4YDVA 4FQLH 4PJFE 4YUEL 4HWEL 1F3JB 3DMMB 4NBZB 3SGDH 3ZKXB 4XB7A 1U8NA 5D7KD 4P2QA 2UUDK 2OM5A 2DYPB 4F7MA 4F3FB 2DWEB 2L7JA 5HYFA 5DQDH 2R2CA 1X6LA 4YGAB 1FVCB 4YHIB 4AM0A 3L5XH 2YOCA 3B9KB 3IDNB 4POUB 3VFPA 5GS1B 3L5JA 3MUHL 1MY7A 1J1PL 1AGBB 1BBJB 4N0UE 3QIWD 2CH8A 2D03L 1A6AA 3MA9L 3O81A 4BSWB 4MLIA 5F9DC 1QVOA 4OZIF 2CGRL 5EU4A 4LVEA 4WTWA 4RMRA 3C87A 3F7QA 4G7VL 5EBMA 1AE6L 4M3JA 3W0WD 4ERSH 1U0QA 4EIGB 5IMOB 4OGYL 3PWPD 3RWFB 1VFBB 2XPGB 1IC7H 5TDPA 4UQ3A 1C5CH 2P5WB 3BESR 4ALAH 3TGXA 4ZUTB 3G5VA 1U9KA 1G1YA 3V5DA 4CDHA 2OJZH 4PS4L 3BFOA 2V17L 9CGTA 1N59B 3X14B 3C6LD 4JN1H 5ELIA 3ARDC 1AC6A 3EDDA 2QQKH 1S7SB 3VXQB 2HWZH 3EYQC 3SE3A 4ODUA 2X44D 3TBVB 4YDKH 2V2WA 1H8OA 2R29H 4EI5A 1Q0YL 1WFNA 4M6AA 3RRQA 5I19L 2ZG1A 5T3XD 3MLZH 4YHLH 3TH3T 2EEAA 2BCKB 1CE6B 1I8IA 5BW7C 1T4KB 1UH4A 2F54A 3QFJB 5GGVL 5C0EB 1JWMA 2JIXD 3DX7B 5HYIA 3X13A 4MA7H 1BZ7A 1XF4B 2A6KA 3HRZA 3MRLA 5HPMA 3KDMA 2EE9A 4HKXA 1X4ZA 1IEAA 2C3VB 1Q0XL 4PGDB 1MI5B 5SWZB 2UWEB 3RWHA 4U05A 5EOQH 3STLA 1J1OH 4IRSA 4MMZC 4MQSB 4KPHL 1OPGL 3HZKB 2R56L 1YEHL 1CFQA 2ZOLA 3NMEA 2WQ8A 3RI5F 2BVOA 1CGWA 2WBJB 1CU4L 2ZG3A 3IDGB 4IBLT 4JZJB 1D5MB 2FO1A 1NFDE 2HT3C 3ARBB 3PHOB 3NFPB 4V2CB 1KIRA 4NP4H 2YC1B 2WUBH 3O2WL 5J57B 3P9LA 2XTJB 4E5XB 3GB7A 3L7EA 1RZJL 3R8BB 3B6SB 5A2JH 4CDGC 1YEIL 1BHGA 2VZTA 4GXUN 4MNGA 2IBZY 4V1DD 3Q48A 3ULSA 1PZ5B 3X3GH 4PJEA 3WIHH 2X9WA 2ITDB 5DVOA 2AKRA 2OI9B 7CGTA 5TH2A 43CAA 4F7PA 3HUJA 3T0ED 3WIIH 3BHBA 1NEZB 3MACH 1OVZA 1I7ZB 2NY2D 3O2DL 3LEVH 1BOGA 4LLYA 1JGEA 3ZE2F 1Z9LA 5JIIA 2JCCE 5KZCD 5JUEL 1AHWA 1F4WH 4JFED 3U36B 2FECI 2VWEE 5D1XD 3ISWA 2AEWA 2IG2L 1HKLH 4KZDH 4U0RC 2VISB 1FO0B 1IGML 3IU4H 4I5BA 5D6DA 4D0BB 3MLVL 3IXAA 1BFOB 1SBBA 2VE6B 3O6MH 4KROC 3TBSA 1HZHH 1ZHLB 2RCSL 4OD3H 5L2KB 3LEXA 4G6FB 4WWKA 5KW9L 1FN4A 4YX2H 2QHLA 3MRBA 4ZFZB 2DTSA 1NDGA 1RUAL 1WC7A 2XKUA 4YNYB 3TN0B 3MODL 3I9GH 2F53A 5DQ9B 5INCB 4MJ5A 1FVDA 2ZKHH 1A5FL 4XH2A 1BD2D 5JOFA 1NC4B 2UWEE 3BP5A 5E8OB 3UC0H 2PN5A 4PIRF 3MR9B 4PB9L 4WU5B 1QO3B 1AC0A 4NDMA 1WIUA 3GJFA 3ULVE 1ZT4B 2FL5B 3MROA 3FJTA 3KS0J 1H15A 4KK8C 2W38A 4PRIE 4RISH 5T3XH 4CADB 5HHMB 4HXBH 5CIPB 2BNRD 5IROC 2XOTA 2NR6D 1CFSB 2APWA 3IDYC 4X4ME 2Z4QB 2D7OA 5DQJA 5TE7H 1FORL 1M7DB 4FQHA 1NANH 4CAGA 3T0AA 3QSKB 3ZLQC 2APTA 3TT1H 3LKSB 3SE8H 3U0TB 3ARSA 4JO3L 1KJVB 1A6TB 3I85A 2YK1L 3MJ9A 2VLLA 4NKDA 3TBYA 5L9DL 4RRPG 3UZQA 2Z8SA 5HYQA 2CDGA 4Y4HC 1ACZA 1WBYA 2VITA 1A7QL 1FL6A 4CMHC 5F7KC 4OQ1A 3CSPA 4OGXH 5SWSB 3SJVA 5D72L 5TF1H 3PGFL 1I1AC 1ZT1B 4XHJC 4CBPA 1XF5A 1MCEA 1N26A 1HSBB 1FCGA 1AI1H 2X4QB 4L9LC 3QIBA 4J3XA 3CFCL 1CDUA 1Y6KR 2R15A 1SY6L 5F9JA 2AW2A 2EDQA 3MRIA 1KJ3H 3LZFH 4BSVA 1T1YA 1KB9J 1UB6B 3SKOB 1KNOA 3PIQA 2QSCL 3MBED 4I9WE 4R7NB 4JQVC 3UTTD 2QSVA 3MGOB 5DRWB 2HP4A 3N1QC 4GW1A 3TESA 4PGBB 1BGXL 3AU1A 3WHE0 1PYWB 5I8OH 3DX6B 3HG1A 3ZT5A 3ZKNC 3CK0H 3BPCA 1MHCB 3MRMB 3B2VL 1JF1A 4KAQH 1JJUA 4PJAB 2J4WH 4HSQA 2D3VA 4AL8L 2W9LA 5I1IL 4NRZA 1GOFA 4C56B 5KSVB 2X42A 2CXGA 3UMTA 5J3HC 4WRLA 4IMLB 1WITA 5IVXE 3MLSL 1PSKL 2FYYA 1EFXD 2E8YA 1P9MA 4PJBF 4PBWD 4RAHA 5C0AD 3HZVB 5KVMC 3FRUB 3MREA 3GBMH 3MCG1 1I3GH 3ORJA 2Y72A 1DLHB 2A1WL 1F4XH 3IDJA 1MFNA 4QCIA 5FUCE 1JL8A 5CSZB 1WT5A 5HHME 3N1GC 4R97C 5MEQA 3IS1X 4FQPA 4IOIB 1U8PA 3O9WC 1MFAL 4P5KB 4TNWK 4F58H 1U6AH 1QBLL 3T77A 1S9YB 3TF7C 4M1DH 2H2SC 1EHLL 5CP7B 4H26A 4F9LA 1Z9OA 4IDJL 4OKDA 2BNQE 5IW1B 1NCAL 3S3JA 1RI8A 1GJIA 3IF1A 3BWAB 4KJWD 4CGTA 2HH0L 4JLRA 1EX0A 4YWGL 2EO9A 5FCSH 4IOSD 2AJXH 4ZFGL 5I17B 3F58L 3KLSA 3H3BC 3RNKB 3KLDA 1IVLA 2YWYA 4MB4A 4X7EC 3V0WH 1PD6A 5SWSE 3I3BA 4HFWA 5JQ6H 3QI9C 3TA3C 3GMPB 5BVJB 4XAWL 1R3JA 4K94L 4L8SB 4Y19D 4AENB 1ZVYA 3CFBB 4JFXB 2ZUTA 4K3GA 3A6BL 3U0PB 1H5BB 1MLCA 1FH5H 5EUOA 1NEZG 1A6VL 2A0LC 4MZ3A 3SQOH 4DVBB 2AGJL 5E1AB 3C09B 4PJHF 5GIRA 3LN4B 5F9AC 2Q86A 2RFXB 1JP5A 5EBLA 1X5AA 3KJ4C 1YJDH 3QEUB 4HUKB 4AEHH 3SKMB 3C5JA 5F7UA 4LCWD 4HMDA 2PW1B 5C0BD 5K9JH 2P8LA 3F12B 4P2RB 4GAGL 1CG9A 1CIDA 3MLUH 2K9UA 5IJVA 4HD9A 4MQTB 4PJAE 1UKSA 3F7VB 4OM0L 2YBRB 4BQ8A 4Z7VF 3OKLA 2VDQL 4MXVF 4WW1A 5ADPH 4KQ4H 1R5VB 3AS1A 3F6LA 1Y6MR 4TPRL 2VLJE 1CGSH 4RGMC 5IFHL 3ARFC 2CRZA 4H20H 4ODXA 1KYOJ 3T1FB 2FIRT 4G8GE 3ALXA 4UOW0 2X89A 3GGWA 5C0GB 2NYYD 3RZCA 2IPUK 3DROB 3WHXA 3NCYS 5DMIL 2QQLL 5FDWA 3DETD 4PR5A 1UM6H 4EKXA 1U8OB 4PRPD 5C07E 4XI5D 3K8LA 2AEPH 2P46B 1X4XA 1GL4B 4Z7WF 1F6LL 1MRCL 5EZOL 5LVEA 3MGTB 2BSTA 3S34H 2CUMA 3A67H 4UT9L 4U7SA 2WWMD 3NCBB 4QT5A 5JW4R 2ED9A 4NFBA 4OZ4A 1HXYB 4FXGA 2EZ0D 2EDRA 5JIKA 1SJHA 2C4FU 2YSSA 3CXDH 3VJ6A 4P5TC 1XR9B 2DN7A 3HE7D 3UXFA 1A02N 5CWSA 4DN3H 5H8DA 5E1HB 3WFBH 2NW2A 1PX3A 5IFAH 5CMAB 3V6OC 4Z18A 1N0XL 5EBWA 3PGDB 2X4PB 4D3CL 5HHNB 2BOCA 3D18A 2IALB 3ET9F 5D2NC 4EJ1C 1JPGA 1UQSB 2CDFB 4NHUA 5I74B 1P1ZA 4G6KL 4OLXL 4NO0A 12E8L 5DYOB 5C08B 4Z7UE 1A6UL 1B90A 3GSRB 3HS0A 3EYOA 5FM8A 1CFVH 2NY0B 3VWKB 2XA8H 2R2HA 3VFSB 3KPRD 1F45A 1GIGL 5FXCH 1PFCA 2BRRL 3VH8B 2G60L 5TDOA 2ATKB 4K23L 3NFSH 1MCJA 3WNLA 4BZ1H 1NCBH 3QNZB 3SBWA 3PWUA 2CIIA 3UPAA 5D7JB 3QO0B 1EERB 5JPNA 1QLRA 1P5VA 1I4FA 1AXTH 1UENA 1F6AB 1XIWD 3HNTH 3GSXA 1FZMA 5DZOA 3C08L 1EXUB 5EBGA 1LP9F 4P5MA 1ZEAH 1I7TB 5SX4H 4X7SL 8FABA 1NFKA 1G6VK 3ESVF 1KCUH 4KI1A 2OR9L 4N8VB 1FC2D 3QHZH 4M48L 3OF6D 2HVKA 2XQYK 1KEML 3KLAB 1WTLA 5DD6B 5FKAB 4OZIE 5D7SH 3DIFB 5FGRA 5FHBL 2A38A 2Y06H 1ORQB 1LQSR 1HSAB 3KYOB 2R9HD 3QUZA 3U6RA 3MNZB 4P46D 5IQ9B 1I8LA 4FP8H 4MHHI 5JOEA 3UTSA 2QEJA 4P2OD 2FEEL 4TVPL 5KSAC 1XGUA 3RY6A 4DQOH 3O11A 4KJQC 4FFWD 2VL4A 1QRNB 1DFBL 1ND0A 3KYKH 1JRHL 5E08H 4CVZA 4XBEL 1I9IH 2XRAL 3GJEB 4TSAL 3BW9A 2VLKD 4GRLD 4HBCL 4Y2OA 3MUZ1 1F3JA 3DMMA 4ZDHB 4UNTA 1QLFB 4YE4L 5HHVL 4HIHB 2X1XR 4ZTOH 4WI6A 1YMMA 1YYLH 3HNSL 4PRBB 2DYPA 4JM4H 2IFGA 4F3FA 3PL6A 4PJ5B 2DWEA 4DFHA 1UWXH 4DKAA 1T03H 1A4KA 1ZS8B 3GBLA 1IRAY 4YHIA 1CFTB 4ODSL 5GRUH 4KVCH 3L3DB 5KVDL 4NWTL 3B9KA 3IDNA 5IW6A 4Z9KB 4JPVL 1QFOA 3WXVH 3ILQD 1D5BB 5GS1A 5E4IA 2R9HC 5EA0L 1J9CT 1DANU 1AGBA 1BBJA 4ONFH 1NGYB 1PG7L 2NY3D 3O8XB 4RRPA 5JMRA 3VDBA 3NA9H 3NPSC 3O4LE 5LCVL 3ZDXF 4FFWC 1MQKL 2NY6D 4NKQB 4E41D 1NGZB 3LB6D 5MI0B 5GGSB 2X4NA 2Q20A 4NC1C 3UAJD 2QADB 2VLRB 1EUTA 3DPBA 3VW3H 4TNWF 1KB5H 2H45A 1INEH 2DL9A 2XZZA 1QBML 5JDSB 3HC3L 2X70B 3EJZC 4GRWF 4D9QE 2P5WA 3BSZH 4MGXA 4MNHB 4H0IA 3SDAB 4HV8B 4ZO6A 3P9MB 3HNVH 4C58B 3STBA 3DHJA 1HH6B 3RA7H 3QEQB 2WNGA 5J89A 4A6YA 4OCSL 4JFQB 1N59A 3H2WA 1A6WH 4K3EL 3X14A 4EBQH 1IEHA 1BPVA 3EGSB 2LAGB 1S7SA 3VXQA 1NEUA 5F3HB 1OTUD 5JIHA 3NGBB 3TBVA 5HD8D 5C3TA 4JFOA 5FO8B 4PGZA 3M45A 4MCZA 1CDHA 2VZVA 1I3VA 2YPLB 2Q8AH 4BFEA 4N8CL 1CE6A 1T4KA 3G6DH 3KXFD 3QFJA 5C0EA 3ZE2E 3DX7A 4EEEA 1QRNE 2HG5A 3VFWB 4P9ML 4LRIA 1XF4A 1MHPL 1CD8A 3CDCA 1BZQK 3V5HB 3L1OL 4GAJH 3WDHA 4D9RD 1BFVH 1K3IA 3W11D 2DQUL 5JOPD 1ONQB 5I18H 3HCVB 4PGDA 1MI5A 4GBXB 1VA9A 5SWZA 2EXYD 1B2WH 2FHFA 2H26B 4P3WA 1WIOA 1T66C 5EU6E 5FYKH 1RIVL 4OCXH 4D2NA 4PJ5E 3HZKA 3BKJH 4Q97A 2WBJA 4JZJA 3IDGA 4XPAH 2O93L 1D5MA 2X05A 2DI8A 3S36H 5EDXA 3I2CL 1QYGL 4OQTL 4LKXB 3SEPA 3ARBA 2CJUL 5EU3B 2J3SA 4Y16D 3NFPA 4WV1B 2E27H 2YC1A 3QQ4A 3FOLB 5DK0A 3D69B 2XN9A 4X8JB 4HG4J 3B6SA 3OKMB 4W6YB 2AXFB 2JELL 5HYJD 2PETA 1X44A 2FD6L 2FLBT 4KRPD 2Y07H 1PZ5A 4XCFL 1I7UB 3JBG7 4XWGH 4UTAH 1SBSL 2ITDA 3AY4C 4JG1L 1CZ8H 4RFNB 2J12B 3WSQL 3RIFK 3VH8G 5B39B 5DD0H 1NEZA 1QFHA 1I7ZA 3HZYB 1J1XL 1XF3B 2FBOJ 1EHNA 2IANB 5D7IF 5HGHB 1J8HB 2VNCA 5IB2A 1N5AA 1BOYA 4HC1L 1FPTH 3DRTB 1OP3H 3EOTL 5C9KA 4MD0B 1XGYL 1PGRB 4FMFA 2RQ8A 4WFFD 1RURL 4NN7C 4EN3B 5JW3L 1T04B 2VISA 1FO0A 2R4SL 2XICA 4KK6C 4D0BA 4GAFB 5IQ7L 1LO3H 2H6PB 1BFOA 2VE6A 1MF2H 3FAXA 4U6XB 5L2KA 1MREL 5F93C 2DBLL 1A4JB 1JIBA 5GXBB 1KF9B 2YPLE 2L0DA 2YZ8A 4NKMA 5T1MB 4ZFZA 1YEEL 5I16B 3W81A 4YHNB 3VMOA 5I71B 2YD7A 4YNYA 3TN0A 4FXKB 3D6GA 3VDAA 5DQ9A 4YFLI 1MCCA 5B38B 5J6GB 4PJHB 1G9MC 1OTTC 1JFQL 4XVSL 3SN6N 1D6VL 1NC4A 1NLDL 3VFGL 4IHOB 1TZIB 3MR9A 4BZ2L 4TOYH 3TPUB 4WU5A 1QO3A 1SEQL 1B0RB 1RIUH 4NQEB 4HWBL 3K7UA 4XVTH 2FL5A 4PREB 1CLYH 1RJYB 2OL3B 2YD5A 2D0HA 1JF6A 4MCYA 4ZD3L 2YD4A 5C0FA 5I1EH 2W9DL 3DTXB 1Q72H 5CIPA 2EXWC 4BFBD 3QQ3B 1NBQA 1CFSA 3E3QE 3RDTB 1KENL 2Z4QA 1HHIB 4KQ3L 5FFLA 4RAUA 5T1KA 1DBJH 2Z31B 4GW5A 4XXCA 4Z7VB 1CICB 3LKSA 4JB9H 1QZ1A 4PRAB 5JZ7D 4PFEA 2VDNH 1KJVA 1A6TA 4PJBE 1NAKH 2VZUA 2ADFH 1C5BL 1JWSB 4FQXD 2KBGA 4FQLL 1RUKH 4NN6B 1X5YA 3SE3C 4EI5C 1EBPA 1TVBB 4ELMF 1JGDB 1XAUA 4JHWH 4TNVK 1QFWH 5I1JH 1F4AA 1ZT1A 2IANE 1TTUA 1OF2B 1J8HE 5ICXB 1M05B 2ESVE 2CLZA 3W9EB 4AH2B 1HSBA 5DQDL 2X4QA 5GS0D 4JPWH 1RJLB 3L5XL 4PP1C 5TGBB 4YC2B 1BIIB 1FHGA 3EDFA 1UB6A 2YXFA 2EDNA 3SKOA 4YIQB 5ICZA 4J1UA 3D25B 2XT1B 4HKBB 4R7NA 3HPJB 3MGOA 3O6LH 5DRWA 4QY8B 4IRSC 2HYMA 1HILB 2E7CA 4ZOBA 1PYWA 4H1LH 4IM8A 5HI3C 1TTFA 3EBAA 5SX5K 1KN4H 3DX6A 3CUPB 1HNFA 1WV7T 5HHPB 5CP3H 1MHCA 3OGOE 3QWQB 1AJ7H 4N9GB 1IGCH 4C56A 3AS2A 3C5ZD 5KSVA 1PKOA 3P4LA 2VL5B 4HK0A 4ERSL 1HYRC 4G6MH 3TWCH 3KPOB 4LLQB 4WI5A 3S97C 5CGTA 4OSUH 4IMLA 1IC7L 1C5CL 1FJ1B 4ALAL 5C0CA 2D7MA 2EYRB 4DGVH 3FN3A 3FRUA 5DD3H 3BZ4B 5FM5M 2FX9H 5CFHA 4M7KH 5F6HI 2OJZL 1DLHA 1MCPH 4GUPA 4S1QH 1MCNA 5CSZA 1I8MB 2YA1A 4JN1L 1KJMB 2QQKL 3FT2B 1M6OA 2HWZL 1DQTA 1JNNH 3JWDH 4YDKL 3RKDD 2R29L 1NC2A 2JB5H 3WXWH 4IOIA 4P5KA 1AHWC 1TITA 2J2ZA 1MELA 4KUCF 4PLKD 3MLZL 1S9YA 2R1XA 4YHLL 2BJMH 4Z7VE 1LP9B 4Z7OF 5IESH 4MXVE 1LDPH 4ZUWA 1IC4H 4Y4KA 1OARH 4KK9C 5IW1A 1FNGB 3EYUH 4KXZH 4U1SB 4WO4B 4MA7L 1TXKA 3BWAA 2FH6A 3S35H 4PV8B 3CDGB 5D6DC 1RZGB 4X6CB 5I17A 3MV7B 3SDDD 3BQUA 2R0WH 4CL7A 3RNKA 4WWKC 3CCHB 5HY9B 5KBNC 2I25N 1UFUA 3GIVB 3QQ9C 5HDLA 4BUHA 3GMPA 3BN3B 1PQZB 4L8SA 5EOQL 3RGVA 4AENA 1J1OL 3CFBA 4JFXA 1CXEA 1FNAA 3KPSD 5E9DE 1H5BA 1V3MA 4Z7WE 1YC7A 4DVBA 2DIJA 1H3GA 4OF7A 3MBXH 3LN4A 5GGTH 3T65B 4NP4L 2WUBL 2RFXA 2HT4C 4H25B 4JY5H 1KN2H 5D70H 1ZLWH 1KJ2H 1I1YB 3QEUA 4J3OC 4NQVB 3SKMA 3VGHA 3BJ91 5F7LB 5GQBA 1KOAA 2K1MA 3S5LB 2PW1A 1AXSB 5FF6B 1NCCH 2ICEB 3F12A 4QOKD 4ZAKD 5A3IC 4P2RA 4QYOB 1QKZH 4G9DB 3X3GL 3GSUB 4LVOC 3MOBH 3WIHL 3OMZA 5DO2C 3SDDC 5BZDB 2P48B 2R0ZH 3WD5H 3WIIL 2YBRA 2N1KA 3MACL 5GS0H 3LEVL 4BQ9A 1WUNT 1R5VA 3EYVB 3U7AA 2X4UB 4MWFB 2UVEA 4YR6A 1F4WL 3T1FA 4HGMA 3RIFF 5FUZH 1FZJB 5B38G 3VGDA 3GSNH 2Q7YA 1FC1A 2F8XC 1KYOK 1CI5A 1HKLL 5C0GA 4KZDL 3DROA 5DFVD 4Z0XB 3IU4L 1WCBB 2V6HA 3OJVC 4ENEC 1U8OA 3O6ML 2BX5A 4TVPE 1HZHL 4OD3L 4EI6B 4W4OA 2HJLB 2VABB 3MGTA 3IKKA 4YX2L 1LP9E 3QIBC 3GMMB 2QKIB 5DURD 4NO3B 4ZPTB 3PDGA 1IM3B 3VXRB 1CGVA 3ABZA 1BQHB 4O2EA 2BNUB 3FFCB 2XKNB 3PNWB 3I9GL 2E7BA 4FTVB 2IH1A 4G6JH 3MV8B 2G2RB 3WEXB 4G9FB 1SJVA 2ZKHL 4KKLC 5DMKB 4PJCA 3BMWA 2GJ6D 5CJOH 5CMAA 4HIIB 3UC0L 2WIIA 2R2EA 4R7DB 1VESA 1YZZA 5DHXB 5EZJB 5ALCH 1FZOA 1UQSA 2CDFA 4D0DA 1OP9A 3F65A 3X17A 3HPLB 4RISL 5DYOA 5C08A 5T3XL 3TVMD 4HXBL 3GSRA 1BFSA 3SKJH 1ZANH 3B9EA 3VWKA 4EXKA 3H9ZA 3VFSA 4LP5A 4AG4H 2FATH 5TE7L 2EDYA 5FK9B 3VH8A 2GHWB 3TT1L 3SE8L 1EK3A 2H3NA 1ZA3B 1NBVH 1I3UA 1JNHA 3KPNB 2B5IB 3QNZA 4GXUM 4Q0XH 5T3ZH 4GJTB 3BRGC 1WT5C 3CVHH 3U7YH 3ZKQD 4OLVH 4FA8A 1F6AA 4OGXL 4MD5B 1UA6H 3RJQB 5MENB 5BV7H 1Q94A 1PVHA 2R1WA 5TF1L 1I7TA 3BKCH 2D4DA 4B53A 1UWXK 3G5ZB 1P4BH 2OQJB 4M7LH 5CEXB 1AD0B 4KK5D 1AI1L 3QG6B 1LO4H 4PJ9A 4OF6A 3DX8B 3B9DA 3ZDXE 1WAAE 2IQ9H 3FO9A 3KLAA 4TNVF 1KJ3L 3HE6A 5FKAA 3LZFL 4YHYB 3KLHD 1ORQA 4OUOA 3KYOA 1PKQE 1U41A 3MNZA 5IQ9A 1ZMYA 2FIKB 4LVNC 5DXWA 3NIFF 4JFDD 1YMHB 5I8OL 1I85A 4I1NB 4GRWE 3QXDB 5D7IB 3CK0L 3CLFH 4RFEB 3L3KB 3VXRE 2MQ0A 1EMTH 4YQXH 2CK2A 3VG9B 4WTZG 3GJEA 3FFCE 4KAQL 2J4WL 5EOCJ 4Y2DD 3PGCB 4FTVE 1QSFA 3MV8E 4G9FE 3CX5J 1CDGA 3P0GB 4UTBH 1QLFA 3VD3A 4BH7B 4HIHA 3G9AB 4PRBA 5A2IH 5E2VH 3CSYB 5LG1A 1EGJH 4RMTA 1Z0NA 5D2LF 3GBML 1I3GL 3TO4D 5C6WH 1CFTA 2EYTB 1F4XL 3L3DA 4MX7B 1NCUA 5EO9A 1D6EB 3MNWB 4U6HB 1D5BA 2G9HB 1RK0B 1UVQA 1GPOH 4UBDC 4R2GC 5DC4B 2O5ZH 3O8XA 5I0DA 5F44A 3G6JE 4JPIB 4F58L 1U6AL 1WBZB 3VFOB 4M1DL 1AO7B 5BOPA 4HX1B 2Z93B 3CMOH 3RZCC 2XY1A 1S7UA 3MOAH 2VLRA 2VDMH 1AKJB 3VXTB 1UB5A 3KWWA 2AJXL 5C0JB 3BPLC 3D85D 3S5LG 3ZTNH 3V0WL 1CE1H 2VJXA 5MENE 4PJ7F 5JDSA 3RUGF 2X70A 1P7KB 2YUZA 3TZVD 5DJ6B 5JQ6L 4K07A 3MFFB 5EOCH 1A1MB 2GSGB 5AUMB 4MNHA 1SY6A 4DWHA 3SDAA 4CU6A 4WHYG 4HV8A 3P9MA 4N9OB 4LOUD 1T20B 5JHDD 1HH6A 1FH5L 1XR8B 3QEQA 4OZFH 5IBTH 1GGIH 3EGSA 3N9GH 3BDBA 3PUCA 3UPCA 5F3HA 1LGVA 4KKCD 5IF0A 1U8MB 3VI4F 5D6CB 2ZUWA 1YJDL 4QHUB 2VSCA 4AEHL 2YPLA 4L5FH 4M93C 3BPOB 3CH8A 3MV9B 5D7IE 4GMSH 5K9JL 1F11B 3VFWA 4QHLB 5AEAA 1CDBA 3MLUL 3LD8B 4DN4H 1NKRA 4Z5RB 3V5HA 2CR3A 1CS6A 3ZDZF 3EZJB 4L4TB 1ONQA 5DFWH 4CMMB 4GBXA 1SYVB 1T6WA 5JXED 5ADPL 4KQ4L 5C92A 2HAZA 1BQHG 3DXAE 3R8QA 1CGSL 3BP7B 2J8UB 4H20L 4PLJD 3T3PE 3SBWC 3TIDB 5JLZB 1SVCP 4OKVB 5EWIH 1PDKA 3DWTA 4ODBD 1NGPH 4F80A 4WV1A 2XZQH 1XH3B 4OB5H 1JGLH 1FFOB 1UM6L 5C0NC 4YO0B 3FOLA 3D69A 1TLKA 4X5XB 2O5YH 2AEPL 1FAIH 3OKMA 1CXIA 3STZB 2AXFA 5DMGC 3ZL4H 2VOTA 3S34L 1P7QB 2P4AB 2EYSA 3WL9B 3A67L 4HG4K 2W0FB 4JRXE 2LV4A 1RY7B 3MUJA 5E8PB 3H8NA 4Y4FB 1YQVH 2VZ3A 4DZBB 1I7UA 4JFFB 5D5MF 3Q6GH 2VDOH 3CXDL 1XGQB 3G5XB 1Q9OA 1MFBH 3QUZC 3QJHA 1I8LC 4DN3L 3NZHH 3HZYA 3WFBL 2EC9U 3FOMA 5IFAL 3V7AE 5HGHA 4ZTPH 3RY6C 2BC4A 3WFCH 4OD2B 3VRIB 3DRTA 4XNYH 4JFHE 4JPKH 3B3IB 4MD0A 3OBAA 4ETYA 1JI2A 5ENWB 3U1SH 4MA1B 4EN3A 1AGCA 1T04A 5DK2A 5L88H 3DMMC 1U3HB 4JGUA 2A9NH 5IMLA 3ZKXC 2H6PA 3L5IA 1CFVL 4D8PA 1MFDH 4U6XA 2FWOB 4YPGB 3TH2T 2XA8L 1A4JA 4ELME 5SWQA 1H3WM 2YD8A 1YEDB 3OB8A 5T1MA 1Y0LB 4XVJH 3NFSL 1FGNH 4BZ1L 2X7LB 1NCBL 5DF0A 4YHNA 3B9KC 4TUJB 4FXKA 2WLYA 4PJ8B 5GS1C 1A9BB 1A0QH 4FABH 4JAMA 1AXTL 4U6TA 3OAUH 3HNTL 3VMNA 5B38A 5J6GA 1BZ9B 4PJHA 5HHOA 3BGAA 3P40A 1TJIH 1ZEAL 3LVEA 4IHOA 5ANMA 1LK3H 3TPUA 2C4XA 1A1NB 3QIWB 1B0RA 4ELKA 4NQEA 2N7AA 2HLAB 4PREA 4Q9RH 3QHZL 3OAZH 1I3RB 1I7RA 1RJYA 2OL3A 2AVGA 4M7JH 1K8IB 4PGJA 5D7SL 3DTXA 1ORSB 5CS7A 2Y06L 3RDTA 2DD8H 3SGJA 3AB0B 3QDGE 3IKCB 1D9KD 3L3IB 3W0WB 2Z31A 4FP8L 3OSKA 2VWEC 2B1HH 3PWPB 1CICA 5DS8B 3JTSA 1FNEB 4DQOL 3ULVD 3VFRB 3FQWB 1BF2A 1MY5A 3KYKL 3LQZA 1KELH 1JWSA 4OF8A 3JZ7A 4JFFE 4PRID 5E08L 1I9IL 1XCTB 4HGWB 1TVBA 2XXCB 2G5RA 1AP2A 4LLUB 3DRQB 1DLFH 3C6LB 4HUWA 4ZTOL 5KOMC 1YYLL 4JM4L 4ZQKB 5J11B 1OF2A 1LDSA 5ICXA 1M05A 4XP9H 1W0WB 1T03L 2J7LA 4LRIC 4XC1H 5JXAH 3IYLW 2X1OA 4Z7OE 1RJLA 4AIZB 5GRUL 4KVCL 2JIXB 1Y6NR 1JBJA 1BIIA 2ICWI 2GJZB 4YIQA 3WXVL 3EO0B 1S7RB 2APXA 1CGUA 3D25A 1KV3A 2OCFD 4HKBA 4I3GA 3UJJH 1VKXB 1K2DA 3HPJA 4ONFL 4NM8H 4QY8A 3ZO0A 3IAPA 3NAAH 3NA9L 1KFAH 2X09A 5D7KE 5I76B 5CD3B 2WBJC 4JZJC 1NUFA 4XC3H 1S5HB 4S1RH 5D1QD 2X1PA 3ARBC 5HHPA 1OP5H 5J7CC 3G6AB 4N9GA 3VW3L 3N1MC 2I27N 3MSPA 1KB5L 2XTJC 2VL5A 4I9WD 4PRHB 3WS3B 1INEL 2QLVB 4CW1A 4I77H 4LLQA 3AROA 3T09A 3RVVC 1EV2E 2D7NA 3UZVB 1FJ1A 3BSZL 3LKRA 1N3NB 2BZDA 2Q3AA 1FFRA 2C1PB 3PHSA 3HNVL 1A8JH 1OD7A 3LPGA 3S88H 4RBPH 5K9QG 1KEGH 2IMMA 3RA7L 3ULUC 4I18B 4JVPA 5K93A 1U8QB 2OI9C 3LS5H 1A6WL 2LTQB 1I8MA 4V1DB 4EBQL 1KJMA 3GK8H 3F7YB 2FJHB 2ORBH 4WTZA 2Q8AL 1FFPB 5DJZB 4HJGB 2EKJA 2NY2B 3PWPE 5EO1A 3G6DL 5IVZB 5EPMB 4LSVH 3FB7B 4QXUH 4LRNH 4WO4A 3VXME 1X4YA 4U1SA 4DUWA 1IJ9A 3SO3B 5KZCB 2WM0A 1MAKA 5F7DB 1HKFA 4JFEB 3CDGA 4X98A 1RZGA 1JGVH 4X6CA 1X7QB 3MV7A 2HJFB 1ETZB 4GAJL 1BFVL 5E6YA 5LGHH 1ZGLM 4DTGH 4R96B 4XCNB 5I18L 3QR2A 3CCHA 4NZJA 5HY9A 4AJ0A 2PNDA 4UILH 1B2WL 1PQZA 5J1AB 5FYKL 1FLRH 4OCXL 4XP5H 4WWID 3F7RA 3HN3A 5E8NB 3BKJL 2BNQD 4C4KT 1N8ZB 4XPAL 3TN0C 2Y5TB 1CXLA 3O6KH 5EO0B 3S36L 3BGMB 3ARQA 1K85A 3QZWB 3ILPB 4P4KD 4PPTA 3T3MF 2EIDA 5E00A 3T65A 3LRHA 2E27L 4H25A 4ZXBD 5E56A 3FN0H 4GMTH 2CKBH 5CLTA 1I1YA 4UINH 4NQVA 2DIBA 4HJ0C 2XG5A 1JGUH 2EDHA 1LWRA 5JNYB 4ZMAT 3S5LA 5HVHC 2CO6B 5FF6A 2ICEA 2XYCA 3QXWA 5FDYA 4QYOA 4E0RB 2Y07L 4G9DA 5FUCC 3GSUA 5I1KH 4XWGL 5D2LB 4UTAL 2EE6A 2VQUA 4LLWB 5BZDA 1CZ8L 3E2HB 4PRHE 4JN2B 5BQ7B 3LRGA 5DD0L 4N0FA 3U9UB 1WQVT 3FQTB 1JHTB 4XPTH 2BNRB 3OG4B 2X4UA 3G04B 4XXCC 1T2JA 1DDHB 1I1CA 3RZWA 4OAWA 1FDLH 1FPTL 3U4BH 5F3BB 5I66B 1FZJA 4RGNE 4R4ND 2WWKO 4XX1E 4JHAH 4M43H 1KCVH 2B4CC 4LHJB 1EH9A 1WCBA 4I0PD 4R6UA 1LO3L 4NQXB 3E0GA 1S7QB 1MF2L 3IVKB 4KI5F 1ZT7A 1T5WB 3QH3B 4WUUB 2WSKA 1FNSH 3L7FB 3EFDH 2HJLA 2VLJD 2VABA 4L3CB 1BJMA 1IKNA 1V05A 3L3JB 1IAOB 3GMMA 2QKIA 3JV0A 1K5NA 4G8GD 2VN7A 2ZOKB 4NO3A 4ZPTA 3JUZA 1IM3A 1QUNA 4D0CB 4OFIA 1BQHA 3DECA 3FFCA 2XKNA 3PNWA 3UTQB 4JKLA 2G2RA 3WEXA 4HDIB 2VAAB 5C07D 4YAQA 4OTXH 3DV6B 5DMKA 2BSSB 3MBEB 2ZWLT 1CBVH 4RIRB 4HIIA 4R7DA 4OZHF 4OQTA 1J0JA 2NLJB 3NABH 5AWNH 5I8CB 1RIUL 4TUKH 4WTXA 5EZJA 3NIFE 4XVTL 2HN7B 4Y1AB 3SDCD 1KIPB 5FB8A 1CLYL 1NANI 1JZ6A 1Q8MA 2FJFB 3O2VH 5FGBA 5GGQH 5DVKA 3HPLA 2M1KA 5I1EL 2QV2A 1ZWIB 1Q72L 3QUYD 4LPWA 1QLEH 4J3SA 1J0ZA 1E28B 2GTZB 3U46B 3Q3GB 4HUVA 1L7TH 1GZQB 1DBJL 2DWDA 3V6ZB 1RHFA 3EAKA 4JB9L 4GG6F 1ZA3A 2IAMB 1E0OB 4K7PY 3GIZH 1EFXB 1T1WB 3CFIC 4GKOA 2VDNL 1NAKL 3ZYOA 1Q1JH 2ADFL 3M8OH 4NZTH 1CN4A 5B8CB 1RUKL 4BA8A 2FGZA 1U8LB 1VCAA 2ADIB 1JYNA 4HC1A 4JHWL 2W60B 1QFWL 3P4OB 4L8DB 4X8XA 5I1JL 3SY0A 3LQAH 3G5ZA 4HWUA 3LEYH 4Y4KC 2OQJA 4P9HH 5CEXA 1AD0A 4NRYA 1ADQH 1BAFH 1T2XA 3CFKB 5F89B 3DX8A 4JPWL 1EAPB 1ZGLB 1JTPA 2NPLX 4H5SA 5E2TH 1L9NA 3IFLH 4RGOH 5IHUH 1UT9A 2V7NB 3QISA 5D5MB 4LLMB 4L8SC 3O6LL 2BY2A 3RGVC 2FIKA 4WUUE 2VLME 4G8IA 1H5BC 3GNMH 4PJ7E 4XNZB 3RUGE 1KN4L 3QXDA 1BWMA 4Y19B 1G7MA 2Y6SC 5C6TH 2X4RA 3C09C 3ZSSA 5K59E 4LHUD 1AJ7L 2HRLA 1VACA 4HZLB 1IC5H 1IGCL 1QOKA 3PGCA 3PV6B 4LPXA 1GOHA 4G6ML 4MQXD 3TWCL 3NA4A 4BH7A 4XPBH 3QDJA 4HWBA 4OSUL 4KKNA 4D9LH 2IF7A 3CX5K 3E8UH 2IWGA 3CSYA 3WKMH 1FNLA 4DGVL 1S78C 3C60A 5DD3L 2HA1A 2OSLB 2FX9L 2V2TB 4LCWB 4M7KL 2FRGP 1INQB 4HQQH 4LSRH 2EYTA 1MCPL 4WEUD 1YN7A 2BVPB 4Y1AE 2ERJB 1U3ZA 4MX7A 4S1QL 5C0BB 1D6EA 3CX2A 3D39E 4U6HA 4U6VH 2G9HA 1RK0A 1URLA 4UT7H 5AZ2H 1NGXB 2FJGB 4JZNB 4MDIB 1F3DJ 1JNNL 2DQDH 3JWDL 1T7WA 5ID0A 2JB5L 3WXWL 1X5GA 4HIEB 4JPIA 3ZDZE 1HHKB 4WEBH 1UGNA 3PP3H 1WBZA 2AV7B 2BJML 3VFOA 3QZWG 4JHZA 1AO7A 2XACC 1KIQB 5IESL 1LDPL 3IFOB 3VD7A 2VXTH 1IC4L 5A2LH 2Z93A 5EH1A 3G5YB 1FP5A 3EYUL 3LPFA 4OCLC 3S35L 1IGFH 5I75B 3AREB 3VXTA 5KS9F 2R0WL 5BRZE 2MSPA 3QWOA 4JFYB 4W4OC 3S35X 5E2UH 1P7KA 5C2BH 3QPXH 4Z78B 5DJ6A 3MFFA 3O4LD 2GSGA 5AUMA 4PRPB 2WP3T 4M8QA 4ZSOE 2J6EH 3GKWH 2BERA 2J8HA 4JG0H 4RDQF 1XR8A 4QRTA 1Z9SA 5EOTB 2IGFH 3FT3B 5D7JD 5DJDB 3DO7B 2B39A 2XZCH 1ITCA 1QPXA 3MBXL 5GGTL 1U8JB 4JY5L 5DA0B 1KN2L 1U8MA 2AP2A 4QEGA 1VFMA 5D5ME 5D6CA 5DHVH 5FM4A 5F8QC 5D70L 1VGKB 2YEZB 1KJ2L 4D9QD 4QHUA 5HVFB 2MCPL 5B3JF 4CVWA 3EOBA 3MV9A 3HAEG 4Y19E 1NCCL 1CQYA 1F11A 5I74C 1KB5B 1NMCB 1MCFA 2Z35A 4XRCB 1G7QA 1QKZL 5IFJB 1VHPA 1OAQH 4PTUB 3MOBL 1KCKA 5ILTH 3GSQB 4UIKH 2R0ZL 2NY0C 3VWKC 4L4TA 3WD5L 1I9RH 4CMMA 1SYVA 2VUYA 5GS0L 3LN5B 2PO6A 3U30B 4FFVC 4E42B 2J8UA 3KPRB 1FFQA 3TIDA 1QRND 5FUZL 5JLZA 4DCQB 1I9EA 3GSNL 1NCWH 4HMCA 3EW3B 2RR3A 1WFTA 5BXFB 1JWUB 4ZNEE 3GRWA 4YO0A 1TDQA 1OHQA 2C3HA 4GQ9H 1XIWB 5KANG 5EU6D 5MERB 5A1AA 5E5RB 4FZEH 3QXAB 4PJ5D 1G7LB 5SV4A 1P7QA 1M7XA 4PJ9C 3SCMA 4PTTA 1ZSDB 5E8PA 3S37X 4Y4FA 2COQA 4LGRB 4DZBA 4JFFA 4LP4A 2OZ4H 1A7RH 1C12B 3G5XA 4DKEH 4XCYA 3I3EA 4G6JL 3ALWA 1X5IA 4ZOCA 3E6HB 3IT8D 5CJOL 4N0YH 4JKMA 1I85C 4HZAA 4JGMA 4OD2A 1HYSD 1XMWA 3VRIA 3OAZK 1F3RB 3JVGA 4Y5YA 5C70A 3DYOA 4AIXA 5ALCL 2HFFB 4YHPB 5ENWA 4ODWB 3S4SB 2VMFA 2EDXA 1HHGB 1U3HA 4U6YA 3FQRB 1T22B 1W0VB 4N5ED 2RAMA 5ERWB 3VXSE 3SKJL 4ACPA 1ZANL 2VLKB 3Q5OA 3TCLB 4FNLH 1NCDH 2FWOA 4GRLB 3BIAX 1MUJB 4YPGA 1G9MH 4AG4L 2FATL 1YEDA 1N64H 4JVUA 2DDQH 2IBZX 3WIHA 1Y0LA 3WLBB 1R3KA 1W0YT 2VC2H 1NBVL 4Q2ZB 4TUJA 3WCYA 4Q0XL 5T3ZL 3CVHL 3U7YL 3QDME 1YN6B 3HR6A 1A9BA 3J8F7 4OLVL 2VXUH 3CFDB 3I84A 4HIJB 5MEOA 3BZFB 4ODVH 3O8XC 3NCYP 3SDXA 1UA6L 2Q76B 2PW2A 5KAQF 2RGSA 5BV7L 1VENA 3BKCL 2ZCHH 1EEZB 4BM7A 4Z7NF 5DI8B 1P4BL 4N0CD 1A1NA 3QIWA 4M7LL 3V0VB 5MI0C 2NY3B 1DEEB 5I1GH 4JY4B 2HLAA 1LO4L 1EJ6A 2QADC 1I3RA 2VO5A 2MPAH 2IQ9L 4E41B 1K8IA 4M00A 5E70A 2V5YA 2O61B 1ORSA 5BJTB 3B2UD 2C3XA 4YEEA 5H37G 2X4OA 4WVRA 3L3OB 3IAGC 3IKCA 3QHFH 3L3IA 3SDAC 4LPCA 3W0WA 4Z7QF 4JO4H 2OMBA 3QJFA 1MAMH 5C7XH 3PWPA 3RVUC 1FNEA 4GW4B 1N6VA 3VFRA 1I8KB 2YS4A 3FQWA 1OP5K 2VYRE 1IEBB 3OKNB 3CLFL 4OFYD 4K3DH 3U82B 5IM7B 4BH8B 1EMTL 4YQXL 1X5LA