2KQMA

Solution structure of the ki o18/o8 y87h immunoglobulin light chain variable domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYHCQQYDNLPYTFGQGTKLEIKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig kappa chain V-I region AU
publication title A single mutation promotes amyloidogenicity through a highly promiscuous dimer interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kqmA00
3QCVH 4ONGH 1CFTB 5DRWA 4NCC2 2YK1H 5MEQB 2BY2A 8CGTA 1YC7A 2Q7YB 3NCEB 5KSBA 3OJDA 4KHTH 1NC2A 4V2BA 5C0AB 4KXZH 1GC1C 3T2OA 1RZ7H 4O5LH 2XZZA 3JV4A 4OGZA 1WAAA 5EC2A 4JO1H 4U1KA 1MAKA 2GTZB 1DQQA 4GW1A 2P8MB 4NQSA 4D3CH 2EO9A 3VFNB 3UBXB 1AC0A 1YMHA 2QKIB 1BPVA 2J2ZA 4LSSH 3UTSA 1CICD 3QQ4A 1G7PA 1KIRA 4OGYL 5DHVA 3GHBL 3OKKA 4NBYB 3V2AR 1YJDC 2BDNH 4PIRF 5CILL 4R4NC 4RFOL 1T3FA 3QUZA 4IRZH 3KPPB 4FMFA 5C0CD 3SDAA 4ZTPL 4PTTB 1M7XA 3NABH 4ELME 2YD4A 2E8ZA 2ESVD 1G9NH 1YQ2A 1Y6NR 1NCDH 1D9KA 3IKCB 1TDQA 2R2CA 5GGUA 5TE6H 4LCIH 4XBPA 3C5JB 4PLKC 3G6AA 4H1LH 4X0KB 3F62A 1H0DB 2LFGA 5J13C 2J4WH 3FN3A 4PJGB 4ZSOE 5JQHC 4S1SL 3O3EA 4N0CC 4RGMB 1OM3L 2A6IB 1UZ6E 2YPKB 4GXUN 1JGUH 1KJMA 3SN6N 3H2WA 4QTHA 1J10A 1U6AL 3OAUL 1QFWL 2AGJH 3C09B 4YDIL 1SM3L 2GCYB 4NPYA 5DQDH 5E8NB 2D4FA 2FJHA 4U0RB 1CD1A 5T3XE 4TVPE 1ZGLB 1K5NB 3K2UH 4J3WA 1FE8L 4ERSH 1KJ2B 2OR9H 3IJYA 4KVCL 4M43H 3GSVB 1CYGA 4HZLA 1FYTE 5IT2L 3Q5YA 3W5NA 5F3HB 2FEEI 1TJHH 4YEEA 4WCYH 1KENH 1S8DA 5KANG 4RMSA 1KN2L 4M7KL 2X4OA 4XCEA 4FTVE 4N8CL 2YD9A 2OJEB 2ZG1A 4NNPH 4UIKL 1U8MB 1CU4L 3QUXD 3VFPA 3MJ9H 2Y5TA 2SEBA 4F7MB 2APBA 4NKDB 3LHPL 5DQJB 2GJ6A 2Z93B 3EHBD 3OF6A 3U46B 3I3EA 4F7PB 1JNJA 3RZWA 2P7TA 1AP2A 1V3KA 4ZUSA 1KB9J 5FDYA 4YZFE 1A14H 2DQJL 5DTFB 1QFWM 3FTGB 4PRHA 5EIQA 3AS3A 4MCYB 4B5EA 1S5IH 1EGJH 1LP9E 4XPFL 3RKDC 3UTTD 1U3JA 5GRXG 4HUVB 1U3HD 1L7IH 3FQUB 3BO8B 4L5FH 4Q9QH 1FO0H 4HPYH 3LZFL 4LVHB 3D9AH 1EEZA 2W9LA 3VRIA 1QFUL 3IDUA 1DQLH 4U1HB 1H3GA 3QIWB 3VRLE 1E28B 2A83A 4G9FE 3OKDB 4IRSB 3WFZA 5J06A 3BESR 4NN7B 4D0CB 1KTRL 4MQ7B 5F97E 4EVNA 2DYPA 4RGNC 5J1AB 5FO7A 3V4PL 5E6ID 3KPQB 4HC1L 3MX0A 4KQ3H 2DQTH 3MLRH 4PJAF 5LJYH 3GJFA 3TVMC 3MJ6A 5F1IA 2W38A 3QIBD 2F53E 3JZ7A 1AGBB 2JB6B 1RZJL 1FG9C 1KBGH 4JPKH 4X80H 5DRZB 3ZDZF 3MV11 1Y0LB 4M5ZL 3SY0B 3HPLB 1MWAH 1RHHB 2WANA 3I3BA 4OZFA 3OHXA 1FPTL 4EDXA 4X5XB 1JWSA 3B4NA 4HWBH 3OKEA 3TO2B 4LSQL 3SCMB 3GZKA 3C5ZD 2R4RL 2NY3D 2JCCB 4NZUH 1I3UA 3MXVH 3PWJA 1R0AL 1QZ1A 4GW5B 4U1JA 3A6CH 3TN0B 3RDTB 1U92A 1RZ8A 4K8RL 4I2XA 1NCWH 1A6ZA 3PWVA 1ZT1A 5L2KB 5H37G 3S9DB 1RJYB 3PL6D 1UB5B 1JGLL 3LAFA 3FT4A 5AUMB 4L8SB 1Q72H 5JMOC 4QYOA 4L4VE 2P8PB 1MIML 3CD4A 4NQDA 4A6YH 3K4AA 1KGCE 3AB0C 3KGRA 1ORSA 4DGVH 1CXLA 3VXNA 2FECI 2X4SB 5E99L 4O02L 5FKPB 5EZLA 1LEIB 2PW2B 3P0VH 3QCUH 4WI7A 5MI0C 3PNWA 5HY9A 1WBXB 3MBXH 1ZLUH 2AI0H 4JO4H 4OCLC 4ODTH 4LLUB 4X98B 2FBJL 1N8ZA 2CO6B 1AXTL 1NC4A 1T7VA 2X4QB 3MSPA 1MJUL 2FX9L 4PD4J 3SKMB 1HNGA 3LDBC 3ZE1F 3RA7H 3H9SE 3OZ9H 2Q3AA 2H41A 1MJ7H 1WJ3A 3RVUC 3DI3B 1SJVA 1X6LA 3A0OA 3P73A 1I1FB 4LSTL 4N0FA 4B7IA 3V0WH 3TBWA 25C8H 5KW9H 1ZOXA 1WCBB 4MS8D 3SE3C 3I9GH 1WFTA 3ROOB 3RWDB 3MRGA 5FB8A 4OZHF 2E8YA 4I77H 1F90H 4XP1L 3L5JA 1CGUA 4YHKL 3QDMA 1ROWA 5SWZA 5BMFH 4YGAB 5T1LD 4RISL 5AAMA 4QRUB 5HGHA 5D7JC 4L3EA 2XKNB 1F97A 4PY7B 5KZCD 4P3CL 5HI4C 1R5VA 2EDFA 4WI4A 1V7NH 1AC6A 3PP3H 2HKHH 3B3IB 4YDVB 1ONQB 5I19H 2AV1B 4IOSD 3MV9A 4R4BA 1TTFA 4JPIB 2HT4C 3LS5L 2J5LB 4PJ7E 2VRAA 5C07A 5TGBA 4X7FC 3WNMA 1MRFL 1U91A 1WTLA 4Z7NF 5BXFA 4BKLB 5IBTL 4OZHA 5FGBC 5E95B 2EIDA 1CDYA 5AYUL 3MROA 4JEGB 5DR5L 1CIDA 1T7ZA 1I4FB 1KF9B 2ICES 3KXFB 4L4TA 5BQ7A 4YXLL 4Z0XA 1J1OL 1FNHA 4JREC 5IMOB 1M6OB 4PRNB 4ODBD 5D70L 3ESUF 4I4WA 3QHFL 2PTTA 1U58A 4NQUA 1VB9A 4M3KB 1RURL 3QA3B 4WV1B 4KVNH 1YY8A 3DHMA 2Z31C 4Z76B 2C3VB 5C0RL 2P5WE 4JVWA 4ZDHA 2NX5A 5IGXH 4GSDH 3OKOB 1TNMA 2CLZA 2X4RB 2VQTA 1GC1H 3DMMC 5D96B 1FNLA 5T5NF 5EU6E 1LO5B 1BREA 4QOKA 3CMOH 1NGZB 2VLKA 3O2DL 4HWEH 4R7DB 3ULVF 1PKQB 2IJ0C 3AS0A 1B0RB 1QHPA 2MCPH 4Z7VE 5J8OA 3QQ3A 2Z91B 3C6LA 1YJDH 2B5IB 2DQEH 3CXHK 2P49B 3LKRA 4Y4HA 3WSQL 3F58H 3MLZL 4ZAKD 2MSPA 1HZHL 5E2UL 4MX7B 5I17A 5JMRA 2UY6A 5MP6H 1NH6A 1UACL 1KG0A 2XV6B 3TV3L 2XQYK 4XNXL 1RK1A 3MREB 4LARL 4DOHE 1PQZA 4PJ9C 4PRPA 4Q58C 5DUPL 1INQB 3GIVB 3O3AA 1JYWA 4WFEE 3P30H 2BNRA 2WINA 3R1GH 1UWEL 3DRTB 4HUUB 4OFPA 5GGQL 2ZSWA 2KQNA 3SEPA 3MC0A 3LPGA 4JLRA 1RI8A 3NPSC 2VZTA 1YNLL 2VMFA 2XN9A 1D5IL 4HBCH 1TJIL 3TYGL 2FLRT 5EWIL 5EUKB 4J12A 3RVVD 3UJJH 3GMOB 3IF1A 5AWNL 4D94A 4E0RB 1CIUA 4UT9L 2IH1B 1LNUB 1KN4L 4Y1AB 1NEZA 1BOYA 4PRBB 4LKXA 4I0PB 5E9DD 2Q20A 2PO6D 1R3HB 1DBMH 2W9DL 2VE6B 1JE6A 2VABA 5E94B 4MGXA 3QXUA 5I1IL 4HWZA 1KLGB 5ESQB 4EI6A 1KPUA 2RFXA 2HG5B 5K9OA 3VD4A 4G5ZH 5IKCA 2WUBH 1KJVA 3Q48A 3OV6A 4P2OB 1N26A 3MNZA 3VFMB 4WUKH 4WO4A 5B8CC 1AD9A 4NBXB 5IVXF 2PYFB 4OLWH 4ISVB 2BOCA 3LY6A 5BRZD 2XZQH 4WW1A 4EIZC 1XF5B 4DEPC 1HILA 3I85A 2KZ1B 2NNAB 4F15C 3WMSA 5CZXC 1RIVL 4MA8H 4HIHB 3ZT5A 1OARH 4EKXA 1E6OH 3HE7D 2DDQL 2DQIL 1QKZH 3NN8B 2Q6WB 3O8XC 4FABL 2VDKL 1JF1A 4WUUE 2VQ1B 3Q6GH 3U1SL 5HGDB 5MENA 3AM8A 5FCUH 4M5YH 4JG0H 4M6OH 4PLOB 5GS1A 1KSRA 4J1UB 4Y2DB 4OZGB 5I66A 2LV4A 4CW1A 1A1NB 1DFBL 3GSNH 3DSFL 2PF6A 1OGTB 2XZCH 4QXGH 4FA8A 2VLJE 1I8IB 1U95B 2G2RA 3OJMB 4Y7MA 1EFXB 3CDFA 3ORJA 2BFVH 5ENWA 3O11B 2X42A 1G9ML 3X12B 3HZKA 3TT3L 5IFAL 3JVGA 5AZEL 3U9UA 3PQYD 4R2GD 3QRGL 3O2WH 2V2WA 3TNNA 3RP1A 4ZTOL 3RKPA 3UJTL 1ZLVK 2ADIB 3PGFL 4G8GE 4P2RE 2Y4SA 1KB9K 3QFJE 3M8OL 4PJBB 4F7CA 2AQ2A 5I1EH 4Z95L 4RAHA 2IH3A 4M9OA 1FNEA 5ITFA 1D7FA 3QDGE 3EYQC 3OR6A 1IAKA 5CP3A 3BH9A 3LKQA 5M94B 1IAOB 4RX4A 4UOW0 1KIUA 3LRSB 4YIQA 4GRWF 5DJ0B 4GG6F 2XACC 3FO0H 3BP7A 1WICA 1W72B 3FT2A 5D7IB 4M7ZB 2EYSA 5TQ0H 4HIEB 5TDOA 3DXAB 4OBRA 4NNXB 3ARED 3KPNA 1ETZB 2A9ML 2XA8L 1QSEA 5E2TH 4N1EA 1J0JA 1G7JA 1N5AA 4XBEH 3LN9A 3TIDB 3BT2H 1W8OA 4HX1B 5JA9A 4A2LA 3VXUE 4OCWL 1FSKC 2J8UF 1M4KA 4KTEL 3MUY1 3T1FA 1QHOA 1MCSA 1RUML 2J1KA 4KK8C 1CDCA 4D0BB 4P59L 2BVOB 2DQCH 4HUWA 4WENB 4UTBH 4Y16B 2CRYA 2B0SL 3NFSL 1BX2B 2XWBB 1G6RB 2R69H 3C9NA 3IJSB 3VDAA 2FATL 3GEWB 2UWEE 4G8IB 4ELKB 2R8SL 5AD0A 1F45A 4JFDA 2NY1C 4WNQA 1ZT4A 3MR9A 2BNQE 4D8PB 4YHOH 1KCVL 4OLZL 3VH8A 1QNZH 4XX1G 2FZ3A 3SDYH 1ES0B 2HTKC 3KPOA 2W9EH 1OLZA 1NAMH 4FHBD 2VAAB 4KROD 4KI5F 4AT6B 5D7LD 4F33A 2XG4A 2UZXB 3QBTB 4LBEB 4PGCB 2VTFA 3GGWA 3VGGA 4D3CL 5CJXA 3I6KA 3DROA 4J6RH 1AO7E 2CUMA 2Q8AL 3BMVA 2BP3A 4X99A 2R2BB 2CGRH 4NUGL 1I7TB 1P4IL 3K3QA 5IK3A 3MRQB 3W39B 3E2HB 1CXIA 2G9HA 1FZKB 5GZOC 3WFDL 2VSCA 4GBXC 5GSRB 3MBED 4QHNB 3ZTJG 5EZIH 1PEZA 5TE7H 4G80A 4NQEA 4LIQH 4ZO8A 3VD7A 4DAGH 3T08A 1ZLSH 3VWKA 4LHUG 1QTYT 3F7VB 2VITA 3U36A 2O5XH 1X5KA 3VCLB 2WBJB 1U8QA 5TE6L 4MNQD 3VXRB 1T0NA 3W0WE 4PLJC 2AJVH 4H1LA 5LVEA 4XPGH 5EN2B 4YHIA 3RVXC 3FQWB 4JFHE 3LD8C 2FSEA 4JRWA 4PGDB 2Y7QA 4XVJH 1CFQA 3QWOA 2ARWA 4JN2A 3RWIB 5F9OH 2OXGA 2A6DB 3VI4F 3MLPA 2OK0L 3QH3B 4CMMB 4GXVH 1IGJA 2BSSA 4P57B 3KPRD 5HHNB 3QEQD 1TENA 5FYKE 3V6OC 3K2UL 4R9HA 5IWLC 3J7HA 3A6BH 1A6PA 5DT1L 3JWOL 1Y18A 2XWTB 3FOMA 3LQZB 3DX8A 2HT3D 4U1SA 4U1MA 3VFTA 3DX7B 1R6VA 4N0UB 3W11D 3FCTA 5C0EA 2EE9A 4Y5YA 4HAGA 2ZUWA 3FQRB 5FO8A 5E4EB 2HJKA 3ES6A 1KENL 4WCYL 3HZVA 4K2UL 4F80A 4P5TD 2RIKA 2ADFH 1G0DA 3WHXB 2FEDD 3O9WC 4Y4FA 3WV0A 5DO2C 1C1EL 3ARFB 5HYJB 4LRIA 3WE6B 5HYSA 2VKXA 3MJ9L 5MERB 4PRDB 4X6EA 4MJID 5ADOH 4U05A 3BJLA 5EUOF 1I1AB 4I18C 4OM0L 1CDUA 1HH9A 3U0PA 1L6XA 3G5YA 5DFVC 1U2CA 4QHLB 3ARBA 4OCMC 2WSKA 3EW3B 3MRBB 3QI9C 2RGSA 5C0BA 3E8UL 3VW3L 1XCQA 2HFTA 4FQXC 4XNZB 3FFDA 3BHBB 4MQXD 1RFDL 4EXPX 4PJXF 5BZDA 4L5FL 1FO0L 4HPYL 3QXWA 4G3YH 3BAEL 1DQLL 1MHHA 4P46C 3VFVA 4DVBB 4UU9A 4YHPB 1A1MB 3FQTB 1WFUA 4TRPH 1KIQA 2AJYL 2GSIB 1HQRB 4H8WL 5I76B 1FVEB 4OQTH 4XXCA 5CEXA 4AG4H 4I5BB 3EJZC 4HK0B 4P2QB 1OW0C 3EYUL 5FOJA 1ZANL 3PUCA 4DK3A 3MLRL 1U42A 3QUYB 3VXMA 3GMQB 4KKNA 4JFYB 2V2XA 3MOAH 5KVDH 3HUJF 1CGWA 1DUZB 4JPKL 4X80L 3P3YA 5D71H 1KTLA 1BQUA 3G5VA 3GBMH 3MCLL 4GW4A 1M7IA 1TCRA 5F1OB 3BXNB 1AQDA 4R90H 1MWAL 3KDMA 3CUPB 3LPFA 1SHMA 2AV7B 2LTQC 4U6HA 1QSZA 1HSAA 2B2XL 3HLAB 1FZOB 4KJWC 3D3VE 4Z6AT 3GM0A 5FHBL 3HC3L 3O4LD 1H3WM 4DTGH 2XKUA 4I48B 3O3UN 4UIMB 1GXEA 4XCCH 5LGHL 4YFLI 4U1IA 4NYLA 5KANI 4NNYA 4NO0A 4DCQB 2C3HA 2VL4A 1FCGA 3RIAK 3QJHB 3UTZA 1A7OL 3HUJA 5DYOA 3RWCB 1CL7H 4LPCA 3P0YL 5TQ2L 4DGVL 2WIMA 2UVEA 2RCSH 1I9IL 3FB7B 3S37H 4YHZH 3P0VL 4L8CA 3MBXL 4PJIE 4PJAE 1ZWIB 2VDMH 2JKXA 3NH7H 4QRRB 2X44D 1EV2E 4F8QA 5MEQA 3B9DA 2Q7YA 4HFUH 1GGBL 1PYWB 5C0AA 4DVRH 2Y06H 4OD3L 5DJ2B 1FRGH 4CN4A 2GTZA 3OZ9L 5CINL 3VFNA 1YMMA 1WZ1H 2ATPB 1U41A 1MJ7L 5F8QC 2QKIA 2NY0B 3BSZH 3QUMB 1A7PL 4HXBH 3TNMA 1P7HL 1EHLH 2AJXH 25C8L 1CVSC 3LQAC 3I9GL 3N1MC 3IGAB 1U8OA 1J1XH 2Z9TA 3KPPA 4PTTA 1I9JH 4UQ3B 2UYLB 4IRJB 5GPRA 4U6VH 4JVUA 4N5UA 4KV5F 2BSRA 1MRDH 1HN1A 4AEIH 3IKCA 1E4KA 5BV7C 5IW1A 5BMFL 5T3ZH 3WIHH 4JQVC 5FHAL 2ZUUA 3ET9F 3IKKA 4X0KA 1EIBA 1H0DA 2IGFH 3WO4C 2BX5A 3MLTB 3QDJE 5I15L 3ZE2E 2A6IA 3WFEH 1A0QL 1BD2E 2YPKA 5DMGD 1V7NL 1KJ3H 4POYA 4HQQH 2FRGP 4P9HC 5KAQF 4XCNB 4P5KA 2GCYA 3MPCA 4KKBD 2EDHA 1T89A 5E8NA 2NXZD 1LDPL 1ZGLA 3DV6B 1K5NA 3PWPB 3V8OA 2H32H 3AU1B 4Z7WF 1KJ2A 4P4KD 4HIIB 3ZE1E 2IMNA 3CSPA 1CICB 8FABB 3K8MA 5F3HA 3MRCB 1RUKH 1A6TB 3VXSB 4QRQB 4W4OC 3WS6C 5I1KL 2CO7B 1JJUA 4LVOB 5C0CB 5HVHB 4W6YB 3G04B 4OLYH 1OWWA 4APQD 4OJFL 3U7WH 4XP4H 4ZUTA 2OJEA 1JRHH 2LU4A 1U8MA 5ABDE 3GI8H 2W65B 3BW9B 4HJ0D 1CD8A 4F7MA 4NKDA 5DQJA 5C09E 2Z93A 3HZYB 4J3SA 2EIEA 3U46A 3IXTA 4O00A 5DMKB 2YMXH 5TE4H 1S9XB 4GSDL 2JJSA 4FQQA 4PRIB 2A6KB 2OJZH 3PGCB 5DTFA 5E4IA 4MCYA 5GS2H 5IBLD 1V3LA 4G6AC 1NPUA 4J3XA 5C7XH 3G08B 5H35B 3VFRB 4HUVA 3FQUA 4WU5B 3QUZD 3BO8A 1KC5H 1L4IA 3DSNA 2FCBA 3AS1A 3U2SB 3G9VA 4OD1H 3SDAD 4U1HA 3QIWA 4UT6H 5A2FA 4S11A 1E28A 3OKDA 4IRSA 4K3EH 2B4CC 3PGDB 3NAAH 4FXKA 1D9KD 5IJKC 1QVOB 3H7BB 4PGEB 1MPAL 4MQ7A 4KMQA 3RAJL 2WWKO 5ECJE 5J1AA 2VDQH 3KPQA 3VXPA 2ZCKL 1JZ7A 2B1AL 3TH4T 3DV4A 3L5XH 3GRWA 2ARJB 3DTXB 2I25N 4NZDA 1AGBA 2JB6A 3CFCH 2NY2C 3FAXA 2ZZUT 3P30L 5DRZA 1Y0LA 2YD1A 4PB9L 4PJDE 3DUUB 4ODVL 3T77B 4U0RC 3SY0A 2APWA 3HPLA 4OCRH 1DBJH 4WVRA 2EZ0D 3TZVC 1FHGA 4RFNC 4X5XA 1Q9OB 3EZ8A 1MLBB 3B5TA 3WN5B 2D7PA 2H8PB 1V8HA 3CX2A 3SCMA 4DUXA 2IPKB 4PG9B 2BNUA 5KTEL 3MV8E 1JL8A 3LKNB 2JCCA 3UO1L 3UTTB 4JQIH 4NHCL 1XT5A 4IBLT 4ODWB 3TN0A 1LD9B 3RDTA 4M1DH 4M7JL 3ULVE 3C2AH 1VFAA 1RJYA 5DRXB 1UB5A 4PJEB 3BDYH 3X14B 2CK0H 4LLMB 2ZCLH 5AUMA 4L8SA 1F8TH 1FGVH 4FFZL 2P8PA 5CKAA 1SYVA 3SDCD 3H0TB 3L3HB 4NGHH 1DVFD 3GI9H 3OF6D 1IT9H 3DURA 3EFDH 2XQBH 1QPPA 2X4SA 1LEIA 1TJGH 2DIAA 4CJ0A 5CD5D 3J8F7 1WBXA 2HLAA 4LNRB 2R9HD 5A2IH 2DD8H 1VPOH 4OB5H 3HAEH 4LLUA 3MJ7B 4PRHD 4RA3A 4X98A 1E6OL 2IQAB 2UUDK 2V5SA 1QKZL 4NSKB 5SWSE 2X4QA 1ZGLP 5IW3A 4XT1C 3SKMA 2VXTH 5FV2A 1GPOH 1YY9C 4MWFB 3BGFC 3MRKB 1O7VA 4JKPL 4MCZB 3G6DH 3GSNL 2ZJSH 5IR1A 2XZCL 4PB0H 1I1FA 3DO3A 5C2UB 2DYPD 4BFEA 1OAKL 2HP4A 1I8LA 1MCNA 4J8RB 1AJ7L 2CRMA 3ROOA 4HW6A 4NJAH 1EBAA 4ENEC 2YPLE 1DL7L 5CZKA 2E6JA 4IOFD 4ONFL 2ZKHL 1CE1L 3Q3GB 3NCYP 2WNGA 2H2SD 1OLLA 4KY1H 1BJ1H 2ITDB 2PCPB 4RGOL 3OKNB 2L4OA 3S3SA 3QWRA 4QRUA 1KOAA 2QEJA 3GMPA 1QSFD 4P2CG 3MRDB 2XKNA 1UC6A 4UMGA 4PY7A 3SJVE 2OR7A 4ZUUB 5IVXE 5ANME 2FJGB 3MRHB 1NGPL 1NJ9B 5KS9B 2OTPA 3UTQB 2F5AL 3B3IA 4YDVA 1A3RL 5GGVH 3FO9B 3SGKC 5JORB 3MV7B 4JPIA 1OAUL 4ZO7A 1MFNA 1CGTA 1FVDB 4KMTL 3IFLH 1F4YH 4GAJH 3CDCA 4YPJA 4AIXA 4CVXB 4BKLA 3BIKA 5ISZB 1LK2A 3IT8D 4NQDD 1CR9L 1OP3K 4XC1H 2Y25A 4ORGB 1I4FA 3KXFA 4XHQA 3JWNC 3SDXE 1JF5A 2VDNL 3D0LB 2VLRE 1MQKL 1FH5L 4B0MM 3FHQA 4N0YH 2HFFB 4FOMA 1NC4D 4RA0C 3D18B 4ZUWB 2R69L 1HYSD 3QA3A 1UQSB 4WV1A 5T1LB 4LVEA 4Z76A 2C3VA 4U6YB 4UV7H 5DS8B 2UZIL 4LP5A 4OGXL 1QBBA 3GSWB 3ROLB 1Y6KR 2X10A 3OKOA 4E41E 4XNQA 4MAUL 5FYLE 1H15B 1LO5A 1O0VA 1NGZA 1FBIH 3B2UD 1MVUA 4QO1A 4R7DA 1A4KB 1PKQA 1DBBH 5L8LB 1CLOL 3T65B 1NAMA 2OM5A 4GKNB 4NDMB 4RMQA 3ZLQC 1B0RA 1A64A 3G6JF 2EH8L 5F1NA 2Z91A 5GS3A 1JWUB 3LQAH 2Y6SC 5E08L 4J6RL 4JKKA 1VGEH 4U1NB 4MX7A 4YX2L 1AQKL 1JTOA 1CD0A 2JTDA 2FYYB 3I6GB 4L3ED 5BV7H 1UWGL 4LDOB 3U7YL 1D5MA 3MREA 3VMOA 1QLFA 3L3OA 4AENB 1GIGH 3O3BA 1T1ZB 4NO3B 5EZIL 3FAWA 2WW8A 1UKTA 1BQSA 2BRQA 4ZS6D 1FAIH 3DRTA 4FMKA 4HUUA 3MV9D 2O5XL 1X4ZA 4U2YA 1OAYL 4P9HH 4RDQF 1MIEH 5C07D 3IJHB 4G42A 2AJVL 5EUKA 3BKJH 5L6YL 4ELMB 4E0RA 1C16B 2IH1A 2ZNXA 3VGBA 1LNUA 1NCBL 4Y1AA 3T2PA 4PRBA 1RUAH 1JPTL 4I0PA 4IS6B 3L7EB 1TIUA 3CNKA 3GBNH 1QP1A 1R3HA 4ZSOB 3QHTC 2VE6A 4EN3C 1G0XA 4GXVL 4OCSL 5E94A 4ZPVB 1IAII 4KI5E 1U93B 1T6WA 3O6LL 1KLGA 4PJFF 1ZA6B 5ESQA 3DUSA 3SQBA 2HG5A 3NZ8B 3C60B 2LAAA 3RL2B 3VFMA 1K3ZA 1DSFL 2PYFA 5IQ7L 1UT9A 2ZCHL 1PBYA 5D96C 1XF5A 2NX5D 2NNAA 4MXWH 5JIHA 1RAMA 4HIHA 2C4FT 1QRNE 3WNNA 3NBNA 2ADFL 3V52L 3NN8A 4QOKD 2Q6WA 2VLKD 2QJDA 3W82A 3GSQB 1N6UA 4JRYE 4DGIH 2PNDA 2VQ1A 5HGDA 1SJHB 1CN4A 4K71C 3RY6C 3EDJA 3RNQB 4FTVB 3L3DB 4OZGA 1BIHA 1UXWB 3C6LD 2PKDA 1KCUL 2HH0L 1A1NA 1YEFL 4Y4HD 4JFFE 5J6GB 4M1GH 3SE4A 2IADB 4PJFA 4YNYA 5D7KE 3T0EC 5E9DB 2B4CH 5D7IF 2F19L 4EDWH 3R0MA 5ADPL 5HDLA 4JKMA 3GK8L 3O11A 4LOUC 2GK0B 1NGXB 4MXVF 3X12A 3VI4E 3REVB 1P84J 3CX5K 4GKZB 1W8NA 2BNRD 1NL0H 2YUZA 5E1HB 3ULUC 2F8XC 4LQFH 5I1GL 1N0XH 5F7DB 2ADIA 3C8KB 1A7RH 1JI2A 3WJLC 2XN9D 15C8H 4H25B 4LRNH 2NW2B 3GIZL 1M7DB 1SEBB 4PJBA 3WCYA 2VISB 2K9UA 4Y4KC 4D9QD 1KB5B 1I3RB 4BZ2L 1BQLH 4ONOA 5LBSL 4HCRH 2M1KA 5D6DC 3HE7B 3IYLW 4HXAL 4YBHA 5KVDL 4LCUB 4RAUB 1IAOA 1ZHBA 2OZ4H 3LRSA 1RUPH 5DJ0A 4GAGL 1EEQA 1G7HB 1Q9KB 5D7IA 5GS0C 4NO5A 3WUZA 1JZ8A 3DXAA 2R0ZL 4HMDA 4P2OC 4NNXA 5EUOE 4HH9A 5K59F 4F57H 4KKCC 3SPVB 4EEEA 3HNTH 4S1RH 4HX1A 4JVPA 4G6JH 1EAPB 4EUPG 1F58H 4OCXL 3NTCH 2X9WA 1DBAH 2DICA 4XMPH 2YD6A 4R2GB 4D0BA 4DN4H 4PJXE 2PTUA 4WHTB 4TNWK 5I1AA 4G43B 4Y16A 5BO1L 1OAQL 1KCRH 2XWBA 3X11A 1BX2A 1P7QB 3IJSA 1G6RA 1NCTA 5TFSL 3ZZ1A 5JW3H 1GOHA 4G8IA 4Y2DC 3DX6B 4G6FD 4D9LL 5T5NG 1V05A 4YHZL 4D8PA 1RPQA 1NGQH 1FGNH 1JNNL 3TGXA 4OGAD 2DI7A 3E1F1 3EDDA 1ES0A 2WLYA 2UV3A 3U82B 1QBLL 1XIWB 5EOCH 4OZIB 4BM7A 2VAAA 5CBEB 4AT6A 3X3FH 3B9KD 4DVRL 2Y06L 5C2BL 2OTWB 4LBEA 4PGCA 1FDLH 3ILQC 1AGFB 3A67H 3ARDA 3AREB 4ZOBA 1WZ1L 4XAKD 5EULV 2NY5C 2R2BA 3TBVB 5JUEH 3BSZL 1FV1A 1ACYH 2FD6H 1YQVL 3CVIH 2QSTA 1BZ7A 1AHWB 1YECH 2EKSB 3MRQA 2AJXL 4K9EC 4LHUB 3FMGH 3W39A 3FT3B 1RZFH 1J88A 4JO3L 1XMWA 3BN3B 3U6RB 1J1XL 5GSRA 5IHUH 3HN3A 4QHNA 3D2UA 5DUMH 4LCWE 2DQHH 4OSUH 1GYAA 1FQ9C 3F7VA 4RX4D 3L9RA 1J8HE 1XGRB 3NVQA 2WBJA 4XCFL 3VCLA 3MOBL 5I9QC 2FO1A 3WIHL 3TCLB 3VXRA 3U30C 2KPNA 2CIKB 3P4OB 2IGFL 2WWKT 3IDYC 2D7QA 5EN2A 3DBXB 1YPZE 5D2NE 5EO0B 3FQWA 1MEXH 4WHCA 4PGDA 4NM4L 1KIPB 4OT1L 4EIGB 3RWIA 1GGUA 3G5XB 4OM1L 4ZS7H 1YC8A 3O4OB 2A6DA 1K4CB 3QH3A 4CMMA 1U3YA 4MZ3A 2ARJQ 4P57A 3UAJD 5HHNA 3U83A 1ADQA 4NKIL 3HI6H 1RMFL 1J0HA 1KFAH 3LQZA 4ZD3H 5HHMD 4N0UA 2BK8A 3O6FC 5FUOL 5T3XH 3FQRA 4HS3B 3FRPA 3K8KA 4GAYB 5BS0D 4JFDD 4LGRB 2WWMC 7CGTA 2IAND 2XZAH 5HI3D 3MBEB 2AK4E 3EJYD 4PYGA 3I6LD 2EEBA 3HMXH 5DC0A 2H9GB 3WHXA 5TDNB 2N56A 3ARFA 5HYJA 1AY1L 3WE6A 1AXSB 4KV5E 2G5RA 3RVTC 5DK3A 5MERA 4PRDA 4EJ1C 1LDSA 4RCAA 1D5BB 1I1AA 4ZFFB 2YMXL 2YXMA 2NYYC 4GRMB 3EOTH 4OV6F 4QHLA 3QQ9D 4AYFA 4V2CB 5DUBB 5F72S 3MRBA 1M05B 2VDRH 1NAKH 4F58L 5IB5A 5ID1B 1LO3H 2P5WB 3BHBA 1BLNB 5BCAA 3KPRB 5SX4H 2ICWJ 3QEQB 4JM4H 3HI5H 5IEKB 1PW3A 5FM8A 5EU6B 5KSUB 2FHBA 2KQMA 4TTDD 2E5EA 4DVBA 1T2QL 5K9KB 2NY6C 5KJRH 2GSIA 1HQRA 5I76A 1FVEA 5EOQL 3VA2C 1MI5E 4Z7VB 4I5BA 4HK0A 4P2QA 5CHNB 4R26H 4EI5C 2V2TA 3QUYA 1I7UA 3MLXL 1JN6B 3GMQA 4JFYA 3HS0B 3FFCA 1EEYB 1BEYH 1S9WB 2A1WL 3P11H 4QTIH 3P77A 4QWWC 4FN0A 1K6QH 4OTXL 3S8WA 4UNVA 1PVHA 3BP5B 3BXNA 5GGTA 3LIZH 2JJTA 1EXUB 4F9PA 4RRPA 4XP9L 1F3DH 3TJEL 3BDXA 1R3LB 4JM2C 3CUPA 4ZODA 4S0SD 1TVHB 1FZOA 3MLWL 4F7EB 1BVZA 5DWUH 4PJ8C 3V4UH 3HRPA 4KZEH 4NQTA 4LPYA 1JCKA 1WZLA 2YRLA 4XHJD 4FFWC 3KPSD 4GMSL 5I6XC 1GOFA 2CDEB 4I48A 3B5HA 3S34H 1K85A 4UIMA 5JA8B 3LEYH 5F9DC 2P5EE 4Y4FD 1S3KH 5I18L 4K07A 3IXAB 1FP5A 2QL1A 3QJHA 2Z8SA 2VR9A 1H5BB 3WFBH 3IS1X 4POZC 1GOGA 1C5BL 2I60L 1IT9L 3QNZB 3PP4L 3TP4A 1FNGB 1REIA 2FR4B 4I3RL 3WKNA 5LGKA 2IG2H 3VD3A 3VI3E 3NFNB 3FN0H 3KS0H 1ZWIA 3ARBD 3I3DA 4NJ9H 4H1LG 5DQ9B 3DETC 5C0BD 5D1XC 2Z4QB 1FLTX 5DJ2A 5EA0L 3ARGB 4TULH 2EDTA 2QADB 2VXTL 1EO7A 2OL3H 3HFMH 5ITBH 4IDLA 2ATPA 4UT7H 4AMKL 1DQDL 4LLVB 3G6DL 1IILE 5I74B 3RI5F 5L0QC 3QUMA 4WUUB 3UJIH 3QPQC 3UTSE 3ULUH 3JWDL 5K9QG 4MQSB 3CLFL 4AEHL 4ODHL 3C5SB 1DANT 4PJHE 4L8DB 3VXMD 3WUWG 5IROC 5LGJB 1AH1A 1HH6B 2VLJB 4U33A 4UQ3A 1GVIA 2UYLA 2WBKA 4XMKH 2DJUA 3RTQB 4MD0B 1D6VH 5EORL 5DEGB 3FQNB 4X4XB 5DF0A 2FH6A 4HS8L 4XPAL 4CVUA 3BQUB 1PG7W 3MLTA 3BE1L 3DVNB 3BYYA 4TUJB 4LPTA 5HYSG 4RGNE 5GS0H 2YUWA 4P2RB 1K4DB 3TA3D 4TSBH 3RX7A 3F6LA 3QFJB 5ALCH 1OP5H 3U0TB 5DLMH 35C8H 1LEKB 4TUOB 1P84K 1JF6A 5E03A 1F2QA 5BW7A 3LS4H 5CBAB 3DV6A 3PWPA 3AU1A 1F4YL 4HIIA 4NO0D 2W0LA 3T8XB 1JZ5A 1CICA 2VXUH 8FABA 3WXVH 6CGTA 4NQXB 3MRCA 1IBGH 1A6TA 3VXSA 4QRQA 4WW2C 4X6CF 5JOPD 3LEXB 2BVQB 1II4E 1ZEAH 4MQTB 5C0CA 5D1QA 3G04A 1EUUA 1X5GA 2VDOL 4N0YL 4NWTL 1MCWM 1I1YA 1DN2A 2EDNA 4ZOCA 3MRNB 3P9WB 3BW9A 3VXUB 1G7MA 3UDWA 5C0AD 2R4SH 2WV3A 3HZYA 4TTGA 2DQGL 2FDBP 2XNAA 5DMKA 2XTJC 1BFVL 2GJ6E 1N7ML 1GHFL 1YMMD 1NBVH 1VEMA 5I2IB 1JPSL 1OTSC 3EOBB 4PRIA 1IM3A 5FEBA 2A6KA 3PGCA 4UAOB 2UWEB 3KYOB 1PSKL 4CRPA 2O61B 5ID0B 1FBIL 4Y19D 2I5YH 1QLRB 2IPTH 4XMLL 1XF4B 3T0BA 3G08A 5H35A 2NY5H 2NXZB 3VFRA 1HXYA 4WU5A 1FN4A 4IRJC 4X6BB 2VZ3A 3E6FB 3U2SA 2EO1A 4K9EH 2AQ1A 4P4KB 1EZVX 1QVOA 3H7BA 4PGEA 4IMKA 5F71A 4DGYH 2PXYC 2AEQH 5D7SL 3RPKA 4OCYH 1F2XK 3RUGB 4K23H 3I50H 1NQBA 1A6WL 1W72H 6FABH 1U8NB 4ZXBC 3MRIB 4R7NB 3BRDA 4FQ1H 4YH6A 1AO7B 4APQB 4G6MH 1WEJH 3I2CH 5SV4A 4MLSA 1CDHA 3T77A 3DUUA 4FQCL 2N1KA 4HG4J 3JV4B 5KVGL 1BOGB 1MIEL 1QYGL 5JNYB 5ESAB 1Q9OA 3WN5A 1YMHB 4X6DF 2W0KA 1PLGH 2H8PA 3QQ4B 2IPKA 1KIRB 2EXWD 5DHVB 3LKNA 1JTPA 4LIQE 4LVOC 1RUAL 1GGTA 3W0WB 4ODWA 1LD9A 1ZLVH 4JJHA 3TEUA 1WZKA 1NFKA 1D3CA 4NQCD 5KN5B 1JFQH 4X8XA 3SDAB 1FC1A 3QSKB 4I2XE 5DRXA 1MFEL 4PJEA 3NIFF 3X14A 4LLMA 3BISA 1Z0MA 1QBMH 1D9KB 3H0TA 5DI8A 1IFHL 3L3HA 1A6UH 3VWJA 3N85L 4Y5VC 2R1WB 2WIIB 4IIQC 1B0GB 1IGFL 3QYCA 4HKZB 4MXWL 4XAWL 4PJCF 4LNRA 3SBWC 1YEJL 1ZLWH 1KYOK 3MJ7A 4NCDA 2IQAA 4ODUB 5FGSA 1Q9WB 4NSKA 4X6DA 1KLUB 5DSCB 3UZEA 3KNBB 2FJHB 3LN4A 4K7FB 3ECBB 3OKLB 1OPGL 5C08D 3EZJB 3ZDYF 4MWFA 3QIWD 3MRKA 4IRSD 4MCZA 1CZ8L 4C56E 4M6MH 2ZUTA 5EDXA 5IESL 3QPXH 12E8H 3HC0B 2XYCA 2A0LD 1B6UA 4P4RB 4S1QH 4EDWL 4J8RA 3WJJA 3C08H 1TQCB 4JY5L 4ZYKB 3V7AE 1EUTA 3LPWA 1DBKH 1JHLH 2R56H 3QUXC 3BIAX 1CG9B 1RIHH 4IHOB 4PJCA 3Q3GA 1WWBX 3EHBC 4B50A 2ITDA 3SDCB 3OKNA 1NANH 1A7BA 1DVFB 3F12A 1A7RL 1EAJA 3QDME 4OKVB 4MJ6A 5SWZE 4JB9H 3MRJA 4LRNL 4PV9B 4ZUUA 1T6VN 2R39A 1P6FA 2FJGA 3RZCC 2R0LH 3MRHA 5KS9A 5KAQG 2EEDA 1KJ2L 4FZEH 4PRHB 5HVFB 3UTQA 2R23B 2ZUQC 4N9GB 1U3HC 4HJJL 3KJ6L 1TQBC 5JORA 5KVEL 2ATKB 2D9CA 3MV7A 4JPWH 4NM8L 1UWXK 2QSCL 2A77H 1WLHA 2X4PA 5HJ3B 3T04D 3HTLX 4WWKC 5FYJL 2V9RA 1FVDA 4QXTA 1MRCH 1IMHC 3B9EA 4G7VH 1RZGB 5I16B 4LPUA 1I9RL 3T0DA 4DJMA 5ISZA 1A7QL 5E6IC 1T7WA 3D39D 2DYPB 4JN1H 4P48A 2HN7B 4CMHC 3K80A 4ORGA 1S9VB 4UI2A 3QIBC 4M02A 4GMTH 3CXDH 4FZ8H 1BZ9B 3ARXA 2D0GA 3D0LA 4L4TE 4WGVB 5F1IB 5ALBH 5F21B 4XMPL 2HFFA 2VZ1A 4KGJA 3D18A 5E00B 3RGVC 5C6WH 4ZUWA 4N90E 5T1LA 1UQSA 1JV5B 4KTDL 1NUGA 1QSFB 1TPXB 5DS8A 3NCJL 3ROLA 3GSWA 1R5WB 2UZYB 1ZGLM 4JQXA 3C5ZC 1U8IA 2NY3C 3OKEB 3ZKXC 4QEGA 1H15A 3MA7B 1KXVC 3GSUB 1E6JH 2EXYC 4EOWL 4RWHA 4U1JB 1CK0H 1BJ1J 5BOPA 1A4KA 2GY5A 3PL6C 4GKNA 1N5YL 4NDMA 3DX9B 3STLB 1MNUL 4L9LC 1LMKA 4PJAB 1BBDL 3GRWL 1RULL 1T2XA 5GSVB 4QYOB 4YBLB 4D9RD 2Y23A 4BFGA 1NMBH 5B22A 1J0IA 4M3JA 4U1NA 5GHWH 1NGYB 4PS4L 3MJGX 3QWRD 2ADGB 3I6GA 5JPMB 4NOBA 4V1DD 3KR3L 3MRPB 1UZ6F 5CIPB 5AZ2H 3PNWB 2E9BA 5F6HI 2ENSA 4S10A 3KWWB 4AENA 1T1ZA 4NO3A 1VCAA 4NUJB 2PTVA 4PRPE 1V3MA 4W70A 4RMRA 1A2YB 2D2OA 3IJHA 2YA2A 1HSBB 3PABB 4FQIL 4ELMA 4WFGE 3PDDA 1C16A 4OGYH 3SOBL 3GHBH 3ESVF 4MS8C 4KJQD 4J23A 4IS6A 3L7EA 4F9LC 3FB8A 3HR5B 4WTZG 5CILH 4RFOH 3WLWD 4ZSOA 2C3WA 2IAMA 1RV6X 4ZTPH 4BK4A 5T3ZE 2PYED 2HT2D 4ZPVA 4HSQA 1U93A 1OD9A 1CT8B 4MMZC 5EU5B 3DJ9A 1IGCL 3C60A 3NA9L 3RL2A 3FB5B 5C0ND 2GW5A 1KPRB 3N1QC 4TQEL 1SVCP 4YZFF 1JNHB 4X9FA 1RJLA 4S1SH 4M1CD 3MUZ1 1OM3H 5L7XH 2OS7A 1LP9F 3UX9B 4B41A 5F7LB 3HMXL 1FYTA 1QFWH 3OAUH 4MAYB 3RWHB 3BKML 3P9MB 3NGBB 5EPMB 4YDIH 3V8CA 3MV9B 3GSQA 2BHUA 3PHQB 5HPMB 3R4DA 2D03L 4NZRL 4GLRI 1SJHA 5C07B 1MY7A 2IBZX 5IBUG 1B2WL 2EKJA 4FTVA 1FE8H 4KVCH 5MENE 1UXWA 3OBAA 5BXFB 4G8FA 4OZHB 5IT2H 5J6GA 1F42A 1E4WL 2HRLA 2IADA 3EOTL 1WIUA 4NZTL 5E9DA 1EK3A 1NAKL 4LGPB 3DYPA 1KN2H 1RZKL 4M7KH 5GRJL 2GK0A 4N8CH 3OGOE 4I4WB 3REVA 2DN7A 4GKZA 4R96B 4UIKH 5D7JD 4AEEA 1CU4H 4LL9A 1LP9A 4IEFB 4NRZB 5HI4D 1U8LB 3RGHA 5H2BB 3C8KA 3LHPH 5EO9B 3Q1SH 5DFWH 2NW2A 1M7DA 1SEBA 2MJWA 3EO0B 2NX5B 1LGVA 2VISA 1KB5A 2VXQL 3V6ZB 3ZDXF 4Z7UF 2DQJH 4XPHL 1XGPB 4X9GA 3HE7A 4Y1AD 4XPFH 3WDJA 2EECA 4OF3A 4HD9A 5D5MF 4RAUA 2WM0A 5CJ5A 5FM4A 5L8KB 2HRPH 3OL2A 1HXMB 3LZFH 1QFUH 1G7HA 2OI9B 1Q9KA 2HA1A 3LIZL 2NQCA 2FECL 5LG1A 2F53A 3QQ3B 3L3JB 5I1DB 1MCOH 5EBGA 4ZAKC 1IZJA 3TO4A 4BFBD 4EUPB 1A21A 3L5WB 4KTYA 5FGCE 1G9MC 3SPVA 5C6TL 4E5XB 1KG0B 1QSEE 2DJSA 1EAPA 4P5MB 2V9TA 4Y88A 5SX5H 2I27N 1IEAB 4WFFE 3RX8A 1RZJH 1N64L 2YS4A 3LEYL 4WHTA 4G43A 3T2NL 4M5ZH 1P7QA 2X4UB 3FO1B 5B38B 3V6OE 3MXWL 1C8PA 5D8JL 4OLEA 1FPTH 4U1LB 1MHEB 3MRMB 4KK9C 5JR1H 4EBQL 5F89A 3BX7C 1U9KA 1OVZA 1T03L 2NCMA 4Z0BL 2AJZB 4L4VA 5FUZL 4QRPE 1MCFA 2MMXA 2IBGA 2PO6C 5JDJA 4LMQE 1B9ZA 1XIWA 1IC7L 4HK3N 4L4JA 5EU7C 1XR9B 5CBEA 4Q9BA 2VABB 4LLDB 2AERT 4JKWA 3F7YB 1JGLH 1AGFA 5DMJB 5IVZB 4AQ1B 1KPUB 1UM6L 1Z9SA 2RFXB 1MIMH 2FBOJ 4HEPG 5SWSB 2MHAB 4H88L 4OQ1A 3T0VA 1KCKA 3TBVA 1J1PL 5E99H 2EIBA 4O02H 2CKBB 4LHUA 1OTTD 4JAMB 2Z8WC 2YXFA 3H9SA 3FT3A 1IC1A 4BUGA 1LO4L 3U6RA 1CFNA 1I85C 5FCSH 1WIPA 1AR1D 2FBJH 5E8DH 5J3HD 1AXTH 2X89A 3L1OL 4XMKL 2AEPL 4XC3L 4NN5C 3UC0L 1J5OH 1E4XI 3QG7L 4PJ7F 4NQEE 4RDQG 1D6VL 1MJUH 2FX9H 1XGRA 3ZL4L 4AZ8A 1GRWA 1L7TL 4G6FB 3TCLA 5JOEA 4NC1E 2DB8A 2CIKA 1NCCL 2G60L 2YPLB 4CW1B 3DXAD 4KRNA 3HE6B 3DBXA 3HHRB 4YO0B 4LSTH 5EO0A 1EHAA 4WWID 1T5WA 3V7AG 3KJ4B 1KIPA 4XWOD 3B43A 3G5XA 4GKOA 1N6QL 1X4YA 1K4CA 3SJVB 1MFBL 5IVXB 5D1ZA 4R2GC 3B9KB 4Q6IB 3QIUB 4KXZI 4S1DD 5I73B 5SV3A 5MEPB 4XP1H 1MJ8L 3O6KL 1AFVL 1TETL 3L7FA 4YDKH 2V2WB 4YHKH 4AL8H 4F2MB 1CS6A 4Y16D 4OIBA 5KSAB 3KLHD 2VXUL 5JZ7D 5CD3B 1FLRL 4RISH 4BK5A 5CZXD 4PJ7A 3PWUB 1UYWL 4P3CH 4F7CB 4UNTA 3CVHB 3OAZK 2BMKB 2X1PA 2BC4A 1BF8A 1JGVL 4XH2B 5EU3B 4YDJB 4CDGC 2J12B 3CZJA 4F7TB 2H9GA 3MACL 2J7LA 5TDNA 3OR6B 1JZ3A 4M93C 1FJ1B 1AXSA 2MQ3A 5JHDE 2VLRB 4W4NA 2VLLB 1DZBA 1MRFH 3AREC 1D5BA 1ZV5A 3ZTNH 4ZFFA 1D6EB 3ARDD 5IBTH 5AYUH 3IFNL 4GRMA 2XICA 3VGAC 5DUBA 1AHWC 1G7JB 1N5AB 2ZPKL 3MLUL 4WIQA 1Q1JL 4YXLH 5ID1A 2I5YL 1J1OH 3L3IB 2IPTL 3LKSB 1HOCB 3V7MA 2P5WA 3JWOC 1BLNA 3W9DB 5C0BE 3G9AB 5D70H 4ZNEE 4E41B 5C0GB 1E27B 3NZHH 5TDPA 3D2UD 2CIIB 5EU6A 5KSUA 5K9QI 3QHFH 4HF5L 3STZB 1HI6B 5K9KA 1RURH 3P0GB 1W0YT 2EE2A 2WBJD 2UUDH 5C0RH 3AY4C 3VXRD 5CSZB 1YEDB 1ZA3B 5E7BA 5BS0B 3NCBB 4GRWB 4MB5A 1MVFA 4JFDB 1W72L 4Z7VA 4GG6B 1HKLL 5CHNA 2IANB 1KT2B 3ARWA 4X6CE 4BSVB 3WD5L 2ITCA 4KMLB 1JN6A 4HFWB 3UPCA 2FZ3B 3HS0A 1EEYA 1S9WA 2JF1A 3O2DH 3O4OC 4KROC 5JQ6L 1ND0B 4I9WE 1D5ZA 3VFWB 4UINL 5DVLA 4PUBL 1UEYA 4YR6B 3BP5A 1HHJB 5IG7B 2J8UB 3BH8A 1AR2A 3GGWB 3BZFB 1EXUA 4BELD 1JPGB 1A3LL 5JHLH 1R3LA 1M71B 3WSQH 3DROB 1OSZB 5DHXB 5DK0B 1TVHA 3SGJC 3RRQA 2Y5EA 3S35L 3S97C 3MLZH 4QXWA 1HZHH 5E2UH 1CXFA 3UXFA 1ACZA 2CXKA 4WHYH 1ITCA 1UACH 2ZOLB 2WZPD 2E7LA 1AGEB 1VHPA 1G6RL 5IK3B 3TV3H 2QQNL 2C4FU 4XNXH 3MBEC 3TM6A 3KYKL 2CDEA 5DUPH 1JFQL 4LAQH 2R1YB 3BPNB 3MNWB 4H8WC 4G80B 2DJ4A 1UWEH 2W0FB 5GGQH 3IXAA 1P9MA 3DWTA 5HYJD 1YNLH 1D5IH 1H5BA 1U8QB 1K8DB 2CRZA 2E3VA 2CMRL 2WBWB 1TJIH 3TYGH 4ZO9A 1AI1L 4IJ3C 3CU1A 4JZJC 4H1LB 3CLEL 4KK5D 3QNZA 1I1AD 2HTKD 2I26N 5GIRB 2CXGA 4Y8DC 4UT9H 1I1RA 1KN4H 2B8OT 5DD5H 2W0PA 3NFNA 1LO2L 3QXAB 2X1WL 4GRLA 4ZFOA 2YD2A 4KDTA 4JN2B 5DQ9A 2XXMB 3T4YB 1OL0A 4R8WL 5F1SA 2YWYA 2E9WA 2W9DH 4JFOB 3ARSA 3UPRA 1IGJB 1J86A 3ARGA 1OP3H 1ZHLB 1J0YA 2CR3A 3AC0A 5I1IH 5IHZB 2HT3C 3AMLA 1QRNB 1VKXB 3M1BB 4TSCL 3FOMB 1PKOA 5J11B 4KKLD 5GZOD 4WUUA 3WUWB 1CGSL 1SY6A 3QPXL 4P5TC 3ZKNC 4U6XA 4YLQT 2A38A 2YA0A 4P2QD 4UV4L 1MCKA 3KPSB 4OF8A 1A6VL 2YSSA 3QUYD 1N2RB 2FEDC 1RIVH 2AEIT 3QAZC 1F3DJ 2J6EA 4L8DA 5DZLA 5LGJA 1HH6A 2DDQH 5D9SB 2VLJA 2X9YA 3FFCD 5I8CB 1CLYH 3INUL 3HRZB 3RTQA 2VDKH 4OIAA 4MD0A 4FABH 1WV7T 3OXSB 3SQOH 1Q0XL 3U1SH 3SKOA 3MV01 1N6VA 5DEGA 3FQNA 1B88A 4X4XA 4XGZB 3RJDA 1CFSB 3BQUA 2EC9T 1P5VA 2FL5A 4UILL 1DFBH 1NMCB 1FFPB 3DSFH 1ADQL 3DVNA 2EDLA 4TUJA 1S7QB 5J12C 2ZUXA 4PJGE 3FHAA 3EYFA 4G8GA 4P2RA 1K4DA 4MQXC 3QFJA 3U0TA 4QLRA 2VH5L 1XCQB 4FFYL 4TUOA 1LEKA 5JO5A 3FO2B 3V4VL 5BZDB 1G9MH 4LGSB 1X5XA 3TT3H 5IFAH 5AZEH 2DM3A 5DD6B 5CBAA 3VFGL 3QRGH 1F4WH 1Z3GL 3QDGA 3UJTH 3T8XA 4UU9B 5I1JL 5INDB 3PGFH 3QT2A 4CN6A 4NQXA 5M95B 1S78D 4KPHL 1MFCH 3M8OH 2VXSL 2VLME 3HA0A 3LEXA 2BVQA 4Z95H 1WUNT 1ZLUK 4XWGL 5D2LE 1RVFL 1ZKAA 3NPZB 3VXMB 5EUOB 3RWFB 5FYJE 1FNAA 4YXKL 1GGCH 2V2XB 2OTUA 4P49A 1F6LL 3MLSH 2BVTA 3MRNA 4M4PA 3VXUA 3RBSA 1PD6A 4P23C 1TCRB 3SKNB 2DWEB 2AJUH 1PDKA 3GDBA 4PJXB 1IARB 4ZQKA 3SO3B 1OCWL 3K4ZA 2XA8H 5I2IA 3ZE0F 4HUMB 2ZG3A 2FLBT 3EOBA 2NY0D 1JWMB 2OP4L 3TA3B 4ZMAT 2UWEA 1WWAX 2O61A 4OCWH 5ID0A 1IZKA 1QLRA 1CK0L 1YYLL 1XF4A 4KTEH 4DKFL 1RUMH 1INEL 3ABZA 4NWUL 2DIBA 2JB5L 2OBGA 4HKJB 4X6BA 3E6FA 3OPZL 3LEVL 3MGTB 1RUQL 4P59H 1DN0A 4Y5XC 4P4KA 4K3DL 2DBJA 4TPRL 3EJZD 3QEGL 5GRWA 3NFSH 1IKNC 2FATH 3HUJB 4A6YB 3CXHJ 3RUGA 2R8SH 1IGYA 4PFEA 5IV2A 3HPJB 5GGTL 1U8NA 1KCVH 4WW2F 3MRIA 4R7NA 4OLZH 1DQML 4WY7L 3MMEA 4APQA 1AO7A 3OAYH 5CCKL 2V6HA 4U4BA 3VG9B 4K7PH 4C58B 1SMOA 2OYPA 1VSCA 4WRLA 1JYNA 3LRHA 1KCLA 5I0DA 5CEZL 4J4PA 2V7NB 4JZOA 3MUGB 5DMYA 1UCBH 4U2ZA 1BOGA 1MFAL 3HAEG 3PWPD 5JNYA 5ESAA 3S96B 1YMMB 5DJZA 2Q8AH 2JJVA 3BPOC 2A2QT 4NUGH 3BKCL 3TNMB 4NZJA 1P4IH 4Y19B 2ZNWA 4HWUA 3S37X 3VXSD 3W0WA 4GOSA 1S5HB 4YC2C 3WFDH 1U8OB 5KN5A 4XXDB 1TITA 5D1QD 1YDPB 5D2NB 5HBBA 5HI5D 4H5SB 4CADB 5L2KE 4TUKL 2BSRB 2ED7A 1P5UA 4JGUA 1DP0A 4NRYB 5IW1B 4WEMB 4P3WA 3UTPE 2R1WA 4M8VA 2WIIA 5E6YA 3U48A 5DJYB 5DMGC 1B0GA 1DTUA 4HKZA 3RHWK 3ZHLA 5L7XL 4PRID 4KKBC 1HEZA 5F9WC 4ODUA 1ERNA 4RZCB 3C6SA 1T1WB 1Q9WA 2NXZC 5J1TC 4P5KB 1KLUA 5DSCA 4KRPD 2OK0H 1XGYL 4URTB 3KNBA 3S3PA 4YEFA 4K7FA 3ECBA 3OKLA 4XNYH 3ZKMC 2A9NL 3V5HA 2MKWA 1JGDB 2AK4B 3LKOB 2I9LB 2YBRB 5DT1H 3JWOH 5E1AA 1INDH 3U9PL 4RNRB 4X9BA 3CFJB 3SDDC 2Y72A 1U8PB 3HC0A 4K2UH 4P4RA 1TVDA 1JBJA 4NQCB 1T22B 4X4ZA 3CFBB 4ZYKA 4JPVH 4BFIB 3H3KA 5HHPA 4CNIA 4ZUTB 3B2VL 1CG9A 1C1EH 1SJXA 4IHOA 1LILA 3EIFA 3SDCA 4KUZH 1DVFA 4BYHA 4OKVA 4X4ME 2EDOA 3Q1SL 1UA6L 3IXTB 4PV9A 4UQ2B 4OM0H 2DMKA 4FQQB 5IBLC 4U7SA 4LK4A 4N5ED 1OF2B 1CD9B 1BFTA 5DEFB 4Z7WB 2R23A 4N9GA 4FQJL 5ACMA 1WT5A 3E8UH 4U3CA 3QUZC 1N3NB 4LU5H 3VW3H 1JIBA 2ATKA 1UM5L 1MI5B 1J18A 3SDAC 1RFDH 3LH2L 5C08B 2HRPL 5HJ3A 2Z92B 3ZT6A 1WFNA 3U4BH 3BAEH 1D9KC 1YUHB 4L3CB 5B3JE 1MCOL 5GRYA 1RIUL 5I16A 1PEWA 1RZGA 4FXKB 3TH3T 4QXUL 5I71C 2AJYH 4H8WH 2QSVA 4BZYA 2MTPA 2HN7A 4RMVA 3E6HA 3VXPB 3VWJD 1S9VA 3EYUH 1NSNL 1ZANH 4HC1A 3DV4B 4PJIF 1BZ9A 3KXFE 3QB7C 1YN7A 2LU3A 3KG5A 2DKUA 5IB2B 4KZDL 1Z2KA 3D3VA 5J13B 1PX4A 2CRIA 43CAA 3MCLH 5E00A 1J8KA 2QBWA 5DZNA 3IB4A 4WI8A 2EZ0C 3WKML 3CU7A 43C9B 1UCTA 1MCLA 1JV5A 3VG0L 4OLVL 1DE4B 1QSFA 3LV3B 3IDMB 2V9QA 1QBAA 1JMXA 1R5WA 2X7LB 5JR1L 2P5EB 2B2XH 4ZNCD 1WBYB 3GUTB 2BNUB 3MA7A 4L8BB 3ZDXE 3GSUA 4Z7UE 4FQLL 2HTLD 4M62L 1DANU 5FHBH 3HC3H 5A2LH 2AAVA 4R0LA 4B7LA 5JXEA 2FX8L 2V5TA 4OZ4B 5D5ME 3BZ4A 4CBPA 2VR4A 3DX9A 3STLA 5LGHH 1VFAB 1PKQE 1XF2B 4PJIA 3S6CA 4PJAA 4JFEE 5HYQB 5GSVA 3SGEH 1R3KB 1A7OH 4MDJB 1SYVB 3D39B 1NGYA 5B21A 2RAMA 1PZUB 1NLBL 3P0YH 1HINL 5TQ2H 3V5DB 5CD5C 3DURB 1I9IH 2ADGA 3ZE2F 5JPMA 2VN4A 4FG6C 4GFTB 3MRPA 2R9HC 5CIPA 4RBPK 2AKRB 4M7LL 3X3GL 2V7HB 1ZVYA 2N7BA 2HLAB 3KWWA 5JW5B 3T0EE 3TESA 2DIJA 3MRRB 5E8DL 4NUJA 3TPKA 1EZVY 5HHQB 4BZ1L 3MLYH 1J5OL 3MV7D 3Q5TA 2AXGB 1GGBH 3DVIA 4OD3H 1A2YA 4WFHE 2F74B 4YHML 1MUJB 4GS7C 1BM3L 5IEHB 1HSBA 2E27H 3PABA 3ULUE 5CINH 3QWQB 1RY7B 5TPWL 5IR1B 5ISZD 1A7PH 2D7TL 4LPWA 3IDIA 3V6FB 1WBZB 2F54E 2W91A 3C87A 1KULA 4YBQD 2IF7A 3HR5A 3FQXB 1KELL 2DQUL 1H3XA 3HG1E 1T04B 5E8OB 1NDGB 2GITA 5IIEA 2QLVB 4IOFC 3SO5A 4RGNB 4C54A 2H2SC 1YN6A 2R0KL 1CT8A 3HKFA 1FNSH 4XI5D 5EU5A 4YDKL 2DI9A 4LKCB 4AL8L 3TVMB 3FB5A 1S7XB 3GNMH 3VD9A 1SEQL 1F4XL 1SBSH 5FHAH 5LCVH 3GMPB 1KPRA 4V1DB 1JNHA 2BVPB 4CU6A 5BJTB 1X6NA 4HT1L 5I15H 1A0QH 3EAKA 2L0DA 2IMMA 5F7FA 3S4SA 4MAYA 3RWHA 4Z77A 3P9MA 5HDQL 5IBUB 5EPMA 1IC5L 5HPMA 3PHQA 1LDPH 1MQ8A 4PJ5E 1OGAE 4IDJL 4W6WB 2ICWI 2YOCA 4BSWB 4Z7OE 3ZTNL 4Q2ZB 3BIKB 4O2EB 4OZGE 3EO9L 4KI1A 1LK2B 1NFDE 5CKGA 1GSMA 1HIML 4BH7A 4MA7L 5C09A 4NN6C 5I1KH 1T5XA 1NLDH 3KYMA 2PYEB 3CIQA 4OJFH 1T7XA 3AB0B 3MLVL 5D93C 3NZHL 4Z78A 3H9YA 3OTTA 1OY3B 4PJDF 3RU8L 1HWGB 4R96A 1BIIB 1TZIB 4MXQD 2OLDA 4NRZA 1SMAA 5DD0H 1U8LA 5MI0B 5H2BA 5DJCA 1X44A 2EDXA 5EO9A 3EYSH 4OIIL 2BSED 5FECB 2D7MA 3EO0A 2QQLH 5T1KD 4JRXE 5T5FL 3V6ZA 3PF2A 4RSVA 1QO3B 4XNQB 4DN3L 1XGPA 3B2UC 4AM0A 3V6BR 1C08B 3LDBB 4HZAA 1HK6A 4QHKJ 2LVCA 5HGBB 1XGUB 1MVUB 3WEXB 2KH2B 2NXYC 1NAMB 1HXMA 2IAMD 3IETB 5JIKA 4P3DB 3FONB 2BHYA 3H8NA 5F1NB 3L3JA 5I1DA 5JHLL 4EUPA 4NP4H 2YKLL 4UDUB 3L5WA 3RAJH 1MPAH 3C60D 5K9JL 2ERJC 1MCDA 4E5XA 2AK1L 2ZCKH 2B1AH 5T3XD 4P5MA 4TVPD 2YHGA 5MHSE 1D5MB 3SE9L 1IEAA 2BXZA 2DMCA 1JPST 1QLFB 1IAMA 2EDQA 3L3OB 4MJ5A 4ZS6C 1IQWH 4LAQL 4HS6B 3O3BB 2R1XB 1FYTD 3D0VB 1G7LB 5D7JB 1X3DA 3C8HA 1MREL 2HWZL 5CGTA 2JELL 4PB9H 4ODVH 3GHEH 2X4UA 3FO1A 1T1XA 5B38A 4DKEL 5GGSB 4G42B 4U1LA 1MHEA 3MRMA 4FTVD 4TSAL 2XOTA 1OB1B 2AJZA 3G6JB 5KTEH 1F4HA 5DD5L 1MELA 3UO1H 1XFPA 3EFFB 3TYFB 4NHCH 5L2JB 4HLJA 2G75A 1BAFL 1XR9A 4M7JH 2Y6SD 3NIDF 4LLDA 4HLZH 3F7YA 4TOYH 1R3IL 5E70A 3RIFF 1UEMA 5IVZA 3DUSB 1T7YA 4FFZH 2ORBL 4JREB 5SWSA 4PV8B 2F9BT 2MHAA 2X1OA 5CUSL 1EO8L 1FCCA 2X2YA 4O51B 2CKBA 4JAMA 4O9HL 5FK9B 5EZJB 1EFQA 4G9FD 3S98A 2JJWA 4C56B 2E7HA 3HC4L 4P2YA 2R29L 4GAFB 1CLYL 5DRNA 4MJ2A 1EERB 3I02B 3SQOL 3DMMB 4BQ9A 3MZTA 2GHWB 3M17B 2F15A 2FB4L 5F9JB 5IW6B 1VENA 3C6LC 4J2XA 5EZOL 1CL7I 3P4LA 3CGTA 1QFPA 4Y4HC 2F53D 1C7TA 3NACL 3T4AB 5H8DA 2YPLA 4JKPH 3TO4D 4Z9KB 3HE6A 3MGAA 4YDLC 4JFXB 4YO0A 1FVCA 5JW4Q 4PJFB 1B4JL 3H42H 4QT5B 4YNYB 3SDXF 5BVPL 1OAKH 2ZG2A 2YUXA 4X7TA 1AJ7H 3SJVA 2D4DA 5IVXA 3B9KA 1VACB 3QIUA 4Q6IA 1U2HA 4TVPL 1DL7H 5MEPA 1ORQA 4ONFH 1F4WL 2ZKHH 1CE1H 1IEHA 5E2WL 1QR1B 4F2MA 4RGOH 5KSAA 1P7QD 5CD3A 2NLJB 2Z35B 4PJ9B 1LE9B 2AP2A 4XBGA 2JE8A 5FAAA 1MFCL 3PWUA 5GXBB 3CVHA 1NGPH 2BMKA 1J12A 4NRXA 4XH2A 5EU3A 3NPSB 4YDJA 4JHBA 4L4VD 3THML 4F7TA 2F5AH 1GGCL 1A3RH 3EYOB 2X1XR 1KGCD 1EMTL 3MLSL 1XIWD 1ZHBB 1URLA 1FJ1A 4HGWB 1OAUH 3QEHB 2VLRA 2AJUL 1UM4L 2VLLA 4KMTH 3RVWD 5DK2B 4NO5B 1Q0YL 1MCPL 4KDWA 1D6EA 4WO4C 2Q8BH 2GSGB 4PTUB 3DECA 4HH9B 4Q6YA 1CR9H 4DW2H 2APXA 5DDHB 2FNBA 3QDHA 2HFGL 5CJOL 2VDNH 3L3IA 2V5MA 3LKSA 1HOCA 4LHUD 4LSDA 3H9SD 4GKSA 3W9DA 1MQKH 1FH5H 5B8CB 4E41A 5C0GA 1E27A 1KB5L 3NCMA 5DD1L 2CIIA 4XTRD 2ZOKA 2X89D 1UJ3A 3STZA 2E6QA 4DEPB 2PETA 5I1AB 1Z9LA 4PP2B 1HI6A 3AM8C 5HHOE 5GISL 3X11B 1X5YA 1XCTB 4K94L 5GS1C 4F15B 5DJXB 5LQBL 2UZIH 5CSZA 1YEDA 1ZA3A 4OGXH 5BS0A 4GG6A 4OGAC 3O8XB 3MCG1 2IANA 1KT2A 4BSVA 2GAZB 3BPLC 3ZO0A 3IVKB 1IAIL 4MAUH 4ZPTB 4DQOL 4HFWA 2EH7L 5IUSA 4I13B 4K7PL 1B6DA 1JRHI 1ND0A 2DBLL 3W9EA 3VFWA 5C0JB 1CLOH 3MA9L 4O58L 1TZHB 4BQ8A 3JVGC 5I73C 4YR6A 5D1ZD 4UOJA 1HHJA 1T1YB 1DUYB 4CGTA 5IG7A 1T4KB 2ED8A 2J8UA 3BWAA 2EH8H 3BZFA 1UCBL 3DYMA 1JPGA 1VEOA 3GJFH 5F8RC 2L7UA 1N0LA 3ARDB 1M71A 5E08H 1OSZA 3SE8L 2G5BB 5DK0A 3L3KB 4FQPA 1UJTA 1DQJB 2DI8A 1AQKH 4YX2H 5C8JA 1FV1B 4WI9A 4I3GA 2ZOLA 3ZE0E 3GKWH 1AGEA 4X5WB 1BZ7B 1UWGH 3U7YH 2YC1B 1V3JA 5CEZE 4MNGE 1FZMB 1NFIB 4OZFH 1WITA 4RFEB 2EEAA 2Z8VC 3KLAB 4Y8AA 1KCSL 4LEXL 2R1YA 3MNWA 4LASH 4BQBA 3D2UB 4UZGA 4HBQA 1TLKA 4KQ4H 2W0FA 2AQ3A 2K3TA 3L9RB 5CEYB 4TNWF 1K8DA 1OAYH 4YK4C 3HMWH 4YE4L 5L6YH 2VDLH 4OFYA 5GIRA 1UWXH 3UP1A 1T83A 1P4BL 1IAIM 1R5IB 4KAQL 5D4QA 5J1SC 1NCBH 4JZNB 5KVFL 3QXAA 1OSPH 1PY9A 2UVFA 1AGCB 1JPTH 4JDZB 3T4YA 3UAJC 1AXIB 4QRRE 4JFOA 1LEGB 4MMXC 2P5WD 3P9LB 3BEVB 4OCSH 4HPOL 4XNYL 1ZHLA 1ZTXL 3O6LH 5IHZA 5K33A 1QRNA 5EU6D 1VKXA 3M1BA 1FSKB 1INDL 2H32B 3QEUA 4D2NA 4Q97A 3WFHB 2XTLA 3OWEA 3HI1A 4F37K 3WUWA 1DSFH 3O0RL 5IQ7H 2ZCHH 2XTJE 4WU7B 5HI3C 4LSVL 3EJYC 2JIXB 2XQYG 2DM7A 3D85B 4Q9RL 1Y6MR 3KPSA 1JHKL 1F11B 1N2RA 2P45B 3NIGF 4JPVL 5D9SA 3V52H 2PR4L 5I8CA 3HRZA 3U0WL 2NY1B 4Z7QF 4LMQI 3OXSA 3SGDH 3ALXA 3O2VL 4M61B 5IMLB 4KUZL 4NT6B 4XGZA 5C92A 3MJ9A 1C5CL 5CJXC 4H26B 4G7YL 1CFSA 4NFCA 3GSXB 3GB7B 1KCUH 2HH0H 3QQ9C 3MFGB 1FFPA 1YEFH 4WFED 1S7QA 1QSVA 3K4DA 4AH2B 4JY4A 3TWCL 7FABL 2FWOB 2F19H 5IB5B 3CSBA 5F6IC 5ADPH 1EGJA 4LU5L 4HUKB 3FO2A 1KTDB 3GK8H 3MNVB 4U49A 5DD6A 3U4BL 3VWKC 1FO0A 1PG7H 4TTDC 4QNPE 3MYJB 4NC1C 3VGHA 3O6ML 3JWDC 5I1GH 4HV8B 1FORH 5INDA 2GUOA 5I1HL 1I3GL 3QP3A 1IKFH 4GBXB 4X4YA 3ZYJA 4MA1B 3GIZH 2H45A 4W81A 2YZ1A 1O7SA 4ETQB 1H3VA 4BZ2H 2V2TB 5LBSH 3ZSSA 1I7UB 5EUOA 3RWFA 3EYVB 4LFHD 3L3GB 3OQ3B 4HXAH 5IJVA 3FFCB 4GRLD 3P77B 5C0CE 4ZFZB 2DS4A 3ILPB 3Q5OA 3BEWB 2K1MA 2B1HL 1X5LA 2ESVE 4GAGH 4GUPB 3SKNA 4GO6B 2DWEA 1NBYB 3P40A 5EOTB 2F5BL 2Q3ZA 3ARGD 2M2DA 1MWAA 3B6SA 2QADD 4LDEB 4LCCA 1P4LA 2R0ZH 5B4MD 4PJXA 2IEPA 2WQRA 4Y5YC 3GMNA 4HWBA 4PPTA 4OI8A 1UXSB 3BN9C 4WUUD 1JWMA 2BVYA 5C9JB 3TA3A 4DK6A 4XHJC 3ZYOA 5HYIA 4OCXH 4KK6D 3EO1B 3IAGC 1X5JA 5C6PB 5I30L 1EJOH 1SVZA 4O4YH 1CGXA 3ZT7A 4HKJA 4Y4FC 1KEGL 2DKMA 3MGTA 3DARA 4LRIC 2VLJD 2RBLA 4QRPB 1FL6B 3IDGA 2AW2A 4JR9L 4JHAL 5BO1H 3RTQD 1OAQH 2CPCA 1IEBB 5TFSH 4CVWA 1FG2B 2EYRB 1I8MB 1CVRA 4A6YA 3R8QA 4D9LH 1LK3L 4M48L 1NMCC 2HVKB 3O9WB 3K81A 3BQUD 1YPZF 3HPJA 2D7OA 1UH2A 3VFSB 1JNNH 3ARBC 2BXYA 3BRFA 3RI5K 1A7NH 5HHXL 1PJ9A 4UB0L 4G8GD 4P2RD 1QBLH 3HAEB 3QFJD 4I18B 2CUIA 4RWYH 3MLYL 1WCQA 4OD2B 2V7NA 3BKYL 3MODL 3MUGA 4LFHG 5C2BH 5TF1L 3JV6B 2E27L 4LQ1A 3S96A 1NBZB 4LCWA 3QDGD 4FQXB 2CD0A 2X9XA 2VUYA 5CJ8A 3C8DA 2DQDH 4XXCC 1J8HA 1T66D 1UG9A 1YQVH 3E0GA 4Y19A 5L9DL 1FIGH 2XI9A 4HH8A 1S5HA 4H20L 2LAGB 4NKQB 4JO3H 3UTTE 2ADJB 2Y36L 4JFPB 4XXDA 4KJPC 1YDPA 1K9TA 1YPZA 5D2NA 1OHQA 1I1CA 4H5SA 4CADA 1FNSL 2DQFA 5E2VL 4OLXL 1VADB 4PJEE 5EBWB 5DURB 4NRYA 3UCRA 3VXUD 4XCFH 3MOBH 3GNML 2NTSP 4QY8A 1BGXL 1SBSL 5LCVL 4XVSL 4F3FB 4KUCF 5GJTL 4LCYB 5DJYA 5D1XD 4CJ1A 4MHHG 1CGVA 4NM4H 4OT1H 3OX8B 1ZT7B 4OM1H 4RZCA 1T1WA 2LTQB 4JG1H 1BJMA 2AXFB 3V9FA 1G6VK 3HB3D 1HCVA 2EC8A 2PW1B 2W1NA 2BNQD 4Q0XL 4DZBB 4LLQB 1JGDA 2AK4A 3LKOA 4G6KL 4NKIH 4PG2A 1LWRA 1RMFH 2I9LA 3D48R 3TLRA 2YBRA 5ICXB 2BCKB 2J6EL 1RQ5A 4RNRA 5I8OH 3CFJA 4NHUB 5FUOH 2XRAL 1U8PA 5JHDB 1RHFA 1BVLB 5CAYB 3LSOA 3BGAA 4NQCA 1T22A 3CFBA 1NLDL 5D1QB 1AO7D 2APFA 2IFFL 3RWEA 4BFIA 3TPUA 4FP8L 1I1YB 2QQKL 2X6MA 4NFDA 4C55A 1AY1H 5GGSY 4AY0A 1AD0B 5DD0L 1G7MB 3IRZA 5DEZA 3CX5J 4J4PD 2VN7A 3EYSL 3FB6B 1XZ0B 2XNAB 4UQ2A 2QQLL 2IC2A 2XXCB 2ID5A 2QR0B 5ERWA 1IM3B 3MFFA 4JO2L 4Z7WA 1OF2A 5DEFA 4ODSL 4F58H 5KS9E 1CDIA 1N3NA 5DVOA 4KRPB 3W0WD 4R6UA 1MI5A 4Q74A 1EH9A 1HXYB 1FN4B 3DIFB 5C08A 2EDEA 4JDTL 4X6CB 2Z92A 2W92A 5B39G 1YUHA 4L3CA 4JFHD 5EIVA 1E4KC 1T2QH 3CH1B 2CH8A 4NP4L 5F3BB 5ICYA 5CP3H 2YPVL 1EA9C 3D87B 1YEKL 4GG8B 5EOQH 1GH7A 5F7WC 3DLQR 4RGMC 4JKLA 1MAJA 3VI3F 1H8NA 5FYKD 1UB6B 4N8VG 3MLXH 5BV7B 1AGDB 1C5DB 2DLHA 2Y07L 4Z5RA 3C09C 5IB2A 2HMIC 1IQWL 2A1WH 1T89C 4OFVA 5I1CH 1T2JA 2CDGA 4OTXH 3GHEL 3ZSTA 3KLDA 4U7MA 43C9A 5CGYD 5J56B 2AJSL 1DE4A 2VO5A 3LV3A 3IDMA 1WAAF 4XP9H 3TJEH 2BOBA 2E7CA 1DCLA 1ITBB 1MAML 2X7LA 2P5EA 3MLWH 1WBYA 3TIEB 3GUTA 3WIFB 4L8BA 5IFJB 1FL3B 4PREB 1T0MB 4MYWB 1P6AB 3QZWG 1R3JB 3IFPB 4PJHF 3IRPX 4OZ4A 4GMSH 5D72L 2MCG1 3CSGA 1QFOA 4CU7A 4TOYL 1XF2A 4JDVB 2CKNA 5I18H 5HYQA 3OAZH 5LXGH 1JK8A 1K8IA 1R3KA 3STBA 3NMEA 4MDJA 2EC9U 4ZXBD 4MZ2A 1CI5A 5DI8B 3D39A 2NMSA 3RNKA 1C5BH 3V5DA 2I60H 3VWJB 5JXAL 3H9ZA 2V17L 3PP4H 2JJSC 4O2CB 4NKMB 3PHOB 3S35X 4ORZC 2AKRA 4Z8FL 4I3RH 2V7HA 1UKSA 5JW5A 2VKWA 2YRZA 3MRRA 1QLEL 1XR8B 3BP4B 5HHQA 4X6DB 3VDCA 4LVHC 3RPIB 2AXGA 3LN4B 5CJQL 5EA0H 3QIWC 3W2DL 2F74A 1MUJA 4IRSC 4PJHA 5IEHA 4NN7C 4AMKH 4WTZA 1DQDH 4RAVB 3GMLA 4C83A 3M07A 4KKAD 3OSKA 4YWGL 3GSNA 3WDIA 2A0LC 3ZKQD 3V6FA 3H42L 1S7UA 1WBZA 3K7UA 3QO1B 3JWDH 1J05A 5H94B 1QEWB 3FQXA 5GZND 2KDGA 4KHXL 3CLFH 4AEHH 4ODHH 2F8OA 4OI9A 1T04A 5E8OA 1NDGA 2H1PL 5FYKL 4YHYB 4Q7DA 4XVTL 3CDGB 4JFQA 3NIDE 1TMCB 3PDOB 3D3VD 2D0FA 1NCUA 4PJCB 4LKCA 5EORH 3TVMA 1S7XA 3GO1L 4Y0GA 4HS8H 4XPAH 3F12B 2NY2B 2A73B 4MJ6B 3MRJB 4V1DA 2BVPA 3BE1H 3SCMC 3RFZC 2OSLB 2VC2H 5BJTA 1GZPB 5C1MB 5E56A 1IJ9A 3TN0C 3NCFB 5DA0B 3RDTC 3K2MC 3TZVB 4RFNB 3CK0L 4RMTA 2J88L 5JXED 2X4PB 3F6IA 4K8RD 1B0WA 5D2LB 4L8SC 4QXTB 1OTUD 1GAFL 4BSWA 2ZUYA 2DAVA 5EU4B 3PWLB 4Q2ZA 1G84A 3D1MC 4BJLA 4O2EA 1C12B 2Q8BL 1I7RB 2AXHA 3OJVC 4DW2L 2OQJB 1Q8MA 1MSPA 3WS3B 2ILLA 5E9DE 2O5YL 1JZ4A 2PYEA 2VDOH 4GQ9L 4ZOAA 4NWTH 5DGQA 1RJZB 4JHZA 2HFEB 5EU7E 3JTSA 3LRGA 1BIIA 1TZIA 2DWDB 4CDHA 2NY7L 3RZCD 5AG9A 1MF2L 5KSVB 2WMPA 2DQGH 1T0PB 3WFCL 4LSUL 3X13B 5FECA 3ZYZA 1BFVH 1N7MH 1GHFH 5BRZE 1U8IB 1OT2A 1CFVL 1JPSH 1QO3A 4WJ5B 4FS0A 1L9MA 3AAZB 1RU9L 1I8LC 1C08A 4WWKD 1PSKH 2MFNA 2GQHA 5HGBA 4XMLH 1XGUA 3BGFB 4XNMB 5KOMC 3WEXA 5FXCH 1RZIB 4OV5B 3IETA 2BERA 1DJSA 4P3DA 3QDJD 2BJML 3FONA 1BD2D 1A9EA 3A6OA 5A3IC 4LLYB 1RZKC 3SE3A 4UDUA 1NMAL 1RD6A 5D7SH 2W60B 4YHLL 1OAZL 4K3JH 4YXHL 1A6WH 3GKWL 2QV2A 1TZGL 3WXWL 3RGVD 4LDLB 2ED9A 5SX4I 4HS6A 2R1XA 1IGML 4LASL 3D0VA 4J3UA 1G7LA 4MAYD 5D7JA 3DVFA 1BBJA 4KQ4L 1A22B 3PQYE 1YEIL 4IOIA 3T0AA 4FQCH 2J5LC 1FIEA 4KJYB 4HMEA 5KVGH 2EXYD 5GGSA 1QYGH 3HMWL 5T1KB 1V7ML 3GMRB 2VXVH 3QCTH 2QSQA 2ICWA 2VDLL 4XX1E 5IP4A 1OB1A 3V79C 4KJQC 3G6JA 3VRJB 3WLWC 3ULSB 4XCYB 1OSPL 3EFFA 3GSRB 3TYFA 3BZEB 5L2JA 5C09D 2LABA 3DGGB 5FUCC 3FB8B 4WHDA 2HT2C 2EDDA 3E3QC 5FGBA 2IAMB 4JFZH 4OZIE 4DFIA 1MFEH 3ETBF 4UDTB 2EDKA 3L6FA 5C0NC 4WV1C 4KU1A 1XAUA 4PV8A 1A1OB 1KEML 1IFHH 4PR5B 3RL1A 1MY5A 1E4JA 4WTWA 2GTWB 3KPMA 3CCHB 3N85H 4M1CC 4FNLL 4O51A 1RJLB 5T1DL 5FK9A 1IGFH 1EHNA 4FFVD 4YPGB 5EZJA 4XAWH 4UBDD 1YEJH 4C56A 3K1DA 5F70A 1FYTB 5FIEA 2Z31A 1CFBA 4UTAL 3AUVA 1QACA 1Z0NA 32C2B 5CP7B 5AG8A 3I02A 1M1SA 5EH1A 1MCCA 3DMMA 3M17A 5TH2A 5IW6A 1OPGH 5F9JA 2XY2A 3S4SG 3BOVA 4AIZB 3LQMA 2B5IC 1S9YB 3T4AA 3N06B 2HJLB 4U7KA 2WK2A 1CZ8H 1MCBA 1P69B 4G8FB 4XP5L 3BYTA 1NBQA 4JFXA 5IESH 5HDBF 1R24A 2AJ3B 4QT5A 4HUXB 1CTNA 1KXTB 5I0ZA 2NZ9D 5DMIH 1HHHB 3IU4L 4E9LA 4JY5H 1VACA 4DUVA 2MOVA 1YYML 5D7LE 1PG7L 2GK2A 1BQHA 4YJZL 4HK3J 3MV8D 4PGBB 1LP9B 3AMKA 1QR1A 1G0YR 1F6AB 4ALAL 1FORL 3WIIH 4XPBL 2NLJA 1IKFL 1CLZL 1DDHA 2Z35A 4PJ9A 4XVUD 4YQXH 1K2DA 2OR8A 1LE9A 2BY1A 4XPTL 3ULVD 4NQVB 4OQTA 3TBSB 4G9FB 1KJ2H 5HD8D 4I0PC 4JHWL 3HNSL 3EYOA 4HJJH 3KJ6H 3CDYA 5KVEH 3NIGE 2AXJA 4XRCB 4NM8H 2NY4D 1CLCA 2QSCH 5F93C 4HGWA 4OUUB 4LSPH 4Z7QE 4RQQB 5FYJH 1HWHB 3QEHA 1SQ2N 1JGEA 5DK2A 1SYSB 2F53B 1B4RA 4JGJA 3CAFA 4MNQE 2H2PD 5E5RB 3TO4B 2DLGA 3MGOB 5AYQA 1I9RH 1A7QH 4NCC1 2GSGA 4PTUA 1S7TA 4XP6L 5SWSD 4EN3B 2AEWA 1GGYA 5F1KC 3QXDB 1UFUA 4ZFGH 5DDHA 1EJOL 4O4YL 5B8CA 4R4FL 2GY7B 4WHYG 1UGNA 3KPRE 4Z7UB 3R0NA 3QEQE 1IL1A 3FN9A 3JUZA 4PP2A 2UY7A 3MRFA 5HDOA 3O81A 4WI6A 2ZSVB 1XCTA 4KTDH 5D5MB 4YHNB 4LVNB 5DJXA 2ZUSA 3T3MF 3NCJH 3P4MB 2DM2A 2C5DC 2DTMH 3CMGA 5F89B 3O8XA 3SE4C 2YPLD 4JFEB 4KC3B 2COQA 2GAZA 4L4VB 5GGVY 3IVKA 3HE6D 4ZPTA 5B38G 2AABL 3IDNB 4K71B 4EOWH 4B53A 4L1DA 4BQ6A 1OP5K 1A7NL 1AIFB 3LMJL 2CQVA 1YEEH 3DVGB 5C0JA 5A40E 4RWYL 1N5YH 1TZHA 3SJVD 1KACB 1MNUH 3QIUD 1T1YA 1DUYA 1T4KA 4G9DB 1S7SA 1BBDH 3GRWH 3T0EB 1RULH 1CQYA 4MJIE 4MD4B 2OL3B 3OMZA 2G5BA 3W5MA 1YEHL 3L3KA 1VGKB 2YEZB 1YNTB 5KSAD 4PS4H 1DQJA 1JZ6A 1MLCB 3WNPA 2DQDL 1KV3A 3L95B 1OTTC 2FGWL 4OBSA 4X5WA 1WZMA 3KR3H 1FIGL 3NCYS 3JXAA 2YC1A 3VDBA 1AR1C 3H9SB 2E7MA 1FZMA 5J3HC 1J0ZA 1NFIA 4RFEA 3ULVL 4XB8A 1CFNB 1G1CA 3KLAA 1A6AA 1F5WA 2O5ZL 2FIRT 4DKAA 3VFOB 2F54B 4KK9D 4PP1D 1ZE3C 4Y4KB 5CEYA 4XB7A 4U31A 4M7ZC 1CCZA 4OFIA 2IBBA 4QCIB 3HG1B 2VLRD 4TNVF 3WIHA 4FQIH 3DHJA 2C4XA 3TC9A 1R5IA 1IVLA 4DZ8A 4JZNA 5IOPA 4XWOC 4S0TD 3DYOA 3SOBH 2DLFL 3CC5B 3UYRL 1T5WB 2YRPA 4JGMA 1AGCA 2QHRL 4JDZA 5FGRA 1Q9LB 2Q76B 5HHVL 4S1DC 4M7LT 4JG1L 1KYOJ 1LEGA 1T21B 5D1ZB 3P9LA 3BEVA 2CKBL 1TFHA 4E41D 5L88L 2OMBA 4Y16C 5FYLD 3KLHC 3L7FB 3TT1L 5JZ7C 3S36L 3ARYA 1GL4B 3NA9H 1IGCH 2DOCA 1J11A 2H32A