3UAJC

Crystal structure of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
220
Chain Sequence
b'EVQLLESGPGLVKPSETLSLTCTVSGGSISDFYWSWLRQSPGKGLEWIGYAHSRVSAYYNPSLKSRVTISVDTSKNQISLRLSAVTAADTALYYCARQGTGTTGVSEDSFDLWGQGTKVIVSLASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVDHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein
publication title Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.
pubmed doi rcsb
source organism Dengue virus 4
molecule tags Viral protein/immune system
total genus 39
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC01
3MNZA 2BFVH 5EU7C 3SE8L 5C6WH 5E8NA 1S78D 1U41A 3L7EA 1R0AL 1M7IA 3QDAA 2JJSC 5I1GH 4I1NB 3QH3A 2GJ6D 3LPGA 3MBXH 3WIHL 1FNSH 3BO8A 1S3KH 1NAKL 5AUMB 4PRPB 1FJ1B 1A1OA 1ADQL 5C08D 3JBG7 1J12A 5C09D 1Z0MA 5DGQA 1L0XA 4Z7VA 2FEDC 1DBJL 5E56A 4DGVH 4X7SL 2I26N 5FGBA 1UYWL 5H35B 5C09A 3SGEH 5IEKB 1QFWI 1N0XH 3GNML 1NL0L 5C86A 1H8NA 4PJIF 4Y1AE 4X6BA 1A6TA 3KJ6H 4I77H 4F9LC 1C12B 1RUKL 4PJFB 4RBPH 1G0YR 5B8CB 1W0VB 1CE1H 3KYOA 5BRZE 2BVQA 4WI6A 1G9NL 1OAUH 3BPOC 3U4BH 4DKFH 1IGTA 3UAJC 1NC2A 2ZZUT 3O2VH 3VFGH 2OK0L 3EGSB 5JZ7D 4NO3A 1CFVH 4XCYB 5EIIA 4RX4D 5IW1A 4GW4B 1VESA 3JV5A 2F8VA 3IB4A 4NN5B 2BSTB 5E5RB 4XMPH 3WXVL 2UYLA 3PWPB 4G6MH 3MGOB 3TVMB 2HFFA 3HE7D 3FQNB 1ND0B 4GRWE 3L3HA 2VZ3A 1N6VA 4HUMB 3VDBA 1K9TA 1ZHLB 3BDBA 4X80H 5E2WL 5FEBA 1KSRA 1TQBC 3MREA 4JO4H 1ETZB 4MQTB 5HVHC 1DP0A 4Y19B 2PTUA 1UADC 4Z8FL 4FFWC 5E6IB 1EV2E 5BJTB 2IAMD 4CDHA 3OKMB 3BIAX 1HSAB 2HLAA 4IMLA 5DD5L 2UWEF 2ZP0T 3DBXA 1L0YA 4JKMA 3C8DA 2HMIC 1NGZA 3X12A 3ZO0A 2IAMA 1XF1A 5TE4H 2VOTA 1BWMA 1FAIH 4MLSA 3D39E 3NTCH 4C59B 3GIVB 4MD5B 1MF2L 4ZOCA 5BW7A 2O26U 3OAUH 3QAZB 4ZUWA 2ZOKB 5L2KE 3H6JA 2CXKA 1RURL 3QUMB 5HYJE 2HT4C 2OL3B 4KK5D 3ULSA 3RA7H 3VWKB 3SKUD 4Z0BH 1X5IA 4O02L 4ZOAA 3FOMB 4D9QE 2ADJB 1Q72H 1AHWC 1YEJH 4UQ2A 3O9WD 3VI4F 2R4SH 1JF1A 1NAMB 5MEQA 2D2OA 2OJZH 4LPWA 1K6QL 5E8OA 5JA8B 1AD0A 4YAQA 2HRPL 3GJFA 1DQLL 3ARUA 5D72H 3EJJX 4JDZA 4L4VD 4XPBL 2Y6SD 4NN7B 4I9WE 5EUKA 2A6DA 4LPUA 5DHVB 3VXNB 2AK4D 2KQMA 1KJ2A 2NY3C 4Y5YC 3QXAA 1CICC 1NPUA 1MCSA 3SDXF 1S7XB 5I1EL 1YEIH 3Q6GL 1FGVL 5D2NA 5IMLB 3C6SA 3KPRA 4GH7B 3QBTB 4ONFH 2AK4A 1Q0YL 1BVKB 4NO2B 3QNXB 2NQCA 1TPXB 1P7QB 4RGND 3MXVL 3X11B 3T09A 1X4ZA 4JZOB 3U0PA 3WSQH 4F80A 4X6DA 2R29L 5ETUA 5J11B 1KCUH 5HHVL 2JB6A 4OLWL 1T1YA 12E8H 3GMMB 2VN4A 2IGFH 4ZTOH 1JUFB 3B9VA 4F7MB 1YDPA 4HG4K 4G8EB 3HMXH 3GI8H 1MFBH 3NFPB 4N5ED 1YPZB 1WBYA 2WBWB 5JIKA 5JPNB 4XZUA 3PNWA 3SGDH 1KYOJ 5IB1B 1G7MA 2YUZA 4YR6B 3ARQA 4Y4KA 3HC3L 3U9PH 4M5YL 1D6EA 4OTXL 1QD0A 2EE9A 2DMKA 1JHKL 4AEHL 4Y2DC 3P4NB 5CEYA 1NC4D 3QEGL 5EZIH 4RDQF 2V5SA 1D5ZA 3UJIL 1IQDA 1UQSA 3TO4C 4HC1L 1C08B 4Y1AD 3A67L 5GGRB 3MV8E 3RWHA 3W9EB 2YD3A 4LF3A 1NC4A 2R9HC 5DK2A 3C9NB 4FFZH 4TULH 4P5TC 1ZOXA 2V5TA 5H94A 1ZMYA 5ACZB 2FGZA 3GMNA 4QRRD 4Y1AA 5BRZD 3QWOA 3QIUA 5KSVB 3LKNB 5J3HD 2W59A 3BWAB 3GSWA 3HAEB 2GUOA 4JFFB 5BRZA 3UBXA 1AE6H 5FUZH 3SKMB 5F9WB 3CXHJ 3VWJB 3IETA 1CXIA 4JCMA 3C2SA 5MHSD 3LDBC 4ZFFB 5IFAL 5IESL 3D1MC 1Y0LA 1X5YA 5CILH 3ARDD 3KPNB 1BPVA 1FCGA 1GGBL 3DOSA 5GGVY 2CLZA 2ICWI 2BSED 3T0EE 4HGKC 4N90E 4PJCE 3ARDA 1H3VA 3AY4C 4WFEE 2DTMH 3S8WA 1AD9B 4JHWL 1E6JL 4EXKA 3RIAK 1BJMA 3D9AH 4OLXL 1DVFC 1DQML 1GRWA 1U8QA 5IV2A 3IDJA 4RWYL 3MA9L 4GRMB 4PJEB 4PP1C 3NZ8B 4U33A 1WBXB 1RK1A 1XGTB 5K9KB 5EC2A 5D8JL 4H26B 5DLML 1MREH 3DYPA 2GJZA 1QLRB 5D1XC 1KCSL 4UOW1 1UH2A 1S7TA 3D39D 5KSAD 4HUKB 3L6FB 1U0QA 3B5HA 1R3JB 4NKIH 3SOBH 4BA8A 1H3PL 5FYKD 4H0IA 3WS6C 5DEGA 5IVXE 4L5FH 5HHOE 1KJ2L 3D39A 5KSAA 2NX5D 5HYJD 2FBJL 4NQDB 2OR9H 2ZUQC 2YUWA 5H37H 4YGAB 2UZYB 3FN9A 2DAVA 1UB6B 4OI9A 5L2KA 1HYSC 4HJGB 4D9QD 5HYJA 2CUMA 5HVGB 4V1DD 4K23H 2X4UA 2YMXH 3L5JA 3PV6B 4PY8J 5T5FH 4KI5E 3R8BB 2CKBB 1R3LA 2VISA 1DLHA 5GRVK 3HB3C 4EDWL 2J5LB 3QCUH 5AYQA 5GGSY 3ZTNL 5E2UH 5F88B 1KLUB 3DIFB 4PRAB 5E2JA 4YHLL 3SE4C 3EO0B 1YY8B 4K3JL 2EZ0D 3CZJA 5DGRA 1PQZB 3EZ8A 3ILQD 2AVGA 3IU3A 5IBLD 4PJGF 4GAGL 4RFOH 3RWCB 4M61A 4BQ6A 3QIBD 4CU7A 2YD7A 3V6OC 4R96B 4KZEH 4M7LH 3DECA 1WAAF 5IGXH 3MUJA 1TFHA 3FB8A 3MUHL 3PL6A 2N4IA 4DGYH 3QIBA 5GJSH 1IFHH 2VIRB 4LRIA 1GGUA 4JY5L 1IMHC 1LO4H 5GZND 1C5CL 1KJ3L 3S5LB 4WGVB 4WW1B 4HH9B 2X05A 2KUTA 1RZFL 5L6YH 1MH5A 2ZUYA 1CFTA 2E27L 3O0RH 1KNOB 5FOJA 3STLB 3MACL 4XPHH 3C60B 5IG7A 3SY0B 2IC2A 1J7VR 3K80A 4MSWB 1LDPH 3TN0B 3MNVB 3GMRB 5D9SA 1FFPA 4PB0L 35C8H 2FDBP 3WEXA 2UZIL 1NUNB 4EDXB 3G08B 4O4YL 4UINH 3AB0B 4XPGL 1F11A 1OHQA 3ROOB 2JCCA 3HRPA 3GSXB 3MV8D 4GQPH 3KPOA 4MJ4A 1B0GA 5C6TL 4FQLH 1RZ8B 5C70A 3CGTA 1MOEA 1AO7E 3FO9B 5LXGH 4W4OA 3I6LE 3HI5L 3UTSD 4YE4L 1BD2A 4J1UB 4LNVA 4NUGH 2G2RA 1Z3GH 2NY0B 3NFSH 1IL1A 3QRGL 3RY6A 5IKCA 1UVQB 2AJ3A 5C7XH 1J8HB 2YRZA 3DHJA 5DJCB 3BZ4A 2OTUA 3P4OB 2MPAL 4TTDD 1MPAL 4P99A 3O11A 3D2UB 4GG6F 4MJ5B 4WFFE 3CDGA 4LHUG 1H0DA 2FJFA 5EOTA 4LLQB 4LSTL 1JNNH 1HIMH 3MYJB 3QXUA 5E70A 3RNKB 5IOPA 3T0ED 4JZNA 2Q6WA 4IRJA 2DQJH 1T5WB 4WFED 3UJJL 4J3UA 5H8DA 4WV1B 3O4LE 4JQVC 3T0EA 3FHQA 4O9HH 4YXKH 1CYGA 1JPGA 4PJCA 2ZG3A 1CDCA 1M6OA 2AXHA 4F37K 2XTJD 4JY6A 1EO8H 4Y7MA 1ZA6B 4NHUA 4ZPTB 4FQ2L 2EE6A 2AI0H 4IOFD 3OAZH 3P11H 4M7KH 3WJLA 3LKPA 3QNYB 3GBNH 3ZKXC 4X6CB 3GB7B 5J6HA 3NIGF 1A3LH 1RHFA 4JRXB 5B4MC 4TNVF 5ENWB 4DEPC 4XNUL 3A6BH 3WMSA 3MROA 5IM7A 3C5ZC 1NGXB 5I18H 3TBWB 5D93C 5HJ3B 2R2HB 5IB3A 1J0IA 3U36A 2VZOA 4JDVA 3KXFE 1QVOA 3SKJL 1FDLL 5HHOD 1OVZA 5GRUH 3LKOA 3CU1A 2R1WA 1R3HB 2JLLA 3BPOB 4JANB 4AK1A 3BW9B 5IVXA 3T8XA 4FTVB 2DI9A 1CWVA 1UT9A 2YPVH 2Y07L 2ZUXA 3B6SA 1XF5B 4GAFB 3TO2A 3I6KA 3TBSA 4HKXB 4KI5D 3PHOB 3LV3A 1P53A 3GK8H 3ZHKA 5CJQH 2WWKT 3VXUB 3BZFA 3OGCA 3CVHB 3SDYL 2BNQE 5CD5C 3MOAL 1UWXK 4NWUL 4OFYA 3DPBA 1JWSB 3VGHA 3QUYA 4ETYA 1TQBB 1GAFH 5HVHB 3EW3B 1P7HL 1P6AB 2GFBA 2VRAA 4HMEA 5C0DB 1SBSH 1VPOH 4RMTA 4RMRA 3WNLA 5BZDB 3IXAB 4MAUL 4KPHL 3M8OH 3EYOB 3QI9A 5FOBA 4PGCA 2VZUA 7FABH 2QSCH 3W9DA 1T04A 3VJ6A 4U1MA 3C8KB 4L8SA 1MHHB 1ORQA 4BH7A 3MZGB 1BBDL 3IU4H 4FG6D 4RWHA 3ARFA 2ATKB 2IFGA 4JFHE 5F7LB 5HDQH 1FL3A 2VC2H 1X7QA 3CUPA 4NIKB 5EZLA 5I1CL 3GSQB 1MJUL 1IGYA 2APVA 4Z7VF 3CFKA 3I6GB 5DDHA 4JHZA 1LVEA 1Q9OA 5IBLC 2VXTH 3TCLB 3S35L 3PXHA 1MJ7L 3BH9A 4Z7OF 1DBML 4YC2C 3DVNA 3BKJH 3G6JB 2QHRL 1VACA 3NA4A 1JK8B 1VA9A 1F90H 1OTUC 1UG9A 1AHWB 3OKKB 1UEYA 3LKQB 2IBBA 4YDJB 2Z31D 3NCMA 4D2NA 3H9YA 4MNQE 2FO4B 2EDFA 1F58H 5KAQF 4UDUA 1W72A 1A2YB 2NPLX 4F33A 5K9QI 2Z31A 3I6LD 2EIZB 4Q9RL 1QSED 1YYML 4ZAKA 3C6LD 1T03L 2F53E 4M6NH 4Q6IB 4EQ3A 1AO7A 2DYPD 4K7PH 1DBKL 5DR5H 5SWSB 2WUBL 4JFOB 3LHPH 4QGYA 3H3BC 3C6LA 3QHTC 2NY3B 4Y5YB 4CNIA 2EO9A 1CICB 3G6AB 2I24N 4ODXA 4WUKL 4PJAF 4Z18A 3PWNB 4WFFD 3QEHA 2P1YA 2VLRE 2V2TB 4X0KA 3TIEA 1GH7A 4HBCL 3QWRD 1I8MA 4JM2D 4KGJA 5FYKU 4S1SH 4GW1B 1T2XA 2XI9A 3K4AA 3AS3A 4XP5L 2D9QB 3GO1L 2FH8A 2APTA 5F7DB 1AR1D 3N1GC 3QWRA 1LEKB 2ZUVA 4KHXL 3O4LD 4BJLA 4NNPH 5CJ5A 5I1KH 4LQFH 1T0PB 3MBED 4X4XA 3PABA 4OGXL 4YHKL 4TUOB 3G9VA 3O4LA 1A7OL 5DRWB 3RBSA 3MBEA 5BOZG 5E8EA 2H32A 2A0LC 1P1ZA 2D0FA 2ITCA 3JTTA 3HPJA 4DKAA 4U6HA 3AREB 2NY1D 1I7RB 2ENYA 4Y2DB 5I1JH 1CFNB 1QUNA 4IRZH 2Y4SA 5EN2B 4BM7A 1ZGLP 1OGTB 5DRZA 4KKAC 4AIZB 2MSPA 5EBMA 5E2TH 3FONB 1XR9B 5K9JH 1OSZA 3IDMB 3GHEH 4ZFGH 4NNYB 3BWUC 3KXFD 5FA4A 1CE6B 4P5TB 3WS3A 4LCUA 3ZDYF 1IQWL 3BQUD 1L7TH 2R8SH 4ZO8A 5JTWA 3WIFB 1DN0A 3EFFB 2GJ6B 1II4E 4ZFZB 3BQUA 2WIIA 1CIDA 5H2BA 5IB4A 4CVXB 4U6YB 2XPGB 2ZUTA 5C08B 1TZHB 3WKML 4KC3B 3LDBB 1MFAL 3EO1A 4GMSH 1HZHH 5FFLA 2H26B 4OD3H 4LASL 5FYLE 2FJGA 2UUDK 1AGEA 1EEUA 2I60H 5ID1B 1CZ8L 3LB6D 1E4KC 1T89A 4NC0B 1KB9K 4AH2B 1VFAB 5C0BE 5EO0A 4YX2H 2BNRA 5F93C 1ZVYA 3B2UC 5AAMA 1TVBA 2K7QA 4CRPA 4YHYC 2BNQA 4DOHB 1DVFB 1DFBL 4ZS6D 4RISH 4ODSH 2I9TB 2EEBA 4P46D 2IPKA 1QNZH 5A2FA 3MJ6A 4X6DF 4HUXA 3RVXD 2J4WL 1HKLL 1DLFH 1UXWA 2XRAL 4OLYH 3QDJD 1YQVL 2YEZB 5T1MA 4X7CC 1W72L 1U8IB 2NZIA 1YJDH 2YZ1A 1MCPH 4PY7B 1ZLUH 1ZT7B 4G43A 1V3MA 2JJVA 4JFHD 2EIDA 5EZJA 5GGSB 5TGBA 3HE7B 1W8NA 4OIIH 3VFTB 1FIEA 4KK9D 1HSBA 4KTDH 5HSFA 4R4FH 1EBAA 3MLUL 1CGSL 4H0HB 2CSPA 5ISZE 2IQ9H 3FQTB 1A3QA 3K1KC 3BYYA 5HYIA 2QBWA 3HRZB 2M1KA 4DQOL 2ZUQB 3RPIB 1INEH 3C8HA 1U9KA 3QZWG 4C56A 5LGJB 4HV8A 4HPYH 5CBAA 2BJML 3ARGD 4YXHL 2NR6D 4EEEA 3OQ3B 4AL8H 4MWFB 1D6VH 5GSRB 3RJQB 2R2BB 4JZJA 3AS0A 3BEVA 5DRNB 2PUQT 3PHSA 5FYJH 1A7RL 2CJUL 2I25N 4JFPA 4KRPD 4NQCE 3ARYA 2NY2D 3HZYB 5HHQB 4F7TB 3BKML 4MNQA 4BZ2L 1JPSH 2DLTA 5F1IB 1TTFA 4FQIL 4OBRA 2F53D 3JWNC 4H88L 2ZNWA 4DZ8B 4MAYD 1HHIB 4K2UL 1LQSR 2P8PA 4HS8H 5CEZE 2OJEA 4NQUA 4RMSA 1CXLA 3VFWA 4U0RB 2MKWA 3S35X 1MFDH 4FQQB 2YD6A 1P4LA 2H9GB 2QR0B 1FE8H 5EUOE 2VLRD 2HLFC 1BOGA 1I7ZA 5DD0H 3O6ML 4BUHA 3NGBB 1BJ1J 3IDYC 4EUPH 1SYSB 2VYRE 3VGEA 1AFVH 4KFZC 4DFHA 3HFMH 4HZLB 4D0DB 2CDFA 4CW1B 5I2IB 2VLRA 1DBBH 4K9EH 5E99L 4G7VH 5KVFH 3O9WB 5GHWL 5KSBE 5FM5O 4X8JA 1U93A 3KYKL 1RK0B 4E42B 2HVKA 4LOUD 4GMTH 5HHNA 3EJYC 2K7PA 3CDYA 5GS2H 3N9GH 1F2XK 2IBZX 4K3DH 1IKFL 1YJDC 2X4PB 1HKFA 2VDNL 1CG9B 3RY5A 5ICYA 3SBWC 3TV3L 2AJUL 5FK9A 5L9DH 3I9GL 5DRXB 4XNXH 1D9KC 1FSKC 1SEQH 4JN2B 2Z92A 1CDHA 2VE6A 3QDMB 2HJFB 1KCVL 3MUZ1 4XCFL 1U8PB 2AEIT 5DTFA 1G6RA 4KRNA 1A7NH 5HY9A 1RIUH 5EULV 4RGNB 5I8OH 1IM9D 5ANMB 4JFQA 4ZUVB 1ITBB 1VGEH 1B0WA 4NRXA 1Q94B 4JREC 5CSZB 5IK3A 2LAGB 3BI9X 4P23C 1IM9A 1LO2L 5JHDD 5FHBH 3IAGC 3SDDD 5CGTA 4NSKB 2R0KH 1LE5A 5DQ9B 4FXGA 5J1AA 4XNYH 4AEEA 4IS6A 5J0BA 3QA3B 4UILL 4L8CB 1OY3B 4OQTA 5J8OA 3IAPA 4MHHI 4M6ML 4H20H 3SDDA 3QCTH 2W0FA 4YHOH 1Y18A 1QACA 5I71B 1XCQB 3QXDA 4D0BA 3PGDA 1J8KA 4O5LH 5FYLD 5IF0B 1RIVH 3DSFL 1NFDE 3WN5C 3VD9A 2H2PD 3G5YB 1MRDH 3EO9H 1G7IA 1KBGL 1DDHB 2NYYC 3D3VA 4KUCF 5C0BD 1QFUL 4WU7A 3DUUB 3O8XA 3GSUA 4QRQB 3SEPA 4RQQB 5DUPH 1OSPL 2VDKL 3FQWB 5C0BA 4QRRB 1YMME 3RY4A 5FB8B 4ONHB 3RWJB 2KBGA 1G7HB 5AWNL 4K55A 4OGZA 5DC9B 4LGSB 1G7PA 4XWGH 2DIJA 4Z5RA 1W0YT 3MCG1 3VFMB 3QJFB 3V0VB 2PTVA 2AEPH 3WFBL 1SM3L 5HHMB 3RZWA 5D6DA 4DEPB 2WWMD 2H2SD 2LU4A 2ZCLL 3C5ZB 5TF0A 5D93B 1A6WL 5MP6L 1INDL 1QBLH 3CFEB 4R3SA 1VKXA 2FEEI 3TIDB 2GK0A 1UM6L 4UQ3B 2YWYA 4WI4A 3S3JA 4CADA 5FF6B 2BVOA 4WFHE 1UJ3B 4MQ7B 3VGAC 3ZLQC 2JCCF 2VDLL 4LKCB 3GSNB 5ISZA 4QRSB 1CTOA 4LHUD 2P8LB 1DQQA 2XZAL 1U8JB 1A9BA 2AAVA 1RZJL 1S8DA 4N68A 5INCA 4F3FA 5J7CC 1YUHB 4NQCD 1FORL 4PV8B 1UXSA 1LILA 1PY4A 1RUPL 2IH3B 4LLMA 1K2DA 4G9DA 5EOCH 1RIHH 3QFJB 4AMKL 1YC7A 1CL7I 3DX7A 4OV6F 3X13A 4NQCA 1KB9J 1QQDA 4QTIL 4QXWA 5CEZD 2HVJB 3ETBF 4WW2A 1HINL 3F7VB 4GAJL 2VO5A 2Q20A 1R5IB 4W68A 5ALCH 4FXKB 2DD8H 1T2QH 2Q8BL 1M7DB 2NX5B 4ZYKA 4R6UA 1V7MH 2C4XA 1ZGLB 3MFFA 1WT5A 5I1IL 3MR9B 3WLBA 3V4UL 1GZQA 4HCRH 1RFDH 4LLUA 3RX5A 1BZ9A 1WWCA 3FQXA 4S11A 1MCCA 3L3OB 4OCNC 4V1DB 4LCIH 5EUOA 2XWJA 1CLOL 1ZVSA 4M6OL 3SE8H 4PJCF 3TZVD 2P44B 3CLEL 1H5BC 2LU7A 4YZFE 4ZUUA 4WWKC 5BCAA 3OB0K 2JK5B 3WIHH 4L8BA 3WHXB 5ACMA 1KENL 4OZHB 5A16A 5JW3L 1NAKH 4KV5F 2FNBA 1ADQH 3RUGE 4Q9QH 2D31A 5CSBA 5KW9L 5C0RL 4P59L 1DQJB 4OQTL 2HN7A 1FV1A 4LDEB 1DBJH 4X7SH 4EVNB 2PCPA 1UYWH 4NZRL 4YC2B 4DUWA 1N59A 4OCYL 5EU4A 3GNMH 3BP6B 4MLIA 5EH1A 1NL0H 3V6FA 5FV2A 1FZKA 2VQUA 5I1LB 1TJGL 5DUBB 5ESQA 4E5XA 4NRYB 3PHQB 1MCWM 1RUKH 4MB3A 3TM6A 1P9MA 1QKZL 4Z78B 2C3HA 1PX3A 2C3VA 5DJXB 2DLHA 1G9NH 1BQHB 1LWRA 1Z9OA 3ESUF 2V9RA 2OK0H 3EYSL 4KQ3L 5D7IF 4JJHA 5FIEA 4PTTA 3EYFA 3BHBB 1JGUL 3TPKA 3CFDB 5IR1B 5SX4H 3WXVH 1IM3A 2Z91A 4XNQB 3RU8L 5DS8A 5EBLA 1LP9E 3PWLB 1XGRA 2VDPL 4HUWA 4L8DB 3ARBA 1HN1A 5E2WH 1RZGB 1IJ9A 4LARL 4NFCA 5K9QG 3I02B 3SDAC 1FZMB 3O3AA 1NFDA 3MLSL 3CK0L 1X5ZA 2ADIB 3QIWC 4G9FE 2FX9L 4XPFL 3ES6B 2JJTC 2C9AA 3MRCA 3UTSB 1AJ7L 2PETA 1T1XA 1I1FA 3OF6D 5DD5H 1MI5E 2WBJD 3VXRB 1YMMA 2B2XH 5DK0B 3OKEB 2P5WB 4PJ8D 4M43L 3M1BB 1N3NA 4ISVB 4A2LA 5AAWA 5I0DA 1Q9KA 3TJHC 2AV7B 3QUZA 4UNVA 1MF2H 1CD1A 4PJ8A 2XNAB 4XH2B 5GZOC 1DE4B 4MJ2A 1JWUA 3CFJB 5E2VL 1RURH 2EDQA 4CU8A 2VLKE 4DK6A 3DMMD 1IAMA 3VXPA 4WFHD 4DWHA 5DC0A 4M1GL 4GKSB 5IVZB 4IIQC 2XTJB 4O51B 2FYYB 2YPKB 3DMMA 1N64L 5CINL 3VRLF 1G9NC 4DW2L 4R4NC 2Y72A 1WUNT 3PQYA 3QQ3A 3BUYA 4NYLA 4JB9L 4XBEL 2FX8L 5AZ2L 3V6ZB 5T33L 1K6QH 2ATPB 2A6KB 3P9LA 2HRPH 1K4CA 3JV0A 5I8EA 1QBBA 1DQLH 5MENA 2Y36L 3MLTA 4MA1C 2I27N 4MNHB 2YC1B 4QHKI 4XPBH 2YD5A 3D87B 3NOIA 1KIUA 3IRPX 5C0EB 1ZTXL 4OZGE 4YHYB 3VFVA 1VFUA 2Q7YA 5I1EH 3Q6GH 1FGVH 3OJVC 4I5BA 4MYWB 3V8OA 1JCKA 2DWEA 1P7KA 1YNTB 3OKLA 4Z7NF 4RAUA 3I3BA 4DN4H 3FRUA 2WWKO 3MXVH 4M1CC 1LD9A 4D9RE 2R29H 4WDIB 5EG6C 5I1AA 5HHVH 5I19L 3ZDZE 4OLWH 1FG2A 3UC0L 2HFTA 3RDTC 4HWBA 1I85C 4N1EA 4ELMF 4UU9A 3U7YL 1QSFD 3S7GA 1WC7A 3H9SB 4UAOC 1KLFA 2NY7L 1HWGB 3WJJC 1KACB 3NFNA 2NZ9C 3VW3L 4PRNA 3MGAA 5GGUB 3G9AB 5K9OB 3SGJC 5M7QA 5LBSH 3WE6B 1QA9A 2F58L 2M2DA 4M3KB 3DRQB 4HKJB 2ED9A 4LKXA 4M5YH 4OTXH 1CFBA 4MJIE 3X3FL 3VA2C 4PTUA 1JHKH 1FZOA 4NM8H 3HUJF 1JTPA 1MY5A 2D9CA 2V9TA 2VAAB 1TITA 3OR7A 4YDVB 4HC1H 3A67H 4KK8D 4PRDA 5TQ0L 1GZPB 2Y23A 3KPQA 2APWA 2W38A 3MRKB 2UVFA 3ILPA 1MCJA 3TNMA 4RRPA 1Q9LB 1XF4B 4U6VH 1F13A 4L4JA 1MCEA 5IJKA 1T4KB 5HI5D 3ZKND 1OPGL 2BVEA 2UWEB 4O58L 5T1LB 4HWNA 4ENED 3ALPA 4HJ0C 3RKDD 4XCNB 3DURB 5IFAH 4TVPE 5IESH 1P4BL 1FL5B 1L4IA 4LK4A 2D4FA 3S98A 3MRIB 4AZ8A 2CKNA 4R0LA 5T3ZE 1GGBH 4ELKA 3Q0HA 3IS0X 5CGMA 1NEUA 4BFBD 1TVHB 3O3BA 2EXYD 4WUUE 3LH2L 4UIMB 3RIFF 1CFQA 1HXMA 5FGBC 1LP9A 1E6JH 4G8GE 5C0IA 1N6QL 5TJWK 4OLXH 4RZCB 1DQMH 3EOBA 3AAZB 1IEAA 3QO0B 1WSST 2HFGL 3JWOL 4RWYH 3MA9H 4BQ9A 3GUTB 1OD7A 1I7TB 1WFOA 1QSEB 2G60L 1NCTA 4F58L 5C0FA 4G9FA 3EOAA 1CGWA 1NFIB 3O3DA 3FB5A 4OCLC 2X4OA 2DYPB 2HAZA 5LWYL 1MVUA 5D8JH 2FH6A 5DLMH 2VABB 1ES0B 3QUKA 4QHNB 5CEXB 3DVGB 1G7LB 1D9KB 1FSKB 2CXGA 2IALB 1MI5A 4KMTH 4DKEL 3GJFH 2XG5A 5C8JA 3BIKB 3UTTB 1JIBA 5LGKA 3FT2B 2BNUA 5KVDL 1H3PH 4G42B 4I18C 3QG7L 4N5UA 4X5XB 1JGLL 2ED7A 1YNLL 5SWZA 5IFJB 1KJ2H 3RGVA 4NZUL 2FBJH 4JREB 1KN4L 1W0WA 2VLKD 4P23B 1OCWL 3DROA 5I30L 4P57A 1C16A 4I2XE 4YEEA 3UPAA 5I1DB 1TVDA 4GKZA 3EJZC 3L7FA 3WNMA 3C09C 5J9PB 5JXAL 2OR8A 4YPGA 1Z9MA 3AROA 3B9DA 2E7CA 3UP1A 2VB5A 2CMRL 4PGBB 4HWBL 2VDOL 3ZDXE 4JPWL 3TPUB 4QCIB 4EDWH 5F3BA 2LFGA 1NDMB 4BK4A 3ZTNH 4LVHC 3R4DA 3RZCD 2YRLA 3ECBB 4OB5L 2MHAA 2Z4QB 1SYVA 3AXLA 4H5SA 4YHLH 4K3JH 3VA6A 1ZANL 5FDYA 4GAGH 4J23A 4QYOA 4YPJA 4HWEL 2DKMA 3VU2A 3NIDE 3KNBA 2GI7A 4WEBL 5JOPE 4PGDA 5AYUH 1RZIB 1Z5LB 2R1XB 4BH8B 4J3OC 1EHNA 4OZGA 2IWGA 4JY5H 1MEXL 4D9RD 1P84K 4LLAA 1C5CH 1KJ3H 3QEUA 2BDNH 4J2XA 1NSNL 1FNGB 2Z0BA 4CVWA 3HCVA 4PJDB 5F6HJ 5HPMB 2ZCHH 4NWTL 3WDHA 4PGEB 1RZFH 1FAKT 5AEAA 3TBVB 4A2MA 3GM8A 2HTLD 4MVBC 1TCRB 4ORGA 1JPFA 2CDGB 3MACH 4JAMB 2BXYA 4XHQA 1S5HB 4M8VA 1NKRA 4AG4L 2NTFB 4PB0H 4LGPB 2UZIH 5FO7B 2V7NA 4NUJB 5L8JB 5E08L 3Q1SL 3DX8A 5EU6E 2AK1L 5D5MF 4G8IA 5IVOA 4O4YH 5DF0A 1TTUA 3VGAB 1KTKE 4XPGH 3GRWA 4MJIA 4LCCB 1EFXB 3FB7A 3MRMB 4P46B 2X1XR 3D25B 5C6TH 1H3WM 4L9LA 4EI5D 1IVLA 2Q7NA 5F1NA 4GRWH 5D2NC 3RIAF 3QDJB 3DRTA 3L5WA 3HI5H 4YE4H 5IBUB 3MJ8A 3T4AB 8CGTA 2FR4A 1WJ3A 3CSBA 1J18A 4KJYA 3QRGH 4QT5A 3KPLB 5E6ZA 1FFNB 2YBRB 3K7UA 5CBEA 2A77H 3S36L 5HYQB 2MPAH 1G9ML 4OZIB 1MPAH 1MLBB 3PDDA 3B8SA 4TVPD 3LN5B 1RD6A 4PGJA 5BZWB 3T65B 1OW0A 2HJLB 3S37H 4LP5A 1XH3A 4LSTH 2HA1A 4NQSB 4R7NA 1YEEL 4Y4KC 1YN6A 1UENA 4ZD3H 2HG5A 5F8QC 4WUUD 4GG8B 3ARGB 1XZ0B 5TE6L 4QRPD 5KS9E 1XFPA 1S7VB 3UJJH 1AXTL 4G8GD 3OAYK 2ZG2A 1ZHBA 4H8WL 4I4WA 1U8HB 4P9ML 4WWKB 2CDEB 4EQ2A 2W60B 4FQ2H 4MS8C 1ODAA 1TENA 4HLZG 4GKNA 1DUYA 4PYGA 3QIUC 3AS1A 4WJ5A 4OAWA 3FN3A 4XNUH 3VXQB 4APQD 1OWRM 1UB5B 3VXOA 3SGEI 3EYUL 1F3JA 2H6PA 3MMEA 4PJGB 5JO5B 2NXZC 5B39B 4DKDC 4QRTB 4U6XB 4Y2OA 2VXQL 2P49B 3SKJH 1FDLH 5FO9B 2EE2A 5D7JD 4NFBA 2EEDA 2F74B 2FIKB 1GYAA 1YMHA 2LE9A 3PGFL 4LLWB 3QSKB 5DFVD 5TDNA 5BXFA 5J6GB 4E41D 3BESR 3NPZB 4PRIB 3PIQA 4YNYA 3ZKMD 5D7JA 4I0PD 3U0TB 5I17B 2WP3O 4L4TE 4P4RB 2Y07H 1SJHA 3QEQB 3DX9A 1YEFH 2BSSA 2NW2B 1OTSD 2F54D 4I2XA 4XCEB 3ZE1E 2N1KA 4I0PA 1V3LA 3X3GL 4M93C 2F15A 1QR1A 1ACZA 4U1JA 2W9LA 3P9MA 2MCPL 2EEAA 3SDYH 1X9QA 1I75A 3J8F7 3MOAH 4YHPA 5IFHH 1SEBA 5DJ8B 4WW2F 3O41A 4UIKL 4RMUA 4ZPVB 1T7ZA 3SDAB 3MX0A 2V2XA 3KHQA 4XPAL 4R97C 2A74A 2QSTA 4MAUH 4KPHH 4POZD 4Z7WB 3PWVA 4QY8B 1OB1B 3GRWL 2W92A 5JHDB 1UWEL 4G7YL 5DD6B 4E0RB 2QL1A 1F6FB 2CRYA 3QQ4A 5D6CA 1BBDH 3MV11 1YQ2A 2OTWA 1MLCA 4Q0XL 3BH8B 3CSYA 3IJSB 5I1CH 4P2RD 1MJUH 4YQXL 1HHGA 1S5IL 1A7QL 4UOW0 2RFXA 3HI1A 1WCBB 4JVPA 1D5XA 5CHNB 5EOQH 4JJ5A 4GXUN 4L29B 4DCQB 3PP4L 3S35H 3UPRA 1MJ7H 1DBMH 3T2OA 1GXEA 4WFGE 4RMVA 3O3EA 1A9EA 5EU6D 2D7PA 1NGYB 4NO0D 1J0YA 3RL2A 4IIQB 3U30C 3KLHC 3ULUE 3FFDB 4RAHA 3GSOB 5HGBA 2J1KA 5D1QC 4J8RA 1QEWB 3BT2L 3HHRB 5T3ZL 1XMWA 1E4XL 5IVNA 3IKCB 4OZFB 3WL9A 3PL6C 3MRFA 1CFSB 1Y6NR 1JN6A 2B4CL 1Z0NA 3FB6B 4WEUD 4LRIC 1XF2A 3BPLC 4Q9RH 1YYMH 4HDIA 4UT9L 4F37F 1KXQE 2C1PA 1UH3A 1T03H 1S3KL 4MA1B 1DBKH 1EEZA 3OSKA 3REWB 2WUBH 1DQDL 1KB5A 1ZS8B 4ZXBD 1A7PL 3K2UL 5DURD 5D2LE 5D4QA 5GS1C 3O45B 2X70B 3INUL 4WUKH 3LQZB 4KKCD 2OSLB 5GIRA 1NCDH 3DTXA 4LSRL 1N0XL 1NBYA 2VL4A 3S97C 3EYVA 4HBCH 4OZ4B 3MJGX 3OXSB 5JNYB 1RJZB 3IFOA 4QRUA 3T0AA 4XP5H 5L2JA 4GSDL 3GO1H 2FSEA 1NFDF 2YPLE 4ZO6A 5DQDL 4ZQKB 1PLGL 3C08L 4DUXA 3QQ9D 3RDTB 3B3IA 4KHXH 5C3LD 1EEYB 5CLTA 3W0WE 1OAUL 3O2WL 3SCMA 1S7RB 1CT8B 1F6AA 4L3EB 4LBEA 3D5OF 4PG2A 3O2VL 1TIUA 2R23B 4OGXH 4ODVL 5KS9A 4CJ1A 2WLYA 5DD1H 3N0PB 3GMOB 2AV1A 1A7OH 3MO1B 3B5TA 4OFPA 1NGPL 3MRNB 5CAYB 3QHZL 3H7BB 3LQAC 4W4OC 1U58B 3VXTA 5EB9A 2R15A 2VWEE 1JGEA 4J12A 1MFCL 4N0CD 4G6ML 3SGDI 1FYHB 3VD7A 4F9PA 4IRSA 3RY6C 1U8LB 2PF6A 2BC4A 43C9B 2JTDA 3G6DH 1S7SA 3G5XA 3LRSB 4HD9A 4RFNC 4TOYL 4M9OA 1A6PA 4GRLC 2GTWB 3B43A 2IANB 5BS0B 1IQWH 3QHFL 4IMKA 1BLNB 3AU1A 1BEYH 3TZVB 4P4KD 2H45A 1T22A 4IRJC 4ODWB 4UUJA 1Q9WA 1SMAA 1ZLWH 3MNZB 5FKPB 4B7IA 4L4TD 5E8NB 4WI2A 3RVTC 3QNZB 2RCSH 3WKMH 1M7IB 3RWFB 1MFAH 1X3DA 2YOCA 3O6LL 2GAZB 3BO8B 1N5YH 4QOKB 4LASH 4S1DD 1A1OB 3UTOA 4OLZH 3MLYH 2X5PA 1CZ8H 5ICXA 1FL6B 1KELL 4X8XA 4JFYB 5F21B 5K59F 3L95A 1ONQA 3HKFA 3L3DB 4IOIA 4LHQB 3RA7L 1DFBH 5AG9A 3NA9H 4Z0BL 4X6BB 2DMCA 4KDWA 3CSPA 5C07E 3NBNA 1K85A 3DV4B 4U6TA 1HKLH 1HNFA 5HYFA 4OI8A 1BOYA 3IJHB 2XRAH 1UKSA 3LEXA 3N1PC 1W72H 2R4SL 1NCCL 2BHYA 5E1AA 3IVKA 1NC2B 1S9XA 4FQXD 1F4XL 4KGLA 4F15B 2OJZL 2YD2A 4PRPE 4MD4B 2I9LA 1J87A 3OXRB 4QGTA 1WWBX 1REIA 1IAKA 1RU9L 2OR7A 4WIQA 4YZFF 4AEFA 4NQXA 5E24E 4I18B 3MLUH 1CGSH 1EO5A 4CMMA 1F4WL 3N1FC 4KKLD 5KZCD 5JPMA 2QSVA 4PJAB 5I9QC 1LHZA 3B9KC 3KWWB 3L3HB 5HD8D 3S5LG 4DQOH 5I15H 4P5MA 4WFGD 4S1QL 1DL7L 3IDNA 3VFSB 4YXHH 3QUYC 4PJFE 1FVEB 2PW2A 3RVUC 1T3FB 3C09B 2RAMA 3LKRA 2GSIB 5F9JB 3TP4A 1A7RH 4KUZL 2CJUH 3L3KB 3V5HA 3E8UH 4AM0B 4ERSL 5IQ7L 2R0LH 3QI9C 4TUJB 2YA1A 1R5WB 3BKMH 3PG2A 4LVHB 3SKOB 4FQIH 1UACL 2DM4A 4BKLB 1J1PL 3GSVA 4L8SC 1KIPA 4H88H 4MQXC 4K2UH 1IEHA 3PWPE 1NGZB 1S7WB 2H32H 3U9PL 3ARFC 1GVIA 4G6FD 5CZVL 3WCYA 1KPRA 3WFHB 4F7EB 3RWGA 5EC1B 1F2QA 1HH6A 5B22A 3ZTJG 3O6MH 5D2LA 5A3ID 1BF2A 5DJYA 5I16B 1LP9F 3PWUA 1HOCA 2PXYA 3X17A 2YPLD 3HS0A 4Y19E 3ARSA 3KYMA 5E99H 1AXSA 1RI8A 1JYXA 3CJJA 5GHWH 4JY4A 3W0WD 1KT2B 32C2B 3KYKH 2BZDA 4HAGA 1XF3B 1E28A 2YPLA 4Y8DC 3OTTA 2D7QA 3UZQA 1JF1B 1HILB 2VDNH 4PP2A 4JRWA 3TV3H 1I4FB 4HMDA 1P2CA 2AJUH 1HHJB 4ZAKC 2DQFA 3CFCL 3FQUA 4F7CB 1MRCH 2APXA 2VLLA 5DUML 4XHJD 5D1ZA 3EHBC 3K74B 4M7ZC 1ZLVK 4XCFH 4NN6C 5I6XC 1U8MA 1S7UA 1HH9B 2FZ3A 4S10A 2VUYA 5D2NB 4B53A 2JIXD 3TA3C 1KTLB 1LO2H 1MIML 1QSFB 1EDQA 2MMXA 5A43C 4EN3C 3FT3A 1TCMA 2ORBL 1NDGA 4XTRD 4UILH 5E4EC 4XXDA 4M6MH 4FOMA 4NQEA 1ZVHA 1NMCC 2QKIA 1JZ7A 3QR2A 1LO5A 3NZHL 3DSFH 1G0XA 3IDGB 5F6IC 4MNGB 1G7MB 5ICZB 1KBGH 5MEOA 3UYPA 5J13C 1D6EB 1QFUH 2CK0L 2K3TA 4YHNA 2HKHL 4TN9A 3VRJA 5DMJB 4KJWC 4ZOEA 4Y4FD 1D5ZB 1OSPH 4RA3A 4G8FB 4QHLA 2VDKH 3RTQD 1IQDB 2XZQH 2Y7QA 3DSNA 3T0DA 2QADC 4OZGF 5C07D 3TESA 5AWNH 3F7QA 2FCBA 3OKDA 4KJPD 5JW5B 2WM0A 4QHUA 5JW4Q 3HA0A 3AGVA 2AQ3A 3EYQD 1Z6JT 2H41A 2L7JA 5T5FL 2ZSVA 3HE6A 1CK0L 2YK1L 5C07A 1U91A 1SM3H 4JHBA 5D7LD 3ULUL 1YPZE 4H0GA 1J10A 4FZEL 1SMOA 4PRPD 2ZCLH 1I8KB 3BPCB 1A6WH 5MP6H 3IETB 5D71L 1INDH 4UBDD 3OKYA 3HMWL 2NXZB 5AUMA 4YDIH 4PRPA 1FJ1A 2ICWB 4RFOL 5KBNC 1VCAA 1UM6H 4RMWA 3UCRA 2G5BA 4KZEL 4J6RH 4M7LL 1AGCB 1RVFL 2UZXB 4HFUL 3KLDA 2BY0A 2VSDA 4U1IA 5IEKA 5H35A 4N0FB 5ILTL 3TFKC 3WO4C 4OV5A 4JGJA 1LO4L 2XZAH 1EUTA 1F00I 1B9ZA 1RZJH 4JG0L 1U8QB 1C12A 1T6WA 2FIRT 4JM4L 4PJFA 5IV2B 2HWZL 1FORH 3H9ZA 3O0RL 4M00A 3GDBA 4GUPB 1RUPH 4JFFE 4M93B 5B8CA 1W0VA 1JBJA 4K3HA 4AMKH 2E9BA 1EAPA 4XPHL 1MCKA 3T2NL 1TXKA 1EUUA 1FC2D 5EC2B 2AEWA 2J6EA 1G7QB 4I13B 3PWPD 3BN9D 3TVMD 5DO2D 4XCYA 2DL2A 2EKSB 1HINH 35C8L 4LSUL 4AYFA 1OARL 3I75A 4GW4A 2Q8BH 1S7TB 4YFLF 4LHJB 2BSTA 1ZXQA 4P9HL 3PWPA 3MGOA 4PLOB 4J3SA 3TVMA 3S4SB 5I1IH 4N1HB 4QNPE 4JKLA 5JXED 3V4UH 4CN1A 3FQNA 3T0BA 1G6RH 1ND0A 2FBOJ 4AIOA 1UCBL 4FQLL 1A4JB 1ZHLA 1MWAB 3O6FD 4M6OH 3AVEA 4Y19D 3MJ7B 5LXGL 3UPCA 3ELAT 3EIFA 1ETZA 1T0NB 4H1LB 4Q2ZB 2RR3A 3CLEH 1YNKL 5E6ID 2YD1A 4PJEE 2V9QA 4MXQD 2D0HA 1Z3GL 1KENH 1IC1A 4Y19A 5JW3H 2OMBA 3LCYA 4WO4C 4NJ9L 1H8OA 5GGTA 1R3LB 5E6IA 5KW9H 5C0RH 4P59H 4OQTH 5BJTA 5JW4N 3NAAL 3OKMA 1N0LA 1HSAA 1NCNA 4HWZB 1CDJA 1M4KA 5F1OB 4NZRH 4OCYH 1AIFB 1IGML 1VENA 2DQCL 3U30B 4BFGA 2EECA 1C7TA 3GIVA 4MD5A 2Q8AH 2IEPA 4NQDE 5D1QB 2JJUA 4TPRH 2LABA 1CVRA 3VWKD 4LCWD 1QKZH 1UWGL 2Q3AA 2ZOKA 3BP4B 3FB8B 3MV9B 3QUMA 1BQLL 5F7UA 4Z76B 3EYSH 1AP2B 3VWKA 4BYHA 2O5ZL 4KQ3H 3BYTA 2WK2A 4M7KL 2P24A 3LN4B 1X5KA 2ADJA 3QWQB 3S3PA 1JGUH 1MH5B 1CFTB 1WITA 2YD8A 4XNZC 5GS1B 3GMQA 2FJHB 2OP4H 1NAMA 1VSCA 1X5FA 1NUDA 2R1YB 3JVGC 5CZXD 1MCWW 2VDPH 1G9EA 1CD8A 3UMTA 4KHTL 4V2BA 1IE5A 4LARH 3LQMA 5DJZA 3WEXB 1KGCE 4EOWL 3MLSH 3CK0H 4EI5B 5DHVA 3VXNA 3IDXL 3P73B 2FX9H 3ARWA 5BV7L 4XPFH 1P7QD 2JCCB 3NIDF 5E7FA 1S7XA 4P2OC 3CVIL 3THML 1AJ7H 1B0GB 5IMLA 1BVKA 1H3XA 4NO2A 4JZOA 4WWID 1T7VA 1BD2B 3LZFL 3GMMA 2G2RB 3SGKA 1JUFA 5CJQL 2E7BA 2EDHA 5J57B 1C1EH 3D85B 4G8EA 3LKSB 3NFPA 5DMIL 4QXGH 5HTSA 4HEME 1UJTA 3NIFF 3P0YL 5JPNA 2J6EL 1OQOA 4J4PA 1V3JA 4HKBB 4GRLB 5E2VH 3EKCA 4HIJB 5IB1A 2OMNA 4QRPB 4YUEL 3EBAA 1MCLA 5CEZH 3SJVD 3C5JB 4IRJB 2UY6A 2QSCL 2X10A 3O8XC 1N64H 5CINH 1C08A 5HXMA 5GGRA 3W9EA 4DW2H 5IHLB 1PKOA 1T66D 3IT8D 3C9NA 1IEBB 1M6OB 5IMMB 4JB9H 4XBEH 2FX8H 5AZ2H 5T33H 5ACZA 1AQDB 1J8HE 4X98B 5HDQL 1F8TH 2Y36H 3DI3B 3VWJD 1ZK9A 4APQB 5M94B 3LKNA 5J6HB 3BWAA 5GGTL 4TSBL 1WTGT 3HAEA 4JFFA 5B3JF 3SKMA 4E9LA 3BP7B 4UT6L 4ZFFA 1OOAA 1JZ5A 3MV7A 1IAIL 4WVRA 3U36B 1F90L 4QWWD 3QDGA 4E41B 5EU7E 1HEZA 1WBZA 1RAMA 1F58L 3UC0H 1EHLL 5HDLA 2ENSA 3U7YH 1W8OA 3QUML 4P2YA 2F54B 4TVSa 5KS9F 2NY7H 3CMOH 2MNUA 4QHMB 3VW3H 3B6SB 5D7IB 4M6NL 2V5MA 4X6CE 3TO2B 3T2PA 4N0UB 3TBSB 5EBWA 5I8KL 3MLPA 4WCYL 2CIKA 2F58H 4GRMA 4JRXE 3F62A 1CLYL 3U48A 4PJEA 5F9OL 4HXBL 3NZ8A 1ZEAL 3X3FH 3KDMB 3PWJB 1XGTA 5K9KA 3BZFB 3OGCB 5I9QB 4H26A 3B9KB 3HG1B 3ZMRA 2GITB 3RX8A 3WDJA 2Q76B 4B41A 2BVTA 1KJVB 4KROC 3QUYB 4S1SL 3PXJA 3FZUD 4WW2C 3L6FA 4G5ZH 1R3JA 2IH1B 4NQDD 2B8OT 5TQ0H 2Y5EA 2DBLH 4ZO9A 2D7TL 5B38B 4NNPL 1WT5C 4FTVE 5I1KL 3QI9B 1UKQA 1KEML 4NQDA 3VJ6B 1UB6A 4L8SB 5E00B 4BH7B 1PD6A 5JA9A 5DJ6A 1OPGH 3HI6L 4O58H 3V2AR 1SQ2N 2XXMB 2H3NB 4P2RB 2KDGA 3ARFB 3PV6A 3F7YB 2EE3A 3VXUE 4TNWK 2E7LC 4N0YL 3AS2A 4JRYD 2CKBA 3CUPB 5I1JL 1J1XL 5FDWB 3CFKB 4YFEA 4Y16D 5FXCH 5F88A 4NO0B 3W81A 4HIEB 3DIFA 3LH2H 4PRAA 3EO0A 1FQ9C 4MMXC 1K8DB 4XVUC 1UWXH 4AQOA 2A6JB 1PQZA 3IFPB 4PJHA 4WU5B 1KGCD 3BXNB 1N6QH 4GQ9H 3ULVD 1ZT4B 4UDTB 1S9WB 3VCLB 4R96A 2HFGH 3JWOH 3DI2B 3MXWL 4NC2B 2DQDL 1U95B 5FAAA 1MQ8A 2G60H 4F58H 1W72B 4XBPB 1BJ1H 3TNNB 3VXMA 1WEJL 4GAYB 5LWYH 4F33B 4LEOB 5IBTL 3S5LA 1K3IA 4GMSL 4ZAKB 4ZXBB 4WW1A 5E95B 4RA0C 3C60D 5GRXG 1KNOA 4DKEH 1JRHL 2PTTA 1IKNC 2X9WA 4M7ZB 4R2GC 5GXBB 5KVDH 3STLA 5EFIB 3DGGA 3QG7H 4CNIB 2YSSB 1I1AC 1JGLH 1YNLH 3SY0A 4MSWA 3G6JE 4NZUH 3TN0A 3MNVA 3GMRA 3BRFA 1KN4H 3TIEB 1ACYL 5E5MB 2YN5A 2WANA 1OCWH 3TA3B 2JF1A 5I30H 3ARBC 3GZKA 4K07A 4HS6B 3G08A 4EN3B 3GBLA 4CDGC 3PGCB 1PFCA 5JXAH 1BZQK 3ULUF 2P45B 4LCYB 2CMRH 4HWBH 2VDOH 4ELMB 4JPWH 1RZ8A 3G04A 2NY0D 1NMCB 1SJEB 3FO9A 1U6AL 3BGMA 1J8HD 2Z8VC 3OAZK 4HW6A 3BOVA 3NH7L 4OB5H 5SWSE 4J1UA 5F6IB 4G6KL 2ITCB 2X89D 1ZANH 5J13B 3D2UD 4HWEH 1UVQA 3DX6B 4CMHB 5DJCA 3JV6B 3P4OA 4WEBH 4U3CA 3QUZC 1OGAA 3E6HB 2X89A 3HUJB 5EBMB 2XICA 3D2UA 2X9XA 5D2LF 1NGWA 4IDJH 2VN7A 2QADB 1EJ6A 4LLQA 2NCMA 3IXTB 4XBGA 1MEXH 5FA4B 3MRLB 2J8UB 3NCYS 3MYJA 3RNKA 1NSNH 4NWTH 5FYJL 3JWOC 4K71B 3R1GL 1T5WA 1F42A 4WV1A 4QF1A 1GIGL 2G5RA 2FEDD 2JJWA 4ZPTA 2IJ0C 3NCFB 4AG4H 3GSRB 1XGQB 3KPSA 4S0TD 2QQNL 1ED3B 4X6CA 3S6CA 1BVLA 1AGEB 3GB7A 2DQIL 3MCKB 5DJAB 5E08H 1T1ZB 1KXTB 1FE8L 2CKBL 3Q1SH 5LCVH 2X4RB 4JRXA 4LMQI 2V6HA 1I3GH 5CIPB 2BNRB 1KULA 3WO4B 3VGBA 1AFVL 1TVBB 3TBWA 5HJ3A 5ITBL 2R2HA 2FRGP 3QO1B 4K9EL 4F9LA 4G7VL 4PJ7A 3D0VB 1ZSDB 1EGJA 4FTVD 2GJ6E 4UTBL 4HUXB 3CPLB 2GSGB 4FQXB 1R3HA 1MQKL 1A3RL 4JANA 1UXWB 1XR8A 4TQEL 2A9NL 2E6JA 4RNRB 5C08E 3BW9A 1MCDA 4FTVA 3S36H 1G9MH 3QPQC 1GGTA 3OBAA 1XF5A 3SN6N 2NNAB 3PJSA 4PJXF 2OZ4A 3PHOA 1UZ8A 3J7HA 4XVJL 1HSBB 3S88H 4OF8A 1BQHG 2UUDH 4NKDB 1YEEH 3VXUA 1JNJA 5I8OL 3IDIA 1GC1L 1S9VB 5TE6H 4DOHE 5J1SC 4LLYB 1WZLA 1AXTH 4HPOH 2DKSA 4C56B 4H8WH 5EPMB 1N7ML 4RFEB 5AZEH 4FFWD 5GS0L 3MZTA 2BSRB 4MA7L 1WZMA 5C0DA 1YY9C 1AGBA 3FFCA 3RVWC 3IXAA 4WO4B 5HYEA 2V2WA 3EYOA 2P46B 3ZT7A 2HMID 4DFIA 4LFHG 1MHHA 1RSFA 2IPUK 3HZKA 4P3DA 4OF6A 1WIOA 4G6FB 4U1HB 2P8PB 3EDKA 4YO0B 3EYUH 4MDJA 4CVZB 4LLDB 2EYTB 2HT4D 1KFAL 3VFWB 4BSVA 2VXQH 3GSQA 3LIZL 4OGAC 5F8RC 4R0LC 1BOGB 3TCLA 2HT2C 4LDOB 3PGFH 4NZDA 4GO6B 4UTAL 3CDFA 2BK8A 1JK8A 1EXUB 2W0LA 1AHWA 4XAWL 3OKKA 1OAXL 3LKQA 3QCVH 1FFOA 2AEPL 4X8JB 1M05B 4XNZB 4X6FA 1FPTL 3S3SA 5HHNB 3X3GH 2XWBB 1A2YA 1UEMA 2YN3A 5SX4I 3T0XA 2MCPH 1ZAGA 5SWSD 1JL8A 1G9MC 1LK2A 5EIVA 1E4JA 4MCZB 5ICYB 1QBLL 1EA9C 1MY7A 2GHWB 2NY3D 2OI9B 4Q6IA 1CICD 3V6OE 1AR2A 3QXVA 4KK6C 4LRNL 4UIKH 2CH8A 2AKRB 4PLJC 1LGVA 4EIGB 2AQ2A 4XPAH 1CVSC 4JFOA 1CR9H 2KQNA 2VE6B 1MNUH 1HXYB 5D5MB 5C0AA 4FABL 1CICA 3G6AA 4GKOA 5DTFB 1FGNL 3HR6A 2IPUG 2JIXB 4P2OB 3GRWH 3MFGB 2V2TA 1UWEH 3RGVC 4G7YH 3V4PL 4NRXB 4H8WC 4QEGA 2KZ1B 4GW1A 5IK3B 2ARWA 1MAJA 4KZDH 2VZ1A 3I50L 1EK3A 2DI8A 3OR6B 2VSCA 1HDMB 3BDXA 4CUCA 5EOCL 1LEKA 4Q0XH 5DEZA 5J1AB 5ELIA 1RUQL 1P4IL 4KJQC 4YQXH 2N56A 1S5IH 1A7QH 2HJKB 6CGTA 1R5VB 1XCTB 4RGOL 4TUOA 4NQVB 3PGDB 1B0RB 3PP4H 4Y2DD 2A6IB 3U2SB 3QDME 4LSDA 2OZ4L 3AREA 3TO4D 1I7RA 4Y4FB 4RGNE 3D3VB 5EO1A 5ANME 4Y2DA 2R9HD 1CFNA 5TFSH 5KVEL 2F8XC 4GOSA 1OGTA 4EZMA 4P5TD 4AIZA 3O8XB 4IHOB 1E27B 1XR9A 3FONA 4KKBC 3KYNB 3BT2H 3IDMA 5T3ZH 1E4XH 1OLLA 4NNYA 2WAHA 5CFHA 4N9OB 2VQ1B 2VXSL 1KG0A 2B4CH 5ADPL 5D7LB 4UT9H 1G7PB 1T0MB 4H25A 3V8CA 4Z5RB 3S96A 3WIFA 1O0VA 1R3KB 3EFFA 4Q9QL 3B4NA 2VXUL 2WW8A 1DQDH 2GJ6A 4ZFZA 3RI5F 1A7PH 4YK4C 3K2UH 2R69H 1ZLUK 4EI6A 4CVXA 3WHE1 4U6YA 4MXVE 2XPGA 3INUH 5C08A 4LSRH 4TRPL 5IIEB 2F9BT 1T83A 4KTEH 4XWOC 2H26A 2ADGB 3OWEA 4LPVA 5LJYH 2GK0B 4GSDH 1EFQA 5DQDH 1DVFD 1PLGH 2PNDA 3C08H 4AH2A 1VFAA 2BHZA 4QRRE 4OCRL 3RNQB 2ADFL 2PR4L 3KYAA 2X7LA 3O2WH 4KQ4L 1FFRA 2BOBA 1JMXA 2O61B 4ODVH 1DVFA 5DEFA 3B5GA 5KN5B 4PP1D 2I9TA 4L9LC 1IARB 3MRQA 4NOFA 5ADOL 4UI2A 1S8DB 2VERN 5HHME 1NGPH 3QHZH 4KU1A 5MHSE 4M8QB 5F7WC 3RPKA 1MFCH 5D1XD 3U4EB 2R0WH 1N6UA 2YEZA 4RX4A 5I76B 4LSQH 5DJDB 2NMSA 2MJWA 1F3RB 4KROB 5GGSA 4K8RL 4HX1B 4WW2B 3AC0A 4TOYH 3HE7A 4B0MM 1JGDA 5IROC 3VFTA 1INQB 1OW0C 2W9DL 4EJ1C 4N8VB 3WS6A 3V5KA 3QHFH 2EDRA 3O6FB 3FQTA 3MFFB 3OKOA 1HYSD 3HRZA 1WISA 4LLUB 1BZ9B 3Q6FB 3FQXB 5LGJA 3B9EA 1ULVA 2XWJB 1ZVSB 1BQSA 3ORJA 4YHZL 2X1PA 2C1OA 3HB3D 4QTHB 2B2XL 2B4CC 4N1CA 3L9RB 4MWFA 5GSRA 2R2BA 3QFJE 4ZTPH 3O6LH 4L8BB 3H8NA 3FT4B 2J8OA 5DXWA 3HZYA 5HHQA 3BUTA 3BSZL 5LVEA 5FYKE 1DEDA 3VE0B 3HNVL 1KELH 4MB5A 4OFDA 4UV4H 5A1AA 3VI3E 1CU4L 3MRJB 4DZ8A 2NX5E 1HHIA 5SWQB 4XX1G 3V6FB 5F44A 3M45A 4R26L 3BKYH 1FZKB 4LCWB 4CN6A 1A47A 5C0NC 3VDCA 3V6OA 3AM8A 4E5XB 1BMGA 4O00A 1VADB 3CCHA 2QR0A 3WLWC 1FCCA 4V1DE 4D9LL 4ACPA 2VR4A 3FOLA 4WNQA 1BFSA 1H3GA 2YS4A 1SYSA 1PG7H 5GGVL 1XGPB 4ZSOA 5IW3A 3H3KA 1N2RB 1NCCH 4HZLA 4BFIB 3NPSC 5CD3B 4D0DA 2OX5A 4CW1A 5JUEH 3W11C 5I2IA 1F4XH 2DS4A 4OZHE 1MELA 5DHYB 4WI9A 1XGYL 3O9WA 4JFXA 1RK0A 4QXUL 3TCXA 4R2GB 4JFDD 4E42A 4RDQG 1RU9H 4EUPG 2AEQL 1I1AB 1KB5H 1LNUB 4GFTB 5DC4B 2VJXA 2X4PA 4PJBF 1F4WH 5HGDB 4G6AC 3BAEL 1IGCL 3LD8C 5EBLB 2FL5B 2ZSWA 1F4HA 4L4VA 1CG9A 3BRGC 3R0MA 3QDMD 1XGRB 3TT1L 3ARBB 5DRXA 1QR4A 4S1QH 4NDMB 4AEIL 1DL7H 4JN2A 4DN4L 3MODL 3MRGA 3QDMA 3K3QA 2HJFA 1JFQL 3VFUA 3IJYB 1J11A 3Q5YA 4P48A 4UB0L 4KUZH 4XP9L 2PO6C 3X14B 3U82B 5ANMA 1ZWIB 4ERSH 4ZUVA 4KVCL 5IQ7H 1C5BL 4FNLL 1Q94A 1VB9A 5CSZA 5CSGA 5IQ9B 3MLVL 4XP6L 1UACH 2K9UA 1J1PH 4YHML 5LBSL 3I3DA 4NSKA 5DQ9A 4HIIB 4I3GA 4NNXA 1KTRL 1N3NB 4HQQL 1I3RB 3QA3A 1KN2L 4BK5A 4EIZC 4L8CA 1A4KA 2DOCA 1JNLL 5CZVH 4PLKC 4HK3N 4NM8L 1CD1B 4MX7B 2ZOLA 4L1HA 1XCQA 4J3VA 4Y89A 1H3TA 2FWOA 5IBUG 5IF0A 1JWUB 1MCBA 4Y5VC 3SJVB 5JOFB 3G5YA 4PJHF 5IMOA 2QQQA 4OCMC 3QFDB 2ZG1A 3VXPB 5D7SH 3UDWA 3UTSE 3TBYB 2VH5H 1KTDB 3T1FA 1UC6A 4JQVA 4U6VL 1AC0A 4OM1L 3ZE2E 3FRPG 4WHDA 3VXRE 4QRRA 5DMGC 3VFOB 5FB8A 3RWJA 1FVDB 1WGOA 3PQYB 2P5WE 1G7HA 3QQ3B 5HHMD 1QBML 2CRMA 5B4MD 1A6UL 4JPVL 4XVSL 3U79A 2RBLA 3E6FA 3UBXI 3VFMA 5C0JB 3CFCH 3V0VA 1K4CB 4CU6A 3C5ZD 3FO2B 5MENB 4HJJL 4JGUA 5DUMH 4G6JL 2X4QA 3OG4B 3OKNA 3BGFB 5LGHL 3HR5A 3CFEA 2Q7YB 1P7KB 3GGWA 3TIDA 4A6YA 3F58H 4UQ3A 2XTJE 2SEBA 1UZ6F 3V5DB 3VH8A 1MIMH 2NLJB 3P30L 1U8KB 5I1AB 5HI4C 2B20A 1UJ3A 4MQ7A 1FG2B 2ORBH 2XA8L 3GSNA 4PYHA 1AC6A 4MZ3A 3SCMC 1WC7B 4WI5A 2EYSA 1T20A 4PG2C 2WLZA 3MRRB 5B39G 3QFJD 1I8IA 2KKQA 5CD5D 4YBQC 4KMTL 3NZHH 4PV8A 4WHYH 3DETC 2IH3A 4LKXB 1EERB 2CK0H 2HKHH 2PYFB 3MLWL 4F9PC 3JZ7A 5EIQA 1EH9A 4IRSC 4XXCA 1MCIA 3STBA 4IBLT 4PS4L 2HVJA 1HK6A 1PDKA 3OR7B 4R90L 1DANU 2MQ0A 2RJMA 4BZYA 4PUBL 4FXKA 2H8PA 5JLZB 4OCWL 2NX5A 4NPYB 3MUGA 1ZGLA 3DARA 3MR9A 2P4AB 4IMKC 1CK0H 3ILPB 4ODTL 2FECL 2YK1H 3H9SE 3TNMB 3L3OA 1EHXA 1DANT 3ULUH 4V1DA 4OI7A 5BQ7B 4P2QD 5GPRA 4FZEH 5CGYC 4MDIB 2QQLL 4LEXL 4JRYB 4AENA 5D71H 3WHXA 4OZHA 4LU5L 3HMWH 3V0AC 1ZKAA 4Y16B 2QJDA 2XTLA 1DQJA 4R0LB 4TNVK 1RVFH 5AYUL 4HFUH 4NT6B 1OTUD 4EVNA 5CJXC 3VGFA 5ILTH 2UVEA 1CFQB 5GRZA 3BP6A 3SKNB 3GBML 4XCCL 5IB2B 5I1LA 5C0IB 2BDNL 2X44D 5DUBA 3EOBB 4PJ7F 2ZCHL 4JG0H 1YEDB 3HC0B 1MUJB 4NRYA 4JM4H 2HWZH 1NEZA 2BXZA 5MEPB 2XV6B 5GQBA 4Z78A 4RIRB 2X2YA 3UZEA 1BQHA 2UWEE 2FHBA 3T2NH 2X4OB 5E6YA 1XIWC 1J1OL 2Z8RA 5T5NG 1QO3B 3R06A 5GSVB 1SVCP 4LSUH 3BHBA 4OGYH 1MI5B 1OARH 3DO3A 5IR1A 5DMKA 4P9HH 4LFHD 4KTYA 4OZFG 4XNQA 2ESVB 3F12B 2Y9RT 4PGZA 3HZVB 5SWZB 3PWLA 3VFPB 3RGVB 1MJJB 2D4DA 2GEEA 4FQPA 1UCBH 5GRJL 4L8DA 5IW6A 1RZGA 1WTLA 1D5IL 3G5VB 3I02A 4S0SD 1QLEL 1WF5A 3QULB 3MV8A 4A6YL 3GMPB 1YNKH 1QSEE 4JO2L 5F7EH 5TDOB 2ZUSA 3KS0J 2FGWH 2AJSL 5C3TA 1JZ4A 4FQHB 4FFYL 3WFZA 4ALAL 3VXRD 1KJMA 2A0LD 4NJ9H 2GW5A 3UTSA 1YYLL 3D18B 3GSNL 3WUWB 3ULUC 5FKAA 2A77L 2P5WD 5DMYA 2AJXH 3NAAH 1X4YA 4JN1L 3RVVC 3P4LA 3WO3B 3FHAA 3UTTE 1WZKA 5DK0A 3F8UB 4KKAD 4J3TA 1GCFA 1IGMH 5M95B 1CLCA 1DSFL 2DQGL 2P5WA 3M1BA 2DQCH 3S37L 3UYRL 4ISVA 3U6RB 4QYOB 3QG6B 4ZD3L 2AV7A 1JTTA 4Y5XC 2XNAA 3L1OL 4PGDB 1DE4A 1T6VN 3MLXL 1UWGH 3LSOB 4ONGL 3VRIA 5IB5A 4U49A 4HG4J 5FYKL 1BQLH 5HYSB 1L6XA 4XX1E 5FGCB 2O5ZH 2PXYC 3N1QC 4GKSA 5IVZA 1U3YA 3BEWA 3WV0A 1J0ZA 4O51A 3UTQB 2YPKA 4XI5C 3CX5K 4BQ8A 3GJEA 1JPFB 3U9UB 4LNRA 5E9DB 3FO1B 1OAZL 4R8WL 1MHPL 1JZ6A 1U3ZA 3ABZA 4W4NA 2ATPA 3B2UD 4KHTH 2XACC 4RGMC 3ZE0F 2YC1A 1TMCB 5D96C 4EOWH 4P9HC 5D1ZC 1NMBL 3IDXH 5C0EA 5BV7H 4HHAB 2VWEC 1OL0A 1PX4A 2EDWA 3TBTA 5HHOA 1QFPA 3CVIH 3THMH 3CLFL 5I1HH 1I7UB 4PJDE 3FQRB 1YEFL 3RAJL 1BVZA 3DRTB 4M48L 3Q3GA 4DGIL 3LZFH 1FLRL 1TETH 3H9SD 4U1SB 3VXSB 4B50A 1BHGA 1EEQA 5TF1L 3EUUA 3LN9A 4S2SB 4KJYB 4JFEB 3H9SA 3RQ3A 5KVGL 5IFHL 5DMIH 5F7FA 4ZMAT 3P0YH 1CF8L 2J6EH 1HQ4B 5GGUA 5C0GA 2MQ3A 3TF7C 3DRQA 1BWWA 2A9ML 2LTQC 4ZFOB 4JO3L 4HKJA 4YUEH 3ZZ1A 5KAQG 3U46B 4ZS7L 1EPFA 2Y1VA 4M7JL 1MRFH 2XQBH 3C5SA 2VTFA 5JHLH 2VAAA 4M9PA 4YDVA 3QDJE 4LDLB 1CN4A 4I4WB 1U8OB 3ME0A 4CGTA 1GZPA 4ESKA 4D3CL 3LOWA 4DN3L 3ZKQD 3MRKA 5ERWB 5T1LD 4OZIE 1Q9LA 2ITDB 3HE6C 1XF4A 4NC1C 5GGTH 4TSBH 3GMLB 1T4KA 1FC1A 5GRYA 1PEZA 5JQ6L 1ZHNB 3BE1L 5EOQL 5T1LA 1VFMA 2P5EB 5FO8B 4UT6H 1YEHL 2HLFD 2YD4A 25C8L 3DURA 3RWDB 2XKNB 3GEWB 4QLRA 4NCC2 1ZV5A 5E1HB 1FL5A 1IAIH 4U0QB 3HC4L 3MRIA 2JELL 4Z77B 1DQTA 4R7DB 2BHUA 1MAML 2VLJB 4JPKH 1TVHA 5BV7C 4IDLA 1EHLH 1NMAL 1YEGL 4JFZL 4UIMA 4KDTC 1YMHB 3QUMH 3EJYD 1X5XA 1FG9C 1WWWX 4YNYB 4PLNC 3L3GA 4RZCA 1K3ZA 4Z7UB 2DLGA 3AAZA 3MJ9A 1BBJB 3U7WH 2HT3C 3QO0A 3WD5L 5I8KH 4WCYH 3GUTA 1I7TA 1QSEA 1CLYH 4I48A 1OP5K 5F9OH 4HXBH 1A1NA 4RCAA 1D9KD 1ZEAH 3BJLA 4R4BA 4XRCA 2DYPA 4NKMA 1NCDL 4HBQA 2VABA 3UTTD 1ES0A 4YHPB 4PJGE 5IP4A 4QHNA 5CEXA 3DVGA 1G7LA 4NZTL 3ARTA 3P40A 2IALA 1IC7L 4GBXC 3SPVB 3HNTL 3OJMB 4HGMA 3BIKA 3B2VL 2V2XB 3SE9H 1UGNA 3FT2A 1UM5L 2WV3A 1KPUB 4G42A 3FAXA 4JM2A 4YIQB 2D7TH 2PO6B 4P23D 5DHVH 4POUB 3T04D 5F97E 5IFJA 4PRIE 3CH1A 1KEMH 1E4WL 1TZIB 3QEQE 5L8KB 5DD1L 3QQ4B 5DZNA 3HI6H 3DVFA 1KPVB 3FCTB 2IQAB 5J9PA 3V4VH 4N0YH 2ZKHH 4O2CB 4PGBA 1ZLSL 3TPUA 4QCIA 1J1XH 2NYYD 4PY8I 3S37X 2ARJB 3WFEH 1NDMA 1ROWA 1GGIL 3TO4B 4BFEA 3G6DL 1UM4L 1ZT1A 4JJ5B 3ECBA 2Z4QA 4Y5VB 3PP3K 3UPRB 1NANH 2BCKB 3I2CH 4Z7WE 1N5AB 4O2FB 2D7OA 5DWUL 1BEYL 1C7SA 4PRHB 3TJEL 5HGBB 5JHDE 3KXFA 2PW1B 3MXWH 2DQDH 4PREB 5A2LH 3IAQA 4HKZA 4J8RB 1RZIA 2V5RA 4FXLA 5HHPA 1Z5LA 1VFBB 2R1XA 4BH8A 1WEJH 2X1OA 3MRFB 4NBXB 2RCSL 5JDSB 5GS2D 5IBTH 1J5OH 1XF2B 5HPMA 3ET9F 4PJDA 4DVBA 1MFEL 3N1MC 3RWIA 1AY1L 2VDQL 1N5YL 3MCLL 4PGEA 1YN7B 1OTTC 4OLZL 1JRHH 3MLYL 4C57C 3FJTA 4P3CL 1TCRA 2CDGA 1K4DB 3IRZA 2DDQL 3HAEH 4XMLL 3CDCA 2G75A 2J88L 5GIRB 1S5HA 2QEJA 4J3WA 3UROR 1ACYH 3EYVB 2Z93B 3NA9L 5K33A 5KANI 1T80A 1EFXD 4DJMA 3SE3C 5FO7A 4NUJA 4OSUL 2HH0L 3NACL 3NABL 3MRPB 3UBXG 1ZHKB 4LCCA 1EFXA 3MRMA 4P46A 1CD0A 1VGKA 4MZ2A 1F6AB 1BX2B 2B0SL 4FS0A 1JWMB 3IF1B 3V95A 3T2QA 3BP5B 4U31A 4XB8A 5D1XB 3BKCH 4MA8L 3QDJA 4K7PY 1U6AH 1J05A 1S9KC 3MJ9L 3NH7H 2XN9D 3BIBX 1KLGA 3NIGE 4G6KH 3T4AA 4EBQL 3VXTB 4BSWA 5T1KB 3SGKC 3KPLA 3F6IA 1FFNA 2YBRA 5HYQA 4OZIA 2N7AA 5I15L 4OFIA 9CGTA 3ROLB 2A73A 3LN5A 1S7SB 3G5XB 4UV7H 5BZWA 3T65A 4MXVF 4J4PC 1OT2A 3N85L 1EZVY 2WNGA 4HGWA 1XAUA 4NQSA 4D8PA 1QRKA 4NO5B 2DQUL 3AU1B 4L3EE 4NKQB 3ARGA 1XZ0A 3E8UL 4NBZB 4WWKD 3R1GH 4WEMB 1S7VA 2R0LL 1Q9WB 4K3GA 2E9WA 5C0CB 1GIGH 1U8HA 4WWKA 4IJ3C 2CDEA 1CXFA 2G9HA 2W60A 3S4SG 2CGRL 2XG4A 3VDAA 2QQNH 2F53A 2DRUA 4MAYA 2DQIH 4XT1C 2CKBH 1Q0XH 5HGAB 3A0OA 4MA3B 4H1LG 5FUCC 3VXQA 4DZBB 2XOTA 4CVUA 1UB5A 4X4ME 4GRWF 3E3QE 2VXVH 3K1DA 5BS0E 2IANE 3JXAA 5ITBH 4Y0GA 5HHXH 4NKOB 4PJGA 3SQBA 4XAKE 3HNSL 43CAA 4QRTA 2AABL 2WMPA 1R3IL 5FO9A 4KAQL 4PRID 4UTBH 3U1SL 3C2AH 1MQKH 2F74A 1A3RH 4LAQL 3QEQD 2FIKA 2IADB 3P4MB 2DN7A 4LLWA 2A9NH 4TQEH 5J6GA 3QUXC 1HYRC 4PRIA 5E1AB 1XIWB 4JFDB 1S9XB 4U1KB 3U0TA 5I17A 4P4RA 3CAFA 4QOKE 3QEQA 5F71A 2NW2A 1MRCL 4XCEA 2A83B 4XVJH 4OUUB 3G5ZB 3PF2A 1BFOB 3WDIA 3SDAD 4Z7OE 1PYWB 1A22B 1A5FH 1GC1H 1HWHB 3RWEB 1JPTH 3QIWD 5DJ8A 1HCFX 1N7MH 3VI3F 4ZUSB 4JG1L 5GS0H 2NY4C 2PW2B 4RMQA 4MA7H 2GT9B 1NBZA 3QPXL 4ODUB 5IWLC 4Z7WA 2C7UB 4HSQA 4QY8A 1WFNA 4JQXA 5JHDA 3BD5A 3DYMA 3OHXB 1ORSB 5E94A 1ZA3B 5DD6A 4E0RA 2HTKC 3CC5A 5HI3C 3TJHD 3WFDL 1U36A 2X40A 5GZOD 1QOKA 4OM0L 1UA6H 3BH8A 3DHMA 1BAFL 1KFAH 3IJSA 4PJAE 4Y5XB 3LIZH 2J3SA 1KPRB 1CGUA 3D69A 5C92A 2EXWC 3RWGB 3OJDB 4YWGL 1CGTA 4L29A 2XZQL 3ZHDA 3KLSA 3PDOB 4UTAH 1PKQB 3PWUB 1HOCB 1AGFB 3MRHA 4OLUL 1XT5A 2EICA 5DI8B 1MCOL 3JSSA 4IIQA 4K9EC 4R4ND 4CL7A 3FFDA 3MGTB 4XAWH 4FRWA 3ZKXB 1OAXH 2P8MB 1LK3L 5IHZB 1B3JA 1T7WA 1E28B 1FPTH 4OZFA 3CFBA 2XZCL 1CFSA 1BZ7B 5KVMC 3FB6A 2QLVB 3ZYJA 1HI6B 4MMZC 3V0WH 5GS3A 4RGMB 3RP1A 2LVCA 4LRNH 4YDIL 2CR6A 4PB9L 2ICWJ 5D96B 1FNLA 4OIAA 3REWA 4HK0A 2DQTL 4GW5B 4J6RL 1IBGL 4OCSL 4FABH 1BQUA 3OZ9L 2X70A 1FGNH 4JPIA 4M1CD 2A1WL 1U8MB 2OSLA 1S7UB 1GC1C 3ESVF 4JHAL 3V4PH 3ZDYE 3TN0C 3RDTD 1RJZA 5JNYA 2C3GA 1JNHA 5GS0C 2L7UA 4L3ED 4LHUA 4O2EB 4P2CG 3I50H 3DV6B 4M02A 4ZQKA 1A6AB 1IC5L 2NZ9D 4JDTH 3RDTA 1EEYA 1I85A 1ZLWK 1RUQH 1P4IH 1S7RA 1CT8A 4I0CC 1WFTA 4L3EA 1GOGA 4YDLC 1LE9B 1RPQA 2R23A 4I3RL 2IG2L 4PJ5B 4RGOH 2GY7B 4NQEB 5GISL 2XWTB 3MO1A 3H7BA 4PJXB 2FO1A 4IOSD 5F89B 1FVCB 2OZ4H 5SX5K 2GTZB 4U1GC 2LQRA 5BVPL 1U8LA 3TEUA 4YHNB 1G6RL 5KVEH 1ZLVH 43C9A 1N8ZB 4W81A 5D2NE 4YBHA 3CXHK 5ESVB 5BS0D 2IAND 3T77A 1RJCA 3LRSA 1L9MA 2IMMA 2Y7QB 4XAKD 4Q9CA 2GTWA 1QSFE 5DQJA 2VXSH 4X4MA 5ADPH 4ZUTA 5BS0A 4PRBB 1BJ8A 1BLNA 4P2QB 1BFVL 3HLAA 4MCYB 5I8CA 3WIIH 2NXYC 1BIIB 5ALBL 3TZVA 3FKUS 3L3IA 4HJ0D 1QRNB 2ZSVB 3CZFB 4ODWA 5KSBA 1NCWH 2VXUH 2WQ8A 4HXAL 1F4YH 5FKPA 1MHEB 4GJTB 3EFDH 5IJVA 4QOKD 4WV1C 5BOPA 4JLRA 3QNZA 4PV9B 4HIHB 4MNGE 3P77B 2EDYA 2ZWLT 4TRPH 3RWFA 1U8NA 2GAZA 5B38G 3NCJL 4QOKA 4YGVB 4FHBD 2DMBA 2Q8AL 3MRDA 3Q5OA 4OJFH 2G5BB 1FL6A 4TPRL 1W2KT 5FYLL 5BV7B 4PR5B 4JFYA 1D5BB 1OAYL 4OCRH 2ADFH 2PR4H 4U1IB 3OMZA 4KQ4H 2HRLA 4S1RL 5KTEL 5IVXF 3L3DA 1GSMA 3GKWH 4OV5B 1JE6A 5T1DL 2YRPA 4B7LA 3BFOA 5ADOH 2XKSA 3DV4A 1NC2D 1HNGA 3IYLW 2AJVL 3IJHA 2DLIA 2OP4L 1XGUB 1EAPB 4KI5F 2GIYA 1DTUA 5GRVL 1C5DA 2X4SB 1S7QB 1RQ5A 4GBXB 1U3HC 4MD4A 5F7MC 4K8RH 4Q7DA 3OXRA 5CKAA 1OAQL 3IGAB 3Q48A 3I75B 4QXTB 3KJ4C 1G6VK 2W9DH 4I18A 4X6EB 4M62L 2VITB 3SDCC 3QB7C 1FYTB 3W2DL 1B88A 2Y5TA 4ODBD 2X4TB 4PJAA 3L5IA 3KWWA 2X42A 3EJZD 4HC1A 1X44A 3RBGA 2W65B 3H42L 4I3SL 1B4JL 5EU5B 3VFSA 1FVEA 4YHZH 1T3FA 2GSIA 5F9JA 4PIRF 1Y6KR 3L3KA 3OF6A 4AM0A 2WBJA 4OD2B 4FQ1L 1C1EL 2VNCA 5INDA 4TUJA 3BSZH 4Q9BA 1JYNA 1F6LL 1R5WA 4RAVB 3SKOA 4QXGL 3HNVH 1AXIB 1NLBL 2FB4L 4Y4HC 4BKLA 1CU4H 4WGWB 4FFVC 3D0LA 3VG9C 2BP3A 1S7WA 3M17B 4R26H 3R0NA 5IHUH 5JORA 5GRWA 5CEZL 3WFHA 4F7EA 3TT3L 5EC1A 4D9LH 1I9JH 2VL5B 1HQRB 3RIFK 2FD6L 2ICEB 3K2MC 5AD0B 5GGVH 1A14L 1NCBL 5I16A 2AJZB 4XGZA 4MVBD 2ZCKL 5MERB 1WCQA 5CWSB 1F4AA 3MRBB 2YHGA 1XGYH 1IGJB 2AP2A 1M1SA 1F8TL 1GOFA 3K46A 1KT2A 32C2A 2P24B 5CCKL 2NY5L 4QXUH 1FZJB 2QTEA 1XF3A 4D0CB 2AEQH 3BD4A 3CU7A 3GMQB 2B5IC 3KPPA 4PBXA 1K8IB 1HILA 1IGCH 3BAEH 4PJ9C 4G80B 1FIGH 1I4FA 2R0ZL 3TT1H 1HHJA 2X6MA 4K8RC 4F7CA 4AEIH 4PJIB 4Q6IC 3GHBL 3MODH 5DJZB 1RHHB 3N06B 1SY6A 4X7FC 1JMZA 3HPLB 1JFQH 3MV9E 2CK2A 4NCDA 3KPRD 1QFWL 4JM2F 2OYPA 4GXVL 2EYRA 3JTSA 2NY6C 1X6LA 4UB0H 4XP9H 3UEZA 2IF7A 1TZGL 4KVCH 1HH9A 2D0GA 2ZNXA 4K3EL 1C5BH 4FNLH 3CMOL 3RJDA 3MLVH 4XP6H 1KTLA 4YHMH 4MJ6B 1QSFA 3BDYL 3K0WA 3QJHA 4HQQH 4KI1A 1T1WB 1KN2H 5KANG 5TH2A 4WENB 1JNLH 1BGXL 3RUGA 2C26A 5HGHB 3W5MA 4Y4KD 4U1LB 3S34L 4KY1L 2F8OA 3IDGA 4MNGA 4G5ZL 5ICZA 2DBLL 3AREC 2JCCE 1I9RL 5KG9B 4TUKL 1V5JA 4WHCA 3I84A 2E6QA 1HHKB 4K94L 4MS8D 1JHTB 2XFXB 2CIIB 4G8FA 4OM1H 4N9GB 3TYFB 5DJ0B 1BD2E 3V52L 4IJ3B 1CLZL 3QIUD 5JW5A 1QBMH 5IMKB 1A6UH 1WFUA 4JPVH 1NBVL 4XVSH 4ZDHA 5EO9B 4PJDF 1LMKA 3FMGH 3JV4B 4LVOC 4N8PA 4HJJH 1S78C 3SQOL 5ID0B 4G6JH 2BOCA 5FGRA 1NJ9A 2NXZD 4OCXL 5E5UB 3IDYB 5TE7L 1I8KA 3BPCA 4QRPE 1Q38A 1FNEB 5LGHH 2YD9A 2QV2A 4GQ9L 2ICWA 1T83C 3MV7B 2MWCA 3RKPA 2MCG1 3QDGB 3P30H 1AGCA 5DJ2B 4OKVA 1HEZB 1WBZB 1NFKA 5LKNA 1MCFA 2XA8H 4N0FA 3H3PL 3QUXB 1NCUA 1M71B 1KIQB 4PG9B 4KV5E 1J0KA 3QZWA 1T21B 4GXUM 4GLRH 4XNMB 5EBWB 2AGJL 4GUPA 3WHE0 2CIKB 6FABL 3KPMB 3T0WA 2W0PA 2M26A 3DO7A 5JZ7C 1N4XL 4PJBB 2QSQA 4L3CA 3DYOA 3MLWH 1RUML 4OZIF 1G7QA 3SDXB 4PS4H 4OD1H 4R90H 2EKSA 2NY4B 3VFRA 4E41E 2PYEB 4PUBH 2DIAA 3HE7C 4OCWH 4LIQE 1T7XA 3WYRA 2VKXA 5CP7A 2VLKA 3S4SA 1SY6L 4HLJA 2E8ZA 4JE4B 5L2KD 3GM0A 4HMCA 3WUZA 4ODTH 1H15B 2F54E 5ITFB 3TH3T 3MOBL 1A4JA 3EDJA 4Z9KB 1MWAA 3EZJB 5D7IE 1X5AA 5E8PB 2QQLH 1RZ7L 3O6KL 4N0UE 3MJ7A 4LEXH 5JR1L 1I3VA 1T0NA 1LO0L 1OD9A 4H1LA 4KWUA 4Q2ZA 5DJ6B 3WN5B 4Z0XB 3BVNA 1A6ZB 3U7AA 4X83A 4LU5H 1ERNA 5EZOH 2IAMC 1QHPA 3RZCA 3HG1E 3DVIA 5ESAB 3H9HA 4PBVC 1TDQA 4HUUA 5BW7C 4HWZA 3KLHD 4EUPB 5B3NA 4IDJL 4KUCD 4K7FB 5D1QD 1AIFA 4MHHG 1JZ3A 3GBMH 4XCCH 4PJHB 2E5EA 1O7SA 2IPTL 4I9WD 3MV9D 3PL6D 5GGQH 4AT6A 4JEGB 5KJRL 5D1QA 4U0RC 3AM8C 2JKXA 1T5XB 4KK5C 3BP4A 5A2JH 3MV9A 1YA5A 2MQCA 3NGBC 3VXMB 4P2RE 4Z76A 3OPZH 2CLVB 1AP2A 1OT1A 4TSCL 1J1OH 3F7RA 4X99B 4KMQA 3LN4A 3UJTL 3REVA 1RUAL 3O9WC 3CNKA 1LEGA 1LDSA 2PTTB 5GS1A 5LCVL 2FJHA 3H0TA 3DGGB 1I3GL 3UXFA 5BVJB 2R1YA 2AXGA 5GRJH 2Y6SC 3QQNA 1D5IH 1QLEH 4A6YH 1JYVA 4JO2H 4EI5A 5FM4A 3VRLE 2AJSH 3P73A 1KXVC 5C9JB 4FFYH 4Z7WF 1I1YB 4ALAH 4YDLB 3EDDA 1YYLH 1BD2D 2XN9B 3GSNH 4RGNC 1IAOA 3G04B 3HZMA 4JN1H 3GI9L 3BGMB 3D85D 5CUSL 1DSFH 2DQGH 4U1GB 2P47B 3S88L 2D03L 3UYRH 1QLFB 3P9WB 1FO0A 4N5EC 1JHLL 3DXAB 4GRLD 3D85A 3LKSA 4YFLI 1UCTA 1RJYA 3L1OH 1OGAB 3L3JB 4M4PA 5DSCB 3MLXH 4HPOL 4Z7NE 3O3UN 4ONGH 4HKBA 1RJLB 1NGWB 4GRLA 4WI7A 5I71C 3OJ2C 5FYKH 5AZEL 4WUUA 3RL1B 4IRJD 5IEHA 1H5BB 4HIJA 4QRPA 1E4XI 4U7KA 4XBGB 1TLKA 4U1NB 4G8GA 2NXYB