4G5AA

Crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
GKQHVKTKSDWVIQRTPVDPEWLKVYVDDESKRLCLNFKDSFAPITVEVKDIEKQIVFQSIIFPVAAGEYTLYLGDLSLGQYELYMYNASVKVVGNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a putative member of duf 3244 protein family (BT_1867) from Bacteroides thetaiotaomicron VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 14
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g5aA00
4G5AA 3D33A 3SD2A
chains in the Genus database with same CATH superfamily
3PLYA 1KPRB 3MLYL 2A6IA 2W0LA 4M5TA 3U4EA 3IVKB 3FH7A 5K9JH 5AAMA 4N25A 3CFMA 2Q6WB 2MNWA 3QEUB 5KZCB 3SYOA 3N85L 3GZQA 4YBLC 1DVFC 1KDJA 1W0WA 2X53A 4HZ1A 1OSYA 4M3HA 3FQXB 4X5WA 3VXMB 5AOIA 3EO9H 3QEQA 1E0OB 1M6OA 1O9ZA 1R3HA 3NSJA 3I6KA 1J1OL 1DL7H 3ARBB 5DHEA 3U30C 4JFUA 2VRKA 3ZHNA 2YD9A 3OLEA 1MEXH 4MDIA 4NZRH 4AM0Q 1V7MH 1JK9B 4JL2A 5I1CH 1SUHA 1C08B 4HJJH 3U9UA 4QTIL 3FHEA 3ILQD 3DX4A 4C8XA 4PRIA 2H0EA 5FYKD 5AVTB 4A2MA 4JUSA 3MV7B 1KWKA 2DQTH 2K45A 1DVUA 2KZBA 5E6ID 4R0LC 5D9SA 2W07A 3VU1A 5AENA 3K2IA 3JTTA 4P2RA 3HMXA 3A6BH 3IN0A 1I3VA 4BK4A 3ARDD 1D5XB 1EMTH 1M1XB 2QSTA 4AMKL 1S9VB 1JV5B 4TSCL 5DMGC 4JRXE 3IU3B 2IANE 4UQEA 3JZ7A 4E0RA 4X7SL 3CFEB 2SODB 4BWTA 2AITA 3EF7A 2UZIL 1E3FA 4H8HA 4ZD3L 1HINH 5F3HA 4HJ0C 4GAFB 3NSFA 1PDKA 3VX1A 4Z7UB 1PQZA 4HS6B 4MJ2A 3FCUB 3HMXL 2EXSA 5FPIA 3BIAX 2FSEA 3ARTA 3GBMH 3CC1A 4NDMA 4D9QE 4RMRA 3QCTL 4H25B 3PAZA 2VO5A 4WO0A 2AQQA 5C8JA 3FMGL 3LKQB 2VNCA 1G7LB 4IKKA 4OGYH 4OLWL 5FDWB 3B34A 1FE8H 5FGBC 5HVWA 3RE0A 1D5RA 5D2NB 5EC1B 5HYEA 4XB3A 1A3RL 4DGVL 3CFJB 2F58H 4QY8A 2WSPA 5BRZE 1CLOL 2JSFA 4Q0XH 5JOFA 5TE7L 2EO7A 3O9WA 3U36A 4D8PB 5KYYB 4TVPE 1GGIH 4M3KB 3HNSH 1BF8A 1MQ8A 4PVMA 5EN3A 1AQDB 2WUCL 2FGZA 5HSFA 1DVXA 2Z3FA 5D8JL 2JFCA 4AZUA 5MEPA 5E8OA 2C9SA 3TNNB 4H44C 1K4CB 2PPAA 1NDTA 4NOBA 1REIA 3RLSA 1HJBC 4FQCL 3LKPA 1V05A 2QLVB 2A38A 2XG5B 3P4MA 4JNXA 4QXGH 4RX4A 4HZLA 3HBQA 4Z7OB 4Y5YC 5F9AC 5C0RH 4G7YH 2F1BA 1ZK5A 2OSLB 3KH3A 4MHHI 4X9FA 3WLBB 2J57A 4URKA 3ET9F 1G7QB 2ZWSA 1CO1A 4BK5C 2WLJA 1YN7A 4QF1B 1QUNA 4CC4C 4NUPA 5IMMB 2O6DA 2E9GA 5CD3B 2YQ2A 4JFWA 4ADJA 5J89A 5IT2H 1XGTA 3J07A 3NJIA 4F58L 4W9ZA 2ODIA 1QR1A 2DQIH 3BWZA 3Q44A 1A3LH 4LZKA 4YDIL 1MLBA 3BN9C 4B7IA 1XH1A 5F9WC 3L3KA 4LL4A 1S7VA 3SDDA 4KV5F 5GS0C 1NPUA 4I0PC 4UQCA 1G9NL 2B0SH 3SYAA 4HEME 2QEJA 4BXVA 5CAYB 1GRWA 4Y2OB 3MTRA 2WZPA 3VRJB 3KR3L 3I6LE 1J1PL 1MFCL 2J21A 1U8JA 4XP9H 3P4LA 3IFOB 4WO4C 3MACL 4HMDA 1MOEA 3KPQA 3BWUC 4I1RA 3LRMA 1XTLA 5I17A 3MV9A 5CMAB 2I9TA 1NCUA 1BSIA 2VB5A 5IHUL 4EVNB 3ARVA 5J6HB 1T83C 4BQ6A 1GMEA 4JQIH 3GZKA 5AAWA 5CN1A 1FN4A 3FTUA 2R1XA 5G4MA 2EDDA 2VDNH 5A2CA 3CSGA 1HSBB 2LT9A 1R3IH 4IBTA 3RP1A 4ZMAT 1J0ZA 3KWVA 4XN7A 1L3WA 5SX4I 3HHMA 3KJ4B 2ARWA 3T6XA 2PCPB 4ELMB 4F37K 3APDA 4NNXA 5IOKA 1G4RA 1KXQE 1U8IB 2UWEB 4LVOB 3HFFA 4GRWF 3VDBA 1IZKA 4DCQA 3BPLC 1DVSA 4UQ2A 4QRBA 2D0FA 3QG6A 5T1KB 4QHUA 3AT9A 1ZV5A 4PJXE 4APXA 2QL1A 5FKPA 3IDYC 3B7RL 3IDNB 3FCTB 1DJGA 2ZG3A 4Z7VE 4HD5A 1CK0H 3Q1SH 3Q2CA 3WNIA 2V2WA 3APNA 3FHQA 1T0OA 1RFDH 1C9SA 3QVAA 1LEGB 3P30L 1RUPH 2Y4SA 2TRHA 4NHCH 3BVNA 3P0VH 4U2YA 3RHWF 1KEGL 1CT8B 3HNVH 1GYCA 3I3DA 3MUJA 5DJYB 4HJEA 2UXFA 2ZXEB 3D34A 3AJ7A 2DPKA 3V6FB 4U4IA 5JUEL 4BZ2H 4JY4B 1P7QA 1EDYA 1OSEA 1E4XH 2BRQA 1G7HB 4DOHB 5LAXA 3VXNB 5BMFL 4A1RA 4Y5VB 2FEEI 3UC2A 4P57A 1A14H 3T4AB 2VMJA 3LPGA 3I50H 2GJJA 3UGUA 2B8OT 5GS0H 4O4YH 2WCSA 5D96B 5BO1L 3GIZL 5ENWB 3T6VA 1MCNA 4IKIA 3U0TA 6CGTA 3NJNA 3QXAA 4B53A 1YYMH 4LOVA 3WTUA 3FQRA 4ONFH 2WCPA 3PV7A 1B2YA 3F6IA 3PQYB 3D09A 4R4FH 2Y5TB 3EJSA 5FV1L 4NJ9H 4MS6A 3ZTDC 4F7EB 3QR1A 4OBRA 1N26A 1P7KB 2FR4A 2X1PA 3D39D 2XZCH 3DHUA 4APQC 2VDMH 3DBXA 3O6ML 4W9IC 4IKJA 4U1NA 3VJ6B 2D0GA 4JO5A 3K0YA 2E27L 3ARGA 1R6VA 1JTOA 3PWPD 5C2BL 1S7QB 3IK2A 4PJEB 3QWOA 3E8UH 2ZCKH 4UDUB 4AWJC 4KZEL 4QXTA 3ZE2E 1YEHL 4JUTA 1ET5A 5CEZE 4OF3A 2WNWA 4KXBA 4MB1A 1A1MA 1PX4A 3ABKB 4MNGB 3FBKA 5C7XL 2W0FA 2NY0C 3DGGB 4NQDE 3S36X 3CZSA 3DO7A 2JB5L 2GBAA 4HISA 4NO0A 1NCJA 1P5UC 1CE6A 3QZMA 2QDWA 3AQYA 4X0NA 4F7MA 2YAOA 3ULUH 5K9KB 5JIMA 5GGUB 1PD1A 3QIWB 5JXEC 2EKSB 3FB7A 3PV6B 4LK4A 1MCWW 2EDBA 2EDHA 1C5BH 4U1GC 3K6SA 2IC2A 4RWYL 2F5AH 1KYOK 2V9QA 1JGLH 4L4TA 1TVBB 3FTVA 4IDJL 1E5CA 3WGVB 4FX5A 2IQAB 4HIJA 3COOA 5E8NA 2FDBP 5CZVL 4OZHF 2APTA 4DAGL 5I5IA 4LCCB 1SVCP 3GLZA 3SDAD 2B15A 4QHKI 4TUKH 4G5AA 3LX9A 5F0MB 2HPTA 5AD0B 3TA3A 2J55A 4LSPL 2VZUA 4QIRA 2AVFA 3ELAT 4ODHL 5FO9A 5IJVA 3LSOA 4OV5B 3B9KD 3L4VA 2J1KA 3S8GB 4AYFA 1E5UI 4FQHB 2CCWA 4DVRH 3G5VB 5F1IA 4MXQC 4N2AA 1FORL 2OJ1A 3EO1A 1IKFH 1BQLL 1W72A 4FFVC 4X6FB 4RMBA 3ILDA 1WUZA 1MQKL 2VRAA 2WLLB 5IEHA 2Q7YA 2WXFA 1D6VL 2ZOLA 1QBBA 2V0AA 2E9IA 4J6RL 4PBWD 2C9VA 1FYTB 4HALA 5AB9A 3OPZL 2G2RB 1XX9C 2O6CA 5FXCH 2H1PH 1UWXK 3L2LA 3F58H 2HT3C 4AEHH 3GDCA 3LHPL 4AW7A 1J05B 1RPQA 2IG2L 4GB9A 1KBKA 5KVGH 4ZUVA 4RLDA 2CO6A 3MBXH 3HI1A 1W72L 2CAKA 4O00A 1U3JA 2F7OA 5LBVA 1MCFA 1T2XA 3BKCL 3QHTC 1XIWB 3LS5H 5L2KE 1ZHBB 2ENPA 1E7VA 1A6AB 1Q9OA 1BBJA 1MHEA 1JWMB 2X3CA 3HS8A 3AROA 5F88A 3SY6A 4G82A 4I77L 2CGZA 1GW0A 2C4FU 3VUAA 4HXAH 4ZMOA 4YL4A 1A7RH 1T04A 2VLJB 3PHQA 4P3DB 1JRHI 3W5NA 2W65B 3FNKA 4MQXC 2IH9A 3PWVB 3BJLA 5CUSH 3NDZE 1NUGA 5K9JL 3H0TB 4P4KA 2XX1A 1IAIH 1M4KA 4DWHA 2AK1H 4KI5C 4XVOA 1JPSH 2PW2B 4FI8A 3M17A 4TULL 4DQAA 1E9QB 2X4SB 2DI7A 3ZO9A 2P47B 4LIQE 3MAWA 4ZYKB 3W3BA 4EEEA 1EJFA 1MEXL 3JWOH 2ZXQA 3L7EB 3BH8B 3EZJB 3OC5A 1IMHC 1I1CA 5C0GA 1V7ML 5I1CL 5D1QC 3C12A 1D5IL 3FN9A 3EOBB 4RZCB 4P4RA 4K55A 3WIIH 4UBDD 1NAMB 4EDXA 1NAKH 2DQTL 1HH9B 4S1DD 3DECA 3FTGA 4PLKD 2XWBB 2H41A 4X7CC 4AJYV 3ZW3A 1B4LA 4N2IA 5DZAA 1GS7A 3VD2A 2ZSVB 2XTJC 1OARH 3D3VB 1ZA6A 3T5WA 5GJTL 4ETYA 1CICD 2ZD0A 1IVLA 4M5YH 3L5XL 4NP4L 2DQ6A 3KPRB 1GOGA 2GK2A 3PDOA 4TKWA 4QXVA 3WUWG 4ODTL 5A7BA 3GO1H 1HX0A 3MBWA 3H53A 1JDDA 2DV6A 2LVCA 2BOBA 1LQBC 3BPCA 2ZXWB 4P46A 5D70H 1K2DB 1NDMA 3EFDH 4L8SC 1HHIA 5D1ZB 2OCCB 2FATL 2PLTA 4ZPTB 2Y1YA 3GSVB 1D3CA 1N6UA 2R2CA 3EO0B 3WGUB 2DEWX 4HDIA 1PIFA 3VFTB 5KUKA 3TLRA 3GBML 2BOCA 4E2OA 4LSUH 2YRLA 3GSXA 1DVFA 2E9JA 2XRAL 4XI5D 3O6FB 4CSZA 3TVMB 5HHPA 2YQGA 4NFBA 4ZAKC 2E7BA 3DIFB 5EEWA 3DUHA 2FL5B 5DSCA 4B3EA 4G7VL 4G9DA 1S5IL 2OV0A 4F2FA 2NR6D 4K9EC 5FYLD 5I6PA 1E40A 1S9YA 2NLJB 3H7BA 2PXYB 4JZJA 3WJJC 1MCHA 1PS3A 4RDBA 5L2JA 2VAJA 2BY2A 4G5ZL 1ICTA 5GRXG 1ZT4A 4HSCX 4RQQB 4NKDA 2P45B 1WFNA 3UCQA 1KZYA 1BJ1H 1H3XA 2AK4B 2WQRA 1GGIL 1H5BC 3HNSL 4QYAA 3K3QA 2OMTA 1R3LB 1AKJD 1SM3L 5ADOH 1VAHA 2EE2A 3QNXB 1EEZA 5E6YA 3ULVD 1NC2A 3GFUA 3GMMB 3C6LD 5D1ZI 1FNEA 1KY6A 2EDMA 3QI9C 4FADA 4R0LA 5DMIH 4UINL 4WNQB 1U9KA 4ISVB 4Y0GA 3BWUF 2YEVB 1DJSA 3RI5F 4UAOB 3UEZA 3WNNA 2V6HA 3W2DL 4F8TA 5C0RL 3MNZB 3QDHA 4G7YL 3PHSA 2J1ZA 2MOVA 1J18A 1VZHA 2HFFB 2YXWA 2GSIB 1IIKA 3EOYG 5FM5M 4UB0H 1WH0A 1OP5H 5HJGA 2OW7A 5CINH 1LEKA 1NGWA 3ZSSA 1TKWA 2ZCLL 2ZJSH 4OCRL 4OZGF 4W9HC 3UL4A 4AVIA 1WC7A 4TUOB 3G5XB 4Y4FD 1FA4A 4NRZB 4N8PA 5IT2L 1FVCA 3F5WA 1HH6A 2X1OA 4R2GD 3VCLB 4M8QA 6PCYA 2YAQA 1NCCH 3KBHE 2A6JB 4BIKA 3RNKA 4L8BB 4MX7A 2YD1A 2CD0A 4GUPA 4OZ4B 5L4IA 2B0SL 5J6GB 4L3AA 2AVGA 2EDJA 2ITFA 4JQIA 2ZOUA 5FGBA 3P3RA 2LOEA 1F4HA 3MYJB 2F0CA 3QDMD 4ZNEA 3Q2VA 1LQSR 4OLVL 2RJMA 3AVEA 4AYBA 3VD9A 1K5WA 3CFIC 2JCCF 4YZWA 4HKXB 4NENB 4X8XA 3T1FA 5KVDH 1OGAB 1P1VA 3RWEB 3H56A 3UTSA 1QSEA 2JV6A 2PYEE 3FPXA 2D2OA 3JBG7 1UUNA 1EQWA 4DPRA 1UD4A 5BZWA 2VM9A 1U8HB 3UEQA 1T5WA 4PAZA 1T7WA 4AUJA 1K5NA 3QYMA 1XF2A 1BXVA 1I82A 3QIBD 5JIQA 3NIFE 5D93B 1DJZA 4K9EH 4AE0A 3BZEB 1JZIA 4Y2NA 2GT9B 1G94A 2J72A 4FE9A 1CN4A 4ZFFB 3BO8B 1L3NA 1QQDA 1X5XA 4Y16C 3RZCB 5B3JE 1LMKA 2NY4D 4PTTA 5I5JA 1MFDH 1K72A 3SBWC 2IXQB 1AY1L 1W0VA 4PTUA 4QRTB 4CC4A 3QJHA 3CN2A 3KHOA 4WWKC 3U9WA 3ECUA 2C9QA 4XOAA 2F53E 4GQRA 4BZ2A 2XN9A 4H2AA 1IEAB 2BRRH 3ATBA 3HCVA 4LBEB 4XMWA 5I74B 5CN3A 5C6TH 5FHAL 4KC3B 5JOPD 5IV2A 2NT1A 3FK3A 1WF5A 2QDVA 3VE0B 3ZKSD 3QXDB 1RFDL 1X5KA 3HC2A 1QFWM 3KCPA 2W92A 1GR7A 1S7WB 4P2YA 1FBIL 4PPTA 2D0HA 4N0UB 4I0PA 5D1XA 1SNRA 3VD0A 3ZT7A 4GAGH 2P26A 5DR5H 4FFTA 5I8CB 3MRNB 2R83A 4NHCL 1EEQA 4A2GA 3ZZSA 1LO0L 1S9WB 1U58A 1OVZA 1KJ2B 2OJEA 4OTXH 2EVJA 1FZOA 4YSUA 4WO4A 1IGFH 1OTUD 2DLEA 3ZDWA 5KJ7E 3FFOA 4NXSA 2ENJA 2H9GB 1E4XL 1OHQA 2EDTA 3RHWK 3FOMA 4ZMPA 3ZDYB 2ICEC 1QATA 1QRNE 3KPSA 1PKOA 1E50A 3F3HA 4OJCA 5CILH 3GRBA 4KKLD 4PJDE 2L7QA 1J1XL 3HHSA 5GS0L 1X7QA 4OZGA 1T83A 1NEZA 2ENQA 1A21A 1NANH 2VLRD 3DHJA 4WHCA 5GSVB 4QKTA 1CQYA 4BINA 2IAMC 3QNFA 2C4FT 4FTVD 4OZFH 1MKFA 5I1GL 4M93B 4EOWH 4YDLB 3B3BA 2DKUA 1IIIA 2X2HA 2N7SA 1E4KC 2WWKO 1JJUA 4R4FL 3SJVE 4JFDD 2K70A 1T21B 3TO4D 4QNPE 2IH3B 4RMVA 4IOFC 3S8FB 4WGVB 2VERN 1YNLH 2DDQL 1YSOA 5ANMA 4GH7B 4FQLH 2DMBA 5LGJB 3L9EA 3V8OA 5E2VL 4EE2A 1O7VA 3RGHA 3BVWA 5C09B 1MNNA 5ISZD 4WCYL 3D0LB 3TEXA 4DKDC 3K80A 3QQDA 1VGKA 5INCA 1ZPLA 1J8RA 1S7SB 3AU1B 3KNBB 2XIBA 5IVNA 5CCHE 4Z3GA 3EFFB 3F8UB 32C2A 3NJFA 5HTSA 1QFWI 1SEBA 5JHMA 4JPIB 1TEYA 4A68A 2AQ3A 4Q97A 4E68A 1AR1B 2Q8AH 3X3FL 1T4WA 4TN9A 2PCYA 3HAEB 1MJ8H 3A6OA 1IT9L 3N3EA 5C0BA 5HGHB 2AAAA 3QDJA 3HZKA 5LBGA 2R59A 3FF8A 3UTZB 4ODWB 4RMQA 2YN3A 4OJEH 2X4PB 1U3HB 4N6RB 4U1SB 5F7YC 3D2UA 3AXIA 4V1DB 3CFCL 3ZN6A 2H2SC 1JGLL 4PN6A 4XPTH 3ZU8A 2GSGB 1KT2B 1UD6A 4F7KA 1JWUA 2WPGA 3PAYA 1U92B 3HG1A 5JYMA 2YO3A 2EECA 3FQUB 1TITA 2OX5B 4XNQB 1PX3A 5KANI 2VXUH 4X6DE 2R2EA 1ACCA 4I4WB 2C1OB 1NBQA 3CH8A 1IM9B 4N0FA 1PW3A 1CURA 1AGBB 5IG7A 1KSRA 5HHXL 3IDJB 3UTTD 4G9FA 4ZK8A 4BWWA 4DVRL 5IBUB 4APQA 2H6UA 4UT9H 3NP4A 1KJ3H 1UQSB 1EAPA 3NGBB 3TBVA 3DX7B 1J9RA 4I7ZC 4ZFGH 1T0PB 1RURH 3UACA 2KERA 3QPQD 3LN5A 1DEEA 2Q20A 1GZHC 3IXAA 3PJNA 3DMMB 1PNDA 3EBGA 2BS8A 1E27B 4KI5F 4K3DH 3SKOA 3LPWA 2BDNH 3IXTA 1BQ5A 1NCOA 4EZJA 1WE5A 4IS6B 5I15H 5AAPA 1FVDB 4IRZH 4NQED 1J87A 3MBXL 4OLUH 5I6XB 2KHAA 2KYIA 1AQ8A 2FYVA 3ZYJA 4KBPA 4TQEH 1KEML 1PG7X 3N1MC 1P5UA 1R0AL 2H6PB 4RSVA 3VXOB 3WNJA 1MWAB 4XBMA 4ZX4A 5JXEA 3LN9A 3GJFH 5HHVL 2XVGA 2IBBA 1U8KA 1H19A 1VFBB 3SPVB 4KUZH 3VXSD 5FO8A 1CF8H 2Y6TE 3GTVA 3MZGB 5TF0A 3C5SB 1A7RL 2NY2D 3EGSA 3NJVA 3K8KA 1TYRA 4NKQB 3GMLA 4OJFH 3VXUE 3B6SB 3W0WA 1X5ZA 3P40A 4N1CA 1EHNA 1TMCB 1E30A 1DQML 2P5WA 3GWJA 3X12A 3UC0H 4N86A 3II2A 5C2UB 1TENA 3ZT6A 4DESA 3D85D 3VTTA 2AI0L 4KRLB 2O4EA 1QOKA 2Y69B 4F80A 3FXIC 3S88L 3SE6A 4UDTA 3HZYB 3OKEB 5B1BB 2AEPL 3HVDA 3WOVA 3O4LD 2AABH 3QT2A 1U8QB 4JZOB 5FECB 1RUAH 2DYPB 1SHXA 4IBSA 2K6ZA 4MHHG 4PRDB 2BNRD 2WSDA 2ARJB 3CLEL 2IGFL 5D7KD 1VACA 4PCKA 1QVOB 1U8OA 1IKOP 3VXQB 4E41E 4JRYE 2DJUA 3LNDA 3GK8L 5E8DL 2WO2B 1FL6B 4XBEL 5F7UA 4F93B 1R19A 3POHA 3ILQC 3LZPA 3KLKA 1AMYA 1OARL 3VI4E 4MJ5B 1IQDA 2Z4QB 1MWOA 4O02A 2ATPA 4ZW6A 2GAZB 3FT3A 3CMGA 3MCKB 5B4MD 3ZTCC 3QYNA 1FIEA 2UZYA 3CWGA 2A0LC 4XC3H 5KG9B 1I3RB 3DTXB 1FFPB 5E6IC 4MZRA 4U1MA 3EYFA 1N2RA 4C4KT 4NHUA 1BYNA 3ARDC 4Y2DD 4FAAB 4UMGA 2OMBA 5DZNA 3MRMA 1N4XL 3MRPA 2QPFA 2WBJD 4YGVB 5A2BA 3RPIB 1C16B 1HHKB 1MH5B 4O02L 4DKFL 5GISL 1AI1H 4IRJB 3VD3A 5IJBC 4UAHA 5ITFA 3EH1A 1RCYA 4LSUL 3DVGA 5T1JA 4R5TA 4UZSA 4BM7A 1AIFB 1YJDC 3ATFA 5EO0A 2PR4H 4F9PC 4LOUC 5I30H 2D73A 1XBRA 1FNSH 1MCIA 4G8IB 2VUYA 1SN5A 5KBKA 2OFQA 4HETA 3HLAA 4X98A 4G6FB 2Q7NA 4AMXA 5EUOB 5EV7A 1ASPA 3LEYH 3MFGB 4HF5H 4YHKH 3P9LA 5D1QA 4ECNA 3FUIA 3WIFA 1AXSB 3ZKXC 3NACH 4JY5H 1P2CB 3ZTNL 1BG1A 3IWVA 3U7YH 1H8NA 2XFXB 5EORH 4JRXB 3X11B 4EIBA 1BREA 2IANB 3DC0A 4MWFA 3EOAB 5ADOL 2X6BA 4QJ4B 1DLHB 2RGSA 4HAFA 2ODHA 4PWEA 5LXGL 3O3BB 4KMTL 1OTSC 4FQXB 2BW4A 2W9LA 4FXKB 2NXZD 4OM1L 2OTUA 1E2VA 3FO1A 2WP3T 1GCFA 3S8WA 1YMME 2DQEH 1SY6H 1WAAE 4GKSA 1BVNT 1T80A 2EDLA 4L4VD 2AV1A 4KAQH 5ANHA 1RUML 1KGUA 2Y5QA 4U1KA 4PS3A 1TLKA 1SDDB 5JHDE 3BZFB 1PLGH 3C60B 1VLXA 4PGDA 4QRUB 4GXVL 5CINL 4OUUB 1G6RB 3UYPB 1CD0A 1MUJA 3RI5K 3HKFA 5I1AA 1D7CA 4L8SA 4ES8A 4ZS6C 1USQA 3N0PB 8PAZA 2ZUVA 4U1LB 1GOFA 3ARYA 3LXBA 3EFOA 4XVTL 4W93A 5M7QA 5FW8A 1FNAA 2FYYB 3MBEB 1HCVA 2EYTA 4GG8A 5MP6H 1QBML 5BOPA 1EJ6A 3GXPA 2X1WL 3QULA 4R4BA 1F1AA 1KCLA 3KVPA 1Y0LA 1SBBA 1I7RB 4MA3B 3I9PA 3EUDA 4ZAKA 4ZDHB 3S37X 4LFHG 5ICYA 3V0JA 3VQ2C 1BEXA 5D72H 4FQQA 3LDBC 5MEND 4LAQH 4CC0A 2QR0B 5DRXA 2OK0H 1F4AA 1OY3B 2XV2A 2V2XA 3OD3A 1CD1B 3O45B 1OO2A 3ARPA 3PF2A 1I85C 4FQJH 3H9HB 1UENA 1XGZA 3O2WL 1SZNA 4JKLA 3N5AA 1FFOB 1P4BH 2ZUYA 2VN7A 4G1MA 1HEZB 2XWJA 4JO4H 1CFMA 4JG1L 4J39A 3FF7A 3L3IA 3B5GA 5J6SA 4FF9A 2Q2LA 1AS6A 2VLLA 2JNZA 1ACYH 5TDNA 3NBNA 3KPNB 3QUGA 2YARA 3QI9A 1X5HA 3QIUC 1H3VA 3HC3H 4K9EL 4RFOH 1M7IB 2QKIC 4ZOBA 4R7DB 1N59A 3QUHA 5GRUH 3MLVL 4HS8L 4AQ1B 3ABLB 1B6DA 1E4WH 3D5OF 1LO5B 1LNUA 2KPNA 1K9TA 3ILEA 4GMSH 4YVNA 5E8EB 3TP4A 4DP7X 3HA0A 4IRSD 3T2LA 3WDIA 4KMQA 3L1OL 3P1VA 2FWLB 2IH8A 5DCCA 4OU3A 1VERA 1EHKB 3IS0X 4E42A 5IHBA 2DJSA 1AJ7L 5F6HJ 2FBOJ 2HN7A 2Q7AA 2OZ4H 4FJ6A 2EH7H 1P84K 1ZRUA 2HFEA 3SD2A 4R4NC 1E42A 5CIPB 1VFMA 5IVZA 3QUZB 3W39B 3FFCA 5F9OH 5C0IA 1UCBH 4GAGL 5GGSY 1B0GB 3MLTA 3ISYA 5IHZB 3BEWA 3SB3A 3F7VB 4LQFL 1UYWH 3DXAD 4N2MA 4OZFA 4C56E 2TSAA 3CPUA 4UIKL 5LXVA 4X4KA 4ACPA 3KZ8A 2ITCB 1XGRA 1IGFL 3EBHA 4DK6A 4BSWB 4OD1H 4A7TA 4E5XB 2JKLA 2X05A 5HI5D 3DGDA 5GGSA 1Z6JT 4OAWA 1A6UH 1IBZA 2W94A 1VKXB 3AAZA 5IB3B 1J5IA 1KFAH 3CNKA 2J4WH 4FG4A 4PJXB 4S1RH 2XPGB 1FLTX 2WV3A 4J3XA 2VDOH 4M7KH 5I75B 5F1SA 4WV1B 1LO4H 3QB7C 3ZHDA 4Z7VB 4UTBA 3WO4C 1CBJA 4X99A 3OF6D 3HLKA 2UY6A 1O9VA 3BE1H 4Y16A 1T0NB 2NQDA 4N2NA 2X2JA 3RWJB 1CXKA 4AXWB 3FQNB 5KSVA 3SBWA 5I1HH 3GEFA 3QG7L 1RI8A 5DYOA 2I7OA 3A23A 4PRPA 4WWKA 4JREB 2VDKL 2NW2A 2X44D 3CZLA 4KY1L 3SGDI 2MNJB 1IFHL 1W2KT 2YSTA 3BWAB 3DROB 1YUHA 1VZIA 2A6DB 3O6LL 2D3JA 4UTBL 4O58H 5SWSE 2E56A 4DPCX 4Y1AA 4JDZA 3V4VH 5SWQB 4DNLA 1N64L 2D7MA 3GMPB 2DWYA 1OD7A 2B4CC 3GXUB 3V6OE 3MRGB 4Z9KB 5KJRL 5F9JB 4W6XB 1FZJB 2GI7A 2WNKA 5HHMD 3QP3A 4RMWA 4YDNA 1J0JA 4PJHE 5CP7A 3P0YH 2GC7C 3AWFA 4NCDA 1CUOA 3LNIA 4GXFA 3IAQA 3D87B 5CKGA 2H0PA 5EH1A 1SUJA 2FD6L 1CFQA 2W38A 5IB2A 1TTAA 2FWUA 3NJJA 4IEFA 2B9AA 4NZTL 7CGTA 3FB6B 2O61A 2ESVE 1U6AH 1DFBH 2F7QA 4ODVL 2HUHA 2NTFA 3L3OC 2CO2A 2IAMA 5KUMA 4JDVA 2CJUH 2N0KA 4LCYB 5HPMA 2VXUL 3HBGA 4WQOA 2YKLH 4Z5RA 1V27A 4ODXB 3HZ3A 1E4KA 4TNFA 5DD6A 3ZIMA 4U31A 4Q9RH 1L9TA 1T1WB 1E4HA 2CLVA 2CR0A 1I7TB 4XX5A 3ZE2B 4NUQA 4F57H 3NFSL 4OFYD 4HIPA 4IRZA 3ZDZF 1Y6MR 1A7PL 1ZGLP 4I3SH 4B95C 3LKNA 3U0PA 2IQ9L 4JFTA 4QTHB 4LLQA 2DN7A 1WAEA 2OBGA 1ID5I 4NQDB 4Y4HD 3VA2C 4ZFGL 3B9KC 4AEIH 3GF8A 4NO5B 3BP4A 3GJFA 5T33H 1MCKA 2XA3A 4JFED 1YYLH 5HI3D 5AWNH 3RL2A 2BDNL 3GMRA 3D8MA 1HZHH 1BZ7A 2UXTA 3GI8H 1F90L 5DD3H 3LVTA 4IRZL 2PW1B 5DS1A 4OLUL 3SE8L 2ORBH 4YK4C 3Q13A 2L3BA 1E65A 4Q74A 1YEDA 4XXWC 4TQEL 2WLKA 3CDFA 5GGVH 3U82B 1T1YB 4YR6A 1R3JA 3HFMH 4K8RD 4BFOA 1ZT7A 3CPLB 2EIKB 3QXVA 4ZO6A 5DVNA 5ETUB 1XSKA 4GSXA 1SXAA 3UDWA 3WKML 4P5TB 1KCSH 1MFAL 3NSCA 4WI6A 3E38A 2WXQA 4TLUA 3KM1A 4ZI8A 2WMPB 4N90E 2RCSH 3OKMA 1VEMA 3FRPB 3I3BA 4PRHE 1DQDL 1B4TA 3CZEA 4NIYE 1G7JA 2NZIA 5JIDA 4I89A 5JDSA 5IJKA 3LH9A 2GIYA 3DURA 1UD8A 5HDBE 4CN1A 2Y06L 3QC5X 4YUEH 3SO5A 4NXKA 4RNRA 4KHTL 4UT6H 3I2CL 1BW8A 4GRMB 4NC1C 2F61A 2P5ED 3SN6N 4YO0B 4A6YL 2GBVA 4CU8A 3IMRA 3LIZH 5AB0A 2EIBA 3T0WA 1HFUA 4D0CA 1RUAL 2UY7B 3CH1A 3T2QA 5AOJA 1XZ0A 4HIEB 5HGDA 1GZHA 4PJ5E 4RGOL 5L2KB 1AC0A 4C58B 3BAJA 4TNEA 5DVOA 2H6OA 3MUHL 4QTFA 3AS1A 1R4XA 1FGNH 3BDBA 1PG7W 2ZKXA 5IGXL 1TOXA 1NFDF 1XCTB 3WE6A 3MRLB 2GK0B 4L18A 4UM9A 3P77B 3RGBA 1KC5L 3QUMB 3T2NL 4YXKL 1F4WL 2VWEE 1MCPH 4S1DC 4XC3L 3EGDA 3TZVC 1XR8A 3ARSA 1GGCH 3B7YA 3NFPB 5AG8A 4KNSA 1XGYH 2X7LB 3HC0B 1BIHA 2CBQA 4F2MA 2Q3ZA 1CICC 2BVTA 4PJ9B 4HJGB 1YEWA 1OQOA 2ZP0T 3AS3A 3RY5A 1EZVY 1MLCB 3UX9B 1EUUA 2NDGA 3X3GH 4PVBA 3OJ2C 1GKOA 1MNUL 3GSNH 3LH2H 4ZS7H 5K1NA 1OALA 4YQXL 1IE5A 2BSSA 4N6QA 4ZXBB 3VWJB 3DI2B 2LHAA 4ORGB 5IW6A 3T77A 1P4IH 3GSWB 3T2PA 2HLAA 1RPKA 3VFMA 4X80H 3GJEA 1T7ZA 1WFJA 4R9HA 3A4AA 3ETBF 2VGLM 5AOLA 4PYGA 2NXYC 3L9RB 3D6GA 4PHXA 2DL9A 5F8QC 5L9DL 4I5BA 5HDWA 4ZG1A 5I19H 1V5JA 3I9AA 4GBXB 2DQFB 3DUSB 4YHKL 5KTEL 4XI5C 5E5MB 2H0FA 4OSUL 5FOBA 4A7SA 4JFOA 2ZXAA 2P80A 2GY7B 4ZUTB 3UYRL 2Y72A 4G7QB 4G8GE 1DBAL 4K3HA 3QJQB 2VC2L 3P3SA 2NR6C 3ZMNA 5L4MA 3FT2B 4X8JA 2OZNA 2X2YA 3TTSA 4K0OA 4LEXL 4FFYH 4WRLA 5I6KA 5K33A 2CO4A 4PVNA 3C08H 4GOSA 4KXAA 3EDFA 4I87A 1A7NH 1I1AD 1S4IA 4JFXB 3IF1B 2FZ3B 3U6XA 2XWZA 3T8VA 4EQ3A 3ULVC 2BIOA 2E74C 1TYJA 2QMKA 3C6LC 4PJBF 5I76A 3M1OA 1G4MA 3PUUA 5I6LA 2HRPH 2NYZA 5E6IA 3CN1A 2N7BA 2CM5A 2HJLB 3L4XA 5I18L 3EGXB 2F19L 5JW3H 3ARDA 3CVHB 1HI6A 2BNQE 2GUOA 3GZOA 3SQBB 1HEHC 3NEOA 4RISH 4M43L 4ELKA 4XPBH 2YRPA 1AGFB 3HB3B 3ZDXE 5I9QC 4B9CA 5FYKL 4R97B 2ENSA 5MP6L 1KLGA 1PU0A 4Y4FC 3H85A 5GGRB 5CF3A 2QV2A 1AXIB 4K5MA 1VADA 2ADGB 4R2GC 1EJOL 3UTQA 2BS9A 5J11B 4JG0H 1NFDA 5D72L 1KTLB 4GSUA 35C8H 3BUTA 4MCYB 5FKAB 5H2BB 4LAQL 4I2XA 2ZWNA 3L5WA 1KIQB 1WBYB 1OCWL 3D7PA 5BOZG 1G84A 3R1GH 1OSZB 1TNMA 1W9XA 4U49A 2OXHA 5ID1B 1R17A 2WVVB 3N55A 1LEIA 1UWFA 3QO1A 4PU2A 5I1LB 1LWJA 5GS2H 1YJDL 3BAEH 3CAFA 2J5LC 4JQXC 1C12B 4YIQA 1OAKH 3BHBA 3GUFA 4UTCA 2OZ4A 3HC3L 1JP5A 3CFKB 4C4UA 4NUMA 2ITDB 1KLFA 3ZGHA 2X0WA 4L1TA 4ILDA 2C34A 4DGYL 4DN3L 3A0OA 5I8OH 1CIDA 3V95A 3QC6X 4GMSL 2DIEA 2E4TA 3HTLX 1N9PA 5AFAA 1GXEA 4QHLA 3H42H 3DVIA 3ZGIA 2PXYD 5GHWH 4N1HB 3VM7A 1U21A 2BP8A 2PR9A 2YA1A 3QORB 3CXHJ 1QFOA 1UM6L 2OZ4L 4WU5A 1TQTA 1Q0YL 3NABH 4HHWA 2CKBA 3MLSL 2NY4C 4M6NL 3II3A 1FQ9C 1ZEAL 2CUHA 3A22A 1R24B 1EIBA 3DVNA 2H32B 2PYEB 4M7LH 2ILLA 1A6TB 4ETQB 5F9OL 4NUGH 4PWJA 2WKLA 1QSFD 2M1KA 4PJGB 5FX3A 5KSBA 1TO4A 2WIMA 1TZGH 3OB0H 2J8UB 3IMUA 2IWEA 5KANG 1RZIB 3MZTA 4JY6B 1C1EH 1XGQB 4NNPH 5F6HI 5E4OA 2DTML 4BFIA 3ZKMD 3NIFB 4UTAH 3DKHA 4OD1L 4Q4EA 2BIPA 2CKBL 2FWOA 4PJBA 2VR6A 3DX9B 2CHNA 3SPIA 1CDYA 4E9VA 3ZE0B 2OMUB 3KDMA 1MVUB 1ZE3C 3HAEG 3EOTH 4IJTA 4GMTH 3KYMA 1OTUC 1S7RA 2PO6B 5F7AA 1KFAL 1KTKE 5DHYA 5EIIG 2J20A 4OH2A 4M6OL 2LLGA 2VL5B 4GO9A 4OQTH 3QIUA 2F53B 2BZCA 2XV6B 1LD9B 4KKLC 2QKIA 2NSXA 2H7WA 5CJOH 3BGFB 5CSZB 1VENA 3R7QA 2DYRB 2WVSA 5E1GA 5K1VA 3RVWD 5JA8B 5LVEA 3TL5A 5FGSA 2B1HH 4MA8L 5AW1B 2VQUA 3L3HB 3L3GB 2VIRA 3APFA 3C8DA 5TDPB 3PL6D 5EU6D 5TE6H 1JL8A 1XBDA 3VB9A 3MV9E 3TO4C 1KBPA 2EDEA 3BT2H 4FEIA 2WO3B 5J9PA 5T1LD 4KK5D 4PJAF 1ZTXH 4YAQA 3H2PA 1X6NA 1QRNB 5ESQB 1W80A 3P9MA 2QQQA 5F7NC 4N9GA 4WSKA 1N6VA 3OR7A 4D7BA 4L3EE 4U33A 3NRQA 2BVOB 4ZPVB 2W8CA 1FVEA 2FJFB 2NY1B 3LTVA 5AVSB 1A2YA 4QRSB 1VIWA 1JGVL 2WGXA 3LZNA 2PTUA 1WSST 2G5BB 2X89D 1RJLA 4RH4A 3SJVB 2AJYH 5LGYA 1YEJH 2Y6SD 1MFEH 1ZHNA 4WKZB 5H94B 3V2AR 4EZMA 4CRPA 1XGPA 3CDCA 1KPVB 1QBLH 5GGTH 1DFBL 2YXFA 3MRQA 1BPVA 5MEQA 3OAWA 3P2BA 2DEYX 1OP3K 3QFJE 2FX8H 3FUHA 1ONQB 3OHMB 4FNTA 4FQ1H 4PW9A 3S2AA 5KS9A 1NA8A 5IJCC 2ZCHL 1KBWA 3DJRA 2BIHA 1BJ8A 4F57L 1T3FB 3MMEA 1N3NB 4HD9A 4WFGE 2Q87A 3UZVA 2XC8A 1HXKA 1MFNA 4OV6F 3FPYA 4ABWA 3NZHH 1XGUB 5CLTA 1A4KA 1F18A 3J8F7 4BKSC 5D5MF 2WO4A 4EI0A 4LLVA 3FTYA 2WXGA 4U6HA 2COVD 1FPTH 2WOBA 4PD4K 2BJMH 4HBCH 4U0RC 1FO0H 5IVXF 3D39A 5EU4A 1A6ZB 1PBYA 3UBXB 2LFGA 5F3BA 1I9RH 4BKTC 1AXTL 5DRZB 4UMSA 4WTXA 2Y7SA 3TPUA 3FRUA 3QPQC 2ORBL 2HXAA 2EDYA 3DSNA 2YMXL 5D7JD 3E7JA 1WHPA 2Q8BH 3CBJB 1BIIB 3PU7A 1F1GA 2PWGA 3EJCA 3UPRA 1QACA 4YDKL 5IKCB 4KV5E 3V6ZA 4X6DB 3DUUB 1GAFH 1UD2A 3MGOB 3NCBB 2LAAA 5DI8A 2P3YA 2CLZA 5DQ9B 1KCSL 1H9DA 4PREA 2P8LA 3DV4A 4MAUL 4WK4B 1OGTB 5C09D 5BV7H 2JKWA 2KLRA 3D18B 4K7FA 4PR5A 3AU0A 2V7HB 4CL7A 2B4CL 2OJZL 5E94A 3O6KL 5AW9B 3L3OA 3HG5A 3RGVD 2XYCA 3ESOA 2DQGL 2YHGA 1CD9B 5I16B 1U8NA 3KWTA 3TEYA 3SE9H 4OZIF 3TIDA 4YUEL 3UBXI 1V3LA 3NAAL 2NNXA 2FHFA 3MRHA 2WANA 3KXFD 4KK6D 1J0KA 4NQXA 2ZWYA 1QFHA 5J1TC 2Y23A 1IQWL 1ES0A 1GGBL 1G5GA 4L1DA 2X87A 4G1EB 3RAJL 4XNXL 2CHXA 4XP1H 2CHWA 3EW3B 4LKCA 3B9KA 1I8MA 4GRWE 2QADB 1TVHB 4XNDA 1LGVA 2CKNA 4OCSL 5AVVB 4N0CD 3RRQA 1FGNL 4MJIE 4XX1E 4CADB 1A9VA 2CHZA 2MJWA 4K2UL 1F11B 3KJ6H 4GRLB 2CUIA 2OMNA 1Z9SB 3F04A 3QUYB 5FUCE 3FN0H 4P5KA 5FC9A 4K15A 3FU6A 4LCIL 3DX8B 4N2LA 1KB3A 1XCXA 1OT4A 3BIKB 3D50A 4KROB 2RACA 4XXWA 1KGCD 2HH0L 4WW2F 3AM8C 3VXUB 3S36L 1UOVA 1GGCL 2NY6D 3K71A 1GMIA 3SY0A 1GC1C 2WQXA 2GITA 3BP5B 2WB1A 2A77H 3K4ZA 4MXWL 3BEVA 2WWKT 3WDJA 1NIBA 4RRPM 4XP4H 3L3DB 4NT6A 2K7QA 3TN0B 2YAFA 5B4MC 5D7EA 2R0LH 2YD2A 3QZNA 1J8KA 3F7QA 2MOQA 1YPZF 2VZVA 3UO1H 5D5MA 1YEIH 4Y8DC 1KXVA 1BGXH 5DJ2A 3X3GL 2WSKA 2ZSWB 1AQKL 4Z77A 3AWEA 5F44A 5IVXA 2CQVA 4Y2DC 4FABH 4OLZH 3ULVF 2I25N 2XPZA 5DZ9A 3VGDA 1U2CA 2WBJC 4E41B 3LXAA 3V5HA 4JRYB 1CL7L 2UZPA 5AVXB 5LNDA 1P7HL 2QPUA 4YZFF 2CPCA 1IGYB 2WD0A 3BX7C 3QZPA 5EOCL 3KLAA 1I8UA 2RALA 4BE5A 1KIRA 3CUPB 4CVXA 3GHBL 5G4NA 2VABA 3MLZH 3CFBB 3RB5A 2FJSA 3B2VL 3VI4B 3TO2A 2WYIA 2Z8RA 3I74A 5F9DC 1VFUA 1GY1A 3Q3GA 1WZ1L 3OSKA 2FQGA 2H26A 1O0VA 2ZAHA 3PJSA 3DNKA 2OTWA 3U2JA 4NQUA 1RUKH 1J5OL 2R7EB 1UACH 3FTZA 3L1EA 4JPVH 3PWUA 1A4JB 4RIRB 1R5WA 1T6WA 2HG5A 1XL6A 5CJXC 5DQJB 1XB3A 4JO2H 5DEFB 3T3MF 3H9ZA 3Q6FB 2V3EA 3D25B 4XBGB 3S34L 1A7NL 4W1TA 5JHLH 1OAQL 3A24A 3BESR 3S5YA 4ZTEA 3VACA 1QX1A 3X2QB 1W8NA 1WFMA 5IQ9A 3TZVA 1OAUH 4OY9A 4WSJA 4J4PD 2N7AA 3FC8A 3GBDA 4QWWC 2HVKA 4P9ML 4CMMA 2ZWZA 3RDJA 3RKPA 1I1FA 1CICA 3MXVL 3WEOA 3HNTL 5F6IC 5EG6C 2E9WA 3FT0A 3NA9L 2CBTA 2D8KA 5DJ6A 2NOYA 3BAIA 4RISL 1AZNA 2XG4A 3OVUB 3ARBC 1NJ9B 5CGMA 1AKPA 1SXSA 2WLIA 2UVEA 2CBMA 4DP9X 3WEXA 3DBSA 5J12B 3FULA 4OZHE 1CTNA 1YQVH 2EDKA 3ECBA 4P2QD 3BP6A 1YEKL 2FX9H 1BQSA 35C8L 4YHYB 1LVEA 5A3ID 3VFWA 3RKDD 5ABDE 3KPPA 3MRIB 1WCBB 4YNYA 2WQVA 2LLLA 5FUZH 2ZP8A 1NCNA 3IGAB 1YMMB 2Z93A 3N1GC 4KKCD 5T3XD 1KIPA 1RU9H 3EH4B 3QHFH 2VTFA 2QSCH 3GNML 4XMLH 4OJDH 4Y5XB 1INQA 3M7FB 5JHDB 4BQBA 2NR6A 2H2PD 3CDGB 2VW4A 4QOKD 1DVZA 5I66A 1RH8A 2P7TA 4S2SA 4U1JA 1OAKL 1G7IB 3NPSB 1YPZA 2CLRB 4HGWA 1QTSA 5DJ0A 3VGHA 1CLZL 3I02B 3VFPB 3WFHA 4AENB 3QZWA 2CJ3A 3H3KA 4HIHA 1PY4A 4X5XB 4E5XG 1XFPA 4OJAA 5I8EA 1BZ9A 1CF1A 4NN7B 3GUTB 3QZOA 4HIIA 3H9SA 4KPHH 3C6LA 1DFXA 1RP9A 4H88L 3TEWA 1HK6A 3UG5A 4JPWH 2EXYD 5E1IA 2J88L 5KAQG 2DKSA 2JELL 3BPOC 3S35X 1OK0A 2ICWA 3FQ2A 3H42L 5FYLL 3GTTA 5IB4B 4X7TB 4M62H 2G3MA 3GBEA 3RTQD 4UTAA 3NABL 1BQKA 3MNDA 1KJVA 4FEMA 3G5ZA 1B2WH 5D2NC 4JKNA 5EOTB 4A7UA 4IRSC 4DVBB 3OGCB 3U4BH 1UXWB 2OQJA 3TH3T 5C9JA 2AHIA 3I6GA 3ULVL 4H0LC 3JWDC 4Y4FA 4L1HA 5DZJA 4MQ7B 3M8OL 3GKZA 2AAVA 4J3OG 4ZT1A 4HHGA 4NWUL 4PV9B 1L5GB 2D9CA 4Y9BA 1A02N 1MIEH 3LKSB 1ZLDA 4JFPB 3VSVA 1Y07A 2VERA 1QZNA 4J1UB 1FLRH 4GG6A 4X7EC 2G60L 4L9DA 3EZ8A 5ITBL 4L5FH 1DHKA 4PGCA 4GQ9H 3LCYA 4D9QD 4LLUB 5CEYB 1WHOA 5DD5L 3ABMB 3PABA 4QRQB 3SSGA 3RX7A 3C5ZB 3LOWA 3I9GL 3QFGA 5F1KC 1U8PA 2KQNA 3QDMA 1AZCA 5TH2B 4M1GH 2Y36H 4GMTL 2BY0A 3LEXB 2XV0A 3WFEH 4HPOH 4HK0B 3QEQD 5BRZD 5HI5C 4FXGA 4J28A 3D48R 4OGAD 5INDB 1IM3B 2HJKA 3CZJA 3BP7B 3OL2A 5AG9A 4LLDB 4PM1A 3FB8A 3HPJA 3L4WA 3TBYB 2E7LC 1BEYH 3RA7H 1J9TA 4L8CA 2VXSH 2MHAA 5TQ2H 3KBFA 4WI9A 4AGQA 1O6VA 1CGTA 2OR8A 3QXWA 5TE6L 4P5RA 4C56B 1DO5A 1HU8A 5DLLA 2IALB 3QZBA 1A9EA 3H1ZA 1QSEE 2A4ZA 1EZUA 4HUXA 1JCVA 4P2RD 3VFVB 4P2OA 4TUJB 4EI5B 5IF0A 3SKJH 5JW4M 1HHHA 2VCOA 4UI2A 2V9TA 2N4IA 4MBOA 5GGTA 4B3VA 4YC2B 3ROLB 2O5NA 5HVHB 5BXFB 2EZ0D 3UJJH 2I24N 4L29B 2Y1ZA 3WUWA 4ADGA 4AYMC 3STLB 1EEYA 1PTZA 1SYVA 2DI9A 4RDQF 5FDYA 3K6DA 3IDUA 1C7TA 5HGAA 5ICZB 2AJYL 1IO4C 1YEJL 4YXLH 4WWNA 4BH8A 3ML9A 1BZQK 4GAYB 1Q1PA 1I53A 3JWDH 4KVCH 4HV8B 4XCNA 5GGTL 1RUQL 3S9DB 1TJMA 2MMXA 4KI1A 2OSWA 1AZBA 1E3XA 2XN9E 3QCUH 2HP4A 4LVOC 4FERA 5FHBH 1DQJA 3L4UA 4FQ1L 2EIDA 1ND0A 1UH2A 3K6IA 4Z0XB 5AB1A 3NIDF 2VLRA 5DF0A 5B8CB 2CO3A 5SWSB 1ZD6A 1ZTXE 3O9WD 3T6ZA 4R3SA 3SYCA 3FRPG 3TS8A 4FLOA 1CLYL 1HS6A 1NM9A 5AKTA 1BOGB 4Z7AA 1CR9L 2ADFH 3DTDA 4PSPA 4AIOA 3VFUA 4AGPA 1BFVL 3TO4A 1IBHA 3KPSE 1M9WA 4XC1H 2VDLL 3VD5A 3V4UH 4N28A 1CFNB 1FPTL 4PJHB 4MNQD 5AW0B 2BJML 3V0EA 4HAKA 3BGMA 3ZKQD 1KCUH 4AQAB 4IQHA 5C08E 1MW3A 1BFOA 2C4XA 2VITA 3G08B 5CP3H 1OM9A 3PCYA 2YRBA 5ACMA 4Y4HC 4Z7NF 3T3PF 1N5AB 1WA2X 3VG9B 2ESVB 4JFYB 4C47A 5SX4H 3HRZB 2QQKH 1ZY9A 8FABA 3AXLB 2VDPL 4GP5B 3VMNA 3OKDB 1GZPB 1ED3A 4Y19A 5ANME 3V55A 5IMLA 1U8CA 3N1QC 2X4TA 1N6QL 2AQ2A 3TWCL 2HT4D 4YHZL 4AKOA 2B16A 5A2LH 5CCKH 2JCCE 2ADIB 3MX0A 3SDDD 4EI6B 4KXDA 1NCGA 3IDGB 4K8RC 2E75C 4LT7A 4OT1H 3MLPA 4PMFA 2VAAB 3FB5B 2LVEA 2HCZX 2FCBA 2WXOA 4O2EA 3MLRH 2K0RA 3BLBA 1NM4A 4XBPA 4Q9QL 3GPEA 3RILA 1R5VA 4NJAH 1ITBB 4XP5L 5I1DA 4OGXH 2OL3B 2XY1A 3OKLA 4O51B 5C0BE 1T66D 3K72A 2O30A 2VLKE 5I71B 1QHQA 2MNUA 3FHAA 3O11A 2Q3XA 5HHOD 2OI9B 1QWUA 4E36A 4Y9EA 4G42A 2FO8A 3UJIH 3VG0L 4MASA 3K81A 4HP5A 5CWSA 1NLBL 1UCTA 1YNKH 1KELL 1FZMA 5EBLA 2CNYA 4JG9A 4YHPB 5G55A 1L7IL 3MV8E 4F7TB 4OQ1A 3LS4H 1G87A 1J86A 4XRCB 2HX7A 1EJ8A 1N12A 2MCPH 4PRHB 4UQ9A 2EVFA 1B9ZA 5SWZE 2G75B 5CO1A 1Y7VA 4WW1A 3DDGA 1Z5LA 3CQFA 5CEZD 1MCOH 2GHZA 3PXLA 5F7DA 1D5MB 5HHQB 1Z3RA 4NQEA 3DO4A 5HDBB 3CCHA 4BH7A 2AS5M 3BWSA 3CFDA 4YHNA 2BS71 3QUXB 4U1HB 4ZW7A 2R0LL 1WAPA 5IR1B 3A6CL 4MMXC 3P4OB 1VDGA 3UO1L 3G6JF 2ATKA 4JRWA 1BD2B 3N6YA 5IB1B 1X9RA 1M7XA 4G6KH 5CBEB 3D0VB 3OZKA 2M26A 5FYJH 1BVNP 1OV8A 3I3EA 4JO1H 4NYLB 1JYVA 2UX6A 3AACA 1P7QD 1D5ZB 1CMOA 4LBAA 4U3SA 2E46A 4R26H 3IRZA 2DMGA 3QQ3B 3WSQH 3FAXA 1U4EA 2ZG2A 2BNUB 3HS0C 3MCLL 1KV3A 4CW1A 3REVA 2OYMA 2BVYA 5C0EA 1ZWIB 5CR8A 1NPNA 1NBZA 3MLZL 3WS3B 5JHLA 2YLKA 5TF1H 4ZRGA 3CXDH 3QYCA 4BZ1H 2V7NA 1GPOH 2I5YH 1N0LB 1ZS8A 2YK1L 3D85A 3MRDB 3TH4T 5KOVC 3GRWH 1T0MB 5EF0A 4LE8A 3ALPA 2R69H 1QI4A 2EC9U 3EYVA 5FWQA 3UIYA 1HSAA 1L9SA 3N42F 3SCMA 1WGOA 4NKMB 4TUUA 4DGIL 4X50A 1UACL 2BSTB 5IMOB 4JPVL 5I82A 3C5JB 5F7MC 3VFRB 3SE4A 5GZND 3WN6A 5HJ3A 4PJIA 4N3UA 2BNRA 2P24A 2P5WE 2VDQL 2AJXH 3G5YA 4N5UA 2EC8A 5C0JB 1U95A 4OF6A 1OAUL 3MHZA 3QFDB 4ZUSA 2BVQA 4Q2ZA 5FM4A 3ARGD 4WTWA 1QLFB 5BQ7B 5JMOC 4MSWA 1PG7L 1T2QL 1JZHA 2R9HD 2FT7A 3LKRA 1GTNA 2AXFA 1N70A 3TXAA 1JS4A 1I1AC 1OSPH 4FP8H 4WI4A 2FECI 1SF5A 1HQ4A 5GQBA 4NIKB 1DVTA 3U0WL 3OGOE 4UOQA 4PUBL 5C0FA 2HKFL 3MA7B 1BVKA 5AKVA 4KO9A 4WEUD 2TSBA 4NO0D 3AW5A 2CCLA 4Y7OC 1GC1L 2H4EA 1J5DA 4G8GB 4Z7UF 1YQVL 2FX9L 2WBJA 4AUUA 1AHWC 4LSRH 1UXLA 4LPWA 3KYKH 2HX9A 5EZJB 4L4TD 2JKJA 3WTWA 3RWDA 1DBMH 1E67A 1Y1DA 3RVUD 5G4OA 4PJFE 3SKMA 4X4MA 1CFVH 3WFBL 4DEPC 4LSTH 3JYBA 1N19A 4PIRF 1IEBA 4P3WA 2CO7B 5C71A 1JRHH 1R3HB 3U1SH 2J56A 4PJ9D 4X4XA 3TA3D 5IREA 3KCWA 4EZKA 1DLFH 3JT0A 4KXZI 1HL9A 2FGWH 4XN4A 3G6JA 4AGMA 3OKOA 5FCSH 5CJXA 1DBKH 2FB4H 4LHUB 5D1ZC 1AIZA 4KI5E 1HESA 4Z7IA 3ESVF 1WTGT 4IGBD 2C9UA 5ACZA 4GKZA 2W60A 3ZDXB 1C8QA 2AZAA 4KTEH 5D7LE 4WHYG 1T89C 3T71A 2ERJC 2R4RH 3PFQA 1U36A 2FIRT 4GJTB 5D9SB 3ZVVA 4ZTOL 2Q6WA 1JIBA 4L4VA 4M62L 3WY3A 3MRBA 3WJMB 4QUOA 3MR9A 2YPLD 3QDGE 3IJEA 4F1ZA 1SQ2N 3FQXA 1AZVA 2DWEA 3H2WA 3TEUA 1NCBH 1U8MB 3ARBA 4E0RB 1PNCA 1EERB 1WD8A 3U4BL 4Z78A 2PXYC 2K8QA 5T3ZH 2DLHA 2XBTA 3LAFA 1S46A 5EUKA 4B9JA 2ZOOA 3OB8A 1DBBL 3UAEA 1KCVH 3UROR 2XTJE 3NTCL 5TK4A 2J2ZB 5E00A 4DERA 1PQZB 1H3TA 3GS0A 3TYFB 1FLRL 3X1NA 4LRNL 4IKLA 3MV7A 5E2UL 5C0ND 3MGTA 2FSEB 3PJLA 5EZOH 4AW4A 1NICA 2NNRA 3JV5A 4PGEA 1Q9WA 2WIIB 3QXUA 4Q9CA 5C8JB 1UT1A 3KPMA 5IW3A 4PRAA 1Z32X 1C5DA 4M7ZB 5KYXA 4UILL 5MENA 1B0RA 1T03H 4H20H 1D5XA 4LKXB 4DFIA 1M1XA 3W38A 1S9VA 4UAOC 3WFEL 1JV5A 1HHJA 1JYXA 3PREA 1MI5E 1ORQA 3N9GL 4JGMA 4NB7A 4POZD 1BMZA 2ZKYA 1MCJA 4OGZA 5JOFB 4U7MA 4L37A 1NAMH 4GAJH 3TU6A 4B5EA 3U36B 2ZX5A 1YEGL 3EDEA 1UADC 1EZSA 2XKNA 3N06B 2JXMB 2P4AB 1IBBA 4XN9A 2Y1VA 1SHWA 3FAWA 3CHPA 3F12B 1CJYA 4ODUA 4Z7UA 2ZYSA 1DVYA 3N40F 2VXSL 4HS6A 5E8OB 2OKMA 5DDHA 3ROOB 5ELIA 1PL3A 3CMOL 3HKZA 2LV4A 4XVJH 4H25A 1G0YR 3I6SA 3QQXA 3HS9A 1Q1JL 3LKPB 4ELMF 4UZGA 3RVWC 3T8XB 3LKQA 1G7LA 3P4MB 5FDWA 4HZLB 1ML0A 3UERA 4F8PA 2YAPA 2WN2A 1BWWA 1YNTF 5D2NA 1FNHA 2WLNA 5EC1A 4IRSA 3CFJA 4DN4H 2CXGA 1BZEA 5H37A 3U2SB 3PL6C 2Y2TA 3FL7A 1MG2C 4YFLI 1OCOB 1YN7B 3KMDA 1QUNB 2QTVA 4G3YH 1GYVA 3QAQA 1XQ4A 4GI9A 2L8AA 4D8PA 4KK5C 5F3FA 5KYYA 2IBZX 4Q4IA 6FABH 4H4NA 2CA3A 5GRWA 3S37L 4GKNA 1BHGA 1ZLVK 1J0HA 2APSA 4HWEL 5KBNC 3L3KB 1M05A 1QHOA 3QO0A 1S7VB 3UBXG 5ALBL 4YXLL 3RURA 1ZKAA 2C9AA 3DXAA 1A7QH 5D93C 1KZQA 3SPCA 3EDDA 3E0GA 3DX6A 4DT2A 3JWDL 2XG5A 1U8JB 1NLDH 1BVOA 4OFDA 3US1A 1WS8A 5DURB 1XF4A 3QCUL 2XETA 3IU4L 2YXVA 2OSLA 3WLBA 2DM3A 3HR5A 4JVPA 4LGRB 3MV9B 5EU3A 1U3YA 1RSYA 1RMFH 2EDQA 2Y6SC 4G7RB 4GI8A 1HC1A 1TQSA 2PYED 2I60H 2ZE0A 1QLEL 2BY3A 4O9HH 5CD3A 5CP3A 1EXGA 3FSAA 4FKHA 3F64A 4UT7L 2E7LA 5I74C 1N67A 3GMOA 4PVLA 1FN4B 1PAMA 2R1XB 4L3EB 3F7YA 4YMPA 2CK0L 2YS4A 4AG4H 2G5UA 3BKMH 3WMPA 2C9XA 4WFFD 3T4YB 4OI9A 1MCDA 4TL4A 3VRJA 4C59B 1YN6B 2W88A 1MCLA 3KS0J 3DTUB 2YGOA 4HFWA 4NNXB 2QFRA 1A8JH 3IE4A 4BELD 3IFOA 2WKOF 4BFEA 4HUVB 2VLME 4UQ2B 3QG6B 1B88A 1JNNL 2R39A 3QWQB 3MLWH 5CMAA 1D7BA 4W9DC 3FUJA 4LSVH 3W11D 5TFSH 1JCKA 1UEYA 5FKPB 4WUKH 5FUOH 4EVNA 1DANU 1K8IA 2YEQA 5J6HA 3QFJB 2D2CC 1P4LB 5FCUH 2F8XC 1IJNA 2EVIA 2V2WB 2Z34A 1O6SA 2Y7OA 4PRNB 1XSJA 3Q06A 1UKQA 4M93C 1KBBA 1JFQL 2PPEA 5PCYA 4YDLC 2X4RA 4FFZA 3QJZA 3EJUA 4OCYH 5D7JC 4X7FC 1THAA 5CCKL 4N68A 3BVNB 4PRPE 1OAJA 4AI7A 4CJ0A 2PCPA 2B3IA 1N8OE 4ELMA 3BRFA 1U8IA 2UWEA 4PWKA 4HCRH 4XHJD 3MLRL 3E3QE 3WNPA 5LAXB 2Z35B 3ATDA 4HT1H 5AVRB 2H3NA 4NJAL 5AZEH 4XB8A 3GM8A 3RWGB 1MF2L 3TV8A 1MXDA 3LD8B 4N26A 4XNUH 3RPBA 4FFZL 1E2ZA 2NY1D 2Y3AA 3FCTA 3RGVC 1XWVA 2HAZA 4BEIA 3QXAB 2E8YA 3EBAA 3FQRB 4ZUUA 1AR1C 2VSKB 1PKQE 4J5VA 1JI1A 4R5VA 1ILSA 4ORZC 3SDXF 1LEGA 2DQHH 1FNGB 3O2DH 5H35A 3LY6A 3BPNB 4R8WL 2Z8VC 1AE6H 4RBPH 1Z5HA 4KK6C 3B7SA 1CT8A 4RRPG 1YNKL 3DSFH 2LLNA 1AO7D 2QMJA 5MHSE 2FR4B 2GKIA 3IFNH 1EZLA 1MCCA 3CFQA 3KGSA 3V6FA 2DS4A 1RD6A 1U3HC 3T08A 1HZKA 4Y4HA 2EP6A 4L9LC 3LS4L 1HKLL 2Y7QA 5GRYA 3RY6C 1QSVA 4JRFA 4Y5VA 1GIGL 1TQCB 1H3GA 3T4AA 1SLVA 4N0CC 4UNUA 5JYLA 2RR3A 4JFEA 2ADYA 1PGRB 4Q14A 3QWOB 3R19A 4QXTB 3QAZC 3AFLA 3UYOD 5BRPA 1A1MB 4FQ2L 3VQLA 1KGIA 4PIBA 1X3DA 1KJ2H 2VISB 5IQMA 3IGFA 5LLIC 1FH2A 3QRLA 3PQYA 3CBRA 3GLEA 4LCWE 4F7EA 2NY6C 5CLZA 5D1XD 3VU2A 1NGYA 1QFWH 5FK9A 2X09A 1P7KA 4PV8A 1FYHB 4BZ1A 4CBPA 1XD1A 2JLPA 2AQ1A 3SQOH 3NGBC 3K6SB 2R69A 5JW4R 4JPKH 4GRWB 3VJ6A 4HWBA 5DUPL 1II4E 2CJTA 2WKOA 4YSQA 4GSRA 2DI8A 3HJEA 4HIJB 4P07A 4MJIB 2A1WH 4KZDL 5MI0C 1BM3H 2NX5E 4PJ6A 4F8LA 4NZUH 4UDUA 4OF7A 3A5VA 5KVMC 1LP9E 4X6BA 4K8RL 5A16B 2DQJH 4BZ1L 3NH7H 4MNGA 2I5YL 2J73A 2XJKA 3QSKB 4KKQA 5EDXA 2WXJA 3B2MA 3DGGA 1EV2E 3FCBA 4FN0A 4HWBL 2VJ8A 4YX2H 4O5LH 1NOFA 3VMPA 2C3WA 5K9KA 2WXPA 3RJDA 5K9OA 3EO1B 4JJHA 1DSWA 1WLHA 2EKSA 3ISWA 1I1RA 1NUDA 1JZ6A 1ZSHA 2ZXBA 2A99A 2EE3A 5JQHC 2W9EL 5IEHB 4K23L 4NQCE 2Q7YB 1VA9A 3ARRA 4RGMB 4X6EB 3WFCL 2KT6A 3AGWA 5EF2A 3ULUD 1NFIB 4BFGA 4YEEA 3HAEH 5I0DA 3S3DB 2PWFA 3ILPA 5DO8A 1UD3A 4RZKA 1QEXA 5DHVA 1P7BA 4Y89A 3K5RA 1L9QA 4KDWA 3GXFA 3UJTH 2AEOA 2AV7A 1ASQA 4ZUVB 5FOJA 1F13A 2CO6B 5AD0A 2F8IA 3HI1B 1UWGH 2QSVA 5E99H 3WY1A 4AT6A 3CSBA 1L0YA 2B5IB 4AL8H 3HMWL 4J4PC 5CBAA 3SDXA 1SQMA 3ATEA 3MRFA 4FQHA 2PPCA 2X0UA 1SJVA 3QDJD 2NUTB 3BUIA 2YOAA 3GB7B 3KYOB 3LZQA 1MHEB 5K59E 1OP9A 1PEWA 5F88B 2XFGB 5LHDA 4WEBL 3D2UD 3BUQA 3DOIA 3PHQB 4G6AD 3B5HA 3L08A 3FFDA 1ADQA 2GSMB 2R4SL 4WTZG 4ZMWA 4P4KB 5HPOA 1CFVL 1EAOA 3KW8A 5F21B 4LSTL 4ZQTA 3M17B 1YG9A 3CDZA 3FT9A 4KRMB 5A3IC 4LGPB 3RKDC 5E5LA 5E5UB 3LV3A 4NN5B 3VXTA 1DLFL 4HQQL 3N40P 4MXVF 2FGWL 4KKCC 5BVJA 5C0GB 5F71A 3VFSA 1ADQL 4XPGH 3Q05A 3RFZC 1RXLA 3GS4A 5I0XA 1WPCA 1ANUA 1JXGA 3UAJA 3VQ1C 2H2PC 2QGDA 4FHJA 4WZ9A 1TZAA 1GJWA 4HHAB 1PMYA 1ZCRA 4E41D 4EDXB 1P5VB 3OX8A 4JRYD 1RJYA 3FUDA 4P3DA 3VSTA 4DZBA 2GIMA 2UV3A 3FTGB 3PWVA 4LEEA 2R4RL 4OZHB 3K7UA 1FL3B 4LLWB 2YWZA 5DT1H 5C0CD 2PMZA 1ZA6B 1I1AA 1MWAH 4ONGH 4QT5A 1CD8A 4TV3A 1NCBL 2EXYC 3S3SA 2DY2A 3MBWB 4ZYKA 4P46B 2BOBB 3BPCB 3DO3A 3L7EA 3BH8A 2X6MA 2FBRA 2ZKHH 1MDTA 2VQTA 3R4DA 5LB1A 3X14A 3RWIA 1HAWA 1NDMB 1BFSA 1BZOA 1I3GL 2AXGB 4JFZL 5KBMA 3RTQC 1ZJAA 2YPVA 1KCVL 1AHWA 1NL0L 4WY7H 1OAYL 1QSZA 4RZCA 3M1CA 1NAMA 1UD5A 2PN5A 4MAYD 5FYKE 1JMXA 5CHNA 3VI3F 4WK2B 3IFPA 4FXKC 4QKXB 5EZOL 4F92B 3WNKA 3GSXB 1DANT 4ENED 5TD4A 4YBLB 5HHPB 3TYGH 2ZSVA 3W0WD 5T1DH 2GTZB 5TPWL 5JQ6H 3UCRA 4H20L 3PP3K 3MNVB 5DJ8A 4G9DB 4V2CB 3WTVA 2YPVL 2WW8A 1ET8A 4YSAA 1A0QH 1XF1A 4JM2D 5AOKA 3BVUA 2XACC 2YD0A 4DW2L 1NAML 4L23A 1EFQA 3ZZLA 2EJ1A 5E70A 2WXMA 1CDIA 2ZWKA 5D1ZA 4A2HA 1RZJC 2YQBA 1MHHA 1KLUB 2NNAA 5AEAA 4IBUA 3HUJE 4CW1B 1NC2B 1D2OA 4K7PH 1T89A 2GBUA 3EH2A 3ZX1A 1Q9LB 4OGAC 3MBEC 2V5SA 1XF3A 4R0LB 2V3FA 1I7ZA 2DWDB 1BM7A 1SDYA 2JCWA 1T6BX 4Z3EA 5E08H 1N7ML 2DBLH 2WKGA 4KK8D 1ZSDA 3KYAA 3EJJX 3CXFA 4DN4L 4FTDA 2J1WA 1KBVA 1LEKB 2NLJA 2C3XA 2DLTA 2PXYA 3JTBA 1TKWB 2PYFA 4ATWA 4YXHH 2QQNL 4RQQA 1FVCB 1KN4H 4LARL 4N0YL 4M8QB 2B9BA 2J6EH 4S1SL 5DK0B 3NP3A 1YDPA 3RNKB 3O0RH 1YEFL 1BQHA 2JJWA 1MJUL 1RZ7L 4NC0B 4GUPB 4XN5A 1QSFA 9PCYA 1KTDA 1KYDA 3FQWA 5ESAB 4BQ9A 4MD0A 5HYJD 1QKZH 1F58L 4DP1X 3PE9A 1I4FB 1WWWX 4ISVA 2GC4C 1JYWA 3ZDYF 6TAAA 4XAKD 3MNZA 2ZUUA 2GSIA 3BD3A 5ERWA 2FT8A 5A6LA 2NDFA 3KPRE 1QRKA 1KG0B 3UTSB 4ESKA 4JFFE 1NC4D 1NCWH 1QSEB 2F7PA 2WBKA 3QR2A 4S1QL 4D3CL 2FO4A 2BFVH 2CNZA 2NCEA 4K3EH 1HNYA 5D1QD 4EBQH 5E7FA 3QQ4B 3VCLA 3NJLA 4KZCA 3X1FA 5BZWB 1RIHH 5IZ7A 5IBTL 4F1SA 5DZPA 4E9LA 3D4ZA 1T5WB 3GM0A 4L8BA 2VW7A 4KKBD 5EO9B 1RZKH 1PLAA 3CBKB 1XF2B 2NPLX 4TLKA 5J6GA 1MIMH 3EJYD 4QLRA 3O9WC 1G6RH 1OGPA 4Z7WF 4Y5YB 1OWRM 4OLXH 5JPNC 1X9LA 3WXVL 5I1JH 2PF6A 1ITCA 3KPLB 2G5RA 1RZJH 1FC2D 1OLLA 4HKBB 1O5PA 1I7UA 1W0VB 3PL6A 4NENA 1K8DB 4KQ4L 2HJFA 5EU6A 1PLCA 4CMHC 4ZZFA 5BW7A 2R0WL 5T1LA 5TFSL 3ZMRA 1VF5C 4XVSH 2XN9B 2BVEA 4I1NB 2ZXDA 3MNMA 4F5CE 4J3TA 3HCVB 4P8QA 4TVPH 4I48A 3TBSB 4DP4X 5FCUL 4JMNA 3DJSA 5IV2B 1LK2B 2JKSA 2IFGA 4JL1A 1SOKA 2YR3A 5F9WB 1PSKH 1QABA 1Z0NA 5BOJA 2W91A 1SJMA 4NO2A 4I0PB 4QXUH 4RGND 4R6UA 1EVUA 1HOCB 1R47A 3LNGA 3V52H 5GIRB 3FS9A 4PG9B 1WYJA 4JJOA 4WV1C 2D7QA 2DZEA 3P3YA 4HAGA 3BVVA 1U58B 2OJEB 3BO8A 3JWNC 1FRGH 1FZOB 5C07D 4WO4B 3RPKA 3K8MA 4F27A 3SPHA 1TJIH 4BWUA 3O2DA 3NEEA 3GBNH 4N87A 5DXWA 4D2NA 3KPSB 3WHXA 2HT4C 4WIQA 1WBZA 3EHBD 2E0PA 3GSQA 3SDDC 2W9DL 2QPEB 3AB0C 2CSPA 1X7QB 2HRHA 3PNRB 4OZGB 5C08B 1NEZB 2GY5A 4CNIA 3KEHA 2AEWA 2Y0SA 3OR6B 5AZUA 4AM0A 1RERA 1HXYB 2PNDA 3LEVL 3WKQA 3N04A 3QXDA 3QNZA 1W6LA 4CSTA 2CGRL 3O2DL 3MJ7A 5I8CA 2ZUSA 4YHOL 4GQPH 1EDQA 3RWFA 1T66C 2F54D 2W1NA 3MCYA 3NCCB 3IFNL 5ANMB 1D9KD 3SOBL 3HC4L 1QLRB 1BF5A 4PGBB 3BPLB 2H9GA 1OKEA 2EXWD 5F7EH 2JCCB 3W9DA 3QQDB 1WQVT 3UPCA 5CIPH 5INCB 3LQAC 4GNKB 2JKXA 2LR4A 3QWNA 3IDYB 4G80B 4MD5A 4Z95H 2XUWA 32C2B 5AOMA 1EWHA 1MRDL 3S5LA 1L6PA 2EDNA 3RIKA 1FIGH 4ZX6A 3SGDH 1MPAH 4KOBA 3BVXA 5BO0D 1VCAA 1NUNB 5C0BB 1PVHA 3CTTA 4JAMB 3FFCD 3HZKB 4YSOA 3NCFB 4X5PA 1T21A 3QJVB 3TV3L 3CX5J 2VLKB 4YHIB 3AY2A 5J3HD 2X12A 1QFWL 3WXWH 4QRRE 3FH5A 3IETA 4ANVA 3T0AA 1YQ2A 4L05A 3OZ9L 1IBDA 2O5YH 4NWTL 3GI9H 4U6VL 4Z7WA 3R8BB 5LGJA 4OB5H 3EJRA 2BSBA 1K4DA 3BCDA 4WTQA 5B21A 5C09A 2XZAH 3ZQWA 3D0LA 2K3TA 4PH8A 2IAAC 3OBAA 1XF5A 2HWZL 4UQ3B 5DGRA 1JWUB 4XO4A 2O5ZH 1S7SA 3PWPE 4DP2X 1E6JL 3MV8B 3KW7A 4B27A 1TZIB 4JLRA 2NY7L 3R18A 5IIEA 2EYSB 1LM8V 4JPIA 2R2EB 5EWIH 2MPAH 2X9YA 5DD1H 1KNOB 1FHNA 4YFEA 1TYEB 2XTSA 5TGBB 3HAEA 5DHXB 1CE1H 2AKRA 1SRDA 4LEOA 5DMYA 4U6YA 4ODSL 3O2VH 4B6ZA 4FKKA 3KXFA 3PIQB 1ULVA 2I27N 4U6XA 4J3OH 3UTZA 3AT0A 4YX2L 5EIIA 4G9FB 3B3IA 4APQB 3UABA 2X4PA 1U3HA 1EAPB 3TBVB 4QHNA 4L9LA 4Y16D 2XQ0A 4HJUA 3RY6A 4P5TC 2PP7A 4PJAE 1X44A 3S96A 1IAOB 4K71B 5IB5A 2GSGA 2DWTA 3LN5B 5D7SH 1OD9A 3SKOB 1U92A 1E6OL 2AJSH 1OANA 1MCEA 3KE0A 3B9VA 3FQUA 4XNQA 5GZNC 5BJTB 1YHPA 3PGCB 4I4WA 2NY0B 2C1OA 1UWGL 2O93L 4MDJB 5EPMA 4LHUG 1JUFB 1TJXA 1P5UB 2E3VA 1AGBA 1RSFA 2IFFH 3ARGC 2N3JA 2MQCA 1PIGA 2R9HC 3D4YA 3IDJA 3LQAH 4XPAH 1JPST 5IJDC 5LCVH 3Q5TA 1U8KB 1OM3L 1UQSA 3G6DH 4U1GB 1FDLH 3EAKA 4N90D 5EF3A 1LO3H 2VQ4A 4V33A 1SMAA 1UFUA 4WI5A 3DMMA 3MLXH 2ZF8A 1F6AA 3HI5L 3VXRD 1JGUH 4JB9L 4HFUL 5DA4A 1NBYB 2B14A 5A2IH 2K6YA 2Z1PA 2P5WB 2IAMD 1UZ6F 4HJSA 4IS6A 5C6WH 5F7WC 5C0AD 5FA4B 3D07A 3RNQB 5D71H 5DEZA 4Z3FA 4HOMA 2VR5A 1CVSC 4YGAB 3IJ7A 3RVUC 3VXOA 5D5ME 3K6FA 4N2KA 1X7SA 3RBGA 1K6QL 1MWAA 3IGLA 4NNYA 4UDTB 4DHLA 1XH3A 4GS7C 4JGJA 4J3SA 1VFBA 3SPVA 5IVXE 2ZZUT 2X6AA 4HXBL 4PJ9C 3H3BC 2E7CA 4HC1A 1X5GA 1ETB1 3DYOA 4PJ5D 1QI5A 4V1DE 1U8OB 2JQMA 2VR8A 1A7OH 12E8L 3N43B 2MQ3A 3L1GA 2CRYA 2D9QB 2EDRA 4UNTA 4NC1E 4XMKL 1IQDB 1KGWA 1MWAL 4O02B 1KN2H 2ATPB 4IGBC 5IESL 1PCXA 3AQDA 2LU5A 2X70B 1ZXQA 4G71B 4J4PA 5DD0L 2IWGA 3PHOA 4PJFB 4X0KB 3ORJA 1F8TL 2B3RA 4HC1L 3V5KB 4AEEA 4U1MB 1KB9J 2OR7A 2FIKA 3EYFB 1N2RB 2QZQA 4NHUB 1RK7A 1Q72H 4OBSA 1ZHLB 1E8WA 2Z0UA 4N8UA 3OKEA 3CK0H 4XN8A 3MRMB 3QJXA 5DS2A 5ALCH 1G9MH 1TNNA 5FECA 2DYPA 5LQBL 2P48B 4PRDA 3GEWB 3MRPB 4XXCC 3GINA 5KJ4A 1WVZA 2ARJA 2B39A 1AGCA 4QHKJ 1ZXKA 1GCYA 2F5BH 4U1IA 4F7CB 4K5PA 4OZIE 3DVGB 1GL4B 1EFXB 3TYGL 4YHML 4MJ5A 2Z4QA 2VXVL 1VPOL 1MW1A 4XOCA 5D7LB 3MCKA 3V0WL 4XMZA 5D7IF 3QUKA 3HLAB 4Z3JA 5C0NC 5KG9A 1OQXA 3LRKA 1U3ZA 3DTXA 1DQLH 1FFPA 2Z7ZA 1ZAGA 4NZJA 1DR9A 4JQVC 2YUXA 4LRIA 2ZWLT 3QDGB 4ZOCA 2FE0A 3RFZA 5DRWA 4PJCE 1OT2A 3L4YA 2JJSC 4AJ0A 4MWFB 3A4EA 1TG8A 4AYEC 2Y2YA 4LAJH 4POZC 1ZANL 4YGVA 1HHKA 3FDWA 1CFBA 3AC0A 3AT8A 5AZ2L 1CI5A 3HB3C 2K6WA 1WFIA 3QUMH 2OTUB 3O41B 1AZRA 2DQUH 2VR9A 2XTJB 5IEKB 4TSAH 4DKEL 4DP6X 2IEPA 1AIFA 4GKSB 5T3XL 4JKWA 1X5JA 5GRJL 1OE2A 5E08L 4MCMA 3L13A 3REWA 3NQKA 5T8IA 4MA7L 2NZ1A 4G8IA 1L4IA 4UM9D 4U1KB 3JV6B 4PGDB 1CDCA 5FYLE 4LIQH 4PS4H 4NKOB 1ZGLM 1MUJB 5I1AB 3CSTA 3GHEH 4X4ZA 4L8SB 4OI7A 1YPZE 1UWEH 4D94A 2B77A 4BFFA 2BNQD 1JBJA 2F8OA 1EBAA 2AGJH 2DWXA 2QQLL 4PB9L 4LHUD 3FUNA 3X11A 2IANA 3THMH 3GD1C 3O0RL 1XAKA 3EFOB 3ULVE 2AJUL 3BIBX 4GG8B 1F4XH 4FQXA 1QNIA 2XVBA 3OC8A 4FXKA 4B9PA 4R4BB 2XIIA 2V37A 1ZGLB 3QA3A 1Y0LB 4OUOA 4IBZA 1D2PA 5ICYB 5E2TL 2BCKA 2M83A 2R56L 4QRPD 3G3LA 5HY9B 3LHAA 4JJ5B 5DRXB 3L3JB 2V2XB 5AW3B 3H55A 1SDDA 2X4QA 3BZFA 1CQKA 3QRGL 4OUUA 4ZW8A 4JM4H 4YSPA 3FONB 1FP5A 4XNZB 4G1MB 4KQ3H 2OYKA 2XWJB 1N8ZA 1LDPH 1H5BB 3QORC 2DMCA 3S3PA 4FA8A 3VA6A 3L3IB 2JI1A 4FQIH 4HSQA 4KRPB 3RJQB 3FO2B 1JHLH 1HYRC 3TCXA 5BRZA 3WEBA 3WI9A 2P80D 4PJXF 3T3ME 5JORA 5HHNA 4JFHD 1BXAA 4FLHA 3ZL1A 3QI9B 15C8H 3MBEA 2G9KA 4NRXB 1VEPA 4JZJC 1AD9A 3S35L 1EK3A 3Q6GH 1N59B 2NW3A 1M6UA 1OAZH 2ZNXA 3K2UH 4MA3A 3OXSB 3VVVA 1QG3A 4KRNA 1RKRA 2XOTA 4RFNB 3VFGH 5I23A 3P73A 5D2LE 5CFHA 2EE0A 2XQBL 1RZJL 3CVHH 3QCVH 2ZOTA 2A0LD 1CD1A 5D7IA 2M2DA 4E42B 4HOZA 3H9HA 1TMQA 2AEQH 1MFBL 5LJYH 2HN7B 1BQUA 7TAAA 2IWKA 5KSAD 3L81A 5EUOE 5IFHL 2HFEB 1BV8A 4ZO9A 4KGJA 2B08A 4M5ZH 2AQTA 3P9WB 2GJZA 4TNGA 1PSKL 4WHTB 4MMZB 4ZTPH 1L6ZA 2SEBA 3KPNA 2P1YA 4QXUL 5C0IB 3BDXA 5E1HB 3MLTB 3ETBJ 4YE4H 3W11C 1SXNA 4B9GA 5L8LB 4R7DA 5F89A 2L7UA 4FZEH 2G3ZA 1LK3H 4NM4H 2OMVA 4KXCA 2VR3A 4UM8A 1FRGL 3PWNA 1XGRB 2HKHL 5EZLA 1GY2A 1OF0A 4LOUD 3L5IA 1LO5A 3IJSA 1N0XH 4W9LC 1OEZW 1CTOA 3QQNA 3KVDD 4HEMA 2WM0A 4X4YA 5GGSB 5DVPA 3QW9A 3Q01A 4OAWB 4PLOB 1MCBA 3AUVA 3CZNA 2ZAGA 4D9RE 5L88L 3WUZA 1OK8A 5JOPE 2VN6A 4XHJC 1NDGB 2VDKB 2OS7A 5CIPA 4JN1L 5FYKU 2XYBA 4DP5X 2WTPA 1MJ7L 1CU4L 4OCXH 2ED7A 4L2LA 3ZE2F 1OTSD 4P59L 4U05A 1X4XA 4XH2A 5IHZA 4KNQA 3RIFF 4J23A 5F0LB 3F7VA 3VXPA 4B9ZA 5K39B 4X99B 5HGBA 3TESA 2NY1C 3MUUA 3PAUA 5JPNA 3J27A 2WOYA 3KWWB 2KPWA 3ARZA 4XX1G 3SZKC 2FRGP 3AG4B 5KSVB 2CR6A 3OAYH 3T0ED 4HUNB 4PHZA 5I0WA 5I5MA 1KB5B 1O7SA 3L8QA 1UA6H 4PRPB 1E5AA 4WWKB 5LGHH 2NW2B 2AJ3A 1CDJA 4I88A 4MNQA 2OSYA 3HBPA 4UANA 3VW3L 2H32H 1VKXA 1TXKA 4NM8H 4JO8A 2QHRH 3MOAH 4ZS6D 2DD8L 1HWGB 1YUHB 3DK0A 5IB3A 1KENH 2BK8A 1I8AA 2FBJL 2JIXB 4FTVE 2BIIA 3O0LA 4L3CA 4Y1AB 5FFOA 4BQCA 2EDFA 3NCWA 5IHLB 3LMJH 1MPAL 2BVUA 4PJXA 1MAKA 3MN8A 4Y88A 3WBDA 1TQBB 4JFDE 4WV1A 5IP4A 5KVFH 4P23D 3L5JA 5AB2A 4K94C 1A3QA 1T0NA 4Z0BL 5B39B 1PKQB 1S7XB 2IVFC 2OMWA 5DLMH 1HT6A 1RZ8A 1B6UA 2ICEB 3FQNA 4GINA 3DLQR 4LGSB 1CFQB 1BMGA 1F86A 4WHYH 1MSPA 1UVQB 4IEFB 1M2VB 1ASOA 5ISZE 1U42A 2A2QT 1BX2B 1MRFL 5D1XC 2O61B 4EDWH 1WEJH 2O5ZL 2ROXA 3BOVA 2YOCA 1R9FA 1D6EB 4UIMB 4JDVB 3DPBA 5HPMB 3QFJD 3AG3B 3BUBA 2VXTL 5EWIL 4Z5RB 5FM8A 4M02A 2Q2EB 2RH0A 7FABH 4LXFA 5DD6B 4NAMA 2QVFB 1JHKL 5E6ZA 2YWYA 3FQYA 3NESA 3QIUD 5E9NA 1QAWA 5F9JA 2F1EA 2LGNA 2HFTA 2R1WB 1EX0A 1QMUA 2DWSA 5DQDH 5HHOA 5HP5A 1JPGA 2YSSA 3U0PB 3LKNB 4LLQB 3G6AB 4ZW3A 4LCWB 4Q6YA 3DRTB 1H8OA 1MCWM 4M6AA 2Z0BA 2Z31B 3CIAA 4XP6L 2O5XH 3BYYA 3TT3H 3RL2B 4PGJA 1GS8A 2X4NA 1JOIA 1BZ7B 4DKTA 3QXTA 2EH8H 4HSAC 4R4ND 4GLRI 1XV8A 3HI6H 3QJTB 1MG3C 3S0PA 2NX5B 1PZ3A 3ULUC 1YEDB 3ZIYA 2XWRA 1T1WA 3OMZA 2HKAA 2EADA 2JKTM 4PWHA 3W9EB 1CC3A 3RZWA 1BVLA 1CB4A 1LP9B 2X2UA 5CR1A 5HBBA 4EZLA 4XPAL 3LQAL 3UTTE 5IFAH 1ZT7B 3PGFH 2NY3D 2OA9A 3RUGF 3G6DL 3HHRB 4DO5A 4CBZA 5IWLC 3LYRA 2D03L 3ECQA 3U2IA 4KGLA 3OKMB 2MOGA 5I2IB 4UNVA 3IMTA 4A6YB 4HUUA 4LU5L 1RZGB 3IMVA 5G5DA 1AOHA 1BAFL 1JZ5A 2FJUB 2ARJQ 1Z9OA 4JCMA 3X1GA 3QJRB 5JDSB 5CEZL 4NQCB 4K94H 2BVPA 4Z7QF 4L3FA 3C6SA 3V0FA 2WUBL 3DURB 2BSCA 4NQEE 2PW1A 4ZUWA 4W9GC