3UAJC

Crystal structure of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
220
Chain Sequence
EVQLLESGPGLVKPSETLSLTCTVSGGSISDFYWSWLRQSPGKGLEWIGYAHSRVSAYYNPSLKSRVTISVDTSKNQISLRLSAVTAADTALYYCARQGTGTTGVSEDSFDLWGQGTKVIVSLASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVDHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords envelope protein
publication title Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.
pubmed doi rcsb
source organism Dengue virus 4
molecule tags Viral protein/immune system
total genus 39
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC01
4QRRE 5EULV 2BVQA 1CQKA 2VLJA 1ZA6A 4M9PA 2D7MA 1I1FB 5DA4A 1WITA 3EOTH 4RFNC 4NQSA 4PJAB 1MHCA 4JM4L 4OAWB 4UUJA 3FCTB 1LVEA 3VXMD 1C5DB 1OVZA 1WZ1L 4Z7WE 1BQUA 5AG8A 4ODBD 1A5FH 1VFAA 1ZLUK 3IDJB 5MI0C 3QUZC 2DWEB 3QUKA 5BXFA 5IW3A 4LPXA 3TZVC 4A6YA 4ZFZA 3KWWB 1Q72H 3QIWA 4XP6H 5DD0L 4F9PA 1V05A 4L4VB 1P1ZB 1AI1L 1WFTA 4RZCA 3JV6B 2ZJSL 5F9JA 1LD9A 3NCFB 3T77A 3MV9A 3UTTD 1DFBH 1N2RA 3TYFA 1LNUB 1ACYL 1FE8H 1FZMA 1VACA 2VQ1A 4FQIH 2XWJA 3ZDZF 5D7IB 1WBXA 3U7WH 1IBGH 1LO5A 3DVGA 2PCPB 1I85C 5D2NA 3VXTB 3ZL4H 1LDSA 1D5MB 3VXRA 2SEBA 3VXQA 1W0WB 2GJ6D 5CIPA 1MOEA 2P48B 5DO2D 3VFWA 4NCDA 4ELMB 3ZKND 3I6GB 4PJ8A 2APFA 3VXRD 3IDXL 3O3AB 4G8FB 4DZ8A 2B0SL 3RNQB 1XR9B 2YD9A 3KJ6L 4GBXC 1KCVH 1U6AH 2BFVH 2VITB 4XNUL 5DA0B 2WAHA 2VQTA 4JVUA 5DJDA 5LGJB 3JXAA 3ZYIA 5IFAH 1A7NL 4OQTH 2CO6B 3WE6B 3QWRA 3CC5B 4AEIL 1EO8L 5AUMB 5I19L 4B41A 2Z8VC 1RV6X 1FO0L 2CIIB 3GGWB 1HQ4A 3VMPA 1T0NB 2NY6D 1S5IH 2DBJA 4N0CC 3QWRD 3VWJC 5BS0D 1IM9A 2YXMA 4G6KL 4TTDD 4I2XE 5L6YL 3BN9C 2VXUH 4ZOAA 3RGVD 4OD2A 4OGXH 4IDLA 3RPIB 1GC1H 2APBA 5EU7C 3MLWL 1X6NA 3UYRL 5D1QA 4MNQD 1I8IA 3V79C 4JO4L 2AXHA 2QR0A 3MCLL 5TQ0H 1AGDB 3HNVH 2LVCA 5D1QD 3E3QE 4NN7B 5IROA 1CFVH 3G5ZB 5EBGA 1I7ZA 3O2WL 1WEJL 5F9WB 5HY9B 3C5ZC 1FNEA 3CUPB 3VXOB 2CKBB 4M7KH 2G2RA 1CD8A 3D39E 1BVZA 1JBJA 5I1CL 2B4CC 3QPQC 1MCQA 1QSEB 4JY4A 4XPGL 1X4XA 3MOBH 1MVFA 3MO1B 1NMAL 7CGTA 1QSZA 5KVMC 3V9FA 1FFRA 4MXWH 1UACL 2DLFL 2GK0A 3QQ3B 3WHXA 4JHZA 4N8PA 2DIAA 4Q58C 4UV4H 4U6VH 3S5LA 1NBZB 4WW1A 4JREB 2WBJC 2EKSA 2YK1H 3TV3L 5HGAB 3VRIA 1R5IB 4KKBC 2NY0B 2XG5A 2DLTA 4E42B 5INCA 5AWNH 5J7CC 2Y36L 3S36H 5MEOB 4KJYB 5C0AD 3IJYB 5AZEL 3OPZH 2VN4A 1NGZA 4L9LB 1UWGL 3TNNB 1NJ9A 4F7CA 4C56D 4L8SA 1AJ7L 2BOBA 3FB7B 5CZXC 2MNUA 5KANI 4M4RA 5DJZA 4U1HA 4X6EB 2AGJH 3JVGC 1QD0A 4QHLB 5E2TH 4I3SL 2WWKT 5DR5L 4NQUA 4PRDA 1XF1A 3T2PA 1QRNB 1OD9A 2BNUA 3F6IA 2HLFC 4QRPE 4P57A 1QFWM 3IFLH 5CP7B 1YYLL 2KL6A 2Z8RA 4F58L 4G8GB 3LIZH 2BRRL 5HI4C 1D6VL 2ED7A 5HJ3A 4EEEA 4K94H 2NQCA 1PY9A 5L7XL 1IAOB 1CG9A 4UNUA 2EIZB 5EFIA 4LLYA 3T0WA 2VQUA 4P99A 1S3KH 5CMAA 2AV7A 4LQ1A 2Q6WB 5EIIA 4Z6AT 3TBWB 1EO7A 3VDCA 4OLWH 3QIUB 4KK5C 2CLZA 1IFHH 1L9NA 3TM6A 1I8LC 4WI8A 3WNKA 4F8TA 3OAZH 4APQB 5CLTA 3IKKA 2P45B 5C6TH 1FO0A 1OAUL 2ATPB 5JXAL 4ZD3L 1DN2A 1OTUC 1B3JA 4K94C 2KZ1B 4XBPA 3SKOA 2G60L 4POZC 3FT2A 3LHPH 1EEZA 2VL5A 3IKCA 4TUKH 3BP7A 4TSBL 3JWDC 4YIQB 3HG1D 4QXGH 1RULL 5IEHB 1CFTA 5FGBC 2R0WH 1KPUA 2HN7A 4XP1H 4O2FA 5HVHC 1I75A 4X7EC 3ZTJG 2YD3A 4BZ2H 1PG7W 4Z0XB 4MVBD 1ZS8B 4RMVA 3X12A 4EIGB 2FGWL 3WDHA 3DX6B 4U4BA 5EZOL 3UTTE 3OGOE 1BIHA 4P46D 4LGSB 1YMHA 2FEEL 5AD0B 3D85A 4M6MH 4JZNA 3PQYA 4OT1H 3VG9B 2CDGA 4MD0A 1N5YH 3MV9E 5DS8A 2V17L 3D85D 3HI6L 5BV7L 4YHNB 3HPLA 2BSSA 2NXZD 4PJEA 3PQYD 1DEDA 4JLRA 4RWYH 4X8JA 1XCQB 5DUBB 1BFVL 1XR8A 2WM0A 4YX2H 4U1GB 2BX5A 5D1XB 4CADB 5IVXF 4PLKD 1J18A 3SGJC 5D2NE 4P2OD 5F9OL 2DQHL 4RRPG 3KYKH 3VXRE 4ZTOL 3ARFB 3REVB 4LCWB 2Q1EA 4K3EL 4DN4L 1J0KA 5D5MA 5FKAA 2J8OA 3MLXL 5E8DL 2Z4QA 4RFOL 2WANA 2YC1A 1DBKH 1JN6A 1YN7A 5DYOB 3IETB 1ADQH 5EOQL 3TO4C 4MQXD 5DVLA 3TBVA 5JPMA 4PTTB 4NM8L 3G6DL 2CKBH 3AVEA 4H20L 2K7QA 2BNQA 4NC2B 1DUYA 1CXLA 4HCRL 2X9WA 4F57L 2DQGL 4M48L 1F6AA 2A77H 3S34H 4U1LA 2YD6A 1MCBA 4L3EA 3UBXI 4MA1B 4MNQE 1G7LB 2OL3A 4MQTB 4XVTH 2BJMH 4NN7C 5JNYA 4JE4B 1FG9C 4MWFB 4YZFE 4WHYG 4UB0L 4L3ED 3GEWB 3WIIH 1X5LA 1ZGLM 5F9WC 2EEAA 3PDGA 5I73B 4Y2DA 3BGFB 1VERA 2J8UF 2XXCB 4K3JL 1JFQL 1HZHL 4AIZA 4FZEL 1PW3A 2R0KH 5JTWA 3RTQD 4ZUUB 3FN0L 2GY5A 5HI5C 4M8QA 5LXGH 4FQ1H 4Y2DD 1H5BA 1JRHI 4R4ND 4Y88A 1ZXQA 4S11A 4XTRC 1EFXD 3EOTL 2OSLA 4RWHA 1QR1B 2VDKH 3QCUH 5FO8B 2GAZB 4P3DB 2D31B 5DTFB 3GI9H 1WWCA 1N6UA 2QKIA 5GRUL 5IBUB 1D5XB 4JDZA 1F6LL 3IFNL 2NY0C 3TA3B 2X4UB 2JJVA 5HDLA 5A40E 2ESVB 1K4DA 2AVGA 4OFDA 4YXKH 3P73A 3T0XA 2I9TB 4L9LC 4BSJA 4Y5XA 1ZVSB 4YPJA 4K71C 1RZKH 4ZS7H 4C56E 3MTRA 2YRPA 4JRYD 2GHWB 3TFKD 4OD1L 4DW2L 3VA2C 4NPYA 5C0GA 1UQSA 4KRPD 5E7FA 1J11A 1HQRB 3KXFB 4OJFL 1B6UA 4JGJA 4WY7L 1CGSL 5E00B 3UDWC 3U7WL 1CXEA 4PRPB 3C8KA 3FZUD 3UTQB 1ZTXL 1AGFA 2GY7B 3ZL4L 5I15L 2Q76B 5IFHL 4GKOA 5E8NA 4J23A 3CXHJ 5E5UB 3RI5K 1AE6H 5IMOA 5C8JB 1Q9LA 2Y4SA 5I1IH 3QXWA 3P4OB 4I5BB 1YEGH 3HE6C 2OS7A 3LN5B 5FF6A 3LY6A 4KDVA 1DEEA 3QIUC 4KHTH 3RWGA 3FO1B 3MXWL 1GXEA 1KCVL 1U6AL 4J2XA 4ZODA 3VA6A 3PHOB 1F11B 2E3VA 2JB5H 5C92A 1HH9B 3EJZD 3Q3GB 4OQTL 1LP9B 3WIFB 4QKXB 3CZFB 2HT4C 1AGEA 1I9IH 4WW2B 4P48A 1I8MB 4HKZA 1FNSH 5EOCH 3NIFE 3D2UD 2LAGB 3DGCR 4AMKH 1OGTA 4HMEA 1IM3A 2Q86A 3VFVA 1T1XB 3U4AA 4Z7QF 2B4CL 3FAWA 4JY5L 1XEDA 4OGXL 3BP6B 2FCBA 1T89C 4K23H 1OF2B 1X5IA 5J6HB 3O6FB 4U0QB 5I75C 5JIIA 4G43B 4GMTL 5F9AC 1T2QH 3QUZA 43C9B 2OZ4A 3UEZA 4IOFC 3VFTB 5TDOB 1YNTB 3RWJA 2CRIA 3VG9C 3H8NA 5CILL 3ULSB 3J8F7 3O3BB 1CVRA 4U1KA 1CFVL 1H8OA 5H94A 2EDYA 1T21A 2OR9L 2QSTA 3WFDH 4F9LC 1ZK9A 4C83A 4S1SH 4NUJA 3TZVD 3EYQC 2VAAB 2VUYA 4NP4L 3PQYE 1J1XL 3MOBL 1UCTA 1Z0NA 2EYRB 2L0DA 2LVEA 1U41A 3SGKC 1WLHA 4LNRB 4MXWL 3HUJB 3V6FA 2Z35A 1IQDB 3P77A 1YJDH 4UV4L 4Q0XH 3QNXA 2FLRT 2HJKA 5I1AA 1U8LB 4HSQA 1A1MB 1S7RA 3OAZK 3SJVD 4YBHA 1YEDA 4HS6B 4N5UA 5ESVB 4M1GH 3SE3A 2R2HB 2CUHA 1MFAH 4GG8A 4HFUH 5F7DA 1TIUA 1PEZA 1J1OH 2FB4H 1UXSB 4E9LA 3S36L 3IFPA 1Z9SA 2J8UE 5FV2A 3ALWA 4GBXA 4C58B 3DROB 1EERB 5D6DC 1FL6B 2C3XA 4MA3A 2P7TB 3QPXH 4YR6B 5I71C 2AEIT 4JANB 1U92A 2LABA 4PJFA 2YRZA 4GBXD 1YJDC 1KN4L 5E2TL 2UY7A 1B0RA 3T4YB 5KN5B 5DQ9A 4NO2A 3IXAB 4JN2B 2E7LA 2ICWJ 4TQEH 1N64L 1H3XA 3KHQA 4HUUB 2LU4A 4XB8A 4Q9QH 1F6FB 4QGYA 5I66B 1DLFL 1PQZB 5BO1H 4ZYKA 1VFUA 1Y6NR 3I6LD 3BOVA 3GK8H 4K94L 2EDBA 2UZIL 3BGFC 4U1NA 2ZSWA 4L3EE 3D87B 2VERN 1Q9WA 5LKNA 4ONHA 4PREB 2AI0H 3JWDL 4JY6A 4N0CD 3VWJD 3C60D 3SDAB 5KJRH 1RURL 4NDMB 4IEFB 3BN9D 5SWZA 4PG9A 2WMPA 1CXIA 1JJUA 4OLWL 1IFHL 1MHEB 4OQTA 4P5KB 3MRFA 2L7JA 5TPWH 5JIPA 4FQQB 4WCYL 5CEZH 5HGDA 3MRKA 5EUKA 4PJFF 4NQCA 1HI6B 1M7IA 3DSNA 1KCRH 1OAZL 1TNMA 1X9QA 2VZTA 4UINH 1ACZA 3LEYL 2L7UA 3WL9A 3LHPL 4TUKL 4PRHA 5EDXA 4NZJA 4X7SL 4NQCD 2HTLC 3I3DA 1NUFA 1OP5H 4PLJC 2AQ3A 3C5ZD 1IGIL 2E9IA 3JTTA 3MJ7A 4QXGL 3VXUB 4PPTA 2NXYB 4F7MB 3MV7D 1NFDF 4PRHD 4ALAH 4XAWL 3QPQD 2QSVA 3DI3B 2WBJA 5A2JH 1JWUB 2XQYG 4BZ2L 4X4MA 4DVBB 5T5NF 1I1AC 4OFYA 3ARWA 4I13B 4JRYE 2PW1B 3GSQA 4IS6B 4J3TA 4OBSA 1G7IA 2WWMC 5JDSA 2BSRB 3O45A 2AK1H 3HRZB 3R1GH 4KKBD 4OFYD 4OT1L 5T1LD 2ZOLB 5FA4B 1N5YL 4WI4A 3RWHB 3TN0D 3QDMD 4OBRA 3GMMA 3PWNA 1NFIB 4LSQH 1KIUA 2APXA 4HJGA 3JVGA 3W39A 5IW1A 4AT6B 4HUVA 3W81A 5CZXD 3VXNA 3MOAH 3WSQL 1T83C 3H0TB 2Q8BH 1CVSC 3LEVH 3QFJB 4W6XB 2MQ3A 4XNQA 4S2SA 4Z7QE 5HHXH 1CBVH 1PG7L 2VABB 3DYPA 5F88B 4Y4HA 3MRRA 1IGFH 2HLFD 4G6JL 4NRYB 4PJ7A 1E4WH 4ZPTA 1VEOA 3RI5F 2Z31B 3BUYA 3BJ91 1BREA 3BXNB 4O02H 1DBKL 4Y5VA 1TETL 4WHYH 2J6EH 4WW2C 4KMTL 1ADQL 3O6MH 4JB9H 3OX8B 3SKUD 4FP8L 4JM2F 1I1FA 2O5YL 4F33A 1I8LA 4PJAA 4XXDB 2CKBL 3EOAB 1EAPA 2ADGB 4XPFL 1VA9A 3BPOB 4X7DC 4XAKD 5EBMB 3CLFH 3L3HA 3EFDL 3WO3B 4J8RB 4KK5D 4MXVE 1D5BB 3BKYL 1QFWI 4D0BB 2DM3A 1NUDA 4ODUB 3O6FC 3C5SB 4MB3A 2DDQH 4UMGA 2DWEA 2N7AA 5KSBA 1U8OA 3M07A 5BZWB 3MRLB 3IB4A 4FABH 3ARTA 3S7GA 3GRWH 4POZD 5FGBA 2AXJA 5ID0B 4S1QH 4M5ZL 3VW3H 5FXCH 1SM3L 4PGCB 2GTWB 4AEEA 3JV6A 4X6DA 4OI8A 3QAZB 2NY1C 2YSSA 1HHGB 4Z7UA 4FQ1L 5IMLA 5LXGL 5IKCB 4HWUA 5FO9A 1T5XB 3S8WA 3SE8H 3DVFA 2P44B 3QUXB 1N0XH 4O5LL 4FQXB 4PJAF 5HHMB 5EBLB 3QCUL 4HWBH 1OM3H 1Q0YH 4PJ5B 3KLHD 3VXTA 4W6WB 1KNOB 3K8LA 1X4YA 2DMKA 3FB6A 3SJVE 1HOCB 4YHMH 2YD4A 2UUDH 4V1DB 5T1KB 5JW5A 2R2BA 4GS7C 3RNQA 3V8CA 2VITA 4OCRL 3M17B 4O2EB 4P2QB 3LZFL 3CNKA 1L0YA 3MRNA 4Z7VA 2I07A 4LRIC 1MEXH 5T5NG 2C3WA 2HG5A 5HYSG 1JPTH 1KIQB 2BOCB 4JDTL 4NNPH 3I2CH 1OARH 4TUOB 2BERA 1W8NA 5AUMA 1S9XA 3GGWA 3TO4A 5CSZB 5D7IF 1T0NA 4PJFE 5DK2B 2QSCH 3VH8A 2GCYA 3S37L 4K8RH 1MJ8H 2FH6A 3TO4D 2IANA 5D93C 3E6FB 4I1NB 1HHHB 4HZLB 3GHEL 5CJQL 3RPIA 1AE6L 2DQEH 1KCKA 3VFOA 5I1IL 1KT2B 4LHJB 4ELMF 5GGTL 1IEAB 3S3PA 1YEGL 5SWQA 1NBYA 1OAXH 3U2SA 1AGDA 5TF0A 4U3HA 2P43B 4KK6C 1GIGL 3QIBB 2VZOA 1T1ZB 4JRXA 4XH2B 1NBQA 3WLWD 4CL7A 2JB5L 1UWXH 3G5ZA 1ADQA 3HNTL 4NBZB 5EU7E 4LSTH 5DC9B 1FZJA 4ZPVB 1EGJL 1V3KA 4RBPH 1M6OA 4X4YA 4YJZL 3T1WA 2X1QA 5SWZE 3OV6A 2BVYA 1OY3B 1GOFA 2HFTA 4K8RC 4YHLH 2AXFA 5GJTH 5CCKL 5LAXA 2YBRB 2ITCB 3FONA 1I9IL 3GBLA 3MO1A 3GB7B 1MCOL 4LLMB 4U31A 1HILA 4BKLA 5HPOA 2NXYC 1TZIA 1XF3B 3WUWA 4NQCE 5D72H 5BRZA 3M1BB 4AMKL 5HI5D 4HFWA 4EDWH 1A6UH 3O2VH 1RK0B 2H45A 4EI6A 1HXYA 2X40A 5AG9A 2OXHA 5FYJL 4PRHE 3O41A 2LU3A 3VGGA 2A73A 2MSPA 3WBDA 4XTRD 4WTWA 1Y0LA 4K23L 5KSUA 5L8JB 1DR9A 3LRSB 2FX9H 3PL6C 2BK8A 5E2VH 5C0FB 1HKLL 1ZE3C 1JTOA 2P5WA 3ARRA 2FSEA 1PKQB 3LQZA 4OZ4A 4L9LA 4CKVX 2NY0D 1YN6A 1TLKA 3SDDB 1CGVA 5I0ZA 25C8H 3QULA 5IB2B 2P5WD 3HR5A 3CSGA 4X6EA 4ODTL 3RVTC 2YUZA 3RNKA 1B9ZA 4J1UB 4OKVB 5F96H 2AS5M 1QRNA 2DWDA 5ID1B 2CH8A 3V0AC 1IEHA 1Q94B 3C08H 3UDWA 1DP0A 4I3GA 3ARGB 4R26H 4RMWA 1YJDL 1QRND 3KPRA 4Q0XL 5IW6B 4FZ8L 1VGEH 2PF6A 4ODWA 5LG1A 3TIDA 1IGJB 2QV2A 4PJCA 2Z31C 3GSNH 5IB3B 1P4LB 4HFUL 2WK2A 5ETUA 3AXLA 2FB4L 1QLFB 3HE6A 3T2OA 1S9YA 4HK0B 1RZGB 2HFEB 1C1EH 1KTLA 1P2CB 5JORB 3QIUA 1HCFX 1KB9K 4PJ7E 3V0WH 4G8EB 2ICES 5CSBA 5I18H 4ONFH 3UZEA 3V5KB 4NC0B 1RZFH 3QPXL 4HKXA 5E5MB 4MHHI 1XF5B 3QIUD 4MJ6B 3QO1B 3RWIB 4Z78B 4PGDA 1FP5A 1GZQB 4XAKE 2Y06L 2YPLB 3VMOA 4TQEL 4PJAE 1GCFA 4JN1H 1M7DA 2PW2B 1Y6MR 2W0FA 3LKOB 3F7YA 3OAYK 1TVHB 3MLUL 4M03A 2QQKH 3GK8L 5IB4B 3A6OA 3IU3B 4TULL 3SCMA 2HT4D 1F13A 4U7KA 5HSFA 1MLBA 5EU4A 2Y5TA 3NCEB 1BP3B 3QAZC 5KSBE 2AI0L 4Z0XA 3Q6FB 1T89A 1ZS8A 2MHAA 4NFBA 5KJRL 5HGBA 5I1JH 1U8NA 4J12A 3FO2B 4YQXH 4NFCA 3QUXC 2X1PA 3KPQA 3RDTA 4W81A 1MREH 2R1XA 4FQXC 3GSXA 2LAAA 4OB5H 4HQQL 4Y5YB 3B2VH 3CX5J 3HE7B 4X6DE 2XZAH 5CHNA 2X4RB 3H42H 4GRWH 4LKCA 3NPSB 3TESA 2X4PA 1BOGA 4BFGA 4Z7UE 2UVEA 5T3XH 3RY6A 3NACL 4YHNA 4IOFD 1YC8A 1KCRL 3OGCA 1NAMH 4JAMA 1XCQA 2BMKA 4HWEL 5D7IE 2IBBA 2HFFA 4P0DA 1MFEH 3VRJA 5IGXH 4XCYB 6CGTA 4P4KC 5I1EH 3EYOA 5DJAB 2BVEA 3EYQD 3BP5A 4X0KB 3RKDC 3PGDA 1JV5B 3MR9B 5MERB 4S0SD 1BVKB 3CFEB 3HAEB 1KELH 1A3RL 1OWWA 1UXWA 2XXMB 4PTUA 3SE9H 5DJ6B 3ARFD 1R24A 3O8XB 4LCWD 3GM8A 4OZIA 4Z95H 1W0VB 4HUWB 2NCMA 4XNZB 3N1GC 4NNYB 3QCVL 4JO1L 1IGYA 4AG4H 3RX8A 4WHTA 3U0PB 3CFBB 3GO1H 3R1GL 1EPFA 4LP5A 5D6DA 5C08A 2DB8A 4MQSB 4LSQL 3LKQB 3LB6C 3DXAA 1QQDB 4PJHB 4YHYC 3MOAL 3A67H 4N9GB 4YC2B 1G7LA 4UIKH 1T5WB 2IANE 3VFPB 5K9KA 5FYKL 3IDIA 3OTTA 1LEKB 1SQ2N 3F7VB 2X4SB 2HKFL 1IGFL 4NFDA 3WMSA 1KN2L 2VDPL 3FQUA 3OJVC 2WZPD 3TIEB 4LHUB 3O6LH 4R0LB 4EBQL 4D0CB 5B38G 5EIVA 1H9VA 1P69B 3KYMA 2UUDK 2EYSA 5E8OA 4G7VH 1I1YB 2X41A 5FO8A 2GAZA 4P3DA 3CVIH 4JQIL 2FDBP 1ZEAH 1XGTB 4G6FB 3ES6B 1D5XA 3RWDA 3OJMB 2HJLA 4J7RA 4PJGB 4CU8A 2X4UA 2NY3C 4HMDA 1PKOA 5GGQH 2ESVA 3N9GH 2HRLA 2I9TA 3TYGH 3TA3D 4FABL 2P4AB 1RJZB 3QB7C 3SDDC 5I16B 2WP3T 2ESVD 1E28B 4LBEA 4S1QL 1MCRA 4RQQB 2NPLX 4FA8A 1UH4A 2A6DB 5J13B 1NAKL 2HAZA 1SEBB 2P5WE 5FK9B 3U36A 1EVUA 4PG2C 3NFNA 5E1HB 3MBEC 1E27B 1NGPL 1I1AA 2IF7A 1V3JA 3HS0B 4MGXA 1D5ZA 1N0XL 5J1AB 5E00A 1HHIB 3ARGC 1I1AD 3U0WL 4KZEH 3FOMA 3MLTB 2WSKA 1Q0YL 3E8UH 4GQ9H 3UTQA 2RAMA 3BE1L 3KXFD 4NNXA 1DUZA 3FT4A 5FOBB 2Q76A 1QRNE 1UWXK 3DURB 1QSVA 4PRPD 3OQ3B 4RBPK 4YHML 3EOBB 4KHXL 4IOIB 3KPRE 1RAMA 1T83A 4RRPA 4TOYH 1TJGH 2ERJB 1WWWX 4PJCE 3JUZA 3L3KA 1FYTA 5IT2L 1CQYA 3T09A 1RZ7H 1F90L 5DJCB 3B3IA 4NKQB 1H3UA 2CUIA 1MEXL 4LPUA 3DOSA 1IL1A 4U2YA 1CE6A 4M6OL 4D0DB 3DPBA 1EXUB 2JCCA 4G3YH 3H3PH 3ZYJA 4NNPL 3I2CL 3VJ6A 1OARL 3LD8B 3QJHB 1FV1B 3CZFA 5D6CA 1F3DH 4U1SA 3PGCB 2OP4H 1XGPA 1U8JA 1A7OH 4RSVA 4HIIB 1MJ8L 2EC9U 1WJ3A 4GJTB 1WBYA 4H1LG 4ZFGL 2CRZA 1P53A 4R3SA 1S7VA 5J6HA 3AB0B 3WXVL 4QRUA 2D03H 1OAXL 4PP2B 3UJJH 1FL3B 4Y5YC 5FYKD 43C9A 3HE7C 2NX5A 2FECL 3FO9A 2YPVL 2UV3A 2J6EA 3O6FD 2JIXA 3K80A 3MMEB 3S36X 3GUTA 3ROLA 1XGUB 2O26U 2GITA 2NX5D 2B2XL 1U91B 4HWNA 4KJQC 3BIKB 1LP9F 4TSAH 2VDQH 2C4FU 2R8SH 4FQHB 4WW2F 5ESQB 4QGTA 2EYRA 4Z77A 3WNOA 2OBGA 5CGYC 4LNRA 1CT8B 2NY1D 5JQ6L 1NGWB 5LJYH 1A6UL 4I9WD 1U8LA 1KJMB 1JRHH 2B7DT 4LSSH 3F65A 3K4AA 3MLPA 3O8XC 1FFOA 1A4JB 1M4KA 3GRWA 3OXRB 5BOZG 2R2HA 4EXKA 1FSKC 1SYVB 2V6HA 1JHLL 4UTAH 2XPGB 1JYNA 2IPUG 4XNZC 3L5IA 4LCWE 2HVKB 4P5MB 3MJGX 3MRCA 1IZJA 3BZDA 1BAFL 3TVMB 4KGLA 2DQDH 4B53A 3SBWC 2GSIB 1JPFB 1R5WB 5FEBA 3ET9F 3BPNB 3MCKB 1FL6A 3PIQB 3TGXA 1DQJA 25C8L 4JANA 4OZIE 2ZPKH 3HI1B 3TO2B 4NM4L 3QDGA 4LCCB 4HWBA 2D4FA 5KN5A 2VKXA 1UM5L 5GGVL 3OB0H 3DO3A 3DLQR 1UWEH 1K8DB 5C08E 1J5OL 3PABB 4Q2ZB 2P24A 2AJXH 5IWLC 5DJXA 2AABH 5JW3L 3C08L 3HUJF 1MCDA 3ZZ1A 3I6KB 3LKSB 4R26L 3VXSA 3CVHB 3DXAE 5DK0B 3ARDB 3VXSD 1XIWB 2DBLH 4NDMA 3U48A 3MBXH 3BAEH 2GTZA 3BKJL 1C1EL 2PTTA 1QHPA 1BFOA 3V0WL 4P5KA 1OW0C 5IEKB 3CD4A 4ZOEA 3AAZB 4ZTPH 1MY5A 1ZLVK 2JLLA 3ZO0A 1PSKL 3MRDA 4F3FB 2OI9C 1KLUB 8FABA 5I2IA 3G6JB 4KK6D 3RPKA 3S4SG 1YC7A 1U58A 3B5GA 1V7NH 4QY8B 1ZANL 4NJ9L 1RFDH 1U93B 4MZ3A 2PYEB 2D7QA 4JN1L 3O0RH 4L4JA 4Q9RH 4PB9L 5ANMA 1IEBA 2JB6B 5TE6H 4DUVA 3VGHA 4K8RD 5IMKB 1FLRH 3UTPD 2QQKL 4JGUA 1RUAH 3I02B 5KW9L 5J13C 3KPSB 5HD8C 4MCZB 1FAIH 4HUXB 2ESVE 4LFHG 3V6OC 2I5YL 3VXUD 3IXTB 1C8PA 2NXYD 1PG7X 2WWKO 4AL8H 1ZLWH 3TBSB 4WFHD 2ICWB 1MWAB 2CJUL 1DQMH 3PL6A 1G6RB 1CF8H 4M9OA 2A1WL 1MREL 1JYVA 4OB5L 4HIEA 3DV6B 3B2VL 4X9BA 3H42L 1KULA 3PL6D 4ZXBB 4NYLB 4DTGH 3BZFA 3KXFE 5EBWA 1NAML 1I3GL 2OJZH 3V4UL 3PWLB 5IGXL 2Z93B 1MFEL 2A6JB 1INEH 5I1EL 1MHPH 3NTCH 1XH3B 3QFJA 3VI3E 1RHHA 5LCVL 1A9BA 4NRXB 5JIKA 2QLVB 1KELL 2LE9A 3SE9L 2XY1A 3QFJD 4R90H 5DD6A 2OTWB 4HIJB 4WU5A 3P11H 3DRTA 4MSWB 4Z95L 1T0PB 2EDRA 1FYTE 1G7QB 4EI5C 2BRQA 4X6CA 5JQHC 1QPXA 3SOBH 2E9WA 4AG4L 3BEWA 3MROB 1JPSL 2Z31D 1EEYA 4MNHA 1QA9B 3RAJL 3QO0B 4XXDA 2JCCE 1NEZG 2AJZA 5DJYA 3DBXB 4JHAH 1LP9E 3ECBB 1T6WA 3AFLA 2V7NB 2XKNB 5B39A 2X2YA 3AB0C 3W5NA 1GH7A 2YUXA 4KPHH 4MAUL 2X4QA 1IGTB 3HCVA 4IOSD 3A67L 3GSNA 2B5IB 2C3HA 3L6FA 3F62A 4NQXA 4D2NA 5FYKE 1CLYL 1TJIH 4M7ZB 3NABL 2GSGB 3FQNB 4U7MA 5D9SB 4XPTH 1OQXA 1XAUA 5T5FH 1EHLH 5IM7A 1T0MA 3O6LL 4PRNA 2NX5E 4OLXH 3WFHB 2A9MH 4XX1G 1JHKL 1FH5L 2W59A 3QUXA 1TVBB 4NHUA 4FFVC 4YAQB 1YDPA 1E4XI 2J8HA 1MQKH 4YXLH 4F2MB 1MHHB 4DZBA 4EDXA 1NLBL 2CD0A 3QUXD 4LLUA 5IV2B 4FQXD 5HHMD 2MPAH 3VD7A 3BH9B 3S37X 2NLJB 3CCHA 4V1DA 3X3FH 4KQ3H 3CVHH 4NGHH 4P4KA 1ES0B 2V9RA 2CRMA 3BPNC 3M17A 4O2EA 4HV8A 2DQIH 2IQAA 4V1DD 5T1KD 4DGIH 1UJ3A 1YNKL 3U46B 4FHBD 1OP9A 3RKDD 4P2QD 2J2ZA 5IQ9B 2YN5A 5C9JB 4LL9A 2BOCA 3TJHC 1NCBL 3VFGH 2XIDA 3MYJB 5E6IC 2HTKC 3WFEH 1NAMA 4PGEA 4PJXB 1U8HB 5DVOA 3HMXH 1N5AB 4YHOH 4GQ9L 3OAUL 5EOTB 1KB5B 3UZVB 1A1OA 4YBLC 4OV6F 4NWTH 2MFNA 3VI4F 3FT3A 3C87A 5DT1H 3HZYB 3IVKB 3QG6A 4UU9B 4GQPH 1IEAA 3FB5B 5EO9A 3VXSE 1CFNB 2N56A 3L5XH 4J6RH 1LO4L 4RA0C 4KKCC 1SVCP 3CAFA 2VE6B 1C08A 2P8PB 1TJGL 1T1ZA 3MLZL 4NZRH 3LB6D 4LK4A 1MWAH 4XPHL 3P4MB 5B8CC 3FN9A 2IFFH 1YY9C 2JE8A 3PJSA 3PWJB 4KAQH 4JFFB 1AD9B 3DGGB 3OKMA 4FXGB 4NN5B 3I9GL 3C6LC 5DZOA 1S9VB 4P59H 1K2DB 4XVJH 1TTUA 2IBGA 3GB7A 5ILTL 3GMNA 4L1HA 2N1KA 4XNMB 2XZQH 1P7KB 3T0EB 1Q9KA 1PX4A 3T0DA 1JL8A 3UTPE 2LQRA 3A6CL 5ESAA 2Z0BA 5DSCA 5ANME 5CBAA 3BRFA 3VXUE 3EIFA 1AKJB 1MFNA 1FZOA 4TVSa 4WFHE 5C0FA 4WI9A 3UJJL 1E6OH 4F80A 3BWAA 5I0DA 1QFWH 1CD0A 3KLAA 5F3HB 3OB0K 1PKQA 1FJ1A 1L4IA 5F44A 2WV3A 3AMKA 5F89B 35C8L 3TH4T 4Y4FA 3V0VA 4O51A 1J88A 1KPRA 4MJ5B 4OCLC 3SDDA 4ZXBC 4KQ4H 4NO3A 1T2JA 3MRPB 4Z7NF 2DIBA 1OSZA 2YZ1A 3SDDD 4HDIB 4TSAL 4HUKB 4PG2A 2R8SL 4PJDA 3UX9B 3MRJA 5HHNA 5CGMA 3MYZA 3MBEA 1PYWA 4LF3B 4X6FB 3HPJB 4RX4A 5CBEB 5HHQA 5ID1A 2V7HA 1QLRB 1KJVA 4UZGA 2GUOB 2VZ1A 3GSOB 4DAGL 3QUYC 5E2WH 5IW6A 4RX4D 4WJ5A 3MNZB 5FGCB 1DQDH 3BDYH 3U79A 4X9HA 4EQ2A 4LSSL 3P4LA 3N85L 1AFVH 5E70A 3QFJE 3ARGD 4IRJB 3B9VA 2Y9RT 1U8PB 4KI5C 3WEXB 1T1WA 1CR9H 3SKNA 5EC1B 2COQA 3KPPB 5F8RC 5C0BB 2EYTA 3P9LB 2DQDL 3TBYA 2HFEA 3I3EA 3OKKB 1KJ2B 5JORA 4NKDB 4C55A 5ADOL 4NO5A 5IB1A 4ZFFB 1IAMA 5CUSH 3BPLC 3MGOB 3Q5OA 3V52H 3WLBA 2Q3AA 3V4PL 4FXKB 5T1DL 3S9DB 5D96B 4OUUA 4XC3H 4ETQB 3DVIA 4GRMB 2XZCL 2YPLA 5IHBA 4YDKH 1ZLWK 3O3EB 2B5IC 4U6XB 1LO0L 2AJXL 2FJGA 5FV1L 2AABL 2YPLD 1G7HA 1EDQA 3KJ4B 4GAJH 3RL1A 4LVHB 4M7ZC 4NT6A 4UBDC 1NBVH 4LVNC 4NN6C 4JKPH 1DQQA 3BZEB 1KCSH 1ZHNA 1FNAA 3GI8H 2DBLL 5C0CA 2R29L 3MBXL 2FL5A 1DDHA 4BSVB 1MLCB 5BQ7B 4Y5YA 1K85A 1BM3H 3BYYA 2NW3A 5C0CD 5FM5M 1X6LA 4Q97A 1R3LA 4I0PB 3CFIC 3HE7D 3DUUB 1SJHA 3QCTH 4LCIH 3C6SA 3ULUH 1U8KB 1RFDL 5HHME 5CEYB 4YDLB 4Q9RL 1T7ZA 4X0KA 3B9KC 5TE6L 4QRRB 1ROWA 5KVEH 1YEFL 4KJQD 3VI4E 1FLRL 1BVKA 3CFEA 3BD3A 4HIXH 4K7PH 1RUAL 3CXHK 4NO0A 4WEBH 3QUMB 1FAIL 4V1DE 3LPWA 3QQ4B 4DKEH 5I17A 4H5SB 5DJ6A 5CGYD 4AL8L 3O8XA 4NZTH 2P47B 3UBXA 1K3IA 1S7WB 1F2QA 4NO0D 4QT5B 2IALA 4R4BB 3MC0A 3HMWH 5FOJA 4ENEC 5H2BA 1UB5B 4XP5H 2W1NA 2MKWA 3O8XD 4RNRA 2DL9A 3SBWA 4GRWE 4L8CA 2HFGL 1MIMH 5A2IH 1GPOH 1I9JH 2JKXA 4P49A 5F7NC 3S3SA 1RUKH 3ILPB 4BQ9A 3H3KA 2OJEA 5GRJH 1N8ZA 3LKQA 2K9UA 2OJZL 1RZIA 3UC0L 5D7LB 2AJUH 1JF1A 3HZMA 5L2JB 1ORSB 4YFLI 4MJIB 1CXKA 1INEL 3FRUA 4E5XB 1C16A 3BT2L 3MODL 1AXIB 2C1OB 3OKNA 1T5WA 4QCIA 5AZ2L 3VFPA 1IAIM 4MQ7B 1LE9B 4R90L 5K9OA 2F54B 3MV01 5FB8B 4BH8A 3X3GH 3P11L 5MEPB 4S1RH 4NN5C 4LARH 3CGTA 1NC2A 4XP4L 3T3PF 4XC1H 3F8UB 3SOBL 1VHPA 5C0RH 3MNWA 4OZHA 1KG0A 1TQCB 1RIUH 5CSGA 2PO6B 5ERWB 5D7SH 4Z7NE 4ZUTA 3DV4A 1OW0A 4M62H 5D7JC 2ICCA 2A6IB 4YK4C 4JHAL 3PWUB 5LGKA 4IMKA 3WD5L 3ZDYF 1JGUL 1XGTA 1MCKA 1GGCH 5ISZA 5F7FA 4LCUA 1I8KB 4KPHL 4PJHF 1MRCL 4HXBH 4M93B 1AXSB 4GSDH 4M7LH 5JMRA 4G6FD 1JYWA 5ISZD 1LEGA 2FWOB 4AM0B 3LN4B 3DVNB 1IC4H 4NQVA 1BQLL 1T03H 4R96A 4HGMA 1DVFC 1A0QL 1FPTH 3S98A 5T33L 4XPTL 3UPRB 4MZ2A 3TT1L 3V6OA 3MJ9H 1SEBA 2DYPA 2P8MB 4I2XB 2XACC 1E6JH 4CVXB 2ATKA 1PKQE 3C8DA 4XHJC 3X17A 4ONGL 4R7DB 4HBCH 5JOPD 2VDMH 3AREA 4KDWA 5HGHB 1E27A 1CLZH 4ZNEA 1Q9OB 3CXDH 1DJSA 4U6YB 3JTSA 1G9MH 2O93L 4IRSC 1HHIA 4JG0L 2R56L 3G08B 4YXLL 4XWGH 2IAMA 3THMH 2OMNA 4PJDE 3JBG7 6FABH 4PJGF 2A2QT 4PYHA 1INDH 1XF2B 4LKXA 3EOBA 3G04A 4P9HH 1TTFA 4QXUH 3C2AH 1FNLA 4IOIA 3W82A 2F5AL 3CVHL 3BPCB 4KQ3L 3X13A 5MENA 2YS4A 5DEFA 5HYJA 5DJCA 3LAFA 5TDNB 4DGIL 1G9MC 3L3OB 5D96C 1JMXA 1A7BA 3VFSB 2EDKA 1Z0MA 3ARQA 1WCBA 4EN3C 1LO3L 1QO3B 5DUPL 3UAJC 3RWCA 3VFGL 3OWEA 4G9FA 3JSSA 2K7PA 3STLB 4EI5A 1GHFH 3WFEL 2JJSC 4P9HC 4LVHC 1T22B 3AY4C 2CR3A 1A1NA 1U95B 1MFBL 3CPLA 3KPTA 5IB5B 4XI5C 3DUSB 5CD5C 5C3LD 3TJEH 3OKDB 2YPLE 4HIIA 4EI5D 2Q7YA 3BKCH 4XBGB 2PXYB 4HBQA 1MCPL 1QNZL 2DQFB 1CGYA 5DT1L 1J05B 2QQLL 5C1MB 2VISB 5BJTB 4IJ3C 2H3NB 4RMRA 3GJFH 3HAEG 5JO5B 1DL7H 3VGEA 5HPMB 1REIA 3QUMH 4FQLL 2ZNXA 5GGSB 5DVMA 4NZRL 4OGAC 4W4OC 3QEQA 4I0PC 1MWAL 5B4MC 2D9QB 1HCVA 3RVWC 5C0CE 1E4JA 4HWZA 4HK3N 1A6TA 2AEWA 4QHUB 1A14H 3QZWB 4TSCH 3A6BH 4LGRB 1G6RL 4OLVH 1W72H 4FQCL 3QEQD 3OKOB 3QHZH 4IIQB 2WBKA 4FQHA 4P59L 4PS4H 4GAGH 2FYYB 3QXVA 5C0DA 3SKJH 4O58H 4HS8H 1JNLH 1NGWA 1EV2E 3MRIA 3KYNB 2CXKA 3SDCB 3KR3H 5ACMA 3GKWH 4X8XA 3DUHA 4FFVD 4S10A 4JQXC 1B90A 2DQCH 2VLJB 1ZA6B 1VKXA 5DFVD 4X5WA 5SV4A 1E6OL 1QFWL 4NQSB 1R5WA 4YO0A 4U6TA 2R4RH 4KQ4L 4UUJB 4LHUG 4XPBH 3HI1A 4OLYL 1EEUA 1F4AA 3T3PE 1AGBB 3I85A 1VFAB 5EO1A 5C86A 3MUJA 3UTSA 1RMFH 1AIFA 3QUKB 1AHWA 4LCYB 1JUFA 1MSPA 4Q2ZA 5E6IA 1I1RA 3UYOD 3QIWB 4JHWH 4HPOH 3WNLA 2BVUA 3LKSA 2Y23A 1KV3A 2RFXA 3TJHD 3CVHA 4N9OB 3ZE0E 4N5EC 1DQDL 2IMNA 3OXSA 5E6ID 5TE7L 5F9JB 2HTKD 1LD9B 2MCPH 3T77B 1AFVL 3MV9B 4OD3H 1N2RB 1IKNC 3TYFB 5GRWA 1JNHA 2ZKHL 1FZMB 1CR9L 1DN0A 1VACB 5GRYA 2VQ1B 1TQCC 2XWJB 1FN4A 1LEIB 5DFTA 5GJSH 1MRFH 1WBXB 3RVVD 3ARDD 4OF0A 3DYMA 3DVGB 1HHKA 4R4FH 5FUCC 1QZ1A 5F7EL 5CUSL 3KPLA 3V52L 2GQHA 3SQOH 4MNGA 1CZ8H 3VXQB 1KLUA 5B8CA 5CIPB 2V2WA 5CINH 3INUH 1X7QA 3HMXA 3VFWB 4XVSH 4PJ8B 3ZSTA 4DZ8B 4YDKL 5DMGC 2X05A 5CFHA 3C6LA 1YY9D 1UCBH 1S7TA 4WU7B 1SEQH 4MCYA 1CGUA 2QQNH 3ORJA 5ISZE 1MJUH 1K6QL 3Q2CA 4PJGE 2PYED 5DJDB 1NBVL 1NSNL 4LSUL 5DHYA 5FUOH 3KPSA 2I24N 5FECA 1KCSL 3IXTA 2VN7A 4ZO7A 3TBSA 3EYVA 4KJWC 4R2GB 1IC1A 1MWAA 1HINL 2AQ2A 3GI8L 4LLDA 2EO9A 3KPSD 1HQ4B 3CFJA 2XZZA 1IQWH 5JOPE 2X7LA 1KGCD 1H3PH 1IM9B 3O9WA 2ADIA 3V6OE 2XYCA 1FFQA 1XCTA 4FFYL 2R15A 1Y18A 3K81A 3VWKB 4MB5A 1KBGH 4OD2B 4NYLA 1UYWH 4OZGA 2KH2B 5I8KH 1IARB 1AY1H 3G6JF 3AC0A 4IRZH 4NQDB 5D1QB 5ECJE 3QCTL 1I8IB 2P5EA 1P6FA 1CD1A 1I7TA 5FHBL 4ZXBD 1KJ3L 5C3TA 1IGML 5HVGB 1KTDA 4EXPX 1KB5L 3QA3A 4GG6A 4K3DH 1BBDL 2A6KB 1I7ZB 4NRXA 3CFKB 3QUYA 4K7PL 4DWHA 5DLML 1D3CA 1JGLL 1RUPL 3QI9C 2G2RB 2HVJA 3TCLA 1HEZA 4NZTL 4U1MA 3QUYD 5DVKA 4JY4B 4KK9C 3HMWL 4PRAA 1G7PA 5CLWA 4OSUH 4XP5L 5C6WH 2GK0B 4JPWL 1FVDA 3WHXB 5CJOH 4LGPB 4CVUA 3S5LB 3R8BB 4WW1B 3ETBF 2NNAA 4L29A 2PXYC 1RUKL 2EKSB 2OK0H 3VRIB 4C57C 5K59F 1ZHLA 3FL7A 5GRJL 4HS3A 2XKNA 5E99L 5INCB 4GKNA 1FNGA 2AJUL 3HB3C 1CS6A 2EDOA 5IBTH 1UH3A 2BHUA 1NJ9B 4F7CB 1TCRA 4L8SB 2BOBB 4JFYA 3K8MA 3Q1SH 4Y4KB 3QEGL 5DJZB 4U1HB 1V5JA 3AROA 4TVPL 2ENYA 1EZVX 1WTLA 4WWKB 3X3GL 4PRDB 4OGYH 4IIQC 4S1RL 5E94A 4P57B 2UYLA 4UBDD 2FEDC 3QEQE 1MAJA 1LGVA 1SBBA 5IR1B 2WUCH 3ARYA 1BHGA 5D7SL 5HJ3B 4H26A 4LIQL 4YAQA 3F58H 3HZVA 2DLIA 1KIPA 4M62L 3SDCC 1AQDB 4WUUA 1CG9B 4ODHH 5DRXA 1H0DA 4LLYB 1SY6H 5EOCJ 1FBIL 5TFSH 3IDYC 3S4SA 5CMAB 2AV7B 3MQIA 3W9EA 4CJ0A 4LSPL 3MACL 3QG7H 4RGNC 4PY7A 4X9FA 5CS7A 4GSDL 3CDFA 2CLZB 4M7LL 1F3RB 3N1QC 3C2SA 2ADJA 4HXAL 2VDLH 3B9KA 2ZCLL 4CW1B 5LQBH 2VDNH 1DBBH 1OAYH 4PB0H 3UJIH 3OMZA 1FPTL 4O4YL 4BA8A 4XBPB 3SKOB 5JHDA 2ARWA 1Z3GL 4C4KT 3MJ9L 3B9KD 4HEPG 1ONQB 4MLSA 1EEZB 2VL5B 1E6JL 5AYQA 3IKCB 3BP7B 1KJ2L 1YEEH 4HBCL 1DBAH 1CLZL 2PN5A 3G6AA 3MGTB 3CXDL 4KUCF 5E4EB 3QIWC 1IVLA 3EZ8A 1CFTB 2CMRH 5IHUL 5HHPA 1JK8A 1QLEL 1KPUB 3Q5YA 2HN7B 1G9EA 1MCSA 4KK8C 1QPPA 4KKAC 4O2FB 2AQ1A 1H3TA 2V5YA 1CDJA 4ENED 6FABL 1NGQH 3F6LA 2ORBH 3IDGB 3IVKA 1YNLH 3X12B 1INDL 1WGOA 4P9HL 4QXUL 2FD6H 3L3IB 1YMHB 5F6IB 3D85B 4JZNB 3OF6D 2VE6A 3AS1A 2NXZB 3PQYB 2CDGB 4MD0B 5BVPH 4I48A 5DS8B 3B5HA 4X7CC 5HDBF 5FO7A 1C12A 5JHLL 2BSSB 4PJEB 4JLRB 1MAMH 4X8JB 3PWJA 2EH7H 1XR8B 4PJ8C 4CVWA 1ZGLA 1FVCA 3CX5K 1F97A 3VGAB 1GHFL 1K2DA 4PJXF 3ZKMC 5IFJA 4AEFA 2WP3O 1OCWH 1QYGL 2DQTH 3R4DA 3DX8A 4I0CC 2D3VA 3PG2A 1NEZA 5K9QG 5D5MB 5D7JA 5FKAB 5MEQA 1F8TL 1BVLA 1UG9A 2Z4QB 3H9HB 2IH1A 1DLHA 4R2GC 2VR5A 2PR4L 3ZTNH 1JN6B 1YN7B 1IKFL 1LK2A 5D7JD 1T2XA 3KS0J 5K9JH 5KZCB 2HMIC 3TBVB 5JPMB 1O5DT 4BQCA 2ZP0T 3QUML 3KPSE 1R5VA 4Y16A 5F3HA 3G5XA 3FOLB 1A64A 1X3DA 2BNQB 1AKJD 2AJVH 2NR6D 3GMLA 2H9GA 5EUOA 3VWKC 5LWYH 1KGCE 4TVPD 1QFUH 2CGRL 3LH2L 3MUGA 2ZCHH 1DVFA 1WF5A 4TSCL 1JE6A 3A6BL 4CMHB 1F6AB 4PY8I 1IILE 4U1LB 3VFRA 1WAAF 1D6EB 1DVFD 1EJOL 2OL3B 5CBEA 4PS4L 4H25A 5BW7C 5JNYB 3BHBA 2GUOA 3SKJL 2DTSA 4UAOB 4XHJD 5K59E 1KB9J 4HS8L 4IRSA 2DD8H 3CDGA 4Y2DB 1JWMA 2X70A 4XMLH 3MNZA 1QBLH 4XCCL 5GZOC 5IMMB 4AIZB 1M71B 4Q9BA 2VXTH 4PGJA 4IRSD 5ITBH 2X4OA 1DCLA 1S5HB 4HAGA 1MFDH 1INQA 2BSED 1H5BB 2X89D 1BEYL 1TPXC 2OSLB 1UM4L 4ZSOA 2ARJQ 1FL5A 3EGSA 5C0BD 2QKIB 4CN1A 4KI5E 3WIHL 4FXKA 4JDZB 3ZKXB 5I1GH 1GGIH 2D7OA 4ETQA 3HTLX 1MRDH 2IQ9L 1RMFL 3BN3B 4EN3A 1L7TL 2QBWA 3BMVA 4RMQA 3GBMH 2H32H 1WZMA 4U6XA 4CBPA 3FFDA 3MRBB 3QJFA 4QEGA 3P0YH 3V7AE 4DGVL 1JZ5A 2JJSA 4JHWL 4Y4KC 5FGSA 3LMJH 4OM1H 4BM7A 3AY4A 1F4YH 3FQTB 3UAJD 4KRPB 5KVGH 3P3YA 2VJXA 4WWKC 3VE0A 1U9KA 4DKFL 1Z5LA 2XY2A 3HI5H 4QXTB 1CU4L 2EXWC 3TWCH 3NBNA 3HR6A 2W07A 5C07A 3CU7A 4NPYB 4XI5D 5FAAA 5C0GB 5CD5D 5JPNA 3C9NA 1UQSB 4Z8FH 4AENA 2YEZA 3VXPA 5GJSL 1MRFL 4YXHH 5C07D 5BQ7A 3T3ME 3W2DH 4R4FL 4NUGH 4ODSH 4XRCA 1AGFB 3RZWA 1NL0H 2XICA 5ENWB 2W9EH 5E8NB 3BRDA 1JMZA 2ZWLT 1X5JA 4I0PA 1FGNH 3SQOL 1CZ8L 4IHOA 5D70L 4LEOA 3V6ZA 5IMOB 4U1JB 1Q9LB 3INUL 4H88L 3NZHL 5FF6B 4XVSL 1KCUH 3ARVA 1W2KT 2DJ4A 4I0PD 1DEEB 5B4MD 3RVWD 3G5YA 5CEYA 3RWGB 4WUUE 4TNWK 3MUY1 4G8IA 1UCBL 1BZ9A 3AS0A 1SEQL 2YR3A 2FH8A 3QXAA 3GJFA 1MJUL 5DEGA 4GAFB 5FUOL 5IQ7H 3QUMA 1S9KC 1U3HA 3JWOH 3MXVH 3SDXB 4MLIA 4B7IA 5D8JH 1AGEB 4JQXA 3IGAA 4HKZB 5E4EC 1VGKB 1IQWL 2XTLA 3MA9H 1W72A 1H3PL 4L3CA 1J1PH 4RFNB 1IM3B 2Q86B 3VFVB 3T2QA 2NY5C 2A9NL 5DFWH 5DD5H 2G75A 5I8KL 1AY1L 1GYAA 5F7HA 1B2WH 4P2CG 3MRMA 2ZOKA 2EEBA 1ORSA 2E6QA 3JWOC 4Q7DA 3RL2B 4L5FL 5MI0B 3QUZB 5F6IC 3CSPA 3L3DA 2EE9A 4K9EL 3RWJB 4ZDHB 4U1KB 5TGBB 1ZT1A 5D7LD 1EZVY 5MP6L 5H94B 4MJID 4ZUSA 5I1KL 4HAFA 5HHVH 2APVA 4C83B 4NUJB 1LE9A 4JJHA 1JPGB 4OF6A 4BFIB 2LU7A 4N5ED 5J89A 2E8YA 3QDJA 2F54D 4DN3H 2VAJA 5ERWA 1ZKAA 4LAQH 5JW4M 1U8MA 3V6FB 2Z35B 3P77B 3QRGH 3EDEA 5I1AB 5DQDH 1X5FA 3MFFB 3QDJD 2OYPA 1YEDB 3ULVH 1XZ0A 2PO6D 4QHMA 5B21A 2D0HA 2Y07H 4YDJA 5F7DB 5TF1L 1CN4A 1I8KA 5DD3H 1ZT7A 5F3BA 3IFPB 4GBXB 3D3VA 1Z6JT 2FWOA 2X10A 4MA3B 3Q1SL 2ZCKH 5KAQG 4GXVL 1U92B 5HVWA 1KFAH 5DMGD 1SJXA 3QXDA 3MLYL 4FNLL 4XNYH 4TVPE 4ERSH 5E08H 3PP3H 1HIMH 4I3RH 5DQ9B 4NO2B 1ZLSL 3ULVC 3BKMH 5CJBA 1GGYA 4DK6A 3DRQA 1P9MC 1Q9OA 2LV4A 5JW4N 2AJSH 4ZYKB 3WV0A 4UAOC 1J0IA 5GHWH 1CDBA 3F58L 3PXHA 2VSCA 4KJWD 5GGUA 4OCSH 3G08A 5HYFA 3DIFA 4L3AA 4RGOH 3AUVA 1Q9WB 1SY6L 4ONHB 5CGTA 1KCLA 1VPOH 2W9DH 5JLZA 5SWZB 1NGYA 4PG9B 5F1IB 1RUML 3QG7L 2NYYC 4PR5B 1NMBL 5ICZA 1NCDH 4J3SA 3NFSH 5FGCE 3TT3H 1Z9LA 1U8QA 5BMFH 3DMMC 3D69A 2F58L 2VDLL 1ZHBA 5HHOA 3VFMA 3BEVA 1ED3A 3DSFH 3MRKB 5EUKB 5KS9A 1M7IB 1HSBA 3ZKXC 1BWMA 3OL2A 4YFDB 5IHLB 2Y7QA 3QI9A 3WL9B 3UJTL 4KXZI 5J11C 4PRHB 3CMOH 4QWWD 4ZSOE 4XP9L 3JTTB 3STLA 1ETZB 1OTSC 3FMGL 3ZMRA 3QI9D 2CMRL 4UQ2A 5AAMA 3RP1A 4F8QA 3OKLA 4KK9D 1YQVL 1SBSH 3L5WB 1F58H 2A83A 2WBJB 2XI9A 1NGQL 5J6GA 1A6VH 1SVZA 2EDHA 4CMMA 4CN6A 4UT9H 5IIEA 2OCFD 3GSQB 4LHQB 1GOGA 2FD6L 1TVDA 2PXYD 1Q0XH 3O45B 5E8EA 3OKEA 3NCCB 2FR4A 3GMMB 5C07E 3HB3D 4ZAKA 43CAA 1L6ZA 4M5YH 4HJGB 4XT1C 3KDMA 5IW1B 4QHUA 4P5TC 3VGBA 3C8HA 4HUVB 5A2LH 2FIKA 4DGYL 3S88L 3VXNB 1NH6A 3L7EA 5DRZA 4XNQB 3RVXC 1L0QA 5ACLA 4S2SB 1OCWL 2DQTL 2IGFL 2DLEA 4Y4HB 3BRGC 3MRRB 2FEDD 2W65A 4PJ7B 3GIVB 3IJHA 4ZPTB 5A1AA 1MPAL 4OIAA 3BUYB 3AGVA 3OR7A 1T7YA 3ZTNL 4Y5VB 5H35A 2Y1VA 3SDCD 3PNWA 4LPVA 3IDMA 2XA3A 2XFXB 3Q48A 1BGXH 4TNWF 4F33B 1N3NA 3RUGA 1EAPB 2AJVL 4PUBH 2VLJD 5LWYL 1QFUL 1YEHH 5CZVH 4RGND 1J9CT 3L3HB 5K33A 3QNZA 2PNDA 1AGBA 2FATL 4CJ1A 4YHKH 2WW8A 1OAQH 1SY6A 1WWAX 1I3VA 5KSBB 1U8OB 4LCYA 1WV7T 2Q7NA 1SMOA 3L9RA 3CH8A 1FDLH 3MJ6A 4KRLB 2NY4B 4NWUH 3QHTC 4O2CA 2DD8L 4JFOA 1FRGH 5D7LE 1QBLL 4MJIE 5HVHB 4X6DB 3QIWD 1A6WH 3W5MA 1E4XL 2YSSB 1OLZA 4Z7UB 5IMLB 2VLLA 5FO9B 3D0LA 4KK8D 3LN9A 4KKAD 1MFDL 2Q8AL 3BGMB 2FX8L 3FO0L 5ALCH 5DUML 1LEIA 3MV9D 3W0WA 1GRWA 1T20A 4XCFH 5FCUL 2F54E 2RBLA 4OZFB 2DJUA 3SE3C 4WO4B 1EBAA 2OLDA 5E56A 2DQJH 4JR9L 2J88H 4KDTC 3I50H 3QNYA 3FB6B 3IJSA 4P23C 3SN6N 3QDJE 4EQ3A 2W9LA 1HH6A 1N6QL 5JW5B 1WT5A 3JV0A 1NGXB 5KG9B 2R2BB 3EJYC 3BW9B 3MGAA 5FUCE 4BK5A 3P0YL 4WU7A 4Y1AA 4OM1L 4PJ8D 3V5HB 5BZDA 5C9KA 3MRNB 4Z7VB 2I07B 3BUTA 2RIKA 3K46A 5I30H 4M1DH 2HG5B 3E2HB 4KVCH 4CDGC 3ZKMD 3HI5L 4Y1AD 2E7LC 3D3VE 4K7PX 4MJ4A 4HT1L 1HDMA 1S9XB 5I1HH 1IT9H 3TO4B 2Z91A 5FA3B 4F15C 2XKUA 4R97B 4R2GD 3UROR 3W2DL 3VH8B 5L9DH 2GCYB 4NUGL 4ODSL 1BQHG 5TE4H 2HMID 3WFCH 1NL0L 1S7UB 3VWKA 2IANB 1WC7A 4HLZH 4CGTA 4NQDA 1IM9D 3VFOB 1FNHA 3MV8B 1A7PL 5SWQB 3EOYG 1NBYB 3VWKD 1QKZH 4G6AC 3U2SB 4WEUD 5DJ0A 5DHXB 4NQDD 1NC4A 1DBJH 4JRXB 2NY5L 3DTXA 5BW7A 1QEWA 1OHQA 3OJ2C 2A6KA 2VC2H 1FZJB 1M6OB 3CFKA 4X4YB 4FFWC 2B1HH 2CKNA 5IQ7L 2J4WH 4BYHA 3MXVL 3QQNA 5C7XL 4N8VG 2AXFB 4BUGA 2VLMD 5LAXB 1GC1C 3D9AH 3FONB 2YWYA 4BKLB 1HILB 4HHAB 5GZOD 1TZIB 3WUWB 3MA9L 5BRZB 3QWOA 4HFWB 3HA0A 1J1PL 2XA8H 4K3HA 3DNKA 4EI6B 1HXYB 2P8LB 5HXMA 5I8OL 1JVKA 3O41B 1X5AA 4ODXA 1JGDA 2DTML 2A73B 3PWPB 1YY8A 4YZFF 1Y0LB 5KSUB 1B2WL 5FM4A 4PD4K 3T08A 1T04A 1B0GA 4XCNA 4N90D 1CE1L 2Q3ZA 2O61A 2P5WB 5F7MC 2FSEB 3LQZB 4LLWB 4OZ4B 3VGFA 2I60L 2Z8SA 1YN6B 4K71B 5C0EB 1CDYA 3QULB 4Y4KA 2R1WB 3HR5B 4D9RD 3RQ3A 2FO1A 1ZT4A 3RNKB 3UMTA 3D18B 1MJ7L 2HH0H 3S3JA 3AMLA 2BNRA 3HNSH 4WWKA 5ICXB 4Y4KD 3PDOA 3VFNA 4ZUVB 5C09A 5C0NC 3P9MA 2DWDB 2XV6B 1F4WH 4F7EA 4UV7H 3L3GA 2BNRD 4WWKD 5IR1A 4DN3L 4HKJA 5GRXG 4Y4HC 5J06A 5C09D 2EXWD 5FHAH 3KPRB 3BZ4A 2RCSH 4ODWB 1A4KA 1AQDA 2H32A 1D9KC 3TIDB 1F3DJ 4PJCB 2RB8A 2IH3A 5EC2A 2XQBL 1ND0A 2OL3L 4Y5VC 5ETUB 3AXLB 3V5DA 2C3GA 3HE6B 5DD3L 1S9YB 1KTLB 3WHE1 4WV1B 3K7UA 4HKXB 2ZCKL 5GISL 4CW1A 1KENL 2H6PA 1OOAA 2VLJE 4PGDB 4XNYL 5E95B 5E08L 1VFOA 4KY1L 2LTQC 4RGNE 4I3RL 5GS0H 1ONQA 3KYOA 2X09A 3BKML 4YUEH 5F6HJ 5JZ7C 4NRZA 4OZFH 4P9MH 1ZA3B 1M7DB 3MGTA 2W0FB 3WCYA 1AO7A 2H1PH 3F7YB 5FIEA 1JGVL 1N0LA 2NY4C 5K93A 3GZKA 3RU8H 3QXTA 2GJZA 2YHGA 4F37K 3GIZL 3SCMB 3VD5A 5SWSA 4EVNA 1LK3L 1MLBB 2Y6SC 5EU4B 2Y5TB 5E4IA 2O5XL 1VPOL 4I18B 2W9DL 4NSKB 2MHAB 5HGBB 3IDGA 2JK5B 1MCWW 1GGBH 1U8NB 2ZUVA 5F21B 4EUPG 4I4WA 1AXTH 1B0WA 5I75B 4QOKA 3L95A 5DMIL 1QBAA 5ABDE 3KPQB 3L3IA 3RDTB 5GS0C 3NFSL 2R1XB 2NW2A 1NDGA 3GSXB 3TT3L 5GRZA 5BMFL 5CHNB 3U7YH 1YPZB 2RJMA 4LKCB 4HULB 5IESL 2X4PB 1BOGB 4KFZC 4KTEH 4QOKD 1UKTA 4WO4C 3NIFF 3UXFA 1BECA 5ALBH 2FLBT 5MHSE 2Y72A 4DJMA 3OGCB 4JAMB 2BMKB 1V8HA 3VRJB 2HFFB 3O4LA 3MUZ1 4CN4A 3CMOL 1I4FA 3QP3A 4UDUA 3ZT6A 3EYOB 3FTGA 1A7RL 3BP5B 2GKIA 2WIMA 3PGDB 2DIJA 2NTFB 5E9DA 3O4LD 1NLDL 1UXWB 4MJ2A 3W9DA 4PTUB 1SBSL 1F58L 3E2HC 4JFEA 3EO0A 3CIQA 2D0GA 3NA9H 1R24B 1P84J 1A6VL 3H9HA 5F1KC 4UT9L 4N1HB 1RJYA 4OZIB 4MA8H 2ZUTA 4Y1AE 2HA1A 1IGYB 5IVZA 1Q0XL 4WHTB 1HNGA 4R97C 3FOLA 5H8DA 5KZCD 5C08B 3KPOB 2YMXL 3X11A 5I71B 2HKHH 1UVQA 1PVHA 1MNUH 1NCCL 4PJEF 4IDJH 2KZWA 4KZDH 3DXAB 2BNQD 3OR6A 1LHZA 5INDA 3VG0H 3I75A 3WUZA 5F6HI 2JELH 3L3JA 4JPKH 2E8ZA 1D6EA 4MMXC 12E8H 1P9MA 2ADFL 3GSWA 5I1LA 2GYSA 2E7BA 4FFZH 5K9KB 1LO2L 3ZT5A 1FFNA 1CTOA 2DJSA 3IDIB 1K3ZA 2DM4A 4NQDE 4RGMB 4E0RA 4UILH 3KLSA 3NOIA 5D5MF 3N1FC 3P0VL 2OQJB 3FQUB 1WISA 5IMMA 1M71A 5LBSH 2OZ4L 1CDGA 1BLNA 5D7KD 4RDQF 1HHJB 4Y8AA 1RK1A 1S5HA 5GSRB 3KYMB 4AJ0A 2VLME 5EPMA 1BGXL 2EYSB 3BVNA 5E8OB 4G7YH 1QSFB 2V5TA 2ZSVA 3DMMA 4M61A 4NOFA 4N1CA 1F5WA 5GRVK 1YEHL 4LP4A 5CZVL 5EA0H 2NYYD 3IU4H 1WVZA 2ARJA 3RWDB 3CH1B 4YHPA 1Q1JH 3FHAA 2HJLB 1A5FL 4YWGH 3EUUA 4YHKL 4HUMB 2XWBA 2VXSH 3EYFA 4N90E 4URTB 2VUOA 4ZS6C 4FQPA 1FDLL 3MRBA 1RZ8B 3NA4A 1GGTA 1Q72L 2M2DA 3RHWK 2G9HB 4XP6L 4LBEB 5EN2A 3GDBA 4NZUH 4DQOH 3FQTA 1V3LA 4K7PY 3L5HA 2VL4A 1OTSD 4D9RE 4RAVA 3U36B 3NFNB 4QXTA 1DFBL 3WS3A 3MJ8A 2HRPH 1I1AB 1FE8L 1GZPA 3MLRH 2O5ZH 1D5ZB 1EUUA 4FQIL 5ALCL 2DQUH 3EYSH 4KROB 5DF0A 1IBGL 2WLZA 3PHQA 4UIMA 3FOMB 2BNRE 4NNXB 1DUZB 3FT4B 5ENWA 5C09E 4GMSH 2DQJL 2J88L 3UPCA 3I50L 1RZKC 4U1JA 4P5TA 1QFPA 1OQOA 3WKMH 1PY4A 2BFVL 3WS6C 4D8PA 4WV1C 4P5TD 5GRVL 5DHVB 3L3KB 1FYTB 4YGVB 3B3IB 4CVZA 3MRHA 1IL1B 1CE6B 3RVXD 2VH5H 5C6PB 4CRPA 4OIIH 3SDXA 2JCCB 5IFAL 1ZHKA 3VJ6B 1GVIA 1QRKA 5D6CB 3K2UH 4JG1H 4U1SB 1FHGA 1VGKA 1S5IL 1XGPB 1U8JB 5EZJA 1OWRM 4C59B 1T7XA 3SCMC 1S9WA 4HH9A 1IAIH 3LS5H 5TE4L 4ORZC 2VXUL 1WBYB 4I18C 4XB7A 1GC1L 1AO7E 3SDYH 4M1CC 4R3SB 4XBEH 1S7VB 4GKSA 3AS2A 4QRUB 1QKZL 5TQ0L 3RDTC 4M4PA 1A7QH 2Z9TA 4PIRF 1CFSB 1ZVYA 3RL2A 4RAUB 3LKNA 3RIFK 3ZYOA 3HNVL 4G6MH 2NX5B 2ID5A 1WFUA 4ZDHA 3FO9B 5TGBA 2JIXB 4CU6A 3E6HA 5M7QA 4KVNH 4F37F 3QUZD 3GUTB 3O6KH 3RY6C 3ROLB 1I7RA 3ARBC 2OMBA 2GITB 4QOKE 4RDQG 3UCRA 2EDEA 4M7KL 1FAKT 3SDXF 4JO2H 1H15A 5I8EA 2NY1B 1JPGA 3NFPA 4BFIA 4MXVF 3KLDA 2VWEC 4AQOA 4Z77B 4HPYH 4M43H 4LOUC 5H37G 1YQ2A 3ZHDA 4PJEE 1N4XH 2KUTA 1RUQH 3NCJH 5E0QA 4U6VL 4YDVA 3O4LE 3MFFA 2VNCA 2XN9A 4X83A 2YK1L 1FFOB 1MQ8A 3GHBH 5DJ8A 3MUHL 4KDTA 2HYMA 4P23A 4QRSA 4KKLC 5AWNL 4H8WH 4OCYH 3MRCB 5FM5O 1MCIA 3KAAA 3OPZL 4GS7B 5AYUH 4JFEE 4P23D 5D5ME 2WINA 4OV5A 1DQJB 2E6PA 2VDOH 2AGJL 3EJYD 3QDGB 2WUBH 4JZOA 4J3UA 3HNSL 1XGYH 2Y5EA 4XZUA 4FQJH 5A3IC 2CK0H 2BNQE 1F4WL 3IFLL 2P24B 4UV7L 3EO9H 4HC1H 5DJXB 3LIZL 3K0WA 4LLVB 3SO3B 4GXUM 1Z9OA 1F02I 3VXSB 4RGMC 4YPGA 1GL4B 3U9UA 3KS0H 2EDDA 1CWVA 2UWEA 2WNGA 3ULVE 3C5JB 5D93B 1LWRA 4MAYC 2DAVA 1S3KL 1DSFH 2BC4A 2VDRH 4J4PA 5F1IA 1CICB 2GTZB 4PR5A 2P49B 5D7KE 2PTTB 4I77H 1BFOB 3ZTJH 5SWZD 2PKDA 1KUMA 4PLNC 5C6TL 1KACB 3MRDB 1R3HA 4G6AD 3JV4B 2VO5A 8FABB 1VEMA 2R4SH 3KPMA 5I2IB 5L8LB 1U58B 1OPGH 2HT3C 5GS0L 5FYLH 4HGKC 1K8IA 3H9SA 2AJ3B 3IFOA 1FVEA 3QT2A 1J0ZA 4FFWD 4E41A 2A0LC 5ANMB 1ETZA 1IEBB 1U2HA 2RHEA 4GXUN 5LGHH 1FGVH 4IMLB 1CD9B 2R0WL 3FRPA 4KRNA 1JHTB 1ZSDB 2FX7H 2UWEF 3L5WA 4XP1L 2D7NA 1BZQK 3D48R 3LS4H 3RZCA 4QHKJ 1DTUA 5DHVH 2G5BB 5T3ZH 1HWGB 3PL6B 4UT6H 4BFEA 2WBJD 4UNVA 5TDPA 5JOFA 4KROC 1WCQA 1C7TA 4HIEB 3K4ZA 4M6ML 2BVOB 1U3JA 2ZUUA 4L4TB 3U7YL 5L88H 4XXCA 1PJ9A 3LKRA 2NY6C 3NN8A 3RHWF 1L0XA 3DX7A 3CSYA 3BZFB 2DOCA 5EBWB 1EO5A 4RWYL 5FDWA 4YX2L 2H8PA 3NZ8A 2D7TH 2PUQT 4JM4H 4GUPA 3OHXA 4G9DA 1RHHB 3KYKL 1A9BB 4FRWA 4OCXH 1B88A 2CO7B 5C0ND 4UDTB 2YOCA 5DD6B 4WU5B 1IE5A 3GIVA 1D9KA 3NA9L 4X6BA 4C4KO 4LDLB 5HI4D 3DRTB 4Y4HD 4X6CB 4Y19A 1G1YA 1D9KD 3DX9A 2WQ8A 5DD0H 1NDMA 1TZHA 2XFXA 3BEWB 1EEYB 3Q0HA 4MNHB 2DN7A 4WWID 3SDXE 4Y19D 2AJZB 5DJYB 4WFED 3GBNH 3S96A 4BZ1H 4DCQA 4WENB 3N1PC 4IDJL 1ACYH 1JWSA 5B39B 3HC0A 2A77L 3VG0L 2X4QB 3S34L 3HCVB 4U1IA 2JELL 2KBGA 2VR4A 3L6FB 3GSNB 2FO4A 1OTUD 4XVTL 5I6XC 2VMFA 2BJML 4FFZL 2R69H 4NQXB 1CGXA 5TH2A 4KMLB 3WIIL 1QBMH 4XVUC 1FG2A 4G5ZH 2F53B 4PJ7F 2P42B 2HJFA 4QRTA 1QP1A 4ORGB 5CD3A 2R0KL 5IM7B 2NY4D 3IDXH 1T0MB 2B0SH 4PRNB 3O3DA 4XNUH 4DEPB 4YNYA 4QHKI 2Y6SD 3BGMA 4JVWA 4Q6YA 4FN0A 4NHUB 1YMMA 3RIFF 3BJLA 1YDPB 4OTXH 2VDKL 5DDHA 4OZFA 2C7UA 15C8H 5C70A 1G9NH 1JNJA 4DZBB 4EDXB 3VD3A 1A7NH 3BD5A 4LLUB 3GI9L 5IP4A 4Z76B 1YMMD 4WO4A 5GS0D 4LASH 5HBBA 4Z18A 5I19H 1Q1JL 5HGGS 4YWGL 5HDQH 2GI7A 2I25N 3LKPA 3CCHB 5KSAA 2VXSL 4WO4D 5DMYA 4YXKL 4QTHB 5KSBF 5KG9A 4P4KB 1NGXA 3BYTA 5L6YH 1VCAA 3BW9A 3ABZA 4KXZH 4U0RC 4HV8B 1BIIB 5DC4B 2IQAB 1RZKL 3V5HA 1A9EA 4K7FA 4MDJB 3B4NA 3MLWH 5HDOA 4ZS7L 1UJ3B 2QHRH 4X6DF 4JO4H 4JFZH 3QEHB 1ULVA 1G9NC 1P4IH 3KPNA 4GRWB 3U9PH 5CEXA 3F7QA 4PBWD 4Z7UF 2KPNA 3U30B 1PAMA 2HRPL 4LSDA 3G9AB 3LV3B 5GGSY 1NAMB 4PGEB 5FA3A 1DANT 3O2WH 1WEJH 1S7XA 1UH2A 3SO3C 2JJWA 2XNAB 1DE4A 3O11A 2OTUA 5IVOA 1S7UA 1A1OB 1CDUA 5I1CH 4GW1A 2E7MA 1KLGB 3FT3B 4XPGH 1XGRA 5J12C 2DLHA 4Z7WA 3QG6B 4WDIA 2RGSA 3MV8A 5DJ2B 3Q6GH 2W0KA 1CICC 1UACH 2IAND 3ELAT 4MVBC 5EO9B 4YHYB 4KHTL 1C08B 2UWEE 3MV8D 2WBWB 3TV3H 4KC3B 1A6AA 4Z7VF 4HIHB 1BF2A 4WGWB 1F3JB 1MFCH 1LE5A 4JRXD 4MD4A 3PJSB 1GAFH 2VH5L 3SY0A 4OIIL 3T8XA 3OKMB 2E27H 1AJ7H 1G7MB 1CL7I 5GIRA 1ZGLP 3JV5A 1FNSL 5EOCL 4HHAA 4PLKC 2DRUA 4PRIA 3GMNB 2E6JA 5JIHA 2FBJH 2DM7A 4OCNC 1Q9KB 4NIKB 2P8LA 1T7WA 3PWPA 4PRID 5BRZD 1SYSA 1IC5H 5D1ZC 4OF5A 4AZ8A 5D2LB 2V9QA 5ESAB 5DSCB 5CBAB 2CRYA 4F58H 2FJFA 4Z5RA 1FZOB 2BRRH 2NY3B 1D6VH 4MS8C 3PWPD 1F4HA 1A7QL 2ZG3A 3BWAB 1T2QL 3KLAB 2RQ8A 4LLWA 1FJ1B 3O4OB 3V0VB 4ZOBA 5L7XH 4Y4FB 4O51B 1KPRB 4X4ME 2FIRT 5C0EA 4NO3B 4M02A 3CU1A 2R1WA 4KVNL 2GK2A 3WFDL 4S1SL 4X98B 4ZS6D 1OSZB 3D18A 2CDFA 5ICXA 1ORQA 1S7SB 3SKMA 4PJDB 2EH8H 3MRJB 5HHNB 4ZUVA 3MBEB 1PYWB 5HHQB 1FZKB 1FIGH 2V7HB 3IAQA 1NPUA 1KJVB 4HPYL 4M43L 4NBXB 3K2MC 3FQXA 1N4XL 2CIKA 4UOW1 4WJ5B 2G60H 4XMKH 4M1GL 1MFAL 3HFMH 5BVJA 3KPRD 1T1WB 5F1NA 1J1OL 3RTQC 3SKNB 1RIVH 4M00A 1K5NA 2B39A 3KNBA 2EYTB 3TBYB 5AYUL 4PJBA 3WS6A 4WV1A 1OP5K 4NO5B 5IB1B 4YEFA 3HE6D 1LDPH 3WLBB 4Y19E 4OUUB 2FGWH 3RY4A 5HYSB 2WUBL 4PJ9B 4WFEE 2EDFA 3WKNA 1XGYL 1YEIH 1I3RA 3IRPX 2CK0L 1H3GA 5E6YA 4ZUWA 4Q9QL 1ZA3A 2FJGB 3MOQA 3EO9L 1XF4A 1MELA 5DGRA 1V3MA 2V17H 2G5RA 5BO1L 1G7HB 4KKNA 3RL1B 5BV7H 3WJJC 4ELKA 1P7HL 3GMRB 4NT6B 1UEMA 1BQHA 3T0AA 3PWVA 1BFVH 1DQQB 5I1DA 1A8JH 4PJCF 1ZHNB 1PZ5A 4UNTA 4I18A 4RMSA 4NSKA 4DEPC 5F7LB 1DSFL 3SCMD 2JK5A 5C0CB 4ZTOH 4BFBD 2B8OT 2FL5B 5CWSA 1DDHB 4DN4H 4KRMB 1F45A 5CJXC 1IMHC 4JFHE 2NW3B 5TPWL 4M1CD 1YPZA 2X4NA 5E6ZA 5CEZL 4RFOH 1R3LB 5I9QB 3RDTD 2AK4A 4DOHB 1CGWA 5BV7C 2VSDA 1T3FB 3ARBA 1SJHB 1OPGL 4UINL 1YMME 4OF8A 1A3LH 2B20A 3C6SB 5FYLL 4W70A 2AK4D 1A3QA 3ARBD 3VH8G 4NQEA 1BPVA 2NTFA 4XGZB 1FGVL 3X14B 1AH1A 4ALAL 4NO0B 1UJ3C 1UZ8B 4HCRH 5JW4Q 4F57H 2DQGH 3WJLC 1OT1A 4NQED 2FECI 4GT7A 5I17B 3ZE1F 3TBTA 4LOUD 3UBXB 5ADPH 4B0MM 3U30C 2C5DC 1FSKB 1VADA 1PZUB 2IALB 5T3ZL 1FC2D 2XTJB 2EE3A 5CP3H 2H26A 3MRQA 5H2BB 4UB0H 4KTDH 4Z7VE 2AK1L 3ARSA 4RNRB 4L8CB 1YPZF 1HZHH 4OFVA 4KKLD 4FZEH 3KPOA 3U4EB 3UTZA 2D9CA 2EDJA 1G0XA 3E1F1 1HXMA 5IK3A 3RWEA 4JKMA 2OJEB 1N8ZB 1ZWIA 4Z7OF 1RZIB 5C08D 1JF1B 3HZMB 1T66C 3VXMA 3WUWG 4L8BB 2D7TL 3FRUB 4LPWA 2AV1A 1C16B 2Q8BL 3LEVL 3OKNB 1BJ1H 4QCIB 4UT7H 3DXAD 3WXWH 5HHXL 1CBVL 4OCXL 5GRUH 3NIGE 3TNMB 5A3ID 5KSVB 3IFNH 3MV8E 1JPST 2ZG2A 4MDIA 2OQJA 5K9OB 2BHZA 1VFBA 4BH8B 1E4WL 2IC2A 3T2NH 3QFDA 4OZIF 3ALXA 4JRXE 4MAYA 3IAPA 4O02L 1NC2B 4NJAH 3P30H 1HHJA 2J6EL 1X5KA 2C1PA 2EC8A 1NCTA 3O6ML 4JB9L 5GSRA 3MNWB 4OZHB 3S35H 1KG0B 3UTTA 3EKCA 4X4XA 4ZUTB 1QSFA 4MAYD 3VCLA 3DV4B 2VXVH 1P5UA 4X5XA 2UZXB 2C3VA 4X99A 4HC1A 4HGWA 4OD1H 3CLFL 2WIIA 3GBNL 4DW2H 4BZ1L 2OI9B 3LEXA 1QSFD 2N7BA 3CH1A 5ISZB 4OJFH 4LCUB 4PRIE 5BRZE 1BZ7A 4WY7H 1CGSH 2DDQL 5FUZH 2GJ6A 3O4OC 1LEGB 1ZTXH 4Y4FC 2D7PA 5I15H 3PWPE 2HT3D 2R69L 1RZ8A 4JQVA 5IFHH 4GLRI 3GRWL 4RIRA 5DMKA 4U6HA 4V2BA 2G9HA 4NQVB 1QBML 4DVRH 2V2TA 4R96B 3VW3L 2EDNA 2HTLD 4G5ZL 4PLJD 2R9HC 2YUWA 3V2AR 2A0LD 2DYPB 3HHRB 1MUJB 2IPKA 2ATKB 3MXWH 3AREB 3D6GA 3NIDE 4EUPA 5HYQA 4HKBA 3SE8L 3RWFA 3MREA 1IRAY 3JTSB 5CEZD 2Z8WC 3KYAA 1FCCA 1QHOA 1YEKH 4OTXL 15C8L 4HWBL 1G9NL 1OM3L 1EH9A 2IAMB 4JFQB 5BS0A 4KROD 2WWMD 3GFUA 4LASL 5FYLD 2NMSA 1ZVHA 5HDQL 4LKXB 3RGVA 3G04B 4MX7A 3DHJA 3C60C 3X13B 3BH8A 4MNQA 3SO5A 5MENB 3WYRA 5DHVA 2B4CH 5DEFB 5HYJB 4JY5H 4YGVA 1HYRC 1LILA 3TPUB 2QHRL 2P1YA 4PJ9C 4JFZL 1P4IL 4GMTH 3U83A 3U9PL 5T3ZD 1FYTD 1JPTL 1WCBB 4OI7A 4PJBE 3RWCB 1J8KA 5CILH 4G9FB 4Q6IC 4EI5B 3V8OA 2OR9H 3ESVF 1A1NB 3CPLB 2QSCL 1L9MA 2PYFA 1N59A 1O0VA 2Q7YB 4K8RL 4NP4H 3VI3F 5DURB 2DKUA 2CDEA 1J1XH 5I8CA 2DQEL 3Q6GL 4LPYA 4JFPA 2GW5A 4M8VA 1HK6A 1ZOXA 4QYOA 1CFSA 4RAUA 1AGCA 2IWGA 3VRLE 1AP2B 3ZE1E 1BD2B 4N0FA 5GS1B 1QG3A 5I9QC 3QEQB 5C0AA 4LSTL 5E1AA 5ICYA 3AM8C 4HWZB 1A6TB 5IF0A 3ME0A 4C56A 1MFCL 2GIYA 3AS3A 3TN0C 4AIOA 1GAFL 3N0PB 2JCCF 2JIXD 2ZUQC 1X5XA 2E27L 4JM2C 4YHLL 5GJTL 1A2YA 1YPZE 4XVUD 5B38B 2EDXA 2AK4E 4LMQI 5C0DB 5IOPB 3EFFB 4WI6A 5D72L 1G1CA 4U33A 3QSKB 1E4KC 4MD5A 3MRIB 2FBJL 1KN4H 4EDWL 4Z7OE 2D0FA 3O2VL 2R2EA 4BH7B 1T1YB 5B3NA 1N64H 1IC5L 4NQEE 3BX7C 2VWEE 2IFGA 2FX9L 2R1YA 2XTJC 1DLFH 3T65A 1F2XK 1VKXB 4X5WB 5E2VL 1N26A 1UA6H 2UZIH 1R3JA 4PGZA 3O81A 4YO0B 1YYMH 1LMKA 4RMUA 3JWDH 1RI8A 4DKDC 3S97C 5AEAA 3WFBH 1RURH 1WZKA 4N8CH 1TZGH 2ILLA 5GGRA 5EO1B 3FJTA 3UTSB 5F96L 1AIFB 3PV7A 1OB1A 2EH8L 1AHWB 3ZYZA 2VTFA 4Y7MA 3QDGD 4WCYH 1JUFB 3R0NA 4AIXA 5E6IB 1FIGL 1JZ3A 3NCMA 1PX3A 4LLVA 3HG1A 2RFXB 5IBUG 1OAZH 3B2UC 1VGEL 3LEYH 3VXME 3OXSB 5C0IA 2MWCA 4XMKL 3ZDZE 2XQYK 4X80H 4ACPA 3C5JA 4YBLB 4X7SH 4I0KA 3GSNL 5IVXA 3HFML 5J3HC 1IGIH 1JNHB 1RJLA 1DN0B 1RIVL 3SPVA 1X5HA 4D3CH 1SJVA 1CICA 1FN4B 32C2A 4XAWH 3HZKA 5SX4I 5CJ8A 1CFQA 1EBPA 1HHKB 4OLZH 5I18L 4ONFL 2EE6A 4UQ3B 1RZFL 3KPLB 4IMKC 4P46A 4OCMC 1CICD 1LDPL 3B5TA 4MNGB 3JV4A 5B8CB 3KLHC 1EJ6A 2V2WB 1X7QB 3GSRB 1YEIL 3SQBA 1QSFE 1CI5A 2KQNA 1CTNA 2AJ3A 1OGAB 4R7NA 3C6LB 3T1FA 5DI8A 1S7TB 4MCYB 4LU5H 4KMQA 1OSPH 3DO7A 3M8OH 4P2OA 4IMLA 3MA7A 5DHYB 1JHTA 1ZSDA 5FECB 2GJ6E 4JFXA 4H1LB 5HYIA 2V5RA 4PGBA 2EO1A 3EYVB 3WSQH 4CU7A 3AREC 5D1ZA 5IG7A 5DMJB 1FLTX 1RU9H 4LLDB 5I1JL 2G5BA 1U2CA 5SX5H 1PG7H 3MRGA 3UO1H 3CFJB 3FQWA 4YQXL 2X7LB 5D1ZD 5DZLA 2BVOA 3TEUA 3O9WB 2ADIB 2XZAL 2J8UA 1XCTB 4G6JH 1J0HA 4L4TA 5CEZE 1Y18B 2I27N 2IAMC 2W91A 1J10A 5J4MA 4BSWA 3MPCA 4MS8D 4OZGB 1K4CA 5T3XL 2VKWA 4ZO9A 1TETH 4KMTH 4L4TD 1SHMA 2P5EB 3GMOA 5FYLE 1A3LL 1CD1B 2E7CA 1I7TB 4FP8H 2O5YH 3DHMA 1KTDB 3RVTD 3BESR 3OG4B 4XPFH 4G42B 5BS0E 4JPVH 3QA3B 4GG6B 4LPCA 3EFDH 2VZ3A 3QUYB 4NKOA 2DMBA 3BKYH 3T4AA 1J0JA 1R3KA 5DD1H 3WLWC 4UDTA 5JXEC 1ZMYA 2HVJB 3TCLB 1HEZB 4U1MB 5ADPL 5GPRA 4AQ1B 2JF1A 1L7IH 1JCKA 2X44D 4MB4A 5T3ZE 3R0MA 4PRAB 3RTQA 1G7PB 4KTDL 4PBXA 4HUNB 4M5ZH 1FVDB 3GO1L 1SM3H 3CSBA 2NNAB 3EO1A 4L29B 3BPLB 1EFXA 1MI5A 1ZHLB 3B8SA 4HS3B 4GKNB 1FNGB 1OLLA 5I76A 3C09B 4Z9KB 4O5LH 4F7PB 1MI5D 1MJJB 4JFDB 4JREC 4UIKL 3MSPA 3IF1A 1TCRB 3WXWL 4UT7L 4JFYB 1T4KB 3H6JA 5GS1C 3ARPA 1KIRA 3WJJA 3N06B 2F53A 4LVNB 1MH5A 4NN6B 4WNQA 4N0UA 2FGZA 4ORGA 3AU1A 5EZLA 3T2NL 5E03A 5E94B 1UGNA 3PGFH 2UYLB 4NJAL 4OCRH 5F70A 5KVFH 3P30L 2F53D 4X6CF 1ZV5A 3LZFH