4G5AA

Crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
GKQHVKTKSDWVIQRTPVDPEWLKVYVDDESKRLCLNFKDSFAPITVEVKDIEKQIVFQSIIFPVAAGEYTLYLGDLSLGQYELYMYNASVKVVGNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a putative member of duf 3244 protein family (BT_1867) from Bacteroides thetaiotaomicron VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 14
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g5aA00
4G5AA 3D33A 3SD2A
chains in the Genus database with same CATH superfamily
1H3UA 1E9QB 2IWGA 3L4TA 4OLUH 4FA7B 4Y5XB 1NGYB 1DANU 1QNZH 3MXVL 4PWHA 1K2DB 2DIAA 4GAGL 3QJVB 5EZLA 3IGAB 2O4EA 2FL5A 4YAQB 4NO0B 4M8RA 3WTSA 2A0LD 2ZXWB 3ILPA 1QOKA 3D3VA 4PYGA 1J5DA 4U6HB 1URZA 1B4TA 2AK4D 4MNGE 4WW1B 4L4TA 1E6JL 4H0GA 3O2DA 2WNGA 4Q4EA 3IXAB 3NACL 5DD1L 3O8XA 3KWTA 3VCLB 3ZO9A 3Q1SH 4BM7A 4AGQA 1FYTD 4O2FB 3FONB 4HZ1A 2NY7L 5HHVL 1AGFA 4YL4A 5G4MA 3I9GL 3ULUL 1EX0A 1QLRB 1MPAL 1BVNP 4DVBA 3N04A 1ZK5A 3ULUD 4FHBD 4HBCH 2ZWNA 2AJUL 2DRUA 1M9WA 3L17A 4AJYV 5D8JH 1MQKL 5E8NB 2DQ6A 5JYLA 1AGCB 1EBAA 2AV1B 2ZKYA 1W91A 1JAEA 1WA1X 3SQOL 2RJMA 2IPKB 4GXUN 3CFNA 3HPJA 3INUL 4N90E 1T1YA 2E75C 4GRLC 3WFBL 4F93B 3HZMA 4JKPL 5F9AC 1I8LA 4RETB 3PWVA 3FO1B 5LCVA 5K9JL 1FC1A 3GRWH 1B4JL 1IMHC 4XN4A 5F0PB 3IU4L 3P0YH 2BNQB 3B7TA 5FYLL 1DR9A 4Z76B 5ECJE 1C5DA 1QKZL 2A9DA 4FNUA 5E5LA 1QG3A 2DOCA 1FVCB 4DGYL 3OPUA 3QCVH 5DHEA 2PO6C 1XGQB 3PV7A 2Y69B 1M7DA 2EC9T 3NCCB 3TN0B 2MQ3A 1JV5A 3BYYA 1INEH 3IDXL 3I3BA 1ZVHA 3QEQE 4GLRH 4X8CA 4Z7OB 3JVFC 3UCQA 4K2UL 1OOAA 1BJ1J 1FLRH 1CI3M 3ZZLA 2BIQA 4L37A 1UB5B 4PS3A 5D7JC 3SO3C 4OUOA 4HSCX 1RMFH 4ZFOL 3DI2B 1HH6B 2HVJA 3FB7B 4H25B 4WO4D 1JERA 3UTSE 4JB9L 1QRNE 3EYOB 3D85A 15C8H 2BDNH 3O6KL 4W4OC 4B41A 5KOVC 4XOAA 2VMCA 5EO1B 3LQAC 1NEZG 4Y5VC 3OMIB 2BM3A 1W0WA 4QR7A 5JW4R 2K8MA 1BQHB 5I66B 4XN7A 3V5DA 2J4WL 2XZQL 4UQIM 3REVB 3NAAH 3RFZA 2H8PA 3S3SA 2NY0B 1XVSA 1URLA 2VWEE 1H0DA 4N6RB 3C2AL 2G75A 1GAFH 2BC4A 4KKAC 1N64H 3QDJD 3EFFA 1PPIA 3HMXA 5JHLA 1TYJA 5ENWB 2A77L 4BZYA 5GRZA 3C5SB 4KI5E 4Z77B 2Y23A 3KPPB 1T0NB 2W65A 3BN9C 4UF7C 4TQIA 4DKFH 1DJSA 1FI8C 4IGBC 2GI0A 3WE1A 4K7PX 3MGTB 4EBQH 2WTRB 3KGTA 5FK9A 4IU3B 4MXQD 5TE4H 2RB8A 4BK5A 3K6SB 3BVDB 1H3WM 1I1FB 4G7QB 4N9GB 5FM5M 3K72A 3F7LA 2WIMA 2ZSWB 1RUPH 1RIVL 1TTUA 1JWSB 4X80H 1F5WA 3BUBA 4ZFZB 4PJDE 4OLXH 4FNLL 5D1ZC 1JZIA 5DQJA 1U36A 2HWZL 5C0EA 1WFJA 1L9QA 2D7TH 4ZQKA 1V7ML 1YNLH 3MJ8A 3ULVF 5HGBA 5D1XE 4DPCX 3UOAB 3OJMB 3NZUA 3V6FA 3WFHA 4H20H 4NN7C 5GZNC 3GBNH 2QMJA 2YK1L 2IWEA 1JGDA 3W5MA 4QHNB 4OLWH 4LRNH 1YPZE 4PY7B 1Q8MA 3WNOA 4MFHA 3BLPX 5CGTA 4AK1A 4K7FB 4XPHL 4Q8BA 1FVDA 1K5NA 5JXAL 4P5TC 1SJEA 5ETUA 2EABA 2GK0A 4LL4A 2DD8H 3LEXA 2GW5A 1TVBA 3J7HA 1G1CA 2CHZA 4NO2B 3MCG1 4FQCL 3VXMD 1N4XL 2X3CA 3DYPA 3QQ9D 3VACA 2VLRB 1X5HA 2H6UA 4NEHB 4UT9L 2XYBA 1EZUA 4DPAX 4MQXC 5EU3A 4DNLA 3HFFA 1UATA 2WNKA 1ORSB 2P44B 1T5XB 5F7BA 1H3TA 1L6XA 1FA4A 3EF7A 2R7EB 2Y7MA 2YQBA 3S36X 2F1EA 1FWXA 2CM5A 3NSCA 4WY7H 3G7TA 5T1LA 1U8JA 3ZQ9A 1JGEB 4XXDA 5GPRA 1GHFH 1KEML 2YD8A 2DYPA 2BOCA 4QRQA 2IAND 5CGYD 3JWOH 1RUML 3UO8B 2NQDA 4QO1B 2IAMC 4XNQA 4F7PB 2XQYA 3QEUA 1S7RA 1TSHA 2IIJA 1EMTL 1TTAA 2E5EA 2R2HA 1I1YB 4JCWA 5JPNB 3JVGA 1PQZB 5H35A 4KK8C 2YGOA 4WSKA 4WHTB 3TJPA 1JTOA 3N3EA 5GIRB 4PJIF 4PRDB 2YQ3A 4GO8A 3KNBB 4GW5B 4PWFA 3LHAA 5CP3H 4M4RA 1U95B 3WIFB 3D0AA 5SV4A 4Y9FA 4KQ4H 4QRSB 1OD7A 5AB2A 1R3JA 2O1AA 3ABKB 3SGDH 3AW5A 2IXQA 4Q9BA 1MQ8A 3S88L 2NY2C 3HOGA 2CPUA 3N42B 1OGAD 2YRPA 1QW8A 1ASPA 4CSTA 4R7NA 3KAAA 1BZQK 1PLBA 4PV1C 2VSDA 3GBML 4X9IA 3TO4D 1WZAA 2W91A 1NGXA 3L1OL 4D0DA 4RISL 4FFYH 3G6AB 2BY3A 3BMWA 4IOIA 2ZXBA 5E6RB 2WQUA 4OR1A 4A63A 3GIVA 4TRPH 3T8XB 5FYKL 4FNQA 4EUPB 1IC4H 1U3YA 5HHXH 2W88A 5FYKD 1OARL 4AEIH 1U6AL 5C7XH 3CK0L 4WWKB 1TYEB 2R2BA 2FZ3A 1PL3A 1SZNA 1G9ML 2VJ0A 4KV5F 1DDHA 1XF3A 3NJMA 3T4AA 2V8MA 5KYUA 5H37H 4YHOH 4OM1H 4N0CD 3MO1A 1IGFH 4YSAA 1EFQA 1U21A 4LB8A 3V4UL 3VW3L 3S34H 5LBVA 2VDNB 4HHWA 2NXZD 2R23A 2VM3A 3B8YA 4EN3C 4IMLA 4LEBA 4CC1A 1D5IH 5F6HI 3D1MC 4JFYB 1UJ3B 2QGBA 3KDPB 2Y7QB 2VC2L 4XGZB 3TT3H 3QXWA 4JG1H 1LWJA 2HLFD 4BKLB 4AC4A 1U2HA 4Z7VB 1F11B 4GSUA 4BSWB 3ISYA 2FGWH 3PV6A 4XNMA 2EDBA 5HDQL 3UDWA 1UA7A 1X7TA 3J07A 3FFCE 1LP9A 3O4OB 1EO8H 5ERWB 2OKMA 3WI9A 4CVXB 2Y7NA 5GRXG 3V0WH 3X11B 2BINA 4BA8A 3CBJB 3ECBB 1XGZA 4GAYA 2Z7UA 1D9KB 3ARDB 2L04A 1B9ZA 2WXOA 4F2MA 1U2CA 1NCJA 1J10A 2WBJC 3KD4A 3X3GL 3LTVA 3JBG7 4NRYA 1CGSL 3PS6A 4JFFB 2AXJA 1PKQA 1II4E 3CJJA 3EJRA 2AEPH 2ZUQC 1PFOA 1WBXB 2VL4A 4AQ8C 3IWUA 5JR1L 5M94B 1FAIH 4QJ5B 1BSIA 2Z35B 5JHDB 3L3JA 4XMLH 4LPWA 1EEYB 1QMUA 1CC3A 4M1CD 4JFFD 5FA4B 5EC1B 5EU7E 2J73A 3U7WL 2ZUWA 3SDCA 3D4CA 5C3LD 2EDJA 1OPGH 5KWYC 3PE9A 5KG9B 1UZ8A 3B9KD 2VR8A 2WAHA 4WUUA 2CUIA 2L7JA 5C0AB 2R56L 3B7SA 3W9DB 4L3CA 3LSOB 3NH7H 2CK0L 3OHXA 2AEWA 4U1LB 5AQ0A 1JGIA 2Y0SA 3C8HA 1T7ZA 4HUWA 3A47A 2G2PA 3LX9A 3NIGE 4F2EA 2OW7A 3GXDA 2DLHA 4MJIE 1BVKA 4HXAH 4ZUWA 3ZTJG 3QYCA 4KZDH 3N40F 4P9HL 4XPBH 1LDPH 1IGJB 3GKZA 1RUKL 4L3ED 1EJOH 3MRRA 5C0AD 2CXGA 3VWJD 1JHLH 4QGTA 1XSKA 3MOAL 3VA6A 3SBPA 1IEAB 3ZR5A 3S9DB 4Z0BH 4X0KB 6FABH 5EOCJ 4OJFL 4QKXB 4CA4A 1DE4A 5D7LD 4U1MA 4P4KB 1KELH 2JF1A 3RPBA 3A6CH 4RMUA 1XSJA 5DO2D 1FNGA 2FWLB 5J3HC 2ADJA 5E23A 2ENJA 3QJHA 5EU4A 5INCB 2DQEL 1RUQL 4IIQC 2JH2A 3NQKA 1LEGA 5LQBH 4PRHE 1WO2A 5DMKB 2X2HA 3CDZB 3P3YA 2WZPD 2W9DH 2R0ZL 4GKLA 5L8LB 1E4HA 4JY6A 4F8NA 4IBQA 2FD6L 2CM6A 3ERXA 1QFWI 3WMQA 3P02A 3DSFL 1YVLA 2ZKHL 3ULUC 3RUGE 1G7LB 2R4RH 4HV8A 2JE8A 1SRDA 2JKLA 2R0KL 1RZIA 2UZPA 4R7VA 3IGUA 4KZ0A 4B9JA 3O6MH 3CUPB 5IB3B 2XFXB 3MRPA 3ZMEA 5AWNL 3EJYD 3ETSA 1GZQB 3UPCA 2J6EA 3MV9A 3KPSA 4KY2A 4ORGA 3P4OA 1W2KT 1YNTB 4HWZB 4TQEH 2EH8H 4JQVC 3IDUA 4PCKA 4MBOA 4XP6H 3T08A 3BIKA 5ID0A 1G9HA 3AT0A 1T1ZA 4MRCA 4KHTL 4F92B 2Y6TE 3PWUA 3T2NL 3LS5H 4JPSA 5J57B 2UWEE 3F7VB 5ELIA 2DQGH 3GB7B 3HHSB 4N0UA 3OAUH 4EUPH 1AS6A 3IDMA 5I0YA 1MHPH 1PX4A 4X4ME 1P0SE 4JJ5A 4F7CB 3UBXB 1ITBB 3QEGL 3TBVA 4P46B 3FS9A 5DHMC 3HRZC 2EIMB 2F9BT 3B5GA 4L4VD 4X5WB 4ODWA 1ZLVK 3UO1H 2RFXA 4JL1A 4BFNA 3MLUL 4DUWA 4EDWL 5CJXC 1N5AA 1X5MA 3ZVVA 3TEUA 1CL7L 3EJQA 3HLKA 3EFOA 4O2EB 4E41B 4QJ4B 4P57A 1J5HA 2VKXA 5DRXB 5F3FA 4ZODA 1D6EB 3RY6A 1MCKA 2VLJE 1O75A 3MRMA 1B2WL 3MV8D 4QRAA 4F20A 1J11A 1ZS8B 3KPLA 1A3QA 1TYRA 2ICCA 2NSQA 2PTVA 2VDNH 3RWFA 3CXDH 2BOLA 2VT0A 1TG8A 2ZJSL 2EIZA 3RL2B 5I1DA 5EOQH 1LILA 4NP4H 3FTXA 4UQAA 4PG2A 2XTJE 1QFPA 1E9OB 5F1KC 1Z3RA 1ZHBB 1OB0A 3V4VL 2BNRD 1QSED 2YD9A 3FRUA 3H7BB 2J8UA 3OG4B 4FXKA 3CZJA 3HE6B 4YBLB 4UTAA 4BH8B 2X4QB 5IVXB 3DTUB 4MGXA 3O3UN 4M3HA 3FW6A 5E6SB 2QPEB 4JK0D 1P5VB 3LEYH 1YEDB 2DQMA 1YY8B 4L23A 5ICZA 4Y19D 1WHPA 4MXQC 4I48B 4IBLT 5HDBE 2CGRH 1RERA 3OV6A 3SE4A 5HHNA 2W0PA 3QPXH 5IB1A 3OGOE 3MLXL 3T65B 4NQUA 4EZJA 4I3SH 4KC3B 2BW5A 2QGEA 3BAKA 2ALAA 3RNKA 3MOQA 4FKKA 1FRGH 1QTSA 1LQSR 3MSPA 1BV8A 5I0ZA 5EZJA 2GYSA 1CGYA 2OMBA 4PP2A 2JELH 1NFIA 4DKTA 5DJZA 2XJKA 5SWZD 4ZW7A 3DXAB 3MRNA 4AITA 5CWSA 2B9BA 2XQBH 4BINA 1CE1L 4GKSB 3R7RA 4PLOB 3S35X 4Z7WB 3TEYA 4Z7UF 3BWAA 3IVKB 4BZ1A 5I18H 1L9OA 2F5BL 3VWKB 5DFWH 4NRXB 1FGVH 1IAIL 4J1UB 1YLBB 1B90A 4FMVA 2WWMD 3MUGA 4BWTA 2EDOA 3O11A 4QIRA 4N8VB 4JLRB 4S1RH 4UU9B 5D7EA 3CZGA 5M95B 3CVIH 1MFEL 4LEXL 3T3PB 2XXMB 4M62H 3GUTA 1IAII 1TO5A 2IV9A 2A9AA 3D9AH 4FJ6A 3VWKD 2AEQH 4URKA 4PVMA 5A2BA 1VIWA 4XXWA 4M7LT 3O3BA 1W72L 1YECH 3D0LA 3RPIB 2J1YA 2P47B 3MV7A 4IHOA 2I9TA 3QG6B 2Q1EA 1JK9A 1QHPA 2DMGA 3QIBD 2ITDB 3ZYIA 2P4AB 4PI2A 5AW6B 3S5LA 2VXUH 1TVHB 3IN2A 4N2EA 3QJZA 3DJRA 4OZFA 5I5MA 2WUCH 4P2QA 4PWJA 4YO0B 4KTEH 5CGYC 5KW9L 4NKMA 2DMCA 3GNMH 4G8FB 2Z7WA 3HR5A 3WY3A 3DDGA 4G9FD 3T3MF 3UFIA 4PQXA 5JW4M 1N3NA 2OMTB 2JCCB 4LGSB 2DQTL 4DT2A 1WQVT 1L0QA 1XGTA 4FQ1H 2OP4L 4CU6A 4OJCA 3TBSB 4MJ2A 4F58H 4YFLF 1TQBC 1OTTD 3ASOB 1ND0B 3S37X 5IJDC 2PP9A 2X0WA 3VXRB 4XC1L 1GPOH 3M45A 1L0PA 5FA3A 5I74B 2B2XH 1BM7A 1JV2B 1XAKA 2CCVA 1XT5A 3CFJB 4G8GB 5F7LB 1ESOA 4Y1AE 2OYMA 2B08A 4HIHA 1WBYB 2ZX6A 3MMEB 4LCCC 4ERSL 3HAEG 3KWUA 1P5UB 3QHZL 5AUMA 4J4PD 4P5MB 3F00A 3E8UL 1QAWA 1JYWA 3T2PA 3TO4C 3ILQD 3ZQXA 3I02A 5DD3H 2QFPA 4WI0B 4R90L 3W0WA 1H3XA 3IJSA 4MWFB 4G8GD 5TDPA 2EDWA 3D30A 1QACA 1R5WA 1CK0L 5E51A 4N2IA 1AO7D 3DETD 3VFRA 5H94A 2ITFA 3QDGA 4FNRA 4H88H 5FECB 3ESUF 2WNXA 4RGMB 3KBFA 1KNOB 1BOYA 2VXQH 5L0QB 1IM9B 4HUUA 1MLCB 1QBBA 2DICA 2ZOUA 3JTSB 1IFGA 4HCFA 4K7PH 5LNEA 4CDHA 1NEPA 3PQYE 1G9MC 1LP9F 1I3RB 4G43A 4N0CC 1NCDH 2ADFH 3IKCB 1Y6MR 4Z7QF 2QQQA 3BGMB 1CBJA 4Z9KB 2DLFH 3HBQA 5L2KA 4K5PA 1RHHB 4PHXA 3LMJH 3F58L 1YMHB 5E9AA 4WNSA 2EILB 4ODXA 1IGYB 2DJMA 4FADA 5TQ2L 1AS7A 1GZPA 3VX1A 2NDFA 3U2JA 1G1KA 2OSYA 4JRYE 4NZUH 3JT0A 4PSRA 2HLFC 5IBTH 3ZR6A 1NFDF 3THMH 2AVFA 2CBQA 2CD0A 1CF8L 1I1CA 1T04B 1OO2A 2GY5A 4NHUB 4QXTA 3EO9L 5T1KA 3RYMA 3T0EA 1NJ9A 2XN9A 3Q2WA 1UJ3C 1DTUA 1H6UA 4FFZA 3N91A 1BGXH 3ARUA 4M93B 4XHJD 1P2CB 4G6KH 1UA6L 5IIEA 4AXWA 3BPLC 3GXPA 3M7FB 4KNUA 2P5EE 1A6ZB 2WWKO 5FM4A 3FU9A 5T5NF 1GY2A 4G59C 4IOFD 3QEQD 3P9MB 1AHKA 1XGRB 1M7XA 3WAJA 2X2IA 3EJJX 3OMNB 5CJOL 1TJHH 2VSMB 2GJ6B 2YGVA 5E5RB 3PP3H 3PF2A 3CVHH 5ACMA 5LDSA 3ZYOA 1D9KC 3ARDC 5TDOB 5K1JA 4QRRA 4S0HA 3AB0B 3L3DB 4PN6A 1BIIB 3EG9A 2JJTA 4N22A 3P0VH 1OGTB 4LKXB 5LN8A 4Q0XL 2X1PA 4M1CC 3S36H 5J11B 2ZP9A 1WUNT 3DUSB 1BOGA 2F53A 3ZE1F 3FUFA 1DBAH 1Q9KA 3OTTA 3SKMB 3B9KC 4ANXA 3LXAA 5B38A 2UXTA 3VI3A 5C0DA 1XH3A 1BLNB 5IKCA 4O4YH 4O58L 5DUML 3RL1B 4K23H 1S6NA 2D73A 2EDHA 4AMKL 1IM3B 1LO5A 2AC0A 1UWYA 2PETA 2HP4A 2VN4A 2R9HD 3QWRD 3VSVA 1SHSA 3LN5A 4XNYH 1FL5A 4BIKA 3TZVA 4JAMA 4HEPA 3AMLA 1NL0L 4K3JL 3K2UH 1PG7X 1G87A 4UAHA 2LVEA 4ADIA 1BQHG 3GKWL 2HFFA 3VWJC 3H3BC 1NIDA 1X5KA 4JN1H 4UDUA 5DZPA 2P43B 1MHEB 4I87A 5L8KB 2QVMA 2XNAA 3WIHA 4AOFA 5DO2C 3R06B 1ONQB 3QK0A 3AJ7A 4I18B 4XWGH 4UB0L 1UWEL 1G6RL 3VRLE 2EYSA 4MNQD 1RULL 4UQ3B 2ODIA 1V54B 5C0GA 3IAGC 4R84A 4U4IA 3NZHL 4BQCA 3HKZA 3LXBA 4W9GC 4M9PA 5BS0D 3QJOA 1S8DB 3D05A 3UJIH 2V2WA 3BEWB 4XNUH 4GRMB 2APTA 2XV6B 2JB5H 3EBAA 2MCG1 5F8RC 4KZCA 3EOAA 1CLYH 3PLYA 25C8L 5DC9B 2APSA 1BEXA 1B0RB 4UT6A 1BYPA 1PSKL 2HRGA 3KXFA 2BPBA 1PYWB 1MRFH 2OL3L 5T3ZD 3QUML 3EJYC 3REWB 3HHRB 3QRGL 4PV8B 2X10A 3H9SA 4MSWB 1DVUA 3VM7A 2RCSH 1EQWA 1TQCB 2D8KA 2CLVB 4MKTA 3WDHA 1KLFB 4HUVB 1OP9A 1C7TA 1W6WA 1QPXA 3VXNA 5BRPA 1J05A 3MX0A 1L7TL 4I2XB 1MWAB 5E6IB 3LRKA 4LSTL 4XPGH 5HPMA 3UGXA 4AYID 3ZSTA 4DF9A 3R4DA 2WGXA 4KU1A 5I1AB 3L9RA 2XVKA 3G6JA 4KZEL 3UTTE 4JO1L 3SY6A 2YC1A 5SWSA 3EFDH 2EO7A 4K3EL 3AY4A 2PPDA 5ISZE 1T5KA 2CZNA 3K1KC 2PR4H 1ZT7B 4JFXA 3HC3H 3RDTB 1VEOA 3BAIA 4X6BB 2Z4QB 4D7BA 2PYFA 4EMZA 2WLIB 1HN1A 4UINH 5AVZB 1U3HB 1ZXKA 5HYJE 4B60A 2EUZA 4M3KB 3K6OA 4ENED 4Y1TA 4DW2L 1JK8B 3BPNB 3BZDA 2XCMC 5KSAA 1A3RH 4HWUA 3I6GB 3ELAT 1J0YA 1TO4A 2XICA 3BVTA 3PABB 5IR1B 4PV9A 3RDTD 4ETQA 3J8F7 2BP5M 1PEZA 1RL1A 35C8L 1QWUA 1U3HD 2KZBA 4N2NA 1T0MB 1B4RA 1QFOA 4I4WA 1UT2A 1A6AB 1BM3H 1CXHA 5EZOH 1GZHC 4ZW3A 1N68A 5F44A 4FXGC 5IHZA 2V9TA 1DSYA 4N3TA 2BVTA 5SV3A 4L5FH 2EVGA 2X6UA 1PGRB 3V6OA 1BAFH 1JZEA 3SB3A 4FLSA 1XGUB 3WNNA 3N85H 1NCBL 2NTFA 3ZDYF 2HJFA 1JN6B 2FX8L 2ZUXA 1WD8A 3SDYL 2WXGA 2GITB 2QVKA 2PNDA 3U4AA 1DFBL 2YKLH 2YUXA 1CD1A 1DN0A 4XP9H 5ILTL 4DWHA 5C9JA 4AQ1A 1U8PB 1JHKL 2GI7A 3DVGA 4HZLB 5GRWA 2P28B 4NS0A 5D6CB 4IDJL 5IJBC 1FGNH 1WZ1H 4PVLA 3M8OH 3QDAA 5HJBA 1E40A 2UYLB 3TCXA 3T8VA 3O6FA 3CTTA 3LZNA 4Y2DB 2JJVA 5F7KC 1GSKA 3KPRA 4Z7VE 4JHBA 1MAML 3KVDD 1KTRL 1UJTA 3U1SL 5F7DA 2I69A 3QQNA 5AG9A 3CH1A 4J6RL 2XT1B 3ZE2E 4DUXA 1OCRB 3MYZA 1KBKA 4HXBH 1P7KB 4ZXBB 4JFSA 3LH2H 4ACPA 1OW0A 1ZPUA 2CMRL 2WWMC 2YZ1A 3FB8A 2N01B 1CFTA 3GIZH 1QO3A 4RGOL 1NC2A 4DGVL 3DYOA 1I9JL 4KTYA 2YMOA 2Z31A 5E8DH 1WISA 4OKVA 1YQVL 5F1NB 2ITEA 1F6FB 1UXLA 1UM6L 1N7ML 1JI1A 1WJ3A 4NRZA 5E5MA 3WFDH 1MRDH 2A1WL 3D52A 3ETBF 4U49A 4UOQA 4DERA 5ALCL 3VWKC 2IPUK 2ZCKH 3RHWK 5IMLA 4CGTA 4LF3B 5FDWA 3D18A 3R4RA 2AQSA 4PJFB 3FO2B 5B39A 1YEIL 3QIBC 1HHGB 1ML0A 3K2KA 5BV7L 4M5ZL 2J88H 4QHMA 3IGKA 1E4JA 2PTTB 4NZFA 5CFHA 4HAKA 4N25A 4B9FA 5CU9A 1C8PA 4X0NA 4YGVB 3UX9B 3R18A 1HHIB 3QRFM 1MI5A 2XG5A 4PW3A 1F45A 3D2TA 4NKIH 2R1YB 4GH7B 3DVNB 3MRHB 4TLTA 3QFDB 1D7BA 5J8OA 2AXHA 5L7XL 2YAPA 2HA1A 1Y6NR 2AVGA 4FYRA 3VSQA 4KK5D 4PGEB 3MROB 4HJJL 1OTTC 4F15B 5EB9A 1DVFA 1A1OB 3WFCH 5GISH 1KB9J 1VZHA 2FLRT 5HHPA 5HDWA 2HFGH 3GSNL 3OKLA 2VGLM 4N8CH 2GTZB 4NNYB 4CNIA 5FO9B 1OP5H 2FATL 3FTWA 1BX2B 3QORD 3UJJH 1CB4A 5G4OA 5FO8B 1D5XB 1S2EA 3GXTA 1J0HA 1T7WA 3IGFA 4DCQA 3HZKB 4J4PC 4W81A 1BZOA 4MD0B 1T89C 2HX8A 1S46A 4R4ND 3ILQC 1A6WL 4EIBA 4Z3HA 3OX8A 1KCUH 2I9LA 3FFDA 5EEZA 3KWXA 5ECGA 2QKSA 4MJ6A 1MAKA 5DHVB 5GS1C 4ODVH 4C56A 4LXFA 2CIKA 5KS9E 3BWUF 3BZ5A 4KX9A 4B9CA 5E8OB 2NNCA 3N43B 4ABUA 4GY4A 1P5UC 4UYQA 5EIVA 3FSVA 3SDDB 3V5HB 3ZDXB 2DMKA 1QFWM 1U91A 5K69A 3KWVA 3UAAA 1SXAA 3BKYL 1HFUA 2C1PA 4OZIA 3JWDH 2JKWA 3M17A 3OSVA 4OLUL 4QRUB 2BVQA 2H0FA 1QNZL 4WTZG 4PD4K 1A7OH 4A6YB 4AKOA 1NGZB 4H2AA 4W9HC 4LCUB 2AW2A 3KYNA 4PS7A 3VMPA 1OZUA 4LDCA 5JHAA 4LSQH 2QR0A 2Z92B 3ARYA 3SDDD 1UACH 4RGMC 1HKFA 5L0QC 1KBPA 5INDA 3CFBA 3UYRH 1M7IA 3T6QC 5CP7A 3RWHB 5C09A 4HOXA 3L2MA 4YR6B 3WFZA 1OF0A 2O5YH 4UM8B 3CZKA 2FHBA 4L8BA 4W9LC 2A73A 1PZBA 2J56A 3ZIMA 2NZ9D 3Q1SL 2VXTH 3TEWA 5EFIA 1E43A 1FO0B 1UWXK 4RFNC 5F89B 4HIXH 3O45B 1Z9SB 3S35H 3UG4A 3RGVD 3VFWB 1HCVA 4NC1E 4HWEH 3BZEB 1SN5A 4HBCL 2VL5B 4WHYG 3C6LA 3IWVA 1AI1L 1MFDH 4E41E 3I2CL 5D8JL 3QDMA 2CO6A 1IEBB 1PCXA 3VJ6A 3BPCB 2NUTA 3MRCB 4HOZA 2XTSA 5HI5C 4JZOA 3WTYA 4IQHA 4JPKH 4XVUD 5F3HA 3L4CA 1XF5A 3V5KB 5C0FA 5DVKA 3N0AA 5JNYA 4Z78B 1HCFX 4TULH 2F7OA 2D0GA 1FBIH 5B8CC 2G60H 2OBGA 3AADB 4M5SA 3A0OA 2VAAB 3GRWL 5AZ2L 3FSZA 5I0XA 4X6FA 3WTVA 5IFHH 2O93L 1WZKA 2OZ4H 3MFFA 4FQHA 4UBDD 1UYWH 1K3IA 1IL1B 3QQ3A 1FFRA 2V5MA 2UUDH 4MMXA 5C7ZA 4WI6A 4DP8X 3EGDA 3Q8AA 3UBXG 4B27A 5LVEA 1GVIA 3AQZA 3GJFH 5ANHA 4CBPA 1BQUA 5EU6D 1T03L 3CCHA 3AXHA 3QCVL 1KPRB 3R8QA 4B53A 2ADGA 4DQAA 3EH3B 5C71A 4HHAA 4AYFB 1H3PH 3HPLA 1INEL 3LIZH 4NPJA 3FQNB 4PJ6A 2PXYD 2Y3NA 3AB0C 3C75A 1GS8A 4LCWB 1DQIA 1XEUA 3ZLQC 4NGHL 1CBVH 4JFQA 4O02H 5IF0B 1INQB 2R9HC 4PJGB 4ZD3H 5HXMA 3TBTA 2IOOA 3OXSB 2COQA 5J11C 2GIYA 4R8WL 1BVLA 1RMFL 1KENL 5JHBA 4Q9CA 4GLRI 1VSCA 1JGLL 3QXTA 3DX6B 2O61B 1KBVA 3S37H 4ZTPH 15C8L 2BDNL 1I82A 3PNRB 4MNGA 4X6DE 2BRQA 4LCWD 3DO7B 4HIPA 4KGJA 5LAXA 3LD8B 1G7JB 4JFHE 5T1MA 5DQ9B 3DXAE 2Q86B 4RAVB 4YSUA 2AEIT 1S9XA 4E5XA 3IF1B 5IW6B 2E8YA 3IDGB 4Z7WE 2RA1A 5HDRA 5EU5A 2NMSA 1ZDQA 5I30H 5IJKC 2G4EA 3RWGA 2GFBA 3TF7C 5AZEH 1GAFL 3L1EA 1E4KA 1OAKH 1OE3A 1GH7A 1N64L 3BP4B 3HG5A 3LKNA 4PAZA 5EEXA 4JE0A 5KSVA 4WSJA 2QFRA 1P4LA 1WH0A 2BWQA 1YSOA 1YDPB 2NW2B 3ML9A 3U0PA 1KFGA 4DKFL 4TOYH 4XAKD 4ZAKD 5PCYA 4OVUA 1URIA 4I18C 1YEHH 3D2UD 2YO3A 3LQMA 1BVNT 4JANA 5TE4L 1A7NH 4GSRA 5EA0H 2X6MA 3VD9A 1QSFA 2GPZA 3MCLH 3HS0C 2YAQA 1RUPL 3VXTA 2BS8A 1X9UA 3G6JF 4PJ8B 5D7IA 4HD9A 4H1LG 5MP6H 3SYQA 1IAIM 3JUYA 4MZ3A 1MG3C 3NIDF 4PGJA 3VQ1C 1SUJA 4LCVA 3PJLA 4OLXL 2O26U 1OOWA 4N0FB 4H2CA 3EOTH 4WRLA 5CCJA 2D7TL 2I26N 1CLVA 5EUOF 4X7CC 3FT3A 1UZGA 4OU3A 2O6EA 3L16A 3LV3B 4NBYB 4WJKB 4A66A 5BQ7A 3HZVA 5DFVD 2ALWA 3KPOA 2WAQA 3G5WA 2J44A 3QNFA 1B9KA 1R24B 4N3UA 3LZLA 5AOZA 3POHA 1T80A 2F1AA 3WNMA 4P2OA 2UZYA 2VH5H 2ZKXA 3KS0H 5DUPH 3SDXB 1AZBA 4OLWL 2GSGB 4LRNL 4XO8A 3HA0A 3RE0A 3GZQA 1TQCC 2Y1ZA 3CN4A 2A38A 2VDOH 2XJLA 4J3OH 5FB8A 1KPUB 1TCRB 1EJFA 1O9VA 1ZANH 2VOTA 4XCFL 3T1FB 3JZ7A 4F2FA 2DD8L 1SEBA 3QJTB 4YHMH 4CDGC 1KUMA 1QRNA 2XPZA 4K5OA 2P5WE 1KJ3H 4OCMC 3B56A 3BRDA 2E7BA 2F7IA 3MN8A 4ENEC 3D4ZA 5T3XH 4E0RB 3NABH 2CKBH 3S2CA 1BXVA 2XY1A 3FB6B 4P5KB 3GF8A 2JQAA 3HVDA 3AREB 1T3FB 4PIRF 4GPVA 4RVBA 4WY7L 2FAUA 3RDTC 3IMSA 1PIGA 3FOLA 1GHFL 3BKML 3OVUB 4AE0A 1ECYA 1U3HC 4OZGA 3QULA 1JF1B 1HL4A 4NFCA 3MACH 4Y1AD 2Q3AA 3JWOL 1CYGA 4R83A 5JW3H 2GJZB 2AQTA 2NZ1A 4JRFA 4H8VA 1F13A 2ZCZA 1NMCB 2KPNA 2NDGA 1GRWA 3L7FB 1T1WB 1B0WA 4HC1L 4NQTA 3X1NA 4OV5B 1ETA1 1E8WA 1ID2A 3QEHB 1MCCA 1SHXA 4B0MB 1A8ZA 4PLNC 3BPOB 4OJEH 4WW2A 5HGHA 3N41B 2XPGB 2ZG2A 3U36B 2VXSL 3KH3A 2DJUA 4YLQT 3E3QE 3LHPL 4BUGA 4NSKA 4KQ4L 2XTLA 4PJDA 1MXDA 4OW6A 3FB5B 1PG7H 1DBKH 3ARBB 5DR5L 3VTTA 1AIFA 3U6RB 3TCTA 3TBWB 3J27A 2F58H 3FRPG 5FWRA 5D1XA 2WWKT 4BFEA 4OAWA 3PQYD 5K9OA 5KZCD 5F1IB 3PAVA 4N87A 1ETZB 3BO8B 4G9DA 4M7KH 4ZO9A 4Y8DC 3SGDI 3L2NA 3Q9PA 5LO7A 5KSBF 4TRPL 5HHXL 3TEZA 1YPZA 1IC4L 3ARBD 3L1GA 3VE0B 1A6PA 3IMTA 5AKTA 2WCPA 3HG0A 3L3IB 5MEOA 3PNWA 4AEIL 3G04A 5C7XL 2Y6SD 3W81A 2TAAA 3MNZA 4ODBD 3AU0A 4YDLC 4JRYD 2YD4A 5AW4B 5IOKA 4KXBA 1KJ2A 3OKEB 1IBYA 4YZFE 3BRFA 5T5FA 2NPLX 2PYEB 4PREA 4RNRB 3EJZC 4OM1L 1IGFL 2NNRA 2GJ6E 4X4YB 2X6VA 4G8IA 5E4EB 2B7DT 5MEPA 3BD4A 4ZXBC 3KGSA 2PPCA 3SQBB 3WXVH 1AXIB 4CMMA 3W38A 4PG9B 1D5IL 1L4IA 4KO9A 4AVHA 2JTDA 3O4LE 2AXFB 4R26H 1RJCA 3TT3L 2DN7A 5TE7H 4JG1L 1TENA 3JXAA 2OX5A 2BSTB 5BV7C 2D7NA 5JPMB 3HI6H 4NFDA 2FGWL 4YHPB 4PJCB 4LRIA 3MUY1 4R97B 4V1DB 3TVMA 2PCPA 4Y4FD 2ED8A 3KLHD 4HS6A 1U3NA 4G1EB 3V0WL 3ULVH 1F8TH 2HB0A 4HJTA 1DVSA 2QSTA 2VABB 1ZLUH 5EU7C 3L3HB 4GBXA 4AUJA 1E3XA 4PB9H 5HGDA 4OIAA 2W5PA 5K1NA 5IESH 1FL3A 1U93B 4JPIA 3O3AB 5GJSH 3VI4B 1L7IH 4KK5C 5GSRA 4X8JB 4WEUD 1Z6JT 3N9GL 4ZUTB 1OHQA 2P24A 4JQIA 1AR2A 2CHNA 3L13A 3TNNA 5DEGB 2AEPL 3Q05A 2NRDA 1BZDA 1F4YH 4YHNA 2ZWLT 3QORC 4U1KA 4UUJA 4HJUA 3VXQA 1FAIL 2C4FU 4OZIF 5K9KB 3NSFA 4XMLL 2DKUA 4JFDA 2ICWI 2BVOA 3QZWA 1MXGA 5TK4A 4KY1H 4QRPA 4F15C 3HJ0A 2DQFB 4K94H 2WZ0A 5IQ9B 4NQEA 5CEYB 2CWRA 4PBWD 3OM3B 1JZFA 3K1DA 4CVUA 2GJPA 5EN2A 3NH7L 4JX0A 5DEFB 2WSPA 4PJBA 2IGFH 2OJEA 4ENZA 1E5ZA 3QHFL 2R69A 4N85A 3MRBB 4KZDL 1NCUA 1CDUA 4YSOA 4XPBL 1LDPL 4PJHB 2W0FA 1Z32X 3H3KA 5TH2A 4P23D 4PWIA 4W93A 1EJOL 2X4RB 4AV4A 2I24N 3RLSA 5GGUA 2M83A 4Z8FL 1JHLL 1A25A 1WWAX 4CBZA 5F8QC 5IB4B 4Z0BL 1R3LB 4I2XE 3OF6A 3PAZA 3SDDC 6FABL 1KELL 3A6CL 1N70A 3DV4A 2A3TA 3U9UA 4OSUH 1HQ4A 1HWHB 1JV5B 1KCBA 3BGFB 5HSFA 5LQBL 4F91B 2NZ9C 3WUWA 1MDTA 1MW2A 4JL2A 2W9DL 1X4ZA 3W56A 3IDIB 1GTFA 4E68A 1I1AB 2I27N 3AU1B 2WWOA 2CO7A 5D2LE 2PMZA 3S0PA 4JMNA 3V4PA 3RGVC 4QUOA 3I75B 5BZDB 4APXB 3LJ3A 2R4RL 2NYKA 1GGTA 3SKNA 1FFNA 1ETB1 4BSJA 4F1ZA 3CD4A 4HYTB 4DOHB 3O6ML 1BBJB 3TPUA 2FJGA 5F7UA 2WKOA 5HDOA 4AYMC 2W38A 2GK2A 4OM0H 1A4KB 2ZXCA 3EYQD 4XVUC 3UTTD 3MZTA 4KXAA 1IFRA 3BAEH 1HOCB 1TZOA 1TETH 5ISZD 2DI7A 3VRIB 5L4IA 2JJSC 1HHHA 2Q7YA 3PXHA 5ITFA 2FYYB 3DJZA 5DVLA 4TQEL 2EH8L 4OFYA 4XP6L 1R3HA 2LR4A 5I15H 1VCAA 2KQMA 3OKNA 4R4BA 4XN5A 5DZAA 4MMYB 4UBDC 3FU8A 2CLZB 5D9SA 5HYJD 1J48A 4GB9A 4GQRA 5BZZA 2AHIA 4X5LA 3AG4B 1N0LB 1MOEA 1S7UA 1U3JA 2CDGA 2CDFA 3GEFA 3HE7D 3OAUL 5FGCB 5BUPA 1MHPL 4Y4KA 5FHAH 4WEMB 4MZ2A 2XZAL 3E6FA 2JQZA 2SEBA 2PXYC 3SCMB 3IPFA 2YEZB 5GS2D 4MJIA 1CT8B 3UO1L 1QQDA 2Y36H 1Q0YH 2QLYA 5KBDA 4NAQA 2FWOB 3QIUD 1RHFA 1Y7VA 3WGUB 1P6FA 4HKZB 3B7RL 1KBGL 2FJFB 4FABH 4LIQH 4Z6AT 2EE6A 4IBTA 3KYOB 4IK6A 2VDNL 3QJFB 2ZYHA 4KAQH 1RZQA 5F9WB 3QUZB 4EOWL 3KE0A 1KIQB 5EOQL 4NP4L 1XQ4A 2W8CA 2DWEA 2IBGA 4V2CB 2AJXH 4H8WH 4PRHA 4ZOBA 3MRJA 4DP5X 1S7TA 3JUZA 1G6VK 3NDYE 1ZHLB 4WU7A 3TBYB 3BVVA 3H9HB 5A40E 5FKPA 3FUJA 3LD8C 1VAHA 1XFPA 2ZKMX 3LEYL 2DIBA 1U58B 3DX8A 4GT0A 3BUPA 1HEJC 5GGSA 3D39A 1AZNA 2CGRL 3MYJB 1DHKA 3BSZL 3QPXL 2XA8H 5JIQA 2YA2A 2MCMA 1OTSD 4I3SL 4PJFE 1A22B 1BXUA 2ZTBA 1NCWH 3DIFA 1IAMA 3V0HA 3O2DH 1ZSDA 1J18A 1FRGL 3PJSB 4LLQB 1BZ7A 1J0JA 2WOBA 4DSYA 2JELL 2QQKH 3VGAC 4BFKA 1ZAGA 2Q2LA 3AGWA 4BV1A 1XV8A 1P1ZA 2B9AA 4HS3B 4PJ8C 3K8LA 2X4SA 1WAAA 2XQBL 4O00A 3VAEA 2ESVE 4JDEA 4Y16A 2OI9B 4EF3A 3W39A 5I18L 5I76A 2BVUA 4M8QA 1WCBA 2JIXD 3WLBA 1RQ5A 1SY6A 1V27A 4X5XA 3CDGB 3KYMA 3RY4A 4OZHB 5IB5B 3FO9A 4PJ5B 2CQVA 5DJCB 4S1RL 2O5ZH 3NN8B 5CGBA 3CVIL 4FJZA 4BUHA 4IBUA 3GRWA 4KI5F 1X4XA 1HL8A 4LDLB 2A83A 4M62L 3IN0A 2ITCA 1TZ8A 4AMWA 2WK2A 3L4VA 1AGBA 5ICXB 3BXNB 2H26A 1FFPA 1ZV2A 3BKJH 4P2RD 1Q0XL 2EC8A 4J3UA 2H0JA 4NQVB 4IRJD 7FABH 1L0XA 1E27B 1NPNA 2OMZA 5D1QB 4HEMA 4K8RL 5F9JA 4KTDH 3VB8A 2GUYA 2VXUL 2G3MA 2AJYH 2X2YA 3GSRA 4GUPA 2YPLD 4K8RD 1KYFA 4PJDF 1IE4A 1OAUH 5CIPB 1HHKA 5I6NA 5BRZE 4LEOA 2WUCL 2NYYD 4KMTH 4ALAL 1F00I 4EN3A 5CJ5A 1V5JA 4PY8J 3GNML 3ZDXE 1MFBH 2E4FA 5JW5A 2MMXA 2GEEA 4AT6A 4LSSH 3AREC 3SGJA 3R7QA 2HVKB 3FQRA 5CILH 3TO2A 2UXVA 4GG6A 3VX0A 3OKDA 4FQ1L 3QPQD 5F1SA 1MVFA 1YPZF 4F58L 1CDCA 4M1DH 5T3XE 5LGHL 1AGEA 3B43A 3UG5A 1LEIB 1MCDA 5FR3A 2B2XL 5D4JA 5IMOB 4ICXA 3P2BA 2BOBA 3WJLA 4B7LA 1RZJC 1AE6H 5LGJA 2VIRB 3FO0H 3ARFD 4KQ3L 1DUZA 4LCIH 3LKPA 2WBJA 2X1OA 4PRNB 5DC2A 4KITB 3NT0A 3SJVB 3AACA 1QLFA 4YHLH 5JHLH 2KHAA 2HJKA 3GGWB 4IKNA 4AQ8A 3ARBC 5JMRA 4XCCH 1HS6A 4JKKA 3C5XA 2LT9A 3AM8A 3U0WH 5IHWA 1AMXA 1JNNH 2NY1B 4H88L 4XOEA 2VQUA 2P3YA 2Y6SC 4BFIB 1C08A 5ESQB 2VXQL 3OWRA 3CFEA 3C5JA 4JCLA 1YZZA 5JMOC 4K15A 1VFBB 4FQ2L 4K7PL 4MJ4A 1Z5LB 3EH1A 2ED7A 2HT4D 2UY6A 4E2OA 5ICYB 2DEWX 5C08E 5EBWB 2VMJA 1NCDL 3L9YA 2ADFL 3L3JB 4C58B 1P7QB 4LHUA 3UBXI 2GIMA 5BW7C 4LPYA 4GW1B 5KTEH 4HVBA 4PH8A 2XG4A 1CQYA 2DLFL 2BSEA 1TSRA 1YN7A 3QPKA 3FYIB 3LMJL 5D71H 3DPBB 5C0BD 3RHWF 4QT5A 1UM4H 3HAEA 3SDAB 2KYIA 2J1WA 4X4XA 4UZUA 1KIPA 4X42A 5IBTL 1PJ9A 4ONFH 1XL4A 4AV0A 4OGAD 2IF7A 5E4EC 2A9MH 3BMVA 1RU9H 3THML 1LHZA 2WLJA 5DHDA 4PJ7A 1BVKB 2IALA 1TNMA 4PJGE 2X1WL 4PJXE 2CUAA 5DS2A 1E9QA 5JXEC 3EIFA 4Y5XA 1NGYA 2W60B 3BUQA 3P69A 4G6KL 5AVRB 3W57A 4F80A 3EJPA 3BHBB 3IGAA 3OC5A 4YAQA 4NO0A 3CLEH 3BDBA 1TJIH 3H53A 3QG7L 4U6HA 4CC0A 3R0MA 3QWOB 2DTMH 4WW1A 4L2YA 4R97C 4PJBF 3HC0B 2LABA 3IXAA 4L29B 1JE6A 1TJHL 3VCLA 1RUAH 5ACZB 1Z1WA 3CVHL 4L9DA 3EHBB 3UADA 4O2FA 3FONA 4LP5A 4JVUA 1MVUB 4OF7A 5IFJB 3B37A 1X3DA 3CN3A 2F54B 2XWDA 3P0VL 2F6AA 1IJNA 1BQ5A 1QLRA 3S36L 3NRQA 3FCBA 3VU2A 1G0DA 4YSQA 3ULVE 1F41A 1TDQA 3DHMA 3DECA 3QZMA 1GJUA 1UGKA 5CZKA 1DBAL 4FQJH 2FSEB 2PWHA 1ID5I 1OSYA 4O4YL 3EHBD 5E8NA 5GSVB 1AGCA 2AV1A 4HMCA 4K23L 1FNHA 4J23A 3WY1A 5GJTH 4OT1H 3C60B 2IPKA 3K8KA 1EDHA 3ALXA 3SOBH 3MLZL 1JGUH 2XUWA 1DN2A 1DLHB 1N6UA 3FO1A 5C92A 3I9IA 3K2UL 5MHSD 4P23C 1H9VA 3F64A 4XB3A 2BNQA 1QABA 4FFYA 3P11H 3HRZA 4Z76A 1FN4B 2B5IB 3QJUB 4APQB 4HK0B 1ADQH 3Q6GL 5CJXA 3EYUH 4IKJA 3STLB 4JFEB 2OSXA 1FVCA 5KJ4A 3MCKB 4RDQF 4XWGL 2WKOF 4DPBX 3TM6A 4Q6IB 1XGQA 4PM1A 3QHTC 1SLUA 2BSSB 2UXGA 1Z7JA 4X5QA 1RJZB 3Q43A 3ECUA 2UVFA 5EOTB 4Q2ZB 2EUVA 4EZLA 3G5ZB 4F5CE 5H37A 4NJ9H 1OWRM 1UB5A 1OB1B 4TLKA 4XNUL 3UJIL 4YSRA 3BCDA 3GRGA 1VGEH 1HH6A 4DK5A 1FNAA 3FB7A 4H25A 1FDLH 2EE3A 4JFOB 1CLYL 3EYOA 2EAEA 3RVWD 3G08B 3IFLH 5I8OH 2XN0A 5EO1A 3BJ91 4FQIH 1MRFL 4HCRA 3GQFA 1KCWA 3O2VH 3L5HA 1BQHA 5I66A 3LPWA 3PP3K 4MLSA 3NIGF 4ZOCA 3Q8CA 3REVA 2RCSL 3LZFH 4N6RA 2VDKB 1M2VB 4ODTH 3RKDD 3F83A 1ULVA 4ODHH 2IH1B 1JPSL 5ENWA 2OTUB 3C5SA 4Z77A 2P5WD 4XPGL 3T2LA 2EDTA 3KPPA 1T0NA 3QAZB 4U1SB 3MGTA 5A1AA 2WTRA 3HUJB 3V6BR 5FKAB 4G2AA 3AG1B 4IU3A 1W8OA 3VFPB 3K6SA 3HNSH 3ZKXC 3V10A 3QUYB 1I1FA 5EEWA 4M61B 1OXYA 4N9GA 1G0XA 1GYUA 2WOYA 2ZSWA 1NBZB 5CSBA 1FHNA 3ARQA 1CD8A 3EFDL 4GQZA 1JWSA 2PCFB 2CE6A 1WA0X 4FEMA 4A7GA 2PR4L 4W1TA 3HC3L 3HS9A 4OFIA 4ZFZA 2XI9A 1N2RB 4GNKB 1EHAA 3QIUC 4UINL 3WDIA 1XIWB 3I9PA 3LNIA 5EBGA 3T2OA 1DJYA 3B8SA 1JXDA 2FNWA 1NAKL 2JKTM 3VXSD 4ZS6C 4YFDB 1Q38A 1A3RL 4ONHB 1JNLH 3LNDA 3QZOA 4OIBA 3ZO0A 2ZG3A 3FUMA 4JO8A 4QHNA 2AP2A 2NY3B 3GI8H 4PY7A 3TH2T 1Y1UA 5FFLA 2BIHA 3NUKA 3Q2NA 2HZHA 4K07A 4K7FA 1BM3L 4IRSB 3FQYA 5EZOL 3B34A 4ZMQA 3PGDB 4KKCD 1ROWA 4LLAA 1Q1JH 3DX1A 4L5FL 2EH7H 2AI0H 1K9TA 3QUZC 4RAHA 1BAFL 1XAUA 3N85L 2VSKB 2VLRA 2PYEE 3BLBA 1SLWA 5EEYA 2ZNXA 4LIQE 4WZ9A 1WAAF 3BVUA 4NZTL 2AJVH 4IRSD 2VDMH 5G2NA 4FAAB 1ORSA 4XP9L 1T5XA 4OD1H 3GM8A 4XPAH 5I19H 4FI7A 2R7EA 4FA8A 3EH4B 1OTSC 1B0GB 1OHZA 4OI7A 3MU3A 1U8CB 2JXMB 5JIMA 1JGEA 1FGNL 2LU7A 3PPEA 3M8OL 3QS3A 4GKNB 3BIBX 3NP4A 1KB3A 5DSCB 1OAYH 2IFFH 1ITCA 1TU2B 5F1OB 3PFQA 4QO1A 4F7PA 3OSKA 3IBEA 1WHOA 3VD2A 2EIEA 1FNFA 1I1YA 4MBRA 2IC2A 2QL1A 5D4IA 1D5RA 3II1A 1LGVA 1PQZA 1N0XH 4OFQA 1XGTB 4FGMA 1BG1A 4ZUVB 4NPYB 2MRYA 4WHTA 5I23A 3OAWA 3IDNB 4HXBL 1I8KB 4LSUH 5F7AA 4UZGA 3O4LD 4PRDA 5GIRA 3LH2L 4EE2A 5A2AA 1RVFH 2J1KA 3CFDB 3KNBA 4GW5A 3CDFA 3C9NB 5FUCC 2CIIB 1U95A 3GIZL 3WIFA 3NYKA 1OM3H 2XV3A 4NXSA 3ABMB 3ZTNH 4BD4A 1YMMD 4QRSA 4XNXH 3V55A 4J8RB 4MAYB 4AGNA 6CGTA 3VD7A 3QXDB 3ZKQD 2J6EH 3WFDL 3CXFA 3H9ZA 3OBAA 3FUNA 1Q0EA 2VW7A 2ZCKL 3C6SB 4FTVB 3UEZA 3BGAA 4LVOC 5I71B 3NVQA 1I9EA 2VAJA 2YARA 4PRIB 3JV4B 5EMYA 5HDBF 4JHAL 4IRJC 4EUPA 4OCSH 1XF2A 5DA0B 3T8XA 4ZFFB 1OCCB 1O7VA 2J88L 3UGEA 1UXMA 2LHAA 5IEKB 3UAFA 5DGRA 1D5ZB 4K8RC 2AERT 1TJMA 1QRKA 4WWKA 1LLAA 2E59A 2CBOA 3X3FH 2NYYC 3FQTB 3P9WB 1MWOA 3MBWB 4P3WA 5BXFB 4ALAC 1G7PB 5AVXB 5E70A 4MCYB 5D1QC 5SX4H 2JV6A 3C12A 2FQGA 2GHZA 2ZOLB 1ES0B 2B4CH 3FC8A 1DVTA 4YLCA 1U41A 5C0ND 3QPQC 5F7WC 5HY9B 3WFCL 3RPKA 2NW3B 5GISL 2VLKB 2XX0A 3HR6A 1ZY9A 4JFYA 1UJ3A 4KVCH 3V0JA 2HFGL 2Y7QA 4KOCA 4ZMPA 4N8CL 2YXMA 1XDTT 4W9EC 4XGZA 1C16B 3UJJL 4EQ2A 1BLIA 3ARFC 2XVGA 2IAAC 5C07E 4BKLA 4DVRH 4Z7VA 1F11A 3GZKA 4BSWA 4JO5A 2ICEC 2VDKH 1F1DA 1IX2A 3DK0A 3W9EB 1R75A 5F7EL 3RVVD 5ERWA 1W8NA 2WO2B 1KCUL 1SLXA 3MV01 1C8QA 4CVXA 4UTAH 3X11A 4PCSA 3ECBA 4YDIH 3UAJA 3W82A 1GS6X 4ODVL 1GOHA 3Q13A 1D9KA 2V17H 3QAQA 2QEJA 2VUYA 3ARDA 5AAWC 5HVWA 5LWYH 1WD9A 3N40P 5IBUG 3R8BB 2YD2A 4XI5D 1SXZA 4DOHE 4JFFA 5FPIA 2IG2L 1XCXA 3JWDL 3L5IA 4PJ7F 4N2DA 5E4OA 2HT4C 3VFGH 1NUGA 1WBXA 2VDPB 3TV8A 1A7OL 3UAEA 3KBPA 4HSAC 3QWNA 5MEQB 2Z35A 1IC1A 3K0WA 4LEEA 5JHDA 1QHOA 3P2TA 2IH9A 4YQXH 5E7FA 4KRPB 1ZA3B 3BAWA 1UACL 5FA4A 5EC1A 2RHEA 3UYRL 1AYRA 2IGTA 3IETB 2TRHA 4D0BB 1F3DH 5KG9A 1SQMA 2O5YL 4R0LB 2WXMA 5C0AA 3W9DA 4BZ1H 5IV2B 4DKAA 3LSOA 1J86A 5E6YA 5FGCE 2V3DA 3W11D 3L3OB 1RH8A 4U1LA 2VRKA 1YAIA 1DQLH 4OGAC 5LG1A 1A47A 3BSGA 4PGCB 4HIXL 2HUHA 4AYEC 3U2SB 3TURA 3S35L 2DY2A 4I8DA 3K71B 1THAA 4RZKA 1IGJA 3SDAC 2QHLA 4EZMA 4ELMB 3LQZB 5AVQB 1EVUA 1EJ6A 1QSZA 4X6CB 1LNUB 1J8HB 1IEAA 2FT8A 4X0KA 1SXBA 3MLTB 4JPKL 4P4KA 3ZE0B 4P2CG 4WWID 1OP5K 1I85C 1TT6A 1GL4B 3D7PA 4K5NA 4TULL 1FBIL 5E9DB 3OB0H 2G60L 5K33A 5INCA 4KXZI 5GGRB 1G1YA 4RMTA 3H56A 4FFWD 5DMKA 1UB6B 3CDZA 2A2QT 2OZ4L 2DLGA 4OZFH 1YNKH 4PJAB 4XMKH 4ANVA 1UYWL 1DQMH 2PUQT 3BCFA 5T1DH 4AIEA 2Y22A 5GRJH 2V2WB 3CIQA 2BFVH 4S0TD 4WV1B 3SGEI 2AXGB 1MJ7H 3SPHA 3EGSB 1MCIA 4NXKA 1G7LA 2XWCA 2MCPH 3BH9B 4BH7B 1DJWA 4GSQA 1H3PL 3RWJB 1K3ZA 3EHBC 3LIZL 4MNHB 1MH5B 5HI3D 4A2GA 3CUPA 5IB3A 2C9AA 2XC8A 2XFXA 2RGSA 1CBVL 4ZQTA 4O02L 1HESA 1ZVSB 4X5PA 4ZD3L 1GZQA 4NLHA 1CDIA 2K7QA 5DJYB 2QSVA 3UZVB 4PP1D 1HSBB 2JTYA 4BWWA 4NKQB 1YNTA 3BQUD 4AQAB 4HWZA 2K4AA 3S37L 3LNEA 5DC0A 4ZTPL 5DJ0B 3EO1B 1EPFA 2ED9A 1SYSB 3NJKA 5DHYB 1EDQA 1NCCH 5DU7A 3ZKMD 2EE2A 2APBA 2MCAA 1MEXH 3Q5TA 3F7VA 4QI3A 3WMPA 1M7UA 1CICB 3BH4A 3GB7A 3HHSA 5B7MA 2NY6B 1F0LA 2VJXA 4PUBH 3RIAK 5I30L 4Y8AA 2ENPA 3V2AR 4F7CA 1QA9B 3UBXA 2QMKA 3FT2B 1OAKL 2GG1A 3EZJB 2X41A 3QFJB 1CWVA 4P46A 4XBGB 1S9WB 3Q6FB 3QCTH 1BD2B 4ANUA 4ANWA 3ZOAA 4A04A 4APQC 1KTCA 4X5WA 4ECNA 3GS4A 2FJSA 4GG8B 4TOYL 1NLDH 1R5VB 2AABH 3DJSA 4UQDA 4O2EA 4E41A 2H3KA 3GPSA 1I7ZB 3I74A 1FUNA 5DRXA 1D6EA 4R7DB 4WIQA 3HC4H 2ESVD 5AW7B 2HTLD 5EA0L 1IGTB 1ZS8A 4N5ED 1IC5H 3QFJD 1ZRUA 3RVWC 4C59B 4K55A 4W9DC 5MP6L 3AWGA 2FHFA 4KROD 3TX4A 1PEWA 2BWIA 3LIUA 2VDQB 1E9OA 4A7GF 1Z9OA 4XX1E 3T2QA 3EOTL 5AKSA 1BVOA 1ZDSA 5I1EH 2WXJA 1ZHBA 1UOLA 1A6TB 1WG3A 2UUDK 4MD5B 4WHDA 4XBMA 3RKDC 4OGXH 3SE3A 1JRHI 3H7BA 5DDHB 1HXMB 1F4AA 3GJFK 3HE6A 4BH8A 1W8EA 3TH4T 2X4QA 1GIGH 5IVXA 1SDYA 3DSNB 3MJWA 1T2XA 4L1LA 1L9NA 4ES8A 1P5VA 2VH5L 4ZYKB 1YEDA 1YY8A 4FEIA 1EIBA 4YEFA 2L0DA 4I48A 2XWEA 3VRLF 1IEHA 4JMXA 4YXKH 2FDBP 3T65A 3UTPE 3JZYA 2PCYA 1NBYB 2VDOL 1X6NA 2JVUA 3NRFA 5BRZD 5D93C 3CNKA 1NCTA 4YHML 5DC4B 1E4XI 1KBBA 3OMAB 3UMNA 2A4ZA 3SN6N 2KZ1B 3OLDA 3P3RA 1BJ8A 2KLSA 5D7SH 1KJ3L 1VFOA 2ZXEB 3QUYC 1JZGA 4LPUA 5F7FA 4AIXA 4BFGA 2EO1A 3QUXB 1P6WA 2DWXA 1LP9E 5T3XL 2OJ1A 2CKBL 3C8DA 3NABL 1S3KH 4DEWA 4YSCA 4J3VA 4TNFA 1IO4C 4GKSA 1MRCH 2E9JA 3MJ9A 4I1RA 4Z7WA 5T3XD 3ROOB 2B77A 2QKIB 5EO0B 4Z7QE 4FG4A 4ATWA 3IVKA 1A1MB 2DTSA 3VWKA 4NRXA 1XIWC 3OZKA 3MACL 1WF5A 3QUXD 4BCXA 5JW3L 4N8VA 4JLRA 4GKZB 4KKCC 3FTGB 1U33A 1PKQE 2OXHB 4UU9A 2VNCA 3QIBA 2MFNA 2IADB 4FS0A 4UTCA 5CN2A 3AY2A 1WV7T 3QB7C 2BWDA 3DNKA 4NQSB 1NOAA 4RFEA 4Y0GA 1G5AA 2NY3C 5J0BA 3F7RA 4EI5B 2BHFA 2H2PD 5FDWB 5I16B 1R17A 2CRYA 3U9PL 2GUOB 3RPIA 4IRSC 4ZNEE 1UT1A 2K7PA 3QG6A 3Q5OA 2IV8A 2ITDA 1XH0A 1BIHA 3WIHH 3CBRA 1PG7L 1DBKL 3STBA 3IRPX 4IM8A 4WUUE 4H8HA 3WO4C 1TVHA 5HHOB 4OGQC 4ODUB 1IBGH 2F58L 3CU1A 5G5DB 3RKPA 3NCYS 3CGTA 5C08D 4YO0A 1AOHA 2H1PH 4M7KL 4G8FA 4J3TA 3MBEB 3WYRA 3VXUB 5GS0H 5GZOD 3NA4A 2OPCA 3MFGB 4OIFA 2OMTA 2JCCA 4XHQA 1L9TA 1LK3H 3I6LE 3HG1B 5I2IB 5I28A 1JF6A 3TBSA 5A16B 3FN0L 1SJXA 3ZE1E 1XH1A 1ND0A 5JDJA 4NJAL 4UT6H 3VXRA 3K7UA 2APVA 3LPFA 3VXUD 4K5MA 5A6IA 1JV2A 1KLUB 3CFJA 4G8GA 2H3XC 2DV6A 2W9EH 1WBYA 3QNZB 2BMKB 3FQ1A 3MMEA 1DL7H 5C6PB 1P5UA 1Z5HA 4P5MA 4OUUB 3X14B 5I5JA 1U8IB 4G6JH 5EPMB 4UAOB 5ADOH 3QZPA 4GIOA 3WLWD 4OLYH 1WFIA 1A7QH 3WXVL 4WI0A 3E7JA 2X89D 3QNXB 4G5ZH 3UERA 4K9EH 4MWFA 3VFOB 4MAYC 4WWPA 1ZHNB 4R26L 1DJXA 5TE7L 5IHUH 4W9FC 2NNAB 3JWNC 4CL7A 4WFEE 5DJXB 5I1LB 2O6DA 5FECA 3HI6L 5I71C 3X1FA 1KNOA 1EZLA 1IM9A 1MLCA 1KV7A 2GBAA 4Y9EA 4HWNA 3FU0A 1VLXA 4KJQD 1JZHA 4Z7VF 3WNJA 2BVQB 2EKSB 1SOXA 3MV9E 3RWIB 3ULVL 1F8TL 4FKEA 4CKQA 1I3RA 2BXZA 3X2QB 4JUTA 2G2NA 3LKOB 2VQTA 2AV7B 3IKCA 3NJGA 4PB9L 3ULVD 5H4ZA 3ZE2F 1IU1A 3NFPB 1NICA 3NA9H 3BGMA 5GJSL 4GAJH 3HMWH 1L7IL 4LLMB 3Q3GB 1M7IB 3ETBJ 1RHHA 1EEUA 1YMHA 4LHQB 1NTDA 1IGYA 3RZCB 2B3RA 5CCKH 4JFEE 2Z0UA 1F4YL 3FF8A 3S3BB 2HG0A 5IREA 1OQXA 3IJEB 2GJJA 5I9QB 4U6TA 1OTUD 1E8ZA 5CD3B 4NQDB 2WO4A 1X9LA 1T04A 4NHUA 1YYMH 3C5ZB 4KY1L 4FLRA 1HZHH 1YYLH 3RVVC 1HSAB 1PLAA 3ZQWA 4K94L 4U1HB 4L2LA 1X5GA 4JN2B 5JQ6H 4LLYB 3T0AA 2LU4A 3F7YB 4PBVC 1TQVA 1P2CA 4GSXA 1A7BA 1U8MB 4ZDHB 3ELQA 3VYOA 4Y4HB 3LY6A 2FCBA 4FZEL 1S9KC 2KT6A 1HI6B 5F3HB 1A6ZA 5CAYB 1OSPH 3KPQB 4HLZG 4KWUA 1JPST 2ZX5A 2IGFL 3QO1B 3P9MA 5EHFA 1XGRA 4F9PA 3MOBH 5IJVB 4OD3H 4Q74A 4ADGA 1XZWA 2GJ6A 2IEPA 3VQLA 1O7SA 1L6PA 3SO5A 2CPCA 4PJIB 4Y4HD 5TDOA 1G5GA 3T9WA 3L3DA 4A2DA 1XSOA 1BIIA 1FPTH 2J8UE 2F8IA 1OGTA 3QWRA 4GFTB 4LKXA 4LO9A 5DMIH 5FO7B 4B9YA 3L6FB 3FTVA 2R0WH 3DUSA 2OLDA 1ZOXA 3EXLA 2CR0A 1GGYA 4J12A 1S7XB 4LESA 3SKMA 4OSUL 1TMQA 5CUSH 2DIEA 2CO4A 3BD3A 3HUJE 1Y07A 4PCYA 1QR1B 3OQRA 4NQCD 1BLNA 2PF6A 3QCUH 5AL8A 3RL1A 3TWYA 3W11C 4PJ9B 4G6FB 1IM3A 3MLRH 2E0PA 2VDRL 5C6TH 1CIDA 1PJWA 3LRLA 1GGUA 3B6SB 3VSUA 3BE1H 2Q0ZX 3DMMB 1ZLUK 4HG4K 3V4LA 5IJKA 1EH9A 1P4BH 1KTLB 5HGAB 4KKZA 1SQ2N 1MCPL 3GS0A 4PJ9D 2XXFA 5FUZH 1V3KA 3VMOA 3ZYZA 5KS9F 1VADB 3C2SA 4IS6B 1U8LB 3NBNA 1NINA 3HBGA 1MHEA 5L6YH 1UVQB 3NCYP 4CMHC 4BRVA 4K3HA 4DTGH 4G72B 3R06A 1ONQA 4I18A 1X5IA 3BAEL 5TK2A 1TETL 4WNQB 2ZE0A 4Y1SA 4KK9D 4UQ3A 4FQXB 1NEUA 1OSZB 4FFWC 2NSXA 2HJLB 4FQQB 5I15L 2P1YA 3KL0A 2NT0A 1KIRB 1YNTF 4N2BA 4G5AA 1S8DA 2O72A 3D25B 3BEWA 4AGMA 4GRMA 4XODA 3QC6X 5E94B 3U9WA 1ZJAA 4MCZB 1KG0B 5C0CB 4KNQA 2EEXA 2BK8A 3GHEH 3LKSA 3VD1A 1H5BB 5F9OH 2WXIA 1B0RA 5HI3C 3LRSB 5B1CA 1AZZC 2R39A 1PYWA 3EDKA 3U4EB 2RTTA 1ZPLA 1ASQA 3REWA 4PV8A 2Y36L 4MSWA 4WV1C 4BFBD 1PZSA 2NY4D 43C9B 3APDA 1UCBL 2UY7B 4PRPD 2CLVA 1NEZB 1KLFA 4HUVA 4ILDA 1A65A 1T22B 4JY4B 4PP1C 5DEZA 5L9DH 3BQUC 3OJDB 4NPKA 4LIQL 4YC2B 1LO3H 4JM2B 1GYVA 4P2QE 4I2XA 5DZJA 1MWAA 5KYWB 5E6IA 3CZNA 4KAQL 3ZKMC 3JV0A 4JDZB 1ODAA 3ZKSD 4Z0XB 1VFAB 3MXWH 5I1AA 2AJXL 4H8WL 3PHAA 1BQRA 3ARGD 4MB3A 3O9WD 1SJHB 3BVNB 4RSYA 1HTYA 1H19A 1JZ6A 4JGMA 3D07A 5BOZG 4OLZH 2NLJB 2YD0A 3S2AA 4CN4A 5I0WA 1NDMB 2QSCH 4XO9A 1ZT7A 2Y5TB 1FVEB 3WSQH 3RDTA 1JPFB 4X6BA 2Z4QA 4WFGE 1A7RH 1TZHB 2WLIA 5CBAA 2Z1PA 1U3HA 3F84A 3PL6D 5IVXF 2NY6C 3ZHFA 4GXFA 4HOMA 1NGPH 1CVRA 5I1GH 1RZKC 2ZT9C 1JK8A 1NCHA 2HTLC 3IJHB 3PY9A 4N5EC 4UM9B 3I6GA 5DD5H 2C8NA 3W0WE 3E2HC 3PABA 4KMQA 5F88B 3BFWA 1NCWL 3OHMB 4KROC 5IR1A 3D3VD 3G5YB 1TKWB 3O2DL 3CZLA 4L4TD 5FM5O 1O9WA 2EVHA 1T0MA 3SD2A 4F9LC 3WFEH 5ADPL 1BYOA 1A6AA 5IWLC 2QQKL 2BS71 3O8XD 4B97A 5IQOA 4IBYA 1N8ZB 2X88A 3PHOB 3SKOB 4OIIH 5D6DC 1F97A 1XGUA 5F70A 4EJ1C 2VW4A 4UNVA 4HFUH 4XVTL 1JN6A 3JTBA 4F33B 5JIPA 4Z7WF 3HLAB 2GITA 2IBBA 3RTQB 5IJCC 3JWNG 2ZYIA 5L2KE 1DANT 3WKMH 1U8PA 2Y24A 2Q76B 3HJEA 4BJLA 2FRGP 5E99H 1DZ0A 4ZZKA 2XN2A 4HZLA 3QWQB 5DRWB 2VLKE 4MZRA 4D9QE 4OF6A 5D6CA 5KJ7E 1NWPA 2PWGA 4PR5B 4W9IC 1AIZA 1N19A 2UYLA 1TMCB 3PXLA 4MD4B 4Y2DA 4B6ZA 2OM5A 4AVJA 5AAMC 3FAWA 2ZKWA 4ZK8A 3BKJL 3A23A 2ZF8A 4FYSA 3T0EE 2EDYA 4J27A 1O7DE 1Z66A 1LTXA 2KUTA 2XN9E 5F97E 2RAMA 1GSMA 3ENEA 3GTVA 2X4OB 1MJ8H 3T0BA 2AJYL 2ZX9A 5HVGB 3V7MA 1P7KA 4ZXBA 1AD0B 1DP0A 1OAUL 2H7WA 4AQEB 4FYTA 4ZO6A 4YPJA 5DZNA 4YOKA 2V6HA 3QUXC 5E03A 1B2YA 3JQOB 1MFBL 5F7HA 5F1NA 4LSSL 3CMGA 3BDXA 4Y9CA 1WCQA 4TSAH 1IC7H 2P7TB 3GMMB 5KVDH 4QRBA 4I7ZC 4JKNA 4XBPB 4PS8A 1LEKB 4QRRE 4WAFA 5GGSY 3VM5A 2EIDA 4LF3A 1Z9MA 2OA9A 4M1DL 3NFSH 1JCKA 4P48A 2N4IA 5E4AA 5HVHC 2Y1YA 3QJSB 4PJFA 5J6SA 3FO2A 5DVPA 3D85D 3NESA 4G6MH 2DQDL 3U2IA 1MNNA 1HHGA 2MPVA 3RWCB 1NFKA 3LN4B 4BZ2H 1AE6L 3FT1A 3BLKA 2PTTA 1PZDA 3FO0L 3VI3E 1A2YB 4CJ1A 2NUPB 2N3JA 2ARJB 2HVBA 2CU9A 4EI5C 3A67H 1F2XK 4YGVA 4TUOB 1HHIA 2H1LM 1NUDA 5JHLL 3ARTA 5GZOC 2R1YA 1GMEA 3DVNA 3MRHA 3PUCA 3PWJB 4KXCA 3QFDA 2H45A 4XCCL 4ELME 2HXAA 4XCEB 1YC8A 1FORH 2XETA 1JNNL 2MOGA 3MROA 5DJ2B 4Y2NA 5SX5K 4PGEA 2GAZB 3OAYH 3H6AA 4JGUA 1A1OA 1J8HE 2M8XA 4N2AA 1Z9PA 3JYCA 2ADYA 4Z1PA 1T83C 3CLWA 2GTZA 4NNYA 5FO9A 1Q72H 1BX2A 2F7QA 3MLWH 3ZRFC 5FO8A 3CX5J 2Z9TA 1D5XA 5KBKA 4TXVB 4JFDB 3HZKA 1DFXA 2UV3A 4KTGA 3ZTEA 4MD0A 4GRLB 1LK2B 5KTEL 5LXGH 4YE0A 2OXGB 3WLWC 2IVFC 3NK3A 4NQEB 1ROCA 5D71L 4L9LB 3KPMB 1HXYB 1OP3H 5AALA 5DHVA 2BCMA 3GHPA 3PHSA 1AHMA 1F02I 4ONFL 5E8OA 2R51A 3KW8A 4TLUA 4S1QH 2A9ML 3SDDA 1RU9L 2KKQA 3IT8D 3KXFE 3SKUD 2NX5B 5D7HA 2BCKB 1QASA 3DUUB 4PPTA 3UP6A 5CEZD 4H5SB 2Y2WA 4PRAB 2AAAA 2PO6B 4XMZA 4LT7A 1KN4H 1WTGT 4KJQC 4Z7UB 4GQQA 5TF0A 1IKFH 1QLEL 4QRUA 3SD5A 2VDLB 4N2CA 4A6YA 2LFGA 1NGZA 4XMPH 3CHRA 4LCUA 3U30C 3CLEL 4NENB 5D7JB 2Z92A 4J28A 5FOBB 2OR7A 2ARJQ 4D9LH 2DTML 2OFQA 2KQNA 3E1F1 3UPRB 3RWHA 1TQUA 3CFCH 4YR6A 4UM8A 2BERA 4YZFF 4P59L 4WI7A 1IBFA 2HG5B 5D2NC 3PWPB 1FO0A 1XD0A 4Y5VB 4E42B 4QTHB 5EIIB 5F89A 4Z23A 1OTUC 3O45A 2DYPD 2GHWB 2J2ZB 1Z9SA 3N44B 4N1EA 3VFWA 4CSPA 6TAAA 4JREC 3BZEA 2WANA 1P1VA 1AKJB 2VL5A 2JJSA 3IAQA 4FQJL 2X40A 3TPUB 3UTZB 3QR1A 4DP9X 1IEBA 3FTYA 3BPCA 5GJTL 3MRCA 2OYLA 1D5BB 1BVZA 4OT1L 4H7VA 4IGBB 4DPRA 3V5KA 4XN9A 3C5ZC 5DURD 3SOBL 3WIIL 4Z78A 3II3A 1JGUL 2YN3A 2B1AH 2VAAA 3MNDA 2JKRM 1RFDH 5A3ID 2EXYD 3BUDA 4MXVE 4M6NH 4Y4HC 3P11L 5F2FA 4ZNCD 1EZVX 1IL1A 1ZS2A 1USZA 4CU7A 1ADQL 5D1ZB 3A24A 3EYUL 3EJSA 1AXTH 3E6HB 4JPVH 4NKOB 4AJVA 3RG1C 1RP8A 1KPRA 1U92B 4AYFA 2CJ3A 5KN5B 1IVTA 3LS4L 3FQNA 5F0MB 1AAJA 1FLTX 4NN7B 4LCWA 1KB5B 2H9GB 4Y89A 5DQDH 1INQA 4PJGA 4U7SA 4NJ9L 5IF0A 2D3LA 3OXSA 3TBCA 2WBXA 1OY3B 2WVUA 5T5FH 4WEEA 3TA3D 5C8JB 1SBSH 1KXTB 4P5TB 1IZJA 3DJTA 3DX6A 1HINH 2O61A 4NUGH 4XO3A 1GYCA 3IFLL 4P3CH 4PJ9C 3DO7A 4KUCF 2CNZA 2B0SH 1T4WA 1G7JA 1ZD6A 2VR7A 4AKQA 2D4DA 2ID5A 2Q86A 4RAVA 4YVNA 5IW6A 3IF1A 5I6MA 3IDGA 2EP6A 4PTUB 2DI8A 4QWWD 1ZGLB 1W0VB 3LZFL 5ESAB 3ZRSA 1XR9B 1YJDC 4Y5YC 4KK9C 5D70H 4CADB 2V9QA 4XCNB 4ODTL 3BP4A 2ZICA 1VHPA 2YMTA 4ODHL 4X99B 2XQYK 3BFOA 5EZIH 2K3TA 1YDPA 2JI1A 2NW2A 2YN5A 3VG0H 1EFXB 1R3IH 1MUJB 1ZSHA 2WC7A 1AR1D 1CN4A 1OKEA 1YAZA 3CFMA 5IG7B 2OQJB 4QNPE 2CUMA 5E2WH 1CFBA 3T6WA 1XGYL 4OCYH 3HNSL 3GMPB 1HIML 1NFDB 1WEJH 1CG9B 2KS0A 2ZZUT 2IAMB 3W5NA 4TPRH 1AACA 4FKHA 4L1TA 4QAMB 1OK0A 2A99A 4D7PA 1WUZA 2R0LH 5J13C 4G8EB 2V5SA 4PJ8A 1F86A 4KPHH 3CFTA 1TZAA 2HKAA 1MJJB 3CDYA 4JQIH 3RVUD 1MY7A 4NN5C 4WQOA 5I17B 5E8EB 3L45A 3BISA 2WINB 4AV5A 4N0FA 5D2LF 2QT6A 1BW8A 5D7KD 1E3FA 4AIOA 2V3FA 3LV3A 1LE5B 1X9QA 4NIYE 5TE6H 2OULB 3O6LH 2NY2B 1JNLL 4AYGA 2X12A 1R24A 1S7QB 4XP4L 1H15B 3KCPB 1NMBH 5BUAA 3SDXA 2X9WA 3KYKH 2GSGA 2P80D 3GI8L 5LBSA 3D4GA 2WXNA 3SDCD 4KHXL 1OGSA 1BZ9A 3D12B 3HG1E 2WN2A 2N7AA 2WSKA 4YC2C 1F56A 4F5CA 3VVWA 2RACA 3RIAF 1DUYB 1QI3A 4RMRA 1MN4A 1Q1JL 2CBMA 1KPUA 1TCRA 3T1FA 2D3NA 3IFPB 4MA7L 1REIA 2AI0L 5L88H 2VTFA 2D03L 2R69H 1CZ8H 3O41B 3GDBA 2Y5QA 1OAZL 4N2GA 3PL6C 1MNUH 5HI4D 4FG6C 3D51A 4IW4C 4K3DL 2AJVL 3P3TA 2EEAA 3AG2B 1VEMA 3SQRA 2VDML 3LYRA 4IK7A 3K74B 4E0RA 4LFHD 4OD1L 3FB6A 4P5KA 1H6EA 3BAXA 3AREA 1T3FA 4PWKA 4TSCL 4HU2A 5D96B 2V0AA 5I26A 4YDZA 5GRUH 4BQ9A 4C56E 4FHKA 5CCGE 3L7EB 2X2UA 5FX3A 1JF1A 4P07A 2B8OT 1OAYL 3Q8FA 3QQDB 5C0JB 1JZJA 2XWBA 3BYTA 3LQAH 1UURA 2GJZA 3P4NB 4V2BA 2I5YH 2AAVA 3P30H 1FC2D 1TZIB 2CO1A 1D7FA 3HKFA 5DD0H 2HPTA 3TTYA 4ZPTB 3L7FA 1T1WA 2X05A 3V4PH 4OV5A 1N0XL 1J9TA 2HMIC 2CHWA 3QEHA 1TEFA 4W9ZA 5HHMB 2GEQA 4NN6B 2PW2B 4S10A 4CW1B 2CBPA 4LSUL 1AGEB 1RZ7H 2YRLA 3ZTJH 1J1OH 1RVFL 2BNUB 5B1BB 2XPGA 3U36A 4W4NA 1KZYA 3S97C 3ZTNL 3ARPA 5MENB 3FB5A 1UCTA 3ARBA 3N5AA 5BPPA 1DUZB 2WXFA 4HIJB 4EN2A 3S98A 1JJUA 2H6PB 3U6RA 2J6EL 3B9EA 3TBWA 5JW4N 5L4JA 3ZK0A 3BWSA 3MRFB 3FQUB 4OGYH 2QVFB 3MV9D 1I8LC 3KPSD 3VFUB 5F1IA 1PMYA 3DBXB 4AZ8B 1ETZA 3BO8A 3NK4A 4M48L 1X7QB 4AGLA 1A4BA 1G7MB 2E56A 2ZOKB 3QE5A 1N18A 2ZUQB 5ALBH 1ERNA 1F4WH 1ZV5A 3IFOB 4OCSL 3UCRA 1ZVNA 4X83A 4Z7IA 1AS8A 3VE0A 4DZBB 2PLTA 1BXAA 2R1XB 4PJFF 2J43A 4TKWA 3L3IA 1N6QL 4WU5B 1RV6X 1BBDL 3GO1H 3AS2A 3X3FL 4XVOA 2AQ3A 1IKOP 1KN2H 2CA3A 2WZ6A 3VXPB 2PPAA 4L0PB 5F0JB 4I85A 4A7UA 5J12C 4N2HA 2O6PA 3I3DA 4FMFA 4QOKB 2MEJB 2PYEA 3H1ZA 4RNRA 4D9RE 1KULA 1X5AA 1BPLB 4X4YA 3US1A 1PX8A 2QVIA 1TPXB 2ZPKL 4K0OA 3U46B 3DGDA 4OCRH 3KEHA 1J1XL 3SQBA 2LVCA 3ABGA 4KBPA 1Y6KR 3ARZA 4PG9A 3E38A 4KVCL 4QEGA 5JXEA 3QFGA 4LKCB 3P77B 5L2JB 2AXFA 4X5RA 5J89A 1INDL 5E08H 1KSRA 5IROA 5BO1H 7TAAA 2BSTA 1ED3A 5JPMA 4JR9H 3H2WA 4M29A 2AK4B 4YHPA 3RFZC 2VDKL 4PJCA 4UQCA 3EF4A 1FH2A 2F08A 4V1DA 1WC7B 1TITA 3ULSB 4M6AA 1CVSC 1TFPA 4UMSA 4EIGB 4UTAL 3ARVA 4IIQB 3HN8A 4G1EA 4QRTB 3ZHLA 4YDIL 2JFCA 5IQNA 4ETYA 5KVDE 3L5XH 2VABA 1FYTB 2V17L 3L3HA 5E24E 2WM0A 1CLOH 4HPOH 5LWYL 1U93A 3GYRA 3O3AA 2G3XA 2E27H 4LBAA 2KI6A 3VI4A 2A6DB 1JPGB 4X8JA 4ZUTA 3GMNB 1AYOA 4UT7H 4H0HB 4J3OF 2XWXA 2CHXA 5DEGA 1YUKB 3BW9B 3V0IA 3ZDXF 2ZXAA 2FE0A 1WIUA 4U1IB 4OVVA 2NCEA 4MJJA 4BGDA 4PS4H 1F1AA 5K9KA 2ENSA 2FO8A 2K45A 2X9ZA 3WHXB 4AG4H 4YQXL 3S96B 1KTDB 3BZ4B 1UWGH 1NZRA 5CJBA 1G84A 2DQFA 1AZCA 3QI9B 3KDMB 4O51B 1I7TB 5IQ9A 1NLBH 5CEYA 4PB0H 2GBVA 4OF5A 2FTAA 1J1PL 2NXYD 4B0MM 4ODSH 3AAZB 2WLHA 3CN1A 5DXWA 4BZ1L 1JNHB 3AXLB 1SY6H 3F6JA 5DEFA 3D4YA 1QSFE 4N4YB 3VH8G 3M7OA 4YHZH 1E67A 3VFSB 5D7IE 4UDTA 2ZX8A 4QLRA 3NIFB 3QI9D 5DLMH 5DTFB 3MRBA 3FU6A 4L9LC 2CG9X 4PJHA 1ZXQA 4WWOA 5CINH 2X4RA 5KVGH 2FQDA 3HRZB 1UG9A 4M56A 4Z3JA 5FYLD 3W2DH 5IB4A 2K9FB 1R3LA 2Y4SA 3SZKC 4HIIB 2MSPA 4YK4C 2YQGA 2C9XA 2GCYB 2R4SH 4ZFOB 4WO4B 5A43C 4JG0H 3MV7D 1GKOA 1OF2B 3RIFF 5AB9A 8CGTA 3MREB 4QHPA 5ICUA 4TL5A 2ENYA 3CPLB 4GP5B 4P99A 3WD5H 2VKWA 3SBWA 4TV3A 5EBLB 3HZ3A 4N0YL 1YNKL 3WNLA 3DGCR 4P06A 4XMKL 1ZKAA 4AH2B 2F19H 3IDIA 5T1DL 1F58H 5GRJL 1I1AA 3AU1A 1F3RB 2BFVL 4P2QD 4ONGH 4HWBA 4EIZC 3GSOB 2YUVA 2JSFA 1MJ7L 3I75A 4OF3A 3K0YA 5I1HH 5BZDA 3U4BH 4APXA 2D4FA 2MCPL 4RESB 1CGUA 5FGBA 4G7YH 3QDJB 4LQFH 3WKYA 2YPKA 2XBDA 3JVGC 1IBZA 1BBJA 1WPCA 2AZAA 1TZGH 1A4KA 4MX7A 1EWHA 2KH2B 2P42B 3IJYB 4WI4A 2YGNA 2ZUUA 3GMOB 3AC0A 4FJYA 4S1DC 1HOCA 2M2DA 2Q8AL 3S8FB 3VRIA 4JRXB 4PJGF 4NUQA 1OQOA 4G80B 4OZGE 4PJXF 2FYYA 1RK1B 1XGPB 2B1HH 5A3IC 2EXYC 5LUMA 2KLTA 3FU7B 3M1CA 4MMYA 1HNYA 3V79C 4G6AD 1TUPA 2CLZA 4D94A 2XBZA 1FJ1B 1NCCL 4XN1A 4B9ZA 1MEXL 4KJWC 1N0LA 4JRXD 4PUBL 3W0WD 2FQFA 3VD4A 2YEQA 4PRBB 1XX9C 5KVMC 4FE9A 2W07B 4LHJB 3SCMA 2YEZA 1NMAH 3QCTL 3A4AA 5IM7B 1CT8A 3R1GH 2XDHA 3QDGD 2CAKA 3FUIA 2WYIA 2K6YA 4IOSD 2PTUA 1QTYT 2HKFH 1TOXA 1NLDL 2FWOA 3Q9QA 4C8XA 2AABL 2EIJB 3S5YA 3TA3C 3CHOA 4HKZA 2V7HB 1KOAA 4GRWH 1H3GA 2RIKA 2FJFA 4AYBA 1NC4D 3UJTH 2ODHA 3HC4L 3F65A 5FYJH 1A9BB 1MREH 1IC5L 3KYOA 5DT1H 1OL0A 5IW3A 1SOQA 3QJFA 4M7LH 2YOAA 3QUZA 3OB0K 3VXMB 1KIQA 3HAEH 2E8ZA 1GGIH 2HT3C 2LGNA 5L2KD 4PD4J 3NGBC 4U2ZA 1CE6B 3F5WB 4QWWC 2XZCH 4M9OA 4A2MA 4D9QD 3S4SB 3N1MC 2JWYA 1ZHLA 5F96H 4OGXL 3TBYA 3QIWB 4GAGH 2CRMA 3DKHA 3H9HA 2FR4B 3FQXB 1GIGL 4FNSA 5KOMC 3DTXB 3CZFB 1OCWH 1HVXA 3GI9H 3I6KB 5I82A 3T0ED 5T1KD 1U58A 3QISA 4FFZL 2IANB 1XMWA 2XN9D 2ZD0A 4RX4A 3SDXF 43CAB 3MYJA 2OTPA 4YXKL 5C2UB 3QIWD 5DVOA 3BVXA 4GT7A 4QF1B 5B21A 2NY7H 1UH2A 2V7NB 4QJ3B 2MH4A 1JZDC 4DP1X 1SNRA 3CX2A 2EZ0D 4LDOB 1TQBB 3DA0A 1I7UB 2BRRH 3PJSA 4LLQA 4OCNC 3TV3L 3U83A 3NEOA 2WTOA 4MXWH 5HGGS 5D7SL 3RX8A 5IT2H 2GTWB 3RA7L 3EDEA 4QRRD 3WKNA 4HS3A 1OGAB 4LCCB 1MRCL 3L4WA 4HS8L 2XIBA 2X4UB 3CXHJ 3INUH 4KUZH 2NY5H 3MA9H 3TO4B 2DWSA 4HKJB 3SDCC 2F53D 3DO4A 5K9JH 3CDGA 4HW6A 1RJY