3UAJC

Crystal structure of the envelope glycoprotein ectodomain from dengue virus serotype 4 in complex with the fab fragment of the chimpanzee monoclonal antibody 5h2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
224
structure length
220
Chain Sequence
EVQLLESGPGLVKPSETLSLTCTVSGGSISDFYWSWLRQSPGKGLEWIGYAHSRVSAYYNPSLKSRVTISVDTSKNQISLRLSAVTAADTALYYCARQGTGTTGVSEDSFDLWGQGTKVIVSLASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVDHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords envelope protein
publication title Structural insights into the neutralization mechanism of a higher primate antibody against dengue virus.
pubmed doi rcsb
source organism Dengue virus 4
total genus 39
structure length 220
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2011-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3uajC01
3QXUA 4J3UA 2DQJH 4MS8D 3NTCH 4G8GD 5IVXF 3VWKC 2R2BA 4YNYB 1WT5A 5L0QB 2H6PA 5IVXE 2CH8A 3ULUE 4N9GA 1CZ8H 1S7VA 4PGDB 2Y72A 3GSQA 3F7VA 5CS7A 2C4FU 5FOBB 2EDLA 4M03A 3NCFB 1KBGL 4JG1L 4APQC 4YDJA 5GRUL 1UM5L 1A8JH 1F2XK 3RVXC 1RAMA 2YD5A 1FFQA 4BA8A 4XVTH 1DBJH 3L3JA 5EUOF 3GGWB 3QG7H 4L3EE 4HZLA 1MHHB 4OCNC 3LAFA 5EUOE 3BDYH 5D70H 3QIWB 5FA4A 1RURL 4PJIF 6FABL 2AP2A 2PUQT 2J88H 4JQXA 1I9JL 2HJFA 3HE7C 4OZFH 3E8UH 4PJIE 4HUVA 3AC0A 1W72H 3HR5A 4HF5H 1K3IA 1KCLA 3QFJD 3C5ZD 3LEYL 1KB5B 1QR1A 2ADIB 4G7VH 1C12A 1QBMH 1YEGH 4ZXBC 2XI9A 5DO2D 1KJ2A 2V5MA 1E4WL 5ESAB 4KY1L 3VFRB 4MAYD 5I1GH 5KVEH 4D0BA 1JYXA 4P5TD 3I6LD 4HFWA 4WTWA 5FA3A 4HQQL 2ZPKH 2NZ9D 4ZO9A 5D7LA 1N59B 3VXSD 3EDDA 3X14B 4X6FB 5BO1H 2WIMA 4I77H 3KPRA 3FCTA 5LAXB 1EZVY 4AH2B 2GTWA 3O6KH 3QWOA 3PWNB 2E6PA 4B0MM 3H9HA 1EO8L 4YFDB 4PJXA 3QWQB 2YPLD 4Y4HC 5F7LB 3W2DL 3GSWA 2WW8A 3QXAA 3RWCB 1MI5B 5IROC 4OTXL 1MCOH 4P3WA 3MGTB 1C1EL 5IKCA 1KIUA 5F88A 3ES6B 1S5IH 3GJFH 5DS8B 3TO2B 3C6SA 4S1SL 2VOTA 1YZZA 2VLRB 4XPHH 1AKJD 1IQDA 2IMNA 1H3TA 1T0NB 1ROWA 2VAJA 4PRAB 4P2RA 4GAGH 4G3YL 2ZUVA 3MXWL 1ACYL 2ZP0T 1Z3GH 4PY8I 2HMID 3VFSB 1IKFH 1ZT1B 3H7BB 3QUMA 5KVFL 1IZKA 3OAYK 2VXVH 3WCYA 4RFEB 5JQ6L 3ZE0F 1MUJB 3O3AA 4JKLA 4MGXA 1T04A 4GW5B 4QRUB 3BZFB 3H0TA 3MQIA 4JFPB 1V05A 1E28B 2OJEB 1G7IB 2V2TB 5J1TC 1SBSL 4OZIA 1WC7A 3BWAA 2AEWA 3I02A 3KJ4B 4M5YH 2C3XA 3QQNA 3UJTH 5DZNA 4ISVB 3DV6B 4X6DB 4KAQL 1F90L 3GRWA 4XC1L 3HI6L 5F7DB 1OSZA 3CD4A 2PXYC 3S37H 5IMMA 4N8CL 3BD3A 5BMFL 1F3RB 4NHCL 3U4EA 4NKIL 5DUMH 3AXLA 5DD0L 4JPKL 2QEJA 4KMLB 2NY6D 1MY5A 4I4WA 3F58H 5CUSL 4KKAD 3TPUB 3BVNA 3O6FD 1JTTA 4QHNB 4S2SB 2DQGL 4QXGL 2A6IB 1ZEAL 1K8DA 4XP4L 1ZTXH 3FFCB 5DWUL 2CKBA 4QRPE 4OGXL 1P1ZB 1RK0A 5HGDB 1XF3B 1IL1B 1EMTH 1LQSR 3N1MC 3U1SL 5KTEH 2J3SA 1DLHA 1KN4L 1QA9A 4GKOA 4J6RL 4M93B 4KQ4L 2FJHA 4KVNH 5I1EH 4LSQH 1U8PB 3WN5B 4B50A 3Q6FB 1RZ7L 5EU7E 1N64L 3IFNH 5EH1A 2XA8L 5CJOL 4AG4H 3KS0H 3BQUC 1RZJC 1PJ9A 5KAQF 1NAMA 1T1XB 4KI5D 3V5KA 2FZ3A 1NCAH 3QNZA 4WI4A 5I9QB 4ZFGL 3QI9A 4Q74A 4JFFB 4NQSB 2BNQA 4W4OA 5KJRL 1IM9D 2ESVB 3JBG7 2B0SH 3MV8A 2Z91A 1QKZH 3WIHA 4JM2B 3GBMH 3VXNB 1R5VB 2XWBA 3ZT7A 5I6XB 3MRNA 1CLCA 1HHGB 5HYIA 3UTQB 4OV5A 2H8PA 3BISA 4XVJL 4XWGL 4HMDA 3I9GL 1ND0A 4YR6B 1WIUA 1CT8A 1VEMA 2DTMH 4LAJH 3MRJB 1IZJA 3MGOA 3MACL 3V4PH 2R56L 4MJ5A 3O6MH 1MCRA 4NWUL 2A83A 2BDNL 4OAWA 1WWBX 4ODVL 2O5YL 5DQ9B 4ZAKA 2FX9H 5C8JA 4Y5VA 3CCHA 3HI5H 2HLAA 5C08A 1RJLA 3NIFF 4U1KB 4DGYH 1JTOA 7CGTA 4L9LB 5FYKE 4J7RA 5IB1A 2YPKB 4RGOH 5EB9A 1EHAA 3NIFE 4OD1H 5CGMA 4TNVF 4KRMB 5GSRA 4UQ2A 3DX9B 3SBWC 4CW1A 3IJHB 3Q5TA 3WIFA 4YHKH 1WBYA 1YMHB 2FGZA 4H1LA 3BIKB 3SDCC 5KVGH 1S7TA 3CMOL 1GYAA 1FE8L 2AV7B 4WFGD 2PO6A 4NNPL 2H32A 1ZLUK 3MLXH 4J23A 2X4PB 4TVPE 1QNZL 5I73B 5GS0H 1MIEH 2R2BB 4GMSL 2E6JA 4WW2F 3X3FL 2XKNA 4N9GB 1MJJA 1S7VB 2DRUA 4LKCA 4LGPB 1QLRA 4HJ0D 3QWRA 2WUBH 1YA5A 4M6ML 5FUOH 4GXVL 5JW3H 1EVTC 2AK1L 3L3JB 3X12B 2AABH 4XNYH 4FFWD 4HZLB 2I25N 4LU5H 1NLDH 2VL5A 1FZOA 1YEFL 5FA4B 1KN2L 4V1DA 4ETQB 5IFHH 1IGFL 1DJSA 1NQBA 3V8CA 3LPWA 4HEME 3HR5B 1RU9L 2GTZA 3AREB 2NW2A 1DDHA 1F00I 2YA2A 1REIA 3P4MB 1QR1B 2UWEA 1A7PH 3P9WB 5C07E 3OKYA 1C12B 1GIGH 4OLYL 1KJ2B 2OP4L 4AY0A 2VQUA 2KZ1B 2BOCB 2P43B 4NSKA 1INQA 2DDQH 3CZFA 2CIIA 1UWEL 1QO3A 2CIKA 1WIPA 4JDVA 5MENE 5JDSA 2QKIA 5FA3B 3VA2C 2VZ1A 5DRWA 5F44A 3I2CH 4LVOB 2NMSA 3IYLW 3P9LB 3BP5A 3FCTB 3KPRB 4GS7C 4NP4H 4TSBL 1R3HB 3UYRH 4QYOB 3QWOB 1ZHKA 4PRNA 3H9HB 3OKKA 5LCVH 4PJXB 3QA3A 2IPUG 3THMH 2WP3T 3V4UH 1YNKH 1F6FB 3GSWB 3CMGA 5B22A 4N0CC 2QQNL 3RI5K 4RIRA 2A9NH 3QXAB 4PRHD 3RPIA 3PV6B 4OCWL 3KLHC 1MCPH 1MEXH 5IKCB 4H25A 2RCSH 4NN7C 1HYSD 1NC2B 2GUOA 2VLKD 3HE6A 3C6SB 5EFIA 5DJZA 3P0GB 2IPTL 3GMMA 1IQDB 2XYCA 4G8GA 1FDLH 3DTXA 4N8PA 2PTUA 4YXKH 5IFJA 4P2RB 3P0VH 5D6DC 5JXAH 4PUBL 1B0RA 2XRAH 5IBTL 1HINH 3IDIA 2X4SA 3QUMB 5F1NA 2NW3B 5I15H 1MCSA 5LWYL 2R69L 2Y5EA 4XB8A 1X5LA 4UIKL 1ZHNB 2MCG1 1T04B 3Q6GL 4DW2H 5HI5D 2BP3A 5CD5D 1UA6H 2LE9A 4PG2C 4DGVH 4XMPL 1EX0A 4RWYL 1IC5L 1WAAA 1WC7B 3BWAB 3I02B 3R8QA 43CAA 5ID0B 1SQ2N 4JREC 1UG9A 3WFDH 2LQRA 4F37F 3JUZA 4XP1H 5DHVH 2Y5TB 3HAEH 4S0SD 5IMMB 4JGMA 5TH2A 2CO6B 3U4EB 4O51B 1T6WA 1YNLL 4K3JL 3AXLB 4ELMB 1FNEA 2HWZH 1IKNA 1NC4B 4I4WB 1BVKA 3NFSH 4MAYA 5HVWA 5ADOH 3BVNB 3V52H 3ARDD 3SDYH 1OPGH 3PWLA 1K8DB 2R29H 2CKBB 3HNSH 3RKPA 3QT2A 1RK0B 2AKRA 4JO3H 2NY5H 1DLHB 1DP0A 1QA9B 5GGSB 2FJHB 3MV7D 2W0FA 1AXTL 1AP2A 2AJXH 4G6JH 3S35H 3SCMB 4OSUH 5C0DA 1QSFD 2BJML 1J12A 3ARZA 2WBKA 4JRXA 4AENA 2B1HH 3QJFA 4IEFB 2XT1B 3DYOA 1S8DB 4MJIE 4ODHL 2MHAA 1RPQA 1P84K 2JK5A 3GMQB 1F4XH 2R9HD 3O8XD 1GAFH 4N1EA 3W9DA 2DYPD 3S88L 1XIWD 1UH4A 2OZ4A 1I9IH 5JIIA 2BVYA 1X4ZA 1NAMB 3M07A 2JELH 4Y8DC 3EDEA 5LXGH 1XAUA 1GGCL 4QRRD 2KUTA 3FKUS 3V5KB 4K94H 2FZ3B 5GISH 1OY3B 1HE7A 3DETD 3QI9B 3KPOA 2BNQB 3P4OA 5JXEA 3P9MA 3GNMH 3VXQA 3NACH 3GHEH 3MV8B 1UKSA 1FAIH 2Z91B 3BN9D 2EDTA 1BIIA 3HKFA 5F7WC 5J12C 4U49A 2R23A 3RGVD 3MRNB 4NO0D 4CAGA 2UVFA 3D87B 3U7WL 5EU6D 4OV5B 2H8PB 3KPLB 3DX8A 2Q76A 4GH7B 2FX8H 2Z35A 5IM7A 2DQIL 4RRPG 3EJZD 2FYYA 2ZUQB 1JGVH 1CT8B 1BAFH 3MGOB 3ILQD 3L5JA 1S3KH 1G9MC 1UCBH 4MJ5B 2P8LA 4JQVC 1HH9A 1C5DA 5E03A 4OAWB 1MCKA 1HIMH 4RBPK 5H94A 2X1PA 2EO9A 5C8JB 4Y5VB 2I5YL 3CCHB 5DD5H 4LHUD 5DRZA 3WIIL 5EZIH 5ESQA 1J88A 2HLAB 4KJWD 5KANG 5E2WL 5C08B 1RJLB 1JGUL 2CJUH 5I8EA 5IB1B 3QEGL 3S8WA 3CX5K 3L6FA 5GGQH 2P48B 1IGJA 4JY4A 4HCRH 3HZVA 3TBWA 1YN7A 5HY9A 4CW1B 3NAAL 4LMQI 2D7NA 3WIFB 4Y4KA 3TESA 1WBYB 1OW0C 1FVCA 2MSPA 1EERB 2A74A 1YYLH 1RJZA 1S7TB 2PO6B 2H32B 4I0CC 5IB5A 1FFPA 2W59A 4D8PA 1KCVH 4XI5D 3DHMA 2F8VA 3OXRA 3LEVL 3GJFA 2XZAH 5GGVL 4K71B 1MHCA 1FZJA 1BPVA 4M6OH 2XKNB 1MJJB 3OX8B 2YWYA 4LKCB 1CFVH 1CD0A 4P4KC 3V0VA 4KTEL 2CLVA 4NKOA 2YS4A 3N1PC 1S78D 4XP9H 3SDAD 2A6KA 4NQVB 3CVHA 4PREA 3PG2A 3VFPA 1F6AA 3LMJH 5IWLC 3RDTB 3STLA 2Y25A 3D69A 1A6ZA 4QNPF 4IMLA 5JNYA 4S1RH 3G9VA 4Z77A 3B5GA 5F7EL 5KZCB 4UU9A 2VL5B 5J57B 1MREH 4QNPE 2X4UA 4V1DB 2XY2A 3UTPD 5EU3A 2C5DC 3WNKA 2CMRH 2E9BA 1VDGA 3QDGE 4HPYH 5E2VH 3L3KA 2Y6SD 1S9XA 5SX5K 2NW2B 4YHMH 3CIQA 5F89A 3G9AB 4K3DL 2P44B 2XOTA 5GQBA 2YD6A 3FAWA 4JKPL 4WW1A 1V7ML 1TJGH 2EEDA 3EO9H 2Q86B 4YDKL 4GRMA 3K4AA 1FNFA 3HMWL 4D9QD 3KXFD 2DQDH 4NSKB 3NCEB 2AJ3B 1INQB 3CZFB 2CIIB 2CIKB 1G7HA 4JDVB 1K5NA 1CGWA 1KIQB 1SYSA 2QKIB 5JDSB 2A9ML 1BMGA 4KKNA 5JMRA 5DRWB 1LILA 4PRPA 4F2MA 1A6WL 3BP5B 4J4PD 2RQ8A 4NQDA 4DVRL 1WZKA 1RZKH 1WZ1H 1ZHKB 3LQAH 4PRNB 1IEAA 5AG8A 3QA3B 1EHLL 5C92A 4C56D 1AGDA 4RIRB 3HPLA 3RPIB 5DD3L 4EDXA 3VXRE 2YEZA 4H25B 4U6YA 5K9JL 1RZ8A 2AEIT 2GUOB 5ICXB 1IAOA 3NCJL 5EFIB 4D0CA 1QFHA 5JHDD 1FFRA 1KSRA 3GMMB 4YC2B 4G8GB 2P42B 2XXMB 3DTXB 1I1AC 3HB3D 1ZLUH 5IFJB 3Q1SH 2IAMD 2C1OB 5ABDE 3DMMC 3RAJH 2FX7L 1KEMH 3IDIB 5F1NB 5AAMA 5HYQA 2VR9A 3M1BA 3BPNB 2CXKA 3G5VA 3HC4L 4D9LL 3OWEA 1HHJB 4RISL 1LK2B 3D39A 5L2KA 1FNGA 3SGDI 1TZGL 4AL8L 4G7YH 2H26A 5LQBL 3VXUE 2A73A 4Q2ZA 4NGHL 2IH3A 4JRYA 3QP3A 4WV1A 1XGTA 4KKBC 5TE6H 4JFFE 1CD1B 4MQTB 3SPVA 1DQJA 3VD7A 2ESVE 3ZYJA 3T0ED 3MXVL 4LSPL 4W68A 5EBMA 3UYPA 43CAB 2B2XL 4XP5H 4EQ3A 1MHPL 4HEPG 1KLFA 1FNSH 3EJJX 5BW7C 4HGKC 4L4JA 3QFJB 5TH2B 4QLRA 3C5ZB 2BRRL 2DQUH 3GBNL 1PDKA 1TNNA 4KMQA 2NXZB 2D03L 4ZO6A 1IC7H 2Q6WA 3V9FA 2VDQL 1BVKB 4MAYB 5D1QD 4LRNL 1OAZH 4P5TB 1A1NA 4ETYA 3PWLB 2YMXH 3KPQA 4JN2A 1FV1B 2VUYA 1KCSL 3OF6A 3FOLB 4P9HH 5F9WC 3VGHA 3VXSB 4BFIA 3ULVF 2AKRB 4JZJC 4NZJA 3DUHA 3L5WA 4OLZL 3HMXH 1EZVX 3PXHA 3ULVE 5D72L 4F57H 1JNLL 1B6DA 4ELKA 2W0FB 1AI1H 1AP2B 1BJ8A 2YPLB 1E4JA 1I9EA 4LFHG 5DQJA 4C54A 4PRHA 1N7MH 4AENB 3BRFA 2NX5D 4ZUUB 2BC4A 3QJFB 2I9TA 4XCEB 1I4FA 5J6GB 1U2CA 2MHAB 5CEZL 3BKCL 2JK5B 3V6BR 1ZMYA 4EUPG 1KPRA 3IFLL 4DKFH 5EU5A 3VFOA 3EIFA 1NMAH 4PTTA 4F7TB 3OZ9H 3H42L 1AKJB 1JUFA 4XVSL 3K4ZA 4DFHA 4D9RE 3RPKA 3KPOB 4N0YH 4G6MH 5LJYH 3P4OB 3ZKNC 3VXQB 1QBLL 5J13B 2VZ3A 1OGAA 1CL7H 3ARRA 3EDFA 1BIIB 1SMOA 3FB8A 1SVZA 3MMEA 3DX8B 4HUXA 2DQCH 2Q76B 1J0JA 2MQ3A 2HRPL 1OWRM 2WLYA 2FYYB 1FP5A 3NABL 3TA3D 5I6XC 4IJ3B 2P8LB 4LCCA 1HH9B 3QR2A 4P3CH 4FQXA 3STZB 3DI2B 2C1PA 3M8OL 3CVIL 5FCUL 5H94B 3OL2A 4JRWA 1CLOL 5F9JA 5DRZB 4Q9QH 1PLGH 4RNRA 1IT9L 1DANT 5I8EB 1EFQA 1RZGA 4IOFD 1SVCP 2NY6B 4LAQL 1EJ6A 3PWJA 3L6FB 1IGJB 4JY4B 2FO4A 4MQXC 1I75A 3HZVB 1D5IH 5DXWA 1YN7B 5HY9B 1J8HD 1GH7A 2F9BT 2UZYB 3MLUH 4Y4KB 4OB5L 1FVCB 2N7BA 3ZDZF 4NKDA 4I48A 1PKQA 2A74B 1V3MA 2AJUL 1CD9B 3VG9C 3ZHLA 4JFHD 1LMKA 3BDXA 1J1OH 1FFPB 4PJXE 5EA0H 4LOUC 3CFDA 3CFCL 3GIZH 3VH8G 3OXRB 2V5TA 1MHCB 1FZJB 3U7AA 3UTTE 2KH2B 4U6TA 3G6JF 4IOSD 4IRZH 1L4IA 3V0VB 4NKOB 2CLVB 4HAFA 3VGGA 5FOJA 3CPLB 1B0GA 2EDFA 3G6JE 3WKMH 3CVHB 4PREB 3VFPB 1F6AB 3TN0D 1U8OA 1QYGL 1XIWA 1FC2D 3WV0A 1XGPB 3CX5J 2FEDD 3FQWA 3HG1D 4OF0A 3QPQD 1A6ZB 5JNYB 1UH2A 2DWDA 4Z77B 3RGHA 4UU9B 4KRNA 2IBGA 3MCLL 3O9WD 3ZTNL 4YDLC 5SX4H 2X4UB 5DJCB 2ZOLA 3QCTL 1DUYA 2Q1EA 4PGCA 4KJYA 1S9XB 2BNRA 3LKPA 4K7PL 4TPRH 4UV4L 5F89B 4E41D 5EU6A 4NC2B 4PV9B 3WFBL 1AJ7H 1T5XB 5DHVA 5TGBA 4ONGL 2BXYA 2FNBA 4JFXA 5DK0A 4X5XA 4KDVA 4JQXC 4JFQB 5DJAB 1G7HB 3BJ91 4LSTL 1BLNA 3EZJB 1K5NB 2W9EL 3Q5OA 4H8WL 4OZGF 4ZS7L 3HC3L 4M6NH 4DTGH 5D1XD 2NLJA 4OZGE 4NBZB 4RGND 4ELMF 4F2MB 5DURD 2VDRL 4OCXL 4R2GD 4LHUA 2XV6B 4NQDB 4ZPVA 5JUEH 4ELME 1WBXA 1J0YA 2IBZY 1IEAB 2ZZUT 4HGWA 3EHBC 2OL3L 1AGDB 5C0CD 2B39A 3QB7C 3MCKA 3IAPA 1E4XL 3HPLB 3VU2A 5CSZA 1IGML 2EICA 4J3XA 5E0QA 2WWMD 2X89D 3IXAB 5E8DH 4EDXB 2YEZB 5GRJH 4MNQA 1CU4H 4Y16D 4U6VL 3UO1H 1FL5A 4KJQC 1D5XB 1I7UA 1N3NA 1HXMA 1S7UA 3MNVB 4HKXA 4M00A 3U0TB 2XWTA 5KN5A 5E5UB 4IIQC 1IAOB 4D0CB 2JLLA 1HSBB 2QQKL 2OBGA 1JWUA 5FHBH 2B4CC 1PZUB 2QSCH 2R0ZH 3CDGA 5CLTA 4O9HL 3SE4A 4W81A 5CJXC 3GSNL 3MZGB 4X6EB 1L7TL 2X7LA 4NJ9L 4NQXB 1IBGL 3K80A 5HYQB 2BOBA 4UDTA 3M1BB 3G5VB 3SDAA 3STBA 5BV7H 2Y36H 3BKMH 3U46A 4O4YH 2BERA 1FNGB 2G2RA 2NR6C 2PW2B 4KRPB 2R4RH 2A73B 3IFPA 4Q2ZB 3RVUC 5DUPH 1AXSB 5LGJB 4OUOA 4WV1B 5C2BL 1XGTB 2Q3ZA 4NUJA 1CR9L 3D48R 4O02H 3SPVB 1U3HD 3CDFA 2YKLH 4KZDL 3RI5F 2IGFH 1SEBB 3ARBD 2MKLC 4LQFH 4JJ5A 3RNKA 3DWTA 4XNXH 3LZFH 4AMKH 4X9GA 3SE8L 3OGCA 4PRDA 4UIMA 4K7FB 1Q9WA 5SX5H 2D9CA 4I5BA 1F4HA 2Q6WB 4OFVA 3KXFA 1BHGA 2FATH 1DANU 3W11C 4ORZC 4MCYA 1JK8A 2ZUSA 1AD9B 3QDJE 2XTJB 3B8YA 1Z0MA 3KPQB 4JN2B 3ET9F 4PBVC 3T1WA 5ICZB 4HCRA 4R4FH 3QDMA 4BFIB 5MHSD 5F96H 1C16A 4CU8A 2Z9TA 3OTTA 3L5WB 4J4PA 4OGAD 1RK1A 4H26A 3BSZH 3TJHD 1RMFH 5DYOA 4ELKB 3CU1A 5I76A 4HS6B 3IDYC 4GT7A 2EEBA 1HH6A 1T0PB 1BM3H 2JJVA 1HILA 4PRHB 4WO4C 4F9LC 4XH2A 2BC4B 3CSPA 2BY1A 1I4FB 1CDCA 3UZVB 1B9ZA 3SGJA 1QFPA 5EG6C 4QXTB 3VXMA 1KPRB 4M62L 4Z18A 4OI7A 4R90H 3EOTH 5EU5B 5KW9H 3VFOB 4PS4H 1TVBA 3C60A 1CBVL 7FABH 3FN0L 5GGSY 1TIUA 2QADC 4PG9A 4OZHB 5EOCJ 4M7LL 1HKLH 2ICWA 4P2OA 3D3VD 3AB0C 3CFBB 2VABB 1TETH 3B2VH 3AM8A 4OLWH 2VDKH 3DURA 4XAKE 2J8UB 3RWIA 3FB8B 1MLBA 3TV3L 3MMEB 5E70A 1ZAGA 4QRSB 3ISWA 4S11A 3MLRH 3OBAA 4HUXB 3TH4T 2K7QA 4TSCH 1F4YL 2E8YA 5GJSL 2YUXA 1S7QA 5IHBA 3C6LD 3OR7A 3B2UC 1AGCA 4LCCB 2I24N 3T2OA 4IOIA 4NWTH 1MH5A 1WIOA 5B38A 1T0MA 4HPOL 5C0BA 3QEHA 3GDBA 5F97E 2A6JA 1Y6MR 5F9JB 2ZUQC 1JZ5A 4NNYA 2RB8A 4KK5C 2COQA 5CINL 1CFBA 3KDMB 4HIIA 5F7KC 1RZGB 3BPLB 1KBGH 1TJHL 4JG1H 1DZBA 3PWJB 1UM5H 5E4EB 3IKCA 3FJTA 3GM8A 2FO4B 3ARDB 3NCBB 4ZAKC 5E9DD 2KBGA 3MC0A 1GGYA 3FT3A 1CDGA 4I48B 1PKQB 2HRLA 4X8JA 3ARXA 4LVNB 3MRMA 3WO3B 2ZG3A 1J1XL 1A4JA 4M7ZC 3SDDC 1RURH 1JHKL 4Y2DA 6FABH 1GGUA 2YSSA 3CFDB 3BMVA 4ONFL 5I1IL 2V7NA 5HPMB 1QSFB 3LEYH 1T2XA 5I1JL 1B0GB 4EUPH 5L2JB 1E4WH 2D7TL 4KY1H 4I9WE 5EBGA 1U8OB 1BP3B 2ATPA 1XIWB 5JOFB 1TJIL 3FQWB 4TUKL 4R7DA 5FGCB 3S37X 4G8GE 3BX7C 1CG9B 1TZIA 2DWDB 4HQQH 3FO1A 2Z31C 4K23L 3REWA 1JPSL 3MYJA 5DMJB 1CXIA 3PGDA 4NZTL 2GFBA 1ZSDA 3KPPA 2ZOLB 5DJ0A 4PGCB 2BVPA 4KJYB 1EO8H 3T4AA 4NO0B 2BNRB 1F3DH 3LKPB 3W2DH 1J7VR 2YC1A 5HDBF 4WUUA 1KPVA 3T1FB 2DICA 1DQTA 3AY4C 5EU6B 5DC4B 2NPLX 3G5ZA 5HDBE 2BVEA 1WTLA 2JKXA 5IGXL 1NBZB 3DO7A 1C1EH 1DBAL 4JFXB 1OTTC 3BN3B 5DK0B 4X5XB 5HVHB 1CE6A 2G9HB 3HZKA 3B9AA 5FYLD 2XNAA 2MOVA 1JGLL 2CXGA 4S1DD 2VZUA 3P40A 4KUCD 4S1SH 1VGKA 1XGRA 2NLJB 3QPXL 3AGVA 1MPAL 3QFJE 2GK0A 3TEUA 4LHUB 4G3YH 2FJGA 3DO3A 1ACYH 3MXWH 4P4RA 4ZPVB 4QGTA 1WBXB 3L1OL 4KHTH 1WWWX 4HGWB 1NGZA 1J10A 2UZXB 3EOBA 1A1OA 1YMMA 3FL7A 4K3GA 2DKMA 3CGTA 5JQ6H 2CRMA 3WYRA 4JQIL 3UJIL 4UT6H 5DVKA 4MX7A 1U8KA 3I6LE 4N1CA 5CSZB 4JFEA 1T1YA 3E6FA 4Z7UB 5BOPA 3VXSE 3RZCA 1FL5B 1DN0B 1S7UB 1HXMB 4HKXB 5IK3A 1SBSH 4UNTA 2XWTB 3EYUL 2PYED 4HFUL 4K9EH 3Q5YA 3QH3A 4I3RL 2YPLE 1JWUB 1BFOA 4KAQH 1F90H 4XC1H 3HI6H 3CDGB 4G8IA 4W6WB 2EC9T 1G6RL 3MRGA 3ULUL 4N8CH 2X7LB 3QEQA 5BMFH 3NIDF 4GLRI 4NHCH 2P5WA 2DLFL 4NKIH 5HYSG 1EO7A 4UOJA 2BOBB 4UDTB 2WSKA 3HE6C 5IG7B 3SDAB 3NIDE 4KGLA 1IAII 4JPKH 4KZEL 3PL6D 3U46B 2FL5B 4ONHA 3UZQA 2BK8A 5CUSH 1GPOL 4EDWL 2DQGH 4QXGH 3QZWB 3HG1A 3IFPB 3RVVD 1CICA 1DQML 1ZEAH 4ZOBA 1L0XA 4XP4H 4OGXH 4NUJB 3WLWD 5E24E 4LPYA 5GIRB 5C71A 3BPNC 4BZ2L 3U1SH 1MLCA 1H5BA 1KN4H 4NQTA 4J6RH 4KQ4H 4HG4J 3VFTA 5CSGA 4JJ5B 3RNKB 5I19L 1EV2E 1LO5B 3P11L 4H5SA 4GG6F 3OGCB 1GOHA 1RZ7H 4L1HA 4PRDB 4UB0L 4UIMB 1TLKA 3VXOA 2XA8H 5DJXA 5IHUL 3QQ9C 5ALBH 3BRGC 4WDIB 5CJOH 1X4XA 4U1JA 4EXKA 1T80A 3N1FC 2YR3A 3KXFB 2XZZA 5JW4N 4MCYB 1JK8B 5ISZA 1H0DA 3F7QA 3EJYD 5TFSL 2XN9A 1NH6A 3QDMB 2XWJA 4JVUA 5GJTL 4LLYB 5GGUA 4ZFGH 1C16B 5TJWK 5KSUA 1JF1B 5L8KB 1GGIL 2DQTH 5C0AA 5KJRH 2NY1D 1RK1B 4H26B 3VWKD 3REVA 2AEQH 5KSBF 4C56B 3F5WA 1J87A 5E95B 5C0CA 1HILB 5DVMA 5KSBE 4XVJH 4XWGH 4XH2B 4APQD 4U7MA 1BWMA 1FC1A 2ZCKL 3I9GH 4UQ3A 3RVXD 3S36X 1NANI 4Y16A 1M7DA 4XCNA 4GQ9L 2ENSA 2R1WA 5F1OB 4PJ5D 3VXMB 4E5XA 3MACH 2R56H 4AIZA 1TVBB 3QRGL 3HRPA 3C60B 2P5ED 4NWUH 4D3CL 3FO2A 2BDNH 4ODVH 2O5YH 5B8CC 4X4XA 1LNUA 2YA1A 2YXFA 4P2OB 3HE7D 1N0XL 4U1SA 1MFAL 4X4MA 2WLZA 3MPCA 3RWIB 3CFJA 4KI5F 1BJ1H 4XX1E 5ACZB 4ZXBD 4KI5E 5T5FL 4KWUA 2VC2L 3IAQA 2MQ0A 1S7QB 2FH6A 1R3LA 4CRPA 1U3HA 3OR7B 3T0EB 1FE8H 1ETZB 4JJHA 3A0OA 4NNPH 1AGCB 2NYYC 1MVUB 4PJDA 4IOIB 5TQ0L 1P5UA 5B38B 1QNZH 1T0MB 4LSSH 4OF6A 3QEHB 5ENWA 4V2BA 3HA0A 4GMSH 2A6JB 3MSPA 1NEUA 4MD0A 2DKUA 3NZHH 4LLQA 3X3FH 3JWOL 2D4DA 2H2SC 1T89C 4Y4HD 2X4TA 2MPAL 4YBLB 5INDA 4HIIB 1LEIA 4M5ZL 5DVNA 3SDXA 4M6MH 3KPSA 5HYEA 5D1QB 5A1AA 4GXVH 2AK1H 1CXFA 3FRUA 3T2QA 1OAXL 3C8KA 3FT3B 4X8JB 2JCCF 1FFOA 1IAKA 1LWRA 1X7QB 5EOQL 3MRMB 3C2SA 1YEFH 2JCCE 2QQQA 3OR6A 1A4JB 1K4CB 4HAGA 4BSWA 4OIIL 1KN2H 4Y2DB 1DVFA 4FP8L 1VSCA 2X1QA 1IGFH 2YSSB 3JV6A 4G8FA 3MOAL 5B39G 2LTQB 1A7NL 2V7NB 1EA9C 5C7XL 5BVJA 1RUQL 1PQZA 4QRTA 1O7SA 2EC9U 3WDJA 1CE1L 3VG0L 2X44D 3QG6B 3ZE2F 2EECA 4OLYH 1J11A 1QFWI 3NA9L 3UTSA 4WFGE 3ZE2E 4Z0XA 4JO2H 5FO9B 3BD5A 2ATPB 3ROLA 5KSAC 1UWEH 5GGRA 4X7DC 5C3LD 1U8MA 4DQOL 4R7DB 3FO1B 3LPGA 2ID5A 1MWAB 2CLRA 3REWB 4LDEB 1U8LA 3MYJB 3PHSA 1AIFA 1G9NL 1SJHA 3PGDB 5T1KA 5I75C 4TSBH 5IVNA 2GFBB 3KPPB 1M4KA 1QFOA 5DJ0B 2DD8L 1IQWL 3RA7L 1EIBA 2GW5A 3T77B 3T4AB 5CHNA 4ZUSA 2DQHL 1EK3A 3IKKA 3ZO0A 4WUUB 3AS2A 1KPVB 2QQNH 3LKSA 4NQCA 5J89A 4OCWH 1AFVL 3DO7B 3UPAA 5IHZA 3O2VL 2YWZA 3H9ZA 4QTHB 4YDIL 1HOCA 4OUUA 4Y4FC 3HZKB 3TA3B 2JJWA 4DEPC 2XNAB 4LDOB 4Y1AD 4WY7L 3VRJA 1VGKB 1XGRB 5BS0D 1FYTD 4N5EC 3S35X 5DR5L 5K9QI 5HVGB 5K9OA 2IPTH 5IMKA 1ZGLB 3E1F1 2V6HA 3PDDA 1MRDL 2W0KA 1WLHA 1IFHL 2FJGB 4P4RB 4UZGA 4PUBH 1YJDC 4HXAL 4XBEL 4Y19D 1RIHL 1BFSA 4AT6B 4HJGA 5IBTH 5EU4A 5FYKL 2J8HA 2PF6A 1RJCA 1NGZB 1KT2A 3EOBB 3WFEH 1A1OB 1YMMB 2B1AL 2PW1A 2FWOA 4MX7B 5LWYH 3BEWA 1U8KB 2R69H 4FTVA 2VR4A 4P3DA 4UIKH 2V5YA 5DD1L 3BQUD 4HUUA 1T1YB 4JFEB 3Q6GH 4PLKC 3E6FB 1NEZG 4P2QD 3RZCB 4E42A 1JPTL 5HVFB 2AXJA 4JE4B 4XMPH 4PRBB 4RWYH 1IC5H 2AJYL 4TVPL 4HD9A 3QH3B 2F53A 1BFOB 3NZ8A 2EC8A 3MRGB 4PRHE 3BIBX 3MRKB 3QEQB 4JHWH 3HUJA 3FONA 2P5WB 2BY2A 4FFYL 1SJVA 4K3JH 1LD9A 1RSFA 4RMUA 3MREA 3ZTJG 3S4SA 2BFVL 1MAJA 3GEWB 4ONHB 4NM4H 2VLKE 1R3KA 2X9WA 3FRPA 4HJJH 5D7IF 3GMPA 2CK2A 1JJUA 4M4RA 3HG1B 4PJEB 4OZHF 3DLQR 1QSEA 1HQ4B 1LEGA 2V17L 4PRID 5IUSA 1CDJA 2V2WA 4OZHE 4XCFL 3O9WB 1CXKA 1UKTA 2J8UF 4XXCA 2E27L 4KRPC 2CO7B 3VFTB 1ZLWK 2J8UE 1AXTH 1RUAL 1V7NL 4DJMA 2IADA 4H5SB 4WV1C 1J05A 5FYJU 2WZPD 2RR3A 2VDLL 3PHOA 2BJMH 2PR4L 5BRZA 1EEYA 3L5HA 3VXOB 5DJXB 1YEEL 5CMAA 1BBJA 3FT2A 1NLBL 4U1JB 4ODHH 5D2NB 5CJBA 3VXPA 5E1HB 1DQQA 3DGGA 5I18L 5ISZB 4KTDL 1TDQA 3RWDA 1H0DB 3S88H 4XB7A 4X6CF 5SWQA 4CBPA 3SDCD 3PXJA 1IGCL 4YK4B 5FDYA 2XN9B 3WHE1 1GGCH 1HEZA 1Q0YL 5ANMA 5D1XB 2XWJB 1OLZA 4X6CE 3DECA 5TDOA 1YY8A 5GGUB 4RGNB 1RJYA 1NGPL 5DURB 4R2GB 3FT4A 5D1ZA 3QNXA 3QSKB 4CVZA 2Y9RT 1OD9A 5DTFA 4ZFOA 2IBZX 4XGZA 3MRIA 3REVB 1VKXA 1UM4L 4W6YB 5IW1A 2XTJC 3KPNB 4HWBA 3F5WB 5C0CB 4UDUA 2VISA 1INDL 3U7WH 5C09D 4P46D 5IMLA 4LCYA 4UQ3B 4Y16B 2DQIH 4G42B 3KYKL 1JHTA 4X7TA 1CK0L 3MRQA 2IG2L 5FUCC 4PV8A 4Q9BA 3MV7E 4AIZB 2VH5L 2W65A 4OD2A 1FO0L 3FO2B 3D2UA 5GS0C 3JSSA 3WE6A 1KXTB 3RQ3A 1QSFE 3PGFH 2I5YH 4X4XB 3WJLA 3WIIH 4JKKA 3LQMA 5E2WH 2UVEA 4U1SB 3U9PL 1H8NA 4QXUL 1X44A 1JGUH 5DVLA 3W9EB 2MJWA 3HZYA 4HUWA 4WWKD 4XMLL 5C0FB 1EFXD 3CFJB 5CZXD 1C5CL 5ICYA 5D2LA 3SE3A 5E6YA 4EN3D 4JFZL 1G84A 2WQ8A 3WLBA 4QRRE 2IJ0C 3NAAH 4R6UA 4UT7L 1QBAA 1NUGA 4RFOL 3EW3B 1U3HB 4PD4J 5HHOD 4JVPA 3ARBB 5A2FA 5CKGA 4PJDB 4IDJL 3R06B 4RFNB 1EAPB 5ENWB 1IAIL 3QNYA 3LEVH 3F7YA 5GGVH 4U1MA 2HJLA 5FB8B 2X4TB 3T0AA 4KTEH 4KQ3L 5INDB 4N0CD 4U2YA 3OKOA 4FQXC 3SDXB 3RVTC 5F1SA 1E27B 3BYYA 3FRUB 4L9DA 2CK0L 1N6VA 5IB4A 1FFOB 1IAKB 5F7EH 5FAAA 3WS6A 4ODXA 1CLZH 3KVQA 3MYZA 1F8TL 3UTZA 1YECL 4BSWB 3VWKA 2FBJL 3RX7A 2XPGA 2Z8VC 3JV6B 2APXA 2OR7A 4G8FB 4Z0BL 4C4KO 1O5DT 3VH8A 4RMRA 4Z7UF 5BVJB 4PIRF 3GSUA 1PVHA 4K3DH 1PQZB 4QRTB 2RGSA 5I66A 5JIPA 4LVNC 2X6MA 4Z7UE 4JKPH 4APQA 1M71B 4ZNEE 3UAJC 1VENA 2ZNXA 3UTSB 4YDKH 4Z5RB 4Z0XB 3PABB 5MI0B 1ORQA 3HMWH 1WWAX 3ROLB 5B4MC 3IDMB 4YHZH 5GGRB 2N56A 3EYVA 1U8MB 5T3ZD 2ZCHH 1R5IA 4CKVX 2A9MH 4BQBA 2CLRB 2LV4A 1U8LB 5J06A 1AIFB 1SJHB 1A6WH 3RL1A 4JPVL 3HE7A 2YZ1A 4G6KL 4N8VA 3FQXA 1EHLH 5CHNB 4ZUSB 4OQTA 1FIGL 4RMSA 1HHHA 1XCQA 3LKSB 1EXUA 1KGCD 3OSKA 4NQCB 3P2TA 5DD3H 5C0NC 4CADA 1B4JH 2IH1A 5JOEA 2K3TA 1WTGT 4MQSB 5K9JH 2KQMA 3C6LB 4OUUB 3BH9A 1F3JA 4RMTA 1P6AB 3UTPE 3NCJH 4Q6IB 4RDQG 5K9OB 1ED3A 4OM0H 4F7MB 5JLZA 4UOW1 1KB5L 3S96A 2YPVL 4J3TA 4Y4HA 2FX7H 1H3GA 1IRAY 3WS3A 1KT2B 1T1ZB 4LLVA 4D9LH 4O58L 1A47A 4D9QE 3KXFE 4RISH 2EDEA 5IROA 3S36L 2FWOB 1IAMA 4LGSB 3UYOD 2BVUA 4AL8H 1TZGH 4FTVB 4P3DB 3LHPL 4HUUB 5LQBH 1NSNL 1FORH 3MR9A 4NGHH 4PJBA 4KKCD 2HFEA 4MNGE 4F9PC 5KG9B 2AXFA 3DPBA 3VW3L 4CJ0A 3B6SB 2NY5C 3MXVH 3MCG1 1YQVH 4LSPH 2B2XH 2F53B 3LH2L 3IU4L 3V2AR 5E4IA 4C56E 1MHPH 2Z8RA 4PYHA 3MOBL 3NZ8B 4FXLA 3HUJB 2BRRH 3GBNH 3BUYA 1YEKL 4OCRL 1LD9B 3MREB 4XMKL 2D03H 3TM6A 4GKNA 3S4SB 1JRHI 1TNMA 3EGSA 2VDQH 2VERN 3GMPB 5IW6A 1H3WM 2XXCB 3D25A 4LRNH 5JHDE 3SE4C 5GRVL 1QSEB 1LEGB 4K94C 3KR3L 2V2WB 3ZL4L 1X5FA 3ALWA 3BO8A 4MJ2A 1DN2A 1D5MB 4EI6A 4JCMA 5DMIL 3RRQA 4KV5F 5D72H 4BH7A 2PXYA 1JNLH 3TVMD 1SY6L 5A16B 4Z9KB 1QFWL 4I8DA 2YBRA 4KV5E 1NFIB 2EZ0D 5IV2A 1J05B 2NY0C 2NY2C 1NPUA 3BPCA 3PHOB 1EEYB 4KMTH 1RVFL 3WNLA 5CMAB 1XR9A 4PP2A 4ZG1A 3RTQA 3PQYA 3RWGA 3VXPB 5CEZH 3BKCH 1KELH 2P24A 3OGOE 1FJ1A 3T0EE 5E7FA 3DGGB 3O2DA 2O5XL 5E7BA 4ZSOB 5L9DL 3IFLH 2W9LA 3RWDB 1FLRH 5SWQB 4U3CA 1NFKA 4Y1AA 2YK1L 1D5BA 2OX5A 1HEZB 5ANMB 2HTKC 4LCIL 4XVSH 5TDOB 1YY8B 4PJ9D 1RJYB 1CD8A 4HS3A 4OLEA 3FT4B 5CD3A 5D1ZB 1QBLH 3QNXB 4CVZB 3ZDYF 5DTFB 5E1AB 4ZFOB 4XGZB 4U0RB 3MRIB 5FEBA 1VKXB 4KK6D 5IW1B 4ZTPL 2WK2A 4U05A 2J6EA 3GI8L 4P4KD 2XTLA 2VISB 5BQ7A 4DN3L 4WCYL 1T20B 3BQUA 1MFNA 3VA6A 5FIEA 5IMLB 1MQ8A 4LCYB 4WUKL 3D85A 2HRPH 2XKUA 1ZT7A 5MEQA 3NABH 4X7TB 4G9DA 3MRQB 1NGWB 4PV8B 2VRAA 3UPCA 4X9BA 4XRCA 3V8OA 2W65B 4OD2B 5IF0A 3M8OH 5I8CA 3CVIH 3WE6B 5DGQA 3SGJC 1CLOH 4N0FB 2NX5E 3ZTJH 4QRQA 3N85L 2B5IC 5K9KA 4KU1A 4UILL 2D7QA 4DZ8A 4NC1C 1AC0A 1IT9H 3HZYB 3PL6B 1NMBL 4LAQH 1NGYA 5ICYB 3WBDA 5D2LB 2R2HA 1CFSA 1FL6B 4Z7OF 3MGAA 4OB5H 2D0FA 1XZ0A 4Z7OE 3OQ3B 5HDLA 4HBQA 2AJUH 3S97C 3PUCA 4M7LT 2G75B 1S7XA 4RZCB 1OAYL 2CDEA 3CFCH 4GG8A 2AJVL 3QNYB 3PNWB 3HFML 1YUHA 3F7YB 4CMHB 3CXHK 3VRLF 4U1MB 1F11A 2AAVA 1JGDA 3QIBC 4GBXA 2R0KL 3VRLE 1XF5A 5DJYA 3WNMA 2V7HA 2ADFL 2FHBA 1GSMA 3OKOB 4IRSA 3TZVC 4GRLA 3KG5A 2YD7A 4ZQKB 3SBWA 2ATKA 2D7OA 4P57A 3RWJB 1P5VA 4JFDA 1QYGH 5TPWL 3EYFA 2HTLC 3BGFC 3OV6A 5IB4B 2Z93A 5FO8A 1F6LL 1VADA 2L4OA 3MCLH 1F97A 1S9WA 4P5MA 3JWDL 3VGFA 1N26A 3UTZB 3ULVL 1MI5D 2NY1B 3ZTNH 1RZKC 1J0KA 3KHQA 2BZDA 3LQAC 1I1AD 4KC3B 5D6CA 3QCTH 3VWKB 3NMEA 2EXYC 4P2CG 2F74B 3DMMD 5J4MA 2DQEL 4K7PH 4UV4H 3GSUB 1J8HE 3MV9A 5I66B 4APQB 3WFBH 4ONGH 4WTZG 2VLRD 1QR4A 3MRHA 2KKQA 1M05A 4L8SA 1BVLA 4JFHE 1ORQB 2VQ1A 4PJ5B 3MJ7A 5E56A 4M1CC 2OTWA 2M1KA 3LRSA 5GS3A 3LDBC 2W9EH 1K2DA 2P5EB 3K74B 1R5IB 4ZS7H 3HC3H 5GGVY 5HYJA 1EUUA 2PYFA 1JYWA 1MQKL 3KWWA 3RL1B 2VDRH 5GS2H 4OCXH 3OMZA 5LKNA 3HE7B 4X4ZA 4CGTA 1TZHA 3RFZC 4N8VB 2GYSA 3FQXB 4PJEF 5E00A 1U92A 2UZIL 3FB6A 2J5LC 1JHLL 2OL3H 1XCQB 3HG1E 4PJEE 4ZXBB 5K93A 1UVQA 3LN5A 1DUZA 1WFTA 1K85A 1E4XH 5E8EA 3VGEA 1MJ8L 5ESVA 3EZ8A 4UT9L 2EYTA 4L4VA 3N50A 5E94A 4U6VH 2R1YA 5B21A 3BH9B 5FV2A 1YPZA 3I3DA 4FNLL 4HDIA 5B3JF 1EH9A 1XGYH 5A3ID 5IEKA 2QQKH 1OSPL 5JLZB 4E41E 1E0OB 2X41A 4FMFA 3S96B 2VLLA 2BX5A 3GSNH 3TFKC 2VXQL 4NJ9H 1IBGH 4EI5A 3ABZA 4Y4HB 2A0LC 1KJ2L 1INEH 3DVFA 3SJVA 3WS3B 3FFCD 5D2NE 3L3GA 4LLVB 3SHSA 3VI4F 1UZ6F 3HNTL 3I84A 4MB3A 1RFDL 4NO2B 3VI4E 1UZ6E 2EIZB 3MR9B 4HT1L 1NKRA 5F9OH 2M8XA 4PJBB 5C2BH 32C2A 2HFEB 1JN6A 4P9HC 2AXFB 4RGNE 3B3IA 4XXDB 1PKOA 4L8DA 4KZDH 2X1XR 4NQED 5IP4A 4YWGL 1VFAB 3ILPB 3VFVA 3ZKND 3MFGB 5C0CE 1FHGA 1OQXA 1E6JH 3OHXA 5ITBL 5D5MA 1OLLA 3BUYB 4YZFF 3VD4A 1X5ZA 1BQLL 4MSWB 1PYWA 1OL0A 4MQ7A 4YZFE 4PJ7A 3EGSB 3LD8B 8CGTA 5IW6B 1C08B 3D25B 2W0LA 4JM2D 5DK3A 5EC2A 2IPKA 4JB9L 1VACA 3ARTA 3MRRA 5HGAA 1U9KA 3CH1A 4NT6A 3BO8B 5CP3H 5EBWA 2RHEA 1I3UA 1NCBH 5SWZD 3QUML 3V6OE 2C3VB 2IANA 1BOYA 3H6JA 4BH7B 2PXYB 1FN4A 5DC9B 2V2XA 4Z7VA 1CICC 3FQRA 2YBRB 5IV2B 1P7QA 1RHFA 4JCLA 5DJDB 3BPCB 2JF1A 2ORBL 3VFUA 1H5BC 2BXZA 1DQLL 1XR9B 4PP2B 2ITCA 5FM5M 4MQXD 3PQYB 4L3CA 2JE8A 3RWGB 4EJ1C 2P24B 4C57C 1KEGL 1EHXA 4A2MA 4M62H 3MRCA 1IARB 4AM0A 2ADJB 3GRWL 1G7MA 4Y1AB 1D5BB 1FYTB 1RZIA 5BS0B 1BBDL 1CBVH 2F15A 3FN0H 1MRCL 1QPPA 5KAQG 3ECBA 3N1GC 3QQ4A 1F4WH 3SOBL 1NCNA 3FFDA 4M7LH 3SDXF 5CD3B 1NGXA 2R4SL 1JWSA 4C58B 3AROA 3IU3A 3SDXE 5CLWA 1WVZA 3W5MA 4HULB 3TV3H 4WI6A 3G5YA 5BQ7B 2VN7A 4EOWL 4PJHB 4LK4A 2CKBL 2X2YA 3BQUB 1H3PH 3QJHA 4A6YA 1AGFA 4Z7WF 3WHXA 1F4YH 5MHSE 5IESL 5GJSH 1ZT7B 2O61A 4IDLA 1KB9J 2X5PA 1HCFX 4Z7WE 4JLRA 1R24A 2VE6A 3WUWG 2LU3A 1UQSA 4QGYA 4XRCB 3IF1A 5IF0B 5I8CB 4HPOH 3QHZL 2VAAA 3GIVA 3SGDH 4QRQB 1SEQL 5K9KB 1XF4A 2J4WL 4X7SL 2HT3C 5CINH 4DZ8B 2F54A 1NFDF 4XPTL 1NGYB 1NAML 2GT9B 1MCJA 1NFDE 2R2HB 1CFSB 2KDGA 3Q2CA 3TYGL 4FQJL 5A2IH 3C8HA 4X7EC 1XZ0B 3O3DA 1N0LA 1ACZA 4YFLF 2GCYA 5CILL 1OT2A 3WIHL 3D3VE 5DUBA 1QFUL 4WFFD 4O2EA 1J1XH 1WITA 1L0QA 1S7XB 1JHKH 4ZO7A 2ICEA 3VFGL 1ZA3A 4LCWE 1W0WB 1GZPA 4ZS6C 1JRHL 4ONFH 5I1IH 1J5OH 2FD6L 4R8WL 5DEFA 1F11B 1A7QL 1E4KA 1W8NA 4ODTL 2R0LL 3EHBD 1PW3A 1A6UL 5DJYB 5I1JH 5HD8C 2GJ6D 4IRSB 4RMQA 5D7LD 1IGIL 1ES0B 2D7TH 2ATKB 1U95A 4P57B 4DFIA 3KPRD 1UADC 3S3SA 3FN9A 5C0JA 1A14L 2AK4A 1TJIH 3EYFB 4TUKH 3DXAA 4I0PA 4KJQD 2P49B 2YXMA 1U42A 3RVWC 5KS9A 5FO8B 3BRDA 4K23H 1JPSH 1VADB 1S9WB 4P5MB 2P8PA 3OPZL 3NGBC 4NZTH 4MS8C 5D6CB 1HHIA 4N68A 4Z6AT 5AG9A 1SJEB 2YD1A 5E8OA 4QHMB 3TBYA 5E9DE 3MV9B 5E99L 5C09B 2P1YA 3I75B 3CXHJ 3MRHB 5IGXH 4ZUTA 3QIUC 4BZ1L 1DBAH 1DVFC 4U1GC 3X11A 3NVQA 4L8SB 1BVLB 3RVUD 4P2RD 2VQ1B 3EKCA 3MJ7B 4I18A 1JGLH 3MLSH 1G0YR 3GO1L 4KH2A 1I7TB 1K2DB 2H1PL 3O4LA 5HYJB 1BREA 1QVOA 2PYFB 2GK2A 5F1KC 4OCYL 4I2XB 3QPXH 4RAVA 4KUZH 1MPAH 1E6OL 3KWWB 3GFUA 1NMCC 4NZUL 1TZHB 5DA4A 4ZFFA 3QXDA 5BV7C 3BHBA 5E00B 1T6VN 1U92B 3JTTA 3FB6B 1EFXB 5H2BA 2B7DT 4ZYKA 1KCUL 4JQIH 3UJIH 2V9TA 1JPGA 1UVQB 4LVHB 1DUZB 5DO2C 3W81A 5TF1L 2EYTB 3W11D 1OQOA 5E94B 5CGYC 1YPZB 1PX4A 4R97C 4JHBA 2G5RA 4HDIB 4HFUH 5IEKB 4I3RH 4K7PY 1LO2L 1CGSL 2MFNA 2WANA 1G6RH 1CS6A 3ULUH 2VLLB 1QRKA 3GB7A 4KROC 4M7JL 4GOSA 2DLFH 3DIFA 1MAML 5CEXA 3I6KB 1N6QL 4KUCF 5FYLE 4KZEH 4WO4D 4ZSOE 2HH0L 3AAZA 4WGWB 1DEEA 1U93A 1GPOH 2Q8BL 5CWSA 5AD0A 4EDWH 5CCKL 3H3KA 5I8OH 5BJTA 1DQMH 4NN7B 32C2B 5CJQH 3IS1X 5EZJA 3P77A 1FNAA 5CBAA 4RMWA 4BZ2H 4L8DB 5D4QA 2EDNA 3EDJA 1P4BL 1GRWA 1I1AA 4DCQA 5I19H 4MLSA 3DMMA 3P11H 2HMIC 4OF5A 3OHXB 4PP1C 5D5MB 2E7LA 4UB0H 5IHUH 4HKJB 2X09A 2K9UA 3V6ZA 4MQ7B 2CSPA 5DHXB 4GXUN 4PJ7B 2BNQD 1Z9LA 3QUKB 1JVKA 2FCBA 2PYEE 3MV8D 35C8L 4QT5B 4JFYA 2C9AA 5EC2B 3CSYA 2IPKB 3B2UD 3F62A 1ZVSA 3MRRB 2BHUA 2Q3AA 5GJTH 3CH1B 4NT6B 4LNRA 5D8JL 4PJAF 4JREB 1LK3L 1GGIH 2IANB 2A38A 1FN4B 2NY3C 3PF2A 2V2XB 4RGMC 4FABL 5BW7A 1X5IA 2GJZA 1TENA 4KK5D 3C5JB 3G08A 3VFUB 3K3QA 1DFBH 15C8L 4XXCC 4DOHB 2ITCB 2ZCKH 4KKAC 1FRGL 3O6FC 5SV3A 1T83C 4L3CB 2DWEB 4ZAKD 4GQ9H 4P5KB 1BQHG 2V5RA 3BKYL 3DBXB 3MRCB 5GRWA 3FO0L 2IC2A 3HCVA 4AM0B 5C08D 1G7MB 1N4XL 1RZIB 1PX3A 4JZJA 4D3CH 4U3HA 3ETBF 4XHQA 1VA9A 3O45B 2Q8AH 1YNTA 5HGHA 5LVEA 3QQ4B 3SDDD 2GEEA 1FQ9C 4OT1L 1B90A 1BFTA 3FFDB 1O7VA 1NGXB 3S5LA 1JWSB 3BH8A 3IU3B 1YDPB 1MFAH 5SWSD 2R39A 4K2UL 1CXEA 4PB9L 5FCSH 1A0QL 4LF3A 2GAZA 3UBXA 3WEXA 4A6YB 1O0VA 1AGFB 4PJGA 5T5FH 3WHXB 3IGAB 2VWEE 3E3QE 1YN6B 1MCHA 2O61B 4PJCB 4OCMC 3ARWA 4JLRB 4U0RC 5I1CL 2DBJA 1R24B 5MEOA 5C0EA 1UQSB 1KULA 3VXTA 4GSDL 2Z31D 3IF1B 3QWRD 3ZDXF 5TQ0H 3V6FB 4D2NA 1FZMA 1I8KA 3ZDXE 3NTCL 4L29A 4JDTL 2VAAB 3GIVB 1ADQA 4NQUA 3JWOH 3U79A 3TNMA 3UDWC 1LVEA 5IT2L 5J12B 1BVZA 1XF4B 1I1YA 2MPAH 4DKEL 1Z2KA 2F54B 4LGRB 3E2HC 4M5ZH 4RMVA 4PJ5E 2OZ4L 4JVWA 2R1XA 2QR0A 2YD2A 5DFWH 1ZWIA 4YUEL 4JHAL 3GKWH 1OTTD 1OAUL 2P5EE 2WBWB 5FUZL 1OAXH 3WJLC 1OP9A 3O3DB 2WAHA 3MBXL 5A2LH 2GCYB 1MCLA 5DUBB 5SWZA 5HDQL 4TRPL 1S7SA 4O2EB 3BDYL 3KAAA 4OIIH 4PJ8A 4OLVL 4XTRC 2R0WL 2ICEB 4FP8H 3U4AA 3FZUC 1K8IA 1P7HL 1ZA3B 4LEOA 3MOAH 1A7NH 1GZPB 4JANA 4KTYA 4BYHA 3LOWA 5IIEB 5DJ8A 5C7XH 5E6ZA 1RUQH 1IEBB 2AJSL 4MXQD 2WMPA 5DLML 1CE1H 3VG0H 5D93C 3GZKA 4MNHA 5GRVK 5J56B 1U95B 3U2SB 1XFPA 2DM7A 3EYSL 5C0JB 2AK4B 4PGJA 5I1GL 5J9PA 5CEYA 5KVEL 2CD0A 4FOMA 4DQOH 4I0PB 5CZKA 5KS9B 5L8LB 3PWPA 5D96C 2ZPKL 3M45A 3GSXA 5E5RB 5EO1A 3LQZA 2P8PB 1G9NH 2LABA 4HC1A 5GXBB 5K59F 2DD8H 1HHIB 1IQWH 12E8H 4OFIA 4FZ8L 1KF9B 3PV7A 1HN1A 4XBPA 2DQHH 2E7CA 4P4KB 5E8OB 5F6IC 3TBYB 3HE6D 1S9KC 1R0AL 4PJBE 2ZCLL 4ZOAA 1MFEL 3DRQB 3TPKA 3ULUF 5LGHL 1J9CT 4M7KL 4YDIH 5JR1L 1MHEA 4I18B 2QV2A 1G7LA 4K9EC 2OCFD 1KG0A 4M1GL 1BD2A 4G43A 2QTEA 3O4LB 5DR5H 5DRXA 1BOGB 1MRDH 3RUGA 4JM4L 1Q9KA 1IFHH 1IE5A 1V8HA 4HXAH 3UZEA 4J3OC 1RIHH 3QQ3A 4ZFFB 5FYKH 3CVHL 3QXDB 3TT1L 5TDNA 3BHBB 5HHPB 3JTTB 5H2BB 4WWID 2B1AH 4ZYKB 2VXVL 4HH9A 3V0AC 1OP3K 1X4YA 5EOCL 2AJZA 1HSAB 5DD1H 3FQNB 4PJFA 3PIQA 2UYLA 5T1LA 2IFGA 5DDHB 4TSAL 1JPTH 1QQDA 3CFIC 2OK0H 5GGTA 5FGRA 1QEWA 5CGTA 4NKMA 5K9QG 3G04A 2WBJA 4L8BB 3HAEG 2AJYH 4TVPH 3GMLA 2NXZD 5AYUL 1Y0LA 2OQJB 3GI9H 3FOMA 4TUOA 1A02N 3GB7B 4YIQB 1FSKC 4OQ1A 3DIFB 2Y7QA 4FFYH 4M43L 5DUML 1YJDL 4BQ6A 4F7PA 5CEXB 1JZ3A 2J1KA 4GRWB 2GJ6A 3BAEL 4P23C 2BSED 2O26U 3RP1A 4DZBA 1I7ZA 2BFVH 4YHNA 4LLUA 1EAJA 3AAZB 3LRHA 1DEEB 4DAGL 1U93B 4Y1AE 5CWSB 5AD0B 5BS0E 1FYTE 5H35A 2XG5A 43C9B 3MUJA 1BZ9A 1QLEL 2EYRA 1HYSC 3X13A 5EZJB 3P77B 4XCFH 2N4IA 5CBAB 4IIQA 4Y19E 5BOZG 2ZSVA 1IGTB 2K7PA 4JRXD 1I1AB 2E27H 4GW4A 3IFOA 4ZO8A 2YZ8A 1NCCL 4PJHF 5SV4A 3J7HA 5CJXA 1I3RA 2OJZL 3EOAA 1RUAH 1V7NH 3DMMB 3VDAA 1XF2A 1VFBA 4PJHE 2MKWA 5EIQA 1PEZA 2VDLH 1EEQA 2PR4H 4P2QE 1KJVA 4LSRL 1YEEH 1UENA 3V6ZB 1NLBH 1CLYL 5JXED 2Z4QA 5F9AC 4KRLB 5I18H 4KTDH 3WDHA 4JFYB 1T66D 1IGCH 1KXQE 1A4KA 1Q0YH 2NYYD 3VGDA 1NGPH 4PFEA 3PHQA 3LD8C 4ZNCD 5DT1L 1XGQB 4LSUL 3WFHA 3FAXA 1UM4H 1KENH 3WXVL 2GJZB 4YE4L 3TP4A 1INDH 3G08B 1BX2A 4PRIE 1C7TA 4JPIA 2C3HA 4LPWA 3KYKH 4HK3J 5IB3A 1HXYA 2VIRA 1X5AA 5F9WB 3D6GA 2VH5H 4JZJB 1FO0H 2OTUA 4WEBL 1M7IB 4B53A 5DJ2A 1B2WL 2VDNH 3DUUB 3RTQC 3W0WA 1VGEL 2FX9L 3NA4A 3S5LB 3BGAA 2DLEA 3BH8B 4Y4KD 3U9PH 5HGBB 4QXUH 4XMLH 4WO4A 4F9LA 3U0PB 1C5CH 3IDXL 3K2UL 1A9BA 1H8OA 4LF3B 4JFZH 5LG1A 2GAZB 3UBXB 3WEXB 4PJGB 4UT7H 5T5NF 1FG2B 4RFOH 3O8XC 5C0IA 1MCFA 5C0EB 3VXTB 1J1PL 4GLRH 4NQEB 1AO7A 3MLXL 4XC3L 2WIIA 2FDBP 1FZMB 1T21A 1UEYA 1UZ8A 1T7XA 2BSSB 1IAIH 5EZLB 4R26L 4MD5A 5C09E 1QPXA 4WI2A 3QXTA 1A7BA 5EIIB 3TNMB 4FQ1L 3TWCL 1I1YB 4LRIC 4KQ3H 1LE5A 2W38A 1AY1L 3BP4B 4LEXL 2CLZA 3K1DA 2R1XB 2O93L 1ZWIB 1X5KA 1MSPA 5FM8A 2VZTA 5KSVA 4XWOC 1KIPB 3H9SA 2DS4A 3R0NA 4J1UA 4Y4FD 2CK0H 4HIJA 2ERJC 4I2XE 3K8LA 1CGXA 4M3JA 5SWZB 1WEJL 1EEUA 1F8TH 2EDYA 3IDUA 1S7SB 4GAJL 4N5ED 1ZANH 4CU6A 1YECH 4PJ8B 2FBJH 1K8IB 1SJXA 3H2WA 4LEOB 4Z0BH 5DJ8B 2AI0L 2X4QA 2DLTA 3GK8L 3WD5L 1UKQA 3RNQA 2HYMA 3VCLA 1K3ZA 5F9DC 5IVXA 1KC5L 4NZDA 4PBXA 4PRPD 4HMCA 4IHOB 2FIKA 4XZUA 5HHOE 2EE6A 4NQDD 2GI7A 3WFCL 1BGXL 5J9PB 5CEYB 3C2AH 2LVEA 3GBLA 3IETA 2GJJA 3UPRA 5ERWA 3VG9B 4GBXC 1AQKL 2Y06L 3SDDA 5EO1B 3LQZB 4IRSC 5F70A 5DQDH 4L3EA 4GRLC 4JPVH 3U30C 4XI5C 5EUOA 4G6KH 5JIHA 5DD6A 5SWSA 3LN4A 1D9KA 1RIUL 4QWWD 1NANH 5EORL 1FIGH 2CQVA 2DL2A 4PJIA 1AGBA 5CBEB 3RWFA 3ULSA 4MAUL 2AQ1A 1R3IL 4WTZA 3V4VL 2NXYC 5DRNA 2H6PB 3CJJA 3RWEA 1MHEB 4NRYA 1KG0B 2Z31A 3GSQB 3F7VB 1BD2B 4G43B 4W6XB 5DRXB 3VJ6A 1Q1JL 4YDJB 4YDLB 3D39D 5L2KD 5CFHA 1JV5A 1KB5H 1PZ5A 1Q9KB 4KRPD 2YPVH 3BXNA 4L8SC 1LGVA 4PB0L 3QQ3B 4JRYD 5TDNB 3SO3C 3ZSTA 3AY4A 4O58H 1CIDA 4HH9B 3S36H 2X05A 5T3ZE 2HKHL 3SY0A 2AJZB 1NDMA 5CIPA 3LHPH 3NN8A 4PJFB 3PIQB 4L4TD 2UYLB 5T1LB 2HJFB 4RAUA 3HPJA 5A2KH 1QQDB 4HUVB 1D5ZA 1A3RH 5ITFA 3MLTA 1QEWB 3ARGC 4NKMB 4DGVL 2WBJB 1FIEA 1ZVYA 3GMLB 3T8XA 3QO0A 1Y0LB 4LVHC 3AUVA 3I50L 3IU4H 3LH2H 3MOBH 3FOMB 4UNVA 4TUOB 2HFFA 3RY4A 1KGCE 3U82B 2OMNA 3SGKC 4D0BB 2XTJD 1YEKH 4HFWB 2Y7QB 4F7PB 5E8NA 2ED7A 4XMKH 3OF6D 2GJ6B 5D7LB 4DZBB 5E6IC 1N6UA 4YHNB 4LLUB 4F8QA 3BKJL 4NIKB 2GTWB 5H35B 4FQHA 2X70A 1BZ9B 4Z7NF 2EYRB 2DQFA 1A2YA 4EI5C 1OPGL 3X13B 3WJJA 3KR3H 2BSTA 4LCUA 4IIQB 3ZL4H 2IALA 4Z7NE 1TTFA 1Z5LA 2ZSVB 5GS0D 5DMIH 4KK9C 4MDIA 4GW4B 1SY6H 2ITDA 2IAMC 1F42A 3EOAB 1QFWH 4UMGA 8FABA 1XF2B 5F88B 1VFBB 4PJCF 2RAMA 2AQ3A 1UH3A 4NJAL 1KJVB 1RVFH 1OGTA 4PJCE 4Z76A 2W07A 2Z4QB 2BVQA 4YH6A 2O5XH 3OKEA 1OGAD 1MRFL 3U9UA 4AEEA 2YK1H 1A4KB 2JELL 4LCIH 4MVBC 3RY5A 3O3AB 2DAVA 1MIML 3FTGA 4QRPA 1GL4B 5D71L 3D18A 3OB0K 3PHQB 3H0TB 1Y18A 4MZ3A 4BJLA 2WP3O 3R1GL 4ZTPH 4Y7MA 5A2JH 4OZIB 1U8HA 3GI8H 1A3LL 5TDPA 1NGQL 3LPFA 1BX2B 4DN3H 4WCYH 4FQXD 4K8RH 3RVTD 1NDGA 4WEMB 4WUKH 2DI8A 1OSZB 5IMOA 1JNJA 2BMKA 3B9VA 5E8PA 5TE7L 3O3BA 5IB3B 1HXYB 4OIAA 25C8L 2VIRB 1RZFL 5AZEL 4RCAA 4BSJA 5I0ZA 4KDTA 3BWUC 5BVPL 4K7PX 2OTUB 4M61A 3LV3A 2D4FA 4NBXB 2BY3A 4B7IA 4OZ4A 3W0WB 3OAUL 5FDWA 1NUFA 3TCLA 1CYGA 3N85H 3VE0A 3IDYB 3T04D 2MNUA 4UILH 3LY6A 2CJUL 1NMBH 4WO4B 1FNLA 4EIZC 1IJ9A 1PSKL 2A1WL 4JKMA 2MMXA 3CK0L 1A9BB 3UAJD 2WWKO 4B5EA 4HCRL 4LIQL 1PY9A 5CP7A 4YQXL 5B4MD 3QYCA 2QADB 1AO7B 1JNHA 2DIJA 5B8CA 1OAYH 5H8DA 5HGGS 2WIIB 1PY4A 1JZ2A 1T21B 1UZ8B 2AJVH 2I60L 3AB0B 3HFMH 4MD5B 3JUYA 4YFLI 2CUHA 2ZG2A 2GHWB 4URTB 2R0KH 1TTUA 3T4YA 3QNZB 2ADFH 4XP9L 3OJMB 2KQNA 4MA7L 1I3VA 5IBUB 5C0ND 1YY9C 5KSVB 3VWJA 3BI9X 1GC1L 1M6OA 2XWBB 4J1UB 3VGAC 4HIJB 1ODAA 2PN5A 2CDGA 2BNRD 4YDVA 4CNIA 2RIKA 1KCRH 3JWDH 4OZFA 3OAYH 3ULVH 3GSOA 1W72A 4O5LL 1ND0B 4ZUWA 1K6QL 1T89A 2DQEH 1E4XI 2X4QB 1WCQA 3IXTA 3RNQB 2A83B 3VCLB 3ZYIA 5IVXB 2R2CA 1J8KA 3SN6N 2H2PC 4ZAKB 2FIKB 3QUZC 4XZUB 4WW2A 4WHDA 4HV8A 2NQCA 1A6VL 5DVOA 3IETB 1E4KC 1ZOXA 3UPRB 5ERWB 2NY4C 2DLHA 3O11A 1MQKH 1RQ5A 4M7ZB 3SDDB 1QG3A 4L3EB 5GSRB 4UQ2B 4J3WA 5EUOB 5K33A 4AZ8A 5DD6B 4H1LB 1DQDL 5SWSB 3LN4B 4MNQD 1GJIA 3LQAL 4I0PC 1WISA 4LP4A 2UZIH 1JHLH 4CN1A 4FMKA 3EFDL 4PJIB 3U36A 4WNQA 3LN9A 3RWFB 3ULSB 1MJ8H 4UT9H 3HI1A 3TN0C 5I1AA 5KSAA 4OI9A 4PGEA 5C07A 2EDQA 3RWEB 1MI5E 3RIAK 2R15A 3T3MF 3MRBA 2D7MA 4FNLH 4UTBL 1QLRB 2Z31B 1G7PA 1JGEA 4UBDC 3T3ME 3VJ6B 2YN3A 1OSPH 5TQ2L 5MENA 1JV5B 4W70A 1PZ5B 1ZA6A 4U31A 3BXNB 2EXWC 3VD9A 2VLRE 1KJ2H 4I18C 3S34H 4DK3A 2NY0D 2NY2D 5DA0B 1FZOB 3HNTH 1XF1A 1WV7T 4MWFA 1II4E 4KK8D 5I2IA 4XHJC 3S3JA 4HWUA 1XMWA 4X4YA 1NDMB 5CIPB 1MWAL 4HT1H 3LS4H 4Y4FA 1GHFL 3IDJA 4JKWA 3HPJB 4RAUB 3QHTC 4F33A 3MLTB 5TE6L 2GTZB 1NCDL 4ZOCA 1DDHB 3B8SA 3GHBL 1U6AL 3TC9A 4OFDA 2HTKD 3CUPA 2UWEB 2J2ZA 2GIYA 3T8XB 3QO0B 4YWGH 5DZOA 3WFZA 4X6DF 3ZMRA 5F21B 2HFFB 2XA3A 2ZG1A 1QO3B 3MLWL 5ITBH 4X6DE 2Z0BA 2CPCA 4GW1A 3FB7A 5E8NB 1BQLH 3QDMD 1ULVA 4QF1A 1QBBA 2QHRL 4Z95L 3OKKB 3ZKMC 4M1DL 4JB9H 3RWHA 2BSTB 4LCUB 1P53A 1JYNA 4YGVA 2IALB 2YRPA 1TITA 1Z5LB 3QUMH 5MEPA 1CTNA 4BM7A 4MDIB 3FFCE 1T7VA 4Z7QF 2VKWA 5GSVA 2ITDB 1ZHLA 5HI3C 2DM4A 4V2CB 1T22A 4ZOEA 4Z7QE 1U91A 4TQEL 3VXMD 1JNNL 2GITA 4IRJA 4TNWK 3HE6B 2G5BA 2ORBH 5DJZB 3T0DA 1U41A 3C60D 5INCA 1OGTB 4X80H 4Z76B 1DQLH 2XQBL 3OB8A 1ZGLP 2PCPA 1KEGH 4GFTB 2PTTA 2VSCA 2BVQB 3O3EA 3MV01 1B0RB 3OKEB 4NQEE 4P2OD 4PLJC 2DBLH 2IWGA 2X4SB 2XQYK 4DKFL 3GRWH 3L5IA 3U9UB 2E7LC 1BBDH 4J8RA 1MCWM 2F58L 1MRCH 1YEHL 4GKZA 9CGTA 1HQRA 4QRPB 4N0YL 3D9AL 3D18B 2R4SH 1Y18B 1G1CA 4YX2L 3L7FA 4ZDHA 1CFTA 1Q94A 4JM2F 3MUY1 2FLBT 4U1NA 1M7XA 3QIBD 1CFQA 4HLZH 4EOWH 3TZVD 4Q9CA 2CKBH 4L4TA 4QHLA 1NDGB 3JXAA 3UTTD 5IBLD 5C0BD 3P3YA 5IESH 5IMOB 4MDJA 5SWZE 2OXGA 1HKFA 2HTLD 3GJFK 3O3BB 4XPFL 1BQHA 1U8NA 2VN4A 2ED9A 4AJ0A 4B41A 5JW4M 4M61B 1ZLVK 1FNEB 4FQCL 5HXMA 3LV3B 4U6HA 4Q9RL 3QHZH 3TJHC 4QO1A 5FDWB 4JHZA 4DUVA 3IJYA 2EXYD 1L9NA 5C70A 1SEQH 2J4WH 2DOCA 1R6VA 4X7SH 4PGDA 3JVGA 3TLRA 2VXUL 5CJ8A 2SEBA 4XPTH 4FFZL 1NAMH 3L9RA 4G6FB 4Y2DD 4XX1G 5CP7B 4FRWA 3TYGH 3WSQL 4FQJH 1GGTA 5C0DB 2OM5A 5CILH 4HKZA 3WIHH 1QFUH 1LO0L 2JJUA 4JRXB 1JNHB 4X98A 5B8CB 3V7AG 2F5BL 3VFGH 5DZLA 5EO9A 1JRHH 4LNVA 2FD6H 3W9DB 4LLAA 4R8WH 4HIXL 1B0WA 2O5ZL 4ODTH 2R0LH 1UC6A 1A6UH 1KNOA 5IVZA 1IGIH 3P9MB 3MJ9L 4LVEA 3VFRA 1A14H 3MJ8A 1HNGA 1M6OB 2CDGB 2R23B 3SGEI 4DVBA 4WUUD 4OF7A 1N59A 4TYUA 3X14A 3OPZH 4OZFB 4BH8A 3T2NH 3GSOB 3QXWA 2P45B 1W72B 2Z35B 5IM7B 3CSGA 3V5DA 4H0GA 1U0QA 1PEWA 2A0LD 2E9JA 4WI5A 5E99H 3IXTB 1C5DB 4Y0GA 5CKAA 5I8KL 3O2WL 5HI4C 5DMYA 1P4IL 1TVDA 5ILTL 4BZ1H 4PJ8C 3SQOL 3SKNA 4H0HB 2H32H 4WFFE 1AQDA 4KVCL 3ARVA 5ESQB 2NCMA 4HV8B 1FG9C 3GO1H 5T33L 1U58A 2H1PH 2VMFA 1YMMD 5JA9A 2Q7NA 3F8UB 1RULL 4OCYH 1E6OH 3TBWB 1KTRL 4JFED 2GSGA 2GJ6E 2Q7YA 4NZUH 3QCVL 4Y5XC 5D7LE 3RZCD 2FH8A 1Q72L 3V95A 3KPRE 1RJZB 1A7RL 1DTUA 4PJXF 3QDGA 5HPOA 1SY6A 5IB5B 1MCEA 4WENB 4D8PB 4ZD3L 5TF1H 2CRYA 3HI1B 3GJFB 5KSAB 4PGEB 3U6RA 1G7IA 3QEQD 3MRBB 2V2TA 2P5WD 3EFFA 1G7PB 3QBTB 5HDOA 4PTUA 1LO2H 5I75B 2A6KB 3K8MA 1I8LC 2R0ZL 1ZA6B 3STLB 5KVDL 1CICD 4M7JH 3D69B 2APWA 3KLSA 5T1DL 3MBEC 4IMLB 1MAMH 3G6DL 1NUNB 4P2RE 1N6QH 4YHPA 1UXSA 4FQQA 1CDHA 4MWFB 5I2IB 2HH0H 4O4YL 4LLWA 4ZUVA 2Q8BH 1JZ4A 5EU3B 3TGXA 5CCKH 3FQTA 4S2SA 1MY7A 4YO0A 4Y4FB 4DEPB 3L3KB 1Y6KR 4F33B 1D6VL 1W8OA 3OG6B 3VXRA 5HGDA 1XF3A 3INUH 5FGBA 4WW1B 1P4BH 3HAEA 4OZIF 2FJFA 1AE6L 4GRMB 1U8PA 4OZIE 3P4NA 1KIRA 3LZFL 2EE3A 1OVZA 3W5NA 5ISZD 4ODSL 3CNKA 4GW1B 1SYSB 2WBJC 4JO4L 2XN9D 3GUTA 3DUSA 4PRPB 5HBBA 5C0AD 4QF1B 4RBPH 4F9PA 35C8H 2BY0A 3RWHB 3VXUA 1T1XA 3FN3A 5DFVC 4YHYC 3TJEL 4MD4A 3S9DB 3I3EA 5L7XL 5D8JH 4Y89A 1LK3H 4AQOA 4BELD 2IMMA 5AWNL 1NBQA 5GSVB 4ENEC 4U6YB 1ZHLB 1RZ8B 1KV3A 1RUKL 3GJEA 4FABH 5CZVL 1T22B 2I07A 2NTFA 3VFWA 4HG4K 1TQCB 2GITB 2HT3D 1B88A 5L8JB 2G5BB 4PLNC 5INCB 1ZVHA 15C8H 3B9EA 3AFLA 1HDMA 1FRGH 3U0WL 2NY7L 2PCPB 1CI5A 3BKYH 3FO0H 4LSDA 4I3SL 4PYGA 4F15B 1DBBL 4J8RB 1CCZA 2E7BA 2OTPA 2C26A 4GKZB 3D39B 5L2KB 3L5XL 1WCBA 1HQRB 4OT1H 2H26B 2BRQA 2IH3B 1ZKAA 4JRYB 4BFEA 3L3IA 1Y6NR 2BNQE 2FHFA 3L7FB 4JEGB 4U1KA 5IJVA 1CFTB 1Q94B 2HJKA 5DI8A 1DQJB 4U1NB 1CFQB 4HGMA 3MV8E 4PB9H 5EBMB 1A0QH 5HD8D 2H3NA 3AS3A 1Q0XL 2E6QA 4L4TB 4NHUA 4QHLB 5JQHC 3DX9A 3OJVC 3IJHA 4YBQC 4MDJB 3DSFL 3KPMA 5I1CH 3EJYC 2FGWL 3RVWD 1U8NB 4GSDH 3ZKXC 2VWEC 1BFVL 5JOPD 2OXHA 4P99A 3Q0HA 4U6HB 3KPSD 1Z0NA 4OFYA 2QL1A 5EZOL 1DBML 4JDTH 4M9PA 3IJYB 1FZKA 4NBYB 5IT2H 4KKLC 1A1NB 2AGJL 3LKOA 3QEUA 1VHPA 4R4NC 5FYLL 4DKEH 2VB5A 2X9YA 2OZ4H 2SEBB 3O4OC 5FHAL 1JZ7A 5C08E 3L9RB 4YUEH 3QIUD 4JHAH 1DVFD 1OAUH 3AU1A 5FUZH 1A64A 2QQLL 2EDJA 1VFMA 5AEAA 3X12A 4YLQT 3VMOA 5DQJB 3MBXH 4HKZB 4ZFOL 1PG7L 5HDQH 3BDBA 4TRPH 5GZOC 2I9TB 5SWSE 3NIGF 4HWBL 2R0WH 4OLVH 4X98B 4ETQA 2IF7A 3KYNA 3UTSD 4FZEL 5EO0A 5EO9B 1GVIA 3NIGE 3MNZA 3EYQC 5J3HD 1VEOA 4FG6C 5GHWL 2HG5A 2AJSH 3AREA 5ADPL 4DKAA 4PTTB 3RIFK 4BKLA 3P4MA 5DLMH 1JUFB 1KNOB 3LB6D 2A6DA 5IVZB 5T1KD 2FIRT 1URLA 3EYSH 1OGAB 2BOCA 3MJ8B 2HA1A 5CGYD 3PE9A 4DVBB 1I8IA 4AIOA 3P9LA 4LHUG 4BH8B 4NQCD 3RU8L 1R3HA 3V5DB 4QYOA 4FZ8H 3KJ6L 4KROD 1SM3L 3QIBA 5EOTA 4V1DE 5HHXL 5I17A 4FQXB 3TZVA 1R0AH 4G9FD 2ZCLH 4YHLL 2C1PB 3QUYC 4JY6A 1MFEH 3UTTA 3PV6A 2UWEF 3SKNB 5LGHH 4M7KH 3BT2L 1AQDB 5JR1H 2UWEE 3G6JA 1KYOJ 4OKDA 4RNRB 3S98A 4OCSL 4ODBD 1NC2A 4M1GH 1U58B 2AW2A 3T09A 5BZDA 1RIVL 5GRUH 1WF5A 4JG0L 3ULUC 3EBAA 3MLYL 4OJFL 4QHKJ 1U8IA 4FTVD 4JM4H 1ZLVH 1MJ7L 5JZ7C 1I1FA 2GSGB 2Q7YB 1Z9OA 3WNPA 4NKDB 3CVHH 3TT1H 4KHTL 4PP1D 1ZV5A 2NW3A 1PG7W 1J0IA 3QDGB 2JJTA 4UT6L 5EOCH 4FQ2L 4S1QL 5DMKA 3MUZ1 3QZWG 3TBTA 2F53D 1ZHNA 3ZE0E 1I9JH 4JR9L 4TSAH 1MCBA 3KS0J 1QD0A 5CAYB 2EDDA 4N0UA 3U6RB 3MODL 1D9KC 1C5BL 1JE6A 1UB5A 3EFFB 4HMEA 5AYUH 5F6HJ 2J12B 3WKNA 5ID0A 2AXGA 4K9EL 4PTUB 3DJ9A 4KJPD 1P6FA 4L5FL 3F12A 4X9IA 1TMCB 3S6CA 2RBLA 2Y5TA 1ZT4A 2NY3D 1AR1D 4OZGA 1UWGL 5C1MB 1QSED 2Y07L 3BEVA 3ARQA 4M43H 4O51A 1YJDH 3BAEH 4YHPB 4ELMA 1UXSB 4FQQB 4LLWB 4DAGH 1NC4A 4ZUVB 1DUYB 3FQTB 4BUGA 4YO0B 1QLEH 1CGTA 3VXRB 5IJKC 3K8KA 1FGNL 1RY7B 5BRZD 5DHVB 5TGBB 4OTXH 4QCIA 2W1NA 3HAEB 4H20L 1WAAF 4BSVA 4DGIL 2FJFB 4HKBA 5GGSA 3NPSC 4OQTL 2XZQL 1NCCH 2OJZH 4NZRL 4LPXA 1WAAE 3P4NB 1KIRB 4WHCA 3H3PL 2EH8L 3TBSA 1LDSA 3ARPA 3RIAF 3SCMA 1BLNB 4Q6YA 5I74B 3DV4A 4U1HA 4LSRH 4RA3A 1JMXA 2VR5A 3GUTB 4R4BA 5ALBL 3DUSB 1CLYH 2QSVA 1S8DA 4LBEA 1XR8A 3VRIA 1EDQA 1PFCA 5D1ZD 3GMQA 1A6PA 3P30L 3DVIA 5IQ7L 3LS5L 5KVFH 5F8RC 1HWGB 1BECA 3HMXA 3VXUB 3VMPA 4MD4B 2D2OA 3MCKB 4J12A 3LVEA 4QEGA 4LFHD 3UCRA 5E2TL 3NPZB 1BIHA 2DQTL 5DT1H 4LSUH 3CZJA 4MNQB 1JI2A 3GJEB 3VFWB 2I07B 2NTFB 1I7UB 1JWMA 3WXVH 1A1MA 2ADGA 1HI6A 2AEQL 1N3NB 3WJJC 4YE4H 2VUOA 5KN5B 1MVFA 5EN2A 1PAMA 3RJQB 2IQ9L 5GPRA 3KPLA 3UJJL 3D2UD 4I0KA 1U36A 3B9KC 1HDMB 1GOFA 4FXGA 4HXBL 1MF2L 5LBSL 4JRXE 5L88L 5IQ9A 4R7NA 3TIDA 1ZXQA 5DD0H 5B38G 2WUCL 4WEBH 4IMKC 3QDJA 4R0LA 1WCBB 2J8OA 1CQKA 2G2RB 3DX7A 4FS0A 4XTRD 4YJZL 1B2WH 3FZUD 3JWOC 1VGEH 2E7HA 4JZOA 4ALAL 5DWUH 3L3IB 2NY0B 2NY2B 1HZHL 5IJVB 2HJKB 5DI8B 4MA1B 4EBQL 4DN4L 3IDXH 3K2UH 2H3NB 2AS5M 4NHUB 3OJ2C 3FQUA 3T0XA 5L6YL 5C6WH 1P2CA 3KPMB 4HUNB 3TO4A 1UJTA 1N64H 3IS0X 4X7CC 2R8SL 4TNWF 1Q9WB 1CN4A 1J1PH 4I5BB 4QKXB 1FL3A 4XC3H 4FFVD 3QISA 4LSSL 3X3GL 5EU7C 5IR1A 4R26H 2JIXA 1FZKB 2ILLA 3NZHL 4OFKA 4FQ1H 3LKOB 3QEUB 3TWCH 1CGVA 4CVUA 4N90D 3OX8A 3VFMA 3O2DL 4KDTC 1NJ9A 1AY1H 3LIZL 4LEXH 4P46C 4ODWA 1LEKA 2EH7L 4NQVA 3LEXA 1VFOA 5I1KL 3DSNA 3AU1B 5DYOB 2YUWA 3RDTA 5I76B 1QRND 2XY1A 3BPOC 3WNNA 5BZWA 4X99A 1HH6B 1G9NC 3O81A 4MZ2A 1WEJH 3SEPA 4GAJH 1TPXC 4HWEL 5J11C 2YUZA 4PD4K 4CN4A 2J6EL 3KYNB 2BVTA 1OM3L 4G6AC 5EO0B 3MLVL 5HHVL 2B5IB 3N1QC 3MNZB 1DLFL 1RZJL 2ZWLT 5D7JA 2AI0H 4I1NB 2HG5B 2UV3A 1TQBC 3O0RL 3GK8H 3WD5H 2QSQA 4BKLB 4WWKC 5CZXC 1KC5H 4EZMA 3O6LL 2A6DB 4EN3C 4E9LA 4PG9B 2EIDA 4YEFA 2Q86A 1W2KT 2IEPA 2ICWB 2YRZA 4JO2L 3WFCH 2VXTL 1BGXH 4OBRA 2AJ3A 3C09C 3B4NA 1MAKA 3QAZC 5JHLL 3DURB 1KIQA 1AQKH 2Y06H 2YD8A 1MLBB 3TCXA 1A3QA 1I8IB 2IPUK 2NNAA 4LL9A 3D0VA 3CXDL 3VWJC 1CXLA 1RIUH 1H3VA 4RRPA 5EORH 1OWWA 3CMOH 3QIBB 5EOTB 3K2MC 1JL8A 1TCRA 3V7AE 5I17B 4P23D 3TZVB 1MH5B 4MAUH 4JY6B 1R3IH 3UTTB 5C0BB 2LAGB 2YN5A 3HZMA 5IFAL 2VQTA 3V4VH 3HRZA 3CH8A 3BGFB 5ETUA 1JF6A 1X5JA 3TT3L 1YC7A 3G6JB 4NNYB 3ARFC 5ICXA 3TH3T 5BZDB 1UJ3C 1Q1JH 3IKCB 1KACB 4DKDC 3LKNA 1U8IB 4WW2C 1I1FB 2C1OA 4PB0H 1EJOL 4RAHA 3VGBA 4PRPE 3WFEL 1CGYA 4NQDE 1QTYT 1HHJA 1LK2A 4BQ8A 4M9OA 1FPTL 3QIUA 5DMKB 2HKHH 3TBTB 2X40A 2WWKT 5B3NA 4N0UB 1RU9H 3LDBB 1CD1A 1UB5B 1NAKL 3ALPA 4MLIA 3KGRA 3QHFL 1WFNA 2AXGB 3I50H 4YAQA 4OD3L 2OP4H 4UINL