2KQMA

Solution structure of the ki o18/o8 y87h immunoglobulin light chain variable domain
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
108
structure length
108
Chain Sequence
b'DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYHCQQYDNLPYTFGQGTKLEIKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig kappa chain V-I region AU
publication title A single mutation promotes amyloidogenicity through a highly promiscuous dimer interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 25
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-11-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kqmA00
5MEOB 7FABL 4M5ZH 1A6VL 3UO1H 1G0XA 2BVPB 4YHLL 2OXGA 3ORJA 2DD8H 4NCC1 43CAB 1KV3A 4PV9A 2EYTA 1R0AH 3ZO0A 2EECA 5EIVA 4FFVC 4S11A 4X6BB 2W0FB 5MENA 2AJVL 1NCAH 4JKWA 4ELME 2PKDA 2OR8A 1VFBB 5D2NC 5ISZD 3BKJH 5JQ6L 5DA0B 4JG0H 4MJIA 4RFEB 3DO3A 3PDGA 4GRLA 5FYLH 5DVOA 1EO8L 1INEH 5I75B 5LGJB 1QRNB 2J8UB 4QTHB 3S9DB 3LKPB 1CICB 1NJ9B 3P11L 4X6FA 1HILB 1I1AA 4O2EB 3VFMB 4UB0H 1RUQL 3VXME 3T1FA 1ZKAA 5C0AE 2A6KA 2J4WL 1AIFB 4KJPD 3T65B 5J06A 1D5ZA 4WUKH 1DBKH 2EDRA 2F54E 5EORL 4Y5XB 5FO7A 1AY1H 2FWOB 1OCWL 1G6RB 4QXGL 1NCNA 4MDJB 3VRLE 1LDPL 2BK8A 3GKWL 4RA3A 2H26A 3MBXL 3NAAL 2WANA 4KKBD 2AK4B 1P6FA 1KCRH 3UZQA 2F19L 4K3GA 3MRFB 5LQBL 2EYRB 2CGRL 1D6EA 5F7LB 1WBYB 2A83A 1HEZB 1V7NH 4YH6A 3QBTB 3VFOB 2VXSH 3BQUC 3JV6B 3UTTB 5MP6H 5M94B 2BHUA 1LE5A 3U7YH 1U0QA 4MDIA 4XNYL 4HK0A 1U8MA 2CIKB 3O3BA 2HJKB 1YC8A 4LARH 5CJ5A 4DOHE 2CRYA 4IRSA 1XGUB 2ZNXA 3SCMB 2OL3L 2GIYA 3TIDB 4N0YH 2ARJB 4K55A 2OL3A 2R9HD 1DTUA 4QHUB 1RZIA 3NIFE 1J1PH 4OCWH 1LEIA 4JJ5A 4PJ9B 2EDXA 3EDJA 1WEJL 4FXKA 1RZFL 1XIWC 4PV8A 1I8IB 3BD5A 2AABL 2XZZA 2FO4B 3KYKH 3VFNA 4NIKB 1WAAA 4URTB 1IZKA 3D9AH 4U0RB 5CD5C 2Y23A 5C08B 3BYTA 5DRNB 3VXUA 5F6HI 1PLGL 1CLCA 1JHLH 2BSTB 1EDQA 4LHUA 4OF7A 2LTQC 3C8HA 1MCOL 4M7JH 1GGUA 2WBJD 5HDQH 1J0KA 2Y5EA 4FQLL 5CLWA 4V2CB 4O2FB 3CH1B 3JWOL 5E2WH 1T0MB 1FVCA 3V79C 2BVEA 5FECB 3CFCL 2P7TB 3LCYA 1LK2B 2Z35B 4L4TA 1T6VN 3UTSB 4OSUH 1MCHA 2EDLA 4R2GB 3SE8H 3AS3A 3RWGA 3INUH 4PJ7E 3SKJH 4XP5L 2L7UA 1VPOL 3QDMD 2GI7A 4NRYB 4ZDHA 4MQ7A 3WFEL 1AO7A 1PZ5B 3HR6A 5CP7A 5IK3B 1NCCH 4XHJC 4P2YA 3QUXD 4M93C 4OI9A 1SJHA 4M48H 1XFPA 4PJGF 2DYPA 4DKFL 4BZYA 4ACPA 5D1QD 5C07D 3KXFD 4JANA 1CU4H 5B38A 4NHCL 4G42A 3ZTJG 2NX5A 2NXZD 1P9MC 4JFPB 3QXTA 4NHUB 5DURB 5E8NB 3CMOL 5EU6E 3ZHKA 1C5CH 3IDIA 3R1GL 3IDUA 4MNQD 3W9EB 4NJAH 3FO1B 3GB7A 2A73A 2DIJA 2XZCH 2XKSA 1DLHA 2V2TA 5HI4C 5IKCB 2IEPA 1SMAA 1ZAGA 1VB9A 3B5TA 2KPNA 2E8YA 3MBEC 2CO7B 1BVZA 3G9VA 4DN3L 3FTGB 4QRSB 3FN0L 4GS7C 1DN0A 5J9PB 2IAMD 3B9DA 1CF8L 3U48A 1P84K 3D18A 4EN3B 1R3IL 4Y5VB 4JZOA 2DLHA 4RISL 5GSVA 4QRQB 3MUY1 5DMIL 3L5HA 1ZGLB 3PP4L 3EDEA 5BOPA 4TSBL 4S1SL 2Q86A 4R0LC 3NCCB 4OD3L 4P49A 4QY8A 1QBLL 1MUJA 3WO3B 1CT8A 3D2UD 2FH6A 3JWDL 3S34H 2JIXA 2WINB 5ECJE 1Q9KB 4PY8J 4UILH 1N64L 3OKDB 3SDAD 5C9JB 2R0ZL 4QTIL 2EIZB 4H5SA 1J11A 2NY3B 2E7MA 2R4SL 4Y4FB 2Y25A 4R7NB 5C0DA 2HT4C 1MFEL 1OP5K 3C6SA 1AD9B 1FJ1A 3V6BR 1S7RA 3H9SD 2NXYC 3RWEA 5C2BH 5D96C 2CPCA 2BRRL 4XZUA 5HHNB 5F9JA 3MZGB 4J3UA 1A14H 4ERSL 3BP7A 2XTJE 3AU1A 4HKXB 5L88H 4L5FH 2GTWA 3C5JA 2DOCA 3AM8C 4MWFB 4LSSH 2J1KA 1JWSB 4P2QE 4PJIB 5IVOA 2Z4QB 3TP4A 4D8PB 3HKFA 3L3HA 4UAOB 5BV7C 1EJOH 1U3ZA 1KPUA 3MLXH 2O61A 1QKZH 1OPGH 4XGZA 4HUWB 5D1ZA 4Q9CA 4RSVA 4Y5YB 4PJ5B 3O11B 5K33A 1S3KH 3RZCB 3AAZA 1X4ZA 1ORQB 4UV4H 5DYOB 2FSEA 5JPNA 4ONHB 1ADQL 1ADQA 4D0DA 1LEGB 2E9BA 4BA8A 2HLFD 3L9RB 3QIUB 4EEEA 4P46D 2UZXB 3OL2A 4H1LH 4HIXH 3T0EB 4K94H 5ID0B 4ZNEE 2W65A 3BVNB 4A6YL 4GMTL 4O58H 1HCVA 4KZDL 5E5UB 3NCYS 1DLFL 3VDAA 1T7XA 5DD0H 3R0NA 3PWNA 4RQQA 2XT1B 5K9JH 3U4EB 2XFXB 3LKNB 4Z0XA 1JNLL 4PP2A 2ZZUT 2LV4A 3G5XA 1YPZB 4JREB 4P2CG 3K2UL 4G7VH 1A7BA 5KSBF 4N0UA 4XBEH 3DIFA 1OGTB 4Y19A 1A6UH 1PG7H 1UWXH 1A9EA 3CD4A 4H25A 3P30H 3STLB 2YZ1A 4RWHA 2VITB 1PEWA 4I77H 1P84J 3U36B 4GG8B 3DMMC 3BAEH 1GIGH 4UT6L 5DJ0B 4YX2H 5I66A 1YEEH 2R56L 4I18B 1N3NA 3NCJH 1A2YB 1NUFA 1OP3K 4IDJH 5L7XL 3HAEB 1CXIA 2V5SA 4KTEH 2EDKA 1UB6B 2VISB 4U1LA 1DANT 2JE8A 1IGCH 1PSKL 1F3DH 4P4RA 3FB7B 5I1GL 4C55A 3LDBC 2VN4A 4WVRA 3RKPA 3O3EB 3VXMD 1Q72L 2J8UF 4YE4L 3F58L 5C3LD 2D4DA 1JPSH 1YN7A 5ENWB 5D2NE 1MLCA 4FQ1L 4QXUH 2JKXA 4JKPH 5HI3D 5IF0A 4GKSA 4JO3H 2EC9U 3MJ7B 2Y07H 5ESAA 1FHGA 4ZO6A 1A7QL 1XGQB 3QUZC 5CEZL 2B5IC 3HI1A 5FGBC 2KZ1B 1K4CB 4JM4L 1VGKB 1NGQH 3DGGB 5IW1B 4YDVB 4Z7QF 1A1OA 1EEYB 3N85H 3PIQB 4PTUB 3EAKA 3OTTA 3VFPA 4IMKA 1NPUA 5J12B 5IB2B 4Y4HC 2H8PB 2FX7H 5EZIL 3IRPX 1VSCA 3LH2H 1C7SA 2KZWA 2Q8BH 4NZDA 1NEZG 1JHKH 5E94A 1JNNH 4JO4L 4ZD3L 4I3RL 3T09A 5BOZG 5C6PB 4NC0B 4UNVA 1ZHBA 3KPQB 5AAWA 2MCG1 2EKSB 1RZKC 5KVFL 3DXAA 3PGCA 2PXYB 5ITFB 3BKYL 1W72H 1IKNC 2XZQH 1ZXQA 3V7AE 5CGYC 1NDMB 1RFDL 4MQXD 5ISZB 1J8HE 3OF6D 1UJ3A 1OD9A 2YWYA 4R97C 4DUXA 4OQTA 4LHJB 5HGBB 1R5IB 3D3VD 4FTVE 4ENED 3FQXA 3WL9A 2Y6SD 4OGYL 4PREA 4Z8FL 5ANMA 2C7UB 4LLMA 5IBLD 2O5YH 5HVHB 3MV7D 3T0XA 3EO0B 1JGDA 5TPWH 3WS6C 5ILTH 5F7MC 2MOVA 4NN6C 1ZA6A 3RWCA 5IEHA 4HK3N 35C8H 1YMMD 1AH1A 3QHZL 4PPTA 5HPOA 3GMNA 2HP4A 3BUYA 1NAML 2R2EA 5CMAA 1NAMA 2XNAA 3LN9A 5DUBA 4GXVH 4S2SB 3CC5A 2VKWA 3RVXD 3FJTA 5ALCH 1HHJA 2VLKB 3QNZB 4JFYA 3FB8B 1WICA 4OGAD 3QI9C 3WN5A 2I5YH 2NY6D 1NCWH 3HI5H 4EI5B 5F93C 3QJFB 1JGUL 1YQVH 3IFLH 1RUML 4YDJA 2VC2L 4PJAE 5JMRA 4K8RH 4NKIH 2O93L 1NEUA 4HUUA 4IRJA 3GMOA 1LO4L 2MHAB 3DVNA 4OZHB 3ES6A 4OJFH 3O3DA 2MCPL 1FVDB 4QLRA 2KKQA 4R96B 4BSVB 3LY6A 3QEQA 3QQ9D 2AK1H 2BOBB 3HC4L 3ARZA 5KS9A 5GJTL 3ARDA 3VFRB 5ID1A 4U2YA 4HZAA 4LSQL 3ULVL 4HBCL 4MCYA 3BPCB 1M6OB 5D6DA 4X7TB 4PYGA 2PYEE 5D70H 1F4XL 1QBBA 15C8H 2R0WL 5GJSH 1FC2D 4Q0XH 3PHQB 3OR7B 4GAYA 3X14B 5EZLB 4XXDA 1MRCH 1F6LL 3BRFA 3LRGA 1MCEA 3OV6A 3H9YA 2FEDD 3DSFL 3QFJE 4NOFA 1OTSD 4B7IA 3GIVB 4PGDB 3HZMB 4NFBA 5TQ0L 5HVGB 1QFOA 2WBJB 5IB3A 3TA3B 3HZKA 4LSVL 3L3IB 3L3GA 2HG5A 3W0WE 4FZ8L 1WWWX 2P42B 4KJYB 4IOFC 2DDQL 2B0SH 5DQJA 1D9KD 1BIIB 5J6GA 5EBWB 4ORGA 2H1PL 4EDXB 4LDOB 4Z95L 4XCFL 2D03H 5E00B 4C54A 4LOUD 2ZCKH 4JM2C 3VRJA 4PJ8A 3QDMB 3IGAB 2CLVA 5FOBA 3C5ZD 5D7KE 1E28B 1M05B 1KLGA 2ADJA 5DD1L 1J88A 1FE8H 3PGDA 4WI9A 5E03A 3QUXB 4OM1L 4DFHA 2OZ4L 5MHSE 5TE7H 2OZ4A 4PRHA 4KRMB 3MLYH 4LSPL 2DBLH 4WWKD 4JFFE 4QYOB 3MJ8B 2R0LL 2X4SA 3HE6D 4QHLA 5DMKB 2BERA 2Q8AL 4RIRA 5J11B 1AKJB 1MIEH 5L2KE 3VGAB 5DMYA 4LRIA 3JWNC 1JRHI 3HUJE 3MA7B 2F8XC 4PJIF 2NXZB 3HPLA 3UZEA 5I73C 4Q9BA 5D4QA 1DBAH 1IM9B 1W0VB 2Q3ZA 3MRRA 3G6DH 3KPPB 4TVPH 2GK0A 4MNQB 4NZUL 3KHQA 4Z5RB 1IQWH 1I1FA 3ARFC 2R8SL 1AGFB 4PGEB 4DZ8A 4Q97A 3UYRL 3V95A 4MB3A 4WV1B 5EBGA 1JIBA 5EA0L 1CWVA 2JCCE 5IW6A 4F8TA 3TYFB 5J13C 4M5ZL 2IAMB 3HZVA 4GW1A 3UO1L 3MGTB 1P53A 2DD8L 2ZPKH 5TE6H 4IS6A 3BW9A 3CFJB 4Z7VB 1R0AL 3EO1A 4PRIE 2APTA 2ICWJ 4GRWB 4XC3H 4NO5B 2ZUXA 3OB0H 3WSQH 4WUUE 4MSWA 1NCAL 1M7DA 4DJMA 4LKCA 3D2UB 3Q1SH 1JYNA 2HT3D 3UTPE 1MI5D 3BKJL 1YPZF 1JN6B 3ECBB 4FZEH 5ICZB 1MVFA 3KJ6L 4HF5H 4HKBA 3WFCL 1U93B 2VUOA 4TPRL 4JG0L 1IGIH 1KELH 1NCUA 3FAWA 4GXUN 5F1IA 4Y89A 1S5IH 4ONGH 3SDYH 4W70A 5FYLL 3IFOA 3MRLB 5CWSB 3BZEB 5FEBA 3H9SB 3KPTA 4P2OB 4U31A 5JZ7D 5AYUH 5FKPA 5C0BE 3I3BA 3QDJE 3DO7B 4UB0L 3DOSA 2HLAB 5FYKD 5HGDA 5DWUL 2ZCHL 1KIPB 4ZTPH 2I24N 4MNGB 1AY1L 4ZAKD 5AEAA 3MLTB 3IB4A 5SWQA 2W38A 3WLBB 5GGVH 1KCRL 4XI5C 3SN6N 1NBYA 5KG9B 2B1HH 3S88H 3B6SA 3LQAH 3QUYA 1DN2A 2AJUH 5T5FH 3BMWA 1C5BL 3ZTNH 5F3BB 1UKQA 1XF3A 1V7NL 5HVFB 4LLYA 3QB7C 4KMTH 5F7NC 4U7MA 2NZIA 3LKOB 1YYLH 4G80B 5HJ3A 5T33H 2Q7YB 2VXSL 1ROWA 4XRCB 2XWBA 5MP6L 3VE0B 3FT4A 1VACA 2N7AA 3OKEA 4KDTA 3U7YL 3PNWB 3J8F7 1MHHA 3FT3A 2PN5A 4KGJA 4LARL 4ZXBD 4NQDA 1FC1A 1I1CA 1S9VA 3HR5A 3PABB 4N0YL 5IMKA 4AK1A 2C4XA 1D5BA 3WEXB 5T5NG 1B88A 3F12B 3QNXA 4OCWL 4X80H 3DRTB 2Y9RT 2IBZX 4JFQA 2CKBH 3BISA 3ULUD 1UXSA 5DFTA 2H3NA 3KJ4C 3K74B 2CDFA 4KKLC 5LGHH 1OLLA 3KYKL 2OS7A 2G60H 1A6ZB 1QVOA 3D9AL 4JFDA 4NN5C 1KOAA 4N68A 3D0LB 3RWJB 5AWNH 1NC2A 3TH4T 3RNQB 2RJMA 1JHLL 5DO2D 1JF5A 3P4OB 4UZGA 5IOPB 5HYJA 4NSKA 3IETB 5DDHA 4M7JL 3GHEH 3M8OL 1MWAL 1SY6H 2FX9H 4RMVA 5HDQL 4L4JA 3QUMB 4NKQB 3EYUH 3ZSTA 1T1ZB 4IRSC 1MCRA 5D7LE 4LEOB 1U8OA 2ICWI 5E2WL 4OI8A 3QG6B 3RUGB 5EO9A 5D72H 1IKFL 2EH7H 1RK0B 2EDJA 3NBNA 3C09C 4NQEE 4TUJA 5L8KB 1QLRA 2P24A 4OSUL 3SE8L 4PYHA 3INUL 3SKJL 2GITB 3VGFA 2UZYB 5DC4B 3QQ4A 3K8KA 3PDOA 3UZVB 2ICCA 4Q9QL 3GSUB 3SKNB 1NCCL 3STZB 4RFOH 3ARVA 4J7RA 2C1PA 1R3KA 1I7UB 4OCRH 4QRPD 4M48L 2G2RA 1MF2H 3TBTA 4XPAH 4I3GA 4ZFZA 1A3LH 1ZSDA 1X7QB 4Q6YA 1FPTH 1HDMB 3VDCA 1S9YA 1BJ1J 1WUNT 1MFDH 1NEZB 2XQYG 3ALXA 1CU4L 1KCUH 1CD0A 3JWOC 1MCPH 3Q6FA 2X1QA 5IMOB 3BN9C 3BZ4A 1BBJB 1C5CL 2OX5A 3OKOA 4N0FB 4BSWA 4MLSA 3OR6A 4NJAL 5C9KA 4WU5A 3FFCA 5HY9B 1JF1A 4YGVA 1JPFA 2XZCL 4OZHF 4M00A 3THMH 1I9JH 4IJ3C 4YQXH 4JCMA 4L8SB 1WSST 4HKJA 4M6OH 3ILQD 3U30B 4MXVF 4S1RH 5KVDH 1AE6H 3TO4B 4NKMB 1RJLB 2VXVL 2GHWB 1NSNH 4BKLA 3U4AA 5GZOD 2PYED 4OZ4A 3ZDZE 3O2WL 5TDPA 3QCVH 3T3ME 4YDIH 1IEHA 3O6KH 4OZGA 5IB4A 3X13B 2DKSA 3D3VB 2XY2A 3ZE1E 4CU8A 1ND0A 1GZPA 5DS8B 5F72S 4MCZA 5TDOA 4H88H 4N8VA 4N90E 3QFJD 3S34L 4GXUM 4MS8D 2JJVA 5ACLA 4UILL 3MV7B 4U6TA 3QDGE 1KTDA 4HJJH 2FJFA 3CCHB 2IPUK 1YMMB 2NLJB 2KH2B 1MRDH 2BVPA 1AXIB 3LIZH 2M2DA 4GRWH 3B9KC 3OJVC 5C2BL 4ZQKA 4X6BA 2W0FA 3IKCA 1CGWA 1YY9C 4POZD 3VD5A 4Q58C 1VFBA 3L3JB 2WBKA 4NO2A 1UWEL 3KYNA 4L5FL 5L88L 4LSSL 3VFGH 2NY6B 1MLBB 4WGWB 1CS6A 3TPUB 1EJOL 3MLXL 3DHJA 1OPGL 2DQUH 1BAFL 1DUZB 3O8XB 1QSVA 3JWDC 5LGJA 3HN3A 1BVKB 1QRNA 2J8UA 2X7LB 4QTHA 3IU3B 1BFSA 1S3KL 1CICA 1AI1H 1NJ9A 4UV4L 2EDFA 2OSLB 1MJ8H 1A6TB 3BEWB 1NGWB 3VFMA 5L2KD 2EIDA 4HMDA 4OZFG 3W5MA 1FSKB 3T65A 5KSAD 4EI6B 2FYYA 3FMGH 4Y5XA 3TCLB 2FWOA 4P5TD 4DZBB 3HC3H 4HIXL 4UINH 1KN4H 2XIDA 4K94L 4MDJA 5KVMC 4O58L 4U3XA 2AK4A 3ZYIA 1AC6A 2ED9A 1ACYH 2GT9B 2YS4A 2EYRA 1T4KA 4MVBC 1AQDB 1RZ8B 5F7YC 1U3HB 3D25A 1WBYA 3WHXA 2Y72A 4DGVL 5CEXA 3MC0A 3VFOA 5E8PA 4G7VL 3JV6A 3UTTA 1EK3A 5MEPA 1E4JA 5D1ZC 4G9FD 4XBEL 4PRID 3NH7H 3S37H 5JW3L 1PG7L 1OAUH 4WUUD 3SDDC 3P30L 3WV0A 2CIKA 2ZUSA 4PRPE 3RGHA 3PQYD 4Z7VF 2AXJA 2HJKA 1QSZA 1A6PA 1HKFA 1NGXB 1MCQA 4GRWF 3S3SA 4ZS6C 1D9KB 2ARJA 1U8JB 2EYSB 3CVHH 3BAEL 4QHUA 1GIGL 3FHQA 4YX2L 5HHOD 1YEEL 4PJ9A 3NCJL 4IDJL 3KVQA 4FQXD 4KTEL 2KQMA 1I8IA 3QCUH 3VFUA 5J3HD 3OJ2C 3RVWD 3HHRB 3ZKMC 2FO4A 2Q76B 3C5ZB 5C0BD 3QDJD 1JBJA 1T22A 5C08A 5DRNA 1YQ2A 4LNVA 3RVTD 2V7NB 1MH5B 3HPJA 1JZ4A 2BSTA 1JPSL 2YHGA 3IDGB 4WWKB 1UEMA 4X9GA 4C58B 4JKPL 3HE6B 4OF8A 2Y07L 5GGSY 3MXWH 3PHSA 5C7XH 3I6GB 5DJCA 3I02B 4O2FA 3CH1A 3B5GA 1T0MA 3AS1A 2D9CA 1NGQL 1ZVSA 2Z35A 5E8EB 1JZ2A 4R4ND 3UTSA 3CU1A 5MEQB 4NQVA 4PUBH 4M03A 2FX7L 3LKQB 2BNRD 3MV8B 5BXFB 3O3UN 3LH2L 4NRYA 2Q8BL 4P4KD 3E0GA 3MLUH 1JHKL 1PZ5A 1U36A 5IMLB 1JNNL 4UDUB 5IK3A 4E41E 5FCSH 1FL6A 5MENE 4U0QB 2D7PA 2DS4A 3U79A 3MUZ1 2VXQH 4QKXB 1ZLWK 4XVJH 1ZLUH 1MJUH 4G6JH 1W72L 1L0QA 3KNBB 1FO0H 4MJIE 3NTCL 3I6KB 1BPVA 1BD2D 4OM0H 3T77B 2RFXB 1PJ9A 1MI5B 3O6FB 2CLZB 1BVLB 4NHUA 5D5MB 5E8NA 3QNYA 2HTLD 3SKOB 4LIQE 2XXMB 4OLXH 3GSNB 3W9EA 4J3SA 1M7IB 3FO1A 5EU4A 4M8VA 1UADC 2DI8A 2V9RA 4IMKC 1DQJB 3V0WH 5IKCA 3K7UA 1Z3GH 2O5YL 1TFHA 3SOBH 3NFNB 3V8CA 5TPWL 4P0DA 5ILTL 2F5BH 2YZ8A 2ICEB 5J9PA 35C8L 3DETC 4PJHB 3IDYB 3FT2B 2R23B 1V3JA 3R0MA 4HKZA 1L9NA 4Y5VA 4WEMB 5ESVB 4M7KH 3EGSB 3MNZB 4QRQA 2EKJA 1ZGLA 4GXVL 1CGSH 4JZNB 3RUGF 4D0BB 3S35H 1T7YA 4GG6A 3DURB 2I5YL 2WIMA 4YHMH 1Q9KA 1YQVL 3IFLL 5E2VL 1FFNB 5C9JA 3DECA 4K8RL 2EE2A 1FFOB 4NKIL 4Y4FA 4RZCB 4R7NA 5L2JB 1QFHA 4NYLA 3MFFB 1AD9A 5DK3A 1LILA 4P5KB 3RIAF 5C0NC 4YFLI 3IFNH 4ZXBB 4JZJA 5HHNA 4IEFB 2AK1L 5E2UH 4Y2OA 4HKXA 4M6NH 1JGVH 4MWFA 3IF1B 5FO9B 4PJIA 1WAAE 1OW0A 2Z4QA 1QEWB 2IPKB 5A40E 1MAML 3VXUE 3S3PA 5D70L 15C8L 3WN5C 5GJSL 1XT5A 5C71A 1KENH 4Q0XL 3F65A 4YDLC 4L4VD 5F7FA 3UPCA 5IHUH 4Y5YA 4PJ5A 4BFGA 1IVLA 4YBQC 3LZFH 5DYOA 1MFAH 4K7PH 1FG2B 4ONHA 2E6PA 1X5IA 4KY1H 2FX8H 2X09A 1K85A 3CSPA 1TTUA 3L9RA 1PFCA 1WFOA 1J1XH 3B9VA 1KGCE 3T0EA 5ID0A 4L4TE 2RR3A 2PTTB 4U3HA 3KPRD 2DWDB 4QRTA 3ARDC 4P3DB 4N90D 4ODSH 1ORSB 5DHYA 2Z91B 2Z31B 1N59B 1OD7A 3U4EA 2EDWA 3PGFH 3LKNA 4KV5F 4OT1H 3ULVC 2FHFA 1IGFH 1DSFH 1AO7E 3PWUB 4ZFGH 3G6AA 5D6DC 1U6AH 4BQ9A 1YPZA 1S9WA 2ZCKL 4N0RA 1KFAL 4Z7WB 4P59H 1ES0B 2AQ3A 1C12B 4MB5A 5B39G 5T1MB 3BPOB 1NGPH 2J8HA 1OGTA 1F8TH 2VKXA 1TDQA 3STLA 3EDFA 4W4OA 3QWOB 3ROOB 3N9GH 3ZKNC 3RL1B 2J88H 2VITA 5TE7L 1AFVH 4KK9C 3MLYL 2DBLL 2NX5E 3ZZ1A 3U36A 4GG8A 1RY7B 4Z6AT 1HXMB 4OGZA 2UWEB 1MIEL 1G7JB 4I18A 1NGYB 2RIKA 2DJUA 4GH7B 4HULB 3P0VH 1UB6A 1OGAD 1DBAL 4TVPL 2VISA 3G6DL 4X99A 1UM5H 2VR5A 5EUKB 3FB7A 3ARGD 4NQXB 1IQWL 1LQSR 3AY4A 3O3EA 3NZHH 1IGMH 4HLZG 3MMEA 2DMBA 3SGEI 3RA7H 4HEME 3PWVB 3OKKA 3T8XB 3MR9B 3ARUA 2ZPKL 5TE6L 1XGQA 2X89D 2LAGB 5BZWB 5GISH 1DBBH 3QIWD 4XC3L 3TFKC 1VGKA 1G0DA 3WSQL 3DGGA 5IW1A 4YDVA 1OTUD 2A2QT 1EEYA 3TWCH 4Y8DC 3EOBB 3O41B 3PIQA 4PTUA 1LVEA 4LRIC 1AHWC 1CFBA 3VFTB 4LLUB 1A3QA 2DTMH 1NH6A 2H8PA 3Q1SL 5CUSH 1VCAA 3LN5B 4FZEL 2RAMA 4HF5L 1IGIL 1KELL 5F71A 3CIQA 3CMGA 2F53D 4XNMB 1S7TB 1S5IL 4ONGL 1VEOA 4YUEL 3SDYL 1IM3B 2VNCA 1FORH 2EKSA 2D7NA 4O51A 1ZK9A 4M9OA 3U9UB 1NGZB 4X9FA 4UIMB 4RGNB 4UOW0 3EYQD 4Y4KB 2XA8L 4LU5L 1NDMA 4O5LH 5ISZA 1CVRA 2ZUUA 5E4EB 4ZTPL 5HGHA 3QJHB 2P48B 3LHPH 5GRZA 2JB6B 4HXAH 1RHHB 4MA1C 5HGBA 1R5IA 5GGVL 1RAMA 2XXCB 3TLRA 2B1HL 3S88L 4RGMB 5GS0D 3LQAL 2AJUL 4OZFB 1G9MH 2OBGA 2C7UA 5T5FL 4F9LA 4HUXB 1M71A 3ZTNL 4Q6IB 3ZT7A 4KMTL 3EO0A 2BRQA 2OI9C 1YYLL 2W91A 5DJ2B 5T33L 3N1FC 4UTBH 5FYKH 2YD6A 3I3EA 5KSAB 2B2XH 4IOSD 2EDBA 3P4NB 2Z93B 1R3JA 3CX5K 4P5TB 5D93B 4BK5A 1UCBH 2CR6A 4S2SA 4LCYB 4OUOA 4N0UE 1YEDB 2Q87A 3UAJC 3LKRB 1N0LA 4QRRD 3SDCC 3QJFA 4X80L 4Y19E 1U8LA 1PEZA 4E41D 4AQ1B 4F7PA 2CKBL 5F1NB 3ZDYE 4NO0D 1Y18B 3EYVB 3QUYC 4KDWA 3FQTB 4G9FB 3BH8A 4XMKH 5LGHL 2MHAA 5JW4N 2G60L 4OF5A 3NCFB 1V05A 5AWNL 3PQYB 5JO5B 1FVDA 2ERJC 4X0KB 4BSVA 3L95B 4PJDB 2NY7H 4KDTC 2BOBA 5F8QC 4PD4J 2NY4C 4HLJA 3IT8D 3GHEL 2CR3A 1JI1A 1WLHA 1SY6L 2FX9L 2IH3A 3EYFB 5HHOB 1SY6A 4WFGE 2BSSB 2FBOJ 3GMRB 3BPCA 3ULUH 1I1AD 4FQXB 5D5MF 2VR4A 1M6OA 4LCWE 5FGRA 2AEQH 4X7TA 4LLQB 4IBLT 5D72L 3NCYP 1JV5A 3H3BC 2EH7L 4WTZG 5DJDA 3PHQA 2FZ3A 3K4DA 2I9TB 1R5WB 3OR7A 3CFDB 1WQVT 4F15C 3DI2B 3X14A 2VDQH 3TV3H 5EZLA 4RAUB 3GSQB 4U1HB 4PJHF 3GIVA 3AXLB 4PGDA 3DNKA 3UXFA 1EZVX 1IC4L 2QSCH 2WBJA 5IEKB 3L3IA 4RFOL 4BUHA 2X1PA 5ADPL 4Z7NE 4OCRL 3RVVC 4KJYA 1MF2L 4OUUB 5C8JB 1I1YB 4XPAL 3REVB 1A3LL 1KCSH 4PRAB 1UFUA 4EDXA 5HBBA 2HH0H 5BJTA 5I1LB 2FJHB 1KCUL 3FZUC 5HYSA 4U05A 5IBTH 3S3JA 2BNRB 3QDMA 3IGAA 4HMCA 1EEUA 3DXAE 3BKCH 1E28A 1M05A 3B8SA 4WFFD 3VXPB 5DJAB 2X42A 3C9NB 3MA9H 4TTDD 5SX4H 3GUTA 3QUXA 4ZOBA 3THML 2VABB 4CMHC 5T5NF 4PJFB 2AS5M 1CD8A 4YQXL 4L29B 5DUPH 2NY1C 4M6OL 1EO7A 3CX5J 4QYOA 1GL4B 3E8UH 1MVUB 1AE6L 3MJ8A 5KVDL 4LHQB 4P5MB 4TVSa 4B53A 4M43H 5DMKA 3B43A 1NSNL 5C07A 1AKJA 3G6JB 2Y5TB 1BD2B 5ERWA 1LD9B 4YDIL 5ANME 5HHVH 1IM9A 1FCCA 2VQ1A 1U95B 3KPPA 4MNQA 2V9QA 4YHYC 1NMCC 3IJYB 3CVIH 4Z5RA 3BO8B 2QEJA 5HYFA 3V5DA 4J3TA 5INCB 4GBXD 1AGFA 4PGEA 4H88L 5I8KH 5B4MD 3KHOA 3V0AC 4WV1A 3VMPA 4HJJL 2Z8SA 2ZUVA 4AJ0A 2IAMA 3IVKB 4GUPB 1MRDL 3TBYA 1P2CB 1PY9A 3EJYC 5IFHH 5A16B 3LIZL 2X10A 4LPWA 4Z7VA 2P49B 3CFJA 1Q9LA 4NO5A 4EXPX 4DKDC 3LEXB 4N8PA 4DGIH 4J3XA 2Z0BA 4KRPB 5K93A 1E4XI 5E7FA 1BZ9B 4LCUB 3WKNA 1OAQH 3D2UA 3N1PC 2HTKD 4HIHB 1IRAY 1CL7H 4FRWA 1WBXB 3VWJD 4PRNA 2ESVB 1JN6A 3ECBA 4OLZH 2PNDA 1KCVH 5ICZA 3RIAK 4NKOA 3SDAA 3KPSD 3B2UD 2DQDH 4J8RA 4HC1H 3NCMA 2I9LA 4U6YB 4G8GD 1S7XB 2DQUL 1H3PH 3QEQE 5SX5K 4TULL 3MRLA 1U2HA 5CWSA 5E2TH 3BZEA 2VLLB 1E27A 1OTTC 5IVXB 3H9SA 3KPLB 4P2OA 1AI1L 5AUMB 1MJ8L 3SPVB 3DO7A 5D2LF 3IDMA 3VXNB 4G8IB 3ULVE 5DVLA 4O2CB 4OLEA 2HLAA 4S0SD 2YD9A 4KK5C 3TO2B 1KIPA 2D4FA 4YK4C 2UWEF 3FMGL 4LMQE 4MNGA 1IAKB 1S78C 3CFKB 1Y0LB 4EBQH 3HC3L 3I75B 3MLTA 4UINL 1KN4L 3WLBA 1WIOA 4IOIB 1UEYA 2BVQB 4UT7H 5F70A 4JLRB 5ITBH 1ACYL 3STBA 5CKAA 4L4VB 5E9DD 3WLWC 4TQEH 5F3BA 3SKMB 4YZFF 4NCDA 1Q1JH 4TNWF 4G6MH 2Q7YA 4MAYC 2X2YA 5JR1H 4XRCA 1UA6L 1IAIM 3VE0A 5I75C 5I18H 3H3PL 3NH7L 3S37L 3QA3B 1QSED 1CICC 1OAUL 3PNWA 4BM7A 1G7QB 2BJMH 4X5LA 1ZMYA 1YUHB 3DV4B 1EEQA 3PABA 1H0DB 1IZJA 4RRPG 2AQ2A 3CVHL 4OZIB 4Y5XC 3WEXA 3F12A 5B39B 4K94C 3DRTA 4JVPA 2ITDB 2BOCB 3QCUL 2VE6B 1JZ8A 4M4PA 4Z9KB 3RWFB 1A5FL 4CDGC 3JUZA 3U4BH 4R3SB 3D0LA 4YNYB 4WW1B 4ODXA 4KJWC 5IOPA 3QULA 3VXRD 3IETA 4NOBA 1UB5B 4F2MB 1GC1H 3L6FB 3TGXA 2QHLA 5JHLH 3QXWA 3QUMA 4HX1A 4B5EA 3MXWL 5C7XL 5E6ID 1S5HA 1CXKA 3GMMB 1OGAB 3QG6A 3S96A 1TMCB 1RK0A 3K4ZA 4R6UA 1BGXL 5LCVH 3ARGB 4KK6D 4UNTA 5DVMA 3JTSB 1BJMA 3NA4A 2HFTA 2HKHH 2UYLA 2GITA 3VFWB 1FLRH 2XOTA 1NQBA 4N5ED 5FF6B 1FNEB 4PP1C 5EULV 2HJLB 3GSUA 4L3EB 4F9PA 2GKIA 2VXQL 4DW2H 1I7UA 2M1KA 3O6ML 4XVJL 3RNKB 4ZUUB 3RY4A 1MJUL 4G6JL 4MA7H 4Y16C 1U8QB 1Z0NA 5LVEA 1MCBA 1X7QA 1FO0L 1HDMA 3QEGH 2FJGB 1NEZA 3ROLB 1MCFA 1ZT4B 3N1GC 1VFUA 4K7FA 5IMOA 5FYLE 3VWKB 4O4YH 3OWEA 3BOVA 3ETBF 3U82B 3ARTA 5EC2B 4MLIA 3MV11 1DVFB 3CLFH 2F53B 1X3DA 3NIDF 3V0WL 1Z3GL 4XCNB 3HMWH 1EBPA 4KVNH 3SOBL 4L8SA 1X44A 1JMXA 4PJDF 1MCNA 2AJYH 2F5BL 4NKMA 1ZHNA 1RJLA 4LCWD 1IC1A 3FKUS 4UBDD 4I3SH 3IJHA 4NQCB 5CS7A 3FQUB 3OF6A 3DYOA 4G6KH 3K1DA 1RJYB 2VDOL 1CGSL 4HUVB 3D3VA 3S35L 1HHKB 3N0PB 2AJXH 5JOPD 3BSZH 5DK2A 1HSAB 4MJ6B 2BX5A 3NABH 4KI5D 4YHML 1QP1A 3MCLH 3MV7A 1HXYB 4MD4B 5E95B 4XHQA 4K07A 4HIEB 1B3JA 1JZ7A 1YMMA 3PDDA 4J4PD 2AJZB 4K9EH 1NKRA 4PJGE 4NQDE 1KACB 2OK0H 5CZXD 2DL9A 5EIIB 3IFNL 3LQZB 1XGRB 3P9LB 1CZ8H 1EEZB 5E2UL 3D85B 5JTWA 2DM3A 2VZVA 4LLVB 4M6NL 3BGFB 3C5SA 1JGVL 4Y5VC 1X5LA 1LHZA 2E27H 4QRRB 1Y6NR 4TSAH 3QWQB 5JIPA 4D9RE 2QSQA 2XZAH 3DSNA 4NWUH 3QDHA 1KENL 5HYJE 5IHUL 1BVKA 2X7LA 3IU3A 4TOYH 3Q6GH 3LZFL 4PJFF 1MFAL 4K7PL 4ZFOB 2OSLA 1A6TA 1NGWA 4K8RC 2D7QA 4RAHA 2FX8L 5I1JH 2KUTA 3ULSA 5L9DH 4GLRI 3TT1L 3P0YH 3NIGE 4P23D 3G6JF 4PG9B 1KCLA 2VJXA 3TCLA 5HVWA 4DZBA 1J1XL 4X4XB 3SY0B 4JZJC 2QHRL 4DEPB 2YA2A 3V9FA 1QFPA 3TBSA 2GT9A 3GBMH 3S8WA 2BNUB 4ZSOB 3PGFL 3MV9B 1RZ8A 4KJQC 1OW0C 1IGFL 4P2RD 1DSFL 4ZFGL 3EFDH 1CE6A 2X4PB 2J2ZA 1U6AL 1CGTA 1HYRC 2F54B 2ZUWA 3W39A 5I8CB 1X5GA 2HRPH 3JBG7 4P59L 1WF5A 1NGPL 3BP6B 1KF9B 3QH3A 1F8TL 4IIQB 3T4YB 2YPLD 4FXGB 1XR8B 5GHWH 3N9GL 2J88L 1NGXA 1AFVL 1Z5LB 3OGOE 3O4LD 1ZT1B 4IRJD 1D9KA 1EAJA 1U8JA 2EYSA 4I9WD 4LPUA 1JPGB 3T0EC 2D9QB 1W0WA 3FFCE 4J23A 2X1OA 5EO1A 4LVEA 2CSPA 1CFQA 1KC5H 2BZDA 4WDIB 4V1DD 1U3JA 5E1AB 1UM5L 5H94B 3L3DB 3C5ZA 2Q76A 3C8KB 3MSPA 1DEEB 4Y2DD 3PF2A 5IVXF 1QO3B 4JFHE 1MH5A 2JJSC 1IGML 3NZHL 3RFZC 4U3CA 3RA7L 4WWKA 5GGQH 4R26H 3CH8A 4W4OC 3P77B 1BQHG 4YIQB 8FABB 5DD3H 3HE6A 2AVGA 4CVXB 4PS4H 5J0BA 3I6GA 1IGTB 5TE4L 4IMLB 2FEEL 3J7HA 5GISL 1DBBL 2K3TA 3C08H 4EXKA 3L5XH 3TWCL 5HD8D 4I18C 5E8EA 2VLJD 3N1MC 2DTML 5MEQA 4UI2A 5ICYA 5CUSL 2UUDK 3Q48A 3LKQA 1HH9B 4YPGB 3MV8A 5BXFA 3EYSH 1F11B 4N9GA 4M7LL 1XF5B 2D0HA 3I2CL 1FZJA 3MJ9H 4ZNEA 4S1QH 4UDUA 4MXQD 3CLEH 3MRKB 1T3FB 2A6IB 1ZA3B 4LRNH 1FORL 4S0TD 3GSRB 4R8WH 4OQ1A 4DGYH 2MPAH 3VGEA 4DKEH 3V4PL 5I1DA 1FIGH 3UBXG 3KNBA 4PJ7B 4OZIF 5BZDB 4O5LL 3EZJB 1IAII 3I6KA 4RAVB 3T77A 2RFXA 3O6FA 1MI5A 2CLZA 3LHPL 1BVLA 5TFSH 5D5MA 3VWJB 5JHDD 4GKNB 4HXAL 3VI3F 4Z78A 1QRNE 2J8UE 2J6EH 2K7QA 3KPSB 5HYEA 3BIKA 4P3CH 1YZZA 2AJ3B 4XCEB 1CCZA 1FL3B 4FQPA 4G8GB 5J12C 1DQJA 1R5VB 3MXVH 2V6HA 4NCC2 4AYFA 5KSUB 4PJEB 1BLNA 4ZUSB 3NFNA 4X6CF 1P7KB 4UTBL 5CJQL 5FYKL 2ICEA 2X44D 4HGKC 4PJHA 3H6JA 1Q0XH 5D7IA 2AK4E 5DSCB 2B2XL 4ZNCD 4NNYB 1M1SA 4Z7QE 3FT2A 1MNUH 4H0HB 2NXYD 4ZAKA 4FG6D 3MNZA 4YEEA 1UCBL 4K2UH 1CYGA 4JZNA 5I71C 4D0BA 3UTQB 5GS0H 1EV2E 5HDLA 2ICES 1OAZH 3UTTE 3RX7A 3ARWA 1UYWH 5E9DB 3BHBB 4K3DH 3ZL4H 5C86A 3T0WA 1AR2A 4KUCD 1FFNA 3RTQD 5IB5B 1FFOA 5F7EH 3LQAC 4RZCA 2LE9A 4F9LC 3EFFA 4XMKL 5CZKA 1I4FB 5L2JA 3CPLB 1QSEB 3MFFA 2FECI 1FNGB 5HVHC 4P5KA 3ET9F 4GOSA 3S7GA 3OG6B 1I9RH 3VXSD 4ZXBA 4RMWA 4KJPC 2H9GB 1RURH 4YO0B 1NUNB 3IF1A 5GS2D 4PBVC 5A2KH 4KKBC 1QEWA 2IPKA 3ULUL 3CDGA 5C08E 2HYMA 3OAUH 4JHZA 5H2BB 2AEQL 1OB1B 2DQCH 1VDGA 1X5KA 3ARSA 5EOCJ 1TTFA 3MYZA 1IC7H 2WP3T 3OZ9L 1S7SA 3QAZC 3E6HB 4GO6B 3AUVA 4N0CD 4F7CA 4WWID 5IESH 2GJZB 2VDQL 3TV3L 1F2XK 1VGEH 3D0VB 4PBWD 3TZVD 5GS1A 1FG2A 2QKIB 1DQMH 2DI7A 3WXVH 1FFPB 3VXRB 3CXHK 2A6JA 4DQOL 3U0WH 2QSCL 5HYQB 4E5XB 5KTEL 2PTTA 1RZ7H 2DWDA 1QPXA 4Z77B 2R9HC 3UTSE 1KJ3H 4P3DA 2F8OA 1ORSA 4ZPVB 2Z91A 1YDPA 3OAYH 1KCSL 1TETH 3L7EB 3TNNB 4JHBA 4I2XB 2HH0L 3PWUA 1QA9B 3DX6B 1GOGA 1QYGH 1KG0B 2IF7A 5DGRA 4I5BB 5IBTL 4Z7WA 4PRDB 1ES0A 3NA9H 5LAXB 5T1MA 2FGWH 3BKCL 2ZG2A 5C0RH 4Z76B 3MA9L 2XKUA 3ROOA 4LVNB 4XMPL 4QOKD 4PR5B 4QRPA 1FGNH 4YHZH 4KQ3H 1WZLA 2NQCA 4UT9H 5DUPL 4L9LB 2WBJC 4Q2ZB 3E8UL 1YC7A 1O7SA 4M43L 5E8DH 2R4RH 1HXMA 1IAOB 1J9CT 3EKCA 4U1IB 1G7JA 1QFWM 1NGYA 3W5NA 5DC9B 3SGKA 2DIAA 5F1OB 1MFCH 4C83B 2VRAA 3TBWB 5HHVL 2HWZH 4YFDB 2VLRD 1HE7A 4MXWH 1H3TA 4WO4D 3CVIL 5EUKA 1T04B 2X4TB 1Q94B 2BVTA 4NQXA 3AVEA 2KL6A 3FFDB 1RIVH 3U9PH 5CIPB 1WCQA 1NMAL 3QXVA 3C2SA 5I8KL 5I17B 2A9NH 2QQLL 4NRXB 3MRGB 3QUXC 4K71B 1AC0A 4ALAH 1RK1B 3MR9A 4XP9L 5IFHL 2PYEA 2WM0A 4PIRF 4I8DA 5DK0B 2C5DC 1XGPA 4GG6E 2AEWA 4HWZA 1ZVHA 5D1QC 5J11C 3O41A 4TTGA 5D2NB 3VGAC 1NFKA 3VFTA 4LLUA 2NXZC 1OAQL 3RKDC 1CL7L 5JXAH 3LN5A 4LFHD 2BVUA 4OLZL 6FABH 5IHLB 3LD8B 5HI5D 5JW5B 2P43B 4AIOA 3G08B 4RBPK 2DQDL 4XNMA 4HC1L 1S7TA 4HC1A 2QLVB 4G8FB 5E2TL 2HT2D 1IM3A 4WV1C 3CXHJ 3GJFK 3C60D 2C3VB 1AGDB 5HGAB 5I16B 4OFIA 2IAMC 4ODTL 2K9UA 4PJIE 4UIMA 5A3IC 5GRVL 4LSTH 1UVQB 1G7LA 5FB8B 1NMBH 4OBSA 4FQIH 3GSOB 2YD4A 1NFIB 4TRPH 3QJHA 4PJBB 4EBQL 2X4NB 2JB6A 5F3HB 4EZMA 1RHHA 1BFOB 4PJ5E 1NL0H 5GGUB 4UT7L 2DQFB 5ITBL 4XCYB 4TUOB 4OZFA 1JWUB 2ARWA 5SX4I 3TPKA 3BDXA 3M1BB 1TZGH 1EAPA 4HUXA 4R4BB 4X7DC 4TQEL 4Q6IA 1EFXB 3ALWA 2EXWD 3NIFF 3SDAC 1Q1JL 3IU4H 2GY5A 4U2ZA 4G6ML 5L2KA 3IAGC 2BNQD 4YXLH 3T0EE 5JR1L 5KVEH 4RNRB 1FN4B 1P4BH 1BOYA 2AKRB 1ZGLP 5I18L 3SE4A 5KSAA 4POYA 4P23B 3AMLA 3OSKA 3P4NA 2Z93A 3ARBD 4UTAH 5J57B 4MD5A 4P5TA 1II4E 5C3TA 3KPOB 1OWRM 2BJML 3EZ8A 3MRDB 5EZJB 3V52H 1QNZH 2E7LA 5GZND 1YPZE 4RX4D 1FAKT 2ENSA 2DQIH 5ESQB 4KU1A 2BDNH 1GPOH 4CW1B 4P2RB 4KKNA 3U46B 1OAKH 3WUWG 4KVCL 1JK8B 4JVWA 1Y18A 2GW5A 3EYVA 4POUB 5DJYB 3FQTA 3CAFA 4G9FA 4PRIA 3BZFB 3VD7A 2L4OA 1N5YH 5C1MB 1T6WA 4WUUA 4ISVB 3U4BL 4HFUH 5KZCD 3MRNB 5JLZB 2H2SD 3PQYA 5JO5A 2GAZA 2A9MH 3F7QA 4X0KA 1OY3B 3O4LB 5K9KB 2LTQB 2HLFC 4MQTB 4LKXB 4PJ7F 1GC1L 3PHOA 1JNHA 4F3FB 4P46C 4Z18A 3EYFA 5HHOA 3HMXH 3QP3A 4OIBA 2BSSA 3GMRA 4YBHA 4FQXA 5F1SA 2SEBB 2HKFH 3KWWB 3DJ9A 4YLQT 3MNWB 3V5HB 1DBMH 4XC1H 1WTGT 4V1DB 1FIEA 4XNZB 2I9TA 2G75B 2WLZA 4Y2DB 1R5WA 4PJEF 1BQHB 3B3IA 4DAGL 4P3WA 3CFDA 4ODHL 1KJMA 1BJ8A 2HKHL 5C09D 1FNFA 1HSBB 5EU3A 2QQQA 2AV7B 1YEKH 1FLRL 2YSSA 3MTRA 4U1HA 5C92A 1S8DB 3AXLA 3RWDB 1OSPH 5IEKA 4DVBA 4U4BA 4FQCH 2EIBA 3P9WB 4G43B 1D7FA 3O81A 1A6AA 4DW2L 5DQ9B 1ZLSH 2Y1VA 2RCSH 3WFDH 1RIHH 4OUUA 5C8JA 1I1YA 4MA7L 3HS0B 3REVA 2QBWA 1VADB 1RUKH 4PRAA 3P40A 2UY6A 2EDDA 5F21B 3QEGL 4NUJB 1FV1B 2VLJB 4AY0A 4CN4A 3F7YB 2FJHA 3JVGA 4JQIH 3SCMD 3NGBC 2BNRA 2R1WB 3RIFK 1JF6A 5DLMH 2HVJB 3CLFL 4LSUL 3VXPA 5DJAA 3TH2T 3C9NA 3UBXB 2PTVA 3ARFD 1INDH 3VD9A 1B90A 3GIZH 5T1DH 5GGVY 2VABA 3HMWL 3EO9H 5E08H 4PJFA 5ISZE 3CFBB 5L0QB 4QT5B 2C1OB 4XCCH 4C4KT 5HI3C 1F3JB 2AJYL 1MVUA 4P5MA 2OM5A 4F9PC 5BW7A 1CGUA 1WZKA 3G6JA 4I3SL 1UXWB 5C0GB 2Y5TA 1BD2A 4MNHB 3U6RB 4G6KL 1G7PA 1LD9A 5JHDB 4OBRA 1U95A 4QXWA 3HA0A 3IJYA 5FK9B 4LF3A 3BO8A 2X40A 1JWMB 3IS1X 2AJXL 1ZTXH 3BSZL 4OLVH 1R3LA 5BVJB 3IXAA 3ARQA 1IGJB 3NABL 3A0OA 2PCPA 3MCLL 2ZOKB 1PYWA 1NCDH 1P6AB 5C0FB 1IL1A 1S7UA 3VXQB 3IVKA 1P2CA 4K9EL 4R2GD 2OK0L 4I4WA 4L8SC 3T0DA 3BFOA 2NXYB 2VLKE 2CRIA 4RDQG 1DQQA 1S7QB 2F74A 2WBWB 2CIIB 5D96B 3LEXA 1IBGH 1KN2H 3GSXB 4OV6F 4MQXC 8CGTA 3CXDH 3RPIB 4LCUA 2A1WL 4KHTH 1R24B 2WMPA 1I85C 3MO1B 4HIHA 5AAMA 1WBXA 1GHFH 2EH8L 4KK8D 3OXRB 2B39A 1OP5H 4ENEC 4TSAL 5BV7B 3RTQB 2Y6SC 1Z9LA 4UQ3A 2XZAL 4NWUL 4U6YA 5TH2B 2W07A 5IBLC 4AMKH 4MXVE 3W11D 3VXTB 2VLLA 5DURD 5IVXA 4TOYL 3RRQA 3Q6GL 4G9DB 2PO6D 5CJBA 3SPVA 2ICWB 3VXNA 4MX7A 4C56B 4O2CA 5I1JL 5CINH 4PBXA 3UPAA 5L9DL 4HS8H 5F7WC 3P0YL 1J0HA 1KB5B 3HFMH 1IAKA 4UU9A 3CFKA 1Y0LA 3I75A 4X6DA 4U33A 4J3WA 4HZLB 1KJ2H 4B7LA 5IVZA 4IOIA 5F6IC 4PJCB 3BGMB 2BVQA 4WI2A 3RVXC 4JLRA 4U1JB 3GBML 4OGAC 1A9BB 4L8BB 1IGYB 2NY6C 4MHHG 3GMLB 4L4VA 4EN3D 5L8JB 3SKMA 3EFDL 4YWGL 2EICA 4KROD 1K5NA 1QFWI 5IQ9B 2IH1A 4FA8A 2IJ0C 2HRPL 2BXYA 3QA3A 1DP0A 5ACZB 5GHWL 2DRUA 1G7QA 3QQ9C 3DV4A 3KPRA 1O7VA 1FSKC 2NY3D 4HCRH 4Y4FD 1SEBB 1OSZB 4OZIA 3DMMB 3TIEB 4DN4L 1N4XL 2I60H 4JN2A 5IMMB 3QDME 5B39A 3BE1H 5KN5B 5HHPB 4KI5F 2BOCA 3MOQA 1P4LA 3LSOB 3WDIA 3RU8H 1KC5L 4G6FB 3RWFA 4CVWA 1RMFH 1HH6B 1KBGH 4JY6A 3TT3H 2YPVH 4JY5L 3V6ZB 2D0FA 4R3SA 5FDYA 1JRHH 3BP5B 1PD6A 4QOKB 4WW1A 1CDIA 2H32B 3BESR 4XP1H 4OCYH 5BS0D 2FEDC 2NTFB 3WS3A 1OTSC 1OP3H 5GGQL 4R26L 4NC1C 2YRPA 4F2MA 1T66D 1XGTB 5DD3L 5HSFA 4MNQE 2PUQT 3MYJB 3RZCD 3AROA 4PS4L 4PJBF 5ABDE 1BX2B 4U6HB 2X9YA 2GYSA 2W60A 1D9KC 4HWNA 3GMMA 1OGAA 2VLRB 3C08L 2YMXH 4WO4B 3QIUD 3KYAA 3L5XL 3ARGA 3EHBD 4LHUG 4LOUC 3H9HA 2HFFB 2FR4B 3EYSL 3C5ZC 4Z7VE 2AXFB 5E56A 4GRWE 5FF6A 1FNEA 4M7ZC 4OCSL 4S1QL 2HJLA 3MJ9A 3CLEL 3DV6B 2XG4A 5CEYB 2X89A 3S36H 2DQEH 5CHNB 4WWKC 4YHNA 3RNKA 4R8WL 4OV5B 4DGYL 5GPRA 2MPAL 4NWTL 2KQNA 4DKEL 1U8QA 2HFGH 1FIGL 2A74A 3ROLA 4K3JH 2IC2A 3QEUB 2DLEA 1GVIA 3VRIB 5CGMA 5TFSL 1TXKA 1CFSB 1BF8A 3H9SE 2J6EL 1NUGA 2F53A 4GSDH 4P3CL 3MXVL 4PG2A 2VR9A 4XCNA 3VG0H 3CDYA 3DARA 3GMPA 5H35B 2P4AB 2BSED 3C60B 32C2B 1WFUA 4MNGE 5TF1H 4NN6B 5DJ8B 2MKWA 3HB3D 1Q0XL 3I6LD 1JUFB 1LDSA 2X9XA 3BWUC 3A67H 3FQUA 1MNUL 3ZT6A 1Q0YH 5F7DB 4HJ0D 2OJEB 4YHOL 4NJ9H 3KLAA 4M8QB 1A4JB 1RJYA 1MELA 3B4NA 2V2XB 1TVHB 4K2UL 4HUVA 4HT1L 3SEPA 4C4KO 4HAFA 1MCLA 2PYFB 1K3IA 5JUEH 2HT3C 1OAZL 4I48B 3QI9B 1UYWL 4MJ6A 3PXHA 5D7JD 4K3DL 1T1WA 4BFIB 1WC7B 4BH7A 4MD4A 4EKXA 4ODWA 5F7EL 2JJWA 5EN2A 5AG8A 1G9MC 2AJZA 4BH8B 1F4HA 5IUSA 1X4XA 3CSGA 5JZ7C 3KLSA 5EIIA 1BZ7B 5KSBB 1I9RL 3LOWA 3LQZA 1XGRA 2ADFH 3P9LA 3UYOD 3WUWB 4P9MH 3OKMB 2QSVA 3IDYC 1ZHKA 2DLIA 2DQTL 1E4WH 4LLVA 2EE3A 2XA3A 4ZAKC 2DL2A 3EBAA 2PXYD 4QRRA 4XNUH 4BZ2H 1PX3A 5CJOH 3TBVB 1BQLH 4FP8H 4E41A 5JXED 2VIRB 3OAUL 4NO0A 2CJUH 5HGGS 2DQCL 1SJEB 1VERA 2Q7NA 3UJJH 1IC7L 1NBZB 5EU5B 1T2XA 5KJRH 3MLZH 3QEHB 3VFVA 2ADGB 1U8PB 1WK0A 5KZCB 1IEBB 5IESL 3FN3A 4ZFOA 1VGEL 4DTGH 1DQML 3WXVL 4XAWH 1K4DB 5ETUB 3VI4F 2PETA 4LIQL 3WHE0 1KB5H 2GJ6B 5GS2H 1U8IA 1FZMB 4WTZA 3V6FB 4ZODA 4ZXBC 3A6OA 3SY0A 4TYUA 3HCVB 4JFOB 3K2MC 1RZ7L 1KJ3L 3WMSA 2ZKHH 1TETL 3ALPA 2BNUA 4ZSOA 4BZ1H 2P1YA 5JNYB 3GSWB 2X4PA 1WFTA 3ULUC 5DHVB 1QYGL 4JM2B 5C09B 5I8CA 2GTZB 1IAMA 2VLKD 3NA9L 4WENB 2FGWL 3BP6A 4C57C 1WBZB 5GSRB 5C0RL 2UZIH 4EI5D 4FXGA 4PGBB 1XR8A 1F97A 5GS1C 5DO2C 1OQXA 3ILPA 3QQ3B 1F3RB 1ZT1A 4UT9L 5DR5H 1KTLA 2Q3AA 1CG9A 1MQKH 4AEHH 2Z92A 4CADA 5GIRA 1CBVH 3IFPB 3NACH 5E8DL 1JPGA 2R4RL 4QGTA 3QSKB 4YHKH 5FYKU 1PY4A 1VESA 3LPGA 4XMLH 2YD8A 1RJZB 5I73B 1Y6KR 1MFCL 1SQ2N 4G8EA 3U83A 4TNVF 3FQNA 4KUCF 4NT6B 1I3VA 3PV6B 4PLOB 4MXWL 5E1AA 3C8KA 2WQ8A 1FRGH 1RIVL 5C0CD 5I8EA 1KSRA 3VGHA 3ARFB 3BPNB 3U9PL 1N5AB 2B8OT 1DQTA 3QIBD 2H32H 3PWPD 3U7WH 4ZTOH 5DC0A 1ZV5A 2A9NL 3KPMA 3BT2H 3BPOC 1JZ6A 3P77A 1AP2B 4YIQA 1U8HB 1J7VR 1GGIH 2IG2H 8FABA 5SWZD 2EZ0D 4CVXA 4UIKH 3FB6B 3D3VE 3MCG1 2WWKT 3IAQA 1HHHA 4IMLA 1T1YB 4KV5E 3A6CH 1AGEA 4PJCF 5HPMA 1YECH 1N6VA 4JPWH 1KPRB 3MV7E 3TA3D 2FH8A 2CLRB 3SGKC 4GBXA 3DPBA 1WCBB 4OCXH 1YMME 5CEZD 4F37F 1O0VA 1RV6X 5JXAL 5ALBH 1F11A 6FABL 4ZOCA 1MCSA 1S9XB 4ZOAA 1G0YR 3LN4B 3MRKA 3DUSB 1T3FA 5C0JB 3RVUD 1B6UA 1N6QH 4XNQB 5CLTA 1J5OH 3GSRA 3ILQC 1KNOA 5GGSB 4LSTL 4HAGA 5BZDA 4FQIL 4K7PY 5GZOC 2WK2A 2VAJA 3FO9B 2W0KA 4RAVA 3QQNA 2NZ9D 4TRPL 1CDBA 2BC4B 3VWJA 5DI8B 5MENB 4GKNA 1WZMA 3L3OA 3TN0D 1NL0L 3KPSA 1YEFH 1GOFA 2QL1A 3K3QA 3O2VH 4XCEA 3TJHD 1AKJD 4G8GA 1ZVYA 3V2AR 3UTOA 2X70A 2VZ3A 3DTXB 4PJEA 1TZGL 4MS8C 2RHEA 3NCEB 1TCRB 3X3GH 1IM9D 4MJIB 1P7QD 4WIQA 2OTPA 4ZUSA 4M1DH 2PO6B 4IHOB 4F7MA 5KVEL 1P4BL 25C8H 4KTDH 5CP3H 3O9WC 1BJ1H 3LPFA 4ZUVB 3SJVD 4NNYA 4UTAL 1AR1D 4AZ8A 1CIUA 1J0ZA 4POZC 3T1FB 3V52L 1QNZL 2LU4A 1D5ZB 2XN9D 1BOGB 1WIPA 1QSFD 2DQIL 5FO7B 2BFVH 2IGFL 3G04B 2BDNL 3QPQD 1FBIH 1GPOL 3BHBA 5E9DA 3ZE0F 1OAKL 4KROB 4NC1E 5B21A 1N0XH 2GJJA 2JJUA 1HHIB 3KJ4B 1D6EB 1C08B 2A83B 3HC0A 2JJTA 4G5ZH 4X8JB 1N5YL 1CDJA 1QSEA 4QF1B 1FNGA 2BY0A 4HFUL 2XRAH 1MFNA 1Z9SA 2EXYD 1J86A 3F7RA 5EO0A 3SE4C 1EZVY 1F58H 1PBYA 2H9GA 5KSAC 4YO0A 4HK0B 4IRZH 1U8MB 4JO1L 1LP9A 2O5XH 4P5TC 4JFXB 1V3LA 4P2OD 3HMXL 2OQJB 5D9SA 3QXAB 4KRLB 3HMXA 3TCXA 2BY2A 1OVZA 4W4NA 2NY5H 2AXGA 2HKFL 2E7LC 5H2BA 1OB1A 1U92A 1DBML 4XC1L 1RULH 5I76B 1VA9A 5J6HB 3E6HA 4PV8B 2GJZA 4D2NA 3CUPB 1RZJH 5F9OH 3D0VA 4UDTA 5FYJU 5BS0B 3L5JA 5JQHC 1FFPA 1YEKL 3VXRA 2E9JA 2YC1A 3HNVH 4LK4A 1OSPL 4CNIB 3VXUB 3ZDXE 1KJVB 4FQCL 5HYQA 4E5XA 3PWLA 4NNXB 1IT9H 4NBZB 3PWJA 5E6IA 3BEVA 1ZLSL 5I19H 4LHUB 5EH1A 5SV3A 4Z77A 2RCSL 3WFDL 1RIHL 5T1LD 3MLWH 3UC0H 3LPWA 1GC1C 1JCKA 3OGCB 2X4QA 1RUKL 1ZS8B 3MV8E 3L7EA 2ZUYA 1G6RH 2MQ0A 3TNNA 4I2XA 2DB8A 1EIBA 3HG1D 4FQXC 5DHVH 3W2DL 5FHAH 5J3HC 3RVWC 4JQIL 1KG0A 4I5BA 2VXUH 3UTZB 2WUCH 4PRDA 1OAYH 4F7TB 5LAXA 2EDTA 5DLML 5AG9A 1HZHL 2FNBA 3OXSA 3Q3GB 3D48R 2CUMA 4WHTB 1CK0H 3RVTC 2ADIB 1INDL 1FZKB 4TSCH 3ZE1F 3GIZL 5T1DL 4IJ3B 3EO9L 5E08L 3VJ6B 4FFWD 1MHPH 4L9DA 3GGWA 3QXUA 1AO7B 3V4UL 5HTSA 5A43C 4XCCL 1MI5E 3H42H 3PJSB 5D5ME 2KDGA 1PDKA 4NBXB 1DE4B 3FQWA 1CDGA 1IAOA 5CD3B 4WFED 4HJGB 1TPXC 5FM5M 3ZE2F 5GRJH 1YNLL 2C4FT 4NFDA 1Z9MA 4C83A 5A1AA 3TBWA 1F00I 4XNXH 4RFNB 4QHMA 4CN1A 1T04A 2X4TA 1Q94A 5J1AB 4WJ5B 3VGBA 3FFDA 1ZTXL 3EOTH 4OLVL 4G42B 4OLUH 5CIPA 4PJHE 1BM3L 2YXMA 5FYKE 3X3FH 1DR9A 5D7IE 1T7VA 1OARH 2O26U 3QG7L 4P4KC 3GB7B 5T3XD 1Q9OB 4NRXA 1NCDL 1T0NB 5I1AB 3MRGA 4LCWA 5E5RB 3FOLB 4NZJA 4ETYA 2N1KA 1RK1A 3I9GH 1NLDL 3T0BA 1FYTD 4PY8I 3B9KB 5DK0A 4L8CB 1WWBX 3ZYJA 2FD6L 4WHYG 1IBGL 1KN2L 5BW7C 3CXDL 1SBBA 4BK4A 1PVHA 1LNUB 5D7JB 1TNNA 2HTLC 5LBSH 3B5HA 2WWKO 5TGBB 5JA8B 2FB4L 1GHFL 3B2VL 4GT7A 1D3CA 4JM2F 1JZ5A 1T83A 2GSIB 3LQMA 5JW5A 3BH9B 1DL7H 2FL5B 1I3UA 2A6DB 3QZWG 4J4PA 2W0PA 4HQQH 4G8FA 4AMKL 5FGCE 1A1NB 4JHAH 3H2WA 2OLDA 4ELKB 2C3VA 4ZMAT 3O2DH 4H0GA 5ICXB 4H5SB 5I16A 2VXTH 4PJXB 5FB8A 1A6VH 1UVQA 4WI8A 4FXLA 4K9EC 3GSOA 5CINL 3ULUE 4HS8L 1S7RB 4GW5A 5B8CA 3HFML 4PJBA 4XPTL 4XZUB 2X4NA 1JI2A 5F3HA 1F6AA 4M61B 5CSBA 1BFOA 1Q38A 3TO4D 1KJ2L 5GGUA 1U9KA 1KJ2A 3BP7B 2BVYA 4XCYA 4AEIH 3C5JB 5BQ7B 4TUOA 5IJVA 3QFDB 1JWUA 1RQ5A 4OQTL 5GRVK 1E6JL 1WISA 4R4BA 3SDCD 1QD0A 2NNAB 4FQJH 5F89B 1KPUB 2EE6A 3MNVB 4E42A 4HEPG 2DLTA 4NN7B 5CBAA 2AGJH 4RNRA 1FN4A 3OKNB 2R29H 4P23A 3SDDB 2I26N 3CFEB 3QDAA 4WEBH 3KPOA 5ADOL 5JPNB 3MRDA 2J12B 2AEPH 3K46A 4CJ0A 2XQBH 1JTTA 2YD2A 3MRIA 4ZUTB 3QO1B 2FHBA 4HCRA 4JPIB 3MGAA 1JYXA 4Z7WE 5ESQA 2Y36L 5GGRY 5I9QB 2QR0A 3BE1L 4P2RA 4CW1A 2W65B 4ZPTB 3NAAH 3U46A 4A6YB 5IB1B 4OFVA 4YFLF 1JK8A 4AL8L 5LJYH 3PWNB 3RU8L 4RDQF 3TF7C 4QRPE 5DEFB 1MIML 1DDHB 3V8OA 1RMFL 4F58L 3BZFA 3SGJC 3UDWA 4PP2B 3TT3L 2YPVL 4ISVA 2YPLA 1VEPA 4P99A 3G5XB 4BELD 1JRHL 3VW3H 1FNLA 4N0UB 1TQBB 4XP1L 3O4LA 4OCYL 2B1AH 2DLFH 5K9KA 5TJWK 4TNVK 4JFED 3O8XD 1HN1A 4MMXC 5GRWA 4FS0A 3L3KB 5FXCH 2G5BA 5T1KD 2SEBA 4QGYA 3SGEH 4APQD 4X7EC 3KWWA 3OJDB 1S7WB 3MNWA 4DCQB 3V5HA 3Q2CA 4YZFE 1PG7X 2YMXL 2MQCA 4V1DA 1ZT7A 4Z7UB 3ME0A 1YNKH 5DEGB 1KTRL 1N3NB 2CXGA 2G75A 5C0CB 4Y2DA 3WDJA 1U8KA 1BQHA 1M4KA 3QIBB 3FZUD 3PWPB 2AABH 5J1SC 3SKUD 1HSBA 4MB4A 2GY7B 3G5ZA 5KOMC 1AJ7H 3RI5F 5LG1A 3RWDA 1U3HD 4X9IA 2EDNA 5SWZB 3NPSC 5GGTH 1PLGH 3MRHB 3RY5A 1JNJA 1YN7B 5DQ9A 3S36L 1MLCB 2DMKA 3S97C 2DQEL 4F37K 1L6ZA 4QXTB 3BWAB 2HRLA 4YPJA 1OAXH 5FYJE 1TCMA 1VADA 2HFGL 1EBAA 2YUZA 4ONOA 5ESAB 1K6QH 5FDWB 1FV1A 2VLJA 1OLZA 1C8PA 2YK1H 4JO2H 4G3YH 4WU7A 1J8KA 3ARGC 1ZLWH 5L6YH 5IR1B 2FLBT 2HVJA 4FQ2H 4GSDL 3VFPB 3UBXA 1K2DB 4GQPH 2IQAB 3VG0L 2LAAA 3CFBA 3RGVC 1I7RB 2C1OA 5TF1L 3RY6A 1J0YA 1U58B 2DJ4A 2VDLL 3EW3B 3UYPA 1UXWA 5AYQA 2ZJSH 3A67L 4MNHA 3PGCB 3U6RA 1Q0YL 3QIWC 5LXGH 5I0ZA 3EJZD 5JHDA 4NJ9L 4OCNC 1OTUC 2J5LB 3MUHL 3TN0B 4YEFA 4ZG1A 5FK9A 2N56A 2D7TH 4HWEL 1U41A 5GRYA 1JWMA 1TQCC 3HAEH 5JUEL 4Y1AD 1BQSA 3F7VB 3OAZK 5BO1L 5BVJA 3MREB 5CJXC 1P7QB 2ZOKA 1BWMA 3DROB 1XF1A 1FP5A 3GDBA 5JPMB 1SYSB 4ETQA 3VXQA 5CCKH 4PG2C 4HSQA 3MRCB 3SJVB 3AC0A 3MJ6A 5CAYB 2NR6D 5T3ZD 5CBEB 3MV8D 1CDCA 5AZ2H 1S7QA 5EBLA 4GKZB 2CIIA 1ZA6B 3RWCB 1OL0A 2ADFL 4U1NB 3EYQC 3MACH 1HYSD 1A3RH 1UH3A 3GHBH 3GSXA 2XN9B 4P9ML 2G9HA 5FUOH 5EG6C 3RPIA 3TM6A 2DBJA 1QSFB 1E4WL 1R24A 2WV3A 4YR6B 3MO1A 4G9FE 1B4JH 2XV6B 5B3JE 2XNAB 4M1CD 1NC4D 4XNUL 3PP4H 5CJOL 3NIDE 1BQLL 4FP8L 3CC5B 2MQ3A 4HV8B 3IJSA 4OD3H 5DVKA 3RTQA 3PQYE 2CJUL 5GS0C 1HHJB 3SO5A 3C2AH 5TH2A 3UJJL 5DMJB 4YDLB 3MRQB 3KYMB 3MLZL 1EERB 3O6FD 2NCMA 4N5UA 5DFVD 3VXTA 1N64H 1I7TA 4I0PD 2WSKA 4XWOD 4G9DA 1MPAH 3VXSA 5HHOE 4X7CC 1NBQA 2ICWA 4DTGL 1TJGH 3GMOB 4M02A 1T2QH 4LEXH 1A7RH 1INEL 1KB5A 3SQOH 2ZSWB 5I1HH 3LV3B 1X6LA 1WGOA 4ZFFB 4HZLA 5KS9B 4PJCA 3ARDB 1I9IH 4ERSH 1BHGA 1QBMH 3UBXI 2ZKHL 1UM4H 4U1JA 4WUKL 1DBKL 1IGYA 3GJEB 4MCYB 3GMLA 4KKCD 4BZ1L 4OF6A 1HWHB 1L7TH 4JKLA 1QR1B 4RMQA 4PLJD 2R69H 1QBAA 3WD5H 1MFBH 2ATPB 3TZVA 5IQ9A 2X1WL 5KOVC 1K3ZA 5K59E 4H1LG 1XF2B 3WKMH 1KLUA 4X5WB 3CK0H 5ACZA 2WWMD 3D87B 4GRLC 5T1LB 1SEBA 5DR5L 1OSZA 4JRXD 1ZLVK 3HZKB 1V3MA 2BNRE 5IMMA 5CGTA 3S4SG 1KIUA 1CBVL 2GCYA 4YHKL 5KN5A 1I1AC 3HG1B 5IJKA 5HHPA 5JDSB 5DQJB 4PJGA 5J6GB 3LSOA 4FQQB 4ORGB 1FL5A 4JG1H 4PJFE 1HH6A 5I15H 1FRGL 5DJZB 1J1PL 3V6ZA 3QCTH 4JGMA 2XWTA 4PFEA 3G5YA 3QWRD 3WNOA 3BP5A 3VRJB 4QOKA 2LVCA 3U7WL 2H32A 3GRWH 3G6JE 3TJEH 4JQXA 2CLVB 4ZTOL 1BD2E 2NTFA 3BT2L 4PJXF 5A2JH 1XGTA 4HH9B 5DRZB 2IG2L 3PGDB 2HN7B 1WITA 3RJQB 3MYJA 4LPYA 4HWBH 4UIKL 4PRHB 1BX2A 4U6HA 3FO2B 3A6CL 5IG7B 5FGBA 2VLRA 3MODH 2VN7A 4UT6H 2O5ZH 2X4SB 4WO4A 1YECL 4Z0BH 4JPWL 4RIRB 4XB8A 2B7DT 1AHWB 2IBBA 2M26A 3HPLB 2HFFA 1T21B 5D71H 2CMRH 5JIIA 2GK0B 1T2JA 3D39D 2XYCA 5ALBL 3WIFB 2Z31D 2AXFA 4QNPF 1E4XH 1F2QA 4MZ2A 4I0KA 4P9HH 4TTDC 4DZ8B 4QHNB 3DV6A 2YRZA 1B4RA 1X5YA 1FYTB 1J5OL 5CHNA 4ONFH 4OV5A 1MJJB 4XAKD 1PZUB 5E99H 1IKNA 1MAKA 3HZVB 1YY8A 4IS6B 3H9ZA 5CEZH 3GM0A 3QZWB 2Z8VC 1JZ3A 1GGCH 3QEUA 2UVEA 4JM4H 3VRIA 1ITCA 2YWZA 1CFSA 4MA1B 1YMHB 1M7DB 2DM4A 4ODVH 5IVXE 4ZYKB 2JELH 1YEFL 2ZOLB 4LKCB 2H6PB 3O2VL 1PQZB 4GBXC 1G9NH 5B4MC 4AIXA 4KAQH 3LS4H 1CI5A 4LCCB 4HKBB 1SVZA 5H35A 3RDTD 3C60A 32C2A 1KPVB 3O6LH 4M1DL 4X6DE 4EQ3A 5DJ8A 3U0PB 3IFOB 25C8L 2AERT 5CP3A 5DD5H 3ZKXC 3ZTJH 5F7DA 5FAAA 4L4VE 2V2XA 2VL5B 5EUOB 1TVHA 4ODUB 4QHKJ 2PYFA 4Z7UF 2HJFB 2HTKC 2BFVL 2C3GA 3QUKB 1B0RB 3VWJC 1FBIL 1T5XA 3SDCB 3K0WA 1GXEA 1H15B 4BFIA 1TVBA 1WC7A 3B2UC 1VEMA 3GO1H 1N0XL 3VD3A 4B41A 2BNQA 3QUYB 3L5WB 2X6MA 3KPRE 4BH8A 3CZFB 4PTTB 1XF3B 4G5ZL 1GJIA 5FYJD 3ARBA 4OZIE 2EDHA 4KXZH 4IDLA 5HJ3B 5KSBA 3H3KA 1DBJH 1XCQB 2XRAL 2ERJB 1MCWM 3BJ91 3VA2C 4CBPA 2P8LB 4K23H 5MEOA 2LABA 3WUWA 3MV01 1BEYH 1F58L 1H9VA 1BQUA 1L9MA 3E2HB 4RX4A 4IRZL 3V0VB 3VI3E 5TF0A 43CAA 1PKOA 1E0OB 3TESA 2V2WB 4KZEH 1KTKE 2C3WA 2B20A 2W9DH 3TBVA 5GS3A 5I1EH 5HHMD 3X17A 5E0QA 3K4AA 4RGND 2NY5L 4HK3J 4Y4KD 3NFPB 1A14L 1SJEA 1RULL 5BVPH 3P0GB 5F7UA 1JYVA 5EU5A 2R1XB 4X4MA 3QEHA 2ADGA 1JGUH 1TVDA 1IEBA 3ESVF 4F15B 3U0TB 4W6WB 4RFEA 1RZJL 1T20B 2CDGB 2X5PA 4QWWD 1T5WB 1QKZL 4LDEB 5ETUA 1UZ6E 2JJTC 4JFEB 4JFDB 2V5RA 3HNVL 1OGAE 2HMID 1FGVH 3LKPA 3V6FA 3T3PF 5F1KC 1XGYH 1HILA 1IT9L 2AW2A 1BWWA 2CRMA 3JV5A 3HCVA 1LO3H 4JFOA 4O2EA 5D8JH 5T1KB 4APQB 5I19L 5GJTH 5DDHB 1AIFA 3MLWL 3UC0L 2E8ZA 3JZ7A 4GAGH 1MWAB 2KBGA 1G6RL 5JNYA 3RI5K 5JIKA 1G6RA 3GSWA 5BRZD 1U8OB 5FHAL 5DHVA 4JM2A 4AIZB 5EO9B 5C09A 3VDBA 2VXUL 1G84A 5DD0L 2GTZA 2Q1EA 1ONQB 3MRFA 2CK2A 2WUCL 3GI9H 1OAYL 5K9JL 4CKVX 5IM7B 1WBZA 3DHMA 5GSRA 1HEZA 5DVNA 5IT2H 1CK0L 4FOMA 4PGBA 4TSCL 4CMHB 3V6OA 3REWB 3HE7D 2FBJH 4OB5H 3DSFH 1MHPL 3MOAH 1HIMH 1JL8A 2VSCA 4KQ4H 5MERB 3DRQB 1A6UL 3WNPA 3IFPA 4FZ8H 4KPHH 5E6IC 3L7FB 2ZP0T 5KAQG 3U1SH 2F53E 2G2RB 4JDVB 4WCYH 1RJZA 2DIBA 3R8QA 1XGUA 3SCMA 4I77L 3TIDA 3ZSSA 4NT6A 3IRZA 4XNXL 4ZFZB 4F80A 4GJTB 4YHYB 5C6WH 1S9YB 4HBQA 4DK6A 4NQUA 4KK6C 4ZO7A 3WYRA 1FNSH 3EOTL 3ARFA 3EYOB 1N5AA 4DFIA 4F8QA 1IJ9A 3X3FL 2F8VA 1N7MH 1IEAB 1EJ6A 1OARL 4N5EC 3GEWB 1F02I 1IGCL 4KHXH 5IP4A 3PP3K 4YGVB 4EDWH 1AP2A 4UOJA 1U8HA 5IFAH 5KW9H 2BP3A 4LVNC 3ARXA 3DVGB 3FB6A 1CVSC 3ARED 1MHEB 4H20H 4HKJB 1T1YA 1YN6B 2X4RB 3SGDI 1KXTB 4QXUL 4R7DB 5KS9F 3M07A 3OMZA 3WO4B 1KPRA 1WWCA 3QUMH 4JO3L 5I0DA 4JRYD 2RB8A 4Y1AB 2BHYA 5TDPB 3ULVF 1ACZA 2I27N 3P9MB 4FQHB 4OZGB 5LBSL 5IB4B 4G7YH 5T3XH 5FECA 2PTUA 2CUHA 4MJ4A 3GI8H 1A4KB 2P7TA 3N85L 3P4MB 1LK2A 4LPVA 2EDQA 4LVOB 3LN4A 2YPKB 5H37G 4HQQL 2VB5A 5C0JA 3LEVH 1DZBA 3BJLA 4L1DA 4XNQA 5EA0H 1FCGA 5JOFB 2FJFB 5GGSA 1GZQB 1EUUA 5A2FA 3O2DL 1C5DB 2VXTL 3O2DA 3QPXH 4K71C 4QRRE 5ACMA 4UBDC 4RA0C 3PL6D 4YK4B 3FO9A 4YC2C 2BC4A 4L1HA 4PGZA 4ZQKB 1NC4B 4XX1E 5DI8A 3IKCB 5SX5H 2PR4H 2XZQL 4MA8H 4CL7A 4NO2B 3KYNB 4AEIL 3MRJB 4GLRH 4MAUH 4PLKD 1UQSB 5DZNA 3DTXA 4KI5C 5BMFH 1RIUH 4JFPA 3KJ6H 1PKQB 1T83C 1TCRA 4TPRH 2IAND 5EB9A 3WFCH 4I0PB 3LD8C 4WHDA 1LWRA 4FQJL 2PO6A 4OF3A 3BD3A 4IHOA 4MAYB 1TIUA 1QZ1A 4J4PC 5IIEB 2AGJL 3C8DA 4X8XA 3K1KC 5DZLA 2PW2B 5CZXC 4XBPB 2R29L 1W2KT 4ZUVA 1CTNA 1D5XB 3DX8B 2NY2D 3HRZB 4W6XB 4WEBL 4ZSOE 3FTGA 3MV9E 4QRSA 4X5XB 2AEPL 2XQBL 5DEZA 4YFEA 5DWUH 4JVUA 2ZCHH 3DGCR 1BOGA 2FYYB 5B8CC 1CDHA 4HMEA 5I2IB 3G04A 5E70A 1N2RB 4EN3A 2BCKB 2X1XR 4F33B 4H1LB 1BREA 3VMNA 9CGTA 1KULA 4LBEB 4KRPD 1HHIA 1T4KB 4U1MB 1H3WM 3DX9B 1UJ3C 5ALCL 1C08A 1C5BH 1A0QH 3D25B 1HOCB 4X8JA 3WHXB 2QTEA 4QF1A 1NCWL 3HI5L 2WINA 5CEXB 3HI6H 2ESVD 4BQCA 5E8PB 5EZOH 3GZKA 2R15A 3S4SB 3H8NA 5SWSD 3OKDA 5DUMH 3VW3L 5MEPB 1XEDA 2EIZA 4EVNB 2B1AL 2DLFL 2P5WB 4DVRH 4JRXB 4P23C 3Q5TA 1XCTB 5IHBA 1A7OH 4JFXA 4OJFL 1QQDB 2OQJA 3QXAA 4WFFE 2PW1B 1DCLA 3S37X 5I76A 4LASH 1YNKL 1KEGH 1JWSA 5J6HA 4OD1H 2OTWB 3RHWK 2VO5A 4D8PA 3K81A 3VFUB 3CUPA 2HVKB 4RMTA 2MJWA 2FATH 5BS0A 2VUYA 4PGCB 4HUWA 3UDWC 2GSGB 4Z7OF 1AJ7L 1T22B 4CNIA 3O11A 3RZCA 1KJVA 5GGTL 1ORQA 4NNXA 3HPJB 5GGTA 4IRJC 1JMZA 1MRCL 5EUOF 4L8DB 1LEGA 4Y16B 3SE9H 3M8OH 1OAXL 1MWAH 3OGCA 3MLVH 3QIUA 1ZS8A 5FUCE 2YXFA 1K6QL 5DJCB 4XPFH 4JDTH 3JV4B 3BVNA 2YK1L 2H2PD 3LB6D 2B0SL 1IKFH 4JO2L 1ZVSB 4G3YL 3UTZA 3D39B 4XNZC 4F7TA 5L6YL 2XFXA 2L0DA 4FQ2L 4Y2DC 3Q3GA 1IAIH 4NQVB 4WHTA 4MHHI 2D03L 2ADIA 4BQ6A 1FZKA 4HUMB 3VJ6A 2V7HB 3LKSB 5F97E 2I25N 3PJSA 1X5ZA 5HYSG 1FL6B 1XMWA 4NDMB 4Q9QH 1PAMA 1DE4A 1EO5A 1FE8L 1RHFA 1ULVA 4FFYH 4KI1A 3KPSE 5CD3A 2VDNH 2YUVA 4HJGA 2ZJSL 4EUPG 4D9LH 5K9OB 4G8GE 4KKAD 5LXGL 4U6XB 1W72B 5D2LB 4PJEE 2FRGP 3KLHD 5HD8C 2D7TL 5F7KC 5DJ0A 5J1AA 4Y7MA 4WJ5A 1A2YA 3HAEA 2L7JA 3QNYB 2MSPA 4OLYH 3RKDD 1UG9A 3CDCA 3RDTB 3VXOB 3JV0A 5EU4B 1YEHH 1WZ1H 1Q9OA 2VL4A 1T0NA 4MXQC 4D9QE 2ZG3A 5I1AA 2QADD 5CCKL 2P46B 3FOLA 2VDRH 1NBVH 4PJ8C 5KSVB 5L0QC 2WQRA 3B9KA 5ENWA 4L8CA 5AZ2L 3RY6C 5E9DE 4I13B 4JAMB 5A3ID 2VXVH 3MACL 1A3RL 3GHBL 4UQ2B 5A2LH 2OYPA 4AT6B 3MJ7A 4L3ED 3Q5OA 1AXTH 5FUOL 3O2WH 4HKZB 1QLFB 1B4JL 1LNUA 4PD4K 5D7JA 5EU7C 4UUJB 3WFBH 5TGBA 1IMHC 4MMZC 3NIGF 1K4CA 1QSEE 4ZUWB 3T08A 2GSIA 3O45B 1DQDH 3BH9A 3EIFA 4FFZH 2FL5A 2A6DA 4CDHA 2P5ED 3C2AL 4GG6B 5EFIB 5IB2A 3KS0J 5T3ZH 3CSYB 1A1NA 2GFBB 2EIEA 4HW6A 4X7SH 4FN0A 1LP9E 4LVHB 3VWKD 1MPAL 4ELKA 3S35X 5ICXA 4UV7H 1DVFD 4FNLH 2AEIT 4PJXA 1TJGL 2EEBA 1EMTH 5E24E 1T2QL 4LEXL 1A7RL 4NYLB 3KPQA 4HS6B 3F5WB 2F58H 3SQOL 4FG6C 5I1HL 2PXYA 5ITFA 2UVFA 5I30H 5AYUL 4AM0B 4JZJB 2D31B 5HHMB 4M61A 4YHPB 5JXEA 1HCFX 1I9IL 1UWEH 4JHWH 1QBML 2WZPD 5BQ7A 1UM4L 2LVEA 2C9AA 4NQCD 5IFJB 3QFDA 2J7LA 3VXRE 1L7TL 2OJZH 2NNAA 3M17B 3GSNH 3RTQC 4S1DD 2R69L 5F89A 5MI0B 3WD5L 1MFBL 4GAFB 3BUTA 3MNVA 1BAFH 3O0RH 3OKNA 3KGRA 4NO3B 3B83A 3SDDA 2MWCA 3WKML 1WWAX 3CFEA 3FONB 3CK0L 1VENA 4I2XE 4XTRD 1R3HB 1C1EH 4ZUTA 3QO1A 4JPIA 4NKDB 3C6LD 4CUCA 1NCBH 3I50H 4K7PX 4R4FH 4ZPTA 2YEZB 2FHCA 4QRTB 4OZGF 4A6YA 4LSDA 5IB1A 5BRZB 3I84A 1D5MB 1NANI 5CZVH 3GK8H 5DHYB 2DF3A 3D85D 3NZ8B 5DEFA 4JG1L 1DDHA 2VLKA 3QNZA 3FB8A 5I15L 4E0RB 4OTXH 3W82A 4DGVH 3G6AB 4X6EB 4N0CC 5HDBF 3FN9A 3QCTL 4EI5A 3ABZA 1N8ZB 1S9WB 3TZVC 3VMOA 3HE7B 3GRWL 3TJEL 1KXQE 3GRWA 5JW3H 3AFLA 1K8IB 2DM2A 4OZHA 3HLAB 3IXTB 4AEEA 4G6AD 1JP5A 1OT2A 1TNMA 4HWBL 3L3KA 1OWWA 2A0LD 4H26B 4HWBA 1JFQH 4R96A 1J18A 3OJMB 1L0YA 2WLYA 3OJDA 3TEUA 1S7WA 5DMGD 4DCQA 3MODL 3UROR 2OR9H 2O5ZL 4Z0BL 3VFRA 4XVUD 1S7VB 1MOEA 4Z7UA 5DEGA 2ORBH 4ORZC 1VFMA 5IJKC 2XTLA 5C0CA 1YEJH 3EYUL 1UWGH 1Z0MA 5E8OB 2COQA 5AD0B 3QIBA 3FQRB 3PWPA 4HPYH 5D71L 1XF4B 2CMRL 5C6TH 4RGOH 4X99B 2YUWA 4M5YH 3P2TA 1E4XL 3MV9D 2AJSH 4P9HL 5IROA 5C0AD 5SWZA 4N1HB 4AQOA 3LRHA 3MRHA 1G1YA 3MMEB 2F54D 4JQXC 5JOPE 3AREB 1CN4A 5EBMB