2Z31C

Crystal structure of immune receptor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
b'IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31C02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2z31C01
2F54A 3PHOA 4O00A 4PJIA 4GMTL 5GSVA 4JN2B 1IAOA 2BHYA 4RQQA 4HIEB 3IFPA 2H3NA 1LO5B 5JMOC 5GJTL 5D7KE 4PV8A 1KT2B 3BAEL 4EDWL 2OYPA 1MI5D 4XX1E 1FLTX 4PTTB 3QA3B 4PJDA 1VCAA 4P2RB 2WBJD 3MZGB 2BJML 4X7SL 2CUIA 4PRDA 4OCWH 4GBXD 3OKMB 1MJ8H 4RISL 5E8DH 4YHYC 5B39G 1JHLH 1FNAA 4LCUB 3GNMH 2WNGA 1AGFB 2X9XA 2YPLE 2ICWJ 3P3YA 1KCUL 4PJGB 4YAQB 4QHNB 3SJVD 4APQA 3I02B 3JWOL 3ARPA 2J5LC 3IVKA 2VWEC 1VFOA 5KSAD 1SBSH 4XVSH 2HKFH 1QLFA 3UTSE 3QDME 3TVMA 2G5BB 4JAMB 4JQVA 1FP5A 2I60H 2Q6WA 2GITB 3TH4T 3C60C 1JUFA 2QL1A 4WFGE 4JFEB 2J8HA 2YXFA 4OZFB 2HN7A 3GSUA 5HDQL 4IRJD 5T3ZE 3DI2B 1N3NA 4M6NL 4QXWA 5F88A 3HZMA 2JF1A 4NKOA 1CBVH 4OZGB 3ES6A 1M7DB 1F42A 1VFBA 3O2WL 3C2AH 2QR0B 3F7YB 4U1SB 3QP3A 4XPHH 4HGMA 3QDGB 1JWSB 2ZUQC 3LDBB 2WQRA 3GI8H 2ZJSL 1GGCL 5IMKA 4X0KB 2BVOB 1UACH 4LSRL 4I8DA 3GSVA 2MCPL 2YZ1A 2F58L 1RUAL 5JNYB 5GRVK 3MGOB 2OTWA 4I48A 4U3XA 4F57H 4KTEL 3WXVL 2WWKO 1M7IA 4KH2A 1HDMA 5FDWA 4J3OC 1ZA3A 4J3TA 3RHWF 3VXRD 1UKSA 3B5TA 4LCCA 2R2EA 3L3HB 4PD4J 2XICA 4M7LT 1QRNB 2Y06L 3ELAT 5IHUL 3DUUB 1W72H 4Y16D 1UKQA 4NQEB 1MCFA 1AGDA 2V2WA 3I84A 4M5YH 4X9IA 1RFDL 1FO0L 3REWA 2RHEA 3HRZA 1WVZA 2GHWB 1T04A 4JB9L 4ZS6C 1QBML 3TBSA 1VPOL 2EDFA 3UTTA 3C6LC 3GMOB 5DF0A 3L3JB 4KY1H 4NZRL 1BJMA 4GSDH 3IKCA 1KIPA 4ZDHB 2ENYA 3BIKB 2ATKA 1A8JH 4ZFFB 3QUKA 2Q8BH 1RJCA 1A6UH 4XVJL 4L8DB 2CRIA 4R8WL 2FH8A 5C7XL 4ELMF 1SVZA 4PJ7E 1P4BH 1NUDA 3QIUA 3V2AR 1IL1A 5KSUA 3RX5A 4ZFGL 2IC2A 5F7HA 2B5IB 1T20B 1T89C 1XMWA 3T65B 2BNRA 4HC1L 3FB7A 3HNVH 3L7FA 2NXYC 4Z95H 3V0AC 2AJXL 4PJXA 1IRAY 2HMIC 5L8JB 3EYVB 1F6FB 5FO7A 2XTJC 3M07A 5FA3B 3ECBB 3UZQA 1S7WB 5L8KB 1X5LA 3O45B 4P3WA 2IALB 4LMQE 4XXCA 4PJCE 4ORZC 2EDOA 3DPBA 5CZVH 2JB5H 5TDPA 2B1HL 1KN4L 3P4NB 1NKRA 4OM1L 1RJZB 3WL9B 3QRGH 4MX7B 1QFOA 3QQ3A 1MWAB 1VESA 2OSLB 3B9KC 3HE6B 3G08B 2F53B 1U3ZA 1ZLSL 5DZNA 3UJJH 5E08L 1MCKA 5MEPA 3VXUE 2C7UA 3CZFA 3ULVL 4U7SA 2ITCB 2MOVA 4JFXB 4FQIH 2DOCA 3ARBA 3QWRD 3V5DA 3NH7H 1N64L 4UINL 3SGJC 3VGBA 1FO0A 2VDRL 1DBKL 4U1NB 4OZHF 5C09B 3VFNB 5BV7B 3CX2A 4M5ZH 2NZ9D 4G6ML 4NQCA 2GUOB 3G6AB 3WFBH 4XNYH 3D18B 3H9SA 1JNHA 4X9BA 1EZVY 1QO3A 3VJ6B 3F58H 3NCEB 1N6UA 2V7HA 4R4BA 3CK0H 3HR5A 4ONFL 4OLVL 5C0BB 2BMKB 3KPMB 1I3VA 3TO2B 5EORL 2G75A 4FFZH 4MYWB 4HS3A 1H8OA 2R23B 4PGCB 1CGTA 2YUWA 1OL0A 5MENB 5T1KB 3H0TA 5IG7A 1WIPA 5JW4N 2X41A 1C1EH 4HLZH 3C5JB 4HC1A 5E03A 4D0BA 3P0YH 4Y1AA 4NPYB 3IB4A 4Y5XB 4ZNCD 3PV6A 5D6CA 2DQEH 3DETC 4LSQH 4YDJB 1HK6A 1A7OH 2Y07L 4FQXB 4IS6B 1IC5L 3ZL4H 4V1DA 1LILA 1P7QD 5A16B 4X6CF 2VIRB 1JGVL 3DX7A 4LHUD 1SJEA 4N0RA 2F8XC 1MCOH 1BREA 1XIWA 2X4UB 1SEQL 1MJJB 1T1XA 4E5XB 1AGCB 3EOBB 1G1CA 3RIAF 1DCLA 1QFWL 4WUUA 3QIBA 4H0HB 4JGUA 3MRRB 1YNLH 3T2PA 1F11B 2RR3A 1PYWA 3MLUL 4HT1L 1A14H 1TMCB 2WIIA 2NY1C 5FGRA 5LWYH 4NNPL 4JEGB 4F3FB 4PJ9A 2C3VB 1ONQA 3PQYB 4HWBL 4YEEA 2ZG1A 3OXRB 5D1XD 3QDJE 3WFDH 3TNMB 1OGTA 1HE7A 5HHXH 1S7XA 1KNOA 2Q76B 3D3VA 4LBEB 4GH7B 2H8PB 5IVOA 4R7NA 1GAFL 5CEZH 2BY3A 4AH2A 2QV2A 3P30H 1UGNA 1VGEH 4HKJA 2GTWB 2DBLL 3PF2A 1A9EB 4RMUA 1UXSB 4QNPF 3X17A 3KPSA 5HPMA 1G9NC 4DTGL 2Q87A 2ZOLB 3EHBC 2H26B 4NUGH 1H3GA 4N9GA 3DVGA 5DHVH 4YHNA 1C08B 1K9TA 4OZIB 3CFBB 2WV3A 2UWEB 4HUMB 5GHWH 2HWZL 1JGLH 1NEZB 4LIQL 4UMGA 2HLFC 2ICWI 1B2WL 3L95B 3O4LE 1ACYL 2VDPH 5CEYB 5BCAA 4L4VA 4LNVA 5KSBF 1YNTB 4JDVA 3LMJH 5E1HB 1NBZA 5JPMB 1RMFH 2ADFL 5DGQA 2VERN 4P5MB 4QOKB 3UTOA 1QSFE 1XEDA 1RJLA 4UT9L 2CR6A 4JKMA 3N9GL 2R1XA 4GUPB 1PEWA 5IF0A 5D2LA 3MRBA 1P7KB 4PRIB 3BRFA 3R0MA 4WEBL 3L3IA 1Q9OB 5BJTA 3HE7C 1MCQA 4CMHB 1KYOJ 1YN6B 1DQQA 2NY2D 5GISH 5FECB 4PJ8A 1LK2A 2WLYA 2YD6A 2NXZC 3DRQA 3GIZH 1CL7L 1RSFA 4GRWB 3W0WD 3GSWB 5FFLA 4WWKD 3UPRB 5HSFA 2A77H 1PX4A 2VDQH 4U1HB 4UV4H 1HIML 5E8OA 5B38G 2DI8A 4F2MB 1XGQA 2EDJA 1JPSH 1T0MB 5TDNA 1UJ3B 5TPWL 3PXHA 1CDCA 1MFAH 4XCEA 3VFGL 5JOFA 2P7TA 2VISB 2Q86A 2WINA 2JIXA 2AERT 3MLTB 3BHBA 5B3JF 4JM2B 3U0WL 1J8KA 4L29A 4ZUUA 2ITDB 1RPQA 1PQZB 1KCSH 4FZ8L 4JCMA 2ESVE 4YBQD 4LLAA 1UXWB 2MPAL 5EBLA 4PJIF 3BDYL 3WS6C 4PB0L 4LLDA 1AO7B 3NGBC 3KYKL 3ARRA 4N5EC 2GJZA 4JHWH 1WF5A 2Y5TB 1OAKL 2AJZA 4QGTA 5D93C 4PJEA 4GXVL 3VWJC 3JZ7A 4XPGH 4BKLB 5CGTA 2I24N 3ZKNC 2P8LB 4LRIA 3NA4A 1P1ZB 4WTWA 4ELME 4C59B 1ZHNA 5C0CB 4GAJL 4AG4H 5E8PB 2XYCA 3H9YA 2VO5A 3EKCA 4LEXH 3QPXH 3F6IA 3WUWG 4O02L 5L9DL 3DYPA 4HPYH 4UB0H 1ZHBB 4GMSL 1WITA 3DHMA 1IKNA 3LKQA 4GG6A 3OJDA 3T8XA 2FGZA 3BX7C 3K0WA 3ARVA 5F8RC 3QNYB 3KAAA 2VB5A 5DVMA 5GRUH 5E4EC 1U8QB 3AAZB 4C56A 4DJMA 3S5LG 5B22A 1GZQA 2BP3A 1E27B 5ESVA 4M6AA 3T0ED 2OLDA 2GQHA 3JV6A 3L3KB 2VXVH 4OJFL 1MJUL 4WO4C 5GGVY 3B8YA 4DKFH 2BSED 1LMKA 4H1LA 5C8JB 4H0IA 5GS1A 3OKOA 4JFOB 1YQ2A 4OKVB 2QKIB 1WWAX 3EOAA 5MHSD 1WT5C 3HG1E 2XACC 5K9OB 1UWEH 3RWDB 4OZHE 4V2CB 1WEJL 3BQUB 4IOIA 4CNIA 3CX5K 3UYOD 4HIIA 1LP9F 1W8NA 4M3JA 3QEQE 3RVUC 3E8UH 1V3LA 3NFSL 2N7BA 1AD0B 1NFDB 2UYLB 4YHMH 2DS4A 3PGCA 4K9EL 5D1QD 4HFUL 1UWGL 2F5AL 1B0GB 2Y36H 1AHWB 2XKNA 4I0CC 4DQOL 1MQKL 4AT6A 1K5NA 5JUEH 4CKVX 3ARGC 3GMRA 1HZHL 3QULA 3I6GA 3NMEA 5I73B 2YSSB 4YGVB 3G6JF 3FO1A 1IM9D 2GJ6D 1JK8B 1H3XA 3SE3A 4Y19E 1G6RL 4MD0B 4Y4HB 4U7KA 3LQAC 4JO4H 5D7SL 1YEJL 1KB5A 3DIFB 3DUSB 4GRLC 3RTQB 1T4KB 2P8PA 1U8MA 3AU1B 4X6CE 4JY4A 3ROLB 2QJDA 1BLNB 4OGZA 4X7TA 2CDEA 2GAZB 4JRXE 3UTQB 5K93A 2LU3A 4JPIB 5KTEL 4K7PH 1A7NL 1YPZB 3D39B 1UYWH 4P46D 4PJAA 3DHJA 2AKRB 4P0DA 1ZSDB 3BEVB 5ALBL 2DAVA 1HHKA 4CL7A 2CLZA 4UDUA 1P9MC 3LRSB 1YUHA 5F93C 4H26A 3QEHB 2CIKA 3CSBA 1CD0A 3SKJH 3QZWA 2WBJA 1KJ2L 4J23A 3WLWD 5DQDH 1UA6H 3MNVB 3TF7C 3BIAX 5KG9A 4GBXA 5I1LB 5ENWB 5HJ3A 3BGFC 4ZSOB 2OCFD 2W92A 3BWAB 3SJVA 3EO1B 1CFVL 3W39A 5DHXB 4ODXB 2FX8H 2CXGA 3EYFA 3SY0A 1SJXA 3C5ZD 4FXKA 2ICES 3UPCA 1NAMB 2BSTA 5KSAA 1IARB 2OQJA 1MNUH 5F6IC 5CZXC 3L6FA 3QXAB 4QXUH 3QWOB 3O0RL 4R0LA 1TJGL 4X9HA 1E6JL 1FIEA 3TESA 2J8UA 2D31A 4G8GB 4IRJA 5CBEB 1I8MA 5ANME 1CICC 3ZLQC 5E56A 3INUH 4LK4A 4J6RL 3ULUL 1OAUL 3ABZA 3WFEH 1EBPA 5DYOB 3ARED 4TVSa 3UTPE 5BZDB 1G6RA 1NLBH 2D4FA 4J7RA 4KTDH 4FABH 2A83A 2Q7YA 3N85L 2E7BA 2G60H 3MJGX 4X5WA 5KSBE 2BNQA 2XWJA 4UOW1 4QTHA 4Z7WF 2D7PA 4MZ3A 3BJ91 35C8H 3NACL 3KPTA 4KRLB 5IBLD 4FTVE 2FHBA 1G0DA 4QHMB 3VD3A 1L9MA 4D0CA 4MNGA 5DFVC 5BW7C 4XB7A 5GGQH 5EC1A 3LHPL 3DWTA 5HI4C 4UIMB 2E7CA 1A6VH 3KLAB 3KLHC 1NDMA 3P4OA 4RGMC 3UJIL 4I0KA 2EE6A 4DN4L 5I1KL 4FQPA 2Z35A 4Z76B 1CLOL 4GMTH 4JO1L 1DSFL 5DJAB 4IEFB 3TA3C 1KJ2A 3IJYA 5AYQA 2HG5B 3O3EB 1IEBB 3RI5F 4CVXB 5EU6E 1S9XA 1IC4L 3WJJA 2LFGA 2FD6L 5GJTH 1XF2B 3VWKB 5E95B 3BAEH 4AENA 5DMGD 4EDWH 3PNWA 2IADA 3ALWA 4TQEL 4OLEA 5EZIL 2YD3A 5SWZD 3MRJA 1NBYA 4HUXA 2BJMH 4X7SH 4GKNB 5FKAA 4RISH 3JWNC 3G5VB 5EU7C 4G6AC 2DLTA 5B3JE 1J10A 3KPNA 3U4EA 1KCUH 1YY8B 2NY6B 1DE4A 3EJYC 4PRHA 1XGPB 4NKQB 1IEAA 3JWOH 1BIHA 3VH8A 4Y4KD 3FFCB 4PJIE 3ZHDA 2CXKA 4LVHB 1MIEL 5EIVA 5C0DA 1H5BB 3EJJX 3QO0B 4BSJA 1MCPL 3LH2L 5CD5D 5EU4A 1CD1B 2HVKA 3VW3L 5HDQH 3QUZD 5H2BB 5BQ7B 4M6NH 4GKZA 2HT4D 2DM3A 2H2PC 4Y4FA 4YNYB 4MA8L 3OKNB 4P4KD 3O2WH 4BZ2L 4YDKL 3QNXB 4N0FB 3P73A 3WMSA 2EH7L 2ZJSH 3LOWA 5EN2A 1GGCH 4MQTB 2OTPA 4PJ5D 4LSRH 2D7QA 4XRCB 4TULL 2MCPH 3OJMB 2F58H 3TGXA 1D7FA 1RUAH 1U8IB 4FOMA 5D5MB 3V6ZB 3QWRA 4KTEH 1RHHB 3WXVH 2HTKC 1BIIB 5EUOA 4U1GB 5B39B 2AK4B 4EBQH 3V7AE 5DUPL 1MHEB 2R29L 4QRPE 1A1OA 3SE4A 1IM3B 4NO2A 2X4NA 1N26A 2Y06H 1C12A 5IHUH 3G5ZB 4N90E 1SQ2N 1FSKC 1MCRA 1FO0H 1NGPL 2RIKA 4JB9H 3S96A 1QBMH 3O3AB 4YPGA 1VPOH 1LQSR 4KJPC 3EAKA 3TYFB 5JQ6L 4UNTA 4NZRH 3VDAA 2OZ4L 4WV1C 1KULA 1FFPB 3I50L 1EFQA 4XVJH 4R8WH 1EXUB 5AEAA 3ROOA 3ZT7A 3ARSA 5C7XH 4HXBL 4I18A 3RY5A 3U9UB 3TJEL 5T3XE 3WHE1 1P7QA 4ZFGH 1LEGA 1H3UA 4LHUA 4HC1H 1AR1D 5JIHA 2QQLL 4BFBD 5TE4L 4P9HL 3WNLA 3GSNL 1TDQA 4CBPA 3B83A 4OFYD 2AJXH 5DRNB 4KU1A 2X89D 3UTTE 3KJ6L 2M1KA 3FAXA 3M1BA 5GRVL 5DJYA 2H32B 1Y18A 1M7XA 1F4XL 5B8CA 1ORSB 4JFDE 4R3SB 2CK0L 4RGOL 4Z7VA 1T5WA 3ESVF 2B1HH 2DQJL 1KN4H 3PWJA 1MLBA 4OM1H 1VFAA 2JJTC 2NY3C 4K3GA 3IDNB 1CZ8L 4NNYA 5CP3A 3U6RB 2J12B 3VFOA 1ZLSH 4M4PA 1U3HC 2VLJB 5A2KH 5E08H 2AV1A 2E7LC 2IGFL 5J0BA 3O41B 5D1XA 1T1WB 1W0WB 3ULVH 1JL8A 3EOYG 2EYTA 2XN9A 4XWOD 3TCLB 4MA7L 1DVFC 1ZVSB 3OXSB 4PGEA 3DTXA 1WBXA 3E2HC 2CRYA 1MH5A 1N64H 3DNKA 4UINH 4P3DA 2VDRH 4NM8L 2IQ9L 1Q9KB 3MSPA 4I0PC 4X7FC 4UT6L 4G6MH 3BPNC 3D69A 3G5YB 2EKSA 5DD5L 2OZ4A 5F71A 5I74B 1I1AD 4OLVH 4ONFH 2V2TA 5F7NC 3S36H 5T1LB 5HD8C 5EORH 1JJUA 1OCWL 5C0FA 1FL6B 2DTML 1UADC 1NH6A 1FYTE 2KZWA 2WAHA 2NX5E 5C07E 4X6EA 5CFHA 4LOUC 4O2FB 3AMKA 1X5AA 4MJIE 4P23B 1TLKA 4UZGA 3G5XA 5K59F 1IQDB 1G9EA 1OSPL 2ADJB 3RVTC 2DLEA 5BRZB 3KPPB 2G5RA 2VN4A 2Y07H 1DQLL 1IC5H 3H9SE 2XZCL 2FHFA 4MGXA 4NQSA 4NWUL 5IEKA 2X4QA 3GIVB 4YO0A 1JGVH 2GCYA 4KROD 4PLJD 2R0WL 5DJ2B 1U8KA 3HPLA 3ORJA 4FXGB 4YDLB 5E8EB 4MNQA 1SEQH 5FCUL 5IWLA 1CDBA 4CMMA 3CFEB 4FQCL 4YK4B 3TIEA 5BS0E 5HYIA 5I1AB 3BN9C 1EGJL 4U6HA 1CTNA 1QFWH 4MDJB 4OQTA 3CU1A 3QUMB 3X13B 3UPAA 3MLUH 4HT1H 4NO0D 3KWWB 4F37K 5EIIB 1XGTB 3MV9D 2K9UA 4NNPH 4HSQA 1BD2E 3O8XD 1RUPL 4PS4L 4QRUB 1GVIA 3CH1A 1YC7A 2ED9A 4HWBH 3ZE0F 3OKDB 5L2KE 2Z4QB 2DYPD 1V7ML 4HIHA 4QRRE 1F4WL 1PDKA 1FRGL 2RFXA 2VN7A 5DLML 4DCQA 5FO8A 5HYJB 1GAFH 4LVEA 4RGNE 2IANB 4QO1A 5FEBA 1I8KA 5KBNC 1K2DA 2X4SA 5H37G 1D5IH 5ACMA 3F8UB 4DTGH 3HUJB 2X7LB 4HFWA 3RDTD 1IE5A 5I71C 5IB5A 5DJCA 5E6IC 5C0NC 5I66B 2YA0A 1KIQA 2J7LA 4HKBA 3K8LA 3VXME 1MRFL 5E2VL 3FQTB 4ELKB 5KS9A 4CN1A 2HWZH 4ODBD 4GAFB 4PLNC 4LIQH 4DKEL 4ZOBA 4O51A 1QA9A 1YMMB 4XT1C 1H0DB 4YHYB 3FAWA 1B2WH 3VG9C 1ACYH 4KK5D 4Y19B 1SYVA 3V0WH 4X98A 5KVDL 3MUY1 1HEZB 1VADB 3KXFE 1QFWI 2J5LB 4ENED 2ADFH 2EDRA 4XCFL 3T77B 3V4VH 4Y2DC 3ZYOA 4QTIL 1IGJA 3OHXA 4UT9H 3T0EA 3N9GH 5EG6C 3MNWB 3Q5TA 3UZVB 5IR1B 1EGJA 2VZVA 4WEBH 3WHXB 3V79C 3C60B 2P46B 5DI8A 5H8DA 2YBRA 2H45A 3EDDA 1K4DB 5I8EA 4ZTPL 3LIZH 5DTFB 1JGDA 4P4RA 1DQDL 4P2CG 5EOQL 3LV3B 3BD4A 5CD3B 3DYMA 4OLWL 1CL7H 3ME0A 2XA3A 3EBAA 3L5XL 1I9IL 2EH8L 2ZUQB 4DZBB 2EKJA 1UZ8A 4ETQA 1T83C 1XH3B 3GMMA 4L1DA 1YMHA 4NZJA 4JVUA 1FZKB 3BISA 5E2TL 1QVOB 1HIMH 2WZPD 1PX3A 4TSCL 3FQNA 3RWFA 3FQXA 4AZ8A 3PXJA 3MBXL 4LF3A 2AEPL 1OW0C 3CPLA 1HYSD 5LAXA 5TPWH 3LKOB 2M8XA 3VFGH 4L9LC 1ITCA 5M94B 3JVGA 1BEYL 4D9QE 3U0WH 2F9BT 1WIUA 4N8VA 1CDHA 3VXSB 2YRZA 1RIVL 5D1QA 4D0DB 1JZ7A 3EYQD 1MVUB 2ERJC 4FZ8H 3MLZL 1D9KD 1ZT7B 4Z5RB 3UCRA 3DARA 2MPAH 4XCYA 1EHLL 4IIQA 3BDYH 4PB0H 4TPRL 4N0CD 3KYKH 5HGBA 1BX2B 5CJXC 1N7ML 4QHLA 4X9FA 2DKSA 1OAKH 2NW3B 3G6DL 3KYNA 3SEPA 3TFKD 4D9LL 3NN8B 1IM9A 2GJ6A 4WNQA 4GXVH 5C9JA 4Y5VC 3V6OA 4TTGA 3FQWA 3C6LB 5C08B 4G8IA 2YD2A 5AZ2L 3DBXB 2XTLA 4P3CL 4PGZA 2A38A 2FIRT 3U7WL 4MHHG 5IT2L 4GAJH 5IHBA 3CGTA 4HJ0D 4LPYA 3S8WA 1ND0A 4RDQG 2DD8L 4JPVL 2IH1B 1A47A 3ZDXF 4Q6YA 2B2XL 1IAKA 1KCVL 3R8QA 4EN3C 4O02H 4JDZB 5L9DH 4NRXA 2C3GA 1NMBL 4MXWL 4XXDA 1HQRB 1Z2KA 3C9NB 4GMSH 2V5SA 2L4OA 4P46A 1C5CH 4PRPD 5I1IL 3FO2B 2WUCL 2NXYB 2DDQH 3RNKA 5FXCH 3X14B 2RQ8A 4FG6C 1H8NA 1R24B 3IU3B 2G9HA 3NZ8B 3VCLB 3IDMB 3KDMB 4FFWD 1TXKA 3DUHA 2XTJB 1GH7A 1N2RB 4OJFH 3U0TA 2X4PA 5E5RB 32C2B 3NA9H 1MJUH 1UKTA 2DQTL 4PP1D 3TC9A 4PJFF 3QEGL 4JFED 1BOGA 1J11A 3BE1L 1G7HB 5FM5O 5GGTL 3C5ZA 1EHXA 4G9FD 1CFSA 4DGIL 5AAMA 3B9KB 1N59A 2HT3C 2YUXA 2NCMA 1WFUA 4GKOA 4MXVF 1WEJH 4LDLB 1OGAB 3QI9D 2P48B 4X6BB 4MQXC 43C9A 4GQ9L 4HUUB 5CINL 3WUWB 3ZKSD 3NFSH 4HZLA 4LLWA 4XNQA 3BT2L 5FUOL 1MF2L 3P11L 1OD9A 4O2EB 1QQDB 3VXTB 4C4KT 1S5HB 2XY2A 4U05A 3RWCA 4K9EH 4G6FB 1ZHKA 2VMFA 4HFUH 1A1MB 1UWGH 2F5AH 2PXYD 3HZKB 3M8OL 4XP1L 3S5LB 4DQOH 1MQKH 1MIML 1I1RA 4G43B 4HG4J 4G42B 5C70A 1HZHH 2FIKB 4KVNL 3NIFF 3P0VL 1HXMA 3NFNB 3HNTL 5K59E 1G6RH 3MV8E 4UU9B 4NP4L 4NQDD 4P57B 5D7JC 3ARFD 5D7SH 4HAGA 2GT9A 3H7BB 2Y4SA 1YEJH 2YN3A 4QT5B 4Z0XA 2FDBP 4OUUB 3VFWA 3KPQA 5C0IA 3IRPX 2GIYA 3FB8A 1G7LA 2GYSA 3NFPA 3LQZB 4HLZG 4PJHB 4YC2C 3VE0A 5LCVL 5KTEH 4Y8DC 1A7NH 1JNLL 4UILL 4NFBA 3CDCA 4MB5A 3RUGB 5ALBH 1YDPB 25C8L 5DRZB 3FO9A 3N1PC 4X6DB 1I7UA 1R6VA 1LE5B 1QSEA 3CCHA 2GJJA 5SWZA 1KJ2H 5IOPA 4KJQC 2D4DA 3T0XA 1OAZL 3H6JA 3L7EA 3LS5L 3ZE0E 3B9EA 1U92A 1X6NA 3CFJB 1PKQE 1NANI 2NY1B 4Y4KA 1PY4A 1T1YA 2ATPA 3TZVC 3DV4B 5ECJE 1G84A 3U1SL 3N06B 1LP9B 3BYTA 3O0RH 1ZLVH 1D5BB 3D0VA 4AIZA 3OX8B 1XCQA 1TJGH 2AJ3A 1E6JH 3IDJA 2PYEE 2PYFA 4PG2A 1I85C 3KYMA 1FNGB 3QUZA 4URTB 5F3BA 4O9HL 4L9DA 3S9DB 4MNHB 4J6RH 3ULUH 1OAUH 2GFBB 3IDIA 1W0YT 5CWSA 1S5IL 4CN4A 1T5XA 5HDBF 1GGUA 3G6JB 5SV3A 2JJVA 4PJ5A 3N85H 4LGSB 4HS6A 3HZVB 5ITFA 2K3TA 5L88L 4IM8A 1GL4B 2C26A 5D4QA 4XBGA 4X7CC 3NACH 1A7QL 3MNZB 4LNRA 1LO4L 4LKCA 2AQ1A 5FCSH 1A1NA 5F3HA 3LHPH 4XI5C 1CDGA 4OIBA 1E4KA 1T66D 3WN5C 3OMZA 4PG9A 1YJDC 1J5OL 2W0PA 3OTTA 3UJIH 1U3JA 3QXDA 1CQKA 4DN4H 5I1KH 3DO7A 1U93A 1CLOH 4JO1H 1DSFH 2HJLB 2BVPA 4QY8B 3QXVA 3GM0A 5IHZA 4KQ4L 1VKXA 1DUZA 3HE7B 1F00I 1IC4H 4LAJH 2FD6H 1JZ4A 1N4XL 2BNQE 5DDHA 4TQEH 2QADC 3NABL 4EQ2A 2NXZB 5EZIH 3IXTA 1I3RA 2ICCA 4HWZB 5C0EA 1LO3L 4MNGE 3QDHA 1NGZA 4OGAC 1T21B 1G7QA 2CKBB 4KVCL 1J8HE 2DJUA 3TVMC 3D85B 2AEWA 4ZUVB 1KSRA 4JQVC 5CEXB 3BP6B 5JHDA 3RX7A 3FFDA 4LDOB 5FOJA 1CGSL 1KTLB 1A9BB 3T4YA 1DN0B 1IGFL 1U8OA 3KPRB 3IFOB 4OFYA 3TN0C 4Z7OF 2PKDA 5J89A 1MIEH 1NDGB 2X89A 1MCPH 3O81A 3LH2H 2Q1EA 4QRQB 5FGCB 4N5UA 1AP2A 3VW3H 2EE2A 3QIWC 5E6ZA 2A0LD 1ITBB 3L5HA 4QGYA 3NGBB 2KQMA 4C83A 4AIXA 4MA8H 1FC1A 1OT2A 5D93B 4ODWA 3VWJB 4BZ2H 1BFOA 4YDKH 3MV7B 4NQUA 3ZDXE 5IGXL 2EH7H 1CFTB 2I07B 5BS0B 1Q9LA 4Z7WB 4XMLL 5I8OL 1OP5K 4YUEL 4KC3B 4PRHE 3LEVL 4NHCH 4TULH 4LCCC 1EZVX 1S7UB 5CBAB 2VQ1A 4ORGB 1CWVA 5J6HA 1QR4A 4OTXL 5EZJB 4LPUA 5CP3H 5HI3D 1BZ9A 1D5XA 5DUPH 1KPUA 2R29H 5HHMB 1LD9A 4J4PD 2DM7A 3JTSA 3E6HB 5E4EB 3T1FA 1I1AA 4JG0H 4RNRB 4JRYE 4RAUB 5ACZA 1S7QB 5JMRA 3JWOC 5I8KL 4JN1L 1NGPH 2AS5M 1IGCL 2B0SL 5SWQB 4ZG1A 1E28B 3LKRB 5F1IA 5IJVA 5JQ6H 4WO4B 3K4AA 1NFKA 2OZ4H 2RAMA 3QIUC 2H6PA 4MXVE 2F8VA 1J0HA 1ETZA 1FN4B 1WIOA 2DMBA 1KELL 3OSKA 3V5HA 3I50H 5TH2A 1I1CA 2WBWB 2BOBB 2X4TB 3K80A 1HHGB 4TVPE 2PTVA 4HXBH 3O9WD 4N0UA 1DBAL 3IYLW 4PP2B 3TJEH 1KN2L 4OI7A 1BAFL 2XNAB 4JR9L 3FMGL 2VLME 1UCBL 2VE6B 5IVXF 2O5XL 1CDYA 4XXCC 2YA1A 5DEFB 1UQSB 2QQLH 3RVWD 3KXFB 4P9HH 2BXYA 3Q48A 3GSNH 2APXA 3BKJL 3ZE1F 3NIFE 2P5ED 3RGVD 3KJ6H 3WJLA 4M7JL 5ISZD 2A6DA 3A6OA 4XPAL 5D9SB 3HHRB 5CSGA 2C1OB 3TJHD 2MJWA 3TCXA 1F4XH 4YFLF 3MRDB 5I0ZA 1K8DB 1KGCE 4MSWA 3ARGB 2CK0H 4RGOH 5TQ0H 4NO0A 5EA0L 2QQNL 3O2VL 2DQJH 3ARBC 5GGUB 1P4IH 4AEIL 3LKPB 4HX1A 1CZ8H 3O8XA 1UB5A 5FHAL 2WWKT 4ZXBC 2DYPA 3HMWL 3VFPA 4JY6A 2VAJA 3QEUB 5E5MB 4MA7H 3CDGB 2EYSA 4Q6IC 4RZCB 4YIQB 4UDTA 3K1DA 5BO1L 2FL5A 4RSVA 5J9PB 1BQHA 2YWZA 1JZ2A 4NM8H 2MKWA 2IQ9H 1M1SA 5ICZA 4UT6H 4I3GA 4XVTL 3P4MA 5DD5H 5F7WC 4BYHA 2VLRB 3CMGA 4XAKD 1ZEAL 3MRIB 5J3HC 2UV3A 3TBVB 1S9YA 3FQUB 2UZYB 1BZ7B 1CK0L 5E4IA 4U6VL 1OCWH 2DTMH 4DZ8A 1S7SB 3U4AA 4LEOB 1FFRA 3BGFB 2XN9E 4OCMC 2IPUK 3MLYL 2DLFL 2VSDA 1AGEB 4ERSL 4YDIL 4G6KL 4KRMB 3Q1SL 5D7KD 4M6ML 1X5ZA 1XIWC 2NW2A 3CVHA 3OKEA 1OSPH 1T0NB 5F6IB 5FO9A 5GIRA 5CS7A 1DQLH 4PJBB 2ADIB 4PTUB 2XZCH 1A3RL 5HDBE 4NWUH 5B4MD 1FNLA 4NRZA 5DUBA 5ADPL 1JPFA 2V7NB 3QIBC 2FSEB 5SWSE 2R0WH 1CICB 1KOAA 1L9NA 4BJLA 2A6IA 4P2OD 4ZO9A 3ULVC 5GGVL 2YPLD 5FCUH 1PG7L 4EI5D 3TH3T 4QXTB 1WCBB 1YYLL 1EGJH 3HB3D 4PY7B 1CXHA 1AKJD 1A4JB 3QDMD 1B90A 5D7LB 2WUBH 3L5WA 4OFDA 5ESAB 2PCPA 4WFGD 3SCMD 1IGML 3MYZA 3U7YL 5T3ZD 1RZGB 3B3IA 2AI0L 4ZMAT 3D2UB 5GPRA 3SE9L 3DX9B 1RUPH 4PS4H 4RFOL 5JA9A 2IH3B 1OAQL 2PTTB 2RBLA 4Y4HD 1V7MH 3FQRB 3BZ4A 1F4WH 1D9KA 4TSBL 2D0HA 1I1YB 5DLMH 5EC2A 3LVEA 5GZOD 4MNQE 4RGMB 2CDFA 2W65B 3JV0A 3FT3A 2JCCA 3HS0B 3TA3B 1F4AA 4BFIB 2J88L 1ODAA 4OD2A 4JN2A 5I19L 1S7RA 1BF8A 3GBNL 3MJ7B 3IDUA 1CGUA 4JO3L 1HILB 1LO5A 1CLYL 1KT2A 1MRFH 5E2VH 5IM7B 4HGKC 4S1DC 4PTTA 1AR2A 3PWPB 1RZKH 4DKEH 1ZKAA 3QA3A 3SDXF 2A73B 4Z7OE 1A7PL 2NYYD 3MV01 2E3VA 4KDTA 5KVDH 4GJTB 5HGHB 4U1IA 4X7EC 4PRPA 1AGFA 4JFPB 4ZUTA 3QYCA 4PJGA 4QHNA 4YAQA 5EBGA 1PG7X 4XCFH 3FONA 4UQ2B 4YHPA 4QTIH 5EUKB 4PJ8C 2R2BB 3FZUC 3VFTB 3R0NA 5JZ7D 2APFA 4XC3L 2HT2D 5FYKE 2GITA 4ONGL 4NYLB 1KB9J 4Z7UA 4JFEA 4OZFA 1O0VA 4ZTPH 5H35B 2XA8L 1T03L 1AJ7L 4WIQA 4G9FA 4OLWH 4OZGA 3GRWA 3L5XH 4NJAL 1I9IH 2EH8H 3F7YA 4U1SA 4PREB 1HI6A 1T0PB 3VRIB 3U9PL 5E2TH 1CLZL 3SDCD 2Z31C 1BZQK 2VABB 4X0KA 1Q0XL 4TSCH 5EB9A 4ODHL 4HIXL 4WU5A 4X5XA 1AXTL 4WHYH 2AEPH 4HH8A 1AC6A 4I2XE 2FHCA 3MGOA 3VFSA 4NC1C 5TDOA 1WISA 2A74A 1BEYH 3TBTB 1RIVH 4NKDB 5JXEA 4PD4K 4CADA 4KJWD 1ROWA 2ZZUT 4UNVA 1HH6A 2PXYA 4LRIC 1EHLH 2PYEB 1PLGL 3L3HA 1CGVA 4TPRH 3VXUD 3UTZB 3D6GA 1N7MH 1QLEL 1FSKB 3BGMB 3G6DH 3VXQB 3ZKMD 2ID5A 1D5ZA 2XQBL 1QLRB 1A22B 2RJMA 1UM6L 5MERB 3QFJE 5F97E 4AQ1B 1WC7B 2IBZY 3P9MA 4P3CH 4EDXA 1IKNC 1TZIB 4WV1B 3U7WH 5IT2H 4ZDHA 1RIHL 3WKML 2DD8H 4JPVH 1EO5A 5IVXE 3CSYB 4KI1A 3PIQB 1H3PL 3RP1A 4KKAD 5FOBB 4IJ3C 2B2XH 2OR8A 3ZE1E 4XAWL 1NMBH 4MXWH 4I5BB 1EEZB 1C16B 1G7IB 3VXNB 3U30C 4Y5YC 4PBWD 4WGWB 5I1IH 2WUCH 1I4FA 1U91A 3F12B 3T1WA 4NSKB 5CKGA 3QFDA 3QUXD 5GS1C 3V6OE 4HKZB 2W60B 1YEHL 3CUPA 3EYVA 4E41B 2DQTH 1QD0A 1S7WA 3B6SB 3O45A 3BE1H 5GGTH 4N0YL 5CJQL 4XP6L 3PHSA 1W72B 2NY3B 5DQJB 4DGIH 4Z78B 4CW1B 2O61B 1RJZA 3WL9A 1YEFL 3O4OC 1UVQB 2OTUB 1MWAA 2OSLA 1U3HB 3G08A 2EEAA 3FRPA 3EFFA 3MJ8B 1DVFB 1R3KA 1FC2D 2ITCA 4GQ9H 3E2HB 5CINH 5C0GB 5E7BA 1NC4D 3X11B 3BT2H 5FUOH 1HSAB 1Z0MA 1MF2H 3EO0B 3P11H 1B88A 3RIAK 4I0PB 2HA1A 1FL5A 3BPNB 2B1AL 1T1ZB 4RAVA 1AD9B 2IJ0C 3M8OH 4XP1H 3D18A 4K55A 1MIMH 2NLJB 1F2QA 3QDJD 2GKIA 4KVNH 5HYEA 5J11C 3P0VH 1EEYB 2BMKA 3KPMA 2NTFB 1XCTB 3TO2A 1VA9A 4NP4H 5A2IH 5ICYB 2P5WB 4PGCA 2AXJA 4MA3B 5T1KA 1GIGH 3EOTL 5TF1L 4JREC 2YD9A 4NN6C 3MLRL 2VOTA 5CIPA 2EXYD 5LCVH 2WBJC 4UIKL 4HJGA 1JYWA 2FWOB 1JNLH 3ARDC 4UILH 5LJYH 4IS6A 5LKNA 3MMEB 5A16A 3GSOB 3CLFL 5MI0C 5E5UB 1JPTL 25C8H 5TJWK 4J3XA 2E27L 2V9TA 4XNUL 4MQ7B 3BDBA 5F96L 2EEDA 4PJFB 3AB0C 1AGCA 4GXUM 5DRXB 1QPXA 1SJHA 1QSFD 3KNBA 5IKCB 2YEZB 5JO5B 3SO3C 2I27N 3MRLA 4K9EC 3LS5H 3MRRA 4LCWB 1R3JB 2N1KA 3RZCD 4G8FB 4IRJC 4K7FB 4M8QB 4QHUB 3SDDD 5KAQG 2BHZA 1BQUA 1CE6B 5DSCA 3WIIL 3U1SH 3W9EA 1OSZB 5FGBC 1FJ1B 2C3VA 4GFTB 5LVEA 3B9DA 1QBLL 5F8QC 2OBGA 3TNMA 4O9HH 4YR6B 3BUYA 4X4YB 3H3BC 1S7TB 4I9WE 1BJ1H 1QSEE 4R7DB 1R3HB 1WQVT 5E1AA 3HPJB 4KV5E 4W68A 1S5IH 4QRTB 3SKUD 4ZQKB 2GTWA 5I0DA 1A9EA 4WUKL 1LEIB 4TYUA 1UXSA 3SDXE 15C8L 5I71B 5E6IB 1R0AL 1HSBB 2ZOLA 4U3CA 5L88H 2ESVD 1RAMA 1C08A 4OZIA 3CFBA 3QISA 4IRSD 2UWEA 4ZFOL 5L6YL 4KXZI 3EDEA 4Y16C 3Q5YA 3E6FB 5JIPA 3ILPA 4HMDA 1A7QH 3LN9A 4I4WA 5ID1A 3QNZB 1LO4H 3VG9B 5BZWA 1BQLH 3MLPA 5LG1A 3ULSB 4FFYL 1AQDB 3BXNA 4J4PA 1YNTA 5A3ID 1FGVL 1MAJA 2WWMD 4P23D 1J5OH 4Y2DB 1T7YA 3OV6A 2EECA 4P5MA 4QOKA 5J06A 3O3BB 5IB2B 3Q0HA 3RQ3A 1P7KA 4PRIA 4MJ2A 2NTSP 2UVEA 2BXZA 2DRUA 3GJEB 1N4XH 1NGQL 3W82A 3NABH 1KPRB 3MRKB 3MRQB 5FECA 2BVQB 3V4UL 5C86A 3ULUC 4OB5H 2BFVL 1LO3H 5DK2B 5FB8B 3O9WA 2CLRB 3AXLB 1D6EB 1ZS8B 4KVCH 1MRCL 1J86A 3UPRA 2CIIA 4IHOB 1RQ5A 4RFNC 4ZODA 4WW1B 2P8MB 3I6LE 5DHVB 1CGSH 5EOTB 1T0MA 3TT3H 2M26A 1FNEA 1IGFH 1CVRA 1UH4A 4DVBB 3U48A 4L9LB 1KLFA 4XCNB 3W81A 1A7RL 4WGVB 3N1FC 3RGVA 2EDNA 1ZK9A 1QZ1A 2ERJB 2XG4A 4W4NA 3PJSB 2KL6A 2BK8A 3WYRA 3HG1D 4ZUSB 4DOHB 8FABA 4ISVB 4BQCA 1E4XL 2DWDB 4QCIB 4ZFOA 3SKOB 1A7BA 2Y5TA 2W1NA 5AAWA 4Y5VB 3QEQD 3IF1A 4BH8B 5IGXH 1DQJB 2ARJB 5IMMB 4JY5L 4XMLH 1DUYA 2NZ9C 4JLRA 4YUEH 5JHDE 5I8OH 2NY4D 4OLZL 3LEVH 1P1ZA 2QTEA 3SE4C 1AH1A 4KRPD 5T3ZL 5E8PA 4OTXH 5F9JB 3MBEC 3VD7A 1C8PA 5HHOE 4LFHG 4EN3B 5BVJB 1U9KA 3DO3A 4PJGF 3L3DB 3EFDL 5IFAL 4QWWD 4MAYD 5JORB 4Y19D 5D71L 4DGVL 3TBWA 3RL1B 1KCLA 5D7IA 4L8BA 1FVDB 5HYQA 3AAZA 5I8KH 4JN1H 1IGCH 2B0SH 1E27A 3F7VB 1S7VB 1A0QL 4KJYB 3OKLA 4EXPX 4HMEA 4JRXD 3MJ6A 3C60D 4OZGF 4K2UL 4HHAB 2FJHA 3G04A 1KELH 1BPVA 4L4TB 1XT5A 5C8JA 1Z5LB 4JFOA 4F9LC 5DJDA 4Y0GA 2YD1A 1IGYA 1DBAH 1FZMB 4LP4A 5DD1L 1KN2H 4WHTB 1BAFH 1MRDL 4JR9H 4DN3L 1UCBH 3BQUA 3HRPA 2NY0D 4P2OA 2O5XH 4PV9B 2YPLA 1ZAGA 1FYHB 1TTUA 3I75B 2LU4A 4OCNC 3BKJH 1A6PA 4S0SD 4EI5A 4LLQA 1TJIL 1NFDA 2UYLA 1ZLUH 4M7JH 1MCIA 2AV7B 4ODSL 1AKJA 4XPAH 3QDMA 1B0GA 3VDCA 5DFWH 3CFDA 2VLKB 4PRBB 5D1XC 5EA0H 2QQNH 3FOMB 3O2VH 4AEIH 5ELIA 5KSVB 1WWBX 4PR5A 4N0UE 4QF1A 5FHAH 3DGGB 1YYML 1T7ZA 4XH2B 5EULV 3UTPD 4MD0A 1ZOXA 4Y4HA 3HMWH 2ZUWA 2I9LB 1PGRB 4HEME 3DIFA 3DUSA 4GO6B 4K8RL 3EYUL 3RTQA 1Y6MR 3TBYA 3E3QE 1XZ0A 5F70A 3PHQB 3BDXA 2CDGB 1MCCA 1LE9A 4MWFB 4YC2B 5IB4B 1W0VB 4XVSL 4P48A 1VERA 4NKIL 1DBBL 2VZTA 5FYJE 4JPIA 4XVTH 4FTVD 3QT2A 1ZMYA 1ZSDA 1V3JA 3GMLB 4TNVF 2EDXA 3MGTB 1ZEAH 2RB8A 3QEHA 3UBXG 3P9LA 1CK0H 1CBVL 4P9HC 4OFVA 3HN3A 2R2HB 1LVEA 4U6VH 4WDIA 5I17A 2HAZA 1CG9B 5T1DL 3MNVA 5IW1B 1CN4A 5I1LA 3MLYH 2DLFH 3ULUF 4MJ4A 5ENWA 4BQ9A 2ICEB 4ERSH 4YDIH 5EU6D 2X6MA 5DWUL 4G6KH 5IJKA 3Q1SH 4ODXA 2NY2C 5MEOB 3TZVB 1YZZA 4M6MH 1OP3K 4JFFB 2QLVB 4OV6F 4RX4D 4F57L 1NAMA 3LRHA 3WV0A 3B9KD 3VFRB 2JK5B 1J05A 5D72H 1A3RH 3RI5K 4WWKC 2PN5A 3IGAB 5F7DA 2ENSA 4F7CA 5ADPH 4WVRA 1ULVA 3B2UC 5DD3H 2XI9A 5GGVH 3MRFB 5CBEA 5INDB 3MLWL 4LASL 5DURB 4JO2H 1LO2L 4X8JB 4YFEA 4U1LA 5BZDA 1YYLH 5EBMB 4KI5F 1TVDA 3GBLA 4LPTA 4YBQC 5ACLA 3QO1B 4A6YL 1IGMH 1YEGL 3V6FB 3U7YH 1DBML 2Q8BL 3BFOA 1YEIL 2F54B 3PHOB 3SE9H 2OMBA 4RFOH 3ZZ1A 2CO6B 3CIQA 1JRHI 2B7DT 2V6HA 3IFPB 4TSBH 3L3OB 3WN5B 1JMXA 4ZD3L 2GSGA 5EO1B 4UIMA 3VXUA 4APQD 3KLAA 4PPTA 3MUHL 4CDGC 3OAYH 2J88H 1OT1A 4KWUA 4PJDB 3HAEH 4Z76A 1VENA 5DEZA 5I19H 4KK6D 3GBNH 4PRDB 2WK2A 2HG5A 3O3EA 1O7SA 2K7QA 4JO3H 4CVXA 1CLYH 4LGRB 3VWKA 2QADB 4QRPD 4DK3A 1PY9A 5CJ8A 3DXAE 5ITBL 4D9RE 3VXPA 4N90D 5DT1L 5HGDA 1QLFB 5TF0A 3T0EC 1JN6A 1F97A 1A7PH 3TVMB 3I6KA 5ABDE 2XKSA 4EVNB 4GKNA 3G5VA 1ZGLB 3RRQA 4JJ5A 4JZJA 1J7VR 3HZMB 3TN0B 3BGAA 3QUXA 3ES6B 1FVEA 1KJVA 1VFBB 1WFOA 3NH7L 2DBJA 5C0JB 3GSQB 5F6HI 2OL3L 4HWEL 4M5ZL 4XC3H 1IZKA 1F3RB 3QIWB 5F89A 4ONGH 5IMKB 5KN5B 5F9OL 5T3XD 3O11A 2R0LL 4Z0BL 5H2BA 1AHWC 2L7UA 2XA8H 3GSVB 4XNZC 5BQ7A 3BKML 4A6YA 1T03H 3NBNA 1AJ7H 2BVYA 4I48B 2OTWB 4YNYA 3MXVL 4P2RE 3MRPB 4LHUG 1Z9OA 4NJAH 3I3DA 1VSCA 1HDMB 2R1YB 3JVGC 4XMKL 3U9PH 5GZND 1CLZH 1CDUA 5D1QC 2UWEF 4PJGE 4LCCB 1Q0XH 3VMNA 2R2EB 1HQ4B 4HIXH 4ODHH 1AXTH 2DQDL 1TCRA 5EOCJ 2PO6D 4IIQC 2BCKA 2R9HD 5D5MA 3RJQB 4JFDD 1NC4A 2FEEL 1CGWA 2ZNXA 1U6AL 1AGDB 1U8LB 2JJSA 2V2WB 2XQYK 1RUKL 2VL5A 3HRZB 1BWWA 2Z91B 1T04B 3U4BL 1BJ8A 1MHEA 4FS0A 4KGJA 3LAFA 4FMFA 4LLUB 1BBJA 3EGSA 1PLGH 3EO9H 3IKCB 1KIPB 5IHLB 1U58A 3WD5L 4OZGE 3SHSA 3QDJA 1CIDA 1CYGA 1QLEH 3G5ZA 3QUKB 1MCWM 3VXOB 4Q9BA 5I9QC 3QDGE 2XQBH 1X5JA 1UM6H 3VI4F 1BFSA 1Z9SA 1A02N 2P47B 3QIUB 1IL1B 1B6UA 3LD8C 3SDXB 5BOZG 5KSUB 4P46C 4NNXA 1RIHH 2BNRB 2JLLA 3WKMH 1A14L 3FB7B 4GRWF 4S1SL 2NXZD 1H3PH 4XGZB 1EXUA 4NWTL 4PJXB 4U0RC 4P5KA 1QSVA 5J12C 4EUPA 3WLWC 1EFXB 5FO7B 1I1FA 3U9UA 2OL3A 5DD6B 1FYTD 2NX5D 2DLIA 5C07D 1QRNE 1G0XA 4NO3A 2EEBA 2W0FB 4NQEE 4HH9A 5TDPB 4MJID 4JM2F 1BVKA 5CIPH 5IBTL 5DRNA 4YHZL 3QQ3B 3NOIA 1QSFA 1DEDA 1YEHH 5KANI 3MTRA 5FYLE 4I3RL 3O6KL 2VUOA 1H8SA 5MEPB 3IRZA 3H9SD 3RZCA 3QXWA 4MCYB 3MRGB 4N0YH 3ARBB 1ORSA 1X6LA 1K4CA 5CJQH 1KIRB 4K94L 4XP6H 3SDDA 4HEPG 3V5DB 4DW2L 3T3MF 4CU6A 1MFNA 1YEFH 1FO0B 3AREC 3VWJD 3U6RA 2UZIL 3BD3A 4YQXL 3MV7D 1A4KA 3ZSSA 5BXFA 4NQCB 5BS0D 5IQ9A 3O41A 5FV1L 5DS8B 1JNHB 4Q6IB 1VEMA 1Z6JT 4NFDA 4R4BB 1ZVSA 3HR5B 4MJ5B 4NM4L 5GS2D 2YZ8A 4FMKA 1CXEA 2AVGA 4HS3B 1Q9KA 5IBLC 2B1AH 1BD2D 1EO7A 2FJGA 5L2KD 1FVCA 1X9QA 3H0TB 1EBAA 4QRRD 5EDXA 3ULUE 2ESVA 2MSPA 1GZPA 4Y1AB 4IRSA 2FYYB 2BY1A 3PV6B 3BO8A 2BNUB 4RGND 1I3GH 2OR9L 2F53E 2MKLC 1FL6A 1EV2E 1NFIA 4V1DB 4LDEB 5D1ZD 2H2SD 3GUTA 2N56A 5HGAA 1WUNT 4P23A 4P5TC 3EOTH 1SJEB 1SYSB 5TF1H 4X6FA 1IQDA 1XIWB 4U4BA 1DZBA 3MLRH 3VXMD 1T1XB 1MFAL 3DV6B 5C09E 2Q20A 2ADJA 4UIKH 1BQSA 4PJ9D 4WUUB 1H5BC 3ISWA 3QIBB 1J18A 4KI5E 5K9QG 1U8NA 3CLFH 4F7MB 1QFWM 1PYWB 3DMMD 1JPTH 4S1RL 1NFDF 1IFHL 5C0BE 2E27H 4XNUH 2WIIB 4E42A 3KXFD 1ZV5A 5E8EA 5F96H 3SGKA 1ED3B 2E9BA 4XZUA 1Z9MA 2XXMB 4W70A 1JWUA 1Z9LA 5MENE 1JYXA 2BSSA 4MDJA 5CD5C 1EJ6A 3QUMA 1LEKA 4PG2C 1S7XB 3QUZC 3D3VB 2J6EA 5CHNB 2IWGA 2HT4C 3PL6D 5EIIA 1I9EA 1XGTA 3WIIH 4P4KC 4B7LA 4QRUA 4DUWA 4M00A 3PABA 1NSNH 3KPSB 5HPMB 1MPAL 3BPLC 3W9DA 3TIDA 2X4OA 3OKDA 1U8PB 2Z4QA 3HG1A 1QBLH 4GRLD 1JZ3A 3AGVA 3T4AB 1HWGB 4N9GB 1GGYA 5F7UA 3DVGB 1JNJA 4OZHA 4YHNB 4OLUL 5SX4H 5HYSG 1C5BL 5GRUL 1MAKA 4R2GD 3NPZB 1QRKA 3QHTC 1YPZF 3QEQA 5DEGA 4CVZA 2O5ZL 4WUKH 15C8H 4UBDD 4D9QD 4L4VB 3TWCL 3BN3B 1R0AH 1PSKL 4JDVB 4OF7A 4N8VG 5I66A 3MCLL 1NBZB 1P84K 2EO9A 1E4KC 1INEL 1EO8L 5L6YH 3BPOC 3QQNA 4GT7A 5C6TL 1MHPL 1ZANL 4K23L 3PQYE 5IF0B 3EJZD 2IPKB 5I75C 2K7PA 3L3IB 4FFYH 1VGKA 4Y19A 3JXAA 5BJTB 43CAB 4H20L 1FGVH 3QB7C 1HEZA 3KHQA 3BP4A 4FQJL 5EO0A 4O2CB 2D9CA 2OJZL 4PJ8B 1LK2B 2R0KL 3DRQB 3MREB 4X6CA 1JF5A 1H3VA 4HV8B 3MNWA 3WHXA 1NCNA 2NQCA 2X09A 4JRXA 3C60A 4PBXA 4GW5A 4FFVC 1NGQH 5E8OB 1K4DA 2UWEE 1XGQB 5DTFA 5TDNB 4TUJB 1AR1C 4L8CA 5D6DA 3V4UH 3LV3A 4OAWA 4XCEB 5KW9L 2BFVH 3GK8L 2WINB 2Q86B 2JIXB 3S3PA 3BHBB 1MRCH 4L29B 4ZUUB 1D6VL 3K46A 1NCUA 2Z31B 1MHHA 1FZKA 2X2YA 3FT2A 1SJVA 2Q7NA 5EBLB 4G7VL 4QOKE 4LLDB 1JTPA 5GGSA 1CE1L 2YWYA 2GJZB 4D2NA 3PWNA 2AJZB 2W38A 5I1DB 1A7RH 4PJEB 4F15C 4PRIE 4WHYG 2HYMA 3C09C 2AABL 1PZUB 3VI4E 3RBSA 1UYWL 1ZHNB 4HF5L 3BP5A 4XWOC 4JPKH 3KLHD 5GS0D 1E4XH 2E7HA 3BJLA 1BX2A 5ANMA 4EEEA 3DRTA 5E9DB 4GRWE 4JGMA 4H88L 1V8HA 4JY5H 5C08A 2P49B 4OLZH 3LKQB 4GG6B 3OJDB 2CPCA 3T8XB 2HJKB 4XHQA 4FQQA 2VZ3A 1I1AC 5T3ZH 4C56B 5KSBA 5AD0A 1GZQB 4IJ3B 3MRNA 5ESVB 4LPXA 5DZLA 4B0MM 1YN7B 1JF1B 2XWBA 4MVBD 3EFDH 5IFAH 1T6VN 5B38A 3U30B 4Y5YB 2GK0B 1JWMA 5D71H 1HQRA 3C9NA 1LWRA 3MV8D 4DGVH 3DJ9A 1T89A 2EE9A 3EJYD 1AO7E 3RKPA 3RKDD 1A2YB 4ZNEA 5GS1B 3OKOB 3HZYB 1IAIL 4HS8L 2BX5A 3IU3A 3EOAB 1A0QH 2D7TL 2FGWH 3GDBA 4P2YA 3WNPA 1TPXC 2YN5A 3VGAC 5IEHB 32C2A 2ZSVA 5C0CE 4KK9D 3KYOA 4K2UH 4CNIB 1IVLA 3AY4A 4KROC 4PLJC 4HIIB 5EU6A 3LB6D 4UUJA 3P2TA 4W81A 5GRXG 4L4JA 1NUGA 3CX5J 4AK1A 4RX4A 5GXBB 1X44A 3GSXA 3O4OB 3GI9L 3B9KA 2OS7A 5DD1H 3PGCB 3SDYL 3C08L 1MRDH 3NVQA 4DN3H 5D5MF 2E7MA 3F7PC 3MACL 2BC4B 3D25A 2XKNB 4AT6B 1K5NB 3HFML 4X8XA 1HHHB 3GMRB 1OP5H 2B20A 3QULB 2HTKD 3I6GB 4HUUA 3RIFF 1TJIH 3FO1B 4JZNB 3V6BR 4ODSH 1S5HA 1A1MA 5DHYB 1P2CB 2HTLD 4HG4K 4LSSL 3S5LA 4UTBH 3DX8A 2PYED 5J11B 1U8MB 4JY4B 1P4LA 4G42A 2FIKA 1TNMA 1YYMH 1V3MA 4MD5A 2VITA 1JBJA 3B4NA 4UU9A 5AUMA 4P57A 5FHBL 3GHEL 4UOW0 5FUCE 4PJAB 4K8RH 3RDTC 3EYUH 3CFIC 5GRJL 2CLZB 4LLVA 3OGCB 4UDUB 1YUHB 3C5SA 4JREB 4LLMB 3TEUA 1MI5B 4H26B 4IOFD 1OTTD 4NN6B 1JE6A 4KKNA 4WI4A 1NFDE 2CIKB 4LLYB 3LQZA 4R4FL 2WBJB 4NBYB 4NKIH 1DBBH 4PJHA 3ARDB 1B4JL 3K2UL 1EX0A 4KK5C 5DMJB 5MI0B 1FG2A 3ZTJH 3SJVB 2KZ1B 4WI6A 5JIIA 2HRLA 4QRPA 3DSFL 5DRZA 3EYFB 4ENEC 3SY0B 4FXKB 3AB0B 5KSAB 1WLHA 1N8ZA 2OQJB 1EH9A 3SO3B 3IDGB 5T1DH 2A6JB 1SEBB 1XF4B 2VAAA 2PW2A 1EVUA 2EDQA 2J8UB 1WZKA 2D31B 1M4KA 4IRJB 1I8MB 5DWUH 4FQ1L 2F74B 4W4OC 5H94A 2BNQD 1F4YL 2NY3D 2W9DL 3Q3GB 1JCKA 2APVA 5EZLB 1JZ5A 5FK9B 4GAGL 1LP9A 4ONOA 4EBQL 1YPZE 3D39E 1G6RB 2BSRB 4J2XA 2BVEA 1GGIL 2Q7YB 4IMLA 1J8HD 1FNGA 4X5WB 4Y88A 3MLWH 4LASH 4MNHA 1LO2H 2XG5A 4KFZC 3MCKA 3IT8D 4KKCD 1HYSC 4Q74A 4LMQI 4I0PD 2HJFA 1KENL 1X4YA 3VXRB 4D0CB 4ZSOE 1F4HA 3G6JA 3EYQC 5EC1B 2V17L 3UBXB 1D9KC 2BOCA 1T2XA 4LSTH 3HZVA 4A6YH 2CRMA 2PO6A 3T0DA 1NDMB 1YEGH 4AM0B 1DBMH 4Y16B 4BH7B 1WJ3A 4JFDA 5FDYA 1YEIH 4N9OB 2Z35B 5DC9B 3TFKC 2DQFA 2NZIA 1HCVA 4N8CL 1KJ2B 3BEWB 4G8GE 4I13B 1S9XB 2IBZX 4ZD3H 3MA9L 4AENB 4WEUD 1J12A 4PRHD 3PNWB 2IADB 2XZQL 4HJ0C 3MROA 2VXUL 4RWYL 5JPNA 4WJ5A 3RVTD 3MRJB 1NBYB 4HUXB 4QY8A 4KGLA 4BA8A 1NCBL 4RRPG 2ZUUA 4KDTC 3KPNB 3T2QA 1DE4B 1U95A 4NQTA 1IEAB 4Y4FD 5AG8A 1J0ZA 5ITBH 2AEQL 5HYFA 5E0QA 4JRYD 5DT1H 1OARH 5C0DB 4FFWC 1PG7W 1RV6X 1T21A 2CKBA 4RFNB 3SKMA 1IAMA 5CEXA 2HVKB 1FYTA 2NX5A 4BFEA 5C07A 4PP1C 5DJ0A 4GKZB 3WLBA 1U41A 2AK1L 1A9BA 4OCLC 4MJIA 1DN0A 1X4XA 3WHE0 2AJSL 1IQWL 3KPRA 3IFOA 3D9AL 1NDGA 1XF5A 4EUPH 2BVUA 3P73B 2OL3H 4HWEH 3GKZA 4TVPD 3S34L 5F9OH 3QQ9D 2R0LH 4MD4B 4Z0BH 3QI9C 3EZJB 3WS6A 3BKMH 1T3FB 2VLMD 4L3EE 2X9YA 4LCYA 1KTKE 3MXVH 3S36L 2FLRT 3O3DA 2WIMA 5MEQB 5IK3B 1FQ9C 5EUOB 3HUJF 3VWJA 9CGTA 3MV7A 4XMKH 3KPOB 5BS0A 4Z7WA 4F7PB 5C0AE 1A1OB 1CU4L 2DQDH 2PXYC 4NO2B 4TOYH 1S7UA 5CBAA 1C12B 3FFCE 2IG2L 2V9RA 4LU5L 1KGCD 4WU7B 3MBEB 1U6AH 1U0QA 1RUKH 4S2SA 3U4BH 3BZDA 5E2JA 3TP4A 2V5RA 3IJSA 4JZOB 3S96B 3QBTB 3PP4L 1ZLWK 3LKNA 1BD2A 4XBPB 3UC0L 5IFJB 3ARFC 4Z77A 5L2KA 1II4E 4QRRA 5IROA 3WD5H 4RNRA 4Y2DD 3VGGA 1XGUA 3ROOB 5JQHC 5SWQA 5JDSA 4QHKJ 2ZCKL 3CFKB 2LVEA 4V2BA 1QUNA 5D1ZA 1LEGB 1A21A 5GJSL 3S97C 4GAYB 4LHUB 5D5ME 2OMNA 2IAMD 3LN4A 3FB6B 2EIEA 4S1SH 3U82B 2AK4E 5DVKA 3VXMA 2Y6SD 2BOBA 4J8RA 4NWTH 3HI1B 2X4TA 1WT5A 3GMQA 3R8BB 1K6QL 1U8HA 5DMIL 5E2UL 3M1BB 1NMAL 2E5EA 5DJYB 4BK5A 1BOYA 2Q3ZA 1Y18B 5DC4B 4M4RA 5B8CB 3SE8L 3DMMA 4OCRL 1WZLA 3QUYD 2XN9D 4KHXL 4Z7VB 3S36X 1T5WB 3LPFA 3WBDA 3QPQC 3KXFA 3THML 3H42L 1MLBB 3PWJB 5IBTH 4YHZH 4NNYB 2VR4A 3GBML 3VFOB 3LCYA 1D5IL 2FEEI 3GHBL 4I3RH 3O6KH 5IMOB 4DFHA 5L8LB 5F9AC 3WNOA 2C1OA 5D1XB 4G8EA 3MRDA 5JR1L 1F3DH 4PGEB 4K94H 5SWSD 4ZTOL 4DW2H 3PL6A 1MH5B 5DUML 4P3DB 1YEEL 4PRNA 2UZIH 4YQXH 4Q0XL 4C55A 4BSVA 4QRSA 3T2NL 3QCUL 3OAZK 4HK0A 3D69B 4GRLA 5LGJA 3V0WL 4CVWA 3QEUA 4RZCA 1A6ZB 1MCDA 2V2TB 1ZA6B 4NM4H 5J1AA 5J9PA 3V4VL 3QG7L 3BVNB 2CSPA 3V9FA 4EN3D 2EIBA 5E8NA 4X6EB 3F7QA 3MA7A 2Y9RT 5E00B 1KTDA 4RIRA 1P9MA 2IMNA 1UT9A 2VDLL 3X12A 2ORBL 5GS0L 1T66C 3G5XB 3LIZL 4UQ3A 3UJTL 3MRIA 4MNQD 5FAAA 3GSNB 4BQ6A 2OR9H 4W6XB 1HHIA 2YRPA 4M1DL 4MDIA 2VLJE 4NCC2 2XZZA 5F1NA 1REIA 2X4QB 1I8LC 2KQNA 4YO0B 2GCYB 2EDDA 2NY2B 3HPLB 4YHKL 4HLJA 3HI6L 1FCGA 4XTRD 2AXGB 2AXFA 3TIEB 1HCFX 1DTUA 2YHGA 2QSTA 4U6HB 5T5FL 3W0WB 4WWKB 5FYJU 5DK0A 2VDKL 1DN2A 3C2SA 4OGXL 2V7NA 3CLEL 1CICA 4S1RH 1M71B 1CXIA 1IFHH 2FX9L 4POZD 1FIGL 1UH3A 2FZ3A 2XKUA 2MFNA 5JOPE 2I9TA 12E8H 3MR9A 2OJEB 5DJ6B 4E9LA 3V8CA 2DQIL 3MLXL 4DVRL 1A4JA 3U2SB 5DVLA 1X5YA 2EC8A 3U0PA 4PRAA 2A0LC 5FYKD 1GYAA 3AFLA 1EHNA 4DCQB 3SPVB 5FO8B 5DO2D 2O5YL 5J4MA 1I8KB 5BRZE 3D2UA 4OUOA 1K2DB 2X4SB 1ZT4B 5HVHC 3O6ML 4G5ZL 4RAHA 4UAOC 4NN7C 1MPAH 2PTTA 5D7JD 1GGBL 4HFWB 1KB5L 5D2NC 5IB5B 5DJCB 1C5CL 1S3KL 3BD5A 1NUFA 4OLUH 4PJHF 1C5BH 1WCQA 5D70L 1WBZB 5ESQA 2DDQL 5KS9B 5F9WC 1PW3A 5EO9A 1I3UA 1A64A 4O51B 3RUGF 1QA9B 2O5ZH 4G80A 4HWNA 1AXSA 4JQXA 1TCMA 4JKLA 4U1MA 4EI6A 3TWCH 1PSKH 1R5IB 1KXVC 3HAEG 3NA9L 4X6DF 4X98B 1RHFA 3MCLH 5I16A 1INEH 1EO8H 2F15A 5ICXA 5ERWA 4EZMA 3OHXB 3PWPA 1MHPH 5C6TH 3T0EB 1ZANH 4K23H 1F02I 3RWGB 4JDTL 1MVFA 1J0YA 1RURL 1TIUA 5DI8B 5EWIL 3MV8A 1T22B 3GSRB 4J3WA 3QFJD 4S10A 4H20H 3HC3L 5CZKA 4FQJH 4JFPA 3WE6A 5HYJE 2IANE 1JGDB 2OJZH 4LHJB 1GHFL 1RJYA 1U2HA 2R0KH 3C8KA 5DR5L 4IRZL 4JFFD 3AM8C 1NLDL 5BMFL 3VFTA 5DXWA 1UZ8B 3HUJE 3O9WC 1ORQB 1YMHB 4N1HB 4X4XB 5HYSB 5C1MB 3ARQA 4XNZB 3RBGA 5H35A 3FQNB 3RWFB 2W9LA 3FQXB 4BQ8A 4D8PA 2BVTA 3RVWC 3CPLB 2DF3A 5LAXB 2DQGH 5IW3A 4RBPK 4O4YL 1YMME 5KW9H 3GK8H 4KDWA 1A3LL 3RGVC 4N8VB 1D6VH 5FKPA 5D1QB 1WZMA 1DQTA 3VRIA 3OKKB 1FZJB 3TJHC 4M02A 5T1MB 4XCYB 4G7VH 2VWEE 4IIQB 2FO4A 4ZAKD 5HGBB 1CE1H 3VGEA 1CGXA 3W11C 1PKQA 4QHLB 2XT1B 4WI2A 3DGCR 1LO0L 4MXQD 4BUHA 3WUZA 1IM9B 2GJ6B 5C9JB 2XWTB 5J13C 4NGHL 2AABH 2C1PA 3TBTA 3RWJB 4G8IB 4YHIB 1JVKA 4HF5H 2X1XR 2PYEA 4BZ1L 1QHPA 3FRPG 3SKNB 1ND0B 1QPPA 1ZHLA 5I9QB 4N68A 1EERB 1INDH 4WHCA 1BECA 3QAZC 4GQPH 5HI5D 5I76A 3O6FC 4XC1L 1QLRA 4H88H 3VA6A 1OVZA 4NRXB 4CJ1A 5MERA 3LD8B 2XRAL 4HUNB 1D5MB 1DANU 1WC7A 2ARJQ 4P46B 1X7QA 2EYRA 4LGPB 3T0BA 4WEMB 4JVPA 3PWVB 2QADD 4R90L 5TFSL 1MUJB 3CSYA 1H9VA 4M1GH 4U0RB 5KVMC 2G9HB 5J12B 5EBWB 2R69L 3VXSE 5HBBA 4H25A 2C4XA 4U6XA 2DM2A 3QR2A 3U0TB 2X4PB 4F9PA 1EEZA 1C16A 1G7IA 1WV7T 3E0GA 3RL2B 4QNPE 3MFFA 4WW2C 1BOGB 2VKXA 2XIDA 4WCYL 1TZHA 4NSKA 3MFGB 1CFSB 1IAIH 5IV2A 4HS8H 4CJ0A 1N59B 3QJHB 5C08E 2D7TH 5CMAA 4OLYL 4RMWA 1RUML 4E41A 5B4MC 1FDLL 4NDMA 1FPTL 5I2IB 5INCA 3D0LA 3VDBA 43C9B 2OI9C 5ID0B 5DQJA 4HZLB 3TT1L 3AREB 4CW1A 2NNAB 3GI9H 3WS3A 4EI5C 4XVUC 3IFNL 3BH8A 3SDYH 3UDWC 3GJFK 3C08H 3RWCB 1ZHKB 3HB3C 1LK3L 3MACH 1ES0A 1NGYA 2HP4A 2VZ1A 1J8HA 1OQOA 3MJ8A 3VGDA 3HFMH 4ZNEE 1YQVL 3N1GC 3SCMC 3MRCA 4POYA 4KMTL 4OFPA 5GRYA 3STLA 1MCBA 3X11A 1HSAA 4AMKL 5IBUG 1FH5H 2XTJE 3F5WA 4NRYA 4I0PA 5IMLB 3WIFA 4RFEA 4TVPL 3H9HA 1P6AB 2GT9B 3GMPA 4Z0XB 2DMKA 5T3XH 4LSSH 1RI8A 3PP3K 4U49A 1CT8A 1TITA 3M17B 3VFWB 1J1PL 3KPQB 5C0IB 2WQ8A 5GZOC 4KZEL 3FB8B 2A9NL 3CXDL 4L3EB 4I9WD 1EEYA 1QSED 2NTFA 1XCTA 4OI9A 3VE0B 4LKXA 4BUGA 1PJ9A 1H3TA 5FHBH 1IAII 1OGAE 3GHEH 2P24A 1DL7L 1WAAF 5GRJH 2V2XA 4P5TB 1T80A 5C0AB 4L3CA 1LNUA 3FO9B 1I7UB 5JLZB 5K9KA 4R4FH 3FHQA 3CCHB 5SWZB 3D5OF 1P5UA 3KG5A 3NCMA 5IOPB 1B4JH 3O3UN 3K2UH 1EFXD 5C3TA 5A2JH 2NYYC 4FQHB 5J57B 3L7EB 4OCSL 1YEDB 2GI7A 3DSFH 5F1SA 1U2CA 3SDAD 5IJKC 5DGRA 2DL9A 4ZPVB 2ATPB 4JRYA 4PJFA 1AI1L 3B9VA 3EDFA 3MPCA 4YZFF 3D0VB 4AIZB 5IKCA 3TH2T 5JZ7C 5JO5A 5DJXB 2AJ3B 3IDJB 2PYFB 1IGIL 3HC4L 2HT2C 3C8DA 3HC0B 3QUZB 3WDIA 4NHCL 5I6XC 4FQ1H 5F3BB 4G8FA 1ZLUK 2H41A 4I77L 4K7FA 1F4YH 4P4KB 2W9DH 5CWSB 3ALPA 4PJHE 1UH2A 4ONHA 2NR6D 3LS4L 5IUSA 1T5XB 4GAGH 3RVXD 1OSZA 3BPLB 4ZXBD 1OTSD 1FJ1A 3RUGE 1X5GA 5HVWA 1GGIH 3MRHA 3QG6B 2PW1A 4PJ5B 3SDCC 3BUTA 4K8RC 1MCJA 4X6DE 5KZCD 4X4YA 4JG0L 3I6LD 4R7DA 2Z93A 1LDPL 5IVZB 4G9DA 1F6AB 1KC5L 4LNRB 4LKCB 1KENH 3RU8L 3KLSA 5F7FA 3VA2C 2R15A 2V17H 5F3HB 4KJWC 1HSBA 3VRJA 3NCFB 4YE4L 4Z7NF 4PG9B 3BPOB 2CUHA 3QCTL 3K7UA 3WO4C 5J3HD 3QXDB 4EIZC 3PV7A 1RZJL 3RJDA 1G1YA 1LP9E 4NKMB 3ZKMC 1U93B 4N8CH 5I75B 3L9RB 5IHZB 1VKXB 2DWEA 1AQDA 4LCIL 3MA9H 5JHDD 5CKAA 5DDHB 3QSKB 2XZQH 5C2BL 4Y2DA 2LVCA 5GS2H 5GSRB 2VXUH 4RWYH 5TGBB 3IXTB 4PJBF 3U36A 1I8IA 3CMOL 1JF6A 2QSCL 1TVBA 4KKAC 1JP5A 1NGZB 4X4ZA 5HHOD 1NC2D 1NCBH 1G7QB 3G6JE 3KHOA 3L5JA 1OP3H 3VFVA 3RAJL 3T2OA 1TVHB 2I25N 4U1JA 3I3BA 3U7AA 1EAPA 3CU7A 3K1KC 3FFDB 2IAMA 5TQ0L 2MNUA 4JZJC 3UZEA 3T4YB 3MRQA 3QQ4B 1P4IL 4BSWB 3AS2A 2BVQA 2AEQH 4KTYA 3QUXC 1F6LL 4GG8B 5JOEA 5DK2A 3VGFA 4ODUA 5I1JL 1G7PB 2D7MA 1D6EA 1Q94B 3AXLA 2GTZA 4OQTL 1AP2B 1OAXL 5KVFL 4OF6A 3BSZL 3VFMB 3ZSTA 4F7TA 3QUYA 1XR8B 2UUDK 3WXWL 2AK1H 4C83B 1OW0A 2AJSH 1IQWH 4F15B 3D9AH 4ODWB 3LEYL 1HOCB 1NJ9A 2A6KB 3C09B 5ETUA 4XX1G 4MJ6A 3PJSA 3S34H 4YXLH 1KLGB 4ZUSA 2FBOJ 4KZDL 1YY9D 2VQ1B 5SWSA 5DVOA 1WZ1L 1FZOB 5CP7B 5C71A 1KJMB 1I7ZA 3CC5B 2JJSC 3BKYL 3WEXB 1H3WM 5KVEL 3B5HA 3JV4A 4BH8A 1DQJA 2YD8A 3MV11 1LD9B 2APBA 4Q9CA 4NQVB 3WIHL 1CU4H 3L3GB 3OAYK 5FYKL 1TZGL 2EDWA 3T1FB 1I1AB 1S9WA 1KPVB 2IG2H 1KEML 3KPRE 4LU5H 4S1DD 2Y25A 5ACZB 3NTCL 5TE7L 2LE9A 5F9JA 1HWHB 2WW8A 4EN3A 1Y6KR 1DFBH 1NGWB 3PP4H 5FGCE 5CSBA 3UC0H 2BRRL 5JORA 2H1PL 2F19L 5GGRA 4M1CD 2FNBA 2H6PB 5FF6A 1ETZB 4MLIA 4DWHA 2VLLB 4MMZC 2VXSL 3BPCA 5AWNL 1FVDA 1QACA 1HXYA 3MV7E 3OR6A 4CUCA 2EXYC 1TPXB 3VGAB 4Z7WE 2ZCKH 3DURB 5FYJD 2QHLA 4YEFA 5GJSH 4KROB 4NZUL 4OIAA 2WUBL 4YXHL 5BOPA 2VDML 4HZAA 1CTOA 3EYSL 1Q0YH 3D87B 4E0RA 4AL8L 5I18L 1K6QH 5DMIH 5E2UH 1NMAH 1L0QA 2LTQC 5JW5A 3OF6D 2A6DB 5HHME 3FRUA 2KUTA 3TO4D 3SE8H 4OCRH 5CILL 4KHXH 3K4ZA 4TNVK 4MSWB 4NO0B 3RZCC 3V0VA 4WRLA 3RY6A 3THMH 3H42H 1OOAA 1OB1B 2P43B 3MV9B 5F7LB 4HX1B 1CR9L 3PG2A 1UB5B 3MYJA 3GBMH 5DMKA 1MHCA 5E24E 3GHBH 3RVVD 2AV7A 1NCDL 2WLZA 2FBJL 2DYPB 4PJCF 3VFPB 4JY6B 4MS8D 5JR1H 4R9HA 4OGYL 3WIHA 2EYSB 1P53A 4UDTB 1WAAE 5DD0L 3FOMA 4ZTOH 3HR6A 5DUMH 1S78D 5KSVA 1XGYL 1RZKL 1YEEH 3CAFA 4WI8A 3DGGA 4JM4L 5LBSL 4Q0XH 3BRGC 5ICZB 5D7JA 3A67L 3LKSA 3T2NH 3QCUH 3DVNB 3RDTB 3F6LA 2I9LA 3P4MB 1MSPA 5M7QA 1QBAA 4CGTA 2VJXA 1Y6NR 3QG7H 4M8VA 1S9YB 4I2XA 1SY6A 3N1MC 5DQ9B 4DZ8B 1J87A 5HY9B 1G9ML 4O5LL 1URLA 5EU3B 1KUMA 4YZFE 2X4RA 5DZOA 3STZA 3FTGB 5CSZB 2VDLH 2ORBH 3K4DA 5GS0H 1AFVL 5A3IC 4U2ZA 3UJTH 1VACA 5F7YC 3QHFL 4Q58C 2NW2B 3OKEB 4M6OL 4RA0C 5F7EL 3ZTJG 1EDQA 2R2HA 4M1DH 5GIRB 1CG9A 2DL2A 3N1QC 2AW2A 1JTOA 3TPUA 5IW1A 5DUBB 3QFJA 1JPFB 5HVGB 3HLAA 5T5NG 2XXCB 4H1LH 1JZ6A 3UO1L 4YHKH 2DIBA 5MEOA 4M3KB 3HI6H 2R2CA 5GS3A 2FO1A 4JFFA 4K94C 1YECL 4H0GA 4A2MA 5IVXA 4RDQF 5T5FH 2HVJA 3DXAD 4UT7L 1ZVYA 4D9RD 3ZE2F 1NBVL 1M6OB 2R4SL 2VDKH 1I85A 3IGAA 4OGXH 2VLRE 2C3XA 2Z8VC 3CLEH 4XPBL 3L5WB 2FX9H 5JW3L 3HI5H 1FIGH 3S3SA 1R3LA 5I30L 1TQBC 3J8F7 4LFHD 5INDA 3B3IB 1YNKL 3AVEA 1BF2A 4X8JA 3B9AA 4LSUL 3JWDL 4Z7NE 1DQML 1GPOL 2W9EL 2DQIH 3FCTA 3MLXH 1BBDL 5EBMA 4LQFL 4DVRH 3BZ4B 3MXWL 4M48H 4ZO6A 5DVNA 1D9KB 2X42A 5FV2A 5EC2B 4PLKD 4ZAKA 2O5YH 5H37H 3OAUL 3VU2A 3FT3B 2JCCB 2X1QA 3O6MH 1F8TL 4G5ZH 2VC2L 4PJBE 4P2RD 4JHAL 4OD2B 3TNNA 1S7RB 3IJHA 1JZ8A 1GGBH 2H9GA 1SMOA 1KB5H 1M05A 4FP8L 2ZUTA 2NY4C 1CDJA 3L3OA 3WN5A 1S3KH 1KEGL 5EO1A 5D70H 2FR4B 4KRPC 2GSIB 2R1WA 3RX8A 1N5YL 1EJOL 4XP5L 1JYNA 3ARDD 4L8SA 3V5KA 2IPUG 3BZFA 5D7LE 1RIUL 2APWA 4YDVA 4QWWC 4MAYC 3ETBF 4U1IB 4PRPB 4ZUTB 3GB7A 1DEEB 4M7KL 2ED7A 3FONB 1MFBL 2Z92B 4YHPB 3IAGC 1HKFA 3STBA 4PGBA 3FOLB 3MOQA 2YC1A 4JDTH 3QDGD 1RURH 4K3EL 4EVNA 5CGYD 5DMYA 5EWIH 1ZGLA 1QP1A 4DKDC 1G7MA 3HC3H 4Z7UB 2YD5A 1JI2A 5JHLL 2A1WL 2ILLA 1CQYA 4P2QB 1GHFH 1IGTB 4G9FB 3RNQA 3TN0A 5DR5H 4IRZH 1NLDH 5D6DC 5BMFH 1BWMA 2Y7QA 5C0JA 3GSQA 1RD6A 3IETB 3IS1X 3R06B 1XGRA 4WHDA 4XNXL 1HI6B 1NANH 4ZFZA 5JXED 3QIWA 3WO3B 1CLCA 3QI9B 3Q6FA 1K8IB 5KN5A 4EUPG 3MO1A 3C6SA 2NY0C 1OAYL 4WU5B 4M7LL 4X5XB 3S35L 1UB6A 4TSAL 2FJFB 1IJ9A 3PWPE 1QRND 1J0IA 1MELA 3QWQB 1FORL 1OHQA 4O4YH 3MRPA 4NQED 3VFSB 4BZYA 5TDOB 2DM4A 1A3LH 5EU7E 1Z3GL 2A74B 3HAEB 1I7TA 4JHBA 4J1UA 2R1YA 5EPMA 4CADB 4EIGB 1F3DJ 4JFYB 1HH6B 2PXYB 4TN9A 5FYLD 3UYPA 5IB1A 1QOKA 1HQ4A 4MLSA 5AZEL 1GIGL 5A40E 1QYGH 5E94A 1ADQL 4HUVB 1WBYA 3CFCL 1MQ8A 1LO0H 5LXGL 4H5SA 1U8LA 3TLRA 1D5ZB 2Z91A 1RY7B 4UTAL 4NGHH 4NQDB 4F58L 4DEPC 1G7JB 2VRAA 3ARFB 2W91A 3N50A 1T7WA 2XPGB 1WTGT 3P9MB 4LLUA 4EDXB 4BZ1H 1TQCC 5F9DC 2X70B 4P59L 3VXOA 2JB6A 1FFOB 3MRMA 1DLHA 1ZWIB 1P6FA 4XC1H 1QEWA 1UEYA 5KVGL 2XRAH 4TUOA 3PGDB 4H8WL 3SDXA 1I4FB 3F62A 1U91B 2Q3AA 4R90H 2XFXB 1IILE 5TFSH 3QFDB 3UAJC 2DKMA 3ULUD 4XGZA 1H15A 5HDLA 2R69H 1CI5A 3K8MA 1HKLL 3CUPB 3SO5A 3HE6D 1EFXA 2F53D 4PIRF 5DD6A 4PGJA 2YK1L 3S35X 2ZP0T 4ZUWB 2X10A 4WCYH 3AY4C 4JKWA 2W0FA 4Q2ZA 3SDAA 1MY5A 4HKXA 4UNUA 1MLCA 3P40A 4OLYH 3V52L 1RUMH 2V5MA 1OF2A 5C09D 4Z9KB 1FDLH 2YMXL 3EFFB 1FPTH 4QYOA 1R3KB 1OTUC 4MHHI 4KI5D 4MCYA 3MRGA 1V05A 1AXIB 1KIRA 1Y0LA 1ADQA 3TT1H 3WDHA 3IU4L 5C0BD 1XAUA 4NJ9L 3IFNH 3O2DL 4ZXBA 1FL5B 1BQLL 1LK3H 4RAVB 4PUBL 5DS8A 1KLUA 5MEND 4Q6IA 5T1KD 4OD1L 1YQVH 4MJ5A 4KMTH 3MBED 4AMKH 1Q9WB 4C57C 1WWWX 3PDOA 4E41E 4TVPH 4OZ4B 3RPIA 4FQXD 3OGOE 1J1PH 1FL3B 2G2RA 1PVHA 4KZEH 4JVWA 4APQC 2A9NH 3CXDH 4YFDB 2FYYA 2EXWD 4JG1L 5CIPB 2BNUA 3DROA 4OB5L 1UENA 1A3QA 2DI9A 4HJGB 4KK6C 4LHQB 4AEHL 1DL7H 3ZE2E 5DK3A 5D96C 1RUQL 3REVA 5HHPB 2Z0BA 1J88A 1SYSA 4KQ3L 1AGBB 3TT3L 3OR7B 4WI3A 5J7CC 4KUZL 2VUYA 3DV6A 1SJHB 2VZUA 3KNBB 4HUWB 1Q72L 5HHOA 1NC2A 4HAFA 3IDYC 3MRLB 1QSZA 2VDNL 3PQYD 4X4MA 4OCSH 2DJSA 4F7MA 5IBUB 4JFQB 2MHAB 3I85A 1AI1H 5DSCB 1ED3A 4PY8J 3W9EB 3EYOA 3O2DA 2P5WE 2EDEA 4Y2OA 3T3PF 4R6UA 5FYJL 1IGIH 3HC4H 4HIJA 4KUCF 4XHJD 1HNGA 3ZKXC 4QXGL 1CCZA 4JGJA 4Z6AT 3BUYB 4FQ2L 4I77H 4JKKA 2YPKA 5CHNA 4M9PA 1RK1A 3SQOL 2EZ0C 5E1AB 2FCBA 3LS4H 5HVHB 4DUVA 2AGJL 4UAOB 4NN7B 5JTWA 2VL4A 3GO1L 5D2NB 3P4LA 5GZNC 1U8PA 2E8YA 3T4AA 3AUVA 1XR9B 1R5WA 1BVLB 4X99A 1KJ3H 5F9WB 1AIFB 4L1HA 2PO6C 4PJFE 3HCVB 1N0XL 2R9HC 2D9QB 4QOKD 4X80L 1LDPH 2WSKA 3ILPB 5ID1B 4I4WB 1KC5H 2ZCLL 5BZWB 3LPGA 3RU8H 1PZ5B 4PRID 3ARUA 4LCWE 3BXNB 3GMNA 4YE4H 2CQVA 5LGHL 3QCTH 6FABL 1RZJH 1JGEA 4GKSB 1B0RA 4PBVC 1NBQA 1SBBA 3FT4B 2IPKA 2ZSWA 4OIIL 4LCIH 1TETL 1Q8MA 1X4ZA 43CAA 3GJFA 5C2BH 1RZ8A 4GS7C 4O2CA 1JMZA 3CMOH 3CVHL 5IB3B 3MREA 2QSCH 2GY7B 3O9WB 4HV8A 3OB8A 4ALAL 1HNFA 3RAJH 4JM2D 1JV5B 4HWBA 2EDTA 5HPOA 1TFHA 2CIIB 2ZG3A 5EU5B 3B2UD 3LY6A 5GGSY 3IXAB 4B53A 3UEZA 1I7RA 3BP7A 3PWLA 4M93C 4TUJA 1FNEB 3PWUA 1AO7D 4CU7A 4G7YL 4GXUN 1P7HL 2HKHH 2P5EB 3RGVB 1N6VA 3JTTB 5ISZB 5I1JH 4U31A 3OF6A 1CFQB 2ZCHL 4L3AA 4OQTH 1OAXH 2Z31A 5KVFH 3BSZH 5J1SC 3S6CA 3TO4A 4WY7L 3WXWH 4B41A 8FABB 5C0CD 3GGWA 1DLFL 4ZFOB 1MCWW 3LEYH 5I1DA 3IF1B 5J13B 1R5VA 3RWIA 1DUYB 4JLRB 1QR1A 3VD4A 4KZDH 1HYRC 3DYOA 4PJDF 4KKLD 1UCTA 1WZ1H 5CEZE 4KK8D 3ZHKA 4NBZB 3BW9A 3QAZB 3DX6A 3RWHA 1O7VA 5E9DA 3BKYH 1JHTB 1JRHL 3O6FB 4ZPTB