2Z31C

Crystal structure of immune receptor complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
181
structure length
181
Chain Sequence
IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFAQLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLLGQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLSYLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell receptor alpha-chain
publication title Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 31
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2007-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
C PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2z31C02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2z31C01
3RGVD 1EO8H 4NQDB 3BH9B 4OF6A 5EUOF 1NCNA 2VZTA 2CXGA 2VYRE 4EUPH 1MCLA 5J13B 1BM3L 5SWSD 3X13A 2VN4A 4LIQH 5I1GL 4G7VH 3QCTL 1KPUB 3CFBB 1A4JB 2DLGA 3D3VB 3FO0H 3MNWA 2GY7B 1IGCL 3OAZK 4G3YL 5TE7L 1QACA 3MACL 2ZUSA 3QXAA 1EFXB 4L5FL 4O5LH 3CDFA 3KPRB 4YUEL 4X9GA 25C8H 4MJ6A 4WHDA 4F9PA 4XB8A 4K71C 3BQUB 4OZGA 5IB4B 4WFHD 1BOGB 1L6ZA 2AV1A 3IETB 1VFUA 5E6ZA 1KTRL 1XGTB 5IVXA 5J57B 4GSDL 2B5IC 4OZHA 1DUZB 3ULSA 1PSKH 4QCIB 1YNTA 5GJSL 3KPOA 4M9PA 4JDTH 1N3NB 1LDPL 1K6QH 1CLCA 1NANH 3TH3T 3CH8A 5T3ZD 4O58H 1WZMA 2UY7A 5GGVH 1RU9H 3GSOB 4NP4L 1KLUB 1M1SA 1RUMH 4XMKH 3S5LB 3JUZA 1XGYL 1S7TB 2F53D 4YDJB 4LSSL 4KZDH 4M3JA 2H9GA 4OUOA 1FCGA 3MLXH 4UT7H 5EO0A 1CICD 3B5HA 4K9EH 4NRZA 4FTVD 1S78C 3C09C 5JHLL 1CLZH 5FK9B 1QO3A 2B1HH 4IS6B 1IKNC 3IJYB 4ETQB 2GJ6A 4NO2B 4NJ9L 1YYMH 3L5IA 4C54A 3QUXC 1VEPA 4DFIA 4GBXB 4KI1A 1R3KA 2NY4D 4FMKA 4LVOB 4BSVB 3JBG7 1PBYA 3C60A 1ADQH 5CGTA 1WT5C 3HPJA 3L3HA 1MLCB 5CEZL 4OFDA 5ICZB 4NQVB 1ZLWK 4WFFD 1A6AB 3ZSTA 5T1MB 3S37H 4JY5H 3NH7H 1U2HA 1FP5A 3RKDC 2NPLX 3D39E 3OHXA 4QRTA 5SX5H 3MCLL 4ZAKA 2P5WE 3OV6A 3BP4B 3LH2H 1NGYB 2ESVE 3BKYH 4GW1A 3BXNA 3C5ZA 3MV8E 4KPHH 1BQUA 5FA3B 3ILPB 4F7PA 4A6YB 2PO6A 4PRHA 2NR6C 4GJTB 4UINH 4PJIE 4I0PA 4L3AA 4R9HA 1LNUB 1NC4A 2NY3C 5KVEH 1NAMH 3MRCB 4PLNC 5ICYB 1P9MC 4NFDA 1A22B 3V6FB 4GAGL 4MZ3A 4YHLL 5SV4A 1OGAA 3OKMA 4FG6C 3C2SA 3WE6B 4N5EC 2ZUVA 1FE8H 5DK0B 4K23H 1CF8H 3N85L 5DSCA 4ZUSA 3LD8C 3K81A 2XTJC 3FB5A 2A77L 3BEWA 4NWUH 2FH8A 3VRLF 4MNGB 2ERJB 4PRNB 2NY2C 1ITBB 2YD9A 3IF1B 1Y0LA 3LEVL 4XNMA 2FIKA 3KPQB 1H3XA 1X5XA 4LDLB 1DBBL 1Q0YH 4N68A 5DMKA 1I7ZA 5T3XE 4F7CA 5EDXA 3CSPA 1NAKL 5IF0B 1DTUA 3VXMA 3HC3H 2H32H 1R5WB 2WP3O 2VZVA 4KY1L 4WW2F 1KXQE 3N06B 1U8LA 2A9NH 4MXQC 3S4SG 4I3GA 3ZMRA 5I8EB 1ZS8A 4ODSH 4NN6B 4GW5B 2F74A 5LG1A 2NW3A 3RUGA 4P2RB 1RVFL 1ETZA 4KGJA 4UZGA 4LQFH 3H3KA 5I74C 2X89D 3NGBB 3VXRD 4NNPH 3GSXA 2R4SL 4Y4KD 4TUJA 4I2XE 5IWLA 3C6LD 1AXSA 3DRTA 3EDKA 5DFTA 1JWSB 3GSNB 3NACH 5SX5K 5DJ0A 4RGMC 4X7SH 4O51A 2QKIA 4P5MA 5JA9A 1JPGA 3WMSA 3Q6FA 3QFJA 3ARGC 1ADQA 4LSVH 3TZVB 3MRIA 5I1IH 5IMOB 1M7XA 3Q6GL 5DR5H 1DQLH 5F93C 3STZA 3QUKA 4X6FA 3CFDB 5F88B 3EOYG 5GGTL 5BXFA 3F58L 3DJ9A 3OKKA 4PJ8B 5KVFH 4CMMB 4G9DB 4JPIB 3ZO0A 5L2JA 3ZKXB 4OCRL 2BOBA 5DTFA 3HA0A 4ZSOB 1OB1A 3MV7A 4KZEH 4FQQA 5KN5A 4H1LG 2IH3B 2OXHA 5KVGH 3CFJB 4H20L 1F4WL 3HUJA 4Z95L 1CGWA 4KK8C 2J2ZA 4N0YL 4TUKH 5HHXH 3UDWC 4OLEA 1T1WA 1MFAL 4XVTL 1YNKL 3WDHA 3NCCB 1OP3K 4JDVA 2FX9H 3V5HB 4JFOB 4LVHB 1WBXA 2A6DB 3GUTA 3PWLB 3D18A 4GO6B 2O5YL 2G60L 3GMRA 3T3PF 1WCQA 1CTOA 5C0CE 2IJ0C 2ADFH 3TBWA 4BSWA 4XAWL 4NFCA 2FEDD 5DI8A 5HGBB 3S88H 2DQJH 2XG5A 4ONGL 5HY9A 3BPNC 5F7WC 4IRSA 3MUGA 4WFEE 5HYJB 4PY8I 1YMMB 4WCYL 4X7CC 4XNYH 4ZYKB 3PP3H 5D72L 3T65A 1MIEH 1G0YR 1AQDB 4I0KA 4OGYL 4M5YH 4S11A 5FGCB 5IEHA 43C9B 5EZOH 3UPRA 1BLNA 5JXEC 4R26H 4MA1C 3L3JA 3WD5H 4YHNB 4UTBL 3KWWB 1QSFB 2CKNA 3LQAH 1NMAL 3D5OF 1A5FL 2EO9A 5E6YA 2ARJA 4P5KA 1CT8B 3K4ZA 3MODL 3QZWG 5E6IB 1NCWH 4OKVA 4ZTOH 4W6XB 1INEL 1FC2D 2F19H 3KPLB 5LGHL 5E0QA 4HXBH 4DZBA 5E2UL 2W0LA 1QSVA 5IT2H 1ZHLA 4M4PA 1QSEA 4I18B 4DTGH 1BIIB 4HS6A 5BCAA 4UI2A 2X4OA 4S1QH 2VR9A 5J9PA 1UH2A 3MBXH 1MFNA 1QHOA 4MNQA 4LRIC 5DD3H 2O26U 1C16A 2FLBT 1JYNA 2F54E 3DWTA 5HPMB 3KDMB 3LPGA 5INCB 5GS0D 5F9WC 3MV8D 3X3GL 5I18H 2I60L 1SJHA 1PD6A 2HKHL 1B3JA 2DD8L 2WLZA 4K8RH 3HMXH 4PJXF 2VLRE 2C3GA 4M7LH 5D1XB 1DLHA 2CJUL 2FBJH 2Q3AA 4GRWF 4F3FA 1S7WA 3SBWA 1FVDB 3PDDA 3RGVC 2E7HA 4W4NA 2X4PB 4LHJB 4KTEH 1AIFB 4FMFA 3DMMC 4U7MA 2WWMC 2XKNA 3HE6B 3IFNL 5GGSA 3QEGH 5IJVB 4UU9A 4N1CA 5GS3A 4U1KA 1CU4L 1DBAH 3P9LB 4XWOC 1C5CL 4LIQE 3H9ZA 3TPUA 4NRYA 15C8H 3MFGB 5FB8A 3I85A 5JTWA 4ZXBA 5EFIB 1R3JA 1PG7H 2GIYA 4AEHH 3KNBA 3O8XB 2VTFA 5EUOA 4HS3B 5F89A 3J7HA 2OQJB 3PP3K 3Q1SH 5KG9A 1TJGH 1MI5D 5F3HA 3BESR 1J1OH 1NFIA 5IMLA 1Z3GL 4WIQA 3QNXA 2OSLB 4LSTH 1JV5A 2YA2A 2R23A 5IW1A 4OCWH 3IFPA 3N0PB 1JZ8A 3WFCH 1XGUB 4PLJC 4NZUH 4FP8H 2BJML 1NEZG 5KAQF 4JFDA 2Z4QB 4D8PB 1XCTB 3VD7A 4WI7A 1WISA 1Z5LB 1KTLB 3O6LH 3F7VB 4YFEA 5DFWH 5ADPL 4Y4HA 5EU6A 2FGWL 3CFIC 4QOKD 2HMIC 4LARL 4Y4FD 3DX8B 2ZZUT 2D7QA 3GJFB 1MRCH 4FQ2H 4LCWB 4HJGA 4OCLC 5CIPH 1LO5B 4K71B 4Z7UA 1F2QA 4G6KL 4QLRA 3GMMA 2P8MA 2IPKB 4Q2ZB 3VW3L 4FHBD 1QBML 1A6VH 3D9AL 1UB6A 3NFNB 2E9JA 1JL8A 1XF3B 4NRXA 2ATPA 2X1PA 4P2QB 2D03H 2W9EL 4GRLA 1L0QA 5JZ7C 5KTEH 1JNNH 3SDAD 5IBLD 4EDWH 1RQ5A 2AJXL 5F9JA 2EE3A 2ZOLB 3BN3B 1TCRB 4ODTL 4JRXE 2DJ4A 4NC1E 5FYKD 5BZDB 3VWJC 3ARFA 4WJ5A 2ADIA 2RBLA 5DXWA 1MCJA 32C2A 3G6DL 3I02A 3KPPA 2QLVB 2E9IA 4F8TA 3FB6B 1GIGL 3C09B 4D9QE 2CRYA 3GKWL 3U4AA 1F11B 2XWTA 4Z7VF 3BI9X 4XPFH 4PFEA 3SKJL 3E6HA 2VQ1A 4W6WB 2V2WA 2HFGH 4PRPA 1T03H 1W0VB 3TM6A 4LASL 5CZKA 1D6EA 3LSOB 3BAEL 1IEAB 3VFSA 1QBBA 1PX3A 4ZS6C 4EJ1C 3SQOL 1ZT7B 3HE7A 3BRDA 1PKOA 5DVKA 2BVQA 5D71H 5J11C 1HINL 4WWKA 5LGJA 4HLJA 3OXSA 1A7RL 2BCKA 5EOCJ 1KENH 3RQ3A 3DRQA 3V7MA 4C4KO 4QXTA 4JKWA 2DWEB 3OKOB 5C6TL 5GRVL 5BOZG 4OZFB 4MJ5B 2ZG3A 4IOSD 3KPSA 4ZQKA 1HIML 1AKJA 4P4RA 4HULB 3VGEA 4LMQE 5E2TH 5B3NA 3RTQC 1ACYH 3LN5B 4Z0XB 2HLAA 3CDGB 3FRPG 5ESVB 1BGXL 3VXUB 2NY3B 1WICA 1ZHNB 3MUZ1 4M8QB 4WO4C 5T1KA 4XBEL 2DTSA 5E9DB 1ZHKB 3L3DA 2V7HA 3MRHB 4KJWC 5JO5A 8FABB 5E8DH 2R56L 4YBHA 3BGFC 2GJ6D 3B3IB 3T8XA 4LCYA 4U3XA 5HDBF 2DLFL 4NQEB 3RPIB 1KEML 4ENEC 5CIPA 5EC1B 5DUBB 4JZOB 4KI5F 5BRZE 4S1RH 1S8DB 3C60D 1AGDA 3HZVA 2YPVL 2ILLA 5L7XL 3K8KA 3H9YA 4I3SL 3ILQD 3GSWA 5T3ZL 3G08A 4JR9H 5HGDB 4NKQB 1ZT1B 5JQ6H 5D7JA 2FGZA 4Y19B 4WW2A 4F8QA 3MRGB 4ZAKD 3EFFB 3ARSA 4GAFB 5I19H 3DXAB 5C08B 3MO1B 4PJEB 5I76A 3QDMA 4K94L 5DC4B 5FCUL 1QRNE 4HKBA 5TFSL 1HH6A 4OLWL 5T33L 5HHMB 3C5ZD 3LHPH 4P3CL 3JWDH 4OI8A 4HX1A 2C3HA 4L8CA 2PO6D 2YKLL 1UQSB 2WBKA 7FABH 2VNCA 3PXHA 4YBQD 5CMAB 1DBML 4I0PD 4KHXL 4ZD3H 4DAGL 3KLAB 1NC4D 4S1SH 3RZCB 1F3JB 3KHOA 3QFDA 1IM9A 5I74B 2UZXB 4LPVA 4EN3C 2WINA 1FNGB 3V7AG 3QULB 1AP2B 3SE3A 1NUGA 1KC5H 4YHIA 3O41B 4L4VB 2B39A 1OGAD 4EKXA 5DQDL 1AC6A 1J0IA 5EWIH 4Z78B 4WFGE 4BFGA 2J4WL 3RA7H 4I4WB 3IAGC 3DSNA 3ROLA 1QFUH 2VXUH 4HUVA 3ALPA 1T2JA 5EU4B 5EZJB 1KFAL 5IBTH 4GRWH 3WFHA 1HH9B 5DJDA 1B4JL 4PGBB 3LV3A 1MCBA 4Y2DA 4AL8L 4JCLA 1XR9B 1YN7B 2FL5B 1Z0NA 1X9QA 3VFVB 5DUPH 3QQ3A 3CXDL 3VXMD 5HYSA 4X4ME 3OZ9H 3B2UD 4ZO8A 3QG6B 1NLDL 3LQMA 1OGTA 3C6SA 4M6AA 2DQCL 4MCYA 5DWUL 5FM8A 5FM4A 3T0BA 2DBJA 2QQLL 1LE5B 1IAOB 5DEFA 4XNZC 4IIQA 3LN4A 4J6RL 4OD1H 5C1MB 4D0DA 1EJOH 4PJCF 2O61B 4CJ0A 3U0PB 3ZE0F 1WIUA 2PN5A 3MRLA 3GKZA 1INQA 3QIUB 4FFYL 4M03A 1DCLA 1S9XB 5FA4A 1XF5A 3G5VB 1CFNA 1P4LA 4TNWF 2W65B 3U0TB 2WIMA 5CAYB 3FL7A 3TA3B 4GG6F 3V6OA 2NZ9C 2YN5A 1JUFB 3QFJD 1T22A 4GW4B 3QDGE 3BPNB 4JQIL 4MAYA 5B3JE 5I73C 5D9SB 3IJHB 5C0RH 1C5DA 1CDYA 5CINL 3UO1L 5INDB 2DWDA 1QG3A 2K7PA 1B88A 2XT1B 3V6ZB 2VC2L 3HRZA 5HGAA 2ICEA 4FZ8L 2NY1D 1H9VA 4K7PL 5E5MA 4MA1B 4MD4A 3MV7D 1QBLH 1A7BA 3TEUA 4P9HC 3FQUA 1GXEA 4DFHA 4HGMA 2EDXA 2Z8SA 4G6ML 2VLJA 2H45A 1EDQA 1O5DT 5EORH 3JWOC 1OQOA 3C2AH 4RFOH 5FOBB 2ZSVA 4HUNB 1DVFC 4OV5A 3GRWA 5DJZA 5FUZL 4ODXB 1T1YB 1DFBL 1VFAB 4I77L 1H5BC 2R1XA 5EUKB 3U9UA 3N1GC 5FYKU 1A6ZB 4BZYA 4IHOA 4N90D 4MJIB 4LCCC 4B41A 3MPCA 1N8ZB 1U9KA 3HPLB 4NO5A 4UNTA 1CD1A 1ZKAA 5EC2A 3U7WL 3I9GL 2LQRA 1OW0C 5TDNA 3BHBA 4PGDA 1YNLL 5F9WB 3TESA 2FCBA 1KIUA 2XRAH 2AXFA 1BMGA 5JIHA 2RCSL 5JHDE 4LLUA 3WUWB 1LD9B 5ACLA 2XN9A 4YR6A 1WFOA 4IRSD 1FBIL 3ARVA 4G80A 3O4LA 3RGVB 4WI2A 1GZQB 1HQ4A 1FIEA 4NNXA 4RISH 5KSBE 4KDTC 1G0DA 4WI9A 1A1OB 5HHPA 1YEDB 3AM8C 4JFQA 1RHHA 3O2WH 2CLRB 3DMMB 1KPRA 5SWSB 3F6IA 1CVSC 2VE6A 1HK6A 5C0IA 5LQBH 4RWYH 3MTRA 4U0RC 4PG2A 2I07B 2YD7A 3G6AA 3UTOA 2P8LA 5E94B 4IRZL 4RMWA 2BDNL 4OD2B 5C07A 4JFFB 2AK4A 2JB5L 3VRLE 1A02N 3DO7B 4NUJB 4JY6A 2FYYB 5D7KE 3U7YH 1UC6A 3QUYC 1SYSB 1MHCB 1FN4B 2CK2A 1LQSR 4RA3A 4MNQD 3OG4B 1A14H 3ZYZA 3OR7B 3QUML 5D7IE 5DLML 5TQ2H 3K2UH 4LAQL 5FM5O 3M1BB 3CX2A 1WVZA 3FN3A 1SBBA 1FGVL 2X1OA 2FD6L 1KB9K 1ZT4B 2F53B 5AEAA 1RUKH 1RAMA 4EBQL 2NXYC 5IB5A 1IC7H 3ZTJG 3MRJB 1HZHH 2VLMD 4FTVB 3TYFA 1KJMB 1D5IL 3MLZL 4J23A 4XTRD 4I3RH 2A73A 4YHPA 3RY6C 2A6JB 3HZYA 4I9WE 4JLRA 2EDQA 2ZPKL 4ZFZB 1R5IA 2AK1H 2XIDA 4QXUH 2I27N 4HH9A 4PJ7F 2XKSA 2BNQE 5CEYB 4Y5VC 5HI3D 3LKQB 5JOFB 3QHFH 3BO8A 4ZXBD 5GS0L 5EULV 3OXRA 4NQUA 2Y36H 2D2OA 2ZKHL 3WS3B 1FNSL 4YHML 1RY7B 4LU5L 4ONHA 3FT4A 2DLHA 1YDPA 4YNYB 3VWJB 4QTIL 5EZIH 3WFDH 1NGWB 4Z7VA 5AUMA 3BP6B 4QRRE 4RRPG 4C56B 2HH0H 4D2NA 5GZOC 3X14B 1RI8A 4E5XB 4ELMB 1IT9L 1NBQA 4XCCL 5AZ2H 3VXSA 4ZFGL 1YY8B 4HD9A 1GOGA 1E4WL 3DO3A 4NZJA 5CHNB 5F7NC 3V5DB 3MLSH 1U8KB 4JFDD 3EYOA 3A6CH 4OV6F 3S36X 1E0OB 4Y4HD 3GNMH 5EU6D 4OF0A 1KB9J 4Z5RA 4LNRA 4YGVB 2RIKA 4X4YB 1KPVB 1R5VA 3BN9D 1FNEA 3PNWB 3UCRA 1S7XB 4U1GC 2NNAA 1HHIB 1TZIA 4NT6B 3NIGE 1GPOL 3CC5B 2AABH 3SGEH 4GRLD 2R0LL 3KR3H 1GYAA 3RBGA 1QP1A 3L5XL 2R0WL 1UG9A 5HHQA 4Q9RH 5EO9A 1QFWH 1RUAL 5DGQA 5F9OL 5KS9F 3RTQB 5F21B 1AGCA 3TFKD 1NBYB 3UZQA 4D0BB 4GMTH 2X4QA 3ARFD 2IGFL 4HQQH 4WO4B 4K8RD 2VR5A 3OJDA 3AAZA 4WU5A 4XMPH 5IESL 2Y25A 3MLTA 4L8DB 1TVHA 5DURB 3OJVC 5EH1A 4ISVB 1OSZB 5IHUH 1QR1B 2DM4A 3TBSA 3VFTB 3O9WD 1IGJA 4TSCL 2Q86B 4NM8H 1MFDL 2VXVH 2BC4A 3BGFB 3VFWB 2J8UF 4JG0H 1YMHB 5BV7C 4N0CD 5DD1H 3GI9L 3OL2A 4ODWA 1I8KB 5TE4L 5E4IA 2DI9A 1UWEH 3INUH 2B1AL 2QEJA 1DLFL 5DQJB 1I7RA 1B2WL 4XRCA 1K8DB 3EZJB 1VADA 1J1PL 2DAVA 4XZUB 3E1F1 1BD2A 3TCXA 3HE7D 1I3GL 1I1AC 5HHVL 3RWDB 1OPGH 4JKPH 3WDJA 2YD5A 4HUUA 4WWKD 1C1EH 4P48A 5EU3B 5FYKL 3W81A 2OTWB 3W9DA 2EEBA 1GVIA 4Y2OA 5DRNB 5DJXA 2NCMA 2YC1B 4P2OA 5EZLB 4FFZH 4PJXE 3WEXB 3E6FB 4F7EB 3KPSD 3OBAA 3CVHH 4PGJA 5DS8A 1M6OB 1AKJD 1U8PB 2AEPH 4P57B 4UAOC 3WKML 3D25B 5F7FA 4UUJB 3RWGA 2IANA 4ODHH 3MXWH 1MH5A 3HCVB 2F8VA 3JV5A 4W4OC 3TO2B 4XP6H 1PVHA 1E27A 3B9KC 3HNVL 2YSSB 3BGMB 4ZTPH 2PUQT 3B2UC 3BUTA 4IMKC 5T1KD 4XI5C 4CVZB 4X0KA 1WTGT 4QRPA 3GBNH 4OLUL 1K4CB 4G8IB 1CL7L 4RA0C 4XC3H 2AJYH 1T0NA 5TGBA 1N7ML 1FJ1A 1Y18A 4K9EC 2GTWA 3C08L 1MRFL 3DECA 5C0DA 4GG8A 2IG2H 1MCOL 1N6QH 1HDMA 2VH5H 3FMGH 2D4FA 4TVPL 5CP3H 1IC4H 5FYLE 4HJJL 1WIPA 4RGNE 2Z31A 2AK4E 1RMFH 5GJTL 2EDLA 2X42A 5D7JD 2GFBA 4YQXH 4L8SC 3RJDA 3PHSA 5L8JB 4LLMA 3HR6A 2I5YL 1ZTXL 1T3FA 1M7IB 3A6BH 2R4RH 3V0WL 1S5IL 4R2GC 5SX4I 4NC1C 3QDMD 5FDWA 2VXSL 4OJFL 4TNWK 1VA9A 3MUY1 2A74A 4HIIB 1RURH 1MNUH 1QPPA 2VAJA 5C0BA 3I6KA 2ITCB 5DJ8B 3QJHB 4XNZB 3S3SA 1Q72H 1P4BL 4AM0A 3CZJA 1ZK9A 1T83A 1IM9D 1NL0H 3CFEA 4GG6A 3IDGB 1ORSA 4P49A 1RZJL 3W82A 3I3DA 3HG1E 3HI5H 1LEGB 1BP3B 3QRFM 4NGHH 1ZANH 3RAJH 4BM7A 2AEWA 3G6JB 1G7QA 4MVBC 1S9WA 5DMIL 1BFTA 3D39B 2JTDA 5I73B 1IEHA 1GZPB 1ZGLP 3MRPB 2P5WB 3HC4H 2AI0L 4S0SD 1GJIA 2ZSWA 3VMOA 4KH2A 2XPGB 5B38B 1VKXA 3KJ4C 2ESVB 4Y2DD 4I5BA 4H0IA 3UTZB 1QVOB 2P5EA 1T89A 3P30H 5KSAC 3MV8B 3E3QE 4HWEH 3CVHA 4PJIB 1UZ8A 3AU1A 5J1AB 4PUBL 3O2VH 3QCUH 4Z7VE 4PJHF 2J8HA 4QRQB 3VGGA 1IEBA 2VJXA 4XWGH 3FO0L 1DVFB 1SJEB 1ES0A 5AYUH 1QKZH 5I2IB 1FZKA 1L7TL 4N9GB 1G7IA 2YXFA 2PW2B 4PRDA 5LJYH 1CDHA 4O5LL 2LAAA 5CP7A 3MNVB 3QXTA 25C8L 4LCCB 3FN0H 1KCRH 2LAGB 4L9LC 4OM0H 4NWTH 2V5TA 4ZDHB 1JTTA 5GGRA 5EOTA 3MOBH 4XP1H 4K7FA 5ELIA 1JI1A 2R2HB 4GKSB 4DGYH 3G04A 1YEKL 4JDTL 2XWBB 1K6QL 2EKSA 1RJCA 3QEHB 4MAYD 4MS8C 3ZZ1A 3DVNB 3IDMB 1VFMA 4HUMB 2VL5A 3EGSA 3FQWB 5I8CB 3MRDA 5CCKL 4LEXL 3MLXL 4PBWD 4W68A 1WJ3A 3ULVF 5MP6H 3TN0C 5BJTB 3NOIA 1ED3B 1EGJH 1AY1L 4IRJA 3VRIA 4U0RB 2VLJD 1KCUH 3MYJA 5TDPB 4CVWA 1ORQA 4PGCB 1DEEB 4E42A 3TT1L 5MHSE 4OF8A 1CXKA 2VUOA 1YYML 2PYFA 5HDBE 4IJ3C 4I2XB 4MA8H 2W38A 4OGXL 2XWJA 4YLQT 1RK1A 3Q3GA 3BX7C 5DZLA 3IDJB 3TT3H 4LSRH 1N5YL 3QUYB 4Z6AT 1C5BL 4QHUA 1ITCA 4JY5L 3NH7L 2OL3B 4JO4L 3BP7B 3VXTA 3R8BB 3L6FA 1M4KA 4Z7OF 3WFBH 1FG2A 2BSSB 2F8OA 4HHAA 4CBPA 1KIQB 1IC5H 3M8OH 4M48H 1R3LB 1CFQA 4G7YH 5IIEA 1MWAA 5HHOA 3RDTD 4LHUG 4X5WB 1K8IA 1V3JA 3P77A 4XHJD 2HAZA 3O4LD 2NXYB 4NHCH 3FQXA 1WBZA 2LTQC 4GKNA 3T2QA 3QA3A 2KH2B 2ZWLT 4PJ7A 1V7NL 1X4XA 1NBVH 1NC2B 1I85C 3RVUC 3ZKQD 3MFFA 1FLRH 4OD3H 1JF1B 3CZFA 1RJLB 2ED7A 1T5WA 1RZKH 3KPNA 4DKDC 4URTB 4NKIH 4KTYA 3BP5A 3FHQA 3QXAB 1YQVH 4Y5VB 5D4QA 5C07D 5IR1A 3LQAC 5F6HJ 2HFEA 3QCVH 4R4FH 2AK4D 5C0CB 2LVCA 4NIKB 3UYRL 1T0MA 4M6MH 4MQ7A 3TLRA 5C0ND 3WNKA 3QNZA 1YPZF 3FQRB 5B22A 2F5BH 4JM4H 3BUYA 4F2MA 1U8OA 1SY6H 3QQ4A 3SGJC 3N1FC 2QQQA 2B7DT 4HIXL 3IS1X 3PL6A 4P0DA 2PR4L 4H8WH 1JYXA 4M7KH 1MELA 2A9NL 4CAGA 5TE6H 3SE4A 1IGYA 2YN3A 2ADJA 2JIXB 3JXAA 4R4BB 4NRZB 4PJCE 3CVIL 4QXGH 3HG1D 5DRXA 4LQFL 3ES6A 5C0BE 3RFZC 4NNPL 5GSVA 3O9WC 3MRMB 3MUHL 1WQVT 5I1CH 5I71C 1G1YA 5B4MC 4NJAL 1A6UL 2Y07L 3ULUF 3H3PH 1MRDL 1R3KB 4LSVL 1BZ9A 5KS9A 4YGAB 1DDHB 2MHAA 3C60B 5MEPB 3HPJB 3KYAA 4HWZB 3D87B 1J05A 4BH7A 2F54B 2MTPA 1MREH 5ADOL 3OHXB 5F7UA 4QRTB 2W0PA 4H1LA 1P69B 4WWKC 2VLRB 3SOBH 5E7FA 3H9HB 4UDTA 1H0DB 3RVVD 2A6KA 4FQIH 1EXUB 4FZEL 5EPMA 4E9LA 4X6CA 4N0FA 5KVGL 3EJZD 4ELKA 1IGTA 3VXSD 2CIIB 2P5EE 4ONFL 3W0WE 2DLIA 3WFEL 3QDJE 4HV8A 2DF3A 5FYJH 3FONB 2PO6B 3DIFA 4H5SA 1MAML 3FOMB 5BV7B 1ND0B 1ONQB 3DSFH 3WIFB 4EUPB 1NC4B 3ZT5A 5E5RB 3P4MA 4LSPL 4XBPB 2FX9L 4W70A 3JVGC 2OR9H 1UCBL 4JQVA 3X11A 4JHAH 4L4TA 1T5XB 5CZXC 2UY6A 3IRZA 1OGAB 3OKMB 4XCYB 4LLVB 1RK0B 4AEEA 1OAYH 4P23C 3NPSC 2ICES 3BKCH 1YEHH 3X3FH 3VFUA 2IADA 2LU4A 3TVMC 2VZ3A 4RDQG 2IBZY 2APVA 3MR9A 5LXGH 3LRSB 3TGXA 2KKQA 1T1ZA 3L7FA 2X05A 5C09A 4XNMB 4UAOB 4JG1L 1SY6A 1F6AA 2X4UA 3QO0B 3CSYB 1AXIB 5DMKB 4F7CB 4HFWB 4D94A 3B9KB 4JVUA 4RMQA 1OY3B 5ACZA 1YY9C 3FO2B 3QZWA 3P4OA 3S5LG 4KTDH 5I30L 4H0HB 4JFHD 3BMVA 1AHWC 1ZS8B 2F74B 4KI5D 1FYHB 5K9OB 4ZTOL 2NW3B 4UNVA 1UT9A 1IL1B 4HK0B 4CW1A 1ETZB 4HXBL 5I15H 2M1KA 1NDMB 4DCQA 2YD3A 3GSXB 1OVZA 5IT2L 1BF2A 2AJVH 1CDUA 4S1QL 3HNTL 1DQQA 3UZEA 5HSFA 1BD2D 5EBWA 3FZUC 2O5ZL 3ULVH 4O51B 4L8SB 3UJTH 3EOAB 2IFFH 4XNQB 3ZKND 3PABA 1J12A 4R2GB 4JRXB 1BQSA 3H8NA 4YE4H 3QUKB 2E9BA 1DBKL 5I18L 5F9AC 2YPLE 1EK3A 1ZGLA 2V17L 4OQ1A 3EHBD 4YO0A 4K8RL 3S35X 4QY8B 3OKKB 3MLYL 1VEOA 2YXMA 4AJ0A 4F9LA 5L2JB 3SJVE 5HVWA 2DJUA 4TTDD 2NY1B 4UV4H 5DTFB 2MKLC 1CE1L 2IAND 4F33B 4FQQB 4J3UA 3S4SB 5TF1H 1MIMH 3DUSA 3VCLA 5CUSH 1TPXC 1OAZL 1G6RB 1XIWC 4MXVF 3UTTA 3U36A 1HXMA 4QRPD 5J1TC 1EHNA 1MEXH 3VXPB 1NAMB 2E6PA 4ODVH 4U6HA 3RBSA 5KOVC 5E8NB 2G5RA 3RNKA 3ZKSD 1DANT 3MRQA 1S9VB 4GLRI 4MQSB 2EH8H 3GUTB 2QL1A 4FXGA 2JK5B 3KJ4B 3GMRB 3LDBC 2CKBH 1TJGL 2Z31D 3BPOC 3BYYA 4BSWB 1WC7B 3HAEB 5JLZB 3MROA 3B8SA 4KRPD 3BEVA 3DX6A 4HIEB 1J1OL 3EYSH 3MJ9H 4NQXA 5I1LA 2X4RA 4HUXA 5EBLA 4C55A 4NNYA 3MLWL 3DVIA 3GSVA 4IRSB 1NEZA 3ZDZF 3HI1A 2MSPA 3IFOA 5ENWB 4HUWA 4V2CB 2GT9A 4IOFC 4OCSL 4XPGL 1BX2A 5C0BD 4L4JA 2H32B 2NX5E 1YJDH 2YEZB 4JRYA 5L2KA 4YFDB 2WP3T 4OLXL 4OGAD 2HFTA 1MRCL 3JWDC 1WGOA 4GMSL 1PY9A 4LSDA 4P5KB 4PGEB 1ZOXA 1X6LA 4JFPA 3ZKMD 4L9LB 4KAQH 1HSAA 1BM3H 4J2XA 5I1GH 5B39B 4MWFA 1H15A 2CXKA 3UTPE 2O93L 4RGOH 4DZBB 4PBXA 4OZIF 4G3YH 1NDGA 5TE7H 1P1ZA 3WJLA 2DI7A 5SWQA 1ZHLB 3UYPA 2D7MA 1CXFA 1U3HA 2UYLA 3OAUL 1JNNL 4L5FH 2X4OB 3Q48A 5F9DC 1QQDA 4EDWL 4MNQB 5F71A 4J1UA 2GI7A 4TQEL 1U8QA 2B4CH 4EI5A 4UT6H 2P5ED 3GMLA 2H6PA 5KSUB 4ZUVA 4CN4A 3PV7A 2CDFA 4LQ1A 4GSDH 5CLWA 1T6WA 4GQPH 3D0VA 3RDTC 4ZO7A 1ZVSB 5CKAA 1S7WB 3ULUH 5I1HH 4XHJC 2J8UE 2DQDL 4R96B 2GEEA 2CMRH 1KLFA 1F97A 2EIEA 4IJ3B 5E1AB 4NP4H 3SHSA 2G9HB 1QZ1A 1XGYH 5JNYA 4HBCL 5F7MC 5MENE 7CGTA 4M6OH 1FVEB 3BDXA 1YECL 2AJ3B 3VRJB 5HHNA 2OX5A 3UTSA 1J8HA 1XT5A 3VE0A 2NTFA 5JHLH 5D71L 3CX5K 4MSWB 4UQ3A 4PRIA 1HHKA 4NO3B 3RWHB 4DKEL 5JW5A 3P4NA 4RAVA 2P24B 5KVMC 1KENL 4RGNC 4LCUA 4ZXBB 4JM2A 5BO1L 1RD6A 3FRPA 3U6RB 3S96A 5GGQL 1NEUA 2WUCL 4G8GA 5LAXA 3HZKA 3K8LA 5CEZH 4X99A 4XP9H 4HKXA 3MJ9A 5F3BA 4LGRB 4GXVL 4UIMA 2WBWB 5IMLB 3K1KC 5EU7E 4MYWB 1MCKA 5BMFL 3MCLH 2GUOA 4U1LA 4XH2B 3RHWF 3L3IB 4HT1L 1F6LL 4HIJB 1A9BB 3HFML 4IRJD 4KK9D 2C5DC 4AENB 1HOCA 1DANU 2HT4C 3PWNB 4S1RL 3QDGB 1F4XL 4Z18A 2DOCA 3QIBC 2FEEL 3D3VE 3MJ6A 4YHLH 3O45A 4WV1C 3UXFA 1I8MB 4YDKL 2EIBA 2BMKA 1NLBH 1VDGA 2JLLA 4KKCC 1KTDA 4L3EE 4QHMB 1I8IA 5GRXG 4KK6C 2DMCA 3N85H 5M7QA 3W9EA 2GYSA 5MEOA 3CX5J 1RZ7H 4JPVH 2A77H 3FT3B 3SKMB 5ICXB 2X1XR 5HHOD 3E3QC 5F9JB 1YUHB 3R4DA 3TJEL 3GIVA 1NANI 3SE8L 3LEVH 32C2B 2YD8A 3TNMA 3U48A 4S1SL 4CDGC 1DBBH 1RJYB 3GRWL 3D0LB 3ELAT 4N8VA 3H2WA 1U92A 3F5WA 3JV6A 2E3VA 3O9WB 4KJPC 5GISH 3N9GL 1NAKH 2ZUYA 1Q8MA 1OF2A 3E6HB 5FO8B 2H2SC 2V2WB 1I3VA 5I71B 4ZOBA 1MJJB 2ZNXA 4HWNA 4BZ1L 5EWIL 3IDNA 4KY1H 5GRYA 2FJFB 4UILH 5FYJE 2OJEB 4M8VA 3NIDE 5CGYC 3VFSB 3QEUA 5J89A 1XF1A 5FV2A 4B7LA 3NFSH 2VZUA 4XXDA 5IHZA 4BUHA 1MVFA 2C4FT 1RVFH 4R3SB 3VWKA 3ZHLA 2FO4B 3DGGB 1W0WA 1IAIL 4KXZI 5JHDB 5I75B 4WWKB 5LGJB 1WSST 4NQCA 5HDLA 1HEZA 2R4SH 3OXSB 2XQYG 5LVEA 1N59A 1INDL 1HYSD 3DRQB 4FXLA 3L95B 5EA0L 4WEMB 1IQDB 4P4KC 4LLYA 3ZYOA 3FQTB 3HB3D 4ZQKB 3PL6D 3OZ9L 2P1YA 1AKJB 4EZMA 4PJHE 3HLAA 1L0XA 4LVNC 5GZND 2EYTB 5DMJB 1PZ5B 2BSTA 4GUPB 3T4AA 5GS1A 1T4KA 1JGDA 1MHPL 5GGTH 5JOPD 3HZMB 2HG5B 5DT1L 2LU3A 1A7QH 4G6FB 1AGEA 2I9TA 2COQA 2JCCE 3EDJA 4NBXB 1OSPH 3ME0A 5C9JB 4OD1L 1MCNA 4HFUL 4OCRH 5T1KB 5F7DA 1U41A 3HC0A 3ALXA 3VFRA 3S36L 4JPWL 1JYWA 3S8WA 3MBEC 1HXYB 1RFDH 3L3DB 3SDDA 3UP1A 3PWPE 4CVUA 4U6YB 5D6DC 5JO5B 4P23B 3A0OA 4LKCB 1F4WH 1YEIH 3NPSB 4Z95H 3SDCA 3QPQD 3VD9A 1KYOK 3CXHJ 4XPBL 1NPUA 1OOAA 1RIVH 5DHYA 4P2CG 3HMWH 1MFAH 5CIPB 4XVTH 1YNKH 5EIIA 3SO5A 4OLYL 5ECJE 4LBEA 4PP1C 5D7IB 3X17A 1MY7A 2FJGA 2DQEH 5F7YC 4YWGL 1LE9B 5ANMA 4LMQI 1P7QA 3ORJA 2G60H 2KQMA 4OIIL 5I76B 4Q6YA 1JVKA 2MQ3A 3EHBC 4O2CB 3V52L 4ZUTB 5DUML 5EBMB 2Q76B 3V6BR 4U4BA 4ONGH 1JMZA 5FUCE 3FFDA 1AHWB 4L8CB 3DI2B 4XCEA 4I48A 1H8SA 4WCYH 2YD2A 2OR7A 3FOLA 2IPUG 3WKNA 3LKOA 5D72H 3STLA 2CLZA 5DDHA 1Q38A 1XGRB 1IM9B 4OGYH 1BBJB 2OYPA 2PTTA 5ALCL 2BNQB 1VACB 4L4TD 2IAMC 1CR9L 3V95A 4UDUA 3K0WA 2E7LC 4ZPTA 1NMAH 4KKLC 1A5FH 1SYVB 2Y6SC 3EYQC 3PP4L 3LEXB 1HILB 4QWWD 4Z7OE 1JMXA 1U8IB 3MODH 4PYGA 3ZYJA 3MGTB 3IYLW 3IDXL 5F70A 4OLZL 5LGHH 3ABZA 3SKUD 5E2UH 1KYOJ 4QRRB 1TNNA 3RZWA 4TOYH 3LV3B 2RFXA 5C09D 2Z92A 2H3NB 4BFIA 4GT7A 2BXZA 4MB4A 5HBBA 3DTXA 4HG4J 4XPHL 3LY6A 3VFNB 2C7UA 5DYOA 1OTUD 4OZFG 4PJBA 3O2WL 3MA7A 1UVQA 5LQBL 5J6HB 1D5BA 3C6SB 4MCYB 3X3GH 2I60H 2HKHH 4R6UA 4XBGA 3F12A 2DD8H 4OCNC 12E8L 4RFNC 3CCHA 2W07A 4XGZA 2Z93A 5HJ3B 2VISA 2XACC 3GZKA 3PQYA 2CJUH 2JB6B 3VFMA 1NFDE 3LN4B 4PRBA 4D0DB 3FTGA 1UKTA 4EDXA 2PTUA 3OJMB 1NSNH 3REWA 1PEZA 1GCFA 4BUGA 1JZ2A 3LDBB 3BPOB 4ZG1A 1YPZE 5HPOA 3JWOL 3C5SA 5CEXB 2AQ2A 4P5TA 1CU4H 1X3DA 5FO7B 4LPCA 4DVBA 4U6TA 4IOIB 3MCKA 1UB5A 1NCBL 4ZUUA 3BKML 4KJYB 1CDCA 1E28B 1FO0H 5D5MF 4N1HB 5EIVA 2DWDB 4K3EH 3HRZB 4UNUA 1RUKL 2X4SA 2ICEB 1U6AL 1MCCA 4M61B 1X5HA 1KLGA 3TBYA 3UZVB 2FJHB 2CUHA 2NY5L 3V4PH 3X12A 5HYIA 4HKZB 3AREA 1SJXA 2NW2A 1UZ6E 5HYJE 5FYJD 3MX0A 1Z3GH 5E8OB 1MJUL 4OAWA 3UTTD 2OTUA 1OAUL 2X44D 1CFBA 3REVB 5IM7B 5DRWB 2H2PC 5FKAB 3D2UA 1RUPL 2EDOA 1MAJA 2R1XB 3U9UB 4MLSA 2GAZB 1WZ1H 3QHFL 4JEGB 1FPTL 5ADPH 3BW9A 3DETC 3CLFH 2FGWH 5JORB 4LARH 1KEGL 1FIGL 3P9MB 5DFVC 1LK3L 4PJXB 5EZIL 1PG7W 4G6KH 4NPYB 4K2UH 3VW3H 1QBMH 2AXFB 4RZCA 3D9AH 5I1AA 1NMCC 3GJEA 4WU7B 5IEKA 3RDTB 2W9EH 4CNIA 5CSZB 4LRNH 4RFEA 1D5MA 2GITA 4D0CB 3BZFB 5KZCD 5HHPB 2AJXH 4AIZB 3RI5F 1P4IL 5CEZE 2J5LB 1RHHB 3LZFL 4ODTH 3C5JA 2E27L 5L2KD 3PWVA 5J7CC 3CUPA 2KZWA 5AD0B 5CBAA 3PGFH 3EYFA 5C0IB 4FQ1L 3UBXA 3H0TA 3P0VL 1GIGH 4JFXB 4NBZB 3GKWH 3G6AB 3TNNA 4YFLI 1V3LA 1R3HB 3SKJH 4DQOL 4RGNB 3RHWK 3BVNB 3MOQA 2FECL 2AK4B 4IBLT 1P2CB 2AABL 4JY6B 4EIGB 3QWOB 1ZLSL 2IFGA 1KV3A 1U3HD 3MCG1 4PJGE 1QFWL 1G7LB 2VZSA 1I7TA 3ULVD 2AEQH 2QR0A 4MDJA 4OUUA 1G7MA 5C8JB 3GSQB 1U8HB 4JJHA 3SQOH 2QSVA 2HJFB 4U6XA 4GMTL 4EI5D 2VLKA 5EU5A 4M43H 3TIEA 3T0DA 4PJFA 4HQQL 1CXEA 3JWNC 2WAHA 1A7RH 1FO0A 3U9PH 3WL9A 5IB2A 5A2FA 3MJ7A 5IHUL 3RVTD 1ODAA 5FKPA 3A67L 5C6TH 4JAMA 4U1SA 4J4PA 4QRUA 3V0VA 4NM8L 3TO4A 5KANI 1HIMH 2AV7B 5D2LE 3HG1B 3TYFB 5HI5D 2D9CA 1UWEL 1S7UA 3GMPB 1BGXH 2WBJC 5HTSA 2A73B 2X4NB 2EDJA 4JLRB 3QIBB 3UTSD 1J8HD 3QIWA 4ODUB 2YWZA 4WV1B 5J3HC 1QYGL 1OPGL 5SWZA 3T4YA 4PRID 4JKPL 4LOUC 4BZ2H 3F7PC 4RAUA 3P3YA 5FUOL 2BVTA 1U8NA 1GH7A 2R56H 5HD8D 3VFPA 3QWQB 5KVDH 4JM2D 2DKMA 2DLFH 3JTTB 3OAYH 4LCWE 4FFZL 1KEMH 3FT4B 5CBEB 2IMNA 2V2TA 2OCFD 2R15A 3DLQR 4ORGA 4G8GD 2YPVH 5L7XH 4MD0A 5DD0L 4I3SH 4Z7VB 4ODHL 3MXWL 1HYSC 4N8CL 3WUWG 5IB3B 4K3JL 1H8OA 3T3ME 3ZYIA 1K5NB 4ZTPL 4L29B 4DKFL 1B6DA 2HJKB 4MXVE 2MOVA 4X9BA 2AJZA 4F7MA 3O6FA 3V4UL 4LNVA 4K94H 2Y1VA 4K55A 4F58L 2R2BA 5TFSH 3IVKA 3EYOB 3BPCA 3OB0H 2NXZD 4OLWH 5T33H 5GXBB 2EXYD 2NTSP 5D7LE 3O3BA 1CN4A 3QXDA 2YKLH 3KYMA 1CDGA 5FECA 2VQTA 4JFYB 1DBMH 5T5NG 1PQZA 4M6NL 4DAGH 5ID0A 1UYWH 5CZVL 2HYMA 5FAAA 1IC4L 4PJDF 4LNRB 1LMKA 1R5VB 2LABA 5DVLA 1AD0B 1CFSA 1L9NA 1TZIB 4WHYH 4YQXL 5FF6B 3HS0A 5DQDH 4PJ5A 2R4RL 4NUGL 1MLBA 4DGVL 1EERB 4ZMAT 4FQLH 4WUKH 4WWID 2J4WH 1N4XL 1FORL 2B8OT 1EHLL 4LVNB 4X6BB 3OKEB 2C1PA 1DQDL 1RURL 3QI9A 4DEPB 1KFAH 1D5XA 4XVUC 3T77B 1U8MB 5L6YL 3MJ8A 4MD5B 4X98A 5ITFB 5FO9B 5D2NA 4AL8H 5JMOC 2Z35A 4WY7L 3OJDB 5JIPA 5F1KC 3PWUA 1NL0L 3MBEB 1TVHB 1ZA3A 3ULUD 3VXQB 4G8EA 3IXTA 3CXDH 2BC4B 3HI5L 3O3EB 4FFVD 3C8KB 2PCPB 1DE4A 1NLDH 4TNVF 2DQCH 4APQC 4JJ5A 3EIFA 1HHGB 4E41A 4Q9QL 3CH1A 4OZIE 2QQLH 4KGLA 4PTUA 3AXLA 1I7RB 2EZ0C 3OKNA 2VUYA 3RWCB 1EEYA 5DD6B 3MYZA 1JWUB 2VAAB 1BHGA 2W60A 5D1QC 3ALWA 5BS0A 1MWAL 4FFYH 4NQCD 4XCNA 1PKQE 3P30L 4AH2A 5FYJU 3B6SB 5TH2B 4RCAA 4X6DE 3T2NL 4MQXD 2DQIL 5DQ9A 2CIKA 2XZZA 5ISZA 5DS8B 3LAFA 5C7XL 4YXLH 5EU7C 5GGVY 4LL9A 4Y1AA 3QYCA 3I6LE 3RWGB 4Y19E 4JZJA 5ESAB 2A6IB 1P84J 2P7TA 1V7ML 2VLLA 3UO1H 4LLQA 1VSCA 1BWMA 2F5AH 5FHBH 2VC2H 4H8WC 3SCMA 4P46A 5MEQB 2GSGA 4K7PH 4X0KB 2UZIH 5JW4R 2IAMB 5HHME 3SDDD 1T21B 2EYRB 2ADGB 5T1LB 1T0NB 4G6MH 3SDCD 2GTWB 2VERN 5D93C 4DJMA 3LQZA 1RZFL 4WUUA 3CIQA 1JIBA 3P73A 3MMEB 4FN0A 4HDIA 4MNHA 1RJZB 5FUZH 5I16A 4PV8B 4I77H 3VJ6A 2Z31B 4CUCA 1JCKA 4NSKA 1ZA6A 3GB7B 2GFBB 4FRWA 4KRPB 3AMKA 5DMGC 1UA6L 1P7QD 2WWKO 1SBSL 3MV01 3U7WH 2XG4A 2EXWD 1VCAA 2IH1B 5FDWB 2W59A 3M17A 4AK1A 1CFVL 1YNLH 2BNUB 4OZGF 4YPGB 2BHZA 4PJCB 2RCSH 1T20B 4JY4B 5C0BB 3MV9E 2EE2A 5IVXF 4CU6A 4UBDC 2J8OA 4X6EB 1IGFL 4O2FA 2ZOKA 4HGWA 2HRPL 1EEUA 5IOPB 1AO7E 1WAAF 2FHCA 1IQWL 1VESA 4GG6B 3P40A 4WI3A 2EYSB 3WIHA 4WDIA 2PF6A 2QQNH 3DVGB 1U58A 1CGXA 3T0EE 5I17A 5I66A 5DA0B 2XFXB 5K9KA 1O7VA 4OZ4A 4NCC1 1IAKB 3E0GA 1M7DB 5D5MA 3W2DL 3NTCL 1WWCA 1MQKL 2BDNH 1WWWX 3WJJA 4R0LA 4G7YL 4DUXA 2BVOA 4J8RB 2JB5H 3OGCA 4NQTA 1EIBA 4LSQH 3MLUL 4LVOC 2BX5A 2DIAA 3ARDA 1JNHB 4I5BB 2Q6WB 3S35L 2P5EB 3W11C 1AJ7H 3W0WB 3L3GB 3QDJB 5MERA 1EMTL 1NCAL 1DSFL 1KG0A 4OKDA 3CVHB 1U2CA 5C6WH 2HVKA 4NN5C 3GI8L 3QUMH 2P4AB 5DLMH 4OD3L 5ID1A 1CDJA 2X5PA 4FNLL 5D7LD 5F1IA 3EO9L 3WIIH 4PJ9C 5K33A 1RZKL 1FGVH 4XC1H 1G7IB 3PQYD 2FD6H 2HRLA 4D3CH 4M1CC 4JFZH 3WDIA 3QCVL 4R4FL 3JTSA 1TVBB 2AXGA 3KYOA 3FCTA 3WLBB 4U0QB 1L0YA 2EKJA 4DGIL 3NN8B 3LEYL 2A38A 3KLDA 4NDMA 4KKAC 4QGYA 3P11L 5JPNB 2QSQA 1KXVC 1KB5A 4HLZG 1ZXQA 5F6IC 5F96L 4Y89A 5GS0H 5JUEH 2XNAA 1BQHB 3VDCA 2BSRA 1FNSH 1MPAL 4YHMH 4LU5H 1G1CA 5CJXA 5KSVB 3QUZA 4QTIH 4QXGL 3Q5TA 2FX7L 3T09A 3BE1H 3ARED 3GMNB 3MYJB 4Y5YA 3NABL 1ORQB 5H37G 4V1DA 1PGRB 3QG7L 4ODBD 1IT9H 4XCCH 4ZFGH 5I1CL 4E42B 2KL6A 3UX9B 2FB4H 4NM4L 2PYFB 1E4WH 1KJ2B 1X5ZA 4YHZH 1GC1C 3H3PL 4CL7A 1KJVA 1NGZA 5LCVL 2XWJB 3MRRA 3D85D 2GJJA 3D2UD 5SWSE 1Q9OA 3NCJL 5IB1A 4D9LH 1AR1D 1I7UB 1TETH 1EBAA 3DURA 3AB0C 4E41E 2DS4A 4Q6IA 1YYLH 2YPLB 1FV1A 4Y16C 2ORBL 3NGBC 5JW4Q 4FQXD 5IVZA 3VXTB 1GGBL 3RUGF 9CGTA 43CAB 3VH8A 4S2SA 3SOBL 5M94B 2IALA 3AY4C 3QEQA 4HHAB 4FQIL 4NO0A 4KK5D 4ZODA 5BS0E 3RWEA 2BK8A 3CJJA 4WFHE 5B38G 3BH9A 4Z7QE 2EDFA 4XP5H 5BW7A 1CCZA 2L7JA 2JJUA 3L5XH 2R0WH 3SDYL 1NCDL 3FQXB 2W9DH 2ZG2A 1RUAH 5JDSB 2V5YA 1UADC 1KPUA 2VO5A 1JTPA 1A4JA 3NA4A 3QUMA 2C3WA 4KRMB 5T3ZE 3ZKXC 2OR9L 3MREB 2IGFH 4JGMA 4P3WA 1EO7A 1B0RB 1QLFB 2YS4A 4M5ZH 1EFXA 1RULL 1S7SB 1T5WB 3KPRA 5IESH 1YJDC 3CNKA 4XXCC 1YEHL 3X3FL 4TSCH 3PF2A 3BQUA 2NY7L 1MFDH 1BOGA 1UJ3C 5E8EB 3IETA 1UEMA 5CWSB 1MFCH 2DQGL 1XGTA 1A9EB 1T0MB 5TE4H 5JXAL 4WVRA 2FZ3B 4QCIA 3SQBA 2B1AH 5T5FL 3EYUH 4M7JH 1DLFH 1B2WH 4F57L 2AXHA 5IV2B 1J1PH 4WNQB 3ET9F 1Z9LA 3QQ4B 5F97E 1X5FA 5H94B 5HHVH 4MDIB 1X44A 3GSOA 4LHUB 3U46B 1KLUA 3ARXA 3S5LA 1FYTA 5D6CB 1KN2L 2PXYD 1S7TA 4Y0GA 4YDJA 2P48B 5FYKH 4OQTA 2OMNA 2NX5B 4RX4A 3RL2B 4KQ4L 3HRPA 3TO4D 1IGYB 1FFQA 5IP4A 3QQ9D 3QNYB 5FK9A 4PJDA 1F2XK 4JHWH 4IS6A 5FGSA 2P8PB 3PUCA 1HWHB 3IJYA 4ETQA 4NO2A 4G6AC 5GSVB 2XTLA 1P6FA 2HFFA 4M62L 4GBXA 3HNVH 4HUKB 1LP9E 3S6CA 3MSPA 4OF7A 4BSVA 2DB8A 1T0PB 3QIWD 4HXAL 3ULVL 1MLCA 3I50L 3ZDXF 1I4FB 5SWZD 5ICZA 4NQVA 4YJZL 1CL7H 3H3BC 3LS4L 2IFFL 1BZ9B 5T1MA 4MAUH 3MLRH 2ICWA 1N7MH 3OAZH 1HHJA 2V5MA 3EJYC 3C08H 1MRFH 1JHTB 3BP4A 2LVEA 1NGYA 1UACL 2GJZA 3SGEI 1WCBB 3L5WB 4TVPH 4DUWA 2H26B 4UV4L 2OI9C 1AE6L 2BRQA 5B8CC 2A6KB 2ATKA 5FA3A 3ILPA 2J8UB 4A6YA 5FGBC 3H9SE 3EO0B 1IGTB 1FNAA 2BVPB 2I5YH 5C2BL 2FNBA 3V0WH 5C70A 1S5IH 2Y7QB 3MRCA 2JKXA 4X8JB 3O6FD 5ICYA 5IJKC 4NQSB 4H5SB 3V6FA 3VI4F 5HDQL 5E8PA 4Y8DC 2VXSH 4OJFH 1QD0A 2FH6A 5IROA 3JV4B 4APQB 3P4MB 3CSGA 5E56A 4YHKH 1EBPA 3WE6A 2NY0D 2D7PA 1UXWA 3LKSB 2ZUWA 5DK0A 1I9IL 1RZGA 4L4TB 2DQHH 1KIPB 5BVJA 4LDEB 3U1SL 3LCYA 1IMHC 5E2WL 2ID5A 3FKUS 4MNGA 1LO3H 4PRNA 1RZJH 1MUJA 1ZHBB 2ICWJ 1FQ9C 3MJ9L 3VXRE 3BKJL 3LKPB 4PJ5D 3KYNA 2YPKA 1FGNL 1Y6NR 4HCRH 5DMIH 4AT6B 2A0LC 2Q8BL 2I26N 1G9ML 4DWHA 3I75B 3PWJA 3RVWC 2CO6B 4B7IA 1MVUA 5EO1A 2APWA 4YX2L 4OTXL 5I8EA 4U6VL 4GW5A 1WLHA 1D3CA 4P2RA 1J87A 3OKLA 3H7LA 4PUBH 1ZWIB 4KAQL 1DEDA 1KSRA 1EAJA 3IGAB 5D93B 1I3UA 1CQKA 1PW3A 3OSKA 4RGOL 3L3OA 4CGTA 4E41D 1C12A 1L7TH 1T80A 3MRFB 2HLFD 3SKOB 4L3EB 4NFBA 2AJSL 3TZVA 3RJQB 4OCXL 2C1OB 2IC2A 5IMOA 5D1ZC 2JELH 3CFDA 5F88A 4DN3H 4DN4H 5BS0D 3UTQA 2B4CL 2ZG1A 4LLWB 5ALBL 5I1KL 4UT6L 1GRWA 1JPSL 3PABB 4PJ8A 1JRHI 4G9DA 4JPIA 5A3ID 1ZGLB 3O2DL 4Z7UF 4ZSOA 4JQXC 1YEKH 1WAAA 5AZEH 5IMMB 3ULUL 3CFJA 4Y1AD 5I1HL 1BVLB 4WENB 1T2QL 4WTWA 4E0RB 1Q94B 2CMRL 2AJUL 4WGWB 2QADC 3SCMD 1BFSA 4M6OL 4X5XB 4P46D 1LK2B 5F1OB 5CCKH 4LEXH 3U36B 3V5HA 3CMOL 4FQHB 4JFOA 1F3RB 1LO2H 3GHEH 1CIDA 4EUPG 2CO7B 3I3BA 1AY1H 3PWLA 5IW3A 1VEMA 5IK3B 2NLJA 1MFEL 4KQ3L 4TPRL 4PD4K 4PYHA 4WUUD 5F6HI 3TT1H 1QR4A 5H2BB 4U1JB 1N5AB 3K74B 3GMOB 3TCLA 4EXKA 2B2XL 2APFA 1KULA 3F7YB 5HGBA 1TTGA 3C9NB 4OGXH 4QEGA 4ETYA 2JJSC 2V2XB 1A47A 3B2VL 4X5LA 1MCDA 2UVEA 4TUOB 1N5YH 4P59L 5FCSH 1O7SA 3PE9A 4XP9L 1C5BH 1YMMA 4PJHB 4WHTB 2DL2A 3G6JE 4FOMA 3NVQA 1NCUA 3VFOB 4HUXB 4PRAB 4JO4H 2Z9TA 4HCRA 1T7ZA 1AH1A 2P42B 4NN5B 4LEOB 2AQ1A 1U93A 43C9A 2JCCB 2UVFA 3HI1B 2GT9B 4PJ9B 5K59F 4NYLA 4YHNA 1G7PB 3KWWA 1QSFA 4OT1L 3PWPB 3IT8D 1FZJB 2XA8L 3NZ8A 2JJTA 5E6IA 3S98A 1BFVL 1JWMB 1T6VN 1B0GB 2GSIA 4R7NB 3KPLA 3RWFB 3VMNA 2DTML 3UJJL 3UAJD 1EZVX 3LB6D 3MRNB 4J12A 1F8TL 1V7NH 1HSAB 4HEPG 4XT1C 4I18A 1OLZA 1BIIA 4X4XB 4QHNB 1QRKA 1NLBL 2VQUA 4XHQA 1NDGB 3B9EA 1CGYA 3MRKB 2J6EH 1RZ7L 4JPVL 1OP3H 2OJZL 3F7RA 3KDMA 5F6IB 5INCA 1TZHB 4J1UB 4PD4J 3UYRH 4FQXC 3ARBA 3H9SD 5D1XA 3DX7B 2PW1B 4PJAF 5E5UB 1ACZA 1II4E 1FVDA 1VENA 4Q0XL 5FYLL 3ZLQC 4CMHB 3LRGA 3K8MA 5GISL 2X4PA 1MI5E 5AG9A 1AIFA 4HIXH 2PR4H 1CG9B 3HE6A 4UILL 3QH3A 3BZDA 3P9LA 1N2RB 4NBYB 3QHTC 2HP4A 3NFSL 3WS6C 2NY6D 5HHNB 4EVNA 3HI6L 4HS8L 3CVIH 3AB0B 1A1NB 3RZCC 4Y16B 1MJ7L 1HHKB 2D9QB 1NCTA 3VMPA 4OFPA 3O8XA 1DQJA 2LV4A 5KW9L 5K9QI 4YDLC 2OQJA 1B9ZA 4H26B 2Y5TA 4QOKE 2N56A 4NJAH 1A6UH 1JGLL 1AGFB 1OLLA 1D9KC 2Y07H 4O2EA 2HTKC 1MRDH 2CKBB 1EO5A 5JW3L 1KUMA 1WV7T 3S96B 4L3CB 3ZE1F 2OSLA 5LAXB 3HZKB 3HAEG 2H1PL 5F3BB 2BNRA 1KN4L 5F7EL 4U3CA 5I9QC 1A7QL 1G7JB 2Q7YB 5ADOH 1L4IA 3GJFK 3KLHC 1OSPL 2PXYC 3QUZD 4HKJB 2FWOB 4U1LB 4C83B 2Z4QA 1BBDL 4D8PA 2P46B 2ARJQ 4QT5B 2F58H 1NFDB 3R06A 4JFEA 4HZLB 1XF2B 1Z5LA 1RFDL 3F7VA 4WI6A 1SVZA 4FZEH 4MCZB 5FYKE 4V1DD 2XZAL 3DX8A 2NXZB 1YEIL 3GJFA 1IM3B 4ONFH 2DBLL 4K07A 3UC0L 1DN0A 1LO5A 3WFEH 5BZWB 3U4EB 3FO1B 2YMXH 1UJ3B 1ZVYA 3M07A 1RIVL 1MAMH 4QNPF 2IPKA 1YPZB 4Q2ZA 3HMWL 3T0EC 3TYGH 3W39B 3OMZA 1QA9B 3NFNA 1QUNA 1XF3A 4LSPH 3FJTA 1Q0XH 1VGKA 2X70A 4P2QA 5DK3A 3KJ6L 1UCBH 3O0RL 3RRQA 4NZDA 4QTHB 5B39G 2DQEL 2BZDA 2EDBA 4J3VA 4XX1E 5ITBL 2D3VA 1KTDB 3O6KH 3QIUC 4U1MA 5I0ZA 2EIZB 2ZOLA 2J6EA 1TCRA 3THML 3P0YH 3QEQD 4M4RA 5BZDA 4NO0D 3SPVB 4P9MH 5ESQB 1U0QA 3TA3C 3T1FB 1N6UA 1ROWA 4OZGE 4PV9B 2Y06L 3FB6A 5BVPL 4WW1A 1Q9LB 5AWNH 5IVXE 1G84A 4G9FA 4OZHE 1LO4L 5BQ7B 3TNMB 4JG1H 1KT2A 1IKNA 1FL3B 1DR9A 1YN6B 1W0VA 4N8VB 3QUXA 4BKLB 1X5KA 4ZNCD 2YA1A 4ZFOA 2V7NA 1OF2B 3F62A 3LSOA 2EDRA 1IEAA 1EFXD 2G2RB 1QEWA 3RVXC 3ARRA 1WT5A 3KPRD 1W72L 5I30H 5DK2B 3BQUD 2XV6B 1HKFA 1Q9WA 4YC2C 3CK0L 4WTZG 1YEGL 4TOYL 2DWEA 3OKOA 5C3TA 2GJ6E 3EOTL 1OTTD 1FNLA 4MJ5A 2OI9B 2VDOL 3FFCA 3WXWL 1UM5L 2Z0BA 3HNTH 5B8CB 1I8LA 1G9NL 2O5ZH 3S3JA 3CLEL 3LN5A 2D7OA 4Z0XA 1FYTD 1UXSB 5ESVA 3ETBF 2PNDA 3VXUA 1KELH 1ZHNA 1KIRA 1A1MA 4M8QA 2BSTB 2GCYA 3T4AB 1P9MA 1DBKH 1T4KB 4FQJL 1JGDB 2V17H 5E9DA 1RZ8B 3MLYH 1OT2A 3MRHA 1G7HB 2AEIT 5IQ7L 8FABA 3VFRB 1CE1H 2WIIA 3G9VA 1NSNL 4NQEA 3RPIA 3TBTA 4EI6B 4OI7A 5GIRA 1OAZH 5EC1A 4X80L 4G5ZL 4PRHE 1S8DA 5HVHC 4GAJL 2GTZA 4PJGB 1SEBB 5I1EL 3DVFA 1PYWA 2W92A 3MRGA 3G5XB 3RWJB 1UH3A 2HTLD 4LBEB 4AEIH 1OGAE 1BF8A 5C6PB 1FO0L 3DXAA 2R29L 5C08A 4PJEA 4XPTL 5LBSL 4K3EL 3VGAC 1VFBA 1GGYA 4HJ0D 2AQ3A 2L7UA 2E5EA 5TQ0L 5IFJA 3SGKC 4KJQD 3V4PL 4PY7A 2BVYA 5D2LB 3KLAA 1F3JA 2V5RA 4CU7A 3MLWH 5IKCB 5CJ8A 4M93B 4QF1A 5C3LD 3QULA 4NKMA 2CLZB 3O41A 3UMTA 4L4VA 4OCSH 4XPGH 3VXME 4KV5F 4Q58C 2APXA 2WUBL 1WZ1L 3ARGA 1CICC 4I4WA 3DV6B 3CLFL 4OLXH 5D1ZB 1I1YB 5IBUB 3V9FA 3BD5A 4CVXB 3S97C 5EU4A 5EZJA 1OWRM 4LHQB 4GMSH 1UGNA 1HH9A 3RUGE 3IJSA 1E4XI 4PGBA 4K2UL 2HT2D 1R0AH 2NMSA 3TH4T 1XR9A 2DQFA 2NY4C 4AEFA 2FL5A 3F7QA 2G5BA 1RIUL 1MJ8H 4LRNL 2YBRA 4OLVH 3QHZL 4UTAH 4LCIH 1M05B 3BWAB 3OAUH 1S9YB 4Z8FH 1A4KB 3K46A 3QG6A 3QFJE 4DZ8B 3VI3F 3UDWA 5IMKB 5DYOB 4X83A 4TQEH 1F90L 2QADB 3K7UA 3U2SA 1LE5A 1IAOA 3HN3A 2CDGB 1UVQB 3PGFL 4OCYL 5D7LB 1D5BB 3LOWA 3EUUA 5C92A 4XBGB 1KTKE 2O61A 4YHOL 4BSJA 3U0PA 5KANG 8CGTA 2VISB 3PQYB 1MCEA 4JFEE 3MV7E 5J6GB 1DUYB 3G5VA 4YHYC 2IBZX 2DQDH 3O11A 1CE6B 5DJ6B 3HUJE 3QB7C 4EDXB 1F4AA 1UWGL 2ZCKL 5CLTA 3REWB 1JUFA 5C0FB 4HBCH 4GW4A 3B43A 3BZ4B 5HVFB 1YECH 2AEQL 4G8FB 5D9SA 1I1FB 3IJHA 1UFUA 3RL1B 4M43L 4R7DB 5GHWH 4DVBB 1Z0MA 2OXGA 4LLDB 1T7YA 4DKEH 3V6ZA 2ENSA 1DQMH 4ZUUB 3FB7B 4N90E 4AZ8A 3U9PL 3BOVA 5JXEA 2DYPB 1AQKH 1I3RB 1YQ2A 2EO1A 2K7QA 1YEEH 4TVPD 5BO1H 1B6UA 5AYQA 5DJAB 2X4SB 3VGHA 4Q74A 4Z7NF 5JMRA 1P53A 2HT3D 1FVCB 3ZSSA 5GGQH 2WUCH 4RMRA 3WN5C 2R9HD 1Q1JH 3T0WA 4JRWA 3X12B 2CGRH 2R2CA 4GXVH 2DQUH 3GGWB 1EEZA 4ODXA 3NMEA 5BMFH 1T1YA 4OAWB 4OZIB 1VFAA 2OTUB 5EUKA 4HT1H 4FABH 4Z76B 1A6ZA 4FFWD 4BZ2L 3HFMH 4X7TB 3B9AA 3D85B 4EEEA 3D2UB 3HPLA 4LRIA 3G5ZB 3OWEA 4BH8B 4YZFE 4ZNEA 3LS5L 2BY1A 1OD7A 1PKQB 3EYVB 5KVDL 4PJAA 2CD0A 2VL4A 4X6DB 2IQAB 3WUWA 4FQXB 1LD9A 2YOCA 5C0GB 3FB8B 5D96C 1GOFA 1K4DA 4Y4KC 1F4XH 1JN6B 3C6LC 4GRMB 1CBVL 1BFOB 5IW6B 3RGVA 1VHPA 2YWYA 4YDKH 1QSEE 1UM6L 4RIRA 1A1OA 5L88L 1R24B 1YEDA 1D5MB 5BOPA 2CLRA 3DMMA 4MNQE 3VI4E 3I3EA 4L9DA 1QSFD 4WHCA 3TJEH 2I07A 1F42A 4K3DL 5E94A 3SE8H 4PRHD 5CBAB 3EYFB 3OX8B 3UBXB 4OD2A 2W0FB 2I25N 3H0TB 3BSZL 1UYWL 2A83B 1RSFA 1XF4B 3GRWH 4JFFA 3P9WB 3QWRA 2ZUTA 5JQHC 3DO7A 4NUJA 2FYYA 3N9GH 4U7KA 5FDYA 2VLME 4YDLB 2DLEA 1QFOA 1MHCA 3WHXB 4BZ1H 1D5ZB 4HMDA 1D9KB 1F4YL 1AR2A 1I75A 4FQLL 4WUKL 3KPMB 1J86A 4MJ2A 2ZNWA 3OR7A 2DQTL 5CS7A 1NQBA 4MDJB 1G7MB 4Y5XC 3M1BA 5I9QB 2OZ4H 4U6XB 3ARBD 3RU8L 3T0AA 1IAIH 2PXYB 3U79A 2F53A 1ZT4A 4HIHB 1FO0B 3MV9B 4U1IB 4LLAA 2FEDC 1JZ4A 1INDH 5EUOE 4P2YA 4JAMB 5EA0H 3KYKL 1AO7B 4FTVA 1KJMA 3TO4B 2IQ9L 4XB7A 1IC1A 3NBNA 3WIHL 3STBA 3HE6D 3MRBB 4ZFZA 3T0EB 1MHPH 5M95B 4FQCL 3I6GA 4JO3L 5C0EB 5DT1H 1OAXL 5CEYA 4NC0B 1MHEA 3LKQA 4HFUH 5JOFA 2FSEB 5HDOA 4CADB 4JFDE 3UEZA 3S36H 4JPWH 5SWZB 5JW4N 1S7QA 2ZJSL 3O8XD 4OFIA 3KXFA 3WS3A 5C0JB 5EU6E 1KNOA 4YNYA 3VWJA 4W81A 4XPBH 1NGWA 1OCWL 4Z7UE 3PDOB 3GDBA 3AGVA 5E2JA 1S5HB 3BD4A 4QHKJ 1FL6A 4C56A 4YXLL 4PG9B 5B21A 3X14A 4ELMA 4OLYH 4B53A 5HI4D 1YY8A 2BNRD 4WGVB 5C2UB 4YWGH 1CFTB 2F5AL 4HAFA 5CHNA 5FHBL 3V5DA 1U95B 1U8KA 1FL5B 4OIIH 3S34L 5GS0C 2UZIL 4JFED 1OAKL 2MJWA 1A7OL 2EE6A 3V52H 1FFPA 2R2BB 5DUMH 2EDEA 2R2EB 4YDIH 4ZPVB 1HSBA 2IMMA 4YGVA 4X4YA 1KPVA 2M2DA 3PNWA 4LFHG 3AROA 1HHIA 4NT6A 4YC2B 1S7RB 1K85A 3FT2B 2YUVA 2D7TL 3CC5A 3LMJL 5DEGB 4IDLA 1KB5L 4PRPE 4ZFFB 5ALCH 4Y88A 1HN1A 4OSUH 3EOBB 1CR9H 4CU8A 4U1NB 3HR5B 3RTQA 5F7KC 3PP4H 1NBYA 3IXAB 1XGPA 3QJFB 4D0BA 3IDIB 2LFGA 1VGEL 4PPTA 1GHFL 3MA9L 3VDAA 4Q97A 2C1PB 2OZ4A 4WO4A 3IDXH 4ZOCA 1EUTA 1NCCH 1VB9A 4OLZH 1S78D 3MJ8B 1J0KA 4L8DA 1QR1A 1OSZA 3VFTA 4G9FD 5KAQG 5F8RC 2Z35B 1WEJL 4Y8AA 1FZMB 4OFKA 3VFWA 4XNXL 1YMHA 2VR4A 4XPHH 1ZA3B 3KPSE 1HQRB 3QUXD 3WSQL 4N1EA 3GSRA 4TRPH 2R1WB 3IXTB 2QQNL 3QT2A 2VABB 3NIFF 5HVHB 2FATL 4I8DA 4BQ8A 1XH3A 1K8DA 3MGOA 3LKNB 4JJ5B 1XCQB 12E8H 3QBTB 4E41B 2V5SA 3RKDD 1CLYH 4PTUB 3AXLB 3RWDA 2EEAA 1EEYB 4NKOB 2CLVB 2L4OA 4Y4FC 2Z91B 5A2KH 5BS0B 4LSQL 3OQ3B 3VGAB 2YC1A 5EZLA 3ARTA 3WEXA 1QSED 3E6FA 1AJ7L 3FFCD 4F7EA 3WO4C 4PJAE 1BVKA 1FZOB 1I1RA 1R3IH 1U8PA 4P57A 3JWOH 5LKNA 3D25A 2CIKB 2NR6D 3VXUD 3PHOB 2NY3D 4U2YA 2HA1A 3BGMA 4EN3A 1NCBH 3BKMH 4BK4A 3WIIL 4JZJB 3SDAC 4CVZA 5IBLC 1BZ7B 2VLLB 5E9DD 3PV6A 3AS2A 4LLQB 5I1DB 4XC1L 1K4CA 4FG6D 4N5ED 4D3CL 4JZNB 3QDME 2WQ8A 1U6AH 4JFZL 3ARWA 1CICB 3K2MC 2XTJD 3DX9B 1TENA 1DBJH 1EAPB 3DI3B 2NY5H 2DLTA 1F45A 4NQED 2ZP0T 3JUYA 2NY2D 4HK3J 4S10A 3H7BB 1MJUH 3PIQB 3ROOB 1OAUH 5CKGA 4WTXA 3HTLX 4MNHB 2NY4B 1M7IA 4Y7MA 1RUPH 4POZD 1CWVA 5CGMA 3DXAD 1ZA6B 4OQTL 5C08D 1FPTH 5JUEL 3E8UL 5D70H 3IU4H 4F9PC 2HJLB 3RPKA 5E1HB 4HIIA 1KEGH 1LEKB 1FIGH 4KUCF 4MXQD 2KZ1B 1B0WA 3W5NA 1LK3H 1TXKA 1H3GA 4X9FA 5DJ8A 1XR8A 3BE1L 3LPFA 1CGTA 4XAKD 2DJSA 4NHUB 4N5UA 3IDGA 3L3KB 2FB4L 2HN7A 4YHZL 1HE7A 1LP9B 4O2FB 4YHYB 1NUDA 1X5AA 4QNPE 1T2XA 4NKDB 1LEGA 3DNKA 1N0XL 3UBXI 2DDQL 5CJ5A 3OKDB 4D9LL 1P4IH 1TETL 3ARGD 3LZFH 2D31A 2E27H 5TDOB 5K9KB 3D39A 1YYLL 3B5TA 4FQ1H 1IGIL 1GZPA 1TJHL 3MRPA 2P5WA 3P0VH 3OR6B 3GM8A 5CJBA 5I8OH 5D5MB 1JPFA 3QPXL 4NC2B 2XPGA 5B38A 2LU7A 3T3PE 2ESVA 1BPVA 1MCQA 3UTZA 1QVOA 4DQOH 2BFVH 4ESKA 3MV8A 4A6YL 3IFLL 3KXFE 4XP5L 3C60C 3H9SB 4PJIA 5CILL 1ZLSH 3V6OE 5J1AA 3QRGL 1D6VL 4KK8D 3ILQC 2W9DL 4QRQA 3WN5B 1CGUA 4ZUWB 1CXIA 1DVFA 3P4LA 5I2IA 4RQQB 4ZAKC 1M71B 2OTPA 4YH6A 4FQPA 4HBQA 4M5ZL 2PW2A 5H35B 1NGXA 4FA8A 1A64A 1H5BA 2EDYA 3MNVA 4NZTH 1K3ZA 1A6TB 2F15A 5TJWK 3A67H 3C5ZC 1ULVA 1ZLUH 2Z8RA 2PO6C 4PRPD 4X6CF 1XZ0B 4YBQC 1MFCL 1OW0A 3BJ91 1FLTX 4I0PC 3R0MA 4KDWA 4QGTA 2VLJE 5DJYB 2OS7A 4POUB 1YC8A 2R2HA 3VXRB 1X5LA 4WEBH 3EYUL 1UCTA 4M7JL 5D96B 3QO1B 4Y4KB 1HYRC 5ETUA 3C6LB 4GS7C 3DVNA 3IDMA 3GHBL 5ILTL 1FFNB 4NDMB 5HGHB 4MA3B 4CJ1A 1QYGH 3HNSL 3SKNA 4KDTA 5FUOH 1KOAA 3FQWA 5DA4A 5I8CA 3AM8A 1RV6X 2X2YA 5JXED 2W9LA 1T7XA 5BJTA 1SVCP 1ED3A 4LGSB 2BSRB 3GM0A 3U82B 1IAIM 3IS0X 4GRWE 5TDPA 1JGVL 4JHWL 2OBGA 4HWUA 1DEEA 3FRUA 1GOHA 5DD0H 3BZEB 2XN9E 3I84A 4U1HB 3SGDH 3QXUA 4N8CH 4I2XA 3GSNL 4K3JH 3VXOB 3KLSA 5DZNA 3O4LE 4LVEA 4O4YL 4DKFH 5HXMA 2P43B 2DM7A 1KBGL 3QUYA 3V4UH 3MQIA 2H41A 4G6JL 4F58H 4MAUL 2OL3A 3MLRL 1Q9OB 1JGEB 3BP7A 1UJTA 2I9LB 5GRUL 2CDEA 2AGJL 2GK0B 4Q6IB 4Y5XB 4YXHL 4KUZL 1TJIL 4M6NH 5GS2H 5HYQB 5IVZB 4BFEA 5CZVH 1A3RH 1R3LA 3VH8B 5C07E 4X5WA 5IWLC 5I8KH 4NO0B 3RWEB 2EDWA 3B9VA 4DK6A 5BV7H 2NQCA 4NUGH 4DGVH 5DJ2B 4JN2B 1N4XH 1FORH 5HI4C 3DMMD 1EHLH 1NC2A 3S3PA 2VDPL 3RY6A 2WWMD 4YAQB 4EQ2A 1DQDH 3U4BL 1QHPA 1JF1A 1JTOA 1ZLUK 3CFCH 1H3PL 1RJLA 3QUMB 4YHKL 5EN2B 4XWOD 1W0YT 4KV5E 5L6YH 4PR5B 1T04B 2NY1C 1B90A 4J3XA 4Y5VA 2DQHL 2XOTA 4WY7H 1HCFX 1JBJA 3ARQA 4JFFD 2FR4A 5C0CA 3QWRD 3AS3A 2R69H 1HWGB 2HKFL 4JPKL 1LO3L 4HPYH 3PJSB 1BZQK 5D7SH 4GAYB 1SMAA 5DHVH 5CSGA 4FS0A 3V8OA 3FQRA 3V5KB 3DROA 4Q9QH 4HCRL 1EX0A 3B8YA 5FV1L 3PGCA 5B3JF 4U3HA 4H88L 4FXKA 2VITA 4XP4L 4PLJD 3VI3E 2VDNL 1MWAH 1FYTB 1TZGL 4LP4A 3ZTNL 1P5UA 3CD4A 2JIXA 4MMZC 4JE4B 3Q0HA 2X7LA 4R4BA 3T2NH 2DQIH 1BQHG 2HMID 4YIQA 5ACMA 4IRSC 3NCYS 4JVPA 5C7XH 1IKFL 1QNZH 4PJDB 1K2DA 3MRMA 3SO3C 1DQTA 1IBGH 3D48R 3VXSE 1CXHA 2CR3A 1V7MH 2HFFB 3AS0A 4KXZH 2XQBL 5IFHL 3VU2A 5JZ7D 1DDHA 5MEPA 5I6XC 2JELL 4UIKL 4HWZA 1AXTL 4DN3L 4DN4L 4YFLF 2X4TB 2F54A 2ITDB 1AGBB 3KXFD 4S1DD 2GW5A 2ICWB 1JNLH 1HHJB 4Z77A 3PGDA 3RNQB 3VWJD 2VLRA 4JO1L 1RZFH 5GGUB 3H9HA 1H0DA 4MQTB 2GJZB 4C56D 1EXUA 5AZEL 1V05A 4EOWL 4Z7NE 2CIIA 3IDYB 3CPLB 1MI5B 3V79C 1G6RH 1I8LC 2ATKB 3AVEA 3FONA 4BK5A 3O3DB 3FOMA 5KSBF 1ND0A 3OJ2C 2ZCLH 1UA6H 4UT9H 1ONQA 3WIFA 1T1XB 4EUPA 1SBSH 4ALAH 1A3LL 3WUZA 1BQLH 4XBPA 1KGCD 3IRPX 2A9MH 1LO2L 1NBZB 5E8PB 2YD1A 3C8DA 1CFVH 3GHEL 4YK4C 1BREA 4ZS6D 1T5XA 4BELD 3A6OA 4XCYA 4LLVA 1RK0A 1I1AA 3K4AA 4HPOH 3SBWC 1UXWB 2EDDA 3RWIA 3QP3A 1GGCL 1RZGB 1IGFH 4NZRL 1JZ7A 5BVJB 1FFRA 3D1MC 2HRPH 4QOKB 4JFHE 4Y4FB 3HAEH 4AG4L 1IQWH 4XTRC 4KI5E 3ECBA 4YEEA 3LRSA 4KRNA 1AD9B 5DHVA 3MJGX 3WO4B 1MUJB 3G5YB 1NGQH 3PHQA 1GAFH 3KYNB 5DD5H 2YPKB 3RTQD 3QO0A 3CSYA 2X1QA 1G9EA 5HI3C 1H3WM 4W4OA 4HFWA 1A0QL 3B9KA 4POZC 4H1LH 1U91B 1BD2E 2P47B 2A1WL 5D7IF 3W2DH 3NTCH 3PWJB 5GRJL 1MQKH 2HVJB 4ZXBC 4WO4D 4IMKA 3H42L 3FO2A 2E7BA 3DUUB 3SDAB 3SY0B 2XN9D 1MVUB 5EO1B 5DURD 2CSPA 3MLUH 4MZ2A 4KJWD 1ZSDA 3S35H 3MXVL 4JM2F 5K9OA 1JGUL 1IL1A 2LE9A 4RNRA 1EMTH 5IGXL 4HK0A 1NCAH 3W5MA 4O9HL 3OKLB 1DSFH 1NDMA 3VFGL 4ENED 1FC1A 2Q7NA 2J1KA 3GI8H 1JJUA 3X13B 2IANE 4FNLH 3EO1A 3EO9H 4WRLA 1X5JA 3MNWB 4ZS7L 3L3OB 2VDLL 1C12B 1Y6MR 5A40E 4L8SA 1P7KA 3UPCA 3EOAA 2NZIA 4XNQA 4QRPE 2J6EL 1J5OL 4UV7L 5C0AA 4Y4HC 4JRXA 4OCMC 4MJ6B 3UTQB 5K9QG 4OZGB 2DIBA 2R0ZL 4QY8A 3L9RA 2AV1B 3VG9C 3BN9C 3V2AR 4DGIH 3LEYH 5IVXB 2UWEF 4OZHB 3ULSB 5I1JL 1YNTB 3KHQA 4F33A 1KCVH 3KPOB 4MB5A 4GRLC 4X7FC 2Q8AL 3S4SA 3P11H 1LO0L 5LGKA 4EN3D 4ZFOL 1G6RA 3UJIL 1QFWM 2BOCA 1S7VA 2MWCA 1YEJL 5F96H 5KJRL 3TFKC 3VXPA 2CRZA 1NAMA 4OI9A 1MPAH 3ARFC 2H9GB 5E8NA 1X5IA 1MY5A 5EO0B 4U05A 1BEYL 4K8RC 1ERNA 3NCMA 1S9VA 2FX7H 3ZE0E 5E00A 1C08A 3NABH 2NLJB 3QG7H 1QO3B 1IGML 2BVUA 1SJVA 2JK5A 2DRUA 2R1YA 1W8OA 2GJ6B 1TQCC 4NM4H 4N0CC 4LPUA 4GG6E 3TCLB 1WC7A 1IRAY 1XGQA 2GHWB 3HAEA 3NIGF 5JLZA 5KSAA 2YHGA 2VKWA 5LCVH 1WWBX 3MNZA 4HIEA 3MOAH 3NCJH 3L3HB 5CJOL 2YA0A 5E99L 4MXWL 3HE7C 4OM1L 3BGAA 5JIKA 5ENWA 5CSBA 2ORBH 5I75C 1GGBH 1U93B 4N8PA 4ZAKB 3LIZH 2H32A 2WV3A 1MHHA 2F58L 2YEZA 4AIOA 4NYLB 4GW1B 3BXNB 2RR3A 1L6XA 3C5ZB 5IVNA 4PGEA 2YMXL 3NZ8B 4F7PB 4L9LA 1IZKA 4PRHB 5BRZA 3SDYH 1NCDH 3TYGL 1GGTA 4I0PB 5SV3A 2GSIB 5B39A 2NZ9D 5A16A 1Q0XL 2VDKL 1A7PL 3S37X 3D39D 5EOCH 2OK0L 2XZQL 3BIBX 1JFQL 4GS7B 1RULH 2P5WD 3O6KL 5GRWA 4IDJL 1QRNA 3NA9L 2D4DA 2ESVD 5DSCB 4ZUSB 4KC3B 2FHBA 3P0YL 2D7NA 2NY7H 4P9ML 3FB5B 3BEWB 1WZLA 5KSUA 1ZEAL 1Z6JT 2EH7L 1J0JA 2DQGH 3TN0A 4R90L 1QPXA 1CQYA 3ARBB 2K9UA 5AWNL 5JXAH 4GKOA 4U33A 1Y0LB 1ZVSA 2FIKB 5T5FH 1I9RL 4OF5A 4F57H 4MA7H 5D7JC 1MCHA 2VXQL 4WW2C 4R96A 1DVFD 4YEFA 5FFLA 1I7ZB 1BJ1H 5E1AA 3NAAL 2G9HA 1KN2H 4XPAL 3VXMB 5FHAL 2QBWA 2ZCHH 3NIFE 1FVEA 4TVSa 3FHAA 5IFAL 2AJ3A 3VRJA 1U8LB 3ZDYF 4KQ4H 5A1AA 3QH3B 1P6AB 4HF5H 5DC0A 3L1OH 4WTZA 4MSWA 2QQKL 4NO3A 4R8WH 3RWHA 3RUGB 4EVNB 2P24A 3TF7C 3UROR 5FOJA 3DPBA 5DC9B 5KBNC 2GQHA 1ZVHA 3QXWA 1FFOA 4M62H 1DQJB 3SE3C 4KVCL 5T3XD 2Y5TB 4TUJB 5AG8A 3DRTB 1AXSB 2ICWI 3U6RA 4HXAH 1CLOL 5DJ0B 3I50H 4X4MA 2QKIB 4P5MB 1JPGB 4O2EB 3Q6FB 3QFJB 1I9JL 1Z2KA 2O5XH 3LS4H 2DKUA 1KELL 3MRIB 3STZB 3BPLC 4X6FB 1I85A 1TITA 2BNRB 4XH2A 5BXFB 4P2OD 2B0SH 3KG5A 1FNHA 3L3IA 1H3TA 1A9BA 4HIJA 1UACH 2CRMA 3OB8A 4Y2DC 4M3KB 2BOBB 1AI1L 1TQBC 4AENA 1AE6H 2XKUA 1TLKA 3R06B 4JFEB 1OB1B 3MV7B 5HHOE 4MX7A 5KN5B 3PWNA 3HUJB 5C2BH 2BY0A 1DN0B 3QUYD 3QDGA 4YXKL 3NCEB 1T1WB 5HDQH 4PJBF 2R8SL 4JREC 4PJ7E 2HWZL 1I8MA 2B5IB 4GKZA 5CJQL 4IIQC 4JDVB 3SGJA 1VGKB 2X70B 2M8XA 4AEIL 4QHMA 3F65A 1CZ8L 4NCC2 1WBXB 1I9IH 3R1GL 1F3DH 3Q5YA 4QKXB 3D18B 3FT3A 3B4NA 3SKMA 5ICXA 3U1SH 2BRRL 4U1MB 4S1DC 1BJMA 5E2WH 5C0AE 2DL9A 1YUHA 4HWBL 2OLDA 4KMQA 3TBWB 1SEQH 2NXYD 3V6OC 5DI8B 3RX8A 3BKJH 3CAFA 3EFDL 3HMXA 1LHZA 5HY9B 1FGNH 1RJYA 4MAYC 4WW1B 3D0LA 1FAKT 3MUGB 4G9FB 3O9WA 2MQCA 1NC2D 2Q8BH 1G9MH 2KPNA