3UAJC

Crystal structure of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
220
Chain Sequence
EVQLLESGPGLVKPSETLSLTCTVSGGSISDFYWSWLRQSPGKGLEWIGYAHSRVSAYYNPSLKSRVTISVDTSKNQISLRLSAVTAADTALYYCARQGTGTTGVSEDSFDLWGQGTKVIVSLASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVDHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein
publication title Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.
pubmed doi rcsb
source organism Dengue virus 4
molecule tags Viral protein/immune system
total genus 39
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC01
5I19L 5D5MA 2FH8A 2Z35B 3ZHLA 4KAQH 5F7DA 4JFDD 4OBSA 5EU5B 4UNTA 5CJ5A 3K4DA 4NRYB 1S7TA 3C5ZD 3QBTB 4JQIH 4GG6E 5D72H 4APQA 1WIOA 3IXAB 4U1IB 2I26N 3PDDA 1BPVA 3ILPB 3VFRB 4CU7A 4X9GA 4JFHD 2NY1B 4QYOA 5HHMB 2VDKH 3I6LE 4I18A 4DGYL 5D1XB 5L9DH 2O5ZH 4S1SL 4UNUA 5DQDH 5JZ7C 2FX8L 3MLYH 4JPVH 2VKXA 4FS0A 1CR9L 1TJHH 2R4SL 1A1MB 2D03L 4H8WH 2PTTA 1EEYA 1HINL 5DC9B 4M1DL 4PB0L 4WFFD 5HGHA 1SJHA 4U1HA 1EHAA 3KPTA 4G80B 3MLRH 2X9YA 1LWRA 2H8PB 1FFOA 3HS0A 4Q9CA 2SEBB 1ACYH 2CIKB 3E8UH 2A83A 2AK1H 1GGCH 1OTTD 3QQNA 5ITBH 5DUMH 1B2WL 3BSZH 3MOQA 3TH4T 1K5NB 4Q74A 4XPAL 3P11H 5BRZE 1AP2A 3WS3A 4HUUA 1CFVL 2PYEB 4OZGE 4LLVA 5I1DB 3W5MA 3GKWH 2EE6A 1CD1A 1AXSB 5F72S 5T5FH 4J3UA 2GFBA 1HZHL 5C0BA 1E4WH 2JCCB 2PYFA 5CZXD 3QUZD 3NABH 4RMTA 4JGJA 1K2DA 2V5SA 4QF1A 2P5WE 1S9YA 1QSFE 5T1DL 4KK6D 2KQNA 3MC0A 2OJEB 1C5DB 3UX9B 1RI8A 5CD5C 4ODSL 4OFDA 4LKXA 5C09B 4KJWC 3ARFB 4YFLI 1CZ8H 2XG4A 1JWUA 3T04D 5F88B 2XKNA 5MEOA 3E0GA 5CSZB 3QHFH 1SBSL 2UZYB 1IFHH 1UENA 3Q6FA 3VCLB 3L7FB 1EGJA 3EYQC 3MLZL 1RIVL 3IF1B 5EIVA 1H8NA 5CWSB 1UCBL 1ND0B 3V4VL 1VB9A 3BD3A 1AFVH 1BEYL 3LMJH 5EZIL 3GSNL 3BRFA 1R3KB 2ADIA 2W60B 1I9IH 3FONA 4KQ3H 3I6KB 3WDJA 3MXVH 3D6GA 2ZUSA 2QR0B 3K2UL 2JJTA 5C0CE 1JTPA 1U3YA 4O02L 4Z7WE 3GIZH 2FSEB 4X6BA 1TITA 1AGDA 2UWEE 3FZUC 4WO4B 1WC7A 1UB5B 2WLZA 5D93C 2IQ9H 3ALWA 3QDME 2A6DA 3QCUL 3ZTNH 1XF1A 3WFEL 1XIWB 3FO9B 4NHCH 1ORSB 3DO3A 2NY3B 4IRSA 4HT1L 3BW9A 4NO5B 4ZAKB 4PJBA 1H3PL 4NJAL 3LEVH 1CGWA 4QXGL 3NFSH 1MQKL 2X4UB 1N6VA 1DQMH 1TJGL 3P4LA 4NGHH 1SJVA 5IGXH 1TZIA 4C58B 4WUUD 2UVEA 1NGXB 2P47B 5AYQA 1LE9A 1U42A 2R0ZH 3D69B 3OKYA 2X5PA 1I9EA 2KZWA 1DBML 1ZLVH 5A2JH 2F15A 4HLZG 4FQ1L 1RZJH 1J0JA 4HGWA 4JJ5A 4JVPA 2UY6A 4JKKA 3TO2A 4NO3B 1XF5A 3MRJB 1Z2KA 3CSGA 2VLKD 4HCRA 4AG4L 3WKML 5KAQG 1ZOXA 5ICXA 5EO0B 3ROOA 2DWEB 4KRPC 1WZ1L 5F7NC 2YK1L 2GW5A 1UA6L 1EJ6A 3VGAB 4NKMA 2ID5A 4G42A 5C0AD 1NFDB 4NWUL 4JFPA 1U6AL 4LSVH 3EJJX 4A2MA 1TENA 5EB9A 3QUXB 5BQ7B 4X80L 4PLKD 5HD8D 2VDPH 4G6JL 1Q9KB 4DVBA 4JM4L 5F7DB 2JJUA 4R2GB 5F3HA 1Q9LA 2W0FB 5DMGC 1FJ1A 4PJ7E 2XG5A 2HP4A 3BPLC 2APBA 3G9AB 5JQHC 2F53A 1HCVA 1MLCB 4K9EL 4OM1H 1N5YL 3L3OB 1G7HB 2BNQD 1WEJL 4I18B 5D71H 3TNNA 1XR8A 4OZIE 1X5ZA 4M7JL 5FGRA 1JZ3A 3TYGL 3RVWC 4R7DB 1Z9OA 3DBXA 1UXWA 1WCQA 1BFTA 2WBJB 4Z8FL 2XTJD 2NY2C 3MROA 5IVXB 1SJHB 4HUNB 4LCCA 2YD6A 3JV0A 1NLBL 4I1NB 1CE1L 3HS0B 3VXOB 1DL7L 3FN0L 2HKFL 2NY5L 4ETYA 4ZYKA 5CGTA 2JJSC 5FUOH 2AJYH 1BQLH 3V6OE 5IB3A 2AKRA 2IAMC 3WS3B 4PJ5A 3RTQD 4XP4H 5DJ0A 1IKNA 1IM9B 3SGKA 1B0RA 4JKPH 5K9QI 3D0LA 4LCIL 4R4BA 5C0BB 1A6ZA 3U0PB 5BW7C 2QSCH 1BIIB 3VJ6A 5IQ9A 5IHZA 1YYLH 4QF1B 4G8GA 5F9JB 1PSKH 4YR6A 1QLFA 1V3KA 4NRZA 4XNQA 4CMHB 2Z31B 4OFKA 3FQWA 1G7LA 1GGUA 4MJID 1BAFL 3LRGA 1CK0H 3DXAE 1AGFA 3DSNA 4FFYL 4KPHH 4Y5VC 3SCMC 1JWUB 1YEKH 3FKUS 4L8CB 1QVOA 2VC2L 2Z9TA 4KTDH 3IVKA 4LSSL 4M5ZH 4Y0GA 4YXLH 1F4XL 1F42A 1PX4A 3FB5A 3IETB 2FIKB 3KPOA 4M5YL 5GRVK 4X8XA 4AIXA 2P8PA 2HWZH 4WW2F 5DUPL 4ZO8A 4PY8I 3UTPD 4MX7A 2DLHA 1CQKA 4F8QA 2Z8VC 1QBAA 2IANA 2ADIB 1ZAGA 3FONB 2HVJB 1EFXB 5DJDA 2ZJSL 3DUUA 4WFED 3GHEH 3LV3B 2C9AA 2IC2A 3X3FH 5JHDA 1I85C 3EYVA 2IBZX 4J2XA 4F8TA 1P9MC 3O6FA 1JGEA 3IB4A 1YJDH 1J0ZA 1WC7B 3PJSA 2LABA 1N0XL 4PRAA 1DN0A 3F12A 2YD4A 4URTB 5IJKA 5C0GA 3DVIA 3C60B 1NC2D 1GIGH 2CJUH 3OJ2C 4MD4A 3BW9B 4PRIE 4XAWL 4LASH 4RGNE 3MLVH 2Y07H 1RD6A 5E24E 3MJ7A 1PEZA 4S1RH 1A4JA 1I3RA 3VXQA 2PTVA 5DHXB 4ZMAT 3O4LA 3VG9C 1TZIB 3AVEA 4K3DL 5IFAL 5DA0B 1ACZA 4LAJH 2HFGH 4WY7H 4HJGB 5KVEL 5CCKH 2C1PB 1VFAB 1LE9B 3O6ML 4FNLL 4YHYC 1NKOA 2P43B 2P49B 3GRWA 1FFNB 2YRLA 1YECH 5ALBH 4FQCL 1R0AH 4R90L 3TC9A 4MAYA 4HGWB 4MD0B 3TO2B 1WCBA 5HHVH 2AQ2A 3MACL 5JW3H 5GRYA 4NYLA 2R29H 4EDWH 6FABH 2IGFH 4F9PC 3V9FA 3SOBL 1KCVL 4XBEH 2X4OB 4CJ0A 2W38A 4NKMB 4G42B 3OJDA 4KKAD 2YD3A 5CZKA 2BVPA 5EDXA 1HH6B 1MCOH 5EBMA 3TZVD 4K2UL 4CN1A 3IDJA 2CO7B 2W9EH 5F7EH 2YPVH 1Q9LB 1KJ2A 4UTAH 1BD2D 1X5HA 4ZFGH 5C07A 1FJ1B 4KTEH 1JRHI 4P2RB 3WO4C 1HDMA 1ZE3C 5D96C 4LHUG 3C9NA 3MODH 4RDQF 5T1KB 2B2XL 3C09C 1NCDL 3EYSL 5E5UB 2EH8H 3TFKD 3GBNH 5E8EA 4UV7L 2VB5A 5GZOC 5FCUH 3VDCA 4YXKL 3WLWD 4P23D 4G6FB 4JFQA 3CH1A 3ZDZE 4JFDE 5ICYB 4WU5A 4LCCB 3LS5H 4XNUL 2O5XL 4LSUH 4DKEL 5CBEB 3U2SA 1E4JA 2CSPA 4JFHE 5FV2A 4PRPA 4ZYKB 2EC9U 2OJZH 1F3JA 1TIUA 3ARDA 3PV6A 4I3SH 1GYAA 2X1OA 2D0FA 3MGAA 4DGIL 4POZC 1CD0A 4KK9D 4PJ5B 1I1RA 3VFUA 4PJ8D 5J6GA 3CSYA 4YWGL 1BVLA 1PDKA 5DJ0B 2VIRA 35C8L 3EFFB 4X6EB 3TT1H 5L8KB 3QFJB 4FMFA 2R0KL 3SE3C 4R4BB 3E1F1 1U8IB 4AH2A 5FUCC 5L0QC 4XNMA 2VH5H 3HE7A 1EK3A 4OJFH 5EU6D 5IHZB 2EDQA 4G8GB 2FBJL 2HRLA 5CP3H 5DQ9A 1AO7E 2R56H 4XNQB 1C7TA 3T1FA 2Y1VA 3HG1D 5HVHB 1I3UA 4PJXE 1G7LB 1FDLL 4MXWH 1JE6A 4WWKA 4M6ML 3FT4A 1UZ6E 2AABH 1AGFB 5MENA 2DWDB 5DJAA 1NEZA 3MLPA 2XWBB 3CFBA 2B1HL 3PG2A 4QRRD 1EEUA 1JF5A 5IW3A 4DN4L 1OD9A 1QVOB 2WK2A 2XRAL 3EOTL 4GRLB 2NY6B 3LN5A 3DTXB 1TJIL 2VITB 3LB6D 5JR1L 1AHWC 4FFWD 3V0AC 4ORZC 1X5IA 3HNTL 4D2NA 3RL2A 4JFFD 4OLVH 2ADGA 2V2XA 2Y06L 1JGLH 4LSRH 4MX7B 4OI7A 3LKNA 5D7JA 2IANB 2GAZB 4WW2A 1V7NL 5I8KL 3T08A 2ARJB 4JDVA 1U58A 5DJDB 5E94B 1PVHA 4K9EC 3WUWB 1I9RL 2MQ0A 3ARGD 4IEFB 3BT2L 5IESL 3O3UN 5AWNL 3SE8L 1JGEB 4AEIH 4CN4A 2XZCL 3TT3H 4NQED 3PJSB 2BK8A 5B39A 2E27H 4PRAB 1DN0B 2AK4A 3F12B 2RCSH 1CXKA 1ZA6A 1K4CA 1JHKH 4OLZH 4X83A 3V6FA 2VR5A 5TQ2L 1A7OH 5C2UB 3CLFH 5F6IC 4QHKI 5FK9B 4ALAH 5IB1A 1ZHBA 2ADFH 4P4RB 2NY5C 5DD5H 1XGUA 4WFGE 1MPAH 2VDLH 4JDZB 5D1QA 3HUJB 2V9TA 2AI0L 5KTEL 3QCVL 1BJMA 1QYGL 3O4LB 5DD0L 2A6JA 2CMRH 3NN8A 4OLYH 4NOFA 1VESA 3GB7A 1S5IH 1C12A 2CLVA 3R1GH 4MCYA 4XBPA 5F9DC 3QHZH 5IWLA 4O58H 3U7YH 5ALCH 4GAGH 5A16A 2IFFH 4EBQL 5BV7H 5IFJA 4U6HA 4E0RA 1T03L 3STLB 4HJ0C 3G5YA 4JRYA 4MAYB 4C83B 4RX4A 4HD9A 1WCBB 1CGTA 2X41A 3WHXB 1PG7X 4NYLB 4M7KL 3MV9B 3QIWC 3FO0H 1QFUH 5F96H 1OAXH 2HG5B 2EIZA 4N5UA 4FQQB 2KQMA 5DSCA 3TBYA 3OJDB 1JN6A 2NY0B 1CDUA 3BP7A 2JK5A 4Y5XC 1OAZH 43C9A 2F58H 3I50L 4CJ1A 3HC4L 5EBMB 1T22A 1VA9A 2Q3AA 4OLXL 5K9KA 3WJLC 3PDOA 5J4MA 4X9BA 4Q9RL 1FAIL 4YLQT 5HYQA 3S34H 2J8UB 2I27N 3T0EA 1VERA 2VLKE 2QADC 1HDMB 4XVTH 1SYVA 5ACLA 2FL5A 3BPNC 4Y5YA 4HC1A 5E8EB 1ZANL 2NZ9D 3FB6A 4L3CB 1OWRM 1Z6JT 3QWQB 2ZPKL 4PJGF 4GXVH 1I8LA 2J12B 4LRNL 4I3GA 2HYMA 4JFQB 1JYVA 3BDXA 3CH1B 2IADB 1AY1H 3D9AL 4FABL 4ELMF 5DURD 2DJ4A 1A9EA 3SBWA 5I1IH 5GGTH 1RURL 5KANG 5DTFA 5D7KD 4OIAA 4XCEA 1L7TH 4QHNA 2BNQE 4PRPB 1AJ7L 3RWIA 2NY1C 1OQXA 3EDJA 3LEXA 4YHLH 3PV6B 5D1XC 2ZKHH 3ROLA 5C0IB 3MSPA 3RFZC 3QIUD 2IPTL 2OLDA 4H20H 1RUAL 4I5BA 2XTJE 5GPRA 1ZS8A 3VWJB 1INDL 3PWJA 3QDGA 3TJHC 3BX7C 4RISH 2VIRB 2G5RA 1EJOH 5B8CC 1FV1B 6CGTA 5TQ0L 3VFNA 4JY5H 5T3XD 4HJ0D 1A3RL 1DQDH 5E2TH 4AH2B 3LZFL 4XNMB 1ZVYA 3F7VA 3HE7B 2J88L 4NO2A 2ADJA 4UOJA 5GHWL 3MGTA 4P3DA 4U0QB 4LSPL 4LVEA 2QQNL 1K9TA 3SKUD 5DQ9B 3LIZL 2BVTA 1L0YA 1V5JA 5KSAA 3UTTB 1UACH 2X4QA 3T1FB 3LKQA 1BM3H 2APVA 3TLRA 1NFIA 5AZ2H 4F58L 4F37K 3BESR 4WWKB 1NBQA 3PQYE 2VXUH 3FMGH 3FT4B 3LKPA 5TDOB 4G7VL 4UT6L 3FT3A 3CFBB 3OAYK 5IW6B 4X6DA 3HAEA 5EO9A 2I25N 1JPST 3P4MA 4JO1H 1JV5A 4XPGH 5I75B 1IL1A 3D39A 3V4UL 1CL7H 4M61B 1A5FL 3ZDYF 3EJZC 4X6CF 1UVQB 4HCRL 4YFEA 2EXWD 3P30H 1HQRA 2V2XB 3QAZB 3H3KA 3C8HA 4FXKB 4P3WA 4DVRL 4JN2A 1FYTD 3LKNB 1A6UH 4M1GL 1U8LA 3IFNH 1QFHA 3HRZA 4ZSOE 4OQTL 1U58B 3ARFC 4WTWA 4RFEA 5FIEA 1ZT4B 2QSVA 1WWAX 3O2VL 3BP4A 3M07A 3VG0L 4I3RH 1TFHA 4B53A 3FQTB 2OR7A 2DQHH 1NH6A 4UDUA 1UM6H 1SVCP 2JELH 4IOFD 1MCHA 2PW1A 3H42H 3HE6A 4W81A 3BWAA 3K0WA 3V6FB 3L3GA 3R06B 3SDYL 5IBTL 3CX5K 2VTFA 4JHAH 5IMMA 3HI1A 5HHXH 3FQXA 1U93B 4FXGB 1ERNA 1QFOA 2VN7A 1P4IH 2AJSH 2BERA 2PR4H 2HT2D 4OSUH 2HRPL 3VXSE 3IDXH 3NIFF 3NN8B 2VLMD 4WO4C 3GB7B 1MCDA 1C12B 2CLVB 15C8L 4MCYB 4HWEH 5A16B 1XH3B 4N0FA 1XIWC 5IFJB 2DTML 1W0YT 2KH2B 1A21A 2NY3C 1N2RB 5E1AA 4E0RB 1OAYL 4HWBH 4OF8A 3EW3B 4JRYB 1XF4A 4Y4FD 1FCCA 4ZAKC 3QNXA 3ULVC 3BUTA 1MFCL 2NLJA 5TPWH 4MNHB 4JKLA 1XR9A 1BFSA 1WF5A 4Z9KB 4OD2A 2E7BA 5C2BL 1FZOB 3HC3L 2EIZB 5DSCB 2VDOH 4WEBL 5HGAA 2IQAB 1FL3A 1JN6B 3I9GL 2DQIL 3MRMB 1RZGA 4JB9L 3W9EA 3TV3L 43C9B 4FP8H 3WE6A 3UMTA 4U33A 3O2DH 3UPRA 2COQA 1F97A 3HAEH 1LP9B 1BMGA 3ZE1F 5EUOE 5LWYL 2Y36H 4FQJL 1N7ML 1L7IH 3BGFC 1M7DA 2FL5B 1KLUA 3VGEA 4Y5YB 3UROR 1S9VA 1NUGA 1VGKB 4LPWA 3VGAC 1A3LH 4FRWA 1OL0A 4I2XE 4QGYA 5KVFL 3VXTB 4YH6A 4ODVL 1HOCA 2X7LA 5KVMC 4PJGA 5CSGA 1BD2E 1D9KB 1P2CB 3DX7A 3KPRD 1PLGH 4X4XA 2H6PA 2CDGA 1A9EB 1AR2A 2DQEL 3QDJA 4LPYA 3L3HA 3BZEA 3ZO0A 4ELMA 4QKXB 4QHNB 5EOQL 5LCVH 3PWUA 4NT6A 2ICEB 3V5DA 4JDTH 4GKNA 3LEXB 5IV2B 4I18C 3QI9A 2VUYA 3QIBA 3MYZA 3IKCA 2DMCA 4OCXH 4NUJA 1DLHA 2EE3A 4X98A 1T1WB 3BPOB 4OQ1A 2B0SL 4HXBL 4I5BB 4PLJD 1ZS8B 4OCWH 1OAUH 3QDGB 5E4IA 4RNRA 3D1MC 5LBSH 3OTTA 2NY3D 2PNDA 1E27A 5BS0E 5E8DH 4OLUL 3H0TB 4XP1H 4G9FE 3MJGX 5BVJB 4LLQA 5EN2B 3MYJB 2WUBH 3D25B 4P3DB 5FGBC 1JJUA 1EEQA 1SQ2N 4M9PA 4U1LA 2X4QB 3N1GC 4FFZL 3LKQB 3BDYH 4ACPA 1NFIB 3NAAL 2GSGB 3W2DH 3LKPB 1IGCL 4PV9A 3RX7A 3LH2L 5A2LH 4IMLA 2HFEA 2DYPA 3QISA 5GGSA 3WIFB 4X6DB 4EUPA 5JHLL 1KEGH 3L5JA 2VAJA 3P4MB 3MV7B 1BQHA 4GMTL 1IL1B 5DS8A 3L5IA 3MA7A 1IGJA 1PKOA 3HMWH 4UIMA 4LLUA 4HK0A 4F3FA 1QSED 3BN9D 3FFCE 2GUOA 4Y16B 1HQRB 4JVUA 4L4VA 4NM4H 1Z3GL 4X6CA 4HS6A 3JTSB 3TA3A 1FZKB 3GJFK 4IRZL 2CQVA 3N9GH 5DK0A 4BQ6A 5FB8A 4AM0A 4M6OH 3ZT7A 1WISA 3QUXD 4L1HA 4AK1A 3HRZB 4QRRE 5KS9E 2XXCB 1IT9L 43CAA 4R2GD 5IK3B 4PJEA 2FGZA 2Z92B 4FHBD 5JNYA 3KPQA 1T66C 4UV4L 1MEXH 1T83A 5KJRH 3G08A 5C0RH 3QWOA 4Q58C 3F58L 5D70L 1BFVH 4I0CC 4OZFH 1WFNA 1Q0YL 1N5AA 4PJIF 4BFBD 4JFFE 2PW1B 4E41B 3VFOA 2V17L 4HG4J 4JRXA 1CDHA 5IB5B 3OPZH 4TOYH 3V7AG 4PS4L 3L3GB 3MRFA 5DJXA 2JTDA 1CGSH 3BKML 2AEPH 3W11D 5E7BA 2AERT 2WBJD 3A6CH 5HGBA 3TM6A 3UTOA 4PJFF 1EUTA 2F5AL 4PJDB 3K3QA 2JJTC 5FYKU 1MHPH 5GRZA 2H2SD 3WIIH 2DQUL 5AD0B 4NQEE 5GGUA 4NQCA 3VXRE 4JGUA 4KVNL 3MMEA 4GW1A 4N5ED 4F7EA 4XH2A 1QSZA 2PW2A 2HT4D 3FOMB 4HPOH 4N0FB 5SV3A 3STZA 1DSFH 1RVFL 3ZL4H 3BHBA 3MGOB 4IRSC 5E1AB 2BXYA 5FYLL 1KBGL 1XF4B 3WFHA 4P3CH 3LDBB 4XCNA 1IM9D 4J4PD 5DT1L 2V2WA 3P77A 1G6RB 2DN7A 1OM3H 2CUMA 3GMRB 4K7FA 1IJ9A 3N50A 5E6IA 4LEXH 5EU3A 2EDFA 1KNOA 3QEQD 2GK0A 3CVHA 3L3DB 2Z31D 2J2ZA 5HGAB 5F7YC 1IQDA 1DBJH 3WE6B 3VFTA 5GRUL 3UPRB 2EDHA 4OGAD 1OAQH 5DFWH 3FN3A 2W65A 1YY8A 4L4TB 3U30B 3DGGA 4OAWA 3SDXF 4JZNB 3WIHH 1JPTH 3MOAL 4CVZA 5AZEH 1KLUB 4KFZC 4TUKH 4NQXB 4M62L 3VXUD 5GRJH 1S9VB 5C0FB 1SY6A 4N8PA 4WFHD 4C59B 1OSPL 3ZKNC 3HB3C 4ZODA 3RJDA 1VGEL 3Q0HA 3ZYZA 1HOCB 2X7LB 5ISZA 5ID0A 3OAYH 5CJOH 1FL6A 3RWJA 5GGVH 3DX7B 1DQLL 1Y18A 4HJJL 3S88L 4NQDA 2YUZA 3BI9X 2H6PB 4X4XB 2FJGA 3GBML 3L3HB 3BZEB 5JW4Q 3R4DA 4O9HH 5ADPH 3RDTD 3AUVA 3DO7B 2APTA 4F33A 1VFBA 3V5DB 4GKNB 4M7LT 3QI9B 1A7PL 5EWIL 4NUJB 1TTUA 4FMKA 4X98B 5GS1A 5SWZE 1NDMA 1P4BL 2J4WL 3OKKA 3PWVB 1P69B 3LQAH 2F54B 3CNKA 3QG6A 4RNRB 4V1DB 3C60D 1RHHA 4LCCC 5LGHL 5A3ID 1YYMH 5HI4C 3CCHA 1HHHA 5IKCB 3HMXH 2NXYB 3G6AA 2GEEA 1OCWH 4K8RH 1MIEL 3BKCL 1A6WH 2OL3A 1QNZL 2JF1A 4IRJD 3OR6A 2YHGA 3D3VD 3O6LH 5HDQL 3TPUB 3BISA 2V2TA 4XB8A 2CXGA 2XIDA 3MJ8A 4XWOD 3T2NL 1UWGH 4BH7A 5AAMA 1IKNC 1W72L 2BRRL 2C7UA 1U8MA 2ICCA 3RZCA 4Z7VF 2WIIB 1S5HA 3F62A 5F3BA 5I66B 4Z7NE 1A2YA 5DVLA 1BHGA 1UM5L 1A22B 5C3LD 1FRGH 4QGTA 1MUJB 4WHYH 4LLUB 4KU1A 4HK0B 4F3FB 2GUOB 1JIBA 3CGTA 3LS4L 3VXMB 2OMBA 3T0AA 3UJTH 3IU4H 1JNNH 5I1AA 1DUYB 1YN7A 3BZ4A 5DK0B 1CICA 4YO0B 1MI5E 5D2NA 4PR5B 3WXVL 5C70A 3I3EA 1D5XB 4ODUA 1MREH 4YDKH 5JOPE 2HMIC 5E5MB 5T1MA 1MRCH 1Z0MA 43CAB 4PJEB 4LQFL 4W4OC 5SWSA 4OZ4B 2NY6C 3PHSA 4P2RD 1TZHA 1WAAF 3G08B 3BMVA 2Y23A 5KVDH 5GGQH 5T1KD 3KWWB 1JMXA 2M1KA 3G04A 4MS8C 5AEAA 3VFOB 5CEZL 4OF0A 3UAJC 5BJTB 4U3XA 4PJIA 4LPVA 5HDBE 1IKFH 3MRFB 3INUH 5JXED 3W9DA 1JGDB 3EHBC 3EDEA 1ONQA 3A6BL 5TE4L 4FG6C 3HI5L 5JLZA 4PJFA 3VFVA 3WFBH 3RWFB 1F3DH 1KC5L 5E2VH 3HC0A 4E5XB 3KYKL 1XF2B 3NCBB 4XH2B 4UILH 5KOMC 5MHSE 4MDIA 5IJKC 1FG9C 4XPBL 4DFIA 3BHBB 5IOPA 1IGFL 1IM3A 1IAOB 4UB0H 1AQKH 4JHWL 3WFHB 5EOCJ 3EYUH 5HI3C 3VRLE 2DICA 4A6YA 3P77B 1CU4H 3NA4A 3UJJH 1BBDL 3QFJD 4D0DA 3RZWA 5DK3A 4K7FB 5M7QA 5FGSA 4PGDB 1I7UB 3QXDA 3HZVB 5D8JL 3JV6A 2FJFA 2EH7L 2GK0B 3CVHB 4GAYA 3LY6A 3RY4A 2XWJA 5IBLD 1J8HA 5J12B 3O0RH 1RUQL 2HAZA 1IQDB 1T89A 5I74B 3VFTB 4LK4A 3ARWA 3DLQR 4FQ2H 2W65B 4MAYC 4S11A 4OAWB 1JF1A 1XGQB 3LQZA 4M00A 4O2CA 1ZTXH 4CVZB 1V3MA 4GRLD 2YPLD 3QO0B 3SDXA 4FN0A 3EYFA 4TTDC 4UBDC 2Q86A 1L0QA 3IAQA 5DD3L 5HI5D 2PO6A 2R39A 4W6YB 1MCWM 1VENA 4QNPE 4JFZL 1CGUA 4MMXC 3PWPE 3V4PH 3UAJD 4BFEA 1UH2A 5CILH 5ISZB 5ID0B 3VH8B 3RWJB 1FSKB 4G8FA 1JRHL 2FJGB 1U8QA 1NJ9A 2XNAB 4JFXA 3DX6A 2X2YA 1JGUL 1QLEL 4F33B 1MNUL 1VFBB 1G7JA 2NX5D 3LPWA 1XGRA 3JWOC 2VDRL 1CL7I 2VXQH 1KTLA 3GJFH 3MFFB 2DLEA 5GS1B 1NDMB 4XHJD 1QD0A 3LRSB 2EICA 1MCBA 3VGHA 4LCWD 1JK8B 3OKKB 3K2MC 1A6PA 3ET9F 1AGBA 2VLRD 1WUNT 3WJJA 1RHHB 2IF7A 1P7QA 4J12A 1G6VK 1B88A 3CUPA 3DYPA 5K9OA 4CBPA 4F7PB 4KDWA 3QPXL 5JA8B 1RZKH 4XNYL 5BMFH 2BVQA 3JV5A 3G6AB 4MJ2A 4B41A 1VHPA 4UINH 3CMGA 1KB9J 5F97E 4TULH 1SEQH 4OM0L 2OL3B 5KW9L 2EEBA 4LPUA 5J11B 3KPPA 2V2TB 5I30L 3RA7H 1IGYA 2KZ1B 4UUJB 4P4KD 5GGRB 3VRJA 4BH7B 2Z8SA 3IS1X 1N59A 2MKWA 4BSWA 4NNPL 5GS3A 3KDMA 4LNVA 3AROA 3S3SA 1A47A 1S5HB 4OFVA 1LQSR 5EC2A 3WFCH 3W0WE 1A2YB 3D5OF 4Z7VA 1ZHLA 3HE7C 3P9MB 1NEZG 3IJYA 3GSOB 1BJ1H 3LKOB 1V7MH 4S1DC 1G6RL 1Q9WB 2IEPA 2UY7A 4N0RA 4Z78A 4HPYH 4ZUSA 2AJVL 1BX2A 3H3PL 2EKSA 4U6XA 3MV9D 3QO1A 5EG6C 3SY0B 3QRFM 2O5YH 1KJ3L 1T7VA 4TQEH 4XBGA 5I1AB 4Z0XA 4OF6A 3SE9H 4WWKC 4D3CL 1L6XA 3BZ4B 1CICB 4YBLB 4LLYA 2NY0D 3LHPL 3VDBA 4ODUB 2NY4D 4GW4A 1YPZE 3EJYC 4U1GC 5T1MB 3EOAA 4Z7QF 1MAJA 1KLGA 4CDGC 5I75C 5C1MB 4LRIA 5SWSB 3MLXH 4MB3A 4YXHH 3WDIA 5CKAA 4U1SA 1FO0A 4U4BA 5L7XL 4FQLL 3L3KA 3KGRA 3AS2A 4XP9L 3TBTA 3RUGF 1MAMH 1VSCA 1MH5A 3V5HA 2H32A 3BAEH 3NA9L 4PP2A 4GG6B 5GIRA 3G04B 3DECA 2BOBA 2H9GA 2J6EA 3BD5A 3QAZC 5INDA 4NC2B 4XVSH 3O6KL 1R5WA 3AMLA 5T1LA 1JFQH 3I02A 1RULH 4D9LL 4F2MB 1EAPA 1MHCA 2A6IA 5D7JC 1F45A 3W9DB 4HH9B 4WW2C 5B39G 3BPCA 1DVFA 1ONQB 3F6IA 3UPCA 4Y8DC 1AQDA 1KIPA 3P9WB 4TPRL 4HIJA 1RAMA 3AM8C 4PRDA 5JLZB 4PJFB 3VFVB 4JQXA 4ONGH 4MMZC 3FN9A 3HC0B 4K55A 1T0NA 3VMPA 5DMKB 2DDQH 5GS0H 4MDIB 4OFYA 1OHQA 5IOPB 5FYLD 5I1HH 1ES0B 1RMFH 3QHTC 3QJFA 4J8RA 5K59F 3VWJD 2A9MH 5BRZB 4PJCF 5GZND 4KAQL 5GSRA 4D0DB 1YA5A 5D1QC 1WK0A 2Y9RT 3QXDB 1F5WA 3NACH 4YUEL 3JV6B 2FJFB 1T7XA 2Q3ZA 5GGRY 1EO7A 4JQIL 5D7IF 1A7RL 5D7LE 5EBGA 4GAYB 3EO1B 2X1XR 1FE8L 1IAKA 1J8HB 1H8OA 3FQUA 4WRLA 5KSBF 4AL8H 1MCLA 4RAVB 1RSFA 3VFPA 2VDKL 5IWLC 2P5WB 5L9DL 2O5ZL 4JPVL 1QSFB 2WWKT 1TJHL 2B1AH 1RPQA 5FKAB 4H8WL 1JF6A 5I16A 1JF1B 1TETH 1YQVH 4O2CB 3MLRL 3SDXB 1QG3A 3C6SA 2BSRA 3N1PC 4FQXA 2D0GA 1RZ7H 5CP7A 3ZMRA 5F9AC 2AK1L 1RV6X 3K4AA 3QRGH 3QQ9C 3OXRA 5ITBL 4W70A 1KEMH 3BSZL 3SE4C 4ESKA 4LGPB 5I17B 1C5CL 3Q1SH 2VQ1A 1NC4D 4RDQG 3OQ3B 1YN6B 4I77H 3AREB 3PP3K 3ELAT 4GH7B 5DJ2A 3N0PB 4G8FB 4MJ6B 5INCA 3PXJA 3GKWL 1U8QB 5DYOA 1NJ9B 3QDAA 4M1CC 5B3JE 4LLMA 5T5FL 1NAMH 3DX6B 5FYKH 3X3GH 4JM2A 4I13B 4XGZB 2LU4A 4Y5YC 1E4WL 3SKNB 2FO4A 1G7JB 3C6LB 5FHAL 4WFHE 3NABL 1S9WA 1IAMA 4M93B 1ETZA 1KTLB 1EFQA 5HVGB 5I0ZA 2R4RL 1I8LC 3QNYB 3RNQA 5F1KC 4JKMA 5MEPA 5IB4B 1FNSH 2ICWJ 1AD0B 1DDHA 2FHBA 2X70B 3ULUD 2BNRA 2IFGA 1P7QB 3QDMB 4MA3A 3N85H 3VWKA 3CUPB 3BEVA 3NH7H 4AZ8A 1LHZA 5K9OB 5M94B 3SBWC 3RVTC 2DS4A 3QXAA 5I18H 5IHBA 2XQYG 1DJSA 2BVQB 1H3WM 4LL9A 1AE6H 1B3JA 3THMH 4C4KT 1IE5A 3FFDA 2P5EA 4OLEA 1BF2A 1CDJA 4LKCA 4PJAF 5HHOE 3QHFL 4X99A 3DRQB 2EXYD 3CJJA 1YNLH 5IMOA 1CGVA 3PGCA 3KPPB 1G0XA 1VKXA 4YHPB 2NTFA 1IFHL 4NFBA 3BPOC 4PRHA 3QPQC 3UJIH 2VLJA 3VRJB 5B38A 1N59B 4BSWB 1A14H 5EFIA 4ISVB 2R2CA 1AFVL 3LMJL 1FHGA 4R26L 4Z7VB 1C1EH 1I9IL 2FD6H 5DFTA 4KQ3L 1I8MB 2O61A 1GC1L 1FL5B 1S7UB 4KH2A 4Z78B 3HAEG 4ZUSB 5I76A 1BX2B 2EKSB 5KSAC 2IBBA 1T5XB 3HLAA 4YPGA 3I75A 5F9OH 5HGDA 4KY1H 4O2FA 3CVHL 1NBVH 4NQSB 4OLWH 2YBRA 4E42A 1I3VA 2X89A 4GW4B 2KBGA 4Y4KD 1ZA3B 3ZTNL 3EOAB 4QHLA 1S7SA 2VISB 2UVFA 2WM0A 2DKUA 4PJHE 4F57H 5DVOA 1KLGB 5DFVD 2KKQA 1ZSDB 2V7HA 3BQUA 4G7YH 4BH8A 5CAYB 4PJ9A 2N4IA 1U8OA 4NN6B 3TBTB 5L2KA 3LEVL 1G7IA 1MCKA 4BQCA 1KPRA 3NFSL 1MH5B 4KVCH 5CEZD 1DQML 3RUGA 4ZS6D 1GPOH 3IAGC 2BOBB 4Z7UE 5IGXL 5INDB 2YUWA 1R5WB 3ILQD 2MCPH 4MWFA 3UTSA 2NYYD 4KV5F 4OZIB 3BPCB 5EU4A 2R0ZL 1DVFB 1G84A 4HH8A 4MJ5A 4PD4K 1AQDB 1D9KD 4XMKH 1YQ2A 4HIJB 3HN3A 2V5YA 1RZJL 1B0GA 2XZAL 3GM8A 3EDKA 3NVQA 4XXDB 3C5ZA 3K81A 3HCVB 3OL2A 1T0NB 1RUPL 3HE6C 1GHFH 1DLFH 5LQBH 3CD4A 1DTUA 1EZVY 1GOHA 3F7YA 1DE4A 3QJFB 4J8RB 4LSVL 1ZHNA 3BKJH 3MLTB 5E9DE 5IEKA 4NKDA 5D2LF 3V79C 2VDPL 4OF3A 3CFCL 5GSRB 5DEFB 5TE6H 4PJCA 4MNQD 2Q1EA 3B2VH 5IJVA 2W9LA 2QHLA 4XNXH 2EO1A 5KN5A 2HTKC 5D7IA 4XMLH 3CX2A 3VFPB 2OL3L 3JWDL 5D71L 5JTWA 4K7PH 1B4RA 4W68A 2Q8BL 5KSBA 3TGXA 4PJXA 3EUUA 2NR6D 5DR5L 1HH9B 4L8DA 5IM7B 3LDBC 3RBGA 2X1PA 3MV11 1FORH 1QRKA 2M2DA 5F1IA 3MV7D 4XPHL 5H35B 3PIQA 4XB7A 3GIVA 32C2A 4UAOB 2BSRB 5EBWA 3L3IB 3O8XD 4U2ZA 4L8BB 5BZWB 1R5VB 5E6ZA 1F4WL 4QOKE 2AV7B 2PETA 4Y16D 4DKDC 5DJ6A 2AJYL 3RGVB 1BQLL 2H26A 1KUMA 3FHAA 5JW4N 3DRTB 5DJ2B 2I9TB 4MGXA 4TUOB 5INCB 1U3HB 3B9VA 3U30C 4ZPTA 2VQUA 4JO3H 3MRKA 3S3JA 3MJ9A 2GJ6E 3VRIA 4ONFH 3IAPA 5TFSH 4JKPL 3AXLA 4LLMB 4PTTB 4DGVL 4XVJH 4X7DC 4JM2B 4G6AD 3B5TA 4NRXA 2QSCL 2VL5A 3MNVB 4PG9B 3U0WH 3AS0A 3ECBA 1YYLL 1ETZB 2A9NL 1PSKL 4YHMH 4E41D 2FB4H 3RNQB 2IWGA 4DTGH 1DDHB 2ZSWA 4MA3B 1URLA 4N0YH 3BEVB 1FP5A 1QHOA 1T3FB 4GAJH 3FO2B 4FFVD 4K3JH 1RK0A 3QXAB 1LD9A 3GSUA 5JUEH 4PRIB 1YEKL 1UKQA 4RGNB 4KI5C 3S36L 2P5EB 1HKLH 1SYSA 4KTDL 2R2EA 4LKCB 4ONHB 3QI9C 4X99B 4FQIH 4M5ZL 1UCTA 3PGCB 5FO9A 4LCUA 4PJAA 2NTFB 1DBKH 2BHYA 2X6MA 4PRHB 2VLRE 4XP5L 5B38B 1LEIA 3BIKA 2JE8A 2APFA 2AXGA 4ODWB 3OGCB 2YA2A 5DD1H 4OIBA 1IEBA 3MA9H 2NXYC 2X1QA 5EPMA 1AD9B 4EUPG 3GHEL 2P42B 1T04B 4R7NA 3ZE2F 1HXMA 3X3FL 1BQHG 5CEXA 4R4FH 4XC1L 4EQ3A 1N4XH 5HGDB 5I6XB 4K3EH 4KROB 5F9WC 3PL6B 3X11A 4GUPA 2WANA 3NFNB 4WUUA 2YBRB 4LF3B 4E42B 1PJ9A 3U6RA 4MHHG 1KB5H 4MB5A 4QHLB 1KCRL 4D9QE 1UEMA 1PGRB 4OZHE 4P59H 4BUHA 5HY9B 3WN5B 1QFPA 1GIGL 2CJUL 4L4TD 3TBVA 3TIEB 4LASL 1JBJA 3GO1H 1CFBA 1HQ4B 1U8OB 5L2KB 5DO2D 1CF8H 1OT2A 2VLKA 1T5WB 1LO2H 3TA3C 2RHEA 2AW2A 4H26A 1WFTA 1Q94A 2HFGL 4WY7L 3D0VA 5C0AA 2V9QA 5EU4B 5SV4A 2C5DC 3QUMA 1S3KH 4MJ5B 3K4ZA 2J8OA 4H1LA 3LEYL 1YECL 5ALBL 4B50A 4JFDB 1T83C 3MRQA 1B0GB 5J9PA 2OI9B 4U0RB 5LJYH 5IQ7L 2EYSA 2R29L 1M1SA 3QP3A 5E7FA 4WJ5B 4EDWL 6FABL 2IGFL 1T1ZA 4XBEL 3UPAA 5C6TH 3UBXA 5HHQA 1Q8MA 1Y0LA 2Y6SC 3PP3H 3F7YB 1DE4B 3B9KD 1H8SA 2E5EA 3MV8E 1ZHNB 2F54D 4MVBD 4QRSB 4V1DD 1MCOL 4NKDB 4OV5A 4YX2H 3VFWA 2BSSB 4P9MH 3DUSB 5D6CB 4UTAL 3N06B 4PJCB 1N64L 5D2LA 3NCJH 4ZFGL 4GRWE 4KTEL 4UQ2A 1JPSL 5IJVB 1N8ZA 3VGBA 4GSDH 5KN5B 4BELD 1X4YA 2PXYD 4LAQH 4UOW0 1AO7B 1TZGH 2GIYA 3CVIH 2VE6A 2EDKA 4PJXB 5FCUL 2K3TA 5DK2A 4L8DB 1I7RA 1FC2D 3GJEA 3RTQA 2VZOA 2BJMH 1GC1C 4AJ0A 1ZT1B 1HIMH 3GIVB 32C2B 2OZ4A 5DVKA 5J13B 4AT6B 3ZKSD 3QUZB 4Y19D 4R96A 4XCFH 4IIQB 5SX4H 4NCC2 1G9EA 5DRZA 4LHQB 7FABH 4XI5D 2OJZL 2ZCHH 4RFNB 5E2WH 4FZ8H 3VXMD 2DL9A 1DANT 4I3SL 2XY1A 2EEAA 5I74C 4O5LH 4MJIA 3RHWF 3ORJA 4IJ3B 5A2KH 2G2RB 3GMPB 3KXFD 5CINH 4ZPTB 3C5JB 4PYHA 3IYLW 3MRKB 2E7LA 3T0XA 1G1CA 3AXLB 3KPNA 3TT1L 4PBWD 1D5IH 3WV0A 3ZE0E 1CG9A 4D0BA 2VH5L 4HWNA 5JW5A 4OJFL 2P8LB 4U31A 3X12B 2VOTA 5EOTB 3QEGH 3U36A 5B4MC 2J1KA 2YUVA 4A2LA 2NQCA 1INEH 3G5XA 2ZSWB 4MXWL 1FSKC 4TUJA 2ZUQB 2AABL 1RJLA 1RZJC 1BF8A 3ZYOA 1RK0B 1WSST 1LD9B 2DLFH 3GSUB 4Q2ZA 5F7KC 4RMRA 1KJMB 5E0QA 1R24A 4Z6AT 5IMKA 5JIKA 1SYSB 3WFZA 2R2EB 2ICWA 1I8IB 3VXNA 3GFUA 5EORH 1Q0XH 4HV8B 3K46A 1ZWIA 2QKIA 4HUKB 5GS1C 1TCRA 2AXFB 4QHUB 1Y6MR 2MFNA 2JJSA 4JFEE 1TCMA 1LEIB 3SJVE 3BIKB 3CXHK 4OLVL 3X13A 2AXGB 2K7QA 4OUUA 2XN9D 4NO0D 1Q1JH 2NNAB 4CNIB 3KJ6L 1CQYA 4ODXA 1NC2A 5C92A 2ILLA 4WUKL 4JR9H 3OB0K 1U8JA 5EPMB 4UT9H 4APQD 3FQNA 3WXWL 2RR3A 2GSIB 1HXMB 4U1MA 1AI1H 5HYJD 1OGTA 5CEXB 3JWDC 4DOHE 1JNLH 1KF9B 4XVUC 1PBYA 4GW5A 3MZTA 3TT3L 3X11B 2BMKB 3RPKA 5ACZA 2I07B 2EYTA 2EDBA 2RCSL 3KS0J 2OBGA 3FOLB 1JHKL 5E56A 3MJ6A 3TBVB 1MHEB 1T80A 3CLFL 1SM3H 4NQUA 5ICZA 4ALAL 4Y5VA 4NKIH 5ACMA 2ADFL 3IS0X 5DD5L 4BZ1H 1MPAL 3M17A 2VDLL 1ADQH 1S7VA 2VLKB 5E08H 2G9HB 2P8MB 1CICC 1Q94B 1S5IL 2IPKA 3D0VB 4HLZH 5C0AB 3TCLA 3GBLA 1XGYH 4P9HC 3QUMB 4O58L 5ALCL 4GAGL 1FCGA 3X17A 5DRNB 4U1JA 4DAGH 3TZVA 4H1LB 4OFIA 1NAKH 4MQXD 1IAIL 3DYMA 2WWMC 3KPSE 3MRQB 1R5IA 4GBXB 5E6YA 2VJXA 3UCRA 1W8OA 4O4YH 1KXTB 4YGVA 2ED8A 3RAJH 3ZZ1A 1I85A 2WUCL 1UYWH 5JIHA 5I2IA 2BNQB 1P9MA 5F96L 1B9ZA 2W9DH 3HZKA 5E99H 5DWUL 3UBXB 5HHQB 1Y0LB 4N0CD 4MD5B 1X7QB 2D9CA 1NCNA 3BZDA 4P23A 3CFJA 4OV5B 4HK3J 2XTJB 4GKOA 3PABA 2XQBH 1K6QL 3UTZA 2VZVA 4UQ2B 3B8YA 4XVTL 2RBLA 4YC2C 3O3BA 4HUVA 4XXCA 3H9SA 3O45A 1C16A 5EZLA 1CVRA 1WGOA 1C5BL 3ARXA 3HFMH 3M8OH 2R9HC 2CDEB 5GJTH 3OKNA 4Q6YA 3LRHA 1IC7L 3WEXA 1N6QH 4PGEA 1F00I 4YAQB 5DK2B 1EX0A 4GXVL 4PJ8A 1JPGA 3KPMA 3PQYB 3GJEB 1QR1A 4Y1AD 4KJYA 3CSPA 1J86A 1AY1L 5C8JA 2E6JA 5CEYA 3QFDB 1BZ7A 5I1IL 4NZUH 2ITDA 4KQ4H 4Q9BA 1HCFX 4R96B 1KENL 2WSKA 5EU6A 1L7TL 2XI9A 3MLWH 5GRVL 5CJQH 4YHLL 2ZKHL 4GFTB 1T89C 3HG1A 1J1XL 1DANU 2X1WL 2IBZY 4MJIB 1I7TA 3ZT5A 2OCFD 4H20L 3MXWL 1OGAD 1P4LA 5BXFA 3VI4E 1OSZB 1W0WA 1MLBA 3DROB 4RISL 1EJOL 1CI5A 1NANH 3KPNB 4TRPL 2ZNWA 4JY5L 4ZSOB 5HYEA 4HKXA 3QCTH 5E2TL 5I1CH 1CG9B 3RVVC 4D0BB 5TE7H 4KHTH 3DOSA 1DEEB 3A6OA 5BO1H 5JW5B 3OKMB 4KRLB 1U8PA 1UFUA 1G9NL 3MBED 1F3RB 1NGYA 4GRWH 5EC1A 5EIIA 1F13A 1MAKA 4HS8H 4I9WE 1BM3L 3AFLA 3BGMA 4XTRD 2DTSA 4JFFA 4P0DA 2VXUL 3GSNA 3L7EA 2HTLD 3D48R 3FAWA 1BBJB 1YEJH 3T0BA 1XGPA 2YR3A 1R24B 4JO4H 5JXAL 4XPGL 3Q3GB 1MIML 3HPJB 3C6LC 4IBLT 2EDRA 2ICWB 1BP3B 3CFIC 1NEUA 5BOPA 1CL7L 1JTOA 4M93C 1ZWIB 4JE4B 4TSCH 3QEHB 2FX8H 2E8ZA 1Z9LA 4NQEA 3EGSA 4Z5RA 3X13B 1YNTB 4Z76A 4QRTA 1D3CA 4XP6H 2XA3A 4ODXB 5BRZD 2VO5A 3R0NA 2VABA 1MY5A 1XT5A 3FQNB 2FLRT 4U1MB 2FX9L 2HN7A 2CUIA 3SE3A 3KHQA 1RU9H 2MWCA 1DUZA 1WIPA 3BD4A 1UZ8A 1DN2A 1C8PA 4QXUL 3V0WH 4GW5B 2CDFB 4XPAH 1UM6L 3IDIA 1KPUA 1LK3H 2JELL 2MJWA 2P5WD 5EOCL 9CGTA 1GZQA 2X4NB 4X8JA 2WIMA 4LIQE 4QT5A 4QO1A 4QRPA 1QSFD 4G8EA 2ZSVB 3MLSH 1U8HA 3MBXL 2B5IB 1FVDA 2CRZA 2H41A 5HHME 3M17B 1S7VB 1NGPH 1H0DA 1P4IL 3GKZA 2BY1A 2PR4L 2X4SA 4OSUL 4YK4B 1P84J 4S1QH 1AHWA 4M7LL 1GL4B 1XCTA 2V9RA 3TCLB 2BNUB 3SDAB 2OMNA 4HWEL 1AGCA 5F8RC 4N0UA 4ODSH 5I1KH 3ARED 4RMWA 1YY9D 3TZVB 4WIQA 1BD2B 5D4QA 4NN6C 2WINA 5IBUB 5TPWL 5FECA 2Q76A 3QJHA 3B5GA 3PUCA 3OXSA 3C5SA 3HZKB 1BOGB 5C0CD 2VDOL 2YN3A 1T1YA 3TP4A 1ZEAL 3RU8L 4WTZA 4ZPVA 1FG2A 1DVFC 1FBIH 3ARZA 3MNZA 4FP8L 3CFJB 3B83A 3CDGB 3NIDF 4L3ED 2JCCE 3PABB 2BHUA 3KNBB 1CFNA 4WNQA 3K2UH 5FDYA 1BVKA 4J7RA 5BS0B 4H5SA 3NCYP 5DHVA 1Z5LB 1PW3A 3GUTA 4HUVB 3VW3H 4NPYA 2YD9A 5J8OA 3O45B 5GGVY 5EZLB 2HT3C 4FTVA 2VWEE 3QXWA 5JOEA 3QCUH 5DGRA 4EN3D 3OKNB 3WEXB 2UUDK 3QIUA 3V6OC 1VDGA 3BXNA 4H0IA 2GCYB 3ES6A 3VFGH 2DMKA 4PJ8B 1NCWH 4HT1H 3KPMB 4U6TA 4KJYB 4UIKH 1QBLH 5C8JB 1P1ZB 5CEYB 3KLDA 1K4DB 1PLGL 1S8DA 4P5TD 3O6FD 4UU9A 2ITDB 3JXAA 4P99A 2PTUA 3RWDA 4P5KA 4CN6A 5IHUL 5LCVL 2RQ8A 1K8IB 4HXAH 2H3NA 2X10A 1CFQA 1Q72L 3FFCB 3ZKQD 1P4LB 3SKOA 5BXFB 4QTIL 3B3IB 2D31B 1MLBB 5LBSL 4WDIA 1UXSA 1EDQA 3OB0H 1PZUB 2H1PL 3TNMB 4QRRB 4S2SA 3IFPB 5E8DL 5IMLA 5KS9B 5J6HA 1AR1C 1QRNA 4UAOC 5HDOA 1TTGA 2CR6A 3U46A 1IC5L 4C57C 1E4KA 2WUBL 1U8PB 2YK1H 5EIIB 5EC1B 5F7LB 3LAFA 4QHMB 4R8WH 1U6AH 3WL9B 3BDYL 4JFFB 4X80H 5I1JL 2R1XB 4G6JH 2GQHA 2VXTH 4JM4H 2ZUVA 3L7EB 3W2DL 1NFKA 1FYTA 1U3HC 4TYUA 3TF7C 3ULVE 2Z4QA 4NIKB 4MYWB 2Z35A 3O41A 4JQVA 4HBQA 1KEGL 1UJ3A 4JM2C 4K9EH 5EU5A 3K74B 3MCLH 3ARGB 4HS3A 1S7XA 4NRYA 5GXBB 3IXAA 5T33L 3HMWL 5J1AA 4M7JH 3GMNA 4NQEB 3VFRA 3STBA 3VXRB 3PXHA 1MCSA 1SJEA 1P5VA 3TYGH 4WHCA 4TSAH 4Z76B 1J0KA 3N9GL 4QRTB 1E6OL 4M6OL 5IVXF 2YRZA 1CE1H 5B38G 2VABB 4KZEH 4RGNC 3DUHA 2UV3A 4G80A 2ESVE 3V52H 2H8PA 1DUZB 5KJRL 4RAHA 5C0RL 4LLDB 2CIKA 2QTEA 1NFDE 3GJFB 1I1AD 4XPFH 1HKFA 3SDDD 3IDIB 5D5ME 4QT5B 1K5NA 1QPXA 3OPZL 3PGDB 4G8EB 4TOYL 1JHTB 1QHPA 2CD0A 3GSQB 4O00A 3V2AR 4LP4A 1CGSL 1JTTA 2AEPL 2HLFD 3MRCA 1U8HB 2PYEA 5I1DA 3DXAD 1FVDB 3RIAK 2DM4A 2VDQL 1NGZB 4Y4FA 2HJLB 2ZUUA 1A6VL 5CGYC 1AXSA 1AGEB 2BFVL 1AR1D 1H0DB 4R0LB 2OZ4L 1U0QA 1MHPL 2X4SB 5I6XC 2Z0BA 2Z8RA 3S6CA 1AC0A 4KROC 3RBSA 3PL6C 1BAFH 1XCTB 3RWHB 3VI3F 3RGVD 3FTGB 1AGCB 1MCFA 3RI5K 3T3PF 5CIPA 1DSFL 2FATH 5ESVA 3WN5C 4JEGB 3ZL4L 2OJEA 4HMCA 1HXYA 2FIRT 1U3HD 3BQUC 3U4EB 2VC2H 1GAFH 3QH3B 2GT9B 1KFAH 4PJ9C 2FH6A 3ARFA 1G9NC 2WINB 1OM3L 5F88A 2Q76B 4BK4A 3I2CL 3QJHB 2FECL 4LEXL 3OXSB 4K23H 2YMXH 4H0HB 5DUPH 1T1YB 3VCLA 5SX4I 3L7FA 4ZPVB 2ATKA 5KZCB 1BZ9B 5CWSA 1WWBX 1ND0A 1PX3A 5C0BE 3MRDB 4LIQH 2ZJSH 5DUBB 5C0DB 1S7QA 1YEGH 1PKQA 3KPRA 4GT7A 1R3KA 2W60A 4HIIB 1BVKB 4WI7A 4LPTA 3I6KA 2BVYA 5DURB 4OT1L 3LQMA 4PRID 4PREA 5E8NA 4ZTPL 3SKJL 2OI9C 4U0RC 1W0VB 5AZEL 1BVZA 4TUKL 5GRJL 2FSEA 1BQSA 4WO4A 3QIUB 1UB5A 4HZAA 3BXNB 4XAWH 1MVUB 1JNHA 1XIWA 3FO9A 1ORSA 4UNVA 1K85A 5CJOL 4XAKE 4PPTA 2D7TH 1F11B 1S8DB 3ARYA 4UU9B 1I3GH 4O9HL 4P5KB 5JDSA 1OTTC 3MCG1 2O93L 3HI6L 2I9LA 1CFQB 3O6MH 1IZKA 4JCMA 1F6FB 3SKOB 1OLLA 1X9QA 5E00B 4Y1AE 4FQCH 3TIDA 5FA4B 3LQAL 1MI5B 5IB2B 4WDIB 4YQXH 3MACH 4OGXH 3DVNB 4ZNEA 1YYML 5IMLB 1OP9A 3U46B 1WIUA 5J13C 4NO3A 5CZXC 3HMXL 3QUZC 3MRJA 4TVSa 3SOBH 1KCVH 4IIQC 4K8RL 5E2JA 3I85A 1MF2H 4RFNC 1QSEA 1WTLA 3O6LL 4G9DB 4HF5L 4LLAA 4X6FB 4KK6C 5JMRA 1HSBA 3BFOA 3U7WH 3VFSB 4IJ3C 4YHOH 4KI1A 4OB5H 1MELA 1FYTB 4PJBE 3N1FC 1UWGL 3OWEA 2Z4QB 3QUXA 4OUOA 5BQ7A 1WICA 3E3QE 1Q9KA 3O41B 2P4AB 4IDJL 1YDPA 4YJZL 1UJ3B 3SEPA 1J12A 5T3ZE 2W0FA 2B2XH 4HS3B 3Q6GL 1S7XB 1VEMA 4KK5D 2ZOLB 1NCDH 4NQTA 3EYSH 1FRGL 4DK6A 2EYRB 1F4YL 1MLCA 5EZOH 3OZ9H 5J1AB 3L3OA 1G7HA 3GMNB 3P40A 5JPNB 4BQ8A 1SJEB 2A6KB 3UJTL 3IU4L 5IW1A 1N26A 1JNNL 4YDJB 2BOCA 4KWUA 2ZUQC 4XNUH 2FDBP 4R7DA 2XA8H 4YDKL 2O5XH 2YXMA 1MRCL 2WBJA 4EI5B 5IVXA 3T77B 3L5XH 4MQTB 1EMTH 4Z7OE 2FR4A 1LILA 3PF2A 3VXOA 1LO5B 2VXVL 4HKBB 4UTBH 5FGBA 2F19H 2XACC 1V3LA 4DGIH 1OLZA 3NZHH 3L6FB 1AO7D 2KL6A 4HUWA 2W1NA 4ZO9A 1FNGB 3T3MF 1DBBH 1IKFL 35C8H 5CHNA 1T6WA 3MRCB 2NMSA 3SDCD 3ZDXF 1MQ8A 3BUYA 2F53E 4Y4FB 1IM9A 4J4PA 1AC6A 1D5ZB 3NZ8B 3RRQA 4LGSB 2VDNH 4M3KB 3ULVH 1KCUH 2WBKA 3U0PA 3DVGB 1GGYA 3WFBL 4H88L 2NY7L 1BIIA 2CK2A 2C3GA 1CLOH 2G75B 4NFCA 5J3HC 5E2VL 3RGHA 3QEQA 5F9JA 2UUDH 2R1YA 3MREA 1E28A 1RY7B 4Q97A 1RZFH 2Z31A 4UILL 5F6HI 4IHOA 5CIPB 5ESVB 1OY3B 5AG8A 1HXYB 2MPAL 4UB0L 1ZT7B 4DN4H 2Q6WB 2A77H 3EYUL 1XAUA 3EOTH 1UWEL 3UJJL 3U9UB 3GSXB 3OV6A 4L8CA 4H1LG 3SO3C 3MFGB 5SWQB 4G43B 3VXUA 1RIHL 3IETA 2FIKA 5DQJA 3B2UD 2ATKB 4P49A 2NW2B 5FYJE 3CXDL 4PLKC 3WNNA 5HD8C 3UBXG 1S7QB 5I73B 4FQ2L 2EIBA 1PKQB 1I9RH 3KPRB 2HVJA 1EFXA 5IESH 5J1TC 4PREB 5E8NB 3LD8B 3WD5H 3BZFA 3RKDD 3LPFA 3RDTA 3TBWB 1NANI 1ZTXL 3LV3A 2XZCH 1CDYA 4WFGD 4U2YA 3MPCA 1T2JA 3HA0A 3PHOA 1UGNA 3TCXA 1EA9C 3NPSB 4X7TB 3AS1A 5TQ2H 2B7DT 1V3JA 5CZVH 3V4PL 4L3EE 5C9JA 5CILL 1JNHB 1QUNA 2XTJC 3C60A 4K3HA 5HJ3B 3SQOL 3OKOA 5JMOC 2AI0H 4MDJB 3HUJF 5KTEH 3QCVH 3ARBD 3W0WB 3KYAA 5JDSB 2NXZD 4KJPD 3P0YL 3VMOA 2I9LB 2A73B 4IOIB 1A64A 4WCYH 5J3HD 4IRJA 4Z18A 4ZXBB 3B5HA 3D3VA 2IANE 2VXQL 4HJGA 1TQCB 5IR1A 1W8NA 5CUSH 2J5LB 2C1PA 1VFAA 1T03H 8FABA 4RBPK 3TIDB 4LSTH 3RTQC 2DQCH 4LSQH 5JHDE 1FFNA 4HMDA 1YPZB 4UOW1 4C56D 5AYUL 4G6KL 4M7KH 4MD0A 3S35X 1RZKL 4MJ4A 1KIRB 4UINL 4TULL 1SEQL 5I8CA 4YHKH 1QSEB 3I6GB 4DZBA 2X4OA 1HSBB 3HC4H 4J3SA 4YFLF 5HPOA 1JZ7A 1M7IB 3MOBH 1E4XL 1FAIH 3RL1B 5F71A 2BRQA 5I1LB 2E7LC 4OQTA 1HH6A 2J8UF 2VN4A 4PY8J 1YMMD 1J1PL 3CFDA 1CYGA 1YDPB 5FXCH 5CSBA 4RRPA 4GBXD 1FPTH 4Q9QH 4JZOA 4P2RA 4QTHA 4KZDL 1V7ML 2AEWA 1IVLA 1R6VA 4HPYL 5T1KA 2RIKA 3ALPA 1B4JL 4WI5A 5FAAA 1X6LA 4LRNH 5IW1B 3S37L 1Z9MA 1EGJH 4WI9A 3RWCB 2BOCB 4CGTA 3N1MC 3RJQB 5JXEA 4KC3B 3WNPA 1G0YR 3KLHD 1OB1A 3O2WH 3ZT6A 1RURH 5ICYA 1FVCB 4O2EB 3MLXL 2FR4B 4YXHL 5I0DA 5CBEA 2DBLL 1A02N 1CD8A 1FFRA 5DJZB 1MAML 5DRXA 5I8EA 1F2XK 3BAEL 1CTOA 4NJ9L 4WEMB 3UC0L 5D7LB 1HYSD 3S7GA 4HUWB 5DMJB 3PP4H 4XVSL 5B22A 1JFQL 5CHNB 1I4FA 1MOEA 1UC6A 5C07E 3H7BA 2DOCA 4LDOB 3PQYD 2QEJA 3BUYB 3LOWA 3QDJD 3OX8A 1MFDH 2AV1A 3EFFA 3BMWA 4X6EA 4LSPH 3EO0B 4G3YH 3QFJA 4NHUA 5T3XL 1U8IA 3DSFH 3T0WA 1EEZA 1OTUD 3QIBD 4JCLA 4ONGL 5T3ZH 1P6FA 5A43C 3QEQB 5TF0A 3MREB 2R1YB 2X4PA 1E28B 3L95A 2DDQL 2CKNA 5DLMH 4G7VH 4IHOB 1I8KB 4NQVB 5I1HL 1RMFL 5L88L 4EZMA 2DWDA 2B5IC 2CUHA 4I0PB 5EH1A 2A9ML 2XWBA 5K9JH 4R97B 4UQ3A 4K7PY 1IGML 4GQ9H 3WUZA 1D6EA 4K8RC 2LU7A 1A1NB 1LEKB 4W4OA 4GRMA 1JHLH 4DFHA 4HCRH 3H3BC 4GRLA 3NACL 2YPLA 4YK4C 3DTXA 2OTWB 3VXUB 2WP3T 2VITA 3QWRD 3G6DL 4DVRH 3SDAC 5DQJB 4MQ7B 3L1OH 5HHNA 1KB5B 4KKAC 4HFWB 4YFDB 4OGYL 5JOFA 3TZVC 1A7NL 2B1AL 1M7XA 3BYTA 1JI2A 2N1KA 2GAZA 4AQ1B 2ZCLL 5HYSB 1I75A 3O2VH 2ARJA 2OP4L 4EIGB 4RGOH 5E94A 1YQVL 3BZFB 2A0LD 3RDTB 5JORB 3WUWA 1RFDH 2DIJA 4JG0L 3GGWA 1JGVL 2Y5TB 3Q48A 3PHOB 1F90H 2NX5A 1RZ7L 3TFKC 1CTNA 5HHOB 5MENE 3VXSD 1KEML 3SDYH 5IBTH 4GG8A 5GQBA 4JPKL 3WLWC 4P23C 3ULUF 5I71B 3Q1SL 4LCWA 5C9JB 2EE2A 3C08H 4XPTH 1RUKH 2VLRA 4JN1L 1JZ6A 1A3QA 3OKOB 4FZEH 1R3HA 1QOKA 3DHMA 4HFUH 5FK9A 4P4RA 4XXCC 2XKSA 4JDZA 3RIFF 3HUJA 4M4PA 2UYLB 2HFFB 2I24N 3OJVC 4IRJB 3DHJA 3X14A 2YEZA 1ZGLM 3SGEH 1X5FA 3D3VB 3MUGB 8CGTA 5IR1B 4KK9C 4PJ8C 4CADB 4LDEB 3D85B 8FABB 3DMMD 5D7SL 1FNSL 3ETBF 5FFLA 1E6JL 1OAKH 5FYJH 3STLA 3O11B 4PJHB 3TVMD 4C83A 5I18L 25C8H 4N1HB 4WHTB 3UP1A 4HULB 4K8RD 4JY6B 3WHXA 3HC3H 1A4KA 1AE6L 4NQCD 5E8OB 2EDXA 3THML 1WWCA 2JIXB 2AK4E 3DV4B 4WEBH 2AJUH 5HSFA 5CLWA 4GAFB 1QR4A 5I8CB 3MV9A 1JZ5A 1YNLL 4DZBB 1G9ML 2HG5A 3TV3H 2FEEI 2FX7H 4FQQA 2VERN 4JFOA 5C9KA 3SDAD 4Z7UB 5HVFB 5KVGL 4ZOAA 1UKTA 1QBMH 1LP9F 1LDPH 2R2HB 3DURB 4LOUD 3K1KC 3CFDB 4M48H 4M02A 2IH3B 2F5BL 2J8UA 4AEEA 2FD6L 1QLRB 4JZOB 2CLRB 5DI8B 4QTHB 4GOSA 1FQ9C 5LXGL 3LB6C 3KLAA 4X4ZA 4FFWC 4PGJA 1GXEA 5IVZB 1KPVA 1RJZA 1LO4H 4OBRA 5FHBL 5KVFH 5F9OL 4KY1L 4ODVH 1OARH 1PQZA 4L3CA 3SKMB 4PUBH 3BH8B 4OLWL 4ETQB 5DJYA 4PGBB 4TVPD 1HNGA 4P2OD 1OB1B 2XQYK 2DQEH 3O9WD 2E9WA 2IADA 1YEFH 2YZ1A 4JHBA 4BQBA 4Y7MA 1X5GA 3GHBL 5E9DB 3FO1A 5EOQH 3ARGC 5BS0D 4G7YL 4QHKJ 4KHXH 3TN0D 4G9FD 3Q5YA 1YEIH 1NBZB 1EXUB 1P53A 4NNXA 5I8EB 5DRXB 4KVCL 1U36A 1NMAH 4NOBA 1GPOL 2B0SH 4HXBH 5C0IA 5IFHH 2YD5A 2MCPL 1I4FB 2ZUWA 3DIFB 4X5XB 3H7BB 4KKBD 4MA7H 2H45A 3T0EE 3GNMH 1TMCB 3OX8B 3VWJA 5C7XL 2AV1B 1FV1A 3DGCR 2APWA 1U2CA 2I60H 4NHUB 1EEZB 5ESQB 3EDDA 4HDIB 4X4YA 3EAKA 4X7EC 1LE5B 2X4PB 1U41A 3L95B 3UTTA 1ZGLB 1GHFL 2JB6A 3FFCD 1MVFA 1DLFL 5D9SB 5LQBL 3GRWH 4WU7B 1NCAL 4X6DF 3QXTA 4AENB 5TDOA 4UQ3B 5A1AA 2EIDA 2UZXB 5IW6A 1D6EB 1KCLA 5KANI 1G0DA 4GRMB 2GJ6B 4R0LC 3PWNB 4PBVC 2ERJC 2YPLB 5J1SC 4PV8A 2OR9H 3IJSA 3AU1A 1Z3GH 1X4XA 3B2VL 4M61A 5ADOH 1IGTB 1UVQA 4XNXL 3F65A 4IRZH 4XMLL 5HHNB 3OKDA 3DI3B 4RBPH 4K7PL 3K80A 3T8XB 5JOFB 1NC4A 3RZCD 5I9QC 1HNFA 4FXKA 1IT9H 4I4WB 1JWMB 3G6JF 3LVEA 1KJ2H 4ODHL 4WTZG 3IDGA 5M95B 1FORL 2WV3A 1KN2L 3F58H 5D70H 4HQQL 5L8LB 1ZT4A 3PHQB 1QSVA 1NMBH 2OTUB 3GGWB 4JAMA 2D7NA 4NBXB 3AM8A 2DKSA 4EJ1C 2NX5B 2V17H 3FQTA 3WSQL 2NZ9C 3MCKB 3JWOH 3QB7C 4XX1G 3VXRD 3MO1A 4WI8A 4GG8B 2QQKH 1I1YB 1EO8L 1ODAA 4S0SD 4LCWB 2EDLA 4MXVF 4ZQKA 5FF6B 4YBHA 3R06A 1F6AA 2VLRB 3D39E 3RWEA 5ERWB 3U4BH 4LLWB 1R3HB 1XZ0B 4DEPB 1U93A 1IEHA 2WZPD 4PJDF 1Y6NR 4FXGA 1S7WB 5TFSL 3BPLB 1S7RA 4XVJL 1HEZB 4KVNH 1SVZA 1Y6KR 4ZO6A 1LMKA 4EQ2A 3X14B 2YEZB 3QIUC 3BRDA 1CN4A 2ED7A 3QUYD 2FB4L 3MRLB 5E4EC 4DTGL 1W72A 1XH3A 2IJ0C 4P4KB 1ORQB 3IFOA 1OTSC 4CDHA 4DKFH 1N2RA 4OIIL 2DQGL 3TYFB 5DVNA 1DFBL 5HPMB 5JUEL 2R8SL 2CPCA 1A4KB 4Q0XL 2CKBA 4ENED 4MNHA 1ZLUK 4Q7DA 3LSOB 4YBQD 2DQFA 4FQIL 1FZOA 4CRPA 2WQ8A 3IFLH 1MFEH 4JFOB 4PG2A 1DBKL 2IQAA 3IJHA 2M26A 3SE4A 3MRMA 2MHAB 3BKYH 2OX5A 2NY4B 1IBGH 4Y4KA 5DGQA 4C56E 5DD1L 1UWXK 1LP9A 2BHZA 3G5ZA 3MOAH 3DPBA 1X5YA 3MA9L 4M62H 1E4KC 2OXGA 4JPWH 2F8OA 2R15A 3KLAB 4LPCA 3BO8A 1KPVB 1RJZB 3DETD 5I1EH 2EXWC 1N4XL 4K3EL 1PQZB 1VGKA 4QLRA 5DJYB 1NSNL 5KZCD 5SWZD 1ZKAA 1YMME 1TQBB 3VXTA 1JUFA 1KB5L 1JVKA 2HLAB 4JQVC 3MV8B 4ODTH 4P59L 5TGBA 1UJ3C 1D9KA 1P2CA 1HHJB 3F7RA 2V5RA 3FO1B 1QQDA 1YNKH 3UTQB 4KI5F 3GO1L 2DB8A 1A7PH 3MNWA 3HZYA 4GRWB 1U9KA 4MAUH 2PO6D 4NNXB 1OP5K 1CF8L 2ICEA 5IV2A 1TLKA 4IOFC 4TNWF 1P4BH 1MWAA 1LO2L 3CFKA 4MA8H 3PGFH 1T1WA 2BDNH 3OJMB 5LGHH 4D8PA 1S3KL 4G6ML 1OTSD 4AMKH 4W6XB 3P3YA 4L3AA 3E6HB 3H0TA 2FBOJ 2VXSH 4MNQA 5BVJA 1TVDA 5FA3A 4XCCL 4X4YB 2HT2C 3D25A 3MYJA 1A6TB 5EN2A 1BWMA 3GM0A 5HDQH 4KKCD 1QBBA 5GS0D 4LFHD 2JB6B 4PJGE 3P2TA 2WNGA 3JTTB 3SPVB 1A0QL 1NBYB 5C6TL 2BRRH 1R3LA 3DV6A 1H3TA 2VMFA 3QDJE 2EDJA 2GSGA 5MERB 4YHIB 2EC8A 1MI5D 4U7KA 1GOGA 4ELME 4Y4FC 4O51B 3WIFA 5JOPD 3MUHL 3OF6D 4Y4HD 4EOWH 3I3BA 3MV7A 4KGLA 4P9ML 5FGCE 1T20B 4PV8B 4BKLA 4P5MA 3IJSB 1EHXA 1G9MC 3AU1B 3O8XA 4GSDL 3VG9B 1OPGH 3CPLA 5HGGS 3OKDB 4Y16A 3NOIA 4OCNC 3JTSA 4RFOH 1FZKA 1NC4B 3CVIL 4LGRB 1TVHA 2VNCA 5HTSA 2XFXB 1QPPA 1EV2E 4PJEF 3RNKA 3IDGB 4OCRH 3OHXA 3S35H 4ZTOH 3G6JA 5ANME 4OD1H 5IK3A 4OTXL 5IG7B 2Z92A 4HWUA 1HIML 3L9RA 3S36X 4JAMB 5C08D 3MRBB 2XICA 4KRMB 5IHLB 5EA0L 4HC1H 1MCWW 4X4MA 4OF5A 4XCFL 1T2QL 2EZ0D 5TF1H 3MO1B 3U4AA 4FZ8L 4E41A 4LMQI 5JO5B 3E6FB 1LEGA 4O5LL 5IB5A 1PEWA 4MXQD 4JFEB 4ZQKB 5MHSD 3C8KB 1F6AB 5I73C 3RWEB 5CINL 4CU8A 4EI5D 1MFAL 3U1SH 3AB0B 1O7VA 3LD8C 4M6NH 5FYKD 1KC5H 1S7RB 2A2QT 3ZDYE 2LE9A 4L4VE 4PJDA 4X6CE 4QRQB 1XGTA 5AD0A 1PZ5A 1KT2B 4DOHB 4QCIA 2OS7A 4XPBH 2C3WA 3R0MA 3FOMA 4JHWH 4PLJC 1W72B 3IFOB 4C55A 3MGOA 1KN4H 4RIRA 3K7UA 2EKJA 3F6LA 1G6RA 4DKAA 4JO2H 2EH7H 1T2XA 2CKBB 3GMRA 4NWTH 4JY4B 5H94B 4JRXE 5EORL 2DQFB 1RUQH 1Q0XL 4ZXBC 4YZFF 3L3DA 2J5LC 3IJHB 1IILE 2WP3O 3LKSA 3WNMA 4Y4KB 2A74A 3PWPD 1FGVH 1FH5H 1I1FA 4J3OC 2OYPA 3V0VA 5FO7B 1FIGL 1GOFA 3G5ZB 4L4TA 3MRGB 4NQCE 2ORBH 4JR9L 1BECA 5L0QB 5MI0B 4JZNA 4L1DA 4UT9L 3KPSB 1U3ZA 1TNMA 3NIFE 3BO8B 1AI1L 1FZMB 4NQXA 4BSVA 3BN9C 1F58L 1JNLL 4JFZH 3ARTA 5C0FA 5L2JB 4JANA 3CU1A 3CDFA 3RVUD 3QUXC 3TO4D 1JUFB 2BY0A 3CZJA 3HZMA 3DVFA 4YPJA 3GMOA 3GI9L 5TGBB 3JUZA 4R2GC 1DQQA 2GY5A 4Y2DD 3L5HA 1QQDB 3WDHA 2X4TA 3D2UD 4FQXD 4NKIL 3BYYA 3MNWB 4RMUA 3HZYB 4BZ1L 4N90D 4D0CB 3DO7A 4Z95H 4ZUUB 3WHE0 3V5KB 3BP5A 4GS7B 1MWAB 5E08L 3CFKB 3T2PA 3CK0L 1F8TH 1Q38A 4P57B 4TVPE 2VR4A 2MTPA 5GRXG 4MLIA 3W11C 4D8PB 1YMHB 3B9KA 3VD9A 1XGYL 3PWVA 3ZE1E 2WBJC 5IT2H 2F54A 4YEFA 4V1DA 4XNYH 4DAGL 1S78D 5JIPA 3KYOB 2V7NA 1HILB 3NCMA 4KMTL 5D1ZD 1INQA 1PYWA 4MNQB 4PGCB 1MCPH 2JLLA 1EH9A 5FA3B 4OM0H 5IKCA 2ZCKH 3W0WD 2H2SC 5KW9H 2DMBA 4NZJA 5ETUA 4O4YL 1VACA 3RVXD 3RAJL 4N5EC 2PXYA 3WMSA 1UYWL 2BXZA 2HT4C 1U2HA 5I15L 4ZXBD 2DIBA 3H2WA 5E99L 4NQDE 5KSUA 4LNRA 4RZCB 3A67H 3TPUA 5LGJB 3VWKD 1R3LB 3DV6B 3W39B 2UZIL 3RPIB 4U1KA 3UO1L 3NIGF 4ZD3L 5IF0B 4TNVK 4J4PC 2WIIA 2C4FT 5I66A 2AGJH 3J8F7 5IP4A 1NCCH 4HUMB 1YEHL 2AJVH 1NGWB 4BKLB 4L8SB 4P5MB 2OTPA 5C0NC 3O8XB 1MUJA 2QSTA 4RMVA 1KJ3H 4Y19A 3CC5A 3D87B 3CPLB 1MRDL 1VPOH 3B4NA 4CMHC 2Z31C 3LHPH 3HFML 3GSVB 1CXLA 3VXMA 5GJTL 3QEUB 3BJ91 2Y7QA 4TNVF 1DUYA 4U6VH 1N6QL 1TVHB 3SGEI 4OGAC 4YO0A 4PR5A 1JCKA 4BUGA 1D5XA 4I0PC 3WFDL 5E5MA 3KXFA 3RNKB 1AXIB 4R97C 1R3JA 2YC1B 3O3DA 3OHXB 1Q9OA 3G6JB 4FQLH 1J05B 4DW2L 3L9RB 1WBYA 2G60H 4LVNB 4XZUB 1V05A 4OZ4A 2I5YH 1ZLUH 4LHJB 1KGCE 3FRPA 3RQ3A 4NZUL 1JNJA 4GG6F 4KQ4L 5DZOA 1D5BB 4F7CA 3KWWA 4PP1D 3UZQA 3REVA 5HYFA 4MLSA 2DF3A 2AS5M 1LEGB 5BJTA 4RMSA 1RK1B 1DZBA 1IC4L 3MUY1 3QQ3B 4IMKA 1VEOA 1UWXH 2D7PA 1JGDA 1J1OL 2K9UA 2P46B 3RDTC 4KUCD 2QADB 5I1CL 1N3NA 3SQBA 1XGTB 1C08B 2C26A 4KHTL 3RWFA 5BO1L 1PZ5B 2KUTA 5D2NE 5E2UH 4P46D 4QCIB 3ZKMD 4E5XA 4B7IA 1XF2A 4HS8L 3UTSD 5D7LD 5I1GH 1GCFA 1B90A 5TH2B 5I71C 5ID1A 1EHLL 3QYCA 4M3JA 3C60C 5SWSE 5F7MC 1J88A 1IAOA 2XN9A 4CL7A 4MSWB 4NO0A 4OZGF 5A3IC 4RIRB 1G7PA 1YEJL 4YE4H 4YUEH 1OP3K 1A7RH 1NCBH 4JO4L 4X5WA 1OP5H 4HLJA 4PIRF 4PGDA 1I7UA 1FE8H 3S96A 3HZVA 4MZ2A 5HYJA 4PJIE 5C0ND 4IRJC 1P7KA 5JQ6H 4TSCL 4OCSL 1H5BA 3UYRH 5JW4M 4XWOC 3LKSB 3BJLA 4MQSB 2A74B 1ROWA 3D18B 4XC3H 1I1FB 3BVNB 5B8CB 4PJFE 4EUPH 4XP6L 3V0VB 2RFXA 4I0PD 1XGQA 4PTUB 1NGQH 1NDGA 1KCSL 3ME0A 1F4HA 3QO0A 4IM8A 4BSVB 1RU9L 1X5AA 4RRPG 4HSQA 1C5CH 1SBBA 3V0WL 3MRRA 1BGXH 1DP0A 4MB4A 3P4NA 4JANB 1LK3L 5ILTH 4J6RL 3HZMB 5ENWB 4WGWB 1KLFA 3GMOB 3GMQA 1UH4A 4NUGL 3VH8A 1RIUL 1DQQB 3MLSL 4PBXA 3VMNA 1CBVH 2X4TB 2OR8A 2XNAA 1T4KB 5FKPB 1J8HE 5FHAH 5IIEB 2G5BA 5C0EA 3QUKB 1NGPL 5DA4A 4Z7WF 3BP5B 2R4RH 3LN9A 1HHIB 5HHOD 5DMYA 2UWEF 4S1QL 1PY9A 1RUMH 3MFFA 2AQ3A 5JXEC 3LRSA 3B9KB 1J8KA 1JK8A 4HX1A 1MJ7H 5I1KL 3P0VL 4EKXA 1CE6A 3SDXE 2V7NB 2YKLL 3ULUL 1INQB 5GISL 4F7PA 1PYWB 2QLVB 3NTCL 2BVEA 1MJUL 2N7AA 5ETUB 1II4E 4S0TD 4OCYH 3HNVL 1VACB 4ONOA 1I9JL 5FEBA 3KLSA 2YPKB 1HWGB 2PXYB 4QXWA 1D6VH 2XOTA 3T65B 3JSSA 4NN5B 5JZ7D 5KSUB 4LNRB 3T4YB 5JDJA 2HA1A 3C87A 4U1KB 3D85D 4J1UA 4UUJA 4UT7H 2QQQA 1FBIL 2B8OT 4R26H 5GGRA 3U9PL 2NTSP 2WAHA 4N8VA 4Y1AA 1T21B 1GC1H 1NMCB 1G1YA 2C4FU 1LNUA 3LPGA 2A1WH 3REWB 1MRFL 3P9MA 3GSOA 3LKOA 4GKSA 1Q9WA 1ZHKB 2JIXD 3DYOA 4Y19B 3CC5B 2GITA 3VW3L 3ESUF 2CKBL 3CZFB 3CVHH 5IBLC 5HVHC 3SY0A 2B4CH 4QXTA 4MCZB 2Y7QB 4NZTH 2DQDH 2PKDA 1OGAA 2GI7A 3VFGL 4JJHA 1NCWL 3KXFB 3MV01 4TVPH 1CLZH 3WNKA 1R3JB 3O3DB 4UIKL 1QBLL 1Q9OB 4M43H 1WBYB 1PG7H 1RJYB 2VDMH 3F5WA 4S10A 4GRLC 3CDCA 4PJ7F 4HG4K 2BVUA 4EDXA 5HI5C 2DJSA 2RJMA 2PN5A 4F7CB 3MBEA 3B43A 3WUWG 1SY6H 3REVB 4HXAL 4GG6A 4M8QB 1HSAA 4GXUN 1IQWL 4B7LA 4OZIF 4L5FL 3TBSB 5A40E 4KDTC 4F2MA 4ZUWB 4NBZB 4Z7VE 4HH9A 4HWZB 1IRAY 2ZP0T 5CD5D 2XZAH 2K7PA 4KJWD 2XZQH 5E9DD 3CMOH 5C08E 2OSLB 3BGFB 4ZDHA 4P2QD 1N3NB 3O3EA 3J7HA 1RUPH 2ESVB 2N56A 2BC4A 3DX9B 5E8PA 2DL2A 4PRBA 1A6AB 3V8OA 4XHJC 2CGRH 5DMKA 2VLLB 5MEQB 3VDAA 4R8WL 1WBZA 5ID1B 1MWAL 4QY8B 3EYQD 5I8OH 1UB6A 1T0PB 3V8CA 5D5MB 2Q7YA 1ES0A 3CFCH 1WTGT 1NL0H 2VXTL 2XN9B 4NO0B 2D4DA 1G7PB 4DEPC 5J89A 5FYKE 5BRZA 1MY7A 2ZUXA 4RWYH 1GVIA 1WAAE 4OZGA 1S7TB 4X5WB 4HIXH 1J18A 4APQB 3MCLL 3S96B 5HYJB 4QYOB 2OL3H 3JWDH 1P7KB 4AIOA 2CK0H 3EO1A 2Q8BH 3FZUD 1H5BB 2L0DA 4NZRH 4RAVA 1TDQA 4K94L 5DR5H 2P5WA 4QOKD 1NUNB 2PTTB 4P4KC 1EEYB 4FOMA 3IDYB 4TSAL 1KELH 1QSFA 4J3WA 3TJEL 4XPHH 5HGHB 2RFXB 4U1HB 5FKAA 3UYOD 2GK2A 1FFOB 4IS6A 4KZEL 1F4AA 1NDGB 2A83B 2GJ6D 3P73A 1MFBH 1WT5A 2C4XA 2EC9T 2GKIA 2DQTL 1F4WH 3V52L 4ZS7H 1QKZL 2FEEL 1T7WA 2GJJA 4HZLA 3MRRB 5C3TA 2LVCA 3P4NB 4XPFL 3ARUA 1CLYL 1AP2B 2NY0C 3GI8L 4HUUB 2HVKA 2MKLC 2YA0A 2LAAA 4IDLA 5CJXA 5I17A 2NY4C 4LLVB 4WGVB 4P9HH 1LO0H 3SHSA 3GMQB 1CD1B 1YN6A 3AREA 1H3GA 4UZGA 4DGVH 4MJ6A 1KG0A 2GFBB 4JM2F 2PYFB 4EVNA 3RWGA 2G5BB 3QA3A 5C0EB 4JVWA 1K2DB 4PYGA 1S9YB 4XGZA 2A9NH 3SKNA 4Z0BH 3C6LA 4ODBD 5HYIA 4KRPD 4XMPH 3BE1L 4EIZC 1GGIH 1LO3H 5C0CA 4Z7WA 2UWEA 3QNYA 1TQBC 3QQ4A 5IB4A 4HX1B 1AD0A 3CLEH 2X70A 2FATL 5GS2H 4LKXB 3QDMA 1U92A 1CE6B 4L3EA 2M8XA 4HKZA 1AH1A 3S36H 2OK0L 2XKNB 1UG9A 5MEOB 5DMGD 1GAFL 4NP4H 2AJXH 1KFAL 2NCMA 4N90E 2FLBT 1WWWX 4ERSL 1GGBH 3Q6FB 3MRNA 4OI9A 1B0WA 3DRQA 4XP5H 4EN3A 4WWID 4K23L 2YMXL 4YHPA 3MRHA 3VD7A 4J1UB 4LPXA 3RVWD 3VWJC 2XY2A 3B6SA 4HHAA 4N8VB 4Y1AB 2NY2D 4A6YH 4ISVA 4LIQL 5GZNC 3QULA 4D9QD 5ITFA 1LNUB 1YEGL 1I8MA 4R3SA 2YWYA 4XC1H 3JBG7 4P5TA 4GKSB 1FL5A 1S7UA 1IEAA 2GITB 4X6BB 2ZWLT 1AGDB 3MLUH 1T5XA 3O4OB 1S9XA 4TSBL 1KULA 2BNRE 2A6DB 4QXTB 4YDVA 1NUDA 4PB9H 2IAMD 1KCRH 4NQSA 2IPUG 1OGAB 3BH9A 4IRSB 3CIQA 4NC1E 1ZA3A 3TWCL 2ZUTA 5F7HA 2VISA 2P5EE 4PJBB 2EDOA 1OP3H 4I8DA 3F5WB 1ZSDA 2D7TL 1I3GL 4EDXB 2DM7A 2AEQH 5CP3A 4PJ7A 4PRHE 1UEYA 3MBEB 2VLJE 4X9FA 1HSAB 1QTYT 4ZFZA 4WVRA 2R0WL 4OZIA 4F9LC 3LEYH 3Q5TA 2MMXA 3ZDZF 3MV8D 4JJ5B 2W07A 4YQXL 3SCMD 4OGXL 1XF5B 4OD3L 4ZDHB 2E7MA 2FWOA 3O3EB 4CU6A 5IQ7H 3ARPA 2YSSA 3VA2C 5ICXB 2YD2A 3ROOB 4XXDA 2BC4B 3HCVA 5E8PB 3RX5A 1MF2L 2FJHA 4PRBB 4JFPB 1WBZB 1UB6B 2XXMB 2Q7YB 4Z7QE 3U7WL 3QG7H 3ULUC 3V6OA 4YHOL 5K33A 3ZSTA 4DVBB 4RCAA 4OB5L 1QFWH 3CU7A 5F3HB 4HBCH 3B8SA 2QSQA 3MLTA 1N64H 5L2KE 3AB0C 5K9QG 4OZGB 1PFCA 1JPSH 3IU3A 5DEFA 2F53B 2AQ1A 3RUGE 4J23A 2DBJA 2EXYC 5TJWK 5D72L 3TNNB 3UTSE 1XR8B 3WO3B 5EZOL 3OZ9L 1I1AA 3SDDA 3OSKA 4PJXF 5FUZH 3DBXB 1MHHA 1UXWB 5DQDL 5FCSH 5C6PB 3MLYL 3MROB 1UZ6F 1HH9A 2XA8L 5IM7A 2VR9A 3DXAA 3S97C 4IS6B 5H35A 3P73B 1H3VA 4WEUD 3L5XL 1EMTL 3H9SD 4W4NA