2Z31C

Crystal structure of immune receptor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31C02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2z31C01
1JWUB 3SDCB 1F3DJ 4JM2D 3QQ9C 4EIGB 4M93B 3H9SA 4XXCA 5EC2B 4X6CA 5I17A 3HCVA 3LQAL 2JTDA 4G42B 1U36A 3G5YA 3T0EC 3P0VH 3CFCL 2BSTB 3DSFL 5HGBB 2BX5A 2DJSA 5GGRY 4C58B 5CSZB 2Y07L 2IQAB 4RX4D 2F58L 4OGZA 1GHFH 4MMXC 5EOCJ 4ODBD 5CEZD 1F13A 4K8RD 1MHPH 5DJZB 1CBVH 1WWBX 5DJ0A 3BO8A 3VGDA 4K3JL 4QGYA 3SDCA 5C9JB 2MHAA 1F2XK 1RU9H 5EC2A 2PUQT 4UINH 4CU7A 5EA0H 1GZQB 4PB9L 4KQ3H 1INEL 2BSTA 3K2UH 5HGBA 4MNHB 4DVRH 5FYJE 1AXTH 1CDGA 2K7PA 1IL1B 2D0HA 1W0YT 3H42L 5SWZE 4MXVE 3TO4B 3BT2H 1P7HL 3FFCE 3L3HA 5FAAA 2OXHA 1A9EA 3BD4A 8FABA 2F54D 1HEZA 1PG7H 1FVEB 2UY7A 5CD3B 5FYLD 3RHWK 5C9JA 1RFDL 2RB8A 3QA3B 5DD5L 1FCCA 5BZDA 5IGXH 2VR5A 4F7CB 1GZQA 4OIAA 1T6VN 4KRPB 4N1HB 1Q94B 4XWGL 5I16B 1N59B 4P23D 3JV4A 3BDYL 4WDIB 4PGEB 3TO4A 2ZCLL 4K94L 2W9DL 2XA3A 4TSCH 5DRZA 2O5XH 2R4SH 2W91A 3VWKB 5FO7A 2W0FB 1FVEA 1V3KA 5CD3A 3QA3A 5IW3A 3PXJA 3RDTD 3CU1A 4JE4B 1TTGA 2J8OA 1KUMA 3PQYE 4G8GE 3L5JA 4UTBL 2GITB 2MQCA 2HRPL 3GMNB 4Y2DD 5D1ZD 4U7KA 2VE6B 1FFQA 2P8MB 1FVCB 3O3EB 4WDIA 4Z7WA 4PGEA 5FECB 1KB5H 3KXFD 5DRWB 5EU6B 2FEDD 4NOBA 2IG2L 1XIWD 1KV3A 1KIQB 4R3SB 3GGWB 1IAII 1FAIH 2PO6C 2NY6D 4HBCL 3V6ZB 4YX2H 1LEGA 3EJYD 5HJ3B 4D2NA 3O8XD 1FNSH 5FEBA 3CVHH 3RY6A 4KVNL 5B8CB 3GMNA 2VDMH 4GT7A 5ANMB 3U30C 3BISA 4UQ3A 1T04B 3VFTB 3BMWA 1I8KB 3KNBB 2YR3A 3QDMA 5IVOA 5GGTH 3WNNA 3RL2B 1W72H 1QFWL 2LFGA 3GGWA 4M1CC 4OFVA 5LJYH 4LSSL 4PJIE 3FMGL 2PYFB 5HJ3A 4YZFE 2ILLA 4TRPH 3OAUH 3O6LL 3L7EA 4JPWL 4XP6L 1DBBL 5ANMA 5A1AA 3SE3C 4M62H 3SDDD 1I8KA 3V5DB 1HQ4B 3ZE2F 3ULVD 5I1GL 1H5BC 4GRLB 5E8DH 3RL2A 4ZMAT 4Z7WF 2FJFB 1WSST 3HNSL 4XNXL 1CT8A 1NBZA 4G7VL 5JDJA 4J8RB 3TBVA 2DF3A 3C8HA 2PYFA 3K7UA 1H15B 1LGVA 3K4ZA 2V2XB 2ZPKH 5HD8D 4MZ3A 4UB0H 3HNVL 1CU4L 4K55A 3SJVD 3OR6B 3ARUA 2JCCB 4PP1C 1S7UB 1NH6A 3MNVB 3V5DA 3TH2T 1T6WA 5F3HB 2NY5L 4JG1H 1A6TB 2AS5M 2CKBB 4Z7OE 2FJFA 2R0KH 4I1NB 3VXUB 2ORBL 3F12A 1HNGA 3NH7H 1NCDL 1J1PL 1YEDB 2I9LA 1BQHG 1NLDH 5F9OH 1B4JH 2V2XA 3MUZ1 5KZCD 5JZ7C 3CZJA 2Q76A 4PS4H 3RWJA 4PJ8D 2YPKA 1K8IB 3OR6A 2JCCA 2J88L 5KVDL 5LXGL 3MNVA 1EFXA 5F3HA 2NY3D 1Q9OA 4EI6A 4APQB 1A6TA 2CKBA 4F7MB 1T0NA 3BJLA 4JVUA 2P44B 3O45B 1YEDA 2DI8A 1HOCB 4G6MH 5F72S 2YK1H 2VR9A 3LKOB 3I02B 4QF1A 4HS8H 5CGTA 1MCIA 5CJBA 4W4OA 1W0VB 5IJKC 4TUOA 3WD5H 1KLFA 3TLRA 1AO7A 4HIJB 4PTUA 2P49B 2HP4A 4XCFL 5IB3B 1T80A 1EJ6A 4LEXH 4L1HA 4OZHA 3QEHA 4WFHE 3JWDC 1R3IL 4BZ2L 1YN7B 5F9DC 4L8CA 4NM4H 2HVKA 1I1AC 4Y8DC 2J8UB 1QQDA 4LLUB 4M8VA 2Z4QB 4X7EC 3VD3A 2BJMH 3O45A 5GJSL 4LIQH 3LKOA 4GBXC 3VRIB 2X44D 3VFSA 3UTQB 4ZOAA 4AMKL 3NPZB 4YAQA 3NABH 4I3GA 3BZFB 3I50H 4EIZC 5T1LA 1WVZA 3IXAB 4HGKC 5IB3A 3RQ3A 5GRJH 2JCCF 3WEXB 1K2DB 4DN3L 1RUPL 4PG2A 3IJHA 5BS0B 5HGDA 4LLUA 2Z4QA 2AI0H 4V1DB 5F7WC 4Z7VF 3P4NB 5HDBE 3QXAA 2X4QA 4NKMB 4YH6A 1E4KA 2XZZA 1CGSL 1WTLA 4HUMB 4YQXH 2FEEI 4LHJB 2GY5A 1QLRA 2BVOA 2YPLA 1OAZL 4NSKA 4LMQI 4XC3L 3ZT5A 5DFVD 3W39B 5BS0A 4OZHF 3AS2A 2D03H 4V1DA 2EEBA 5D70L 5GZNC 2QADC 5AEAA 2EDJA 5E9DE 1Q9LA 4NKDA 2Y23A 1FJ1B 1N7MH 1TVBB 5INDB 1IQWH 3BE1L 4PTTB 2Q8BH 2XXCB 5EBMB 1JRHL 5FYKH 5BCAA 3LMJL 4QRPB 5EUOE 2NY2B 4XCEA 3Q1SH 4R0LB 3HS0B 4UOW1 1S9VB 3BP5B 4BSVB 5DT1H 3RIFF 4KRNA 3GSQB 3HC4L 2DICA 1EBPA 5IFAH 1EVTC 3IDYC 4H1LB 5SWSB 3M1BB 1FJ1A 1U3HB 5INDA 2XWJB 5FB8B 4PTTA 4JFQB 5I15L 3K4DA 2JIXD 3BYYA 1JGVH 2F74B 2R56L 1QPXA 4X6EA 4QRPA 4WU5B 3D0LA 3KYOB 1JN6A 3MLSL 2YSSB 4R0LA 3HS0A 3O3BB 3BP5A 4RAVB 4BSVA 4Y4HC 4P5TB 1KTLB 3GSQA 5JA8B 1ZHLA 3GBNL 2O5ZL 3ARDB 4IOIB 5SWSA 5E7FA 5FHAL 1A02N 2XWJA 4EBQH 1DQML 5FB8A 1HYSD 1QZ1A 2BY0A 2EZ0D 2WV3A 4PJBE 2RQ8A 4JFQA 2AJSH 5I1HL 4PJFA 3G04A 4WU5A 3L95B 1CLOL 2E6JA 1CXIA 2JB6A 3ZKSD 4Q58C 4P5TA 1KTLA 3A6BH 2OLDA 4MA3B 1OLZA 4IOIA 4JR9L 3AB0C 3MROB 1KJMB 5I6XB 4H25B 4WO4A 2FSEB 3Q6GL 4XVSL 5L8KB 4XX1G 5JPMA 5EZOH 1P7QA 3WXVH 5MEQB 3OZ9H 3MV8B 3HC3L 3AM8A 4NC2B 3TBTB 3EYSH 4U1KA 1A4KB 4JPKL 5CP3H 4HWBA 1SYSA 3MLXL 3ARBD 4L3ED 4MA3A 2VDLL 1KPVA 3W81A 3MRFA 1PFCA 3OKKB 1S7RA 2ITDA 2YN3A 4TVPE 2Q7NA 2GSIA 3BPLB 3MROA 2G2RB 4KDTA 5CUSL 1KJMA 3RVVD 2J7LA 4P99A 3L3KB 3HFMH 3GZKA 4O4YH 1DFBH 1WZ1L 3MV8A 4CMHB 1TZIB 4JY5L 2NXYC 1NMCC 1G7IB 1R5VA 1C1EH 5HHPB 1HXMB 3TCLB 4LPXA 4PJFF 4CJ1A 3S88L 1C7TA 1HI6B 3OKKA 1RK0B 3TVMB 3IVKB 5ALBL 3P4MB 3LN4B 3RVUD 5DD1L 4HLJA 3SO3C 4XI5D 1YECL 4IIQA 4M6OL 5L2KD 1BEYL 1RV6X 2AXFB 2IALB 3O2DH 4S0SD 1E4XL 4ZDHB 2M1KA 4NUJB 1YPZB 4FZEH 4ELKB 5H35B 1TJHH 4D3CH 1A2YA 4H1LG 5C0JB 2R2EA 1G7IA 5HHPA 3TCLA 1HXMA 5JR1L 3QDJD 4ZPTB 4XB7A 5J3HC 1HI6A 5D1XA 1RK0A 3HC0A 3TVMA 5EUKA 3IVKA 3B5GA 3LN4A 1CIUA 5GISL 1QO3B 4L5FL 4MXWH 2C26A 3S35H 5IESH 4MXQD 1DQLL 2ID5A 4XBPB 5I74B 5CEZE 2IALA 2RJMA 4NKIH 25C8L 3KGRA 2CRZA 3DMMD 1RZFL 4MSWB 2K9UA 2E8ZA 3BWUC 1CR9L 3NCJH 1TQCC 3ZKMC 3LHPH 4WCYL 5H35A 2QBWA 2VWEC 3S5LB 5BZWA 5EOTA 1Z6JT 3AREA 2H2PD 1T2XA 2CR3A 4LVNC 5EU7E 4ZPTA 2NX5B 3IDJA 3BEWB 2PTTB 5B38A 4NBYB 1JUFA 4XRCB 2P42B 1JYVA 1OSPH 1NL0H 4XBPA 2I60H 1PKOA 3KPMA 1NCBL 2RR3A 3AGVA 2IPUK 3MNZA 2F54E 3CH1B 3TYFA 5FYLE 4AZ8A 4K3DH 4BSWA 4XCYA 1BVLB 5CEXA 4M6MH 4PD4K 4ETQA 2XYCA 4JB9L 3B2VH 4HH9B 4Z95H 2NX5A 2PTTA 1K3IA 1YEEH 5CFHA 1ORSB 4NCC2 4XRCA 5FKAA 5T1KA 4YXLH 3MTRA 2OMNA 4FQXB 4GH7B 3RZCC 3DYOA 3D2UD 3CH1A 4DQOL 2ZCKH 5L88H 2WK2A 5SX5K 3NPSB 1P7KA 2QHLA 4XP4L 1BVLA 2E9WA 1X6NA 2W60A 3I3DA 4MJ2A 4QXUH 4HH9A 3VFWB 4CNIB 1V05A 1GAFL 3LEVH 3CSYA 3VXMD 1IGIH 4XP5H 5F9JB 3GSWB 4R4FL 1IT9H 2MPAL 1M6OB 3CK0H 3THML 3GRWL 3KXFE 1G7PB 2JJTA 2CJUL 4N0FB 4KWUA 4NQSB 2GJ6E 1A6UH 1DQTA 1L0YA 1VESA 4LHUA 4BK4A 4HAGA 4WWID 4LLQB 1G7QA 5ICZB 2OR8A 2UWEE 1CD0A 4EN3D 5GS0C 3MLRH 2F19L 3RVXC 1FCGA 4KVCL 3MJ9L 3VFWA 4JRYA 4L8BB 1DBKH 1VFAB 1X5FA 3TA3A 4LSQH 2O61B 3GSWA 4M48H 4UV7H 4ZFFA 3S34L 5DF0A 3CFJB 1G7PA 1MREH 1NC2D 3T1FA 1YEIL 2N4IA 5FGRA 1TJGH 2RCSL 1WISA 2EKSA 5L8JB 2OQJA 4LLWA 4F7PB 3LN5A 5ESQA 1HINH 1RVFH 5IMKB 1EFQA 5C70A 4L8BA 2R0LL 3UC0L 3LKQA 5T3XH 4LSTL 3ARZA 4P2RB 2O61A 2ZNXA 3V0VB 3WIIH 1WAAA 3HI1A 4QY8B 4Y5XC 1WCQA 3S5LG 4HUUB 4HK3J 1T66D 1OTSC 3HZVB 1AXSB 3UCRA 2V5SA 2VLLB 1FDLL 2J6EA 4KV5F 2X70A 4X5WB 2AP2A 2VUYA 2ADGA 4M7ZC 4PV9B 1XGRB 2ICEB 4F7PA 3GB7B 5EOCL 4WY7H 2IANA 4MA1C 1IGCL 2OXGA 3OKEB 4R96A 2E7MA 3TZVD 4P2RA 3SJVE 1GGIL 2XWBB 3VRLF 5CP7B 5I0ZA 3V0VA 1NFDF 2BRRH 2HJLB 1QR1B 4JVPA 4J1UA 5D2NB 3HZVA 1CDCA 2VZVA 4WHCA 1RUQH 4M5ZL 1AFVL 1B90A 1UKSA 4KAQL 4XC1L 4H88L 3BMVA 1BD2D 5AZ2L 2QL1A 4HG4K 3HRZB 4NKOA 3DXAB 3GB7A 2PXYA 2OL3L 5GRZA 4DN4L 4Z8FL 1DSFL 2WM0A 1KTRL 1GGBH 3OKEA 1AQKH 4JJHA 1YN6B 1BREA 5J12B 4TTDC 4WWKC 4JFOB 4P5KB 2Z35A 4WI6A 4QT5B 2OM5A 3UZVB 2HJLA 4M7LH 5K9KB 1QR1A 3MV7E 5D8JH 1OW0C 3GKWL 1FHGA 5I18L 1NEZG 4WI2A 3TT3L 3GHBL 1WAAF 5IW1A 2FYYB 5FA4A 2QSQA 3DXAA 5B3NA 4M02A 3UAJD 3MBEB 1TZGL 4MHHG 2X09A 4U1GB 1IBGL 1X5ZA 1YN6A 3U9UB 3OAZH 1GIGH 4JFOA 4P5KA 2OL3A 4QT5A 2AJUH 5K9KA 1BFTA 4JN1L 2NLJB 5B4MD 3U2SA 1U9KA 1QYGL 3LY6A 3QXUA 4JGMA 2FYYA 2R1WA 1JPFB 5H94A 5BVPL 3SCMC 2ZZUT 1P1ZB 5FO8B 4KZEH 4OFKA 4AG4H 3MCG1 1QHPA 4X6DB 4E5XB 3MBEA 1MLBA 2VDOL 3T4YB 5AG8A 1Y0LB 1IAIH 4YR6B 4C55A 5DJAA 3U9UA 2HFFB 5IEKB 1R24A 3BRDA 1SEQH 1S3KH 4RISH 4LKXA 5C08E 3QO0A 2C4FU 2W9LA 3QP3A 3ULUD 1P4BL 4OGAD 2DQEH 3EOTL 4WHYH 4HUNB 2G9HB 3F7YB 2CSPA 4LCIL 5J8OA 1AGFB 1JPFA 4Z77A 2FATL 5FO8A 1P1ZA 3H3PH 3RWEB 5HGHA 4IDJH 5D5ME 3T4YA 4DVRL 1S7VB 4Y16A 1IJ9A 2APBA 3BEVA 2HFFA 3O6FB 5IEKA 1BVZA 4PRHE 1QPPA 2OP4H 4EUPB 4L29B 5D72L 1CE6B 3TJHD 1R3LB 1F6AB 3T65A 5DJYB 1WFOA 4XXCC 1OL0A 4DKAA 1R3JB 1SQ2N 2G9HA 2XTJB 3F7YA 4GW5A 1JGLH 2DI7A 4OFYA 3ESVF 2C3GA 3IDIA 3RWEA 1PEWA 4YBQD 4EEEA 1WLHA 3IAGC 1NFIB 1JGDB 4PJCE 5C3LD 1QBBA 1REIA 4KFZC 3O6FA 4ONFL 3FO0L 2DKUA 3RGVD 1I9EA 4RIRB 4P2OB 5A3ID 1CE6A 3C08H 1EGJA 1F6AA 1R3LA 5F96L 3PGFL 2V17H 1R3JA 1VDGA 4PV8A 2EDQA 1OT2A 4XHJC 1LK2B 2BRQA 4MJID 3D39B 4HZLB 5TH2B 4ZFOB 2OYPA 1CVSC 3LQAC 1FN4A 4DKDC 1NFIA 4GS7C 1JGDA 4GMTH 1T2QL 2X4SB 1FFNA 4RIRA 3H7BA 3OXSB 3O3UN 1J0YA 3SDXA 4LCCA 3BVNB 1ACZA 1OTTC 1VGKA 3FO9B 1LK2A 1YYML 2EE3A 3N85L 4X99A 4X5XA 4HZLA 4ZFOA 2YRLA 4G3YL 1FNSL 5GRUL 4PJXE 4I0PC 3R0MA 3TO4C 2VDML 4QRQA 3WSQL 5I1IL 2X4SA 2F5AL 1NBVH 1XMWA 2A73B 2HFEB 3OXSA 3PL6A 3EYVA 1HHKB 1JNNH 2BC4B 3BVNA 3FO9A 3HG1E 5HHQB 4LLMB 3BUTA 5DSCB 2CH8A 5CJQL 1N64H 1XF5B 3WLWC 1UJ3B 4N1EA 1G0YR 3OG6B 1U3JA 1CDBA 3IRZA 4YPGA 1QKZH 4IS6B 4W6XB 4N0UE 3RIFK 5F7NC 4OF5A 4JCLA 2MFNA 2A73A 3TPUB 4E42B 3NBNA 4RGOL 3FTGA 1XGPA 4K94C 5DR5H 3LEYH 3T4AB 4L3EE 5DSCA 1MCDA 5IBLC 3RY6C 3SDXF 3L5HA 5F9AC 4EUPG 4DZ8B 1IAIM 4QHLB 5F7LB 3O4OC 4KZDH 4HJJL 5JPNB 2FO4B 1Z9LA 2B2XH 3LB6D 3FJTA 2AQ1A 1YYLL 2DM7A 1XF4A 2R1YA 5FYJL 3HMWL 2XRAL 3TPUA 3G6DH 1KGCD 4LPUA 3BUYB 4ZODA 1XF3A 3C5JB 4ODTH 5AYUL 1O7VA 5F9OL 3QO1B 4DZ8A 4NO5A 4JFDE 4QHLA 2WBJA 4KK9D 2B5IC 5IMMB 1ADQH 4FFVC 2HLFD 5IF0B 4P2QB 2F8XC 1SM3L 4AEHL 3PGCB 3NVQA 2MSPA 1G0XA 4DVBB 1KJVB 1NDMB 4MGXA 5JIIA 3GMLA 5FKPB 5I76B 1MRFL 1A7RH 5FUZH 3BUYA 3O41A 2EDXA 8CGTA 3OXRA 1A6VH 1I9IH 1CICA 5DGQA 4MA8H 5F7HA 5CZXC 4KI1A 3EBAA 3EAKA 3QO1A 4YXHL 3BWAB 1A14H 2C3VA 4B5EA 3V5HB 5IMMA 5IF0A 4P2QA 3MRHB 3GO1L 4QHKI 3RKDD 3UJIL 5JQHC 4ETYA 3AY4A 5IG7B 3W5NA 4DVBA 1KJVA 3I6GB 5I73B 4N8CL 3SDAB 3BPNB 4AQ1B 4X7SL 2EE9A 2ZUQC 5FKPA 3DVNA 5I76A 4NM4L 1FH5L 2VAJA 4WRLA 4MHHI 2LU4A 1M71B 3C6LD 3RTQB 3PV6B 1GOHA 2UY6A 2A83B 1E6JH 4AT6A 4YUEH 3QIBB 4RSVA 5L9DH 3NABL 5D7IE 3V5HA 3QHZL 3G5VB 3MRHA 4MNQD 3GJEB 5L0QB 4XMLH 3I6GA 4OF0A 5C9KA 3SDAA 2VKXA 4G8GA 5C71A 3MLYH 4OZ4B 4M3KB 2X9YA 3GSRB 1M71A 1SJEA 3NGBB 4HEPG 5E5UB 3CFDB 1NKRA 3ROOB 3MQIA 3DI2B 4W4OC 5ICYB 4OZFB 3QIBA 2GAZB 2ZUWA 1GVIA 1CQYA 2EICA 3G5VA 1OAKL 1BGXH 4QO1A 1DL7L 4MXVF 5JW4Q 2X4NB 1KCLA 2BXZA 1CL7I 3B5TA 3UTTB 1MJ8H 4LARH 4CN6A 3G6AA 1AQDA 3SKJL 4OKVB 5IB4A 3RBSA 3D48R 2OCFD 3UYPA 4OZ4A 3FRUB 2D03L 2E7LA 4ZSOE 3C6SB 3CFDA 3VXME 1S78D 4Q97A 5ICYA 3EFFA 4GKOA 4ZTOL 4YDVA 1QNZH 5TDOB 5AZEL 1D6EA 3QEGH 4N1CA 5I8OL 5C09D 4PJIA 4E0RB 4PG2C 3CMOH 3TT1L 1EHXA 1ZWIB 3GSXB 2ED9A 4R4NC 3Q1SL 3DJ9A 4QWWC 3QCTH 1QLFB 2UZXB 3FRUA 1E4KC 3QQNA 1MEXH 2AXGB 1RUKL 3FFDB 4GRMA 4OCYL 3RWHB 2LVCA 4RGNB 4N90D 4MDJB 2E27H 2YZ1A 5TDOA 2X1PA 4QTHB 1JGVL 1OAQL 3PUCA 1RJLA 4E0RA 4LPWA 1ZWIA 2VYRE 5DEGB 2ZG1A 1JWSB 1OD9A 4MD5B 1CZ8L 3IDMB 3GSNL 2Z31A 2DQUL 3QIWD 3MJ6A 4G5ZH 4QHMB 5KSBE 4PRDB 2AXGA 4BKLB 3L3GB 2P5ED 4KK6D 1FPTH 4O9HL 5MI0B 3S35X 1VEMA 3RWHA 4EBQL 4J3VA 3QCVH 3ZKND 1JVKA 1A1OA 2AJSL 2YWYA 4MX7A 4ISVA 3KYKL 1GGUA 2DTSA 1I8LA 1KT2B 1U0QA 2FIKA 5F93C 1WZKA 3MUHL 5HYEA 3MC0A 1ULVA 1JWSA 4OV5B 5E8EB 4MNGE 3A6BL 3IDMA 5EIQA 3RI5F 1MFNA 4FFYL 4PJIF 4PRDA 4MMZC 2H26B 2EDEA 4YZFF 4BKLA 5GGVY 4YNYB 3WN5B 3GSNA 4LLVB 4ZFGH 5F7EH 1TITA 4W68A 5EZOL 4BK5A 4PJEE 4R0LC 3WIHA 2EXWD 1TPXB 4NNYA 4L4VD 1WWAX 3TIEA 3EYSL 2JELH 1S7WB 4YHPA 5E8EA 3RIAK 3F62A 1DJSA 2H26A 3EFDH 3PGDA 4Q0XH 4ENED 3HPLB 3STZA 2D31B 2IH1A 3UJTL 1XT5A 5TQ2L 4K7FB 2IPUG 3CGTA 3CFBB 2XN9B 4POZC 1CN4A 4O4YL 2BDNH 1AI1H 1JNLL 3VXSD 3AROA 5J1AB 2Q8AH 1GGTA 2NY7H 1FP5A 4PY8I 5FO9A 1S7WA 2EYTA 3P0YH 1EZVY 4Z7OF 1C1EL 1QP1A 4MQ7B 1K4CB 1EEUA 3KDMB 1X9QA 2FX7H 3HPLA 4WO4C 1L6XA 3T2OA 2YPVH 5DDHA 3CPLA 3CFBA 4ZUWA 4MQTB 5EFIA 3AM8C 3ECBB 5B21A 4L4TE 5FUCE 3WXWL 3PP3H 4LVHB 5J1AA 3PJSB 3QDGE 2NPLX 2BNRE 3VU2A 2H41A 4MQ7A 4LVEA 5HDQH 1GYAA 2OI9B 4KDTC 4XCCH 5HYJB 5FGCE 3V4UH 1DQDL 3AMKA 4R8WH 4JREC 3S35L 4UI2A 3HMXA 4EVNB 3TIDB 3ULUE 3HE7B 1T1ZA 4U1HB 4LDLB 3PJSA 1NCNA 3VFNB 4IDLA 1DBJH 1RIVH 1T1WB 2J4WH 3QUXB 4OQTA 3BPLC 4PGBB 1PKQB 5HYJA 1X3DA 4IIQC 3IDNB 4HX1B 4X9IA 1ZT1B 2V2TB 5EUOA 4PGDB 1CDJA 2WP3T 1QFUL 4EVNA 3TIDA 2ED8A 3HE7A 3VI4E 2ICWJ 4U1HA 1MI5B 4LQFL 2VXTL 4FQJL 3U46B 2XWTB 4AIXA 5I66B 3BKYH 5D1XC 1T5XB 3TVMC 2NY1D 4Z95L 3QUXA 1UH2A 5HDBF 1PKQA 2MJWA 1NLBH 4HMDA 4J3TA 3NTCL 3TNNA 1FG2B 4G8FB 1ZT1A 2V2TA 1OF2B 3O3DA 2H9GB 4YXLL 3KR3H 2BNUA 1EAPB 3VGBA 3AREC 1MI5A 5C0FB 2MCPL 1CFBA 4YDKH 4Y5YA 4DZBB 2XWTA 4FQCH 5I66A 1T5XA 4QXUL 4K3GA 4PJBA 5ITBL 1U8MB 1J86A 1L7IL 3WIFB 1AKJA 43CAA 4XP5L 1X5KA 1FG2A 5FM5O 5I74C 4CU6A 1KN2H 5IBTL 2A6JA 1OF2A 3U7WH 2H9GA 3ALXA 3EYQC 5EN2B 5HSFA 2DBLH 5KAQG 1FORH 1FZOA 4TVPL 4YXKH 1EAPA 1A6UL 5MEOB 2QQKH 2R9HD 5EUOF 1YEJH 2RGSA 4OF8A 1NAKH 2YS4A 5C0FA 3KPRB 5E6IB 1NCAH 1RZIA 3L5XL 3HZKB 3WNLA 3TN0A 2DYPB 1QR4A 3MLRL 1FZKA 1MRCH 2EC8A 4NQTA 4YDLB 3WIFA 5A2KH 5GGSB 4TUJA 1L9NA 4PGCB 1YNLL 4XPHH 1FNAA 2X42A 4F57H 4EXPX 3DX7B 3WE6B 1FSKB 4AL8H 4OLYH 3WHE0 2X7LB 4HWZA 1ZVSB 4P48A 3RWCB 5E94B 2KZWA 3KG5A 2EDOA 3N1MC 4HGMA 1J1XL 1HZHH 5I8EB 1NSNH 5JDSB 4R2GC 3KPSD 3HZKA 4KU1A 3C60B 2DYPA 4MD4B 5JMRA 5DJ8A 2ZOKB 1HINL 1QA9B 4V2CB 4X4MA 4N0CD 1WFTA 2VAAA 1PLGL 3CXHJ 1UWEH 4I3SH 3UZQA 3WNOA 5E5RB 4PGCA 2JJTC 1UADC 4JM2B 2ADJA 5FGSA 1JHTA 5KSAB 4PJBF 3WE6A 3MYZA 1ZVSA 3RWCA 3A67H 1CFTB 1F90H 5E94A 3VFVA 2DQGL 3O6KL 2VTFA 4D8PB 5CEZL 1F11A 1DR9A 5JDSA 3BRFA 4Y19E 3V6OE 1YY9D 1KEGH 4W6WB 1UXWA 3TA3C 1QA9A 4K07A 4JM2A 2BRRL 1V3JA 3T0WA 1KCKA 5EOQH 4Z0XB 3V4PL 1NCWL 1CFTA 1D5ZB 1S7TB 4HKZA 1Z9OA 1NUNB 4KKBC 3QAZC 2BY2A 2BNQD 1AR1C 4RAUB 5FYLL 5DMGC 3O9WD 4RX4A 3CUPB 4UBDD 4XP9H 1GGBL 1D9KD 2R2HB 5TPWH 3A6OA 1AGEB 3C09B 2AEPH 2VOTA 1NC4D 4Z7QE 3T77B 4J6RH 5ESAB 3ZKXC 1NGPH 3IYLW 5HHOB 2QR0B 1KJ2B 1I3GH 1IEAB 4RAUA 3VW3L 5JOFB 5JHDD 1S9WA 4RRPA 5CZVH 5JNYB 3K4AA 2DQHH 2R2HA 2Z8VC 1F4AA 2F54A 2MWCA 4O2CA 2P24B 1SBSH 2VL5B 4OZIB 2P48B 2UYLB 3ZLQC 2VDRH 2IPKB 1JWMA 3VCLB 3T77A 5CKAA 2X9XA 5K9OB 4U3CA 3IT8D 4OZGB 2VNCA 3E3QC 1OM3H 5T33H 2APWA 2PXYC 1HKFA 3RVTC 5D1ZB 1KJ2A 1IEAA 4P23A 1OQOA 5CCKL 4LSVL 2NY4C 4YBLB 4J23A 1X5JA 4FABH 2CIKB 5EO9A 1T2JA 1IILE 1XIWB 1JNHA 4G7YL 1SEQL 1DLFH 2P24A 4C4KO 1S3KL 3T2QA 4HCRL 2MNUA 4WUUD 3EW3B 4PJDB 4OZIA 1QRNB 3I6KA 3RDTA 1FIGH 3KPQA 4KHXH 3QH3B 3FOMB 4Y2DA 1JF5A 2E6PA 3H3PL 5D1ZA 3FQTA 1JV5A 1KNOB 5BRZD 1MWAH 4N9OB 3KXFA 2Y5TA 4A6YL 4KKLD 1IE5A 1XIWA 4H8WC 2H32A 4YIQB 1JZ5A 4HAFA 1N3NB 1ZGLA 3VH8B 2UWEA 5JXAH 2EDFA 3SKMA 3QG6A 2VDPL 4IRSD 3O8XA 3C8DA 3OKDA 4RCAA 3VGHA 3DO7B 4N68A 1ZLSH 1F4XH 5I75C 4QXGH 1JE6A 1JGLL 3MBEC 3HE6B 1ZLVH 4FTVD 3SDDB 1GOFA 5TQ0L 1KNOA 4M1GL 3MUJA 3PWVA 3ZDZE 4F7TA 5L8LB 2AQ2A 3VFUB 4ZUTB 3MRJB 4ZTPH 1N3NA 3MRPB 2VR4A 4MJ5B 3C08L 5AD0A 4A6YA 3C2SA 2D9CA 3QEQD 4L8SA 1XCQB 4G9DB 3HPJA 4LCYA 1EHLH 3DO7A 3JTSB 1CXLA 2APTA 1AP2A 4OZIF 3NCBB 1U41A 4FFZH 3VXRE 5E08L 3KS0H 4TOYL 5C0CD 4GSDH 3SDDA 4Y16C 3QI9D 1T0PB 2YWZA 4ONHA 4X7CC 3SPVB 1CDIA 4GMTL 3GNML 3MRBB 1AY1L 3B9VA 5EU3A 1JZ6A 3MRJA 3P3YA 1LMKA 4LVOB 2YBRB 4FRWA 5BJTA 2HT3C 3MRPA 1JK8A 4MJ5A 1R3HB 1FC1A 4BJLA 3ZE0E 1JZ2A 4G9DA 4MAUL 1T7XA 2FL5B 2UWEF 2C3HA 3SJVA 5FCUH 1J8HD 2P5EE 2VDKH 1KELL 3O6FC 2NY3B 2EXYD 4EI5D 1KCUH 3E8UL 2ICES 3PWUB 4QCIB 4C4KT 2EYRB 2Z92B 1JNNL 5F6IB 1SJXA 1CK0H 5DD0L 2FCBA 3AU1B 4PJ8A 4OM1L 4IOFD 2ZKHL 1N64L 1GXEA 3ARYA 1FNEB 4UT9H 1AD9B 3U0PB 3PWUA 4QCIA 2E6QA 3SE4A 1CD1A 1YA5A 4LCCC 2G60L 1A4JB 2CUIA 1RY7B 2DWEA 1WEJH 3JWDH 5DR5L 3LEYL 3S36H 4Q9QH 4NO3B 3VWJB 4NQEE 3VD5A 5GGSY 4JRWA 3IB4A 3NCCB 2EO9A 3G08B 4WV1B 1HE7A 1KG0B 2GK0B 3D3VB 4KQ4H 3VH8G 4YHML 2HH0H 4MLIA 4JQXA 4TYUA 3FT2A 3VWKD 4M1DH 1C12B 4RFNB 3PL6C 3QFDB 2IJ0C 4CJ0A 12E8H 4OCXH 1C5DA 3G6DL 3VXSE 5TE7L 1A4JA 3QHTC 5EIIB 4Q2ZA 4XMPH 4X80H 1MRDH 4OCMC 3DV6B 2APVA 1RURH 1R5WB 3RNKB 5FHBH 3MA7A 4XPAH 4I2XB 1CL7H 4ORGB 3RAJL 4NZTH 5EU6D 4PRNB 1DTUA 3ARPA 1E0OB 3RI5K 3F7QA 3UTZA 4OIIL 3VA2C 4C56B 5I19H 4BH8B 5EIIA 3HA0A 1QSZA 4NWTH 1A7RL 3MMEA 4S1SL 1MVFA 4PFEA 1IC1A 1R5WA 2OR7A 1IGMH 1KCSH 3FRPG 4MA8L 1NAMB 4RFOL 4I3RH 3TFKD 4I2XA 4JQIL 3TCXA 3WS3B 3BKJH 4TUKH 3QPXH 4Y5VA 4RFEA 3NA9H 1KULA 1MJJB 1D6VL 1RHHB 4PJ7E 3EO0B 4PG9B 4BH8A 4YHKH 1A7BA 4HT1H 2XKUA 4NZJA 4XGZA 4PJCA 3R1GL 2WBJC 4HDIB 1NAMA 1C5BL 1HN1A 1U3ZA 2FNBA 4OV6F 3CH8A 1LHZA 2P47B 2AJVH 4GRLD 2NW3B 3F8UB 4X4XB 1IEHA 3BAEH 2B1HH 3EO0A 4L3AA 4TVSa 3B9EA 5I71B 2PYEE 1MQKH 1WT5A 5GRVL 3OSKA 1CICC 2DQCL 3MLYL 4XPTH 1MHCA 4UAOC 5JLZA 2JIXA 1S5HB 3DTXB 1FE8L 4W4NA 1IGJB 3HAEH 3T2PA 3KWWB 3AY4C 4XNQA 4FQPA 2NW3A 1FLRL 2YOCA 4X4XA 4O5LL 3EHBD 5F6HJ 35C8L 5DJCB 3VXUD 3FZUD 1EH9A 1HIMH 3GMOB 1F4WH 5DWUH 4HH8A 1E27A 1HH9A 2ZSWB 5IEHB 2VXSH 1E4WH 4DGYH 1U8OB 4PJXA 4JO4H 3SKOA 3JZ7A 3QXWA 4EOWL 2WUBH 1YMMD 5ITFB 1FFOA 3G9VA 1A7QH 3STLA 3RY4A 4HIIB 4J4PD 1UA6H 3FB7A 4PJCF 3KWWA 3V95A 1NGZB 4OD3H 5TDNB 3F7PC 4APQD 3SDAC 1N0XH 3V2AR 1J11A 4DFHA 1BIHA 3ES6B 4M7KL 3PV7A 3QCTL 3WUWA 5ITFA 4HPOH 3QIBC 5IB5B 4N0UA 3WJJA 5IK3A 3IFOA 4HIIA 4GRWB 2GY7B 1S9XA 5D7KD 1NGZA 3NFPB 4K7PH 2B1AH 2DD8L 1ZSDB 3ARBA 4L3EA 4F9LA 3ES6A 4NWUH 1VHPA 2E7LC 4ELMB 4MWFB 2XA8L 5DLMH 3DNKA 4YEFA 2VLKB 5L2KB 1YY8B 2D9QB 3FHQA 1QSFE 1EJOL 2CRIA 5ACZB 3IJSA 4HC1A 4OB5H 4PJXF 5KN5A 2ZJSL 4JHAL 4TSBH 3JV5A 1GL4B 3NFPA 3U1SL 2DKSA 1ZSDA 3QDJB 3GI9H 2ZCHL 5D7SH 2FJGB 6FABH 1IFHL 4ELMA 4MWFA 3ZTJG 5DUMH 1MY5A 1HYRC 2CDFA 2I5YH 4MAYD 4N8PA 5L2KA 2FO1A 5T5NF 1JPGB 4N8VA 1YY8A 3GM0A 4NO0D 5EZJB 3MA9H 1K3ZA 1FZMB 2AQ3A 2C4FT 1G7LB 4L1DA 1ES0B 3G5XB 1CF8L 3G6JB 3QDJA 4JKKA 1RK1B 3FAXA 1U91A 2EYSA 2EEDA 4UV4L 1T21B 2H8PB 2Z31C 2DL2A 5IFJB 1D5MB 3BIBX 5T3ZE 1LO3H 3ME0A 4RMVA 3U4AA 4DJMA 1QEWA 1JPGA 3EFDL 4ZO7A 1P4IH 3DMMA 1RZKL 5EZJA 5C0BD 2NY2D 4XWOC 4P46D 5KSUA 1JRHI 5C0EB 4N9GB 2Z93B 2ICWB 1G7LA 4F58H 1I8LC 3MRRB 2BDNL 1ES0A 3O6MH 3G6JA 1AI1L 4Y4KC 4ZO8A 3FAWA 1RK1A 2AK4E 1T21A 2V2WA 4ZS7L 2NY7L 4YHOH 2H8PA 3FQNB 1C08B 3T3MF 5IFJA 1D5MA 5J4MA 1U3HD 3L5WA 4L9LA 5DD6B 4LOUD 3REWA 3DX6B 3D2UB 3ILQD 1A3LL 4ELMF 3RPKA 3U4BL 4P5MA 1N6QH 4BZ1H 3GBMH 2ICWA 5L2JA 4JFPA 4JKWA 1MAML 5IVXB 5C6WH 3L7FA 3QUZC 4XAWH 3ARDD 4JFEE 3FQNA 1QSVA 4PJAB 4S1DC 5EBLB 3IDUA 4P9MH 5EZIL 2Q7YB 4Y1AB 2NNAA 4OT1L 5EIVA 5I1AB 2DM2A 3MYJB 4XCCL 4UNVA 1MIEL 2BOBA 4QXWA 1B3JA 3EDFA 4D0DB 1G7JA 3D2UA 3V4UL 4HFUL 4KKCD 3T1WA 2Y36H 2D0FA 1MHHA 4WUUE 3X12A 2R15A 3X3GH 1FV1A 2VZ1A 4H0HB 1U3YA 5EO0B 1ZLUK 5IVXA 2IBZY 4C59B 4DW2H 3VXMA 4U4BA 1G6RL 2CMRH 1S8DB 5EBLA 2AV7B 3G6JF 4YLQT 5GS0H 3W11D 2Q7YA 2J4WL 3OJDA 4MQXC 1MJUL 4Y7MA 5BRZE 1S7SA 4AM0A 4RNRB 1D3CA 1TETH 4D0DA 1KLGB 4PYHA 5D7IF 4NQVB 1WFNA 4GG6E 3GSOB 1IM9D 4YFLF 4EN3A 1HILB 2FJHB 1Y18A 5A2IH 4U49A 5EO0A 1PZUB 2OTUB 4OCSL 5C7XH 3BKCH 4WTZA 1JTOA 3SDYH 1S8DA 4FTVE 5A40E 1KB5B 3MACL 4XVUD 3DUUB 4HWEH 3FT3A 3KYAA 1NLBL 4RNRA 1G6RA 1NC2A 1I8MA 4P3CL 3RFZC 1KLGA 1UWXH 2UZIH 4HK0B 3H9SE 2XKNB 2WBKA 2VXUH 4X6CE 2AJZB 1Q8MA 3KR3L 5AUMA 1HILA 4MA7L 1UB5B 2FBJH 3CVHB 3TYGL 4KMLB 5KSBA 2OTUA 4U1NB 1YEKH 2ZG3A 1DBAH 4X0KB 4NQXB 5IWLA 2OI9C 4M8QA 5E5MB 3TPKA 4M7JH 5IVXF 5ETUB 4BELD 1W72B 5DHVH 1W8NA 1OAXH 4D94A 5T3ZH 3B6SA 1JGEB 4JDVB 3KJ6H 1UCTA 2XKNA 4CRPA 2AJZA 3M8OH 2DBLL 5C2UB 1BD2B 4XBGB 2DTMH 2ATPB 2FLRT 5F7DB 4YXKL 4MNGA 2AABL 1FG9C 3TJEH 1YEJL 3H6JA 5DVNA 1WFUA 1MHEA 2EDNA 2IBBA 2DQDL 1UC6A 3WLBB 3TZVA 3QUXC 5E5MA 4X4ZA 5F88B 3BH9B 1MRCL 4EXKA 5KVGL 4WNQB 5IKCB 1W72A 4NJ9L 3U9PH 2F53B 1TIUA 4XPHL 3IFNH 2V7HB 1JGEA 4JDVA 2A1WH 5IBUB 4H0GA 2G5RA 1BD2A 4XBGA 1E28B 2X1XR 2ATPA 4OLYL 5F7DA 4ODHH 4JRXB 4Y5YC 2BCKB 4YE4L 1HZHL 1NSNL 3CFEB 3MX0A 3VGFA 1BFVL 5F88A 3BH9A 5TE6H 2GSGB 5KSBF 5EH1A 5KOVC 4PB0H 1U8KA 4JEGB 3BZEB 5LVEA 1UWEL 2CLVB 5A2FA 1KLUA 4PP1D 1JZ8A 1BBJB 3JTTB 3KPNB 1K8DB 1OAUL 1B0GA 3N9GL 1E28A 1MCWM 1CIDA 2CPCA 3FB6A 3OJVC 1I9RH 2BCKA 4MJ6B 3TN0C 5DURB 5JW5A 3S6CA 4XVJL 3BN9D 5SX5H 1T7VA 3RWGA 1KEGL 4ODSH 2B20A 3VDAA 4XTRC 5E70A 2GSGA 5KW9L 2I9TA 4FQXD 4WUKH 4OGYL 4G6KH 2IH3A 2IGFL 1BBJA 3JTTA 3KPNA 5D6DA 1T4KB 2ZUUA 3TV3H 2WSKA 3MLUL 3NACH 3PDOA 4U1IB 4PJEF 5DTFB 5IV2B 4NQDD 4P59H 4RAHA 1FNGA 3PWJA 1UZ6E 3BPOC 4YK4B 1RZJL 2DM4A 1AGDA 3EO9H 5EC1A 5EU6E 1A1NA 3GHEH 3RKPA 1KSRA 1WIOA 1WBZB 3DETC 2W65B 3ORJA 4ACPA 5DTFA 1NGQL 1CE1L 4UIKL 2W9EH 5LBSH 1KTDA 4OFIA 5D1QB 2AJXH 2V5YA 3QG7L 5ANME 1LD9B 2D0GA 3QRGL 4XNUH 5AG9A 1I3GL 2IF7A 4PR5B 1OB1B 4KRLB 3EJZD 5CZVL 1IQDA 1UYWL 4ZOBA 4JM2C 5IMOB 3P30H 3GIVB 4IOSD 4HS6B 4U7SA 4QOKB 2D7NA 4O02H 4ZPVB 3OBAA 4MJIB 1WBZA 2QSCH 2LU3A 2W65A 2VERN 4DEPC 3WFDL 2YD8A 5M7QA 1OM3L 5MP6H 5I8KH 2OSLB 1MPAL 1RJZB 5FCSH 1FRGL 4K8RC 1OB1A 3RGVA 1A6AB 3LQZB 2I26N 5IBUG 1AHWC 4FABL 2NXZD 3LQAH 4E41B 4WVRA 1H3PL 4WENB 5IMOA 4YHYB 3BJ91 3CFCH 5DQJB 3DSFH 3UTPE 2VN7A 4HKBA 1PJ9A 1EEZA 5IP4A 4ZPVA 4MJIA 4HV8B 1KFAH 2Y07H 3ULUF 3QIUD 1ED3B 2F58H 5E2VH 1INQB 2J5LB 3VI3E 3NCFB 2XNAB 2OSLA 2YEZA 5D71L 1Q9KA 4PRID 2BHUA 2JCCE 4K3JH 5SWQB 3GUTA 3LQZA 1U8NB 4FNLH 4ONGH 2AJ3B 1Z3GL 4GG8B 4PB9H 1HDMA 1INEH 1I7UA 3VXUE 3UO1H 5L6YL 1ITBB 2ITCA 3H42H 5E8PB 1IEBB 3O2VL 3VI4F 4PUBH 4CN4A 4P23C 1INQA 4AYFA 4D9RE 2XNAA 4LSUL 3IAPA 4F80A 2M26A 2ZUYA 3E6HA 5C6TL 5SWQA 1CFQB 1RFDH 5DD5H 1C8PA 3HUJB 2AJ3A 4TQEH 1S9YB 5FK9B 3RDTC 5DUBB 4ZTPL 1PX4A 4NYLB 4LU5L 1IKNC 1VFUA 3OL2A 4XWGH 2DMBA 3GMMB 1IEBA 3BDYH 4Y2DC 2ZCLH 2Y1VA 5FF6A 4K94H 5D1ZC 3OWEA 2W9DH 1V7ML 5HYSB 1MLCA 3VE0B 1MCKA 3Q48A 3X13B 5BVJB 4UT7H 2FEDC 1FYTB 1CFQA 2VC2L 1XIWC 4JY6B 2YKLL 3HUJA 3MXWH 4U6HB 2NY6C 4WU7B 5FK9A 5DUBA 3EJYC 4UTBH 3I85A 3O8XC 2HRPH 2J8UE 3V6OA 2R8SL 4U6VL 1MUJA 4MZ2A 3P9MB 3LZFL 1A21A 3IS0X 3FOLB 5HYSA 2DIJA 5GGQL 3VE0A 2IG2H 2JJSA 5F3BB 1FL5B 1UKQA 4HBCH 4WTWA 2SEBA 1IGTB 2FH6A 3ZSSA 4RDQF 3SBWA 4GFTB 4IHOB 4L8SC 5BS0E 4M03A 1WTGT 1HH6A 3VXQB 1NMAL 3FQUB 4V1DE 3ZDYE 5C2BL 1XCTA 2FHFA 2GIYA 1RQ5A 4Z6AT 1CK0L 4JJ5B 2E9JA 4Q6IA 4PJ9C 2FX9L 1Q0XH 4I5BB 3EYOA 4OLXL 1FL5A 1V8HA 4LSSH 1HKLL 2ARJA 1KB9K 2BVPB 3FMGH 1ZVHA 5ERWB 3O6LH 5JOPD 3L9RB 3BGFB 4JPWH 4XXDB 1RULL 3O11A 5HD8C 4CADA 4L8DA 2CLZA 2FHBA 5I1GH 4NRXB 3UJJL 1VFBB 1X5XA 4MNQB 1L4IA 3QXDB 3HNSH 4P2OD 4R97B 3KLDA 4XNXH 2HH0L 4QRPE 3CNKA 1J05B 3KPPB 3MBXL 3QUYD 1NMBH 5I9QC 3F7RA 1T3FA 3HNVH 1CU4H 4XXDA 5E1AA 1PYWB 1F4HA 3D39D 3C6LA 2KBGA 2CKBH 1KPUB 2XZCH 1WF5A 4PJ8C 5SWSE 4WW1B 4YC2B 1U8JA 3O2DA 4NRXA 1PEZA 3OB8A 4PRPB 2NY3C 5GRVK 4MNQA 5DMJB 4NJAL 2Q1EA 1NCDH 4NZTL 4TNVF 4FG6D 1FL6B 4U6YB 4H20H 3SE4C 1JF1B 3KJ4C 3KPPA 3UBXG 3QUKB 1WV7T 2NTFB 1LP9B 1PYWA 5I19L 4NDMB 5ENWB 4WJ5B 2J88H 5KVDH 1KPUA 5IIEA 5LXGH 4H26B 4WW1A 4R7NB 4JO2L 1S7XB 4AENB 4POUB 1S9KC 5C09B 4GXUN 4TUKL 3QPXL 1FL6A 3NA9L 4U6YA 1JF1A 3QEUA 2NTFA 2GTWA 3H9YA 5ENWA 1RIHL 1YC8A 4YHKL 4XCFH 4H26A 4OIBA 4GXUM 5JW4N 4R7NA 3OHXB 1S7XA 5KVFL 2EDWA 1R3IH 5MERB 4KKAC 1XGTA 4LSDA 5C09A 3BXNB 3MV8E 2AJVL 1JZ3A 3KYNA 3RZCD 3BAEL 4AMKH 1X7QA 1EX0A 5JW4M 5GS2H 1FO0B 3T3PE 2KKQA 1A1MB 1YNTB 1ZHKB 4G6FB 3RNQA 3PABB 3EDKA 3OHXA 1PDKA 5DS8A 2EIBA 3D9AL 2V7NB 1BZ7B 4HEME 4DN3H 3NCEB 1RUPH 4Y5VC 5DFVC 3CIQA 3BXNA 4ZD3L 4NQCD 1OAYL 2DAVA 4R6UA 1IAMA 3VMPA 1CGSH 3QIWA 2HWZL 3ARTA 5BV7L 5D93C 1FO0A 5CS7A 1OAZH 1BZ9B 2P5EA 3FO1B 4DGYL 3PABA 4JO4L 4XC3H 1MFDL 3EYUL 1BZ7A 4OD2B 1YPZE 1UA6L 3ZDZF 4L4VB 4OD3L 1T22A 1DQJA 2OJZL 1J1OH 4ZFZB 1WT5C 4H5SB 5KJRL 2VABA 4I0KA 3FO2B 1U8PA 4IMLB 1JRHH 3WS6C 4J3WA 3LMJH 4AIOA 1M7IA 3BP7B 1PGRB 1EEQA 2XXMB 2EKJA 3LKSA 3HC4H 4L4VA 3TBWA 3QJFB 3BPCB 5HYQA 4OQ1A 4K7PL 4ZFZA 5I71C 4CDGC 2NX5E 5I15H 2L7JA 4I13B 3RTQD 3ZE0F 1GPOH 1HYSC 1BWMA 2R56H 4IMLA 1ZHBB 3LEXA 5F71A 5JORB 5DLML 5IMLB 3BP7A 3X3FH 1VPOH 2Y6SD 3MLSH 4XB8A 5DK2A 3I9GH 3OF6D 5DVLA 5LAXB 1CVRA 3VXSA 2O5ZH 2O5YL 5ID0B 1TXKA 4TSBL 1N26A 3BPCA 2F15A 3QJFA 3PDDA 1JBJA 3WO3B 3P73B 1OGAB 5LWYH 1DQMH 3AXLB 1ZT4A 1KIRB 1FGVH 5K59E 4G6JL 1NQBA 4DCQA 6FABL 5I1HH 1A9BB 5JORA 3WJJC 1CLOH 3T0XA 3MNWB 3MXVH 3MR9B 4KJPD 4TTDD 5TF1L 1T1YA 2X1OA 3UTTD 2B7DT 3ARBC 2WWKO 3D69B 4F9LC 5D4QA 4JR9H 4LPTA 3GMRA 3P73A 4K9EC 4PP2A 3AXLA 4D0CA 4CVXB 3FQRA 1KIRA 4UU9B 3RVVC 1HHJB 1EK3A 2P5WD 1A9BA 3A0OA 3HC3H 4X83A 3WNPA 4JPKH 2A6DA 5DJXB 3MLXH 1NKOA 5JQ6L 2C4XA 3RUGB 4HKJB 2VDLH 3WKML 3GI8L 4JVWA 2Q3AA 3SQBA 5B39B 3CCHB 3SE9H 3RVUC 4LCWB 1VKXB 4N5ED 2BVYA 4JDTH 4UU9A 4XI5C 2XICA 1HHJA 1ETZB 1G84A 2DLGA 4QHUB 4RGND 1AC0A 1WJ3A 4MCYA 1CTNA 1U58B 4EDXB 4JY5H 1EXUB 1YNKL 2V5RA 5INCA 5DJXA 3VG9C 1MCOH 5IQ9A 3B9KD 3V6BR 2EDYA 4U0RC 4HKJA 7CGTA 4TSAL 2OR9L 4G6AD 4LDEB 2XPGB 5IB1B 3GBML 2BHYA 3QB7C 5DD1H 4LAQL 2Z8SA 4U0QB 5B39A 4O51B 2VISB 1YECH 4JFYB 5T5FL 5J11B 4BSJA 4M6OH 4TNWF 3MJGX 2XG5A 4YGAB 1ETZA 4P2RE 4Z76B 2N7AA 1D5BA 3DMMC 1JFQL 1U58A 1EXUA 4Q9RL 1I7TB 1A7OL 3UBXI 3DRTA 3W9EB 2H2PC 2Y36L 4YHLL 3MZTA 3VXNB 5HGAA 2XPGA 3H2WA 5IB1A 1I3UA 3CVIL 4KJWD 5GISH 3X3GL 2R29H 4L5FH 3RX5A 2VISA 4JFYA 1DQLH 4YFEA 4DW2L 1H3TA 4L9LC 2CMRL 25C8H 1RZFH 3MJ8A 4Z76A 1JPST 1CR9H 4ODXA 4WCYH 1HSBB 5D2NE 3U7AA 2KH2B 1TETL 3EOBA 3QNZB 5DMKB 3W9EA 2X2YA 4RZCA 1LEIB 4FQQA 1OSZB 4ZO9A 3KPSB 2WWKT 1SYVA 3DXAE 2MMXA 3UTOA 3TM6A 5IR1A 3S37X 3TNMA 1S5IL 2ADFL 5DJ6B 2XN9D 1PZ5B 4MVBD 5SV4A 1E6OL 5ADPL 2YD1A 3JXAA 5T1DL 1LEIA 4OCWL 4OLEA 1UEMA 4R7DB 4ZS6D 1OSZA 3SGJA 1B9ZA 3KPSA 4F15C 1NDGB 5ILTL 4HWUA 1YEKL 4Z7NE 5DK0A 2JE8A 4DQOH 5D7LB 2XQYK 5DJ6A 1DDHB 4I0PD 4WFFE 3ZTJH 1PZ5A 1MY7A 4HJGB 4K3EL 5T3ZL 3D85D 4EN3C 3V79C 3UTSB 3KJ6L 4JZJB 4NBZB 1EHAA 4R7DA 4G80B 3M8OL 2D7TL 2LTQB 2BNQB 3BHBA 4JY4B 3BQUD 3O9WB 4R4FH 1NDGA 4X6DE 2MPAH 2N7BA 4OGXL 3B4NA 3THMH 2XACC 3GRWH 2CJUH 4WHYG 1RZ8A 3MODH 1T0MB 2MQ0A 1J88A 3MFGB 2DLFL 4M43L 1KIUA 3U9PL 2IBGA 4HJGA 2F19H 2RIKA 3K8MA 4KVCH 3MJ9H 4WHTA 4JZJA 4G80A 3IU3B 4JN2B 2BNQA 1I7ZA 1QSEB 3K1KC 4ODHL 1DUZA 3O9WA 5JHDB 4RWHA 1FIEA 3F5WA 3O3AB 5DMIH 1D9KA 4FHBD 1T66C 1MCPH 5HY9A 1T0MA 3EZ8A 2HT4D 5TE6L 1UVQB 2RCSH 3VFOB 5JOEA 1GC1L 5EPMA 1NC4A 2NW2B 1B0WA 3R0NA 5ECJE 5J56B 4K71B 5DXWA 2DQIL 2R0LH 1BQSA 2XTJE 3UC0H 5JOPE 3IU3A 3HLAB 4LSTH 1F3DH 4JHBA 1NGXA 4QXTA 3DURB 1T7ZA 2WW8A 5JHDA 4ZAKC 1IGYA 3MOQA 3TZVC 1L9MA 2Y7QB 1QVOA 1HNFA 3PHOA 3I3EA 3IGAB 1FDLH 3RGHA 1RMFL 3VFOA 3ISWA 3S37L 1UM5L 4WTXA 4LSRL 5EOCH 2E9BA 1IGCH 4JFFB 4Z5RA 4QHKJ 3QQ3B 3TV3L 3D39E 1C16B 2APFA 4M6AA 2P1YA 2WQRA 3RPIB 3H8NA 4M5ZH 3W0WD 4KAQH 4OLUL 4XC1H 4WUUA 5HVFB 4JPVL 1KIPA 2X1WL 3IJYA 4G9FD 4F37F 3F7VA 4DN4H 2OL3H 4Z8FH 1DSFH 3GHEL 2X40A 2ZNWA 4H8WH 3MRLB 3KPRD 1GZPB 2ZWLT 3QQ3A 4NNPH 5E6ID 5F1NA 3UAJC 1U2CA 1JPTL 1EPFA 1T83C 1B0RA 2H45A 5LBSL 3P4OA 5BRZA 1PY4A 1B6DA 2AJXL 4RMWA 5KTEL 3GKWH 4XNUL 5I18H 5B4MC 3TT3H 3GHBH 2ZUTA 2GCYB 1RZ7H 3VXPB 5FUCC 4FQHB 3K74B 5D6DC 5CIPH 3MRGB 3QEQB 1ZLVK 4IRSA 3QQ4B 1TZGH 3LD8B 2QQNH 4YHZL 2VDNH 1MVUB 1IBGH 4G8EB 4O02L 1Z9SA 1SEBB 5IFHL 3C60D 2QSCL 5C0CB 4FTVA 3QI9B 1YDPB 4HD9A 5I2IA 5DUPL 1J9CT 3G5ZB 4OUOA 4JN1H 3FN0L 5DVMA 4UNTA 1QYGH 1ZS8B 5L7XL 5IB2B 3DI3B 4JO1H 5C8JA 3U6RB 3ULUC 5KSAD 1BF2A 4OGAC 4FQHA 5BVPH 4NUGL 3MRGA 3QEQA 3HR5B 1GJIA 2GTZA 2VDOH 3GMQB 4FQLL 2BFVL 5C0CA 4CUCA 1J8HB 1KFAL 2PW1A 2VZUA 2FWOB 3PF2A 3QI9A 3QFJB 4TNVK 4I18B 5E2VL 3OAYH 4EI5B 1QD0A 3NIDE 3CFKB 4OLZL 1P4BH 3EOTH 1JWUA 3OMZA 1IC5H 4JFZL 4LCIH 3U6RA 1RZJC 2FATH 4FNLL 4ONGL 4G42A 3R8BB 3BI9X 3T08A 3GMQA 4GG6F 3UO1L 3DX9B 4G8IB 3QZWG 4YBQC 4KMTH 3SGEH 1UQSB 1JTTA 3AMLA 4OLVL 1J8HA 5CSZA 4MLSA 2IQAA 2FWOA 3LKPB 4QWWD 4PUBL 5D72H 4I18A 5C0AD 4EI5A 5DJZA 3RGVC 1T03L 5A3IC 4P2QE 1Q38A 5MENB 4ODUB 1ZE3C 3FKUS 2CXKA 4FQ2L 4KUCD 1Q0YL 4NPYB 4TQEL 5J13B 5GS2D 3FN9A 4MNHA 2LAGB 4X6CF 3I6LD 4G8IA 5FV2A 5HHOD 1IL1A 3NZHH 3QCUH 3EGSB 4ONFH 2GFBB 1BQHB 3FO0H 3LKPA 4S11A 5IT2L 1DE4B 5HHMB 5F96H 4PJ5B 3PGFH 4W6YB 4UT7L 4ODUA 2FIRT 4NN6B 4YHYC 3ZYJA 5E2WL 3MXWL 4F7CA 1F8TL 4NPYA 1Q94A 1JPSL 5I16A 4AJ0A 1N59A 2J5LC 3DV4B 1T2QH 1BQHA 5E56A 4HHAB 1DE4A 4F7EB 3VWKA 4HS3B 3ROLB 2W0FA 3UX9B 5CD5D 2FDBP 1JMZA 1YYMH 3N85H 1QRND 5CBEB 1D5XB 4G3YH 5T5NG 5GRUH 2GITA 4UUJB 3BYTA 3IU4L 2B4CL 3WSQH 4HIHB 2Z8WC 3MCKB 1KXQE 5DFWH 4OCNC 5I1IH 2VE6A 5J6GB 2DB8A 3O3EA 1FVCA 2F5AH 2P8MA 4PY8J 2B8OT 5FECA 3S8WA 4YFDB 3D25B 4F7EA 3BKML 5DRWA 5EU6A 1Q0XL 3ROLA 2C3WA 4UQ2B 4NC1E 1KIQA 4R3SA 5DQDL 2WUCL 3V6ZA 5CJQH 3UTTE 3HI6L 3V6OC 2L0DA 5EB9A 2GK2A 3ARFB 5B8CA 4PY7B 3HE6D 1T04A 5ABDE 1U2HA 4UT6L 3VFTA 2ZSVB 3EUUA 4LNRB 1N5AB 3EYFB 3LB6C 3KNBA 5CGMA 3D25A 2JJSC 2P46B 2A0LC 4RGOH 1BOGB 3WL9B 2R0WH 2FGWL 4GAFB 4L4JA 1I1FB 3SBWC 1UFUA 1NMBL 4OBSA 3EO1B 3GJFB 4HJJH 2ICCA 4Q6IC 5D6CB 2CKBL 1YYLH 2XZCL 1N5AA 3EYFA 2HLFC 1HQ4A 5FYJH 1PQZB 3HMWH 2XRAH 1UZ6F 1U8IB 5ISZB 4RGNE 4GRLA 1BOGA 2D7MA 1GGYA 1EDQA 4QHNB 3FT4B 4R90L 1MCEA 5E2UH 4J8RA 2YC1B 5AYUH 4UDUB 4H20L 1H15A 3DGGB 1AXIB 5I1CH 3GJFA 1YMMB 4CW1B 2PCPB 1SM3H 4AEHH 5D6CA 1S7UA 2I07B 5LCVH 1PQZA 3RKDC 1G9ML 1P5UA 4GQPH 1MRFH 4QHNA 1F3JB 3U48A 3FT4A 3VXUA 2W0LA 2YC1A 3BGFC 4UDUA 1UM4H 2VZTA 3SOBH 3DGGA 5IVZB 4YXHH 3C6LC 4LCUB 1KXVC 3IFLH 4WW2B 3OR7B 1ODAA 5D96B 1YMMA 1K8IA 4CW1A 2PCPA 3ZMRA 3GO1H 5F70A 3UJIH 4JAMB 4J4PA 4F8QA 4FQIH 4N8CH 1F4YL 3AS1A 2Y9RT 4KJQD 5J0BA 4X7SH 3PWPB 1BQLH 3V8CA 3VFRB 4APQA 1YEHL 1WWWX 4F7MA 1FH5H 4ALAL 1OP5H 2EDBA 1ZXQA 1EBAA 4P9HL 5ID1B 1HOCA 3I02A 5IVZA 3SKUD 1NEUA 1PG7W 3JV6B 5EBGA 5B22A 3VWJD 3LS4H 3QHZH 3KPOB 1NCUA 1W0VA 4YC2C 4C83B 1TVDA 4HIJA 3D3VD 4JAMA 4IJ3C 5A2JH 3QBTB 5E4EB 3VI3F 4KI5D 1VCAA 2XN9E 3E6FB 3VFRA 1YN7A 4FZ8H 3IS1X 2FB4L 2J8UA 3MOBL 4YO0B 1MH5B 3QISA 3EYQD 4LHQB 3VRIA 2A77L 3UTQA 1S78C 3BZFA 3KPOA 4MAYB 3WNKA 1OAKH 4C83A 3IXAA 1DL7H 4UDTB 2HKFL 4NO0B 3BH8B 2ERJB 4LEOB 3VRJB 2DQFB 2ARJQ 3WEXA 3SKJH 5MHSD 1K2DA 4TULL 3BGMB 4C56D 4GXVL 5I1LB 4QGTA 3P4NA 4U6XB 4XPGL 1H9VA 4NKMA 1E4JA 2N1KA 1J1OL 4JGJA 4ZTOH 4MAYA 1KXTB 5HYJE 5AZEH 1N0LA 5I8OH 4NO0A 1ITCA 1VFMA 5C0BB 4P46B 3TT1H 4LEOA 5CJ8A 3VRJA 4F9PA 2DQFA 3W39A 2BVQB 3RY5A 1UM6L 5HHNB 3BGMA 3VGAB 4U6XA 3OQ3B 1RUKH 3QIWC 1UKTA 3WDJA 3ZHDA 4OCYH 1TVBA 3T0EB 4XAKE 1BX2B 2J8UF 4KK6C 1PX3A 2KPNA 1PKQE 3LCYA 3G9AB 4QRTB 1EIBA 1GPOL 3ZKNC 5EBMA 2VLRB 4CL7A 4HLZH 4WGWB 1OAQH 5C0BA 2BSRB 4P46A 3X3FL 2ARWA 1VPOL 2J1KA 3WMSA 1BZQK 1DQQB 1S9VA 3I9GL 4R4BB 1CZ8H 3GSNH 2DQUH 1MI5E 4JPIB 1PSKL 4O9HH 4H1LA 3CLEL 3M1BA 1U3HA 2DJ4A 5DJ2B 3WIHH 4BQBA 1BX2A 3H9HB 3DX8B 5LWYL 5BW7A 4KKBD 3S4SG 3ZDYF 3WYRA 1TCRB 4HWBL 1AR1D 3FCTB 1QLEH 1F6FB 1FGVL 2F74A 2ZOLB 5BV7C 3KYKH 1GSMA 2LAAA 4P4KD 1TENA 2BSRA 5ICXB 3KYOA 4XVTL 2YSSA 3MXVL 3O2WL 3O3BA 4NGHL 2ZG2A 1UH4A 4RAVA 5GRXG 4Y2OA 3GKZA 4FFYH 1TQBC 4LPYA 3ARDA 1CGTA 4DAGL 4FS0A 2DIAA 1CDYA 2R69H 4PD4J 2X6MA 4UTAL 5DJ2A 3DX8A 1TCRA 5CSBA 2ZOLA 5A43C 5ADOL 3L95A 1IM9B 5C0RL 1ZT7B 2FD6L 4PJHB 3KPRE 3OKMB 1JYWA 4UIMB 1B2WL 4XNMB 5IHZB 1XGYH 3UJTH 5TQ2H 4X4ME 3SE9L 4H25A 1T89A 2FSEA 4JDTL 5FUOL 2X05A 3RVTD 2LE9A 5MEQA 3OKLB 4IEFB 1JNLH 2NY4D 3TBTA 4JZOB 4BYHA 3HNTL 1IM9A 1YEFL 1A4KA 1WIUA 5K33A 5J1TC 1MCOL 3TEUA 4CVUA 1ZT7A 1A6ZB 1FVDB 5CSGA 4PJHA 2HRLA 4XNMA 1UWXK 2G2RA 1MWAB 3MLVH 5EULV 3L3KA 2VLKD 4X8JB 4DKFH 3U30B 1ZVYA 1IZKA 3DBXB 2AK1L 4S0TD 2XQYG 3WXWH 5DRNB 4OQTH 1TZIA 4JZOA 3TH3T 2K1MA 1A6PA 1T7WA 3LPGA 5BMFL 2J3SA 1FVDA 2IMMA 1CXFA 3T0AA 3RVWD 3P4MA 3LDBC 1BF8A 2R29L 1DQDH 2UZYB 1I7RB 2A9ML 2AXFA 4F37K 3DHJA 4ZDHA 3MLTB 4NUJA 2XZQL 4GKSB 1YPZA 5DRNA 5D2LB 5FXCH 4ELKA 1YMHB 3QWOB 5C0JA 1EEYB 1BQUA 1QFOA 2UV3A 3BZDA 2NY1C 1QO3A 3B8YA 3SGKA 4YFLI 1I7RA 4U33A 4ZUVB 4PJHF 3T3PF 4NT6B 1QFUH 1JF6A 2VQ1B 4MSWA 3S3PA 2BVUA 1EMTL 4LQFH 5D2LA 1YMHA 3QWOA 3R06B 3S5LA 1VFOA 2VXTH 4FQJH 4MB3A 4GMSL 3VMOA 3BEWA 1K85A 3I6LE 3NTCH 5HHOE 4HG4J 5FOBB 5LKNA 4UILL 5HHXL 3GDBA 1OHQA 3BW9B 3FONB 5E00B 2JK5B 3ALWA 3ARSA 4NT6A 3CAFA 3GSVB 5J6HB 3DOSA 2MCPH 1L7TL 3IFPB 3OGCB 4NC0B 1ONQB 4OZIE 2R9HC 4ZXBC 2VQTA 4L9DA 1BVKB 5K9JL 4F33B 2P7TB 1NEZB 1YPZF 4NQDB 4OZGE 5DMYA 1BIIB 5ITBH 2CD0A 1L7IH 2CGRL 2YA0A 4QRRB 5FOBA 1ORSA 2R39A 3BX7C 5IBTH 3LIZL 1ZLUH 3LH2L 4Y1AD 3MREB 4FQXA 4M61B 4JFXB 1H3GA 4TVPH 2JK5A 5C07D 3MODL 5HYIA 3GSVA 5J6HA 1EVUA 3HZMB 2CIIB 3L5XH 1AJ7H 4PJDE 4NFDA 1QRNE 1NBQA 5HDOA 4B7LA 2HFGH 1AGCB 1Q9WB 3SGJC 2P7TA 1NEZA 4NQDA 3QUMB 4CNIA 1I1AB 4QRSB 4N0CC 5F9JA 1YNLH 2J6EL 3O4LB 3ARRA 1M6OA 2E7HA 5DMIL 1ZANH 4FP8H 1JHKL 4N0FA 4NQSA 1MCPL 3MV9D 5AYQA 2CO7B 4PLOB 1J1XH 1W2KT 4LLQA 3TC9A 2CIIA 5ICZA 2Z91B 1A0QH 2RBLA 4JLRB 3TBSB 1Q9WA 2X5PA 4D9QD 1YY9C 1UWGL 2ESVB 3QUMA 1VFAA 1PLGH 2DLIA 2Q3ZA 4QRSA 2HT2D 3T04D 4QLRA 2XIDA 5GQBA 5KS9B 2NXZB 3ULVE 3CFJA 2BVEA 1R6VA 1OOAA 2JKXA 5K59F 4O00A 4YWGH 5I30H 2DQGH 3O6KH 4O2FB 5CEZH 4K8RH 1FNFA 5GJTL 3WDHA 3AAZB 2FH8A 3QIUB 5GIRB 3O81A 5IMKA 3O9WC 3MLZL 4UBDC 4PRIB 2QADB 1D9KC 1X6LA 4QY8A 4JQVA 5F21B 4HUUA 4GLRI 1AXSA 1BAFL 2X4UB 2VLLA 1FL3B 1NCWH 3V4PH 2B0SL 4GQ9L 4O2FA 5C6PB 4X5WA 5D9SB 3HTLX 3MLWL 3AAZA 1DVFD 5JUEH 4PV9A 1XGRA 2ICEA 1TTFA 1CGYA 1KC5H 5FYLH 4OI8A 1HXYB 3QIUA 5HXMA 1JHLL 4H8WL 4NNPL 4KGLA 1F58L 1IRAY 3E2HC 3KLHC 4PRIA 5LGHL 1OP3H 2XWBA 5CP7A 3IDYB 5GRYA 4LQ1A 4QTIL 3ZHLA 5D2NA 2F53D 2X4UA 1JYNA 1RZ7L 1XGUB 4U1SB 3HRZA 1SVZA 2XG4A 3VW3H 1GC1C 1HXYA 4JRXD 4XZUB 4Y4HB 3FQXB 5IROC 2QQNL 1HCVA 1HHIB 2VDNL 1UZ8B 5FYJD 4H0IA 2WINB 3Q2CA 1ZEAL 3LSOB 1SMAA 1IAKB 5SWZD 5DC4B 3CDCA 3FFCD 2MQ3A 3B9DA 1LO0L 2D7PA 1K4DB 1A3RL 4JO1L 5TFSL 1I1YB 3NIFE 3RRQA 5CCKH 2H32H 4LSVH 1SY6L 5DURD 1HHIA 2IFFH 4LSPL 4PLJD 3QNXB 1BMGA 4G7YH 1S7QB 4G43B 1U93B 3D3VE 3AB0B 1IAKA 4HCRH 2H3NB 1MCHA 2NLJA 4KI5E 5HPOA 1EZVX 3T2NL 4GUPB 5TJWK 1IC5L 1KJ3L 1KF9B 4IRSC 5FDWB 2YUZA 2CK2A 1T20B 3JUZA 4HUWB 3DUSB 1I1YA 4X6DA 4E5XA 3T0VA 5FYKU 1EGJL 1Y0LA 4A6YH 3PQYD 4KMTL 4YR6A 3QNXA 3S9DB 3BSZL 1S7QA 4I2XE 1VACB 1CFSB 1SY6A 2H3NA 4Z0BH 2VDPH 2X4PB 5MHSE 4O58L 5IM7B 1AGFA 4C56E 4JG0L 3LD8C 2NXYB 4BFEA 5TQ0H 2VRAA 2VH5L 4M1GH 5D1QD 3QI9C 4K23L 1S7VA 3NZHL 3QCUL 4EUPA 1VACA 1CFSA 4HQQL 4L29A 4LLYB 3SO3B 3SDCC 5DJYA 4M93C 1MCJA 4ZFOL 1H8OA 4Z7NF 1TCMA 1HSAB 4M4PA 3QUYB 2IMNA 4QOKD 4HJ0D 2MTPA 3IETB 5E08H 3NCYS 3PHSA 4TOYH 4PRAB 2HAZA 3GK8L 4Q9CA 5GGVL 3WKNA 3GNMH 1KYOK 3IF1B 3AS3A 1AY1H 32C2B 4I18C 1KENH 4X6DF 2E7CA 3C2AL 3CDGB 5FA3B 4OSUL 4P2OA 2B39A 4LLYA 5T1MB 4E41D 2HG5B 5F97E 3MV11 1HSAA 4MAUH 3QUYA 5LQBL 1GGCL 4X7TB 1TQCB 3D39A 3I2CH 5TH2A 3HAEG 1ROWA 3S97C 1KELH 4IOFC 4LVNB 4I8DA 1O5DT 4XNYL 5HI3C 3E8UH 1RZGB 4XMKL 3L3DB 5FYKD 2LQRA 2NYYD 4Z18A 4WEMB 4DGIH 3BOVA 4HUVB 4GAJH 5H2BB 3U0WL 4WI4A 1LEKB 2G5BB 1P4LB 5DD0H 5J13C 4KRPC 4OM1H 15C8H 2ZKHH 4OF6A 3K0WA 4XH2B 2P8LB 4Y4KD 4Y88A 4PJGB 1IC7L 1NPUA 3C5ZD 3MRCB 1RZGA 1ZTXH 3VWKC 2HFEA 2G60H 4V2BA 1IGFH 2VLJB 4NN6C 1HHKA 2R0WL 2H1PL 3WHE1 2G5BA 2BC4A 3RZCB 3MJ7B 1X4ZA 2XTLA 5HHQA 4LLMA 2YHGA 4J7RA 1A5FH 1CLYL 5EBWB 1MFAL 4F2MB 2D7QA 2VB5A 1ZGLM 1X5GA 1XF5A 4XH2A 1UJ3A 2EE2A 3V7MA 3OJMB 4YHMH 2P8LA 2PR4L 4P4RB 3GIZL 3QUZD 3RX7A 4IS6A 1FYTD 3BDBA 5MEPB 2F9BT 4GRWE 4E42A 5TE7H 1DUYB 4NQCB 3OTTA 2V5TA 4ZYKB 3T3ME 3T4AA 3RZCA 3MJ7A 2IAMD 2HLAB 5E2UL 4F3FB 1Y6NR 2GYSA 5B8CC 3RAJH 3C87A 1KEML 3TFKC 4ELME 5I1CL 5JPNA 2E7BA 2FO4A 1LDSA 2VLKE 5L2KE 1R5IB 2B4CC 1JTPA 4OIIH 5LCVL 2IQ9L 5JW3L 1OT1A 4AH2B 1NAMH 1DUYA 4KUZL 2YD3A 4MQXD 4NQCA 2O26U 1G1CA 4S1SH 3B9AA 2QV2A 1A6WL 2KL6A 2NZ9D 3QDJE 3C5JA 2HLAA 4F3FA 4RFOH 2DDQL 4JQIH 1UM4L 1OGTB 4OCRH 5TE4L 3SOBL 1UB6B 4HPYH 3IFLL 4JDZB 4S2SB 1R0AL 4IMKA 1FGNL 3MFFB 5C3TA 5I1DB 2JJVA 2DQTL 4OD1H 1D6VH 3PGCA 1R5IA 4GRLC 1ZLWK 1HWGB 4FQIL 1NDMA 2C7UB 4Y5XB 2A9NL 3R8QA 1BQLL 2J2ZA 2VZSA 3DRQB 3G6JE 3E0GA 3R1GH 3TO2B 4HXBL 1C5BH 1IC4L 1OGTA 4M7ZB 4J3XA 5F1IB 2Y4SA 3BWAA 1H8NA 5E9DD 5DHVB 4JDZA 3LS4L 4MA1B 2OTWB 1U8QB 3MFFA 1YQVL 5I1DA 2AEWA 2OZ4A 5IG7A 5FV1L 2C7UA 3P9LB 2C5DC 3EHBC 4FXGB 4CVZB 3FZUC 3NIDF 4HFWB 1RIUH 4FZ8L 4S1RH 2DQCH 2ZUVA 3DRQA 1RD6A 2UVEA 4HSQA 3V4VH 2XT1B 3BRGC 3TO2A 1IVLA 5ALCL 3RTQA 3CFIC 3PV6A 1FE8H 4X6BB 2A83A 4HMEA 4OLWL 1A7PL 3HRPA 2OTWA 3K2MC 4D9LL 1FLRH 4PRPD 3GJEA 3OF6A 4O5LH 4JM4H 35C8H 2C1PB 5F6HI 4APQC 3P9LA 5DEZA 4FXGA 4CVZA 3BDXA 1G9MC 2HTLD 3MRMB 1EHNA 1LK3L 5IVXE 4U31A 3GSRA 4EOWH 3OB0K 1BHGA 3ROOA 4X6BA 3T0DA 4PJAE 2CDEB 2P5WB 4OZFA 1I3VA 2GAZA 1LO4H 5CILH 4Y1AE 5HGGS 3DHMA 1QBMH 4JZNB 3ZYOA 1MIML 1QHOA 2X4NA 2I25N 2OJEB 5E99L 3UTTA 4M7KH 4M4RA 4OKVA 4NFBA 3MRMA 2XFXB 5IJVB 3C6SA 3SCMB 3ELAT 2CDEA 4P9HC 4NHUB 2P5WA 3VJ6B 2ATKB 5IQ7L 3NCYP 3CSGA 3L3OB 4X6FB 2D3VA 3B9KB 2DD8H 4XCNB 5I1EH 1LO2L 3ARGD 3MUGB 1EO7A 2OJEA 3GSXA 2BK8A 3CX5K 1OCWH 3U7YL 2XA8H 1QLFA 3K81A 5DYOB 1MAKA 2XFXA 5CGYD 1N8ZB 3KPLB 1EJOH 4G6FD 3FFDA 4MAYC 4NHUA 4I9WD 3WIHL 2ZJSH 1N6VA 4MDJA 4JHAH 3D5OF 2V9TA 3L3OA 3U1SH 4X6FA 1QLEL 4QTHA 3B9KA 4F9PC 2WLYA 4WIQA 2ZCHH 1OTUC 5DEGA 1JP5A 3CMGA 1IFHH 4MD5A 5CZKA 4QHMA 3I75B 3G5YB 5DD3H 1MELA 4M6NL 3L3GA 2R69L 1K9TA 1WITA 3K80A 5JIPA 4KPHL 2NY2C 4P46C 1T5WB 3WFCH 2WQ8A 1CF8H 2PTUA 1P84K 4UV4H 1KT2A 1BJMA 1BD2E 2MHAB 2VXQL 1BPVA 3VGAC 4DK6A 4OV5A 1I1CA 2P43B 5T3XD 3I75A 2F5BL 1U3HC 1H3VA 5BW7C 1RZKH 1XGYL 4YNYA 4LOUC 1VENA 3CSBA 3WN5A 3QXTA 4LLVA 1A64A 3ILQC 4GS7B 3ARQA 2BY3A 1VA9A 5CMAB 4Y89A 2F53E 1T5WA 3L3HB 4B7IA 3MZGB 1A9EB 5CLWA 8FABB 2F8OA 1HEZB 4ZS7H 4P5TC 4MCZB 3ZTNL 5FDYA 5FM5M 4YJZL 3ARDC 4EJ1C 5BZDB 4JRXE 2AKRB 1V7NL 1M7DB 1H0DB 3HMXL 2Q6WB 2D31A 4KDVA 1A3LH 1AE6L 4TPRL 3U4BH 4K7FA 3MLVL 4I0PB 2XN9A 4KKCC 3JV4B 4RGMB 4DKFL 5CMAA 2C1OB 4Y4FD 2DLHA 5DRZB 1MAMH 3D85B 2V5MA 4EDWH 5HBBA 4OQTL 5FO7B 3B5HA 4MCZA 3DPBA 1UCBL 3BQUB 5EZIH 1OGAD 3DO3A 1K4CA 1LWRA 4HXAH 4OT1H 3KDMA 3TGXA 2AKRA 1M7DA 1H0DA 1MIEH 3CLFH 3W11C 5I6XC 2Q6WA 1T89C 1NGWB 2XI9A 4HFUH 4EQ3A 1NFKA 4HIXL 4I0PA 4Z7WB 3ECBA 2C1OA 2K7QA 4XPFL 3D85A 3UYOD 1G6RH 3K8LA 2GUOB 4D0BB 2VDQL 3BQUA 1LEGB 1LNUB 1MJUH 1ZAGA 4XVUC 1MCCA 1NGWA 4KXZI 4NRYB 3VD7A 2KQMA 2QTEA 4UQ3B 3O4OB 3NCMA 1NCCL 4CMHC 1BBDL 3QDMB 1MFBL 2QHRH 4OCSH 2AW2A 1TJIL 2GJ6D 2ZUXA 4IRJD 4EQ2A 4LIQE 3VFNA 2GUOA 1ACYL 4D0BA 3MACH 3EIFA 2J12B 1T1WA 4LCWD 1LNUA 4PGBA 3IRPX 3L7EB 1ZV5A 3IDNA 4HX1A 5KAQF 4P3CH 4NRYA 2IPTL 1IKFL 1XF2B 4PGDA 3DARA 4BFIB 3K46A 5DEFB 2B5IB 4B41A 5E2TL 4MA7H 3TYGH 2LU7A 4QOKE 2EDTA 3U46A 4MJIE 4GLRH 3QHFH 1CT8B 1NBZB 1KN4L 3IKKA 3TBVB 3SGKC 2EH8L 1UXSB 4G8FA 3W0WB 1WUNT 1XF2A 3PG2A 4BFIA 5DEFA 4E41E 4PJ9D 3VXTB 4G9FB 2AABH 3SE8L 4R9HA 2DQDH 1AJ7L 4DZBA 1MFCL 2ZUQB 3F12B 2HFGL 2I9LB 5KVGH 1U8MA 3OKYA 4NJ9H 3IKCB 4RA3A 3DWTA 1UXSA 2Q76B 3QRFM 5FYKE 3M07A 3RWJB 3W0WA 3VFGL 2YPKB 5EN2A 1P9MA 5DO2D 1ZANL 1NCTA 1CLCA 3QPQD 1EFXB 4FP8L 3RA7L 3VXTA 4G9FA 1DP0A 1Q9OB 1TFHA 3N50A 4YE4H 4Z7VB 2R0ZH 5MEOA 4OKDA 3KPRA 5E6IA 4EI6B 1T0NB 2H2SD 1A0QL 4YHIB 1YC7A 1BFVH 3BN9C 2GT9B 3OKNB 1U6AH 1RUAL 4KY1L 3IKCA 4FOMA 4ODVH 4QF1B 4Z7UB 5GGSA 4FQXC 1VEOA 2KQNA 1OAUH 4TUOB 3DX7A 1AO7B 3N9GH 3HUJE 4PTUB 5AWNL 4OZHB 2X7LA 4U3HA 3QEHB 1X5IA 3MV7D 4YWGL 5I30L 3LS5L 3NPSC 2NY0D 4Z7VA 4XVJH 5I8EA 4K8RL 4L8CB 2AXJA 5H8DA 2HVKB 3DVGB 3ULUH 1KBGL 3C60A 1WZLA 4YHIA 2W07A 3F58H 4MD4A 1QQDB 2WIIB 2ZOKA 1FNHA 1PAMA 4JKPH 2GT9A 3OKNA 5KW9H 2X4RB 4MD0B 4OGYH 4XPBL 5HI5D 2V9QA 4NBXB 4Z7UA 3VFSB 2IGFH 4X7FC 1RHFA 1K6QH 2COQA 4YAQB 5D7LD 1FYTE 5T1LB 5KSAA 2VZOA 1PVHA 1I1RA 3MLUH 1KGCE 3V0WL 3UTSD 4D8PA 3OAYK 5I1JL 1J87A 2NCMA 5JUEL 3IJHB 1X5AA 3DVGA 5HGDB 1RZJH 1KC5L 5KVEL 2WIIA 5CJOL 1J12A 5ELIA 2X4RA 3QXAB 4MD0A 5C0AB 2X4QB 1OP9A 3EJZC 2XQBL 3HB3D 3U83A 3NAAH 1QLRB 2BVOB 2YPLB 3DVFA 4NSKB 1KJ2L 2AJYL 4Z0XA 1NGQH 4KKAD 5C08D 1D5ZA 1CE1H 1S7TA 4UIKH 4DKEH 4ZNEA 1SVCP 1LVEA 3QG7H 4KTDL 2Y06L 3QRGH 1QSED 5JO5B 4LBEB 3CUPA 4JO3H 4R26H 1UYWH 1XAUA 5C0AA 1Q9LB 4JQVC 4NKDB 2OBGA 1AGEA 2NXZC 3ZKQD 4PRHD 4Z7UF 3WFDH 3NMEA 1B6UA 4WI9A 5ESAA 4JM2F 2YD7A 4XCEB 1RI8A 3QIUC 3WBDA 1MPAH 5HHOA 1I4FB 2QR0A 1FRGH 5JOFA 5D7JD 5JO5A 4LBEA 1BFOB 5JNYA 5DC9B 2IFFL 1H3PH 2PETA 1D7FA 4KC3B 5D2NC 4NZUH 4MNQE 5EORH 2VL5A 5E95B 2UYLA 2DM3A 2IPKA 4S1QL 3VCLA 1Y6KR 4X6EB 1MFEL 5K9OA 3D0LB 4OZGA 1JN6B 4JFFD 1I4FA 5D71H 1JYXA 1ZHLB 4LKCB 2VO5A 5J12C 1BFOA 1QTYT 1Z3GH 2CIKA 2X4OB 1MF2L 4PRPE 5C0DB 1MCRA 4MDIB 5L6YH 4PJDA 4AK1A 1G0DA 1QRNA 4OF7A 4Z0BL 4DUWA 2V6HA 4PJFB 5AAWA 3O2VH 3G04B 5GS3A 3QH3A 3ULVL 4KUCF 1LP9E 3FOMA 1IM3B 2JB6B 4LSUH 4N5UA 5C6TH 4U1GC 4LKCA 5DC0A 2R1XB 3B83A 2GW5A 2X4OA 2YXMA 3MGOB 4XP1L 3O0RL 3SN6N 2IBZX 5C0DA 4WO4B 2AEQL 4YIQA 4MDIA 2XZAH 4LU5H 5C09E 3VH8A 5JPMB 4NZRL 1P7QB 1YJDL 5GRWA 1Z5LB 1QBLL 3AC0A 4U2YA 2Q87A 1V7MH 5HHVL 4U1KB 2HA1A 4Q74A 1IM3A 1SYSB 3HE6A 3HG1D 3Q3GB 3PXHA 5GHWL 5E24E 1KPVB 3MRFB 2VC2H 4OZGF 2YKLH 2R1XA 1VGEL 4N90E 5GZOD 1S7RB 1G9NC 2ITDB 4KTEH 5J06A 2GSIB 3MGOA 1GOGA 1KENL 3VFUA 4ZUTA 4JREB 2R8SH 4BQ6A 4U6VH 2EDDA 1XCQA 4HZAA 1OPGL 1Z5LA 3LZFH 3ZDXF 1G9EA 2EE6A 3JTSA 4U1LB 5GGQH 3LAFA 4PJDF 2NZIA 3I2CL 1KACB 1R5VB 3Q3GA 5F8RC 3QFJD 5A2LH 4I77H 1VEPA 4I9WE 3SPVA 3OPZL 3MRBA 2CK0H 1EO8H 3FRPA 2EEAA 4IIQB 2YBRA 4DGIL 1J5OL 1NMAH 3ALPA 3T09A 1R3HA 4GAJL 2XTJC 5C2BH 5CLTA 4S10A 1A2YB 3HZYB 3NFSL 4U1LA 4BQCA 2FL5A 2FX9H 2R2EB 4OLXH 15C8L 1RUML 5D1XB 3HC0B 5EUKB 1HKLH 2EDLA 4JFDD 3ILPB 2E5EA 4P2OC 1ZTXL 3BP6B