2Z31C

Crystal structure of immune receptor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
b'IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
molecule tags Immune system
source organism Mus musculus
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31C02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2z31C01
3O6ML 2NQCA 2P24B 3FFCD 1NLBL 3U7YL 1F45A 4XPAL 1U3YA 1YYLL 4KQ4L 4YHOH 2RAMA 4LLVB 4X8JA 4JM4H 2A1WL 3ULUE 1RUAH 3PDOA 3QQ4B 3TA3B 2DQHH 4NRYB 4U6YB 2XFXA 1N5YH 1LO4H 4KJPC 4RWHA 1UXWA 2G2RB 2CKBL 3VXRE 3U48A 4R4BA 1KFAH 2H32A 3CD4A 4JY6A 4KGJA 5A16B 3CFJB 5F7WC 2V2TB 5ANMB 3WUWG 4LSTH 4AM0B 4LCCB 4M9OA 2NY4D 2OQJB 5ALCL 4ZAKA 1Y6NR 3QFJA 1KSRA 3HI1A 5FYLL 1MJ8H 3T4AB 5J12C 5IVXA 4CVWA 3QUYB 1DQML 2KQMA 4Q6YA 4NNPH 1FNSL 3OBAA 3QDGE 3KPMB 3KNBB 3NA4A 3W81A 1HDMB 2VC2H 2KDGA 2R29H 4OLVL 4OUUA 4G8EA 4DFIA 1VACB 1YY8A 3TWCH 1XGQA 4L4TE 3QI9A 1H5BC 2IALA 4R4FL 3KPNA 3QXAB 1Q9OA 4HS8H 4NJAH 1FLRH 4TSAL 2W65A 1J5OL 3CZFA 1PG7X 3L5WB 4I5BA 3DURA 3PWLB 3ILQD 1DDHA 5DVOA 2QQNL 2OXGA 4QRQA 3AREA 4MMXC 3U4EB 1XF5B 5I1IH 4F15B 4GAGL 3WN5B 4YH6A 3H9SE 5I16A 1BGXL 5T1KA 4L3ED 3V6ZA 2WUBL 3HHRB 5LGJB 1A1MA 3MRQA 4JPIB 1INEH 4Q2ZA 1QQDA 2MSPA 5JMRA 5I1AA 3TVMC 1QSED 4DGVH 3QUML 4Z95H 3CFCH 3VFGH 4LASL 5EOTA 1MWAB 3RZWA 3WJLC 3O8XD 2Z91A 5DJCA 2AGJH 3M17A 2EYRA 3DUSA 4IIQA 4NQDA 5ENWB 4ONGL 2GJ6A 4LQFH 4XNUH 3ZHLA 2EDYA 5TDOA 1DQQA 4J1UB 4K7PH 3PQYB 1K8DA 5T1MA 3NIGE 3WIIH 4P49A 4DK6A 3ARDD 5C08E 4XPHH 5HHVH 2R4RH 3D18A 3W39A 5GS0H 4OF3A 2DLEA 4S1SH 3MUGB 2V9QA 4X4ME 3RBGA 2AJSL 3ZKSD 1AGDA 1KIPA 5DRZB 2AGJL 1FLTX 4X7CC 3VFGL 5H2BB 4LSQL 1FVCA 3RVVD 1VADB 5C0DB 4PJEE 1S7RA 4JFED 1KN4L 1SY6H 5B39G 2HKHH 1A6VL 5LWYH 3UYRL 5D2NA 2GTWA 2APWA 4ONHA 5A2JH 4FQXB 4O2CB 5L0QB 1QVOB 2JE8A 5BZDB 2OX5A 4HJ0C 2R1WA 1BOGA 3UTPD 4PJAB 1MIML 1N6VA 4MA3B 2BY1A 4YHPB 2FHFA 4LCUB 4PREB 3NAAL 2UZIH 3H7LA 3N9GH 1FNSH 5F97E 5JA9A 3PE9A 1PG7W 5TPWH 3U0WH 1NFKA 3MRNA 4MXQC 3K4ZA 3MLZH 3UJTH 1MF2L 3JXAA 3WE6B 1GH7A 1OY3B 4P2OD 2WNGA 3MV9E 1MNUH 2FYYA 1CD8A 1ZVSA 1AFVH 3JV5A 1G7PB 1YNLL 4V1DD 4XC3H 4FQ2L 3TVMD 3S97C 4JFYB 5FYLD 4LLQA 5ILTL 1HINL 4JR9L 1J9CT 4E42B 3MO1B 3ARDC 4LRIC 1H5BA 2EYTB 3CFKA 3D87B 1A64A 3GJFB 3INUL 5DJXB 4MJIE 3G5VA 2JCCF 4Z7VE 4K9EL 4YHNA 3LKPB 4GW1B 2BDNL 3MXVL 4W68A 1FBIL 4MSWA 3M17B 4NWTH 2P5EA 4QRRE 4H26B 3T2NL 5CP7A 1KCUH 3RVVC 1J0IA 3TEUA 3L6FB 4IDLA 1MFAL 3MV7B 4ODHL 2A83B 4NO0A 3DOSA 1FAIL 2IH3A 5DT1H 3QUKA 1U3JA 3BUYA 4EUPH 3DROB 5I1JH 4M7ZC 5DMJB 3H9ZA 4QHNB 3STZA 2OI9B 2PTTB 5DEFB 3K46A 4Y8AA 4DJMA 2QLVB 3DTXA 4C58B 4UBDD 5IESL 5DD1H 1AGEA 3AU1A 5ICYA 3AS0A 5LGHL 5DDHB 4CMMB 3L3OB 5IT2H 4BSWB 1T20A 1BJ1H 3D0LB 4XCEA 1U8MB 1KPRA 4BUHA 4P9MH 4ELMA 2MWCA 4G6FD 3FL7A 3V95A 1CXHA 3QIWB 4B5EA 4HJJH 4LU5H 4XNMA 1NANH 2ADIA 5EO0B 2AV1A 4NUGL 4F7TB 3BP7B 2A73B 3H3KA 1FZMA 5C9JA 2E9JA 3QPXL 4DQOL 1DN0A 4OKVB 3QEQB 5EO9A 3KXFB 4JANB 2DQDH 3ZDYE 1OTTC 3D39D 1URLA 1E4XI 5FUCE 5E6IB 3UTTB 3MRNB 4JFFA 2IH1A 4K3EH 3WN5C 5IEKB 1S9XA 1KTLA 1ED3B 1VFUA 2LU3A 3BYTA 4I3RL 1TTFA 1FFPB 4NQCE 1U8PB 4NZUL 2HT3D 5JQ6H 3U7WH 5KSBA 1MJ7H 3BP5B 3DXAD 3KPLA 5D1XA 4HXBH 3T2PA 4GAJH 5I1GH 5BOZG 2Q1EA 2V17L 3BGAA 3THMH 5JR1H 4DUVA 4YHZL 3RNQB 1QSEA 3BKYL 1BFVL 1PKQE 3G9AB 2EH7H 2NY2C 1SYVA 1KT2B 4G6KL 4NQDD 1XF2A 2AS5M 4OCRH 4Z9KB 1RZGA 5EPMB 1IBGH 3P4NB 1RZIB 1ZWIB 4IRSB 1VGEL 2HTLC 4PJFA 5EC1A 4LCWD 2HJFA 1FG2A 2FX9H 2QKIA 3SDCC 5CJQH 1EEYA 3EUUA 3MBXH 1DVFA 2E6JA 4U4BA 1KACB 4UILL 1E27A 1NDMA 1MAJA 1ZT4B 3U2SB 4YPGB 1LP9B 2GITA 3Q1SH 3G6JF 3TP4A 4HPOL 4RBPK 3NN8A 1WBYB 1EAJA 1AKJA 3BZDA 1MPAL 4QHUA 1CGVA 1FNAA 3BO8A 4JFFE 5DDHA 4KROC 5ADOL 5FK9B 1CDBA 2DQCL 3D6GA 5GS1B 5J9PA 1X4XA 3DO7B 2HJLB 3G6DL 4Z7VB 2A9NL 5DD5H 5LG1A 4GKZA 4FFZH 2CLZA 4POZC 4W6XB 4Y2DD 1I8KA 5FUZL 3TBWA 1S78D 2NXZC 1AE6L 3VH8G 3WBDA 5FM4A 5DJAA 3LKQA 4XCNA 2RFXB 5BXFB 3QDGB 4UV4L 5IBUG 4Y5XC 3Q5YA 1J0HA 2OBGA 1GOGA 3RX8A 1G84A 5JOFB 2GEEA 5FA3A 1TZHB 2V5SA 5I9QC 1BVLA 4LSQH 1WTLA 2J6EA 3MV9D 1OP5K 2E5EA 4LQFL 4CVUA 4DKFL 1HXMA 4AEHL 5ADPH 3VFPB 5EU7E 3SQBA 3V5DB 4YIQA 4KJYA 1TVDA 4KWUA 4HIXL 4K8RH 4KV5E 4WTWA 3T3ME 2EYSB 1NUFA 1SEQL 3BEVA 4OM0L 1MCRA 5DZOA 5M95B 4QTHB 4M5ZL 3TVMA 2B7DT 3QDME 4XXDA 5EU6A 1KLUA 1UJ3C 3MR9B 3EO0A 3W2DH 1YYML 5CEZE 2NTFA 1G7JA 4LEXL 4JFEE 3UJJH 1MLBA 3HRZA 3L3IB 4OFIA 3O6LL 2VLJB 5IOPB 1ZHBA 4LGPB 3QIUA 4OFKA 3U0TA 4RFNC 1ZEAL 1P2CB 1U9KA 1YDPA 3T65B 1XIWC 3MRCA 3OKLA 3CU7A 5EZIL 1EH9A 1D6EA 4GAGH 3GMQA 2VLRB 5DXWA 4WI8A 1YNLH 4PJ7A 4JHAH 1S3KL 3QIUD 4NNPL 4M7ZB 4GMTH 4Y2OA 4K94H 2I07B 5FIEA 3HPJA 4MYWB 1Y6MR 1IGFH 3BN9D 4GXVL 5C70A 5C07E 5ILTH 4NNYA 3TZVD 2DQFA 4WWID 2KZWA 2X4QA 3RX5A 5CBEB 1AKJB 3LKNA 5L8LB 5DJDB 4OFVA 2BVTA 1A4JB 4UINH 3VG0L 2P7TA 4DUXA 5BMFH 3PWVB 3LRSB 4FZ8H 1XGTA 5J89A 1S7VA 5DHYB 1RJZA 2D7TH 3U4BL 3I6GA 2Z92B 4EUPG 1C5CL 4LRNH 4HG4K 1OP5H 3OKEA 2ICCA 4HUVB 2CLZB 2I9TB 4DEPC 1UH3A 3JWOC 2IG2L 1R3JB 1YEKH 4X4YB 1V5JA 1R3IH 4HT1L 5DUBB 2DYPB 5BXFA 4JZNA 1I7UB 4C56A 2DQEH 3MNZA 4X98A 4PJBE 3GSQA 4YE4H 4CADB 2IAMB 1IEAA 2XWTB 4P5TA 1FFQA 4NKQB 4XHJD 3IDXL 1EUTA 4R7DA 5EFIA 4M4RA 3O3AA 2YRZA 2P48B 5B4MC 2EZ0D 4D9RD 3BQUD 2WQRA 2K3TA 4N8VB 4KDTC 3VFMA 5EOCH 3K74B 4D9LH 3K8KA 2WK2A 1QFUH 3GRWL 3TBVB 4PJFE 4J23A 3I50H 1T2XA 1AXSA 3ORJA 5IMOB 4OF7A 2BNRD 2ZUXA 4P4KD 4KH2A 2X4TA 3BPOC 1V7MH 5HHNB 3VWJB 3BP6A 4MCYA 3MLRL 1RZJL 2GY5A 3MLTB 4M7LL 3QZWG 4MJ2A 4UT9L 4X6EA 4YBQD 4ZOCA 5DLML 3ZDZE 5T3ZE 3CC5A 2ESVE 3X14B 3R8BB 3CXDH 1U3HC 2VLJE 3SHSA 4XB8A 3ILPB 4U31A 4ZFZA 5F71A 3B3IA 5T1LD 3ARBD 1R3KA 4W4OC 2JCCA 1I1YB 3T65A 1CFNA 5E2VL 3QUMA 2PTUA 4M1CC 2B2XH 3S37H 3ARTA 1N0XH 5D5MB 4HKXB 2DTMH 1QSVA 1FN4B 3GI8L 4PJXE 3F6IA 2X41A 4KK8C 3MLRH 4M7LH 3SDAA 5HYSG 2AVGA 2HTLD 4G3YL 3KLAB 5I1JL 4XMPL 5CP3H 4JO2H 3RPIB 3FQUA 2OL3A 4L29A 4MAUL 4N5UA 3FRPA 1QEWA 2G9HB 1N6QL 3L5XL 2C1OB 4MXWH 3WKMH 1YEDA 4I9WE 1AKJD 2EKSB 1FFNA 3RI5K 5IW1A 5FFLA 5GGUB 1MJJB 4OZFH 2DQUH 2ZOLB 3AMKA 4FFZL 3N85L 3QO1A 5LCVH 4N68A 1ZSDB 1OAXH 4E41E 3VXTB 2VYRE 5B22A 3WNOA 5ID1A 4AK1A 3EW3B 4NHUB 2A6IB 4J8RB 3LQZA 5IHBA 3FO1A 4XBEH 2N56A 3MJ8A 4XGZA 4Y5XB 3VXNA 5K9JH 4F7CA 5HYQA 2CDEB 4FNLL 3RKDD 4F9LC 5DHVA 1MJ8L 4CADA 3LEXA 3WS6A 4L4JA 5I8KH 1F90L 2DS4A 1MI5B 2LTQC 3CFBA 4GRWB 1Q0YH 3U7AA 2XIDA 3PGCA 4LHUB 3RRQA 2R1YA 1RHHA 4K23H 3FJTA 3AS2A 3MLWL 1JPFB 1MHHB 5GGSB 1A7QH 1ZVHA 2BNUA 5F7MC 2K7PA 4J4PD 3MBXL 4OF6A 3L3KB 5B38A 3B8YA 1TQBB 3ARBC 3R0NA 4P2OB 5J6HB 1HZHH 3MYZA 3RI5F 5MI0C 1VHPA 4N1EA 3NAAH 4B41A 1AXSB 5IMOA 2IPUK 2YKLH 5DRWB 3MRQB 3IGAB 3RAJH 1P4BH 1S9KC 4PJ8B 4Q7DA 1QTYT 5DRNA 1I3GL 1ORSA 1BZ9B 3MRIB 4N8PA 1V3LA 1UFUA 1OTSC 3HAEH 4KI5D 4ZFZB 1K9TA 4XPAH 4HIJB 4AT6B 4U3HA 5TDOB 1R3KB 3GSNH 1T22A 1E4XL 1CLOH 3QIBC 1SJEA 1CICA 5DJ6B 2CSPA 1SEBA 4HKXA 2DM4A 1I9JH 1JMXA 4GUPA 3GM8A 1I1FA 4G9DA 1K8IA 3JTSB 4W4NA 4NPYA 3VWKD 5CZKA 3HC0A 1QRND 3HG1A 1K2DA 1NGYB 4YDVA 5E6YA 4FZEH 2AP2A 2MHAA 4JFZL 1F6LL 5MHSE 3C6SA 2EDBA 3A6OA 3F65A 3WEXA 3O9WA 5DK0B 2D0GA 5ANME 3H9SB 1BQSA 1D5ZA 4PJ5B 1BPVA 3BEWB 3QCTL 3QG7L 4HWEL 4L9LA 1FORL 3MOAH 3FT3B 5GJTL 4BK4A 1T83C 4NNXB 5DJ0B 3MV8D 4KKAD 4EVNA 4FZEL 1B88A 4R26H 5HI3C 3D39E 2X10A 1T5XB 2B8OT 3C6LB 1IZKA 1PSKL 1NBVL 3OPZH 5EU6E 3M07A 1KCRL 2CO6B 4NBXB 4PJAE 3IJSB 3T04D 2NY7H 4KV5F 3T3MF 4MD0B 1DEDA 1MCLA 5CMAB 3ARGD 1CBVL 3VXUD 5I1KH 2XG4A 3IDIB 1R3HA 1N59B 5DZNA 2WWMD 4MS8C 1IKFH 1LNUB 5T5FH 2DWDB 1QSZA 3MRFB 1C16B 3X3FL 5SX5H 5BO1H 5KSVB 1QRKA 5MEQB 1NCWH 4HW6A 3ULVF 5C6TH 3HE7D 5D9SA 3TT3H 4RGOH 5IVXF 1RIVL 1X5IA 3ARWA 4RAHA 5HTSA 2KH2B 1BZ7B 4BH7A 4BKLA 1T66C 2ZKHL 4YNYB 4YAQA 4NDMA 3KDMA 5TF1L 5H94B 3MXWH 4X80L 3O6FD 3BXNB 5C0CA 2OZ4A 5SWQA 4P0DA 5LXGH 1HQ4B 5D2LF 3DI3B 1H0DA 4MJIB 2OSLB 4QRUB 5IWLC 4HWBA 4I5BB 5IEHB 1MNUL 1R5VB 1VKXB 4P4KA 4E5XB 3DUUB 1UB5A 4XVJH 3LKPA 4GW1A 3WXWL 1D7FA 4BH8B 1HHGA 4A6YL 2P5EB 4HKZA 5HHOA 4M6NL 2X09A 3SGKC 1L0XA 1S5HA 3G6JE 4QT5A 2ZUYA 1PVHA 2X4SA 3TN0B 4XMLH 2OR9H 1DZBA 1T22B 4NZUH 3S4SG 3QI9D 5D7KE 3MV01 2AW2A 3NFPB 1XGYH 4P2QE 4P2YA 5CJXC 1WTGT 3FFDA 3ARZA 5CJOH 5BVPH 1J8HE 3X11A 2JJSC 1VCAA 3MA7B 4QRSB 4JM2F 3F7QA 4EBQL 1J0ZA 2C26A 4ZTOL 3FZUD 3HR5B 2YD9A 4J1UA 1S9WA 2OK0H 4MDJB 2LVEA 4HDIB 3BDYL 4QEGA 3QNXB 2FR4A 4EQ2A 4L8SB 1FHGA 5IB3B 3V0AC 4GBXC 3WD5H 4Y8DC 4M8QA 2GAZB 2CIKB 2V2XB 4G9FB 3EGSA 1S5IH 3AS3A 5FA4A 1B9ZA 4XC1H 5GIRA 1DLFL 4P3WA 3TCLA 5HPOA 5D70H 1NFDB 3E8UL 4OM1L 5C0IA 3UJJL 3RY6C 3FZUC 2GKIA 2H2PC 4OT1L 4F7TA 1A6UH 4U1IB 4RSVA 4L4TA 1EXUA 3CMOH 4D9QD 5DA0B 1DN0B 4A2LA 4LSUL 5F44A 1FSKB 5F1NB 5TF0A 4H0IA 4J3XA 4O2CA 1X9QA 3QDGD 1F58H 2Z9TA 1S9XB 2GSIA 4N8VG 5F7FA 3EYQD 4G6ML 4KKCD 3RZCA 2ICEA 4KK9C 1OAUL 4NQUA 1CL7I 4XCCL 5HYSB 1IQWL 4KUCD 4O02L 3C5JB 3FT2A 1AGCB 1FVEA 1DBJH 2BSTA 5MI0B 5JIPA 1ZVYA 4QO1A 2MJWA 4HMDA 2BFVL 3VXMB 4XTRD 4M7KH 5B21A 4RFOL 3BSZH 1IGIH 2A6KA 2NX5D 4WRLA 3TBYA 3RZCD 4IRJA 4F2MA 4XP4L 4EJ1C 3BN9C 3N06B 4G8GA 4W70A 3H2WA 5I19L 1MEXH 1G7PA 4J6RL 4KUZL 4L3EE 4O2EB 3SOBH 4K7FA 2YUZA 1YN6A 2B20A 1QSFE 1I7TA 4ZXBC 4JQVA 3FT4A 2YRLA 2FX8L 2HLFD 3GM0A 1P6AB 1JK8A 3D1MC 1ZLVK 4MQ7A 2NW2B 2BNQB 5JUEL 3V5HA 3ROLB 3REWA 2QADD 4MCZA 1CZ8L 4WDIB 4YPGA 1N2RA 1JHTB 1AGBB 3L3GB 2VL4A 5F8RC 1RUQH 3I84A 4IJ3B 3D2UB 5CSBA 3HAEG 4HUNB 5JOEA 4MDJA 4PG2C 3DVGB 5AWNH 1RZ8A 3OGOE 4O2FB 4WWKB 5KJRH 3MTRA 2ZCLH 5I15H 2UWEF 3TZVB 1EHLH 1B4RA 2O5YH 3U46A 2XRAH 2H26A 4OB5H 2EIBA 5IQ9A 4ELKB 3VXPA 2DD8L 5HSFA 2AEQL 1P4IH 3GSVB 5IM7B 1A1NA 5IF0B 3IKCB 4OUOA 3T0EC 4OLZL 3H0TB 1YMHB 1MCEA 2X7LB 2J88L 2X40A 3IAPA 4FQIH 4PJ9A 3TF7C 4FQLH 5TE4L 1C5DB 2AXGB 3CVIH 3B43A 3RWDB 4W6YB 1TZHA 2ADJB 4OB5L 5EIIA 4TPRL 3DHMA 1CFTB 5F1NA 3VD4A 4D3CL 2AV1B 3I6KA 1FL6B 5CHNB 5JMOC 3O6MH 5IMLA 3QEHA 4JFPA 3OJDB 4JM2A 1ITCA 2BCKB 2IAND 1OAKH 3FTGB 1IMHC 2FJGA 3DX7A 2BSTB 3VD3A 4LLUA 5F89B 4U2ZA 5HYFA 3SDYL 2FIRT 1SEQH 3KYAA 5D7IA 3HLAA 1BWMA 4WHTB 4UU9B 4HJJL 2AXFA 4NN6B 5D1QC 3WUZA 4ZMAT 1E28A 3VXSD 4ZD3L 1K5NA 1XH3A 1JGLH 1KELL 5KS9E 1P2CA 5IGXH 3ARFD 1XCTB 2R8SL 1PZ5A 3UP1A 4U1HB 1FNGA 1YEGH 1GGBL 5D2LA 3RNQA 2VLRE 1JRHH 4JKKA 3TYFB 4NKDB 4PGJA 2VIRB 4HUKB 4KPHH 5J06A 4UB0L 2X9WA 2V5TA 3PXHA 3Q3GA 1LK3L 2E7HA 4FABL 2E7CA 2YD7A 1I9RL 2FX7L 2DQFB 3CGTA 3CUPB 3ABZA 4OCSH 4XBGA 1RSFA 2XPGA 3LKSA 5CJ5A 3BZFB 4HUWB 2QKIB 2QSTA 4U0RB 1RJLB 1S7WA 2E7MA 4JFXB 2IWGA 4O2FA 3N1PC 5TH2A 3X17A 2CQVA 1ZLWH 1RVFH 5E8PB 1U8LA 3KYKH 2YHGA 1P7QA 1UCBL 4KTDH 4ZPVA 3Q5OA 5FB8A 1I9EA 2PETA 4ALAH 2R1XB 3FB7A 1A6UL 5C0BE 4PD4K 5JW3L 1ZHLA 2F5AH 1MQ8A 4N0CD 3RU8L 2BSSB 5F7DB 1AGFA 2XN9D 1KJ3H 4Q9QL 4GW4A 3UTTD 3QA3B 2EC8A 1WCQA 4MNQB 3MLVL 4P5KA 3EOBB 3MNZB 2F53D 5J6GA 4G8EB 2BK8A 2D7MA 1C5CH 1QR1A 2FBJL 2VXSH 3WLBA 1CZ8H 4K9EC 2CLVA 2YPLB 1Q72H 1MWAH 1I8IA 1TCRB 3DETD 3VGDA 3RGVD 1MFBH 3GB7B 2R2BA 5SWZE 2OMNA 4U6YA 1ZOXA 3U4EA 4JM2B 1HIMH 4LSRL 5C0RL 2HFFB 6FABL 4GXVH 3DX7B 4HWNA 5KVEH 5ANMA 1WBZA 3SDAC 1I3GH 3BIKB 4EQ3A 1FVDA 4DKAA 4UQ3A 1FQ9C 4ACPA 1ZLSL 3BRGC 3S37X 3OAYH 4PJHA 1G1YA 3RIAF 3ELAT 1U8HB 1BIHA 4GLRI 4MNGA 5EORL 2Q8AL 5I75C 5JW4N 3HG1E 2ZUUA 3LDBB 2AQ3A 2XZAL 3LB6C 5DQ9A 1Y6KR 1A6PA 1U58A 2CJUL 3W5MA 3PV6A 3AVEA 3RDTB 1U95A 3O2VL 1KN2H 3MRPB 3CSGA 1OAUH 4AQOA 3QXDB 5IOPA 1VACA 1YY8B 5KSUB 1EERB 1U8JA 1HHIA 4R90H 4ZUTB 1WV7T 5LXGL 4MQSB 3D3VE 3LN4A 4OIAA 2D9CA 4KRPC 1UJTA 3U79A 4PJCB 2W65B 3NBNA 3SQOH 4PJGF 4KI5F 4NN7B 4YXKL 1GGTA 5DO2D 1L6ZA 1S7TA 3FQRB 3MJGX 1S8DA 1U8QA 2V7NB 4NC0B 1JF5A 1FH5L 2ARWA 4LARL 1B2WL 2HWZH 1JZ4A 1U8IA 4U2YA 1QRNB 4L8CA 4PJAF 4TVPL 1Z2KA 1IEBB 1YEDB 4OSUH 4HZLB 1G7IB 3IXAA 5FYJH 3BUTA 1T3FB 3RNKB 1H8NA 3P2TA 2HT4C 4PJ5D 4NNYB 1NJ9A 4ZO9A 3O9WD 1BBJB 4MA7L 5IR1A 1NC4B 4J4PC 1F3DJ 5KSAB 2V5MA 1OGAE 1GGCL 1AGFB 3DETC 5IFJA 5DK2B 4FQHA 4F33A 3MRRA 4CUCA 3VWJC 3NCJL 4XP1L 3TIDB 3EOYG 4N9OB 3AAZA 2NY6C 2F54A 4N90D 5BQ7B 1M1SA 3HI1B 1YY9D 2H8PB 2R0LH 5GJTH 2YWYA 4WI2A 2W9EL 3BI9X 2HT4D 3QUYA 4P23C 1U8NB 3P4MA 4M8VA 3UCRA 4MNHB 2X4NA 3O3BB 3ARUA 3P9LB 2R29L 5TF1H 4ZYKB 2HFFA 2FECI 3HE7B 3OKMB 4KRLB 5IMKB 2ESVB 3D69B 1A3LH 1TETH 2JK5B 5I18L 3IDJB 4A2MA 3BN3B 3EYQC 1G0DA 2WINA 4M1DL 3KPQB 2H2SC 3WO4C 1JWMA 2OCFD 1WVZA 3S5LG 3V0VB 2FGWH 3BWAA 3V4UH 2ZOKB 4BM7A 1ZHNA 1WF5A 1SQ2N 1WZKA 2FZ3A 1QD0A 3GRWA 3E6HA 4J2XA 2WZPD 3M8OH 4NKMA 2D03H 1SJEB 2P5WA 1JPSL 3LCYA 4JDZB 3OX8A 1D9KB 2R2HA 5MENB 4PG2A 1WBXA 4MB4A 3EZ8A 2P42B 4HF5L 4PJCA 5I1EH 1JF1B 1PAMA 4L8BB 5DGQA 1CU4H 1EVUA 2MQ3A 2QQKL 1U8QB 3DTXB 1WZ1L 2EDNA 2ZUQC 3Q2CA 1CIDA 4H8WL 5ABDE 2Z93A 1UM5H 4OCWL 4IOIA 1EZVY 5A2IH 4ZXBA 2BOBA 3LKOB 3N1MC 4PLNC 2W9DL 3L3DB 4I48B 3BPOB 1JHLH 4XVUC 4A6YA 1P7KA 3KPSA 4QGYA 4M48L 1H15B 5JDSA 4DKDC 3MCLH 4LP4A 5DEGB 1JPGB 5KVFH 1EBPA 2DDQH 1T1ZA 2PCPB 4JB9L 5C0DA 1OOAA 1Q0XL 3MV7E 1BFSA 3V7MA 2VH5L 5I1HL 1ZA6B 2F53E 4HFUH 5FKAA 5C9JB 5IW1B 5E9DD 4XPGL 4Y4HC 1NC4D 4EI5D 2BVQA 5IJVA 3CLEH 4OZFG 1CG9A 1C12A 2EO9A 2H9GB 1FZJB 3P0YL 3TJEL 1TNMA 3C60B 5J57B 3NCMA 2DL2A 3SY0B 5HGGS 3RQ3A 1A14L 2DTSA 5GGVY 5I8EB 3IDYB 1P4BL 2PTTA 3TLRA 3Q6GH 4KK5C 4PV9B 1G6RL 4RAUA 5TDPA 2EE6A 2HN7A 2ZNWA 4ZFGH 5BV7L 4MDIA 1RURL 4HWBL 3QHFL 3SOBL 3L3OA 4NQVA 4OLYL 4YAQB 1DBBH 2BX5A 2PR4L 5IJKA 3L9RA 4XCEB 2VLLA 3QEGL 2VITB 4LLMA 3OAZK 1MCSA 2E7LC 1JGVH 1H8OA 1U91A 2WIIB 1A3LL 4E5XA 3QJFA 5E4IA 2C3VB 3QH3A 5JTWA 4JO4L 3A0OA 5BV7H 3P4NA 4OGXL 1I4FA 4CN1A 4HIIA 2OJEA 2NPLX 1S5HB 5J3HC 2FZ3B 4FNLH 3SN6N 1H3PL 3O4LA 4LCCC 4K9EH 4O4YL 8FABA 4DTGH 2ADFH 5E1AB 1N7ML 1U6AH 3CFKB 1K3IA 4H20L 3RTQC 3OX8B 3SDYH 5I1DB 4K23L 1YJDC 3T77B 1IM9A 3HRPA 4U6XA 2R2HB 4ZOEA 3T1FB 3SGJC 5JPNB 4JQXA 1LD9A 3BOVA 4JKMA 1ED3A 4POZD 4LIQE 4Y2DC 2DIAA 3ZSTA 4OQ1A 4HG4J 5F6IC 1NAMA 2ZSVB 4QHUB 1H3VA 3RPKA 1ES0B 2J6EL 3MLXL 3IFPA 4WHCA 4K3HA 1OAZH 5D7LB 5DJZA 4GAFB 3BP5A 4F57H 3MRDB 4Y4HD 5I76B 1MIEH 3BRDA 3DO3A 4ZNEE 3OG6B 4I48A 4IHOB 1EIBA 2ED9A 1HILA 3SDXF 4GQ9H 5GGQH 1IL1A 2OXHA 2W9DH 2YD1A 4WWKD 2M2DA 3NACH 5DEZA 3NCCB 4G8GE 3QUXC 3DX8A 1YEKL 1NDGA 1SJVA 2BVEA 4OFPA 2HKHL 1L7TL 4Y1AB 3D25A 3ZT7A 1KGCE 5I71B 1Y18B 1QOKA 4P46D 4PY7B 4Z78A 2AJXH 4LPXA 1T03H 4MAUH 3UTOA 1SYSB 4XP5H 4MNGE 5E9DB 1ZT4A 1NCCH 4ERSH 1IAOA 5KSAC 1EHLL 1N5AA 3BP4B 3SY0A 3WFDH 4KK6C 4F9LA 2DIJA 2D7PA 3EFDL 1SY6L 1NGXB 4JJ5A 3PWNB 3UJIL 1ACYH 3FT2B 4X6CB 5IG7A 1IGFL 2VLKD 4JFFB 1SBBA 4LRIA 5C8JB 4X4XB 5DI8B 3PIQA 4WUUD 5IBUB 3NGBB 4XHQA 3SO3B 3BJLA 1C16A 3UTZB 4FQXD 3Q6FA 3MX0A 1BFVH 4LSPH 4FMKA 1JHKH 1KPUA 1ZLSH 3CFIC 4C57C 1FFPA 1BF8A 4WTZA 5IHUL 4F80A 1EDQA 1NMCC 4P5TD 5IFAH 2YPKA 1MHPL 2WP3O 1YEFH 3JVGA 4JZJA 1OGAA 1I4FB 2M1KA 1AJ7H 1I75A 4Z5RB 4GOSA 3BXNA 3VGAB 3B5GA 4LASH 3MUZ1 5CGMA 1NMCB 5CGYD 5A1AA 4GRWE 2QHRL 5TGBB 1T83A 4J3UA 2AJZA 4HT1H 1R3IL 4XH2A 4BZYA 4XX1G 3U36A 3H7BA 7FABL 1FYTA 1N2RB 2YUXA 1Z9LA 4QRPB 4CN6A 4OZIB 3QI9C 3CFDA 3FQNA 4TVSa 4LVHB 3JUZA 3LV3B 3MCG1 4OM0H 3EJYD 3VGFA 5MP6H 2BRRL 4EIZC 4AEIL 5GGTH 2XNAA 1MLCA 4FG6C 2Y7QA 3HZMB 2CMRL 5DFVC 4KQ3H 12E8H 5T1LA 1YQVL 4Y19A 2LFGA 1MCOL 3O4OC 5BS0E 5E99H 2Q7NA 5IK3A 3NN8B 3HC3H 4Y4HB 5T3ZL 3TWCL 1ACZA 5D6DC 4QXGH 1R3LA 2IQAB 3BH8B 4GMTL 4OQTL 4RISL 4G7VH 5FYJD 1AHWA 1AQKH 5F1IA 3VFTA 3OKLB 1NGWA 3ZKMC 1DLFH 4JREC 1AD0B 2H3NB 1KLGB 1XF4A 2AI0H 3CLFL 4DVBB 5TQ0L 3S88L 2H6PB 3RP1A 1JUFA 1DANU 3J7HA 4OQTA 1JI1A 3TCLB 4P4RA 5FO9A 2Y9RT 5IP4A 1KXVC 4R8WH 4OCWH 1EEZB 3QAZB 4U3CA 3QDMB 1BFOB 4ZFFA 5JXEA 4BZ1H 5AD0B 1QBLL 3BDYH 3R06B 1QLRA 5ALBL 3QQ4A 1OGTB 3MLSL 2XYCA 4Z7OE 4OFYD 5BVJB 4JJ5B 3G5XB 3FTGA 4HPOH 3W2DL 3DX9A 2SEBB 4IDJH 3ARFC 1OLZA 1BOYA 2APTA 1UH4A 2X4OB 4Q6IA 2GSGB 1RK0B 5INCA 1F3RB 4R2GB 2YMXL 2ZCHH 1T0MA 3V6FB 3FN0L 3WIHL 1S7VB 5DHYA 5AEAA 3C9NA 3D3VA 5EBMA 4X7EC 1BWWA 1B0RA 3ILPA 5EU6B 2PO6B 2C4FT 4G5ZH 4UI2A 5JXAL 1JGDA 4DZBB 2H45A 5C0EB 1T04B 3MRHB 1AH1A 2CR3A 4OF5A 2FCBA 1IM9D 2DAVA 2OTPA 4MZ2A 1KJ2B 1A4KA 2VZOA 5E95B 3V0WH 4RRPG 3V4PL 2IPKA 3O4LD 1W0VA 1FL5B 4PB9L 4QRPE 1EJOH 3GK8L 4GG8B 1I1AC 3RWHB 3PV7A 4L29B 1QFWL 2AXJA 1VADA 4QCIA 1D6EB 1ODAA 5EUKA 3LQMA 4N0CC 3QG6B 1A0QH 2C3XA 1BM3L 3HPLA 4QOKD 2ZG1A 1F11A 3EOAA 1KENL 3O3DA 3A6CH 2B0SH 5T1KB 3KR3H 1FC1A 1P84J 3DVNB 3VU2A 1U2HA 1X5YA 5GGQL 2Y06L 1F97A 2DM7A 3NH7L 3GBML 5F8QC 4WCYH 4X9BA 5ETUA 3HE6B 1RUML 3DSFL 2KPNA 4NCDA 2ENYA 1MUJA 2IFFL 2F58H 1A4JA 2I24N 2Y23A 3HI5H 5T3XE 1XGYL 4Y5XA 3CFJA 4PP2B 1OQXA 3CU1A 2OP4H 4FFVC 4NGHL 1D5BA 3GBMH 4PY8J 3STLA 1TJGH 5CKAA 3BD5A 3BPLC 3TC9A 4ORGB 8CGTA 4OFDA 1KBGL 9CGTA 1TQCC 5E24E 3KR3L 3MREB 1NGZA 2BZDA 4ZUSA 1UJ3A 1UVQB 3RUGA 3T4AA 5FYKE 5GGSY 4EN3C 5L6YH 1C8PA 2CLVB 3F5WA 4PGZA 1TVBB 4S1SL 5CSZB 1I8IB 3L7FB 4RGMC 4LIQH 4UTBL 1BVKB 3LKRB 4FN0A 3HB3D 1FNFA 3BVNA 4KAQH 4NQCB 1R5IA 4G80B 1TZGL 5GGRY 4MA8H 5IVZB 5DUML 1KELH 4MAYB 4N0UA 2YR3A 2FECL 4HQQL 4OIIH 4U1NB 3EDDA 1CL7H 3P30H 1FAIH 5E8EA 3T2OA 1U36A 1UC6A 3TGXA 1INEL 5FGSA 5F3BA 5CEZD 4J3VA 1BOGB 4RWYL 2Y72A 4YGAB 4CW1A 2Y5TA 4K3EL 3L3JB 3QUYD 2ILLA 5BZWB 2X4RB 3RBSA 15C8H 5F7YC 3RY6A 4LAQH 3BZ4B 3B8SA 4F7CB 1GGIL 2X4TB 3MV7A 1IQWH 1F4HA 4MCYB 1GGCH 1QPPA 2OQJA 4WHTA 1RZFH 1U8JB 4NO3B 5MEPB 1LP9E 4H8WC 2AK1L 1UACH 2B4CH 1B4JL 2PW1A 4HIHB 2VDKH 5GGSA 4ZUUB 4RGND 1Z0MA 3T08A 3D85D 1IILE 3IT8D 3ULUL 2VERN 4TUOB 1MRCH 3H9SA 4FTVD 2VXVH 1Q72L 5MERA 1JV5B 4WO4A 1T20B 5GRWA 2BRQA 3O3UN 1I85A 5T3ZH 1Q9LA 4DAGL 5HGAA 1L9NA 4YUEL 3PWLA 1IARB 2CKNA 2HVJA 1UYWL 2XKSA 2DOCA 1CT8B 1LVEA 3HMXL 1AQDA 1PLGH 5GHWH 5GRZA 5K9JL 3OSKA 1RIHL 1MUJB 4YEEA 1N4XL 3P77A 1MCQA 5KSAA 2VDPL 4JFDB 2VXQH 4ODSH 1DCLA 5AZ2H 4GT7A 3SKNB 1T1XA 1KYOK 1DEEB 2NY3B 1KG0A 4KMTL 4OCLC 5K59E 1AI1L 5TFSH 5IBTH 3BKJH 4OJFH 3QDJA 3HZYA 4NWTL 5C0CE 4FQCH 1A7RL 3C09C 4UIMB 3MXVH 4WWKC 1BLNB 3O8XC 4XPFH 5I8OH 5HDLA 4P99A 3ZMRA 2DKUA 4PRAA 3CX2A 1OSZB 4LEOB 1RZJC 1FYHB 3GSOA 3I02A 3MOBL 2YKLL 3O3BA 4HPYH 3SGDI 1YA5A 3C60D 4G8FA 3IXTA 1BZ7A 7FABH 5JLZA 3KPLB 5D1XB 1D3CA 3RVUD 3PHQA 5L8JB 5SWQB 4XC3L 1QLFA 1RHHB 4E41D 3HMWH 4QTIL 3BIBX 5FKPB 4HBQA 4U0RC 3ZYJA 4DN3H 4R0LC 3ZTNL 1S9YB 4XWGH 5DWUH 4CW1B 4HWZA 5ACMA 5TQ0H 1XAUA 5IFAL 3L3JA 1HHGB 4PRNB 3RWEB 4XNQB 4YDLC 4HBCL 3K1DA 3MO1A 4EOWH 4UDUB 3BIAX 3ECBA 1NEZA 2P5WB 3RA7H 5EWIH 4PJ8A 1ZS8B 4UT9H 4M6MH 1BZ9A 3P4OA 2VOTA 4Y89A 4NRZA 1W0WA 1T7WA 1BGXH 1I1AB 1CLZL 4YHPA 5C9KA 1REIA 2AJXL 4HIJA 4AT6A 3TPKA 1T03L 3N85H 2XZCH 1QBBA 5I6XB 4AIZA 3HUJA 4I2XB 3IU4L 2DLGA 4UV4H 3KG5A 1BJMA 4HMEA 3QNXA 2FR4B 1AE6H 4ONFH 4Z7UF 2IH3B 4M03A 3FO0L 3UTQA 1YPZB 3MBEA 5C0AB 2R0ZL 2P45B 3OGCB 4GQ9L 1RFDL 2DQTH 4FHBD 2Y36H 2FD6H 5EO1A 2EZ0C 3MROB 1S7SA 2VDLH 5HI4C 1R5VA 3QQ9D 1VKXA 2NZ9C 4RIRA 2ITDB 2ZG2A 5H35A 5I73B 4Z7WE 4WI9A 1BJ8A 1HHKB 4JLRB 2P44B 3H9HB 3FT3A 4YGVA 1N0XL 3D0LA 2DBLL 4TN9A 2EYTA 4M6OL 2VTFA 1B0GA 1C1EH 1T3FA 3PGDA 1F4XH 2CGRH 2NY3D 2VL5A 2GFBA 4JHWL 4ELME 1U3HB 3DYPA 4UILH 4DW2H 2BY0A 1GOHA 1I9JL 4U7KA 4HGMA 5D1ZB 4MD0A 2PYEB 3FMGH 3ROOB 3VFSB 4CDHA 2IF7A 3MJ6A 5GRJL 3HFML 4XXDB 4WGVB 3B6SA 1KB5A 1RHFA 3MR9A 4PRDA 1LWRA 2XOTA 1X4ZA 4LLDB 3EFFB 3L9RB 4KHXL 3UAJD 4D9LL 1J0KA 1ULVA 4LFHD 4MVBC 4OD3H 4ZQKA 3JSSA 2CK2A 3BKYH 1FGVH 4LSVL 4HLJA 1I8MA 2G5RA 4RAVA 5EU7C 3THML 3BKCL 5C86A 3DECA 1WAAE 3GBNL 4PRID 1I3VA 1J5OH 4GAJL 4HULB 3QJFB 2IADA 1T7XA 1KC5L 4OD2A 3O41A 2ENSA 4CU7A 4QXUH 3KXFE 3ARGA 2VR9A 5I19H 5IQ7H 4RQQA 3O6KL 3F7YA 4JY4A 3ZLQC 4PJXB 2XQYG 3G6JA 3ECBB 5E1AA 2OJZL 3MLWH 2N7BA 5C2UB 4P57A 1GAFL 4NKIL 4XNMB 5ERWA 4K7PY 2DD8H 2P5WD 3HS0B 4JKWA 5ACLA 1CCZA 1LILA 4PV8A 3RZCB 1OL0A 4D0BB 2VXQL 4ODSL 3T0ED 2R56L 5HGBB 4RMUA 2FEDD 3QFJD 4YK4B 2PW2A 5F6HJ 3W11D 2D2OA 5ICZB 1ROWA 3NCFB 1NBVH 5IB4B 1KCVH 1A9BA 3CSBA 3TPUB 1XF1A 3TZVA 5ADPL 5FUOH 4NM4L 1A7OL 5BW7C 1MJUL 1R0AL 2YN3A 2Q20A 5FYLE 4R9HA 5DHXB 1AR1C 4P46C 1QBAA 3T4YB 5L2JA 2BSRB 3MJ7A 1IAKB 5KN5A 4TTDC 2QADB 2JJWA 4NQXB 3VXPB 4PJIB 5JIHA 1HNGA 4K3DL 2JCCE 3LS5L 1R3JA 3BMWA 2CLRB 1YN6B 3ULSA 3K3QA 4X99B 1E6OH 4H88L 1HXYB 4N0UE 3KYNB 4MJ5A 5LQBH 3WNPA 2C7UA 2DDQL 3SKOA 3SBWC 5A3IC 2E27H 1JZ8A 1RUPH 2F19H 1N3NB 1GC1L 2B4CL 1FO0B 2GTZA 2DLFH 1SYSA 4LPWA 4ODWA 3S35X 4JO4H 3ARED 2UUDK 4GKZB 4QRRD 1H3TA 2CKBB 1BJ1J 2YBRA 1WJ3A 1FIGL 5D1QD 4L5FL 1JRHL 3LB6D 1T4KB 3V6OA 3U0PB 3ULUD 3LDBC 3RY5A 1QHOA 2NMSA 5C3LD 1U3HD 1V7NH 4DK3A 4KKCC 2GYSA 1NDMB 2VKWA 4DUWA 1MCKA 5ESQB 1C12B 4M7LT 4YHML 1WCBA 3GSRA 3O81A 4QF1A 3LRSA 3AREC 5E2UH 2LAAA 1MCHA 3B9DA 1DBMH 3CH1A 3OKEB 4JGJA 3CFEA 5DC9B 3SGEI 1XT5A 4QTHA 4GBXD 3PWPB 3TA3C 3EYVA 4C56E 1NAKH 2HG5B 4PJBA 3ALPA 3T0BA 4NQSB 1JYXA 3S35L 1J1PL 2PXYC 5E8NA 3KNBA 3P9MB 5CGTA 1MOEA 1CGXA 4R6UA 4UQ2B 5HY9A 1C5DA 1L9MA 2AXGA 1JMZA 4TUKH 2XWBB 3KHQA 1UKSA 4L4TD 4PJEF 5DD3L 4CNIB 2AXHA 4NT6B 1B3JA 2YA2A 2H41A 5LBSH 3O6KH 5L88H 3L5WA 4H5SB 3MRCB 4XCNB 4XCFH 5KW9L 1PQZA 5A43C 2CRYA 3OJDA 4NYLB 4LGRB 5HVFB 2CRIA 5C09A 3MA9H 1XIWA 3E6FA 1A9BB 3GSXB 3SE8H 4LLUB 2DKMA 3FOMA 5FGBA 4KC3B 3UTPE 1FO0H 1MJJA 2DLTA 1AGBA 1T80A 4LFHG 5I1AB 1P7QB 4G8GD 3TA3A 4I4WB 4TVPE 2JJVA 5BMFL 2O5YL 2IBZY 4PJIA 4NQEB 1TQCB 3SJVE 1H3UA 4U7MA 4CJ1A 5GRUL 4I0PC 3VWKA 4FQ1L 3IDMB 4NBZB 1E6JL 1NGWB 4R26L 2QQQA 3GSWA 1AD0A 2H3NA 4JG0L 5D2LB 4V1DA 5EULV 3W9DA 3EHBD 4P9ML 2VJXA 2IBGA 4F3FB 5IMMB 4Q9CA 2DTML 4M1DH 4L3CA 5JUEH 4KKLC 2IPTH 1QLRB 5CD5D 3VFRA 3WSQL 1YMMB 4TOYL 2XTJE 1MFDH 5GGRA 3AB0B 1LO2L 5E8OB 4XP6L 3UZVB 1ZEAH 3ZT6A 1WBZB 1RIVH 3CZFB 3QQ3A 2NR6C 1GHFL 3LD8C 5F6IB 3IDYC 4LHQB 2QR0A 1RZJH 5EH1A 1PKQB 2NXYB 3HNSH 4PJHB 2BHYA 3VDAA 2ZSWB 4M3JA 4YHMH 1TPXC 2CRZA 1ZSDA 4NO0D 4ZO6A 3CFEB 5T5FL 3EYVB 1MCJA 5I16B 4XNZB 2FJGB 3PQYE 3VXOB 5HYQB 3UTSE 3CK0L 3HNSL 4DZBA 3LSOB 2P5WE 3VMNA 1LGVA 4LOUC 2AERT 1EMTH 3F6LA 4LP5A 2P8LA 4GRLB 3HUJF 5AZEL 1D5XA 1KXQE 4NCC1 1S9VA 2Q3ZA 2X1QA 3ULUF 3RVXC 1CFNB 1R24A 1GYAA 4FQ2H 4RX4D 1TMCB 1D5MB 4O51B 5LQBL 3I85A 2ADGA 4HFUL 3FHAA 2IAMA 2VH5H 4AZ8A 4PS4L 1K3ZA 2ATPA 3O3DB 4U1MB 5JORA 4RISH 3KPNB 2ICWB 3FCTA 4XH2B 5TE7H 3GSUB 3MBEC 3QPQD 5D70L 4ALAL 3QEUA 3FONB 3IGAA 3WS3B 4YDIH 3C5ZA 2D4FA 2DJUA 4MQXC 2OL3B 3OAZH 2B1AL 3G5VB 3BT2H 4I18A 12E8L 1JNNL 4LSTL 2RIKA 2XPGB 4K3JL 4ZDHA 5IR1B 5JW3H 1NMBH 4L4VE 4X6DE 4YBQC 3KPOB 3OF6A 3SCMC 1FCCA 1AC6A 4TTDD 1RIUL 1ZE3C 1U8LB 3NH7H 3TBSB 4Z18A 1CXLA 3X14A 2MMXA 1QBML 5CZXC 3BDBA 1RZFL 3ZKMD 1NBZA 3U6RA 2VLME 4WHYG 4ZG1A 1UM6L 4PREA 3INUH 3CSPA 4PR5B 1U8NA 4JAMA 4GKNA 1EAPB 4M7JL 2D03L 1FE8H 3QWOB 4JZOB 4M1CD 5F9OL 2V7NA 4XCFL 5D7SH 4YXLH 3PL6D 1PW3A 5CBAB 1XF3A 1NMBL 3KPSD 1A7PH 5CUSH 5DJ8A 1QNZH 4XRCA 3V4VL 4GQPH 5DHVB 3I75B 3BYYA 3SKUD 1DQJA 5C0GA 1C08A 1X6NA 3WE6A 4I0PB 4NN6C 5I9QB 5AAWA 1U8MA 1MFBL 2XICA 5J8OA 2FYYB 1ZTXL 1I7ZB 3VGHA 1GJIA 4V2BA 1M7DB 1GGBH 2IANE 4ZFOB 1WSST 1A2YA 5T33L 4GBXA 4M43H 4Y4KA 4P2CG 3FAXA 1S7RB 3BDXA 4LLAA 4UIKL 3R8QA 2HA1A 3IJSA 4CN4A 4XX1E 5EG6C 5T1DL 1MRFH 3MRJA 2BVPB 1D6VL 4OCNC 2OS7A 3IDIA 4ONHB 4HX1B 3MGTB 5DVLA 3QO1B 2KKQA 3KJ6L 1PZUB 4OV5A 5E6IA 5DRNB 4QRPD 3SKJH 4D2NA 3IVKB 5EUOB 5FO7B 2DRUA 1EZVX 3B2VH 4XPTL 4CKVX 1CN4A 1OAKL 3TNMB 1JRHI 4AYFA 5EZOL 2UVFA 3P40A 3B5HA 3C8KA 4XVTL 1GZQB 4LDOB 3C2AH 2CUIA 3R0MA 4LKCA 2X1OA 1JN6A 5KSUA 2G5BB 3SCMD 5TQ2H 4NJAL 5M94B 2IGFH 1HSBA 3HC0B 3OZ9H 1FL5A 1QSEB 2FRGP 2HMID 4KKNA 3B2VL 1A7OH 1SYVB 3RWHA 4X7FC 4I18B 1J1OH 1AGEB 4JFYA 5CD3B 4X6BB 5C0AD 4G8IA 4GMSH 4JG1L 3C2AL 4GG6F 3BEWA 4FP8L 3BWAB 1RZIA 4IRSA 2R56H 5I2IA 4PRPB 4HSQA 2HJFB 5FKAB 5D4QA 1M7IB 3RDTC 2VLJD 1MCIA 1RZKH 3O9WC 5D5ME 1UWXK 3QXWA 3TIEA 1CD1A 3BESR 3K4AA 3ZHKA 2VDOH 3VMPA 2EIZA 3WL9B 4UIMA 1WT5C 3X11B 5KJRL 4KUCF 4PJXF 4YPJA 3LZFL 1Y0LA 2CKBH 3MCKA 1X3DA 4WUKL 1FZMB 4OCXH 2CUHA 3GMOB 2WV3A 4HFWA 1RMFH 3D9AH 4PJEA 4OGZA 4AL8L 5DMKA 2A83A 2CK0L 3U82B 1IBGL 1U93B 4U6HB 4MMZC 2EE9A 4ORGA 5F9WB 1EGJA 3AAZB 1DUZA 3OG4B 2H2PD 3S34L 2YA0A 3MRFA 2HFEB 3LPWA 2X1XR 5JZ7C 4P59H 3HNVL 4JDTH 5EU6D 5IROA 3HZKB 3IJHB 3X3GL 1BVKA 3LKRA 4X5LA 4BFIB 1RULL 1MH5A 1IQDB 4TPRH 1S9YA 1MJ7L 2ARJB 2CK0H 4PJ5A 5GRVL 2FB4H 1RMFL 3D9AL 5LVEA 2W38A 1QYGH 2WLYA 3NPZB 3EYOA 4U1NA 1E4JA 2YD3A 2F53B 4WNQA 1HQ4A 4QKXB 1QBLH 4P5MA 2XKNA 3B83A 3QR2A 2B1HH 2E9IA 2NNAA 4U0QB 3KPRD 1LEKB 3UO1L 4APQA 4HCRA 1CDJA 1KNOB 2P49B 2UWEB 3BD3A 5CIPA 2JB6A 4QWWC 3BZ4A 4MX7A 2NY6D 2IAMD 3IAQA 4B7LA 5SWSB 3HUJB 2D7NA 3WFDL 1KTDA 4XBEL 4QXTA 5HD8C 2YK1L 5I8CA 2VAAB 3HE7C 1F58L 3EIFA 4P23D 5MENA 3U2SA 5K9OB 1CR9H 2Q86A 2YOCA 4NO3A 2JIXB 5MEOB 2MTPA 4HF5H 2IGFL 3SCMB 5IQ9B 4HD9A 5CJXA 1AO7A 3B9AA 3QIUB 1JZ6A 2WIIA 4HDIA 5KSBF 2WIMA 5C6WH 3JTTB 4K7FB 2GHWB 4OM1H 3LIZL 1B6DA 1F02I 2FL5B 5F6HI 4X7TB 3U9UB 1RFDH 4Z7VA 2HVKA 5FA4B 4GH7B 2XZQL 1HYSC 4J6RH 5L2KD 1ZXQA 1XF2B 4ETQA 5ESVB 4O58H 4OTXH 1CFSA 2GK0A 3FB8A 5I18H 1IJ9A 1J05A 5IMLB 4LBEA 3GMMA 1ZA6A 1L6XA 3LIZH 1AXTL 4JRYB 4PP1D 1CXFA 2KZ1B 2X4SB 5DJDA 2X89A 5HHME 2CIIB 3O11B 5EDXA 3SDDD 4C56D 4YO0A 5IGXL 3ZTNH 3QUXD 1G9MH 2P7TB 1IC1A 1F4YL 3MFFB 4XCCH 4E0RB 2Z8WC 3GSNB 5GJSL 4WHYH 1PYWA 4LCIL 2X89D 3T0XA 5KSAD 1TVHA 1TJGL 3ARYA 5DUBA 5F7KC 4WI5A 5EC2A 1VERA 3PUCA 5F7NC 3ZZ1A 1HDMA 1VESA 1AFVL 5ISZD 2FLBT 4LIQL 3RUGF 1T21B 1AIFA 4KJQD 1G7MB 4TTGA 2IALB 4PRHB 4RMSA 5DJ2B 1WWWX 3ES6B 5E9DA 2VZ1A 4WCYL 2C3VA 2YUVA 2GUOA 1FO0L 4OLUH 4QRPA 4HPYL 2W0FA 3CUPA 3DXAA 3NA9L 2OJEB 3QEHB 4FQLL 4QXUL 3IU3A 1ORQA 1EXUB 5CZVL 3WDHA 2VSCA 4POUB 3SDXB 1QKZL 1NSNL 2Q6WA 1A7BA 2ERJB 4HJGB 5E5MA 5ITFA 1HXMB 5FV2A 3VFPA 4P23B 2AK4D 2LABA 4I18C 2BSRA 4DZ8A 3BMVA 1A8JH 1FNHA 2C4XA 3ME0A 3NVQA 3FQWB 5E7BA 3BKMH 4K3JH 1BM3H 3ULVC 2JCCB 4JZJB 1VEMA 4MWFA 5KVDH 1EGJL 2YN5A 3P0VL 1OGAB 4DW2L 5EU5B 4QNPF 4Z7UA 2DICA 2ID5A 2FL5A 4PRBB 4ZOBA 5K93A 1ZK9A 4CVXB 5JA8B 3S96A 3I6GB 1IGJA 4WFED 4JPWL 5JQHC 4HH9A 1NCNA 3U83A 5BV7C 4OZHA 5JW4M 4TUKL 3BPCB 1BBDH 3UDWA 5JW5A 3IDNA 5J12B 4H20H 3QDMA 5AD0A 1MAKA 1FIEA 2A2QT 5HVHB 3TA3D 2V6HA 2FO4B 4OKDA 3G5YA 3QISA 4M62L 4Y2DA 1J1OL 2EEAA 2YZ8A 2EKSA 4WFGD 5KOVC 1EMTL 1N5AB 2RJMA 3EDFA 4BA8A 4YC2C 1T0NB 5KBNC 5CHNA 1N0LA 3OV6A 1D5IH 4DVRL 4U1JB 1NCWL 1MAMH 1QVOA 1A1OA 2ZUSA 3AMLA 3FO2B 3CH1B 1B0RB 1B0WA 2XFXB 2BCKA 4HK0A 4JN1H 3WFHB 1NGPL 3DGGA 1MY5A 5D7JB 1UZ6F 3GIVA 4IRJC 5D6CB 3RX7A 4YQXH 4MVBD 1G1CA 4FQQA 3VFTB 4LL9A 4B7IA 3EOTL 4WI7A 3PIQB 1IZJA 4P5KB 4H25A 1T7VA 2F5AL 1X44A 3ULVE 5EN2A 3LEXB 2NLJB 4ZUTA 4YWGH 5L9DH 4QHKJ 4PTTA 2HH0H 1M05B 4JQVC 4XP6H 5SWZA 4QGTA 4R4FH 4CNIA 5DJYA 4PRHD 1J87A 4J3WA 4X4YA 2BNUB 1FYTE 1D9KD 1X5JA 2W0FB 2AABL 1U8OB 2DQJL 3T3PE 1A3RL 2EDJA 5BVJA 35C8L 3HPLB 5FXCH 4Z7OF 3CDFA 3LN9A 5JHDE 4KVCH 2R39A 2UZYB 1QRNA 5EBLA 3D5OF 2PXYB 1IEBA 2W92A 3JV6B 2X4OA 4M5YL 2JELL 4I3GA 5F1OB 1KYOJ 3UYPA 4Y5VB 1FL6A 4PUBL 2VAJA 4KKBD 2VN4A 4WFHD 2FB4L 4KRNA 4YHNB 2Z35B 4AEIH 1QEWB 2WQ8A 5J13B 1J8HD 3VXRA 1WISA 1YNKH 3MUY1 4EN3D 4H26A 4HXAH 3GUTB 4YHLH 3L6FA 1P1ZA 3HZMA 3RDTA 1PD6A 3NCEB 2VMFA 4Z7UB 3VI3F 2DI7A 3MRBA 1LK2A 3HLAB 4LHJB 3T2NH 1J1XH 5FYKL 1EUUA 4KXZH 1GAFH 4NKIH 5CEZL 1WC7B 4P9HH 1CK0H 2JTDA 1E28B 3PDDA 4OZHB 4DKEH 1YC8A 3FO1B 2AJVL 1KGCD 3L5XH 4XAKE 2ZZUT 3ULSB 3BVNB 5FHBL 2I25N 4J3OC 1YMMA 3ZL4L 2E3VA 3QG6A 5GS0C 1N3NA 1ADQA 2H6PA 4KK8D 1IAMA 2NY1B 2F54E 3RTQB 2R15A 1M71B 4PRIB 1HWHB 2RB8A 4KRPB 2W60A 1EEZA 2DQGH 4ZFFB 5D93C 5HGDB 5H2BA 4YK4C 2EDWA 3VD7A 2MKWA 5SX5K 5BV7B 2VXVL 5CJ8A 4HUWA 3WFHA 2VWEE 4OD1L 5E2JA 3SPVB 1WZ1H 4P3DB 1CGSH 5D2NB 2VZUA 4N0YL 1D9KC 5DK2A 4DGVL 3VXUE 2UZIL 5FOBB 3TN0C 1XCQA 5BQ7A 1T66D 2WWKT 4HC1H 3HE6C 2OMBA 1I8LA 3UBXG 5SWZB 3EOTH 4KKBC 4JEGB 2KBGA 1JGEB 1CBVH 2AJ3A 1JGDB 1OSPH 4HIEB 2ADGB 4UQ2A 5HY9B 3HUJE 5T5NF 1OAYL 5JXED 1DFBL 4ZO7A 2XY1A 4G9DB 4OLXH 5D8JL 2ICWA 3FCTB 2E8YA 3B2UD 4LRNL 4M93B 1MHHA 2AI0L 3QDJE 4IRZL 1J11A 3IF1A 2F9BT 3L3KA 3PJSB 5EU3B 1Q9WB 3WO3B 1KJ3L 4Q9QH 3U30C 4FQJH 3WIHA 4Y88A 2NW3A 1XEDA 1M6OB 3FB5A 2ZOKA 4P3CH 3WKNA 4HZLA 3W82A 2DM3A 3TN0A 2OL3L 5HI5C 4Z0BL 3E3QC 3HMWL 1F4AA 4YXHL 1ND0A 3MRLA 3MUHL 3GJFA 5DJXA 2GCYB 3WFEH 5ISZE 1U8HA 1EFXB 5DS8B 3B2UC 1JGVL 2WUCL 1OTSD 4KI5C 3C6LA 3RHWF 4QYOA 4RFEA 4ZNCD 4LVEA 3VRJB 4KTEL 5F72S 1JCKA 4HBCH 4QOKA 3I02B 2ZJSH 5L0QC 5CBAA 1OM3H 5AAMA 4OGXH 3BO8B 2Z93B 5J13C 4MDIB 3IXTB 4YHKL 4L8SA 3TIDA 4FXKB 5CKGA 5DF0A 4ZNEA 1K8IB 4I0PA 3VWKC 3MV9A 3RVWD 3BW9A 3B9KD 4KMTH 3OTTA 4U6VH 1T1YB 2OTWB 1W72L 3VFOA 4X9IA 4A6YB 3RTQD 2WUCH 2B0SL 4HV8A 4FQCL 3R1GH 2HVJB 3T3PF 1QKZH 2BFVH 2EDRA 2FJFA 3GHBL 4YHKH 4HHAA 1TENA 1G9NL 2Q7YB 4ZYKA 2FEDC 2CUMA 2H1PH 3LHPH 1WK0A 4OGYL 1AC0A 4L4TB 1XGUB 1T5WB 3EFDH 5DJ0A 1WZMA 3SGEH 1FDLL 1UM4H 5HI3D 4U1SA 1VFOA 2MQ0A 3EO1A 3GO1L 4UOJA 1W0WB 1I1AA 1NC2B 1UZ6E 2F54D 3UC0H 3F8UB 3VWJD 3BEVB 4G5ZL 4RMTA 32C2A 2HLAB 4AG4L 4MJ6A 1Q94A 3I9GH 5D96C 3KS0J 1NAKL 3IFPB 1D9KA 4H8WH 1G7JB 3E2HB 3MRDA 3L95A 1TQBC 3ARBB 3CCHB 3FN0H 1D5XB 4WFHE 1YPZE 3TBYB 4EBQH 2DBJA 1JHLL 3TBTB 1MCWM 1XR8A 4OLXL 5D8JH 4YQXL 4UBDC 5CWSA 4TUOA 5D2NE 3REVB 3QH3B 1YDPB 4G8IB 2PO6D 1L4IA 1I3RA 4L3EB 3AGVA 4PRPE 4XVUD 1HHKA 4JLRA 2HFGH 4EN3A 4Z77A 1JV5A 1JTOA 3QEUB 4R8WL 4ZUWA 3SGKA 3Q48A 4QHMB 1GXEA 4DOHE 1T1WB 5DEGA 4QHLA 3B5TA 2GCYA 4KPHL 2I07A 1BQHG 1IM3A 1U6AL 3DRTB 1EA9C 1RZGB 5EPMA 1NBYB 1EFXD 3I2CL 5JZ7D 4GKSB 5DR5L 4XZUB 1YN7B 2EDEA 4PJ9D 5C0NC 3BE1H 4S0TD 5IBLC 1HOCA 4IM8A 1TIUA 5EUOF 3KYKL 3DRQB 1JF1A 4UNTA 4EXKA 4XBPB 3TH2T 4YHYC 3HR5A 4GKNB 1EAPA 4X80H 4OLYH 2FWOA 3UDWC 2DI8A 1SJHA 5FF6B 3QIWC 4IS6B 5H35B 1DQJB 5C0GB 3ARGB 4NGHH 1NMAH 2IAMC 3G9VA 1KIUA 5D2NC 3GJFH 3EYOB 2EH7L 1XGUA 2R2EB 3F7YB 4JY4B 3IJYA 3DO7A 3U1SL 1ZANL 1T1ZB 2FLRT 2PCPA 1H8SA 5I17A 3NCJH 4XP1H 1P7HL 3O6FA 5DJAB 5DURB 2DMBA 2XY2A 4JPKL 1Q8MA 2FH8A 1LO0L 5F9OH 5AYUH 4OZHE 1QO3A 2PYEA 3ROOA 3VFSA 4YDKH 5FUCC 3O4LB 2VRAA 2HLAA 3VE0A 4X6CA 5IG7B 1XR9A 2MQCA 3NZHL 6CGTA 1TTGA 3TPUA 1AP2A 4WJ5A 5DTFA 1WICA 3OAUL 3Q5TA 4YLQT 4J12A 5KOMC 4E9LA 1LD9B 5K9KB 3FHQA 5A3ID 4WIQA 5BRZB 1ZT7A 1KIRA 5FCSH 4PLJD 1NAMB 1PY9A 1K5NB 1DSFH 1XH3B 2P8MA 2VDNH 1ACYL 1CFVH 1FPTL 2NY5H 4Y4FD 5CILL 1G6VK 1CD0A 2CLRA 5FYJE 3QUZD 1SM3L 3GKWH 3RIFK 4XT1C 1M4KA 1HXYA 5C09E 1DBML 1FH5H 2HRPH 2PYFA 2CJUH 3VFVA 3MBEB 5C0AA 1IAIH 3DV4B 4MD4A 4JFZH 3KJ4C 1YJDH 1YPZF 4NOFA 2A9ML 2E9BA 2R0KH 4K7PX 5DQDH 2YXFA 3RVTD 4HS3B 3LD8B 4UMGA 3LAFA 1MAML 4OZ4A 3VCLB 1CFBA 3WXVH 1OB1A 3PL6B 4PS4H 1FYTB 3OJMB 4BQBA 1XIWD 3ARDA 3TESA 2E8ZA 3SBWA 1IM3B 3DRTA 1NDGB 5D71H 5DD1L 1J05B 1CDYA 3EDEA 5FM5O 5ACZA 3LV3A 2C5DC 4PY7A 3G04B 4Z78B 5F9AC 4KDVA 1NPUA 5TDNA 3V5HB 5KZCD 1J86A 2UZXB 3LQAC 4LOUD 2XTJC 2FH6A 1Z9MA 3OZ9L 4KI5E 1RUPL 2L0DA 1GHFH 5IK3B 3NCBB 2BNRE 4LAQL 4L4VB 4M7KL 4JPWH 5A2FA 2R1XA 4F58L 5FGRA 1CXKA 2FWOB 5E5UB 4AG4H 5F1IB 4FQXC 5C0BD 4X0KB 5DJZB 5C08A 1EX0A 5F89A 4O5LH 3RJDA 4JJHA 5E99L 4Z76A 4UTBH 1F4WH 2HFEA 1X5HA 4JGMA 1RJZB 1FO0A 2GTZB 5IUSA 4D8PB 4QXGL 3MXWL 2X4PA 4BFIA 1MCDA 1MH5B 1HSAB 3ZYIA 2Z4QB 4HC1A 1BEYH 3O6FB 5F7LB 1CYGA 1CXIA 2DYPA 1T4KA 2LU4A 3GMNB 4W81A 3C5SA 4ZTPH 3JWNC 1MHEA 2FHBA 1OP3H 4KY1H 2WM0A 2Z31C 5IB5B 3VXMD 4YJZL 3BQUC 2OJZH 3GSXA 1QG3A 3U36B 1IAOB 2QSCH 4J4PA 5GS3A 3HS0A 1KBGH 4I77H 4FABH 4PRIE 3ILQC 4NSKA 4G9FE 3W11C 2CRMA 1INDL 5D96B 1P4LA 3HE6A 5GGTL 4PRPD 1G7HB 1NSNH 3G6AB 4PGCB 3WDIA 3E2HC 4Y5YA 3KLDA 4XWOC 1EEUA 1SMAA 5SV3A 5GS2D 5ICZA 2VDML 2G60H 1FZOA 2PO6A 4ZTPL 2XNAB 3HB3C 1D5BB 1F13A 5E8PA 5I8OL 3I3EA 1KC5H 3CC5B 1GCFA 1EV2E 1WWAX 2AV7B 5GGTA 3NIDE 1U3ZA 3QCVL 2VXTL 2CPCA 2EH8L 2FSEA 2VABA 5J1AB 2YEZA 2Y07H 3IDNB 5GS0L 1S7TB 4H5SA 2YPLE 3QUMB 1JPTH 3WIIL 1T89C 4NQCA 4QCIB 4TQEH 5EUKB 2P8PB 1KLGA 3O2DA 4BFBD 2XZAH 3TCXA 3IRZA 2R9HD 1PLGL 1NFIA 3QXUA 5GHWL 5MEND 4GO6B 4YBLB 3V4PH 5IV2A 3QB7C 4LCWE 1JHKL 1YUHA 3ARGC 3BH9B 4P2QA 5E8EB 3PWUB 4HH8A 1MFNA 1PKQA 1Z6JT 3OKNA 1BQHA 2C1PB 3GJEA 4YHZH 4G6FB 5BW7A 4JO3H 3NZ8A 2ZKHH 5DFVD 2FBOJ 1V7NL 5BZWA 2XTLA 2DBLH 3O8XB 5DYOA 5C08B 4Z0XB 3BZEB 4LMQI 3FOLA 4GS7B 3O2DH 3STLB 2Z31D 3RWJB 1U92B 3D3VB 2IANA 5EBMB 1CFQA 1HHJB 2DWDA 2NLJA 5SV4A 4R3SB 3MREA 1FLRL 4TSAH 1PYWB 3Q0HA 1EO5A 1S9VB 3IU4H 4XP5L 2W91A 2F19L 3OXRB 2HJKB 4LCUA 4LSRH 5SWSD 5C0RH 1TVBA 3PGFH 3QBTB 1VFAA 2NY2B 5EC2B 2VQTA 5LGKA 2P43B 2J88H 3LEVH 5HPMB 1R5IB 4HUXB 3LQAL 3SDDA 2XXCB 2BVYA 1MHEB 3IFLH 4Y16A 5MERB 3ES6A 4JFEB 5FYLH 1UWGL 4K71C 1W0VB 2JK5A 1MCOH 1FV1A 2YPLA 2HRLA 5HGAB 5I71C 5EZLB 5GRYA 2BC4B 5IIEA 4FZ8L 4EI5A 4M6ML 2Z35A 3QUZA 1WIUA 1IGYA 1ZA3B 2R4RL 4QT5B 2SEBA 1FNLA 4JPKH 3SDAD 4R0LA 5DGRA 1FGNL 1MJUH 5HVGB 3B9KC 5DUPH 5IB2A 2OZ4L 4Y4FC 3C9NB 4MNGB 4R96B 4WFFE 4NZRL 4JRYD 4QTIH 2QHRH 5BCAA 4CU8A 4R4ND 3KLSA 3IS1X 5B3JF 1GGUA 2VLMD 4EIGB 2VLRD 3T0VA 5GRUH 3QIBD 2XKUA 1CWVA 5FDYA 4S11A 1LE9A 3MLPA 4FFYH 2FATL 5F21B 4GUPB 2W07A 1C08B 3QZWB 25C8H 4MQTB 2QQLH 4V1DB 4M5ZH 2DLHA 3LMJL 4AENB 1RUKL 2J8UA 5CD5C 3GI8H 2D0HA 4LVNC 4TVPD 3BD4A 4G6MH 2Q76A 3DBXB 1K4CB 4TVPH 3WFEL 4M6AA 2QSQA 4ODTH 1HEZA 4HMCA 5IJKC 5C0BA 1D5ZB 4O5LL 4ZDHB 4L9DA 4ODVH 1U8IB 3SGJA 4PRNA 4L8CB 3OKYA 3P77B 1KPVB 1UYWH 5E8OA 2ESVA 4PUBH 3VI3E 5BOPA 3OJVC 2P5EE 3V2AR 1LEIA 5KANG 4NNXA 1CDGA 5E9DE 4B50A 4RMWA 5B3JE 3GMPA 4X7DC 3IDUA 5IJVB 4PRHE 4IRJD 3TJEH 5BJTB 1NCCL 4I0PD 2Z31B 3E3QE 3RVUC 3OKKA 5ALCH 1ZHNB 1E4XH 3CMOL 1EHNA 4JAMB 2VDKL 1P5VA 4PJGA 3PGFL 5CMAA 3BRFA 2HFGL 4V2CB 1YEIH 4X7SH 1UACL 1UQSA 4NKMB 4OKVA 1A5FL 4DN4H 3MRRB 3VA2C 1OF2A 4F58H 5ECJE 2IMNA 4LKCB 3I75A 4L9LC 5DFTA 5IEKA 1XGQB 5JLZB 5GRXG 3RVXD 3VXMA 1F4XL 3QXAA 1UVQA 3RUGB 4TSCL 1JWSB 1DR9A 1L7IL 1MQKL 4L8BA 5LCVL 3NMEA 1A6TA 3MROA 1OARH 3GMLB 1WGOA 2BC4A 4F57L 5IIEB 4Y4KB 3V8CA 1YEHL 2VLKB 2BNRB 5KAQG 4X7SL 4APQD 1M6OA 4XMLL 4LSSH 3FT4B 5C0CB 1F6FB 2RCSL 4MNQE 3FONA 2NW2A 4Q2ZB 5CS7A 1ZS8A 3S36X 5HHMD 4OCRL 3HI6H 2R0KL 3MRKA 5DD6A 2Y25A 1FDLH 1UM4L 3KYMA 1SJXA 3RA7L 2Y5TB 3VXRB 1Y0LB 1JPSH 3MCKB 1O0VA 5GZOC 2XG5A 5EC1B 2GW5A 4OIIL 2FX9L 1T1XB 4YR6B 5HI4D 1T7YA 4K7PL 2W9EH 4AIZB 1CLZH 1K8DB 2EC9T 4JDZA 5T1MB 3KYOA 5DRXB 5HHQB 1LK2B 2VR4A 4KUZH 5GRVK 3QDJB 5T33H 1EEQA 3EFFA 3U46B 4RGNC 2H26B 4ZQKB 1FP5A 2OP4L 1TETL 5E94B 4ELKA 4GAYB 2ICES 3G08A 4ZUUA 2VDMH 3EKCA 3VW3L 1GL4B 1UEYA 5GZNC 5ICXA 5DJ8B 4YDKL 3DX8B 5EOQH 2EDQA 2LU7A 3H0TA 4AEFA 4F7PA 1S7QA 4RQQB 5EOCL 3OHXA 1LEIB 2ZNXA 1M71A 4PRIA 1HI6B 4OIBA 3ZDZF 2VITA 4ELMF 1NCBL 1H15A 5JDSB 4QHKI 1JI2A 3A6CL 5DD0L 3OF6D 4XP9H 3QFDB 4ZAKD 5C2BL 1I8KB 2YWZA 2ZCKL 1P53A 1RIUH 2Z31A 5EZJB 3V7AG 4ZFGL 5I75B 2X9YA 4LDEB 2F5BL 4HIIB 4O02H 2J7LA 5D1ZA 4JFPB 1YMMD 4ODUB 1TTUA 4MJ6B 1Q94B 3X12A 4CGTA 2XA8L 4HIXH 4PRDB 5KVMC 3CPLB 5D1XD 3T1FA 3OB8A 1WAAA 4GRMB 4PBVC 3RVTC 3P11L 1HKLL 3U4BH 2PN5A 4G6AD 4UU9A 3MV7D 4WW2F 5J56B 1JYNA 4MXVF 5JXEC 1AO7B 4YWGL 3HFMH 1JFQH 2I60H 1FJ1A 2ITCB 1ES0A 2AEPH 3LEYL 1VEOA 3CK0H 2CR6A 2OR7A 1CDHA 4AQ1B 2BNRA 3NFSH 2VDQH 2MNUA 2R2CA 3NABL 4XCYA 5I76A 3EYUH 1B4JH 1J18A 4LGSB 1H9VA 1QLFB 4YXKH 2XA3A 3TYFA 3BAEL 3OR7A 43C9B 2Q87A 2NNAB 1VSCA 4YC2B 5I1CH 1DQDL 3A67H 5TE6H 2VUOA 4FG6D 4HWUA 5HDBF 5L2KE 4K2UH 2RCSH 2JLLA 1KNOA 4DWHA 5L7XL 4ZPTA 5LJYH 4JFQB 4PIRF 4D9RE 5I2IB 3GMQB 5SX4I 2NY1D 3QNYA 4BQ8A 4G43B 1CVRA 4X5XA 4A6YH 4Z7WA 5I1CL 2XQYK 4RGMB 1P5UA 4R4NC 5ALBH 2FBJH 4YFEA 4OV6F 2IPTL 4QF1B 3ARFB 3FQXB 5T5NG 4PGDB 3U9PH 3X13B 3QHZH 3W9EB 4PYGA 1AR2A 5BS0D 1Q0YL 4Y1AE 3VG9B 1F90H 4QOKB 6FABH 4HS6A 5DUMH 2YPVH 3U0WL 4XVJL 1JTTA 2C7UB 3A6BH 3C8HA 4BSWA 4L8DB 1YQVH 4IOFC 3JBG7 1PFCA 4ELMB 3EYSL 1MIMH 4XI5D 5F88A 2NZ9D 5KSBE 2H2SD 5JO5B 4R2GD 5EO0A 2RGSA 1LDPH 2GJJA 2KUTA 4QLRA 2GUOB 4F9PC 3R06A 4GG6B 4JRYE 5CSGA 4OBSA 1I1RA 4ODUA 1U8KB 1IGML 1QFPA 1ITBB 4ZS6D 3KXFA 4JANA 4KK6D 3AB0C 1ZANH 3UYOD 3PGDB 2B1HL 3CIQA 5FYKU 4Q6IB 2J8UF 4M00A 4P57B 4Z7QF 4IRSD 4UOW0 4LCYB 4WI4A 4N1HB 4JO2L 3I6KB 4XI5C 1X5XA 4DQOH 4F15C 3DX6A 1WFTA 2AK4E 4CU6A 3QCUH 5K9QI 4KHTH 5F9DC 1OTUC 4LVHC 1QFHA 5HGBA 4PJBB 1IGMH 4WVRA 2MFNA 1JGUH 3ISWA 4R7NB 3HNTL 4S1QH 4K71B 2R8SH 3H6JA 2XZZA 4HKBA 2PKDA 4NKOA 2NY1C 4PRBA 1BAFL 2VSDA 2MPAH 4DKFH 5JDJA 4MZ3A 4MGXA 4WFEE 3U30B 3BE1L 3DYMA 2IPKB 4Z95L 1E4KA 3K2UH 2P5ED 4HWEH 2HTKC 4IIQC 4XNXH 4BZ2L 5FDWB 3O2VH 2VDPH 4PG9A 1ZV5A 3S37L 4F7MB 1F4YH 4CMHC 4PJFB 4Z5RA 4I3SH 1OD9A 3WNLA 3G5ZA 4D3CH 3SQOL 2L7JA 1N8ZB 2GI7A 4NUJB 3H7BB 1W72B 7CGTA 1BD2E 5FO8B 3FQXA 2ATKA 4TSBH 4P2RE 3EJYC 4H1LB 4C83A 3CFDB 4WEBL 3FQNB 4MLIA 4GMSL 4K07A 1JWUA 4KRMB 2VDLL 4DGIL 4R2GC 2Q8AH 4OLWL 4NQCD 2DKSA 2AK1H 4Z76B 4G7YH 1MHCA 3WIHH 1HKFA 4WEBH 2HMIC 4KU1A 3RZCC 4NQXA 2F15A 1EO8H 2HG5A 2X42A 3JWDC 1HSAA 4UUJA 4PFEA 1TVHB 3FAWA 4OLWH 3V6OE 4JFDD 5J1TC 1QFWI 3LH2H 3P9MA 1F2QA 2Y6SC 3MGOB 4GG6A 2EDHA 3S5LA 3GNMH 1SMOA 2OR8A 1RUQL 4JHBA 5JHDA 1QRNE 3WXWH 1IRAY 3N1QC 5FA3B 3HE7A 1CGUA 1BVLB 1WIPA 1NEZG 1DBAL 1IGTA 1YECL 2IJ0C 4P4RB 2D7TL 3QQ3B 3OR6B 5FCUH 2R23B 1KIQA 2DJ4A 4UDTA 4HEPG 1YYLH 4LF3B 3J8F7 3LHPL 4LVOC 4UZGA 1JZ5A 3NZHH 3U0PA 1KULA 3TH3T 4XWGL 4U33A 4NYLA 3MV8E 1A7PL 5CUSL 2W0LA 4OQTH 5D7SL 1N5YL 1P1ZB 4OF0A 4FQQB 4WW2C 2F5BH 5ESQA 2NTFB 2ZCKH 4RA0C 4GXUN 3MRBB 5FM8A 1ORSB 3HZVB 4FQPA 1BAFH 2P8LB 4GRLA 2FATH 3U1SH 3W0WD 4W6WB 3QUXA 2YD4A 2JELH 2O93L 5IVNA 5C07B 4ODBD 1U58B 4PG9B 2JJUA 1XF3B 43CAB 4JQXC 1A3RH 1CXEA 3QXDA 2F74B 3OKOB 1H3GA 3VRLE 4EXPX 4GFTB 2ZUVA 3JV6A 2X5PA 3QNZA 4OZ4B 3VCLA 3SDCB 1K2DB 1DQTA 2C9AA 4M5YH 3WS3A 3HPJB 3V9FA 5IKCA 2OLDA 3BSZL 2ATKB 4M93C 2BHUA 1U0QA 3O9WB 3QRGL 4JQIH 2KQNA 4JVPA 5DK0A 1DL7H 4PJ8D 1LE5B 2E7BA 4J7RA 4OZFB 5GGRB 1IAIM 4X6DB 3G04A 1FCGA 3BT2L 3FRUB 1NUGA 3FMGL 5ELIA 3UTSB 2V2TA 1HK6A 3P73A 3BZEA 3C60C 3RNKA 2EDFA 3CH8A 4O00A 1A1OB 3CDGA 4JKLA 4G7YL 1BBJA 4JN2B 1PKOA 3GIVB 5DSCA 3VFNB 4PJ8C 3VWKB 3VXOA 4FFVD 3MGOA 4X6CE 2DJSA 1BIIB 4XRCB 2NXZB 2E7LA 2BDNH 1MREH 5EORH 2XWTA 4Y4FA 5I74C 4TUJB 3KXFD 3VFUA 4X4MA 4KTYA 1XFPA 2ZCHL 3RAJL 1MFCL 3F5WB 1I7ZA 2VB5A 4HIHA 5B4MD 2XRAL 5E0QA 5FYJU 2ICWI 2YK1H 3MBED 5D7JC 5KVGH 1NCDL 1IGYB 1W2KT 2CXKA 4NN7C 1NQBA 1P4IL 2XWJB 4H0HB 4EOWL 1Z9SA 4PRPA 1AD9B 3UBXI 3HN3A 4UDUA 3O0RH 2P4AB 3V4UL 5GSVB 2C3HA 1CD1B 3VWJA 2QL1A 1C5BH 1MSPA 2APVA 2UUDH 3KPQA 3VXUB 1HKLH 3C8DA 1EBAA 4HAGA 2NY0D 3MQIA 2DI9A 3V0VA 2ADFL 1H3PH 5ITBL 3W0WB 2AEPL 4FMFA 1JGEA 3QQ9C 5L6YL 1RUAL 2VXTH 5DWUL 4LCWB 5I0DA 1QNZL 3TBSA 3V4VH 3C6LC 4MJ4A 2VISB 4EZMA 1JPTL 3WCYA 4P2RD 5E8DH 4I77L 4HEME 3WUWB 3VXME 5SX4H 1EVTC 4DKEL 1UWEH 1DN2A 3NIGF 4IOSD 4WTXA 4XNZC 3RL2A 4F8TA 4LEXH 1ZLVH 4PJDB 1CE1H 1OLLA 5CD3A 1MI5D 4DGYL 2Q7YA 2N4IA 3AY4C 3SJVB 1LO0H 1CLYL 1QP1A 2C1OA 3FFCE 5FHAL 4M8QB 4KTEH 1KEML 3GSUA 3IYLW 4NO5B 4X5WB 1YUHB 2G75A 1Q9LB 3GHEL 4F9PA 4LCIH 5D7IE 4KGLA 3TIEB 2XKNB 2QHLA 1OD7A 4FQXA 5E2TH 1S7UB 1BECA 1KTKE 1PG7L 1AQDB 3IAGC 4AH2B 5GS1C 4LSUH 4WV1A 2YSSB 3NZ8B 4URTB 5E7FA 4RFEB 2M8XA 1RK1A 3H3PH 5FYJL 3SPVA 5IHZA 2HT2D 1NGXA 1T6WA 2H32B 5E2VH 1P84K 5A16A 3DWTA 1YEFL 2PO6C 1SHMA 4RRPA 1GIGH 1Q1JL 3QCTH 5SWSA 1A7NL 1JGLL 2CDEA 4P9HC 5FOBA 3RWFA 5LGHH 3IB4A 1NLDH 1QHPA 4S1RH 3I2CH 1CG9B 2IANB 1XCQB 3MCLL 1X5GA 3TV3H 1HQRA 3CFBB 1IFHH 3BW9B 4O58L 5D7KD 5JXAH 3HI6L 4PRAB 1A6TB 3HZKA 3IJHA 1OSZA 4LEOA 2XV6B 3BQUA 4JM2D 3QWOA 4JZOA 5DMGC 3P4LA 4BSJA 5I1HH 5JW4R 3VMOA 5KS9F 2QBWA 3JTTA 1X7QA 5F93C 2HT2C 2VQUA 5F3HB 4DCQB 5IESH 3U9PL 5FGCE 5L7XH 4MXVE 1AO7D 5EUOE 2VLLB 2WSKA 1DQDH 2ARJQ 4N9GA 3WFCH 4BQ6A 1A2YB 5CIPH 5ESAA 3UBXA 5BVPL 4U1SB 5DFWH 5ADOH 1X5KA 4QRQB 2GK0B 1HE7A 3DLQR 3PP3H 4OGAD 4PV8B 3UPRA 2A74A 3QJHB 3QXVA 4HCRH 3BGMA 2UYLA 4XB7A 4ZXBD 4K94C 5GGVL 1QR4A 1AR1D 3H9HA 1OP3K 4WO4D 4GG6E 2YD6A 4ZTOH 32C2B 1A9EB 1P6FA 4JPIA 3WFBL 2NCMA 2J5LC 3Q1SL 2P46B 1HOCB 4EI6B 5C0FB 1AHWC 3DROA 3EYUL 3MLVH 1FG9C 3DRQA 3WXVL 5B3NA 2GJ6B 2Y4SA 3VJ6A 5C1MB 4P2RB 4PJHE 3MZTA 3NPSC 5D1ZC 3MLZL 1Z5LB 3WEXB 2IFGA 1KB5B 3ZL4H 1AHWB 4IS6A 1I3RB 4L3EA 3E0GA 5D7LA 5LAXA 2RBLA 5E00B 3NTCH 2R2EA 1KPRB 1FPTH 4CMHB 1T1YA 3VFOB 2W1NA 4Z7VF 4KJWD 5JPMA 1CK0L 5JR1L 2EXWC 3QIWA 1NLBH 1S7UA 5FYKH 3OB0H 1ADQL 1CFSB 5HI5D 5EOQL 3ZE2F 3MPCA 3W0WE 4JCMA 5JQ6L 2WANA 3RGVB 1Y18A 1MRDH 1PDKA 1PG7H 4F37K 3X12B 4KHTL 1N59A 3P9WB 3QIWD 1RJYA 2EIZB 5EA0L 1IKFL 3STBA 1HH9B 4ORZC 4OFYA 1RUKH 2B2XL 5AG8A 3QPXH 4I8DA 4MX7B 3PWPA 1A6VH 2O26U 3RL1A 3VGGA 1KCSL 2ESVD 2XI9A 3Q6GL 4U6HA 5IHUH 4MD5B 5E8NB 2VAAA 1FGVL 4LSVH 4XNXL 4YNYA 4LLDA 3MSPA 3W5NA 5C09D 1LO5A 4K3GA 4YBLC 4P5TC 1UT9A 3Q6FB 2JJTA 4AJ0A 5MEOA 3ZE2E 1IGJB 5IW6A 4IRZH 3WNNA 4QRUA 1KT2A 4S1DC 5ESAB 5IT2L 5DQJB 5INDB 3BPCA 4XAWL 4UNVA 2XTJD 3REVA 4BUGA 3UPRB 3TT1L 4IEFB 5EIVA 3SKOB 1QO3B 4JHWH 3QCUL 2AQ2A 4I13B 4OTXL 4ISVA 1A9EA 2E9WA 4JN1L 4F7EB 4ERSL 5EZOH 4NKDA 1EK3A 2LV4A 1XR9B 1W8NA 2QQNH 1LEKA 4ZSOB 3WJJA 3OKDB 4KJWC 1X5FA 5BRZA 5I66A 1AO7E 2AEWA 1MVUA 1NCDH 3ZYOA 3FO2A 1JP5A 3PABB 4YR6A 4P46A 1NFDE 2P8MB 1OW0A 1HIML 1KCKA 2AEQH 1RJLA 1S7WB 1WIOA 1KTDB 3VGEA 2IEPA 3MFGB 1WLHA 2Y7QB 5JNYA 3IDMA 3BUYB 1A7QL 1SVCP 4CJ0A 4L8DA 1YEEH 5I30L 2B39A 3D85A 4FTVE