2Z31C

Crystal structure of immune receptor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell receptor alpha-chain
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31C02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2z31C01
4X4XA 1U93B 3FB8A 2H2SD 5DD5L 4IRJD 1X7QB 1JK8B 3DUUB 5E95B 1NDMB 4KROC 2YRPA 1OAZL 1H3PH 3ULUF 1FN4B 2VDKL 4KK6C 1UEYA 5D1XB 5L8JB 2GI7A 2OQJB 1CK0L 3SBWC 3O81A 2W9LA 1CR9H 3KPMB 4EVNA 3D0LA 1KCSL 1DEEA 5ABDE 1FVEB 4LMQE 1V5JA 3DX6B 3TGXA 3GSNH 3HCVB 3DRQA 4WGVB 3V4VL 2EZ0D 3IB4A 1RUQH 3OKDA 4TNVK 1AKJB 3BD3A 5MEQB 3IXAA 1A3LL 1U42A 3MLXH 4XCCH 3RIAF 3QUXC 3M17A 2ZSVB 2XKNA 1INDL 2ZUSA 4Q2ZB 5IW1B 5K9KA 3OWEA 3R0MA 1TZHB 4Y19E 4RGOL 4NZRH 3N1MC 2IALA 4KVCL 4V1DD 4YX2L 2DQTH 4GRMA 1FPTL 4TUOA 3HN3A 1A7OH 4HGWB 1A7BA 3CFCH 3O6FD 4WW1A 5HI4D 4OB5L 4X9BA 1G7LB 3BQUB 2EKSB 4PRIA 3S37X 1LP9E 2VXSH 3FB6B 4NPYA 3QRGH 4JKKA 1KACB 1FDLH 3ZHLA 3FFCE 4RFNC 3HMXA 4AT6A 3GB7A 1BQHG 2W60A 3ORJA 2E6PA 5JORA 2Y4SA 1KN2L 5IMLB 4ZFOA 4PJHE 1GXEA 3PWLB 2R0WH 1K5NB 3K4AA 4HIIA 2HT4D 4IRSC 2D7QA 4Y5YA 4RIRB 1YJDH 1L7IL 4NUJB 5IVXE 4BYHA 1JZ5A 5E6ID 1WFUA 1MELA 4AL8L 1EO5A 3B2UD 1CFQA 4OZIE 3GGWB 4KFZC 1TZGL 3R0NA 1R5VB 3MO1A 1A5FH 3VFOB 3WN5C 4F7PA 3QIBC 3S3JA 5J0BA 4O2EB 2EC8A 1F4XH 3DO7A 3JV6A 1MLCA 3O41A 4Y8AA 2NLJB 4YHZL 2XZQH 5C0CA 1T0PB 3A67L 4JKPH 3TWCH 1N7MH 4PS4H 3U0WL 1JGDB 4O02L 4GO6B 1NFIB 4UB0L 1GIGH 1BM3L 2KL6A 3RDTB 3WKMH 32C2A 2Q8BL 3C09B 3L6FB 3WS3B 5I73B 5IIEA 2JJVA 2Y5TA 3BUYB 3ALXA 3HMWL 3LB6C 4NM8H 3F6LA 5I6XC 4L4TA 2QQQA 3GIVA 5CSZA 3QZWG 1DQML 1BIHA 4W4NA 4CN4A 4MDIB 3IU4H 5IFJA 3REVA 4J6RL 4LLDA 3UTTB 2AJUH 5FYJD 5GS0D 4BUGA 4YIQB 4ELME 1AR2A 2AI0L 1FAIH 1PW3A 4GRWF 1URLA 3HNTL 4FG6D 5FOBA 4WEUD 4X6DE 1EO7A 1FNLA 1A1OA 4U1JB 5CP7B 2C7UB 4XP6H 1MUJB 3MRLB 3RX5A 3ZDYE 1KTKE 1BD2D 1QFPA 4PJBE 1OQXA 5DEGA 3BH9B 5I8OL 4NO2B 1KXQE 3VGGA 5DHYB 4PJ8A 1A7NL 4DUXA 3CLFH 2HYMA 4U1MA 5J06A 2OL3A 2XWBA 4V1DA 5FOBB 5DTFA 4NCC2 2FIRT 5E24E 1RFDH 3S4SA 2GW5A 2QHLA 3K46A 4LAQH 3MYZA 1Q9KB 4P2OB 1CT8B 5DFVD 3WFEH 5I76B 1KC5L 4OZHB 4IOIB 1SM3L 3DARA 1UM5L 3PWJA 3E6HA 2XIDA 4HKXA 5GS1C 3VXSE 1UADC 4NQSA 5D8JL 4XCYA 4LEXH 4YPGA 3O0RH 5EU7C 4UT9L 4NN6B 1YEGH 3RL2B 2EDWA 4FFWD 3LAFA 5BVJB 2BC4A 9CGTA 2R1YB 4I2XA 4JKWA 3QEQE 1TVBB 4NBZB 3JWDL 1EJOL 3KPRA 1JV5B 1RJLB 2PF6A 2XRAL 4LRNL 3C6SB 1JZ8A 4P5TC 1Q72L 3GMLA 2R2EA 2X41A 1YEFH 1OT1A 2UUDH 2WUCH 4LLMB 4DOHB 3DO7B 3SQBA 4GMTL 3N1QC 1H5BA 5F7EL 5F9JA 1N0LA 4MZ3A 2MKLC 4XAWH 3QI9C 2D3VA 4TUJA 2QLVB 3MV9D 3S97C 5I1HL 3T65B 3L5IA 4KY1H 4ZTPL 4OFKA 1U0QA 1TTGA 5F89B 3E8UH 3MV9E 4HFWA 4HC1L 4YH6A 3U9UB 2BDNL 4WDIB 2E7BA 1CXHA 2HJKB 3MUJA 4OCXH 5DQ9B 1QSEA 1S9WB 3L1OL 3MXVH 4MHHG 1U8KB 4WWID 1J8HB 1NMCB 1OARH 3C8DA 5C0BA 2EEDA 3BP7B 4K7PH 4TSBL 4FMKA 4JFPA 2LTQC 4MD5B 3QFJB 3IU3A 3O8XB 1H5BC 2VXTH 1QFWL 2XKSA 3IGAA 1N6QH 1IC7L 1VACB 4QTHA 2RR3A 4QRUA 1DVFA 4PYGA 4LK4A 3PWUA 4L9LB 4V2CB 5JIKA 1EHLH 3FN0L 3BPLB 5FM4A 5L7XL 1OTSC 3SDXB 2EH8H 5D7IB 2MHAA 4KK6D 1GGTA 5L2JB 2NTFB 4Z95H 1DBJL 5EOCJ 4L4TE 5K9OB 2PTUA 4Z5RA 4XBEH 1A9EB 1P7QD 4PB9L 1G6RL 3MXWL 5LGHH 5KVGL 1FNSH 5J1TC 2R1WA 1N6VA 1S7UA 5K9JL 4UT7H 4YFLI 2KDGA 4KJPC 1FO0H 1DQLL 1QP1A 4TPRH 2DBLH 1NCCL 4RISH 5C09B 3T77A 4RMVA 1EJOH 2E7HA 4OIBA 3SGEH 5ESVB 3DPBA 4FABH 4S11A 1K4CB 4ALAL 3FO1A 3VFMA 3P77A 1VFAB 4ZD3L 2CUIA 4FQIL 5FK9B 1P1ZB 3TBSB 4DCQB 4NUJA 2XTJC 4B41A 1P6AB 5T1KD 4TTGA 4XMLL 3QUKB 4U1HB 2CIIB 3NIFE 1I85A 4ZPVA 1JWSB 1P4IH 1R24B 4JRYA 5DEFA 3GMOA 1WTGT 4KMQA 2ICWI 2YD1A 4LSVL 1KYOJ 5DJ0B 4HZAA 1FBIH 1RZFL 2FX9H 4OZHF 1HHHA 3RNQA 1MVUA 1MWAB 5A2JH 2QV2A 1LVEA 1F97A 1XR8A 2F5AL 4BK4A 1A7RH 3V6FA 3FOLA 3PQYA 5J6GA 3QIBB 4Q58C 3WDJA 5HYQB 2F53D 2QQLH 4KQ3L 5C0CD 3Q0HA 1I3RA 2C9AA 3RZCB 2PN5A 5SWQB 3WXWH 1AKJA 5A3IC 4BKLB 4JFPB 4KXZI 1OM3H 3U4EB 5JR1H 4NKDA 1BF8A 5HHMD 1EEUA 1SYVB 1Z9MA 3VFPA 1B6UA 5DUPH 4LPUA 3MACH 1WLHA 4MHHI 3FTGA 2NXZB 4Y4KD 2CK0L 2YHGA 5D2NC 3IDNB 4QHKI 3PGDA 3MRGA 2E9WA 3GSQB 3EYOA 2BK8A 1S8DA 3QB7C 4ODBD 2APFA 3OXSA 4GAJH 3T1FB 4RWHA 4UV4H 2BFVH 3C5ZD 5C3LD 3JTTB 4CDGC 2VLRB 1JRHI 2DRUA 1WAAA 3HNSL 3UBXA 3V6OA 2CXKA 3PDOB 1GZPB 5IMLA 3FQUB 3KPLA 5EU5A 4ELKB 43CAA 5GS2H 4NNXA 5T1LA 3OV6A 1XGYH 4GFTB 3HE7D 3KPQA 4JFEA 4FS0A 4IRZL 5EUOB 3U6RA 2ICEB 1OT2A 1BFOB 5ESAB 1EHNA 4G6JL 4YZFE 4OZFB 4XBPB 2W92A 2X1OA 3PWJB 4PLOB 5IEKB 3TO4B 4R7DB 1S7XA 1MF2H 4HF5L 4PJAF 1HILB 3BGFB 5EZOH 4PJFE 2X89A 4ODTH 2AS5M 3ARGD 5T1DH 5DSCA 5KVGH 3SDCB 5EU6A 2AJVH 2XWBB 3WIHA 4U1MB 4LVNC 5JXED 1XIWC 2E6QA 4R4FL 1OAKL 1JZ7A 4OFVA 2HRPH 4UAOC 1M6OA 2FD6H 1Q9WA 5HHOA 1F6AB 4KUCF 1UXWA 1U3HC 1U8JB 5J1AB 4Y5YC 2CSPA 4C56A 2A9MH 5J1SC 4MS8D 1F2QA 2BNRA 5CP7A 4Y1AA 3TH3T 1SY6A 2OJEB 1XIWD 3N06B 3BKYL 3BPNC 3I3EA 1QRNE 4R3SA 1S5HB 1BAFH 3QIWD 5FYJH 4M00A 3HLAB 3HNTH 1DP0A 5KVEH 4X9GA 2XV6B 2IH1B 3WIHL 2E7LA 5C09A 2OTUB 5IROC 2VDMH 4K55A 4OZGE 4RFEB 3TBVA 3FONB 3O11A 1HYSD 3NA9H 2BVOB 1BVZA 2UVFA 4M6NL 3O4LE 1K6QH 1EFQA 4I3RL 4TN9A 1KLUB 5SX4I 4D9RD 3NIGF 3KHOA 3ARDD 5IIEB 1FL5A 4PJXA 3LDBB 4JFFE 4JREB 4EI5A 4OF0A 2ITCA 4NNPL 5GS0L 2F8XC 5EUOA 3U6RB 1NCBH 1XH3A 4CNIB 1QUNA 2NY4D 4ZOEA 3RZCD 4BSVA 4DW2H 3S88H 5DMGC 3IJHB 4NNYA 1IGIH 2ICWJ 1FFOA 3LS5L 1O7VA 4JKMA 3IDMA 1MFDL 4HBCH 3EOTH 5HXMA 1OAXH 4HWNA 4GOSA 4K7FB 3GJFH 4OD3L 1SQ2N 3M8OH 4LBEB 1ZT1B 3I84A 3QXUA 3QNXA 4D94A 1GGCH 1A4JA 2XI9A 1T7VA 5B8CB 5I9QB 3L5HA 5LXGL 4HUUB 3PDGA 4PV9B 1G7IB 4RFNB 4L4VB 1ZLSH 5HHOE 4ZS7L 3MLVL 3S5LA 1OF2B 2CR3A 3CSPA 3L3DA 2R8SL 5GRVK 4NN5B 5DFWH 5IB2A 2WUBL 1NCAL 1N7ML 5I66B 3T0EA 3U9UA 1CDYA 1R3IL 4GRLC 2UZYB 4MWFA 3MFGB 4YPJA 2GT9B 4CADA 4G8GB 5CJXC 4KMTL 3TBYB 4QF1B 1TQCC 4GMSL 5JW3L 2BNQB 4JRXA 3QNYB 4KK8C 2FEDD 2AJZB 4AG4L 3WL9A 1Z9LA 3VRJB 5JNYB 3OHXA 3LRHA 1MPAL 1V3LA 2F54E 4P2RB 2OI9B 5CP3A 4D9QE 1RZJH 1XGUB 1FNFA 4OZ4A 4PJGF 1KIPA 4HQQH 1DANT 5JXEC 2PYEB 1RZIA 3G08A 4FP8H 1RU9H 3SJVB 2DMCA 1A6AB 1FL5B 4S0SD 3CUPB 4H5SA 4G9FE 3QIWC 3OJ2C 2J1KA 5FCUL 3JTSB 1HI6A 1D5XB 4G42A 5AZ2L 4G3YL 2PW2B 3PDOA 1QO3B 5CZVL 3CFDA 4G8IA 5DQJA 1EEYA 5DMIH 1B4RA 3C60A 2X4SA 4ZXBD 1G6RB 5GGTA 1NEZG 4EZMA 2VXQL 3LEXB 5FYKU 4WWKA 2AKRB 4A6YL 3CJJA 4MD0B 5T5FH 3OXSB 3GMOB 4GKSB 4F9PC 5DRZB 3FRUA 5HGHB 1C16B 4M03A 4P48A 1HXMB 3DUUA 5FYKH 3E6FB 2RCSH 4UNTA 5DHVA 3OQ3B 1PSKH 2O26U 4HIHA 1T66D 5FXCH 4PRNA 1OAYH 4LCIH 1VGEH 1YEJH 2HT2C 2ICCA 3DXAA 5HYIA 4B50A 5C8JA 1J8HD 1JCKA 2OSLB 2V2TB 4JHBA 4WIQA 5E2WH 3SDCA 1J8HE 4CW1A 3FQWA 4U1KA 4JFFA 2BSSA 4JB9H 4OI9A 1XMWA 3BPLC 1TENA 3MV9B 3SDYL 3QIUC 1CDCA 5ISZE 1MLBA 1T04A 3O9WD 3D25B 3ECBA 1XGTB 4WJ5A 4X6BB 1KEMH 1WBXB 4M61A 3L7EA 3B4NA 3MTRA 3UJIL 3DOSA 4UUJB 4DAGL 1I8KA 4XMLH 3H9HB 2K1MA 1C5DB 3P0YL 3CSGA 5LJYH 3P40A 4D0CA 5D9SA 4GXVL 3E8UL 3PABA 4OAWB 3MCLH 2BNRE 4NQDD 4MA3A 3H42H 1W2KT 4OLUL 2VC2L 5E03A 4JO3L 5HHNA 2PXYA 2FJFA 3DV6B 4QXUL 4KKCD 1WFTA 3EFDH 1VFAA 1LO2L 2GCYA 4PJEB 4FMFA 1OD9A 5I1LB 3O9WB 4OGYL 5EU6E 1T22A 1HHIA 5E99H 2IGFL 1MREL 3KYMA 2EIZB 5DJCA 1BQHB 4HKBB 5GGQH 3BW9B 2APBA 4ZUVB 3MGTA 1GZQA 3MOBL 1HN1A 1LO4H 3W0WE 3UTSD 5INDB 3MREB 4ACPA 5IMMB 3QXAA 4M43H 3HZKB 3WIIH 2DM2A 4WFGD 1C1EH 1YMHA 1AGFB 3ULSB 2EH8L 3FO2B 1RHHA 4UQ2A 4GG6F 1JPSH 5ID0A 3MLZL 2LTQB 4JM4H 5DMKB 1R3KB 2VLJD 2HVKA 3UPRA 5DZOA 1UYWL 4WU5A 4HUNB 4U05A 2X4NA 4ONOA 5FO8A 1LHZA 3L7FB 3MXWH 1MFBH 3CFEA 3NAAL 4X4YB 2VDLL 5C0IA 2NPLX 3GMQA 1CFTA 2GHWB 3PJSA 4XXDA 3V6OE 3CFKA 1KPRB 3BHBA 4QCIA 5E2VH 3PWUB 4XWGL 1QRNA 3SGDH 2NXZC 1ZANL 3EGSA 5DFVC 1ZAGA 3MGAA 1U8NA 3PGFL 3SKJH 3O2DA 3QEQB 4CMMB 5I1JL 4N9GA 3RIAK 4BM7A 2V2XA 5EBMB 4TYUA 5E7FA 3DBXA 1T1XB 2MFNA 3H7BB 1ZVSB 3EOAA 3IDGB 3UTZB 3SY0A 1T80A 1GGYA 2ZSWA 2R0LL 3V4UL 4LRIC 4HGKC 4R2GB 4JZJB 3CX2A 1B0GB 1RURL 3G5VB 3PWPE 1IVLA 3UAJC 1AC0A 3T09A 1BBDL 5I19L 3WIFA 4XH2B 4FFZL 5D7KD 1NC2D 4DW2L 2JJSA 3WHE0 2DMBA 4P9MH 4OI7A 3JWOH 4HCRH 5IMKA 3O9WA 3G6JA 4X98A 3OJDA 3HFMH 2IG2H 5HPMB 3OKOA 1TVHA 4JHAH 4MS8C 1YY9D 2R2EB 3L5XH 3ZKSD 3TV3H 4KZEH 2CQVA 3ELAT 3LV3B 3WKML 4GG6E 3ZT6A 1FZJB 5ICYA 2AEQL 3ARBC 3KPRB 3H2WA 2XZAL 3HTLX 4EI6A 1WFNA 4JFXB 1VADB 3D3VD 5F8RC 2DLFH 4J7RA 5T1MA 1Q1JL 2DTSA 3C09C 3AAZB 3WIIL 3SE9L 2KZ1B 2H1PH 1OSPL 5IBTH 4JY6B 1UH4A 25C8L 3MFFB 2E7CA 1JE6A 3GIVB 1MCQA 4DGYL 1YQVH 4XXDB 5J89A 3VXMA 2FLBT 2Q86B 2X5PA 1IEAB 2GTWA 5I1GH 1HH9A 3IAGC 3MV7A 3RP1A 2LQRA 3D39A 1SYSB 4TNVF 1WWAX 1CLYL 5CSBA 2OR9L 1OHQA 3MRRA 3WYRA 1FDLL 4PLKD 4KTYA 2VE6B 5FIEA 4B7LA 3HAEA 2D0FA 2GIYA 3GMPA 2ZOKB 2MSPA 3S36L 4JGMA 3LVEA 3NABH 3MR9A 3S5LB 4ELMA 1E4XI 3P4OB 3O3DB 4NFDA 3P73B 4RQQA 2AQ2A 5TQ0H 3S88L 4J1UA 4PY7B 4ZXBA 1AI1H 1E4JA 3BMVA 3QFJE 1XIWB 4HUVA 4FQLL 2ATPB 3QEHA 5D2NA 4WTXA 2PW2A 1G7IA 1AO7E 1NEUA 1CLCA 4Z7UB 5I1DA 2IQAB 2XTLA 3WD5L 4TUOB 2XZQL 3EDJA 3EOTL 1NLDL 4XWOC 5I1AA 4LHUG 5FO7A 1EHLL 4MNGA 4CNIA 5D1QB 3RL2A 2P48B 3OZ9H 1VKXA 1RUKH 1OW0C 1T3FA 4XCEB 3ZKNC 3BN9C 3RAJL 3ZL4H 1FP5A 4Y4KC 5DJZB 5JUEH 4R97B 3BPNB 1ONQB 2XACC 1FORL 1KT2B 4GKOA 4AK1A 3SDCD 4UQ2B 4XX1G 4PGDB 3TNMA 4EUPB 4U1NA 4Y16D 5IK3B 3KVQA 3VG9C 5I1GL 5I9QC 3WFHA 3HG1D 5DRNA 4RX4D 3Q6FB 3OAUL 3K3QA 5IW1A 4EVNB 4J12A 2FJGB 3HLAA 1MY7A 1H3VA 4JG1L 3EOBB 2DL9A 5B4MD 1PQZA 1ED3A 1MNUL 3HE6A 3U30C 1QQDA 1YC7A 4KY1L 2OM5A 2VNCA 3QFDB 4R6UA 2PW1B 1BFSA 1W72H 1LK3L 1CTOA 3U1SH 5D1ZD 5I1KH 4Y5VC 4P2OD 3FFCA 3PL6A 2IANA 5CZVH 1U8JA 4OB5H 5MEPB 3DYMA 4NZJA 5HHOB 4NQUA 2H2PD 3IDUA 3TBWB 1A3RL 1FYHB 3K2MC 5DD1L 5B4MC 1FN4A 4ZYKA 2NW2A 1JWUA 4D0CB 2APTA 4OLVH 4ZUWB 3OKKA 5D96C 4JLRA 5I75B 5D1ZC 1HXYA 3D18B 4WY7L 2B4CC 1SEQH 3UJTL 4EKXA 1YYLH 1P69B 3UPAA 3GJFB 1MJJA 3TV3L 3VFRA 4KZEL 1HINL 5L7XH 2ADFH 1MLBB 1K2DB 3CUPA 4XCFH 1GPOL 4GH7B 4PGZA 4WHCA 1AXIB 1U6AL 4LNVA 3U48A 4RFOH 2V2TA 1FC2D 3LH2L 4JGUA 5GGVL 4HS8H 1NL0L 4Z7VE 4F58H 5IFHH 4HIEB 3GMMA 5SWSD 3F7VB 4IIQA 1OAQH 5C0CB 3QCVH 4K3DH 1FGNH 3ZYIA 2WUBH 2DQFB 2AEWA 3JZ7A 3HUJB 3ZT7A 3OG6B 1E4XL 1QBAA 3HB3C 3GDBA 4BQ8A 4AIXA 2QHRH 4O2EA 2Y36L 2IF7A 2WINB 1AGDA 4J4PD 3QISA 5EZJB 1GGBH 3U30B 4KRPB 1EZVY 5DRXA 2EE2A 5MEPA 4KKLC 4MDJA 1KLGA 1BP3B 3BSZH 4U4BA 2IBZX 1L9NA 5F97E 3QCUH 4JDTL 4L4VA 5BZWB 1CF8L 5A16A 4JFZL 2V5RA 4HEPG 3ARFD 3EYOB 3SDCC 1BECA 3NGBB 3MOAL 4X7TB 1REIA 2DQDL 5CCKL 3W82A 1CD9B 43C9B 1JGUH 1XF3A 3O6KH 4GAYA 3ESVF 3BD4A 1QA9B 2NYYD 1T83C 5CMAA 3TYFB 2VLJB 1CG9B 3VFVA 4PBXA 3BWUC 3EIFA 4P3WA 1PY9A 4QXUH 5F21B 1NDGB 4HXAL 1JPTH 1NBQA 4TVPD 3RUGF 1FYTD 2JLLA 1U6AH 4XC3H 1F4XL 4F3FB 3C6LB 3D3VA 4QHLB 1X5LA 4KRNA 1DBBH 1GAFL 2O5YL 2FECI 1X5IA 2MPAH 3RWGB 2VABB 4MSWB 3VWJB 4JPIA 2B1HH 1BVLA 1A1NB 4MDJB 4N0RA 2COQA 1U3HD 1S5HA 2DICA 1MSPA 2WZPD 4HS3A 5IHUH 5F1OB 3SDYH 2VISA 2DKSA 3QYCA 2VLME 2FO1A 1IM9A 1QZ1A 3LKPA 4TQEL 1IGJA 3CXDL 1WICA 5A2LH 3DGGA 4IMLA 4ZFFA 2XPGB 2YN3A 4YDIL 3FZUC 2VDPH 4WUUD 5BRZD 3QG6B 4OZGF 1KIRB 4P99A 3U1SL 1MHPL 1Q9OB 4JQXC 1BBDH 5I19H 3ULVD 3CXHK 4D9QD 3GUTB 4G7VH 3ULVE 5TE7L 4LLQA 3TYGL 3PWNA 5LWYH 4FQXB 1D9KC 1EGJL 1PBYA 1OLZA 4EN3B 4LGPB 1JVKA 3HI1B 5L8KB 4KI5F 4EEEA 3G5XB 5D5MA 2ERJC 5I1EL 1VDGA 4R7NB 5ISZD 4RSVA 2YD4A 4JJHA 1U3YA 5J12C 1YN7B 4K7PL 4DVRH 4LSRL 2QL1A 4M6MH 5HDLA 2QJDA 1FL3B 3SGDI 2G75A 1RJCA 1D9KD 4YHPA 1UM6H 4ONGL 3PV6A 1JWUB 4OSUH 1PAMA 5GGUA 2HT4C 5EU4B 1JYNA 5MP6H 5FECB 2EDLA 4GG8A 3NZHH 3BFOA 3C5SB 1HWGB 4OCLC 5MERA 1ZVHA 5C0DB 3TC9A 1VPOL 3BZ4A 5AYQA 3AVEA 1EA9C 5F88B 3IGAB 5HPMA 3DGCR 3N9GH 1JGEA 1DUZB 2PYFA 1P2CA 1MI5A 3QUXA 1E4KC 3SDAA 4EDWH 1RZKL 3AGVA 1R3HA 1KLFA 4Y7MA 3MJ6A 4P5TB 3L9RA 3TT1H 4H0HB 5DC4B 1H15A 4P4RA 2LABA 2IBBA 2X42A 2I9TB 5DJYB 1HSBB 2HJKA 3WFCH 1WT5C 4U1NB 3RVUD 2HP4A 2GSGB 5HYSA 3U46B 2EDOA 3QT2A 5E1HB 3VRIB 4YHKH 3TBTA 5IT2H 2B1AH 1YJDL 4MX7A 1A9EA 5DC9B 2GJ6E 2JCCE 2YXFA 3N1GC 4TQEH 4ZQKA 3DO3A 1RMFH 4I77L 1MAMH 1FBIL 1U36A 1U8HA 2LE9A 2R4RH 5GGSB 1RU9L 2X1WL 3BE1L 4L8SC 3W81A 5BQ7B 5MHSE 5TDOA 4X9HA 5FGBA 3UBXI 2BX5A 4PJGA 5DEZA 3RDTC 4GRWB 4HIXL 4WV1C 1A14L 3SCMB 1MFAH 2R0WL 4RAUB 3F7YB 4AMKH 3CH1B 3ZKND 4OKVA 5KSBA 1O7SA 3T2NL 1P84J 4ZNEE 3RRQA 4JRYD 1IM9D 1OTTD 4ZNEA 4MYWB 4DK6A 3T08A 4P23A 3DI3B 4JY5H 2EZ0C 2NQCA 4HKXB 1JPTL 3PGCA 3KLHD 3B9EA 2J8HA 4YUEL 1J05B 5D7SL 2EH7H 4E41B 2Q76A 2Z31C 5DK3A 1B2WH 1KBGH 5DO2D 5FO9A 1I9JL 3MNWA 2A77H 3T3PF 4PJ9A 2ZCHH 1RV6X 1PG7L 5DJ6A 1KTDA 3K8MA 1JBJA 5SWQA 5T3XE 3MZGB 4UDTA 1OP9A 2X40A 4JDVA 4K07A 3TIDA 2PETA 1HHKA 1IC1A 1SJEB 2GK2A 5DI8B 5DVKA 4F9LA 2XZCL 4D0DB 4KK9D 2EYSB 1IAIL 3VGEA 4NKMB 2XXMB 3FQRA 4OM0L 4H20L 5I8CB 3QXVA 2V7HB 3SO5A 5JPMA 3ZDXF 3GFUA 5HDQL 4L8CB 3QI9D 2DLIA 2X4RB 3GBNH 3B9DA 5K9OA 4G3YH 3JWNC 1S5IH 1T5XA 2HFEA 4U1GB 1JHLL 4PJIE 4S0TD 3KPSB 1I8KB 2IANE 3TYGH 5GS1B 5FUZH 3FRPA 3QQ9C 3MA9L 4XI5D 4GRLB 5GGRY 5EUKA 1A3RH 4HIXH 1HHGB 4YEFA 4OQTL 1SEQL 5DMIL 3UJTH 4Z77B 2NX5D 5D93B 3JBG7 5E08L 4PRPB 2HLAB 2WQRA 3BH8A 2DIBA 4OLZL 1U58A 1MQKL 4OLVL 3UCRA 4JRXD 1S7SB 3CVHA 2ZUTA 3HS0A 1X44A 4V1DB 1ZT4B 2Q8AL 1V8HA 1AGEB 4D8PB 3MOBH 3MRFA 1E4WH 5L0QB 4L1HA 1G7MB 2EECA 5E99L 3TO2B 2ZUYA 4NQTA 3SO3B 1OAUH 2R23A 4PLJD 2A9ML 3OKNA 1LE5A 1BQHA 3DXAE 4HKBA 2ZUWA 4U7KA 1ZHKB 4DWHA 2CXGA 5IVOA 1EFXA 1KEML 3O8XD 3VI4F 1K4DB 3QIWB 2QADB 1FORH 4ZSOE 4EDWL 4BA8A 3WHXB 1NAKH 3UPCA 5D2NE 3KAAA 4ZSOB 4WFHD 5EG6C 4LNRA 4GG6A 1EMTL 4WFHE 4HGWA 4P46A 2BOCB 1I8IB 5E2UH 4N8PA 3ZTNL 1JGVH 5KVDL 2NCMA 3OBAA 1KJMA 5ICXA 3MX0A 1QVOB 1CFNA 4Y19A 1V3KA 5HI4C 5SV3A 4F7EB 4FXLA 2ZNWA 3ZKQD 4Z7WA 4YAQA 4KI5D 1SY6L 3O45A 3RJDA 4NCDA 1K6QL 1I75A 2BY1A 4L3EE 1RURH 1ZHBB 4F37K 2BSSB 2F54A 5C7XH 2OTWB 2G2RA 2VLLA 1DN0B 4B0MM 3VXUB 2X09A 3GHEL 3TEUA 2V7NA 5FUCC 4NNPH 4APQB 5JO5A 1F13A 4K2UL 5DRWA 5K9QI 3DV4A 5BZWA 4LCCB 1OL0A 5C3TA 3JVGA 5JW5B 5CGTA 2VAAB 4E0RB 4R26L 4X8JB 3ROOA 1LEGA 1UA6H 4IJ3B 3E6FA 4IOSD 2ZP0T 2YD5A 1YMMA 3G6JF 4G6FB 4WTWA 2W65B 3S34H 1MHEA 5J11C 1IQDA 5DVMA 3UYRL 1R3JA 2BCKB 3RBSA 2BP3A 2P47B 5E2JA 1UH3A 3F12A 1NSNL 2MQ0A 1C5CH 3CPLA 3S4SG 5BV7C 1CGSH 2DD8H 4Y89A 4YDIH 1INEH 5D5MB 4DEPB 2CDEB 5HI3C 1QEWA 1PG7W 4NRZA 2ICES 1OWWA 1KPVB 4PJXB 4JDZB 2I9LA 1SBSL 4PPTA 1KELL 1RK0B 3ULVH 4MAYB 4JZNB 3RHWK 3MUZ1 4L3EB 2V7NB 4NO2A 2IBZY 3X11A 3JWOL 4UV7H 4ONHA 1FVEA 2QEJA 2QADC 3NN8B 2IH1A 5IB5B 5HI3D 4JO3H 3RUGB 4JN2A 3WDHA 4FQCH 2HVJB 3S96A 3MBXH 3VWKC 5C6PB 2A73A 2RB8A 1T83A 3GSVB 5FYLE 4DFHA 4XVTH 4PJCF 2F58L 3ULVF 2OZ4L 5C7XL 1QRND 3PP4L 3WHE1 3L3DB 3PWLA 4TTDC 4KI5C 1RJZB 4M02A 3X12A 1HSAA 1XGQB 3DYPA 1H3TA 3TESA 2FB4L 3MMEA 4F3FA 1ZGLB 3S34L 4XXCA 4S1SL 4NPYB 5BCAA 4PJ7F 5MENA 1MEXL 5KSAD 3HMWH 3ZMRA 5E9DB 5GZOC 4FA8A 3SKMA 4RDQF 4P3DA 5DS8B 4OZGB 1QSVA 1KTLB 1F90L 1VGEL 4JRWA 4UIKL 3MRJA 1QA9A 3B5TA 2BVPB 1BFOA 3RY5A 4KRPD 4LCCC 3GK8H 4ZO7A 4KU1A 4JVUA 5MENB 2E7LC 4C4KO 1A0QL 4O5LH 3SQOH 3VW3H 4WHTA 1U8QB 1FNEB 1ZV5A 1LO0L 1I8MA 2MCPH 3MZTA 3KDMA 2JB5L 1PKQB 1SHMA 3M07A 4JKLA 5GGRA 4DZBB 5E5MB 3HAEG 1CL7H 5FYLD 1OARL 3VXSA 2Y6SC 3VI3E 3MRNA 3T8XA 1A6ZB 4J1UB 4FNLL 1NCDL 2W9EH 5EPMB 4D9LH 1S7WB 3CCHA 4OLUH 4PJIB 5IQ7L 1VCAA 4KGJA 4NDMB 1YNLH 1NDMA 4RGND 3FB6A 3R06A 3DURA 4NQDA 4WO4B 5L2KB 1HINH 2M8XA 2Y07L 3ESUF 3GMNA 3D39D 5BV7B 3U4EA 4DZ8A 1BWWA 2APXA 3A6OA 5KOVC 5KS9E 3OXRA 3BRGC 1H8OA 1QKZL 3PL6C 3MUGA 1OTUC 1KULA 1D5MB 3EYQC 5CWSB 5HGDA 3V4PH 4G8EA 4Z7WE 4LQFH 4Z7VB 3MV8A 2IGFH 4HK0B 4KV5E 2C5DC 4WV1B 1TITA 4PB9H 2FATH 1LK2B 5FV2A 3KR3H 2HLFC 2HT3C 2C3VA 1EH9A 3KXFB 4UIKH 1LD9B 1MRDL 5TDPA 4C83A 3MFFA 1TDQA 4K3JL 4OM0H 1F8TL 3P4MB 5KANI 5DGQA 1J8KA 2XZCH 3STZB 4LSTH 3BKCL 3ARGB 4ZTOL 3IS0X 1JGLL 4XI5C 3TT1L 3VW3L 3MV7E 3OL2A 3HG1B 4R9HA 1NGYA 1UJ3A 5D7JC 4XHJD 1FO0B 4JG0H 2EC9T 2JK5B 2EEAA 1Y0LB 3FFCB 4RGNE 2F8VA 3B9KA 4QYOB 5EIIB 1RZ7L 2I07A 2N7AA 1QG3A 5IQ9B 4YXLH 4H8WC 4XP9L 2C4XA 1KB5H 5FDWB 4YDJA 5JO5B 4E42A 1MCEA 3MYJB 2ZCLL 4I5BA 3MLPA 1NCTA 3BP6B 5MEOB 1CFTB 1NCNA 1PD6A 3H9ZA 2F54D 5ID1B 2YSSB 5I75C 3MRDA 1RD6A 2VERN 3NBNA 2OR8A 5E8NB 4K7PX 2B4CL 1BIIB 2CLVB 3PHOB 1MFAL 3WLBB 4YHNA 3FQNA 4PLKC 4Z76B 3NZ8A 1UCBL 3SY0B 3SE8H 3VA6A 3ZE0E 4F7TA 3A6BL 3FZUD 1E6JL 1ROWA 3L5WB 3IDYB 1UKSA 2P43B 2VXUH 3FT3B 1B3JA 3D0VA 4S1DC 4H8WL 1YMMD 3TH4T 2GJJA 3TJHD 3ZE2E 2Q8BH 3MV8E 1FNGB 3RGVD 5JW3H 5JOPD 2EH7L 1I1YB 1UQSA 4PGEA 4MQTB 3QULA 5I1CL 4C56E 2YR3A 3PHQA 3G5ZA 4POZD 1N2RB 1NJ9B 1U58B 4NHCL 4MLSA 1T03L 3JTTA 3AM8C 2K3TA 1NCAH 3BZ4B 3HI6L 1BVKB 4UT7L 5GPRA 2JK5A 5F6IC 3TZVA 2FGZA 4Y8DC 3LKOA 3QXTA 4PY8I 1XCQA 2V9QA 4PRPE 5CEXA 3ARQA 1N3NA 3BWAA 3CX5J 2D7TH 4LPWA 4RAVA 4H1LB 5E4IA 5I0DA 4KKAD 1LO3L 2BSTB 1VENA 3AU1B 3QXAB 4UBDC 3RVWD 2PYED 4L8CA 1S7VA 2MKWA 4YC2C 5JIPA 2Z31B 3P77B 3JWDC 4H88L 5H2BB 1NKOA 2GJZA 5C0BE 2B39A 3ZT5A 4PJXE 4GXUN 3K1KC 4NP4L 4JZJC 2IPUK 5DHXB 3LKNB 1DUYB 3EO1B 3MNZB 5EO0B 4OCRH 5C0RH 1HHKB 2UWEF 3F5WA 2QTEA 4JDVB 3T3MF 3GUTA 4QHNB 4LSRH 1G7JA 1D9KB 1CIDA 1A6PA 3DSNA 2C1OB 2DM4A 1UA6L 4PJ5D 5GISH 4FQLH 4P2OC 3RNQB 2B4CH 4Z7NF 3OB8A 3QIUB 4N9OB 3I6KA 2X4RA 3P3YA 1D6VH 2CKNA 3U0TA 3LN5A 1NC2B 3QUMA 3N9GL 5DHVH 3CLEH 2XNAA 1L0YA 1UM6L 4ONGH 1IMHC 4PR5B 4PP1D 2FX7L 1UYWH 1JZ2A 1T6VN 1ZGLP 4UDUA 2HKFL 3S3SA 1ACYL 5EDXA 2YPVL 1P7QB 3MJ9L 4YE4L 2KUTA 1TJHL 4WUUB 5BRZB 1OGTA 1I85C 1MJ7H 5C0JB 1YN6B 3ARBA 4M3JA 1YY8B 1KTDB 2UV3A 4PBWD 3EYVB 3VE0B 2AW2A 5JMRA 2FR4B 1MIMH 4HWUA 1N59B 2AK4E 3CFJA 1T1ZA 4YNYB 3NH7H 3L1OH 3MXVL 3MUGB 4JFQA 1W72A 4OFYA 4Q9QL 4KVNH 3WIHH 1A6WL 1S78D 2R4RL 4FQXC 1I7RB 3KYNB 3N85H 1MOEA 1ZE3C 2AJ3B 1KEGL 4NQEB 1H15B 4H88H 1I7ZB 5D7IA 1OPGL 4X7TA 4KHXH 5LCVH 1NEZB 2YPLB 2X1QA 1T6WA 3EDEA 2OR7A 5HHPB 1TLKA 4MAUH 2GYSA 2CIKB 3JUZA 2NY7L 4NRYA 4M7JL 5T1KA 5EA0H 1DVFB 2IAND 1K3IA 3HC3H 1JPST 4O2FA 1OAKH 1UWGL 4KRMB 2PYEA 1NGXA 2YA2A 4NKOA 5I1IH 1AQDB 3ARFC 1NMCC 4HW6A 2A6KA 1EV2E 3F58H 1JFQL 4NHCH 4ODSL 4OD3H 5I76A 4XCCL 1XF4A 2W0KA 4K94H 3HZKA 3FMGL 2MPAL 1SM3H 3AC0A 5EFIB 3CK0L 3QG7L 2UZIL 1PLGL 4MNHB 2NZ9D 3QEUA 3W0WB 1R3HB 1YPZE 3RPIA 4Z78A 5C2UB 4HJGA 4OT1L 3KPNA 1U8PB 4GAFB 4PTUB 2CO6B 1J0JA 2Y36H 1IBGH 5EWIL 1AXSB 4UILH 3KYKL 2CDEA 4WFED 4ZFOB 4JQIH 4I48A 5FUZL 3FT2A 4JFYA 4WVRA 1EHXA 5ENWB 4L29A 2F19H 4OD2A 2DQHH 1BAFL 5F9WB 5FYJL 1NCBL 3NGBC 4C54A 2J8UB 4LLDB 1AY1H 4CVZB 4U1SB 1UM4L 4DKEL 1ZWIB 3ARFA 3UP1A 2NY5L 1M71A 2ZCKH 3QDHA 3QPXL 5C0AE 1BD2B 5EIQA 2FLRT 1U92B 2WWKO 4G6KL 4JVPA 2NY0C 5C08E 2R9HC 1TZIB 4XB8A 1EHAA 5FUOL 3V5HA 5DQDH 4OTXL 1LQSR 5IB4A 3L6FA 1F11B 3CLEL 3FAWA 4K7PY 4YUEH 5J1AA 5DD6A 3N1PC 4M5YL 1JZ3A 5F7DA 5HHME 4JPKH 3TPKA 4HAGA 4OD1L 4OFPA 3FQXB 2BY3A 3SGJA 1C08B 1FYTA 4PJAE 4MNHA 3GSRB 1KIQA 2DL2A 4R0LC 4RFEA 3REWA 3WFBL 3LQAC 1R3IH 4G6FD 2Y07H 2LFGA 1XF2B 4XPTL 1ZHNA 1U8LA 2VXVH 4KJQD 3TNNB 4IRSA 1UB6B 3BJLA 4R4BB 4YIQA 1ZLSL 4U6HA 1X7QA 1QVOA 5AG9A 4XC1H 2WBJD 2X4SB 3CMOH 3MRIB 4JAMA 1QLRB 2UYLA 1S7RA 2VWEE 3VRLF 3SOBH 4KPHH 2A0LD 3MLYH 3PE9A 4Q0XH 3EYQD 5ITFB 4HT1L 2XQYK 1DDHA 1NGWB 4PY8J 3RZCC 4WEBH 4X6CE 3BUYA 3I9GH 3UBXB 3HMXL 4L8DA 5IG7B 3QEHB 4X6DB 1S7QB 3VXRD 3K4ZA 1JHLH 4GXVH 4KXZH 3HAEH 3MRKB 1DBKL 6CGTA 1XGUA 2Z91B 4G6KH 1CF8H 3W9DA 3MA7B 4BFIA 2ITDB 1F58H 5DR5H 5KSUB 3MRGB 4WI9A 1TZHA 4JFOA 3WN5B 1PFCA 1V7MH 3BI9X 1G9EA 3FQTB 1LDSA 4WHYG 2P8LA 4OV5A 3KXFE 3RTQB 4YAQB 1AXTH 1F5WA 1II4E 3QA3B 4OM1H 5IFAL 3EO9L 2ZOLA 4Z7WF 1U3JA 1NMAH 3AROA 2X4TB 5ITBL 3KPRE 4X7SH 2FWOA 1A2YB 1RK1B 5DO2C 4HJ0C 5D70H 1KLGB 4JFOB 3WN5A 1DEDA 4JZOA 3O3EB 2YC1B 4LVOC 5J6HA 4BFIB 5JORB 4OKDA 5IUSA 1DDHB 4NM8L 3FOMB 1OW0A 5EO9B 1K8DA 3O6LL 2XN9D 4KK9C 4LSUL 1A21A 4QNPE 1NC2A 1RUMH 3U0TB 5DT1H 4XNUL 1JUFB 3VCLA 1OCWL 3Q3GB 2FO4B 1YEGL 3L3KB 2WBWB 3IJYB 2ZUQC 1HYSC 3QXWA 1XH3B 3IETA 4V1DE 1JP5A 2KKQA 2VLKD 3P0GB 3VMPA 1HNFA 4N0UA 4NQCD 5KVDH 2KH2B 2P5WD 2EDNA 4R97C 4LVHB 5FKAB 4Q7DA 4IDJH 3DIFB 2D31A 5GRXG 5T5NG 2WIMA 3MRCA 3PWVA 3QQ3A 3BKML 1A7NH 2BY0A 1JYVA 5ADOL 1WCQA 4FQ2H 5I1KL 3TFKD 3V5KA 4LCWB 2G9HB 1AD0B 1P84K 5DJ2B 3LOWA 3AS1A 3KPRD 5FYJE 1CICA 1WUNT 2IQ9L 3VXRB 4KROB 4CU8A 5GGQL 3DHJA 1MQKH 3BWAB 5CZXD 5BJTA 5D4QA 2C3WA 4YFLF 1JWSA 2G60H 3ARFB 1B0RB 3VFNB 3QWRD 5GRYA 1QFOA 1INQA 3EDFA 2GSIA 2WK2A 3AY4C 4HUKB 4PREB 2Z4QA 2G5RA 4FQHA 2PTTA 5IV2A 3K74B 4WW2C 4WW2A 3GSUB 3CNKA 3SGKC 1K4CA 4JPKL 4X7SL 1WC7A 5I8CA 3EOBA 2HN7B 4HD9A 3V95A 4WWKD 3LS4H 5F6IB 4MQ7A 4YHOL 4GKZA 4YXKL 2JKXA 2PKDA 4ZOAA 1F90H 1RUQL 5CS7A 2CK0H 5BXFB 1ZANH 5ENWA 3SE4C 5FF6A 5IWLA 1BJ1J 4PJ7A 4HZLB 3CFJB 3VXUE 3NCJH 3UAJD 1YDPA 1LO5B 2OXHA 4LF3B 1JL8A 2LU3A 4HDIA 4PRBA 1OTUD 5GS0H 2F19L 3KYMB 5JPNB 4KKBD 4ZPTB 4S10A 1DLFL 2ZKHL 4KK5C 4F33A 4H0GA 4MXWH 1TQBB 3ILQD 2R0LH 3V4UH 5F88A 4M8VA 1MCPH 2YKLL 2CRMA 4RMWA 4QXGH 3SKUD 2X9WA 5C07D 3EO9H 5IJVA 3G5ZB 2CGRH 2YEZB 1JV5A 3NTCH 3TVMA 4P23C 4FQJH 3MLRH 1NFDA 1QD0A 2ENSA 1T89A 3D87B 5I18H 1M05A 1FNGA 4DTGL 3VWKA 4O2FB 3U0PA 4MD4B 3WUZA 1X5XA 3IF1A 3BP4B 4YHZH 2UY6A 1TCRB 2CUHA 4Y4FA 4I4WA 2YWYA 3VRIA 1LEIA 4IOIA 1GAFH 2O5YH 4XX1E 5LGJB 4ZUUA 3G6AB 2J6EA 3MRQB 3VXUD 1ZS8B 2VXVL 2NY1B 4ODVH 1W0WA 2XA8H 3PQYB 4XBEL 2ATKA 3HRZA 3LKNA 4IOFC 2DBLL 4RISL 5HGDB 1IFHH 5JW4R 1CTNA 1Z3GH 4FQ1H 1AGBB 2X70A 4X99B 4UNUA 5A43C 3V52L 2YUVA 3QJFB 4NQXB 1TCRA 5DJDB 4I0PA 4YX2H 4XH2A 1PGRB 3QSKB 4LSUH 1T0MA 5FB8A 5CIPA 5HYJD 4ETQA 3AAZA 3EAKA 3SJVE 1MUJA 1LDPH 4F57H 3QUYA 2B1AL 2VISB 5ICZB 5DJ8B 5FCSH 1NFDB 1C8PA 1IM3A 4N0FB 3FL7A 2EYTB 5F3HA 3TJHC 1RUAL 4PTTB 2EDJA 4QHKJ 2ZWLT 5IJVB 1W72L 5ETUA 2YPLD 5KJRL 2ARJB 3X14B 5F7MC 1KJ2H 3BMWA 4P57B 4APQD 4X98B 5I1EH 4FTVB 2BXZA 3WMSA 4KTEH 2DJUA 4F80A 3QUYB 1J1PL 2GJ6A 2JCCA 2XA3A 1QSFD 4Q9RH 3TN0B 4PJ8C 5IHZA 2Y06L 3OPZL 3QDJE 1AKJD 3UTPE 2AV1A 2XZZA 2IPKA 2FJHB 1IGML 4U1LA 5DMKA 1RIVH 1NMAL 4RDQG 5DURD 5I2IA 4PRDB 3QFJD 3GHEH 3VCLB 1CFSA 1NLDH 3GSXA 2HFGL 5C0AA 4JRXB 1LEKA 2NY0D 5IJKC 5D1XD 3IFOA 1N3NB 3VXPA 2HRLA 3KHQA 1BREA 1QTYT 1IGYA 3P4NA 4JKPL 4KPHL 4UT9H 1QNZL 3ZE1E 4PJEA 3QZWB 4DK3A 5B39A 3G6DL 3JWOC 5J4MA 1JIBA 2HJFA 5FDYA 1KJ2B 5A2KH 1EDQA 3AS0A 2HH0L 4U1IB 3OJMB 1HEZB 2F53E 2UWEE 2AEIT 3G5YB 4JFED 3BVNB 4AM0A 5DURB 2NX5E 4YK4B 1O0VA 1RUAH 5KS9F 3EHBC 1P4LA 3UTQB 2CH8A 4HQQL 3BKJH 5B8CC 5T33H 5HVWA 1ZT1A 2AXGA 1VFMA 5D5ME 5C6TH 4M4PA 1IGTB 2QKIB 3GSOA 1UB5A 4Y5XA 5IBUG 1YN7A 1XEDA 4HC1A 2PTVA 1IKNA 5I18L 2JELH 4G6JH 4I9WD 4KUCD 4IIQB 3IJHA 4NNYB 5EB9A 4HKZB 3C2AL 3ES6B 3QWOB 2R1XA 2DQEH 2VDNH 4I3SL 3DIFA 2V17L 3MRDB 3RGHA 1S9VB 3QR2A 1F3DH 4HBCL 1KNOA 2BHYA 3VGFA 4Z76A 3WNNA 3DUHA 1KCSH 5FUCE 3T4AB 4P46C 4R2GD 2ZG3A 1ZSDA 2DN7A 1PY4A 3SGEI 1AIFA 2DLFL 2Z93A 5BS0D 3I2CH 1Y0LA 3T04D 3TA3C 3RFZC 5IVXA 1A3LH 3MLXL 1L7TL 4WW1B 3RU8H 3CDCA 2CJUH 4NO0B 4GT7A 3RX7A 4PJFF 4GKSA 3SCMD 3V4VH 5BW7C 5KG9B 4IRSB 3ARDB 2Z4QB 3L3GA 4LLYA 2AXFA 2YOCA 4ODXB 4H20H 4K3DL 3OF6D 3GM8A 1A1NA 3CDGA 3NOIA 1GGBL 2YD9A 4JJ5A 3RY6C 2ARWA 2DBJA 4S1SH 3U7WH 5E5UB 2EDHA 1D5XA 1WJ3A 5AD0B 5C8JB 4YE4H 5E4EC 3WS6C 3BN9D 3F65A 2ORBL 4JDTH 1YPZA 1VA9A 4E41D 4M6AA 3LN9A 2FBOJ 1Q72H 2VRAA 3G6JE 4Y4KA 4ISVB 2H6PA 5EBWA 3PWVB 3QQ3B 1HOCB 5L9DL 1F3RB 5IK3A 4O2CB 4OCXL 4YGVB 5F1SA 4F57L 4LPYA 1G9NC 4JM2C 5E8OA 3UTOA 5DS8A 3DYOA 4JPVL 2JJTA 2SEBA 2X9YA 2EE6A 2NY4C 5TE7H 2BOBB 3L3KA 2DQCL 2B2XL 2VZ3A 3KLDA 3C5ZA 1RULH 4OF7A 1S9XB 3C60B 5F70A 2QQKL 3TVMD 4PJ8D 3QUXD 2DYPA 2Z35A 4MAUL 4X7CC 5F1NA 1TNMA 1C5BH 1ORQB 3OAYK 4POUB 3BYTA 4J8RB 5IM7A 5D1ZA 3T8XB 1XGQA 3UXFA 5J3HD 4XNMA 5ITFA 3PL6B 2APVA 4Y16B 4MJ6A 1A6AA 1A7QL 2LAGB 1CXLA 3SDXE 3SJVA 3IKCB 3QDGB 1CDJA 2X4TA 4TNWF 1GGIL 1P4BH 5KSBE 4KV5F 5D6CA 3L3HB 5HDBF 1OP5H 1DLHA 2GK0A 2J3SA 5HHXH 2YC1A 3RNKA 5JZ7C 2YBRA 1MLCB 2Y1VA 1CCZA 5A2IH 2R8SH 4ZXBC 5CD3B 3VMNA 2ADGB 4POYA 4KKLD 3TH2T 4LHUB 3B9VA 3BESR 4QOKE 5I30H 2R9HD 3O6ML 2ESVD 4XPGL 3LZFL 4PGBB 4MWFB 1G7QB 1EUTA 3L3HA 2EYRA 3S37L 4CUCA 3BKJL 3BPOB 4FXKA 5C0EB 4HUWA 1UJTA 4X4ZA 4RAHA 3FN9A 5E8OB 2W91A 2GFBA 4NO5A 4S1RL 1HH9B 4PV9A 2AV7A 4P2QA 4JR9L 1CD0A 3IAQA 2C1PB 5EN2B 4LSPH 3B9KD 4LKXA 4U33A 3U36B 4YBLC 3PF2A 4IHOA 2GITB 3ILPB 1MFNA 5C0AB 5AYUH 3S35X 1ZT7A 4MJ6B 2CLRA 4OLWL 3LKSA 2YKLH 5F44A 2ZZUT 2NW2B 3H9SA 2J8UE 1QSFA 1W0VA 3D9AH 5AAMA 1DLFH 2AV7B 1ORQA 3O3AA 4P2QB 2AABL 2GFBB 3TF7C 1MHHB 3T4YB 3NCYP 2H32H 3FQRB 3OKNB 2P5WB 2EXWC 1LE5B 5LWYL 2AXHA 4XNQB 4DEPC 3T2PA 2VLKB 1M7XA 1B0RA 1FYTB 1H3XA 1IEHA 5IBUB 1A4KA 2GUOA 4O9HL 1LP9F 1OGAB 1UB6A 5CUSL 5EZIL 4M1DL 4WI3A 3NIGE 1U8LB 1U8IA 2VZOA 1NGQL 4JDZA 1UVQB 2QR0B 1KB5B 5HVGB 1YEDB 4IRJC 4GAGL 2BSRA 1WWBX 2GTWB 3NCBB 4ZO8A 3QDMB 1RVFL 3B2VL 1EGJA 2PXYC 3GMRA 4N5ED 1BOGB 2R2BA 2BJML 5IEKA 3RVXD 2IFFH 3I9GL 3WFDH 4GW5B 1NUDA 1CGSL 2DD8L 4A6YA 3LHPL 1U93A 4RWYL 5I1CH 1K3ZA 3VFWB 3EJYC 3VDCA 1E4KA 3SDAC 1WF5A 3LDBC 2FSEA 2QSQA 3NFNB 2PXYD 2D7TL 5EU5B 4ELKA 1GC1C 5SWZD 3MCLL 3AREA 3MRHA 4WUUE 5BRZE 2VH5L 4KVNL 5I8EA 1C5BL 4L3CB 1IC5L 1YEIH 3FO0H 5DRWB 1EFXD 3OAZH 2VLKE 1KJVA 1WWWX 5H2BA 5LCVL 1ZEAH 2Y6SD 3U46A 3ROOB 5JOFA 4NIKB 5AG8A 1MJ8L 1ULVA 4FZEL 4QY8B 3RJQB 3EYFB 3G5VA 2Z8VC 1RFDL 4M3KB 1Q0XL 4OCYL 1MEXH 2ZSWB 3RA7H 2AABH 3RVVD 5E8EA 1OAZH 3CU1A 4JE4B 3VXOA 1U95B 3C8HA 4ODWA 1Y6MR 1HDMA 5H94B 2VLRA 3CXHJ 4Y5VB 4WWKC 1Y6NR 2WBJB 3DI2B 4JRYE 1CVRA 1XF4B 2XTJB 4D3CL 4Z7QE 2Q86A 2FHFA 4Z0BH 2YUZA 1OM3L 3NFSL 5BOPA 3OR6B 4K23L 4PR5A 2IPKB 3I02A 2ZCHL 3PV7A 5SWZE 5DD3H 5GGUB 1XF5B 3FTGB 3VH8B 2DLTA 3D0VB 5IF0B 1MCWM 3QIUA 1YEKH 4W4OA 1FGNL 4XMPH 5EU3B 4P4KD 4HG4J 4ONFH 3HZVB 5SWSB 3RX8A 4PUBH 4F2MA 1QLFB 1CLZL 3IFPA 5DUBA 1HIML 4LIQL 1JI2A 4CAGA 4F37F 2APWA 2IFGA 5D93C 1TNNA 3O3UN 3SEPA 4RGMC 5KS9B 2VH5H 2J2ZA 3LMJH 3HMXH 3Q1SH 5B38A 1GHFH 4I18C 2BMKB 4X8XA 3WSQH 1I7UB 3ES6A 5JW4N 2Y72A 1V3MA 4KDTA 4P4KC 4UV7L 1AP2B 4I5BB 4PV8A 1IEBB 4PJ5E 1ZHNB 4G43B 5IR1B 4M5ZH 3TCLB 4P57A 3K0WA 2X05A 3O2WH 4ISVA 3S35H 5CEZH 3FO0L 3VE0A 15C8L 4HIHB 2Q8AH 5D71L 5C1MB 5HVHC 5C0DA 4JPWL 1NCDH 2W9EL 2DWEB 1XGRB 3V4PL 4NN7C 1CGUA 1GL4B 1ZEAL 3AB0C 3ARXA 5C0GA 4EBQL 3W39A 3QUYC 2YPLE 5EBMA 3ARGA 3K4DA 4PRPA 5CP3H 3EZ8A 5BOZG 4Q6IB 4FQPA 5I17A 5EU6D 2Y7QA 5EBLB 5DT1L 5JPMB 5IR1A 2HA1A 5JTWA 2JIXD 3WFDL 3W0WD 2DM3A 1TFHA 3LQAH 2CK2A 1QSEE 3HHRB 1T04B 1OTTC 2FBJL 3ECBB 4WJ5B 4XP4H 3OR7B 3V8OA 5IKCA 5I6XB 1BPVA 4CBPA 1ACYH 2X4NB 3MRQA 4HSQA 2FCBA 4R96B 4XCNB 1KXVC 2NXZD 4WW2F 1XF1A 4KJYA 1HZHL 4DVBB 2CKBA 3QO1B 1WVZA 1D5ZA 5JQ6L 3VFUB 5DVNA 4I13B 4HFUL 3UYRH 4PJHF 4YQXH 2HH0H 3DVFA 5FO9B 3EFFA 1K8IB 4L3AA 2BFVL 5E8NA 1JF6A 3I6GA 3J8F7 3G04A 1ZLWH 4F7PB 2ZG1A 2HMID 4UDTB 3MO1B 1M05B 5EU7E 1L0XA 2VN7A 1PG7X 4LFHD 5AZEL 5ACZA 5MENE 3L3IB 3GI9H 1LO5A 2VDOH 4LF3A 5MEND 2I5YL 1IGTA 2VQ1B 3CSBA 4HKJA 3ZDXE 2YEZA 1F4AA 1JWMB 4YHLH 5TJWK 2FEEL 1X4ZA 5I66A 4LPTA 1T21B 3UZVB 1AI1L 4KH2A 1YQ2A 4QRQB 3EZJB 4WU7A 3LSOB 3PG2A 4L3CA 1NGXB 3G5YA 3OKYA 3R1GH 5GXBB 1KENH 3D3VB 3MUHL 4QHLA 4YFEA 1BD2E 3QNXB 3DVGB 5DYOB 3KJ6L 3R8BB 3U82B 1T1WB 1A7RL 2BHUA 3WNMA 4NQCA 1NL0H 4U6TA 5IFHL 5DVOA 1I8LC 2X2YA 5MI0B 5I1IL 2EXYD 4HEME 4JM4L 2KQNA 4P2OA 2A1WL 1A7QH 3U2SB 2D0HA 5E9DA 1CD1B 4X6DA 3MV11 5IW6B 3CK0H 2GT9A 3F8UB 4HT1H 1FZOA 2WAHA 2RIKA 4DVBA 3IDYC 4CU7A 3KJ4B 1DUZA 3C8KA 3LPFA 5BVJA 4BZ1L 5DEGB 5FKPB 3LIZL 3QWQB 1RZKH 3RKDC 1N5YL 3G9VA 2ICWB 3ZKMC 1INQB 4CMHB 2PR4H 4PP2A 4U0RC 2WNGA 3KLHC 4MAYD 4NQDE 1FV1B 1S5IL 5SWZA 3GSNB 3D48R 3QUZD 3ZHKA 5FECA 3NFPA 2WMPA 3H3PL 2NY1D 5I71B 1JGUL 3O6KL 2VKWA 1XT5A 4JPWH 5JA8B 5T3XH 5KBNC 2P49B 5D96B 1U91B 2EYTA 3BJ91 4UOW1 1U8IB 2B2XH 3KWWA 2EE3A 4JM2A 1N6QL 1BOYA 3MLRL 4K8RD 4OF5A 3VXRA 2IG2L 4P3CL 5DJ2A 1EXUB 4H5SB 1ZVYA 2Q1EA 4M1CD 4RZCA 2AK4A 4LARL 4TRPL 3WBDA 5IP4A 4GKNB 3MLVH 5TH2A 5GRWA 4PJAB 2C7UA 5GRVL 3PNWA 4Q9CA 4LP5A 4LVEA 2BVUA 2VLJE 4F58L 1LK2A 4KHTH 4IRJA 3I75B 3DSFL 4JY5L 3TO4C 3SKOB 3H0TB 1BM3H 2J8UA 3LEYL 2YPVH 2XY1A 5EULV 1WBYA 1KXTB 1N5AB 1YEFL 2WUCL 3RTQA 3DX9B 1DL7H 5DFTA 3CCHB 4PJIA 4X9IA 3VJ6B 3VU2A 3NAAH 3P9MA 3UJJL 3EJZC 2WANA 3GRWL 2XPGA 2ZUQB 3VFWA 5C08D 2R2HA 5F9OL 4NHUA 3U83A 2DTML 3LKPB 5D2LF 3MLTA 5TF1H 1A47A 4YDLC 2G5BB 1A2YA 1RK1A 5B39G 4KI5E 5KJRH 4HUUA 1FAKT 4YHIB 4RBPH 5FAAA 4X7EC 3RWIA 1BWMA 4RQQB 5I8EB 2A73B 5HI5C 1JF1A 1XFPA 1PYWB 3QDMA 3F7PC 3BKMH 4HK3J 3P0VL 4I3SH 2BSRB 3WJJC 2XWTA 4M9OA 1G7LA 4HWBL 4PRIB 4UT6H 3K81A 5JHDA 2NR6C 5LBSH 5EUOE 2NY5C 3U7YL 2DQEL 5AUMA 3FHAA 5C6TL 3O2WL 2NYYC 5C9JB 1G0DA 3QHZL 1MJUH 5D6CB 3EYFA 2Q6WA 3CLFL 43C9A 2BOBA 3HC4L 2JJTC 3RY6A 1RIHL 3MRMB 1CL7L 3CFBB 3HB3D 3D39B 1LO2H 3TM6A 3FFCD 1K5NA 3IETB 4HIIB 5ESQA 1TJGL 5L2KD 2EO9A 4RMSA 3UMTA 2H32B 3WLBA 1AQKH 4YR6B 5HY9A 5IBTL 4F8QA 3VD5A 4YGAB 1FGVH 4KJWC 1W8NA 1OB1B 3QUZA 1RUKL 2ZJSH 2GITA 5C86A 3SBWA 2R0KH 3UTTD 2XG4A 2DQIH 1CFVH 1NKRA 4GQ9H 4GRMB 2IBGA 1VB9A 3NVQA 4U1HA 5LQBH 5ESQB 1D5IH 2A1WH 5D7LB 4JB9L 4EN3D 3MRIA 4JAMB 5IB1B 3BT2H 1MRFH 2I60H 3VXOB 2AEPL 3X11B 3EUUA 4LCCA 2P5WE 3AXLA 3SGJC 4PJFA 4HIJB 5F6HI 1EX0A 2E9IA 4PUBL 4ENED 4CJ1A 4GBXA 4KJQC 2HTKC 1HOCA 4NC2B 3HNSH 3I75A 2N4IA 1Q9LB 5L0QC 1HKLH 1YUHA 1UVQA 5C0FA 4HG4K 4DGVL 2WIIB 5J6GB 1FLRL 1O5DT 1XAUA 3FQXA 1TXKA 3FOLB 4J4PA 4NO5B 3B9AA 4JHZA 5KSAB 1KJ2L 5BVPL 3CFBA 2NY2D 1G7PA 2VL4A 1QOKA 4FQCL 4MQXD 4PTUA 1D6EA 1VSCA 1RIUL 3MSPA 5IMOB 2QSTA 3EJZD 1UKTA 1H3PL 1T5XB 1U2CA 4XNMB 5HGBA 4AEIL 4ZMAT 3NIFF 1L7IH 2OX5A 5DD0L 1M7DB 3DMMD 5H37H 4XTRC 3I2CL 5T1LD 1CS6A 4L9LA 3WXWL 1DFBH 3AUVA 3MBEA 5C0IB 1W8OA 3Q5TA 1NFDE 4JEGB 5T5FL 1NPUA 2GK0B 4D0DA 1JPSL 5E6ZA 4BZ2H 1BX2B 4YBLB 3A0OA 1ZA6A 3CZFB 2X44D 4ERSH 3E3QE 5HGAA 4BH8B 4I48B 2FYYB 4MA7L 3V52H 3Q6GL 5CBAA 1FYTE 4PJAA 3BEWA 4MB5A 1LO4L 3IDJB 4QO1A 4U0RB 1P7KA 1HHJA 1YMHB 2EDBA 2FBJH 4XP4L 4Y2DC 4ESKA 1EEZB 1P53A 3SPVB 1TCMA 2RQ8A 4KVCH 1X5GA 4G9FA 5C0EA 3O2VL 1DSFH 4EQ2A 5I16B 2D4FA 1ED3B 2HTLD 3PGCB 2EEBA 1EZVX 3AXLB 3VXUA 1ZLVK 3MV7D 1YECL 4YHKL 5IT2L 1IFHL 1I3RB 1XGYL 1NCWL 3CMOL 1SMOA 4C56D 1C5CL 4LLUA 3UZQA 4R8WH 3ZO0A 3O45B 2DQCH 4O2CA 3RVTD 3GMLB 4FQIH 1HHGA 1OGAD 3Q48A 1G9NL 2M1KA 2AJXH 1H0DB 5EC2A 3QUMH 3P11H 1U8OA 2W0FA 3UTSB 3B3IB 2QSCL 4TNWK 4OGZA 2Y5EA 4OLZH 3BO8B 5HHVL 3QPXH 2HTKD 1NGZA 1ITBB 5F7UA 3QJHB 4AEIH 1T1YB 5AZEH 3W5MA 4WUUA 5BRZA 2W9DH 3VJ6A 4TSAL 2V7HA 2YD3A 3QPQC 3UZEA 1DVFC 1QSED 1KNOB 4O4YH 1DJSA 1X6NA 2I25N 4GSDH 3CVIL 3RWFA 4K2UH 3IXTA 3H0TA 4GBXD 1IM3B 1Y18B 4MJ5B 7FABH 2VKXA 2GJ6D 4GQ9L 3RWJA 4MA1C 4KQ3H 5D6DC 1UACH 2Q20A 4XCFL 1A64A 2RBLA 1ZHKA 3MRBB 1IZKA 4OFDA 4OJFL 4XP5H 3LRSA 5EBWB 3BXNA 4K94L 3DXAB 4M48L 1MFEH 1JF5A 5CD3A 4HS8L 3VD4A 3MODH 4G43A 1RJYB 5F1IB 4ONHB 2FJFB 4Y0GA 5DUML 3HPJB 5HHNB 4QXTB 5FHBH 3RWIB 3QI9A 1NUFA 3BKCH 2Q7NA 3BPOC 3EJJX 4B5EA 1DUYA 2NY6D 3EO1A 3HKFA 5E2UL 3RWCB 1CWVA 5ECJE 1P7QA 3RGVA 2X7LB 3KPOB 5ERWA 4HMCA 3ARDC 2VDML 3F7YA 4NWUL 1VADA 3BP4A 3P9WB 5HTSA 4W4OC 1DQQA 2JELL 3Q5YA 3QUML 3P11L 5D1QC 5T3XD 3IDXL 2KQMA 2CDFB 2NW3A 3MRPA 4PG2C 4XNYL 5HI5D 3ZKXC 1Q94A 2PUQT 2F5BL 1OTSD 5JHLH 2NY7H 4C59B 1HEZA 1YMMB 2BVEA 1A6VL 3MA9H 1BEYH 3HZYA 1IAIM 2WBJA 4P2RA 1A6WH 4I0PC 5GZOD 1HNGA 1S7VB 5CKAA 3TCLA 1HQRA 4PJDE 4YO0A 3X3GL 4FN0A 1GOHA 5KN5A 4J3UA 3MGTB 3H9YA 2DQUH 2BNQA 3HE7B 4QF1A 4KTDL 4KWUA 3WJLA 3ZE0F 1PDKA 4QY8A 1UB5B 3X13A 2F54B 4P2RE 1MAKA 3LEYH 3DBXB 8FABA 1KF9B 5DD3L 2R39A 2OJZL 4FFYH 7FABL 1CXEA 2X7LA 3WXVL 3T2OA 3IFPB 5DUBB 3NCCB 4DZBA 3LN4A 4QT5B 4RGMB 4G6MH 2Y23A 4NKIH 3QDAA 3FN3A 4JFEE 4NGHL 3QI9B 4AM0B 4WU7B 5FGBC 4CVXB 5IHZB 1DQMH 1JWMA 3TZVC 3L5WA 5CJOL 2FSEB 5DUPL 1KIPB 2HMIC 3BQUC 3RWDB 3IYLW 5HVHB 4HH9A 1X5FA 3X17A 4WGWB 3V0VB 4U0QB 3D25A 4NQEA 1WSST 3ZYJA 4L4VD 1HSBA 5ILTL 4XPAH 4M93B 2A38A 5E8PB 3SN6N 2EICA 5BJTB 2J8OA 2X4OA 3MCKA 3TBYA 2WWMD 5CZXC 2GAZB 3TBTB 3KS0J 1QBBA 4HPYH 1Q0XH 4DKFL 2KBGA 4QWWD 1B88A 1AP2A 3IVKB 3SE4A 1ZA6B 3CZFA 4P5KB 2DS4A 4HK3N 1A5FL 3QEQD 1G0YR 3C5SA 3TWCL 1AHWB 3LSOA 4N0UB 5IB1A 3GSWB 5GIRA 2XA8L 1C1EL 4LGSB 2DQJL 5K59E 5J13C 5EC1B 3ZTJG 1T66C 3ZSSA 1E6OH 2F9BT 1PZ5A 1HQ4B 3B9KB 4QYOA 4XPFH 2P5EB 3NN8A 3ZDZF 4HGMA 4N0FA 4ZFGH 4G8IB 1FNSL 2J6EH 4NM4L 2VIRA 4BQ6A 5DJ8A 1JNNH 4I1NB 1KJ3H 5ACZB 2VXUL 2W1NA 1JUFA 4HXBL 1DR9A 1SJHA 2EKJA 3O9WC 5GSVA 1XF5A 2MMXA 1IT9L 3G04B 1DQLH 4Y2DD 4Y1AD 3VI3F 4WFGE 2H32A 4ZUTB 4AG4H 4G6AC 4LFHG 3W9EB 2AERT 4MAYC 3ARSA 4ZD3H 1UZ6E 1INDH 1WCBB 3TO4A 1SVZA 3M1BA 4R96A 3OKMB 2FWOB 4HHAA 5CMAB 2ARJQ 2BMKA 4RGOH 5B38B 5M7QA 1NAMA 4L5FL 3ZE2F 4PRHE 5CGYD 1PX3A 4P49A 3AREB 3MRHB 4G7YL 4PP1C 4CW1B 1GVIA 1QFUH 4LQ1A 1K85A 5B3JE 4X80L 3OPZH 4LHUA 3FOMA 1S7WA 1QLEH 2O5ZH 4QTIH 2Z31A 3OGCA 4PJHA 4K71C 4I3GA 3T0EB 3THML 2AP2A 1J1PH 2H2SC 4HCRA 1QFWH 4HAFA 3NTCL 1KJVB 4LPXA 3D1MC 3VFNA 2LU7A 1GGCL 3UTTE 3H9SB 3CGTA 3NA4A 3LKSB 4LLWB 5DD5H 1BOGA 2R2BB 4M6ML 3GIZL 4KAQH 4QRTB 3GBML 2IEPA 3QO0A 1BLNB 4BH7B 2FX7H 4LL9A 4P5MA 5C0FB 5F1IA 4Y4HA 1QYGH 1TQCB 5DMYA 3P9MB 4G6ML 1NGWA 1HSAB 3KXFA 4R90H 2ZUUA 1AXTL 1X5ZA 1FFPA 3F7QA 5KZCB 2JJUA 4LLUB 4KQ4L 1A4KB 1I7UA 4K3JH 1GIGL 5IMOA 4WFFE 1KT2A 3C5ZB 1NC4B 5IGXH 3SKMB 4M6OH 2DWDA 1H0DA 1OP3H 1CFVL 5F7EH 1MHHA 3T4YA 4CU6A 5DF0A 3TCXA 3AS2A 3V0WH 1I3UA 3VWKD 3LPGA 5E8DH 4DZ8B 2BVOA 4P59H 5GJTL 2IC2A 2R56L 2R29H 1IKFL 4X6DF 3VFGH 5T3XL 4HUVB 1BJ8A 1FVDB 1OB1A 3QUZB 5M95B 1U8OB 1FFRA 3DVIA 5I0ZA 3MJ7B 3RZWA 2A9NL 5B8CA 1P7KB 1MIML 2F53B 2UWEB 1XR9B 4UINL 3KYOB 2X89D 4NT6A 3U4BH 3BE1H 4X4MA 1FO0A 3L5JA 2DQFA 5DZNA 2IPTL 1CGYA 1WBYB 2GQHA 3N85L 4XTRD 4P9ML 1FG9C 1BQSA 4MXWL 4ZFZA 3A6BH 3RGVC 1AGEA 1KGCE 4D8PA 5EZOL 4M8QB 4DQOL 3FFDA 3QXDB 1DCLA 2G9HA 3ABZA 2W65A 4KHXL 4HHAB 4AZ8A 4OQTH 1T7WA 4X6EA 1G6VK 4R26H 5JOFB 1RAMA 1KTLA 4JM2F 3V6FB 1S7UB 3MODL 1CQKA 5MP6L 1DLHB 3JUYA 3T0WA 4RZCB 4YEEA 5DUMH 4XBPA 4OJFH 1YPZB 5IVZA 3U2SA 1UCBH 3HI1A 4HWEL 2ZUVA 4JY6A 2A77L 4NRZB 4JCMA 5TPWH 3QA3A 5E6IB 1ITCA 4XMPL 3VWJD 2CJUL 2VIRB 5FO7B 1PSKL 1N6UA 1T89C 2PO6D 1G0XA 4O58L 5GRZA 2P5EA 2MJWA 2HFFA 4X6CA 2L7UA 3DGGB 4LDEB 4LCUA 1XR9A 4S1QL 5ICYB 1PYWA 3L3OB 1ZKAA 2OL3H 5JW4Q 2EYSA 2J8UF 1DQJA 2E8ZA 4YDVA 5LG1A 4LSTL 4X80H 1F6AA 1OLLA 3H3PH 1FV1A 2A6JA 4WEMB 3BQUD 2FGWL 5KVMC 1WIUA 3QFJA 1Q38A 4NQED 4D0BB 4MNQA 1DBKH 5HJ3A 4K8RH 2D7OA 4L9LC 5D2LA 1NMBL 2CRIA 4RX4A 2V2WA 4NRYB 1YEDA 2VR4A 2W59A 2AJSH 4NP4H 1CGXA 3RWGA 5JLZA 2BRQA 4NYLA 3QHFL 3T0VA 4NZUL 1S7RB 1CD1A 3QEUB 3BGAA 3BZFA 4UQ3B 2R0ZL 2YD6A 1ONQA 4QRRE 1T2JA 3DETD 4UAOB 5D72L 3EKCA 5JOPE 4KTDH 1UC6A 1N4XH 3PP4H 4IIQC 4LLYB 3V5HB 4M43L 1SEBA 4HLZG 1U8NB 2MHAB 4RAUA 5GZNC 5K59F 1WITA 2OZ4A 1GGUA 1LGVA 3MJ7A 1CQYA 4M7LT 3MRKA 5I30L 1G7MA 1VGKB 2QBWA 4OGYH 3DLQR 4AY0A 1ZT4A 1DN2A 3MLSH 3ULUE 3U36A 1KC5H 5D1ZB 4MNGE 4MD5A 4PJDF 1KJ2A 4EIZC 4BSJA 1X5YA 4NHUB 1AO7B 4GRWH 1AE6L 5L88L 5HJ3B 1HKFA 1T1ZB 3CDFA 2FR4A 4LLVB 5F8QC 4X83A 5EO1B 1INEL 3NH7L 5E0QA 3SDDD 3IJSB 5CJOH 3QUMB 5CHNA 2EDXA 4XPAL 2YPKA 4DJMA 2ID5A 3I3BA 4PRDA 1ND0A 5CJQL 4HJJH 2VWEC 3KNBB 4PD4J 2DAVA 5IB3B 1KIQB 1NC4D 3Q1SL 1RZJC 3SE3A 4HMEA 1ES0A 1AXSA 5CCKH 3VRLE 3IFLL 3ARBB 5I1HH 1SY6H 2X6MA 3UTZA 4TSBH 4MJ2A 4M1CC 4UMGA 4TULH 3UYPA 1MQ8A 1X4YA 2DQGL 5F71A 3GO1H 1ORSA 1P9MA 1UGNA 4Y4FC 2NTSP 4XNZC 2Y06H 4JRYB 2C1OA 3F58L 3X14A 3C87A 1KPUA 1BD2A 3DVNA 5FYKL 3KPOA 2IH3B 4HPOL 4ZO9A 4JFFD 4W70A 1P9MC 3WD5H 2VDKH 4UBDD 5T5NF 3RVWC 3DECA 1KCUL 5B3JF 2D7MA 2V9TA 4O02H 4MCZB 2K7QA 3VGDA 2SEBB 4OIAA 4QRQA 5J57B 3D85A 3H8NA 2CKBB 3M45A 3QO1A 5HHMB 3X3FL 3QCVL 4LQFL 3KG5A 3QH3B 1DBBL 4XRCA 3NFPB 1I9RL 5C0BB 3QAZC 3JSSA 1YNTA 3GSRA 2JJWA 4PJGB 1RI8A 4K3EL 4FABL 5DQ9A 2YPKB 4M7LH 4PFEA 4EUPH 1Q1JH 4LPVA 3B43A 3MRLA 4OBSA 3QG7H 1C7TA 4QRPE 1T4KA 1MRDH 4TPRL 4U6YA 5J9PB 4QKXB 2X4QB 1ADQL 5KN5B 4CN1A 1QBMH 3VDBA 4YFDB 3W2DL 4NO3A 3SJVD 3LHPH 5F9JB 1FE8L 2D9CA 3HZYB 1KELH 4J3OC 5F96L 3GI8L 1J05A 1BVLB 2VUOA 4NQVB 5CLWA 5EUKB 3C2AH 5GGSY 4N8CH 1NAMH 4UT6L 3FO9A 1YNLL 2AK1L 3GSNA 1KPRA 3BHBB 3QJHA 4UINH 3CFKB 1WEJH 1N0XL 3BVNA 4RRPG 1CFNB 1JTOA 5BQ7A 5CEZL 3OR7A 2Y25A 4HJ0D 4XAKD 4ETQB 4N0YL 5GQBA 2AXJA 1FFPB 5IHBA 3FT3A 5KSVA 5FEBA 3GBMH 3NFNA 4XCYB 3ZDYF 4UUJA 2H2PC 4NO0D 4P5MB 3R8QA 3UTPD 3W5NA 5IQ7H 2ATKB 3HRZB 3JV4B 4BSWB 3PP3H 3HFML 3VRJA 4Z0BL 5JNYA 1CFSB 3GSXB 2VITA 5FHAL 4EJ1C 4OLYH 3BZFB 4K71B 2R1XB 1JNLH 3FO9B 3S4SB 4XHQA 5D70L 1TQBC 3V0VA 4M48H 2QQLL 2Q3ZA 3HPJA 4G8GA 3HPLA 1G7HA 1R3LA 2G75B 5TQ2L 3P4LA 4JQXA 3MNWB 1U2HA 1H5BB 3P4MA 1HHJB 4PG2A 5TDPB 4C83B 4ODUA 1YEEL 5GJSL 2X4QA 4LIQH 5GSRB 1MCHA 4HFWB 5F89A 4KJYB 1PX4A 4M62L 4UB0H 4X7FC 2CLZA 1FL6A 1JMZA 4MJ5A 3GNML 2ORBH 2D7NA 3MJ9A 4U3CA 3CC5B 3CVHB 5C0AD 3EW3B 1YEHH 4OKVB 2I07B 3CH1A 3HZMA 5FGRA 4LRIA 3BQUA 5JQHC 3T3PE 1IJ9A 4NRXA 2R4SH 2QSCH 4U2YA 1IGYB 1MI5D 3HNVL 1S9KC 3ULVL 5C08A 3ZKMD 4M7ZB 4UTAL 4AH2A 4GW1B 2BHZA 5IJKA 4JGJA 5LGKA 1CU4H 2B8OT 4IHOB 2OP4H 4WV1A 4XNXH 2HJLA 1I7RA 2E27H 1DZBA 2OCFD 4OCSH 4UU9B 3V79C 1A6ZA 1FIGH 3FQWB 4NRXB 1BMGA 1N0XH 1VEOA 4LP4A 5D72H 2DF3A 5CIPH 1KLUA 3ZE1F 3QHZH 4HWZA 5BXFA 2OI9C 6FABL 4YDKH 2VDRL 4H8WH 5L2KA 4PJCB 2OTUA 2DWEA 2BVQB 4HXAH 1TPXC 4RBPK 3RWJB 4J3SA 3VDAA 1AJ7L 3HC4H 2OQJA 2B7DT 5C0JA 2GJZB 2D03L 1MI5B 1KCUH 4ODUB 5EZLA 2FEEI 4NC1C 3GGWA 3VG0L 4NT6B 1J1XH 2VQTA 2IMMA 2PCPB 5LGHL 4M7LL 4NQDB 4NJAH 4WO4A 2J5LC 5TF0A 5FF6B 4OLXL 4TUKH 5HGAB 1BHGA 2CR6A 1QLFA 4P46D 5FA4B 2HTLC 3IJSA 4GW5A 1PKQA 4S1QH 4WI4A 3W39B 3ROLA 4GAYB 1NGZB 1TJIL 4MMXC 3TZVB 4P23B 3TVMB 1BFVH 1FH5H 4O51B 3PV6B 3ILQC 4HH9B 1YEKL 3STZA 3ZYOA 5SWSE 4AIZB 4H1LG 1TIUA 3UTTA 5C70A 1LO0H 3BSZL 4BFEA 5JDJA 3SCMA 1NDGA 5TF1L 1IEBA 1FLRH 3MRJB 4JZOB 3HNVH 4E41E 2EDTA 3ARGC 3F6IA 2IALB 1JYXA 3SKJL 5HYJB 1KCLA 5CKGA 5CD5C 1F58L 5DR5L 1QPPA 5EC2B 1YDPB 1FFQA 2XKNB 3GSVA 3R1GL 1D5MA 3B83A 5ILTH 2WIIA 4P3CH 1L6XA 4OF3A 4OLWH 3KNBA 4Y4KB 1R5WB 2IPTH 3BEWB 1VEPA 2OLDA 2YSSA 4FZEH 1YZZA 4OV6F 4ZG1A 4GBXB 2Q7YA 1X4XA 3UC0L 5FYLH 3HE7A 4A6YH 3MBEC 1G1YA 4HUXA 3MMEB 1ZGLA 2I9LB 5I1LA 1J0IA 1JFQH 4ODSH 2VLKA 2OJEA 4XRCB 2P5WA 3P4OA 4S1DD 3MBEB 1FRGH 3VXSB 3HR6A 2VUYA 5AEAA 4Y5VA 2FRGP 5KZCD 4OCMC 3FHQA 1J11A 2WLZA 3O6FC 3O6FA 4PGEB 1BX2A 3QBTB 2BVYA 2FH8A 1HXYB 1IGFH 3D18A 4X5WB 3MBED 4KKNA 3H7LA 2BCKA 4PRID 2A6IA 2A0LC 1C5DA 3IRPX 4RGNC 1JI1A 2YZ8A 3KR3L 5T3ZE 5DJXA 3QIBA 3RNKB 2CUMA 3MA7A 4P9HH 2VL5A 5C9KA 5CJXA 4HIEA 4XGZB 2BNQD 3C08L 5E5MA 3L95A 3U9PL 3CX5K 1U3HB 2FIKB 4ZUWA 1QBLH 4FFZH 4JFFB 2YMXL 2JIXA 2N1KA 3UJIH 1JHTA 2ADJB 5DJ0A 5GS3A 3QCUL 2OTPA 5T1MB 3VGAC 2VLMD 5BO1L 2HKHL 1XZ0B 2FL5B 1LE9A 2BNUB 3FT4B 3C9NA 5DJAB 4KUZH 4FQJL 4FNLH 2VXTL 5AWNH 1A7PL 1UZ8B 3RDTD 3VFTA 3KGRA 5SWZB 3T0EC 1AQDA 1MCPL 1PEWA 5DMGD 5ICXB 1QQDB 1UACL 3ZTJH 5L6YL 1FCGA 2NY0B 4QNPF 5KSAA 2NR6D 2P5EE 4BFGA 1F3DJ 3MLTB 1CICC 3L5XL 1IAKB 3L3JB 3C60C 4Y1AB 5BMFH 2BNRB 2MNUA 1AC6A 1N8ZB 1DN0A 5GS0C 3H9SD 4KHTL 3C8KB 1RSFA 1MCRA 4L8BA 4P46B 3HI5H 2NY4B 1EO8L 4LNRB 4O4YL 1HILA 4RCAA 3VFPB 2DI8A 4RMUA 4MJID 3WLWD 2YK1H 3U7WL 4L3EA 1AR1C 2A83B 2CDGB 1QLRA 2UYLB 4IMKA 4YHMH 2D31B 4ZAKB 3SDDB 3E3QC 1NANI 1B0WA 4QRRD 1K9TA 4DUVA 2BNQE 1G7QA 3RI5F 3L3GB 1S7XB 2P1YA 4MA8L 1G84A 3TNNA 3BGMA 4JN2B 4JFDB 3CFIC 2BOCA 3NFSH 1VESA 3BGFC 2BVTA 2Z0BA 3WL9B 5IHUL 3FFDB 1GOFA 1SBSH 1C08A 2BRRL 2FZ3B 4GBXC 4Z0XB 1I7TB 2P42B 2KPNA 4MJ4A 4YHIA 3KWWB 2MQ3A 1RZJL 3O6FB 4CRPA 4G7YH 1X6LA 4PY7A 5IROA 2CIIA 1A6TA 1FNHA 3HG1E 1JMXA 3STLA 1LEGB 4G80A 5DK2A 4HULB 3C5ZC 1SJVA 3T3ME 1NANH 1YC8A 4N1EA 5T1DL 1CGWA 3MPCA 1Q8MA 4M7JH 2IMNA 3FB5A 3P73A 3MV8D 1IQDB 4IJ3C 4OUUB 1R5WA 2PCPA 3EFFB 5EOTA 3TO4D 1MREH 3REWB 3IDMB 3DX9A 3VA2C 3F62A 2BNRD 4M5YH 1JHTB 2ADJA 3IFNL 3O2DH 4Z7WB 4QRPD 2H6PB 4LIQE 1I1RA 2Z91A 5K9QG 4QLRA 5A3ID 1Q94B 2FJHA 3KJ6H 4PJCA 5HYJA 5HHOD 4XPTH 3MNZA 3ULUL 4FRWA 4ZUSA 1MAJA 4LEOA 1YNKL 4X5LA 3ARZA 4QHUA 3OJDB 5JIIA 4TOYL 2Z8SA 4Z77A 1NFKA 5K9JH 5E94A 4PJ9B 5CFHA 1FPTH 2F8OA 1JTTA 5CJ8A 2H3NB 3QQ4A 3O11B 2E8YA 1CDHA 2DI9A 3L3JA 1I3GL 5C0BD 3ULUD 4O58H 4NN6C 4X6BA 5HDQH 3SKNA 1QNZH 1HHHB 3MJ9H 4KDVA 4P9HC 4HFUH 1OY3B 4YXHH 1VEMA 3ROLB 5C08B 1IZJA 5B21A 3VXQA 2BXYA 4OD2B 1HZHH 2E5EA 1T7ZA 4U1KB 1FCCA 3FO1B 4L29B 4X6CF 5IHLB 2OK0H 1EGJH 2VYRE 4HC1H 1PVHA 1WT5A 2D9QB 4PB0H 1UJ3C 5I8KH 5KTEL 1CYGA 2I26N 3PHQB 4OFIA 1UXWB 1I1YA 4WCYH 1D9KA 4DGVH 3L3IA 2CLZB 1EXUA 5IVXB 4LSVH 4M7ZC 5DHVB 3BDYL 3G6JB 1ZXQA 4KMLB 2VR9A 2NXYC 2VXQH 2J4WH 2ADFL 3BIAX 2EIDA 1AJ7H 4Q9RL 1F4YH 3RWFB 3ZKXB 1F11A 1R6VA 1QACA 3DETC 3X3GH 1F4WL 2NY2C 5C07A 4Y5XB 5KG9A 2X4OB 3D6GA 3MCKB 1T2QL 5E8PA 2XQBH 5JA9A 2AJVL 2HJLB 3MREA 1I1CA 5IMMA 1NH6A 4HLJA 1I1FB 1PLGH 4BQBA 3IDIB 4P4RB 1X5KA 1EBAA 3QWOA 4C57C 3HR5B 5BZDA 5D2LE 1FSKC 2JE8A 4EDXB 1NAKL 5T1KB 2XYCA 2AEQH 2IAMD 3V0AC 3GSUA 4CDHA 3O8XA 4D2NA 5EBGA 1T1WA 4RA3A 4NZDA 3ET9F 5EBLA 4N1HB 4ZFGL 3OHXB 5E8DL 3WO4C 4MQSB 3DV4B 1IGCL 4HJGB 4QT5A 1CD8A 2ILLA 4J3WA 1S7TB 4PJDA 5SX5K 1GHFL 2NY6B 1DQDH 3I6KB 3BP5B 4QRPA 3PGDB 5CEZE 2PYFB 1CZ8H 2GCYB 3GHBL 4M1GH 1J88A 4YBQD 1LD