4G5AA

Crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
GKQHVKTKSDWVIQRTPVDPEWLKVYVDDESKRLCLNFKDSFAPITVEVKDIEKQIVFQSIIFPVAAGEYTLYLGDLSLGQYELYMYNASVKVVGNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative member of duf 3244 protein family (BT_1867) from Bacteroides thetaiotaomicron VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 14
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g5aA00
3SD2A 3D33A 4G5AA
chains in the Genus database with same CATH superfamily
1PDKA 3KPMA 2Y5QA 4PB0H 3WKNA 5TE6L 4DH2A 1Z9LA 1ZTXE 2C7UA 3ECBA 2EVHA 2OMXA 4QXTA 3OWRA 1E5ZA 1BHGA 4P2OB 3AWFA 1PU0A 2YJQA 2RQ8A 2QHLA 1FSKB 2QZ5A 4N8VG 5C0IB 4A7VA 5HI5C 1X9RA 5AFAA 1GGIH 1HHHA 3ULUD 3EGDB 1NC2D 2YA1A 2XN9E 4NZ8A 2FDBP 1DBJL 3CFUA 2XWBA 3HN5A 4NKDA 5EZJB 5DK2B 3ZZLA 1FV1A 4NBYB 2BDNL 2Y25A 4A37A 4ZZKA 4PEEA 4FNPA 3KAAA 2QFPA 3QS3A 5KS9A 5L9DL 1BQSA 3C5SB 3TX4A 4K5OA 5DJXA 5KZCD 2EIJB 3KVQA 3OX8A 1VEMA 2BNRB 1F6AB 4I0PC 4W9LC 2K8MA 1L0XA 4OT1L 2VAAA 5EOCH 1AGDA 2CDFB 4M6OH 3OLEA 1RP9A 5E8PA 3QPXH 4OCRH 3P02A 3QIUC 4F37F 4G5ZL 1M7IA 3IJYB 3SPJA 5DGRA 1G7HA 5I2IB 4LVNB 4ZQKA 3TXAA 3GHEH 4AM0B 4FEMA 3TIDA 3NIDF 4QTHB 1TYRA 2MQCA 4JPWL 4N24A 3MCKA 1QNZH 1QFPA 2CSPA 3O4OC 1OT1A 3QAZB 2IAMA 4GQQA 5IESH 1MDTA 3FU7A 1NCDL 1MHCA 3BP7A 2BVPA 1K9TA 2FTAA 1EVUA 2FX9H 3LRMA 4LIQE 3PJLA 3L6FA 4G2AA 5FB8A 1Q0XH 3FAWA 2OBGA 3MOBL 1I4FB 1IAKB 4LL4A 1T1XA 2FIKA 1DQTA 2D73A 2Z4TA 5JOPE 2OMUB 2WLIB 2OMUA 2WLIA 2ZAIA 3R06A 1MCBA 3G6AA 2ARJQ 3V0WH 2XRAH 3MGTB 4P2CG 4WUUA 5GIRB 4ZSOB 3DGGB 3MRKA 4PJEB 4QHMB 1F58H 3RPKA 4P3DB 4YO0B 8PAZA 4OZHA 3WD5H 4NZTH 2CE6A 1OP4A 5BQDA 1SVCP 1T2JA 3FSAA 1TZOA 1V10A 4PRPE 1KIUB 1FBIL 4UU9B 2LR4A 1LE9B 1PQZA 5LJYH 4Y9EA 1OCOB 4Z77A 2BP0B 1VJSA 1PX4A 4PJIB 3UC2A 2WY3B 5IVZA 4HJ1A 3DV4B 4HPYH 2ORBL 4XMUA 4NPYA 4YDMA 1IBFA 4TRPH 1T04A 1CCZA 5AVQB 4H0HB 3FL7A 1QTSA 1S7UA 3DYPA 3B2PA 3EF4A 3MLYH 1JBJA 4R7LA 3PNRB 2A9NL 3ZYZA 5BUPA 1RUAL 3EJRA 4V1DA 2PP9A 4D0CA 2O61A 1FO0H 3DIDA 1HXYA 4TQ8A 1LO3H 2V9UA 1TDQA 2GSIB 5DHMC 3MX0A 4AEIH 2EH8H 4U1KB 2FATH 2XIDA 2R69A 1FVDB 4FTVB 5F9DC 4XVJH 2B1AH 5C2UB 3E9TA 2OZNA 3FW6A 2WBJC 2ROXA 3SGEI 4BK5C 3ELAT 4QR7A 4ZUVB 1KXVA 2CLVA 3GLEA 4HC1A 4WW2A 2FB4L 3VD9A 1LK2B 1M7UA 4QOKD 4H1LG 2IOIA 4ZUWA 4BH7B 4XBGA 2DMGA 5B1CA 3D0LA 1WFIA 2IWKA 5KVFH 2CUHA 2HLEB 4XXWA 1HESA 1NUDA 4XNXH 5ESVA 2B7DT 5D7HA 1GVIA 5JZ7C 3R0NA 4YE4L 5LQBH 1TTFA 2PTVA 1IM3A 5AZEH 3QUMH 3UG4A 3LH2H 4B53A 1J12A 3MGOA 3S7GA 1XGPB 2GB2A 3NCFB 1QSFA 1A6UL 1ZS8B 1F3JA 1H3PH 4F7EA 2CALA 3N1MC 3Q5OA 4OLYL 5L4JA 2HG5A 5D7SL 5F96H 1TR7A 4W6YB 1HS6A 2AXHA 3Q9PA 4JRYD 4MA3B 2A4ZA 2I07A 2L7UA 2H3NA 1FVEA 4UUJB 2H2SC 3GYRA 2OYPA 3W56A 4PGJA 1CLOH 4GS7C 4JFUA 2ZWKA 2ADGA 1VPOH 3APDA 3TS8A 3M7FB 5CUSH 1BVLA 5K1NA 2J20A 3COOA 4CMMA 5D1XE 3SD5A 3W81A 3DVGA 3GLDA 1SEQH 2DM7A 2XX0A 3FU6A 1HQRA 2FX7H 1AANA 2GSGB 4L23A 1H6FA 5GGTL 4Z7QE 1I8LA 2DM2A 1E9PB 1KB9J 2F0CA 2G5RA 3H1ZA 4O02L 4TXVB 2R51A 1K3ZA 1QEWB 3CFCL 4GNKB 1NCAL 2VXUL 4XMKL 3MGAA 5F8QC 2AK4B 2YRBA 1UM5L 3L1OL 2FJFB 5KAQG 1D5BA 4PS4L 4E41A 5CBEB 4XPTH 3F6JA 4AW4A 1GS6X 3MXWH 4NZTL 4WI9A 3BUDA 4M8QB 1N70A 1FFNA 4OM1L 2RALA 4E5XB 1B4RA 5ACZB 3JTSA 4WUKH 3WY4A 4S1DC 3SJVE 1A7NH 1JGEA 3IPBA 1IEAA 1Z3RA 4IOFD 3QDJA 4N87A 5JA9A 2DYPD 4JZNA 3DUHA 5EN3A 3MACH 5EIIG 2J6EL 4P07A 2XA8H 3O6MH 2R4SH 1Y6MR 5CCHE 3FOMB 3NFSL 5BO1L 2P52A 1NICA 4KY2A 3RTQB 3OKLA 2W59A 2APWA 1UM4H 3TBTB 2QHRL 4ATWA 2DRUA 2EINB 3BGFB 1C7SA 4UT6L 1WZ1L 3Q13A 1FFPB 1FZOB 4YWGL 2VRAA 1KJ3H 1C5CH 2OCCB 1D5MA 5AG9A 3SGDH 3V7AG 3DETD 5CR1A 2ED8A 1DE4B 2A6IA 2NRDA 2WOYA 4WU5B 5LWYH 4TPRH 2P8PB 4QXVA 4L0ZA 2PW1B 3EFOB 4BFKA 4J7RA 4ORGB 5CM1A 1GL4B 2OTWA 3S35X 3TASA 3W0WB 4LEXL 4E5XA 1JUFB 2XQBH 4G7QB 1RJCA 3VGEA 4R83A 4YH6A 3GSNL 3IDGB 1UACL 3CZJA 2YEVB 2OAAA 1O7SA 1C08B 4J3XA 4Z7WE 2R2EB 5FC9A 4ENEC 1QOKA 4DESA 4L18A 2ZOTA 1I3GH 2CHWA 4JM2D 3HC0B 1UB5A 1OGPA 2EDTA 2F58L 2E8ZA 4ZSOE 1JF1B 5FV2A 4KK9D 4PGEA 3IU3B 1GHFL 3MBEA 4LHUB 2CO1A 4NQCE 4M93C 1TEFA 1WSST 1AQKL 1FZJA 1MWAH 2MIZA 1M7DA 1Q9LA 3P4NA 4NQTA 1OK8A 2X2HA 1F97A 1MJ8H 4EIZC 1KEML 4X0KA 4XB7A 3GEWB 1U8MB 3CVIL 4KZ0A 4DP4X 2RCSL 1WFJA 5EZIH 2D0GA 4FQ2H 5CJXC 3IDYC 5EN2A 4JPQA 3MFFA 5C92A 3IMVA 5JHBA 4LVOB 2B4CL 1Q0YH 4MDJA 1I7TB 1T7VA 5TQ0L 1FZKA 4H7VA 5IV2B 3QDHA 3G08B 4XC1L 3T3PB 1JYXA 4Z7UB 3VD7A 4OLUH 4CC0A 3KLHC 1FAKT 2EVJA 1FLRL 5JPMC 1ZIAA 5DTFA 1MW3A 1TQVA 4HK3N 5SWZD 2VIRA 2ZX7A 1WCQA 3EYSL 3VM7A 3VU1A 4OZFH 3MLVL 1LILA 4IDJL 1YNTA 1WC7B 3DV6A 3SE9H 3AQZA 5H94A 4PR5A 1CICA 1BG9A 1TPXC 5CJOH 1DUZA 2BC4B 1NFDA 2ZCKH 4GBXC 1AR1D 2KL6A 5J1TC 3RWFB 1SEBA 2BO0A 2B1HL 3W11C 4AI7A 2J2ZB 4HXBL 5BMFL 1DN0A 3EYFA 4RA3A 2G4GA 1JGLH 1ACZA 5LBSL 3F62A 3F58H 1K8DA 4K9EH 4NWTH 4O5LH 3AUWB 4OR1A 3GMQB 2UXGA 1MW1A 4JO3H 5I1IH 4PLJD 1HN1A 5I0XA 4B50A 1DJXA 1GAFL 2IJ0C 1PKOA 3FPYA 3LXAA 1BD2A 3C6SA 3QXDA 1EGJL 2GTWB 3X3GH 4WI0A 6TAAA 5IHLB 2RFXA 1YJDH 2NXYD 4NRXA 2AF2A 5DS1A 1KC5L 2OMTB 3P1VA 1T1ZA 3TZVD 1TF4A 1OL0A 1YEHH 1Z9PA 1KENH 1JHTB 4KXBA 4AL8L 1KB5L 3MRRA 2V2WB 3FN3A 2OKMA 4P5RA 2H9GB 3L3IB 3BC9A 4P9HL 1L9PA 1KBGL 2YD8A 5I0WA 3FHAA 3NYKA 2H2SD 4BZ2A 3V6FA 3MUGA 3MUGB 1SMOA 2FR4A 1Y6KR 1FAIH 1PJWA 2EADA 3PGDB 5IQLA 3NOIA 5C0GB 1QEXA 1XF4B 3KL5A 3MRRB 2AZUA 3QIUA 3D69B 2OTUA 5HGHB 1RUKH 1AAJA 1HHIB 1AI1L 4YHLH 5BMFH 4GOSA 4LKXB 4MJHA 2CK0L 1LQBC 1ECZA 3MBXH 4XN1A 2F74A 4ODUB 4ZSOA 3H55A 1CFQA 4BH8A 2RBLA 1OF2B 4X5RA 3TCLB 2DQHH 3BAKA 5IKCB 5IG7A 4MNHA 4BQ6A 1JHLL 5I75B 4Q9QL 5I66A 4N2KA 4V1DE 3BKCL 4EN3A 3LB6C 4N8VA 4QYOB 1DN0B 1V8HA 4QTFA 5TTRA 1BFOA 3OHXB 4LPVA 1MEXL 3WO4B 5F89B 4BGLA 4RETB 4CU6A 1QA9A 3QCTL 5GGSB 4B96A 4KPHH 1WF5A 3QORA 4OI9A 2P8LB 3NTCL 4XWGL 3NK3A 3ZQXA 3SPCA 1UFUA 2NYYD 4L8SC 1OV8A 1NOLA 4WQOA 5CZVH 4PJAF 4ZZFA 1MFMA 1DO6A 1DZ0A 1UD3A 1Q0YL 2EKSA 2AJ3A 3KPNA 4HCRL 5TQ0H 3BP4B 4DJMA 2EIZB 1O6VA 3BPNC 4Y1AE 2Y5TB 3HG1E 1U8HA 2EXYC 3KM1A 4WU7A 3OKNA 1L3WA 2N59A 4NT6A 2VAAB 1YN7A 3QGVA 4W9CC 3KGRA 5EO9B 5BS0E 2PXYB 2WINB 2CIIA 3LJ3A 4HSQA 4IKLA 3GSRA 4LDLB 1NTDA 2C1OB 2DQCH 4YSAA 3VFPA 4KV5E 2K4WA 2QDWA 4OUOA 4Q89A 5DMGD 3VI4F 1DVUA 3H56A 4WY7H 4I1PA 4DKAA 4JVWA 4QRRD 5IT2L 1AR1C 4LSPL 4QY8B 12E8L 2MRYA 3DX4A 2DQUL 3DO3A 4YSPA 3ZMRA 2O5YH 5CJOL 4OF7A 3V0EA 1SJEA 4IOIA 4XZ4A 1IQDA 5EBMB 2CUMA 5KVDL 1FG2A 1L9NA 4OQTH 4BQCA 1NCHA 1BGXL 2JJTA 3SDCD 1CJYA 4BUGA 5E1AA 3T8VA 1UWYA 3SGJC 4BSVA 5F1NB 1U8JB 1J05B 4UNUA 4CGTA 4IBUA 2R2HA 5FM5M 4B0MB 1IKOP 4BD4A 4X4ME 5CILH 4ELMB 4J2XA 1A9VA 4HH9A 3EG9B 4KQ3H 3FQ4A 4FZ8H 3U4KA 2PYFA 5C7XL 3OLDA 4TSBH 1FL5A 3GHBH 4F9LC 4LF3B 4JG9A 5CFHA 3O4LE 3TZVC 4G6JH 3HG5A 1A3RH 4HOZA 2QTVA 3FCTB 3X12B 4Z3EA 3QCVL 4WW2C 3RDTD 1BFVL 5DD1L 3TVMA 1DP0A 4JN2B 1BZ8A 2KS0A 3E7JA 4PP1C 4OLVH 3ZZSA 2EKJA 4K5NA 4Z0XB 4F80A 3BPOB 4TM9A 3GRGA 5E1HB 5HI3C 5HVHB 3RKPA 3S2CA 1XCWA 4AMKH 1G94A 2Q6WB 3WO3B 4EAEA 1LYQA 2FEDC 5DXWA 4XO3A 3SJVA 3BLKA 2WD0A 4XXCA 4JN2A 4F24A 3I2CL 4ILDA 1K4CB 3L17A 4I13B 3T71A 1LDPH 4WF7A 4NOBA 3SPGA 4WFHE 1NC2B 3WEOA 3OKDA 2PCFB 3X12A 4U3SA 5HDBB 3UTSA 2WVVB 1QABA 4PTTB 1G0YR 5FA3B 1DQQA 1F4WH 2VN5A 4MJJA 1F11B 2O6PA 3KH4A 3RJQB 3T1WA 4I88A 3L2NA 1YHPA 7FABH 3HHRB 1NEZB 3BW9A 1J05A 3IU4L 5F1NA 3BESR 3T0EE 4PJFE 5C0BE 1ZS2A 2MNUA 3G5WA 4NEHB 2LU4A 2HJFB 4KRPD 5EF1A 1EERB 1HDMA 4B9PA 1GYAA 3OR7A 4JG5A 4YL9A 4W9JC 4YUEL 4TLUA 2X12A 2PUQT 3WN5B 3EYVA 5MEQA 4Y5YA 3O2VH 3EYUL 1G87A 1A1NB 2F7PA 1OAJA 3DRTA 5FYKL 5SV3A 2WXPA 1OHQA 3CLFL 3AXLB 2UUDH 4DN4H 3SDAB 2FHCA 3QFJA 1D9KB 3RFZC 1P5UC 5E5LA 5BO1H 3BIBX 2CHZA 5A7EA 1TMQA 4A2DA 1X6NA 4BZ2H 4N90E 3JV6A 3PGFH 2WQ8A 2A83B 3QDMA 4E9YA 2ZF9A 2X2IA 5DMGC 4TUJB 2Y5TA 4OW6A 4FERA 5FYJD 4RDQF 4WK0B 3F7YB 3MJGX 4H0IA 4QIRA 3QIWC 1N7ML 3QI9B 4HLJA 2PWDA 4PRBA 3S88L 2X4PB 2B59B 2CGZA 3LH9A 5I76A 1I8LC 4GKNA 4DK5A 2E6PA 2OMVA 2FWOA 1JFQH 3SQBA 4A2GA 1R3JB 2YK1L 3HOGA 1EXGA 1BZDA 2WYIA 3MRMA 4UQAA 1A4JB 4X4YB 1DJHA 1OGTB 4OSUH 4DKEL 2Y2TA 2LW3A 3JV6B 4DUXA 3ARVA 1T0NB 1TVHA 2XICA 3CBJB 3S4SG 3WTVA 2YKKA 4RGMB 3QEQB 8CGTA 1OF2A 3VXSB 1EEZB 4F8NA 3ARFC 4ZMLA 5E9AA 3UTQB 3SCMA 3B7UX 3CH8A 5DS8A 4X5QA 3P11L 5CBAB 2Q8AL 1WE5A 1XVSA 1TOXA 1YJDC 4IGBB 3VSUA 4HXAL 2P5WE 2XI9A 3MJ9A 5J6SA 1JZHA 2K4AA 1M71B 4DVBA 3UYOD 3UGXA 4Y2DD 1TQBC 1VFBA 1S7SA 5IBLC 5JHDA 1KBWA 3DXAD 2MCPL 3SDXF 4FC3E 1ZJBA 4RZCB 3ZLQC 1PYWA 3I2CH 1YEJL 5AZEL 3TFKC 4GI9A 4AYBA 5IZ7A 3RYMA 2AV1A 2YAMA 4NC1E 4Y4KC 3UDWA 3UTTA 4GUOA 2E7BA 1Y6NR 4PJBA 4RAUB 5I24A 3MXVL 4RBPH 3FSOA 1YEFL 4LSVL 1VLXA 3DXAA 3KL3A 2R2CA 4RWYL 3GSOA 4RRPA 1T03L 2YMXH 5C7ZA 4KRPC 4BK4A 3SB3A 1C1EL 1I9EA 4MJID 2J2ZA 1AQDB 3Q6GL 4X5LA 3GRWH 5ISZD 1NLDL 2X42A 5HVFB 4GQZA 5DUBB 3VXUA 2HJLA 1S78C 3RVUD 3CFKA 5FO9A 1BYOA 3GUTB 1DQMH 1YAZA 2DDQL 3B9VA 5D2NC 1UJ3B 4PLOB 3KPSD 1ZLWH 1RKRA 2KC0A 1NKGA 3VGGA 3TVMB 1RUMH 1XCXA 2BOLA 2J3SA 4Y1AB 4HKBA 1KMGA 2W0KA 3MGTA 1F02I 5IOKA 2FX8H 1W0YT 5D6CB 3R0MA 2D03H 4XZUA 2DWDB 1SYVB 2F58H 2HG0A 4KQ4H 1J8HD 4MNQD 2YD9A 4HH9B 1BQKA 4XCFH 4DAGL 4XMTA 4TUKH 1XH3B 1BLNA 3TIEA 2XX1A 2ADIA 2ZUYA 3N44B 3S34L 5HD8C 2P46B 3PABB 4ODXB 4QLRA 3VVWA 4N90D 5JR1H 1ONQA 3CCHB 1SRDA 4JCMA 3EFDL 2XVLA 2YPKB 4KFMA 3FH8A 1BAFL 2R4SL 1OARL 4IRSC 4NPKA 4YHIA 3RHWK 5AVSB 5FYKE 4LOVA 4NM4H 4YFLI 1WK0A 2VDOH 1CIDA 4YR6A 4FHKA 3HZMB 4BQ8A 3QE5A 3P4OB 4QRQB 1CE6A 3D2UD 4QRQA 4D94A 4NT6B 3V0WL 1EEYA 5I1DB 3HG1A 2X4UA 1NMAL 1EH9A 2H3KA 3HC0A 4JS7A 3VJ6A 4AG4L 4DWHA 4JHVA 3K71B 3D25A 1IRAY 4G80A 4UV4L 2OL3A 5IIEB 1A0QL 4HKJA 5JW3H 4Q56A 2WVSA 1T83A 1JDAA 2HJFA 1BOGB 1EEQA 3MO1B 1Z3GH 3F04A 4AQEB 4TVSa 3ZL1A 1NGQL 2C7UB 2FBRA 1Y18B 4QRPE 4NO0B 3KPTA 4U6TA 1DBBL 1BFOB 4EIGB 2AQ3A 4QMEA 5DRNB 3VAEA 4O9HL 3ARRA 2WQUA 1ES0B 3BAIA 3CMGA 4X9HA 1CU4L 1X5IA 1RIHL 1NSNH 2FWSA 2QMJA 2WQVA 2APVA 2IADA 4G9DB 4AQ1C 1OLLA 4PY8I 2YJLA 4ZUUB 5JNYA 3U30C 4Z3IA 4NNXA 5AAMA 1EQWA 2X4TA 1JDCA 5I8EA 4XP9H 5E1IA 3BX7C 1A6WH 1FORL 1PLGH 4UNVA 3S35L 5IFHH 3A47A 3MROB 1QNZL 4WW1B 4KMTH 1YEFH 4XVSL 2MQ3A 4JZJC 1I8MB 4Y16A 2FH6A 4FMKA 3DXAE 3GZPA 4XT1C 1XF3A 5IJVA 4GSDH 1INEH 3V6ZB 1GIGL 1KBGH 4JFHD 3RUGA 3AU0A 4Z7OE 4BWWA 5F2FA 4XX5A 4KVPA 4E9TA 2VWEE 2C7FA 2P24A 3TT3L 5JOFB 3RWDB 1KPVA 1RPQA 3LN4B 4W9KC 1YYML 4QUOA 3CXFA 5BRPA 1QUNA 1XXFC 4MXVF 4H88H 4TS6A 2A9MH 3FCTA 2VYRE 3FO0H 5A7BA 5FXCH 5KWYC 3HBQA 3B2UD 4LLYA 3KPLA 3BGFC 5IB1B 4RGNB 1IIIA 5E2VL 1DQDL 3EH1A 1S7SB 3T0DA 3GMMA 2PLTA 5IQ9B 1XV8A 3NFNB 5BXFB 4TRPL 2EECA 4MQXD 4K3JL 1OAQH 3EDJA 2A9AA 1B3IA 2X1XR 1VGEL 5DJ8A 3JUZA 3SD2A 3HUJA 4OVVA 1MDAA 3A21A 3T2QA 2YGVA 1ETZA 2OZ4H 4DFHA 5EPMB 5IHUH 1YNTB 3DV6B 1Q9KA 3SBWC 1EXUA 3CN0A 4I77L 2WAHA 1SQMA 4DPAX 1O6SA 3F12B 2DY2A 1ZV2A 3HI6H 3HUJF 1SBBA 1YEKH 2AJXL 4RMTA 5KBMA 3W9DA 1NLBL 3RY6A 5FGCE 3DOSB 5CHNB 3DOSA 1DQVA 3N0AA 3GRWL 3AXHA 4I48B 5ECJE 5C0CA 4WI8A 4Z7UA 5BRZE 3L13A 4ONOA 1XD1A 2CBQA 2JKLA 3UJTH 4UF7C 3DK2A 4L8SB 4KDWA 2HSIA 4V1DD 4MAUL 5I1EH 2YRLA 5H37H 3BRDA 3CPUA 3L1OH 3NCBB 2A7BA 1B2WL 1E8YA 4AE0A 4PRBB 3B37A 4KRNA 1YPZF 1MH5A 3LEVH 5GGSA 4CN6A 5CIPB 4WWKA 4XPFL 5TE4H 3SHSA 4XCYB 1ACXA 3SYCA 1FGVH 1HWGB 1QQDB 1FZJB 2WAQA 2YAPA 2B0SH 4GKSB 4MJ6A 4MSWA 4EKXA 2Z0UA 2BHUA 4YIQB 4HW6A 2ZXEB 3O2WL 3CSYA 5K1VA 1U8CB 4L1HA 1P6AB 1GSKA 3GNMH 5DJAB 2GHWB 4DKFH 4ODVH 4YDKL 1JHLH 4PCKA 3AREA 3CZKA 4D0CB 1U58A 3LEXB 1U91A 1WFNA 2XLLA 3P3TA 3VXRD 1AD0B 3JWOL 3VWJA 1C5BL 4JG1L 2M83A 3PWPD 1MJUH 2AABL 1RZ7H 1TETL 4D2NA 3QQDB 5DS2A 5FK9B 4R8WL 4PJDE 4TF4A 2ODHA 3LB6D 4U05A 4TPRL 2XG5A 3TA3C 1AD9B 4FNTA 5KZCB 5LCVH 4F93B 2G3NA 5A2KH 1FCCA 3K72A 3A6CL 5EU3A 3KEDA 5AZ2L 1VAHA 1XF3B 3RIFK 5IJVB 4F2MB 3CQPA 3AY2A 1KIUA 4HHWA 4WHYG 5CP3A 1MZZA 5C70A 4LPTA 5D5MA 3IMSA 4UV4H 5E99L 3QJZA 1ZT7B 5D7JD 2JB5L 4P3DA 4YO0A 1A6TA 2IFGA 3TVMD 2OL3L 4U3SB 5I0DA 2Q7NA 1B88A 1ASOA 4ONHB 1NMAH 3K6DA 2KZKA 1BD2B 3B2XA 3C6SB 1DVQA 5E5MA 3KPSE 4J8QA 2ZWNA 3O4LD 1TFHA 2NDFA 1A7NL 2WWMD 5DHDA 5FKPA 4NNPL 3GF8A 5AVXB 4CAGA 3I9PA 1K8DB 4C55A 3U2SB 1ZY9A 4HS6A 3O2DA 3U6RB 5B8CA 3FUNA 2YQ2A 3ILPA 4XN2A 4U1JB 5ESQA 3WNLA 2ZYSA 4JRYE 4AQEA 4GP4B 3KLQA 2P8MB 1PG7X 3BCDA 3BAEH 4DKDC 4R5XA 4KMLB 2R15A 3VFRA 5HHMD 5E4EC 2AVGA 1RIHH 3QXVA 4HKJB 1KCUH 4PWJA 3QDGD 1D7FA 2XQYK 4PSRA 4Z3FA 1ESOA 4HX1B 1T4KA 4AKQA 1N2RB 3TOPA 2MKWA 1KGWA 3D2UB 1A1MA 1B3JA 4QPEA 1IARB 1WBZB 2XXMB 4HIHB 4JMNA 4RGOL 1WISA 2WLZA 2I85A 1WH0A 5LAPA 2GITB 5D7LD 2QPEB 4JY5L 1EHLH 3EYSH 3VFMB 4JE0A 4UT7H 2PKDA 4LARL 4U6XA 4MCYB 3LMJL 2VMDA 5EU4A 1CYGA 1AJ7H 4KC3B 4O51B 3WD5L 1BG1A 4A66A 3WO4C 1FG2B 3QYNA 1N64L 1SMAA 5INDA 1FP5A 4X6CE 2NX5A 4M3KB 2UZYB 4E2OA 1IKNA 2UZYA 3BWUF 1XIWB 2IMMA 4Y4KA 5EO0A 5FYJU 5SWSE 4BSWA 1WFMA 2LLLA 5SX4H 3X1NA 5C2BL 3MRDB 2VRKA 4AJYV 4WJ5A 3CVHB 2ADIB 2DQTL 3GXPA 3F7LA 4XX1E 1NCWL 1ZS8A 2G30A 3QAZC 5GISH 1ET5A 1G6RH 2Z31B 1VADA 2E75C 2GITA 2AS5M 1SYVA 2PCXA 1K85A 4TQIA 4A6YL 1ZHKB 2A9CA 4URKA 1ZT4A 3SKOA 2E3VA 3IDIB 5EU7C 3MZTA 1R3LB 4X80H 5GS3A 4X6BB 5F9WC 4GP5B 5IQ7L 2XSKA 1IEBA 4K0OA 4ZAKB 4ZUWB 4BH7A 4KRLB 4MA1C 4I77H 2ZSVB 4BZ1H 2Q5BA 4L9LB 5J12C 4LAQL 4N0YL 2AEOA 5DJDA 5DWUL 4FFZH 2G9HA 3C5ZC 3CVCA 1DVXA 1MFEH 1YMME 4HXAH 3VQLA 4AZ8B 1GC1H 4EZMA 1NMBH 1XT5A 4IBQA 3T6XA 1DZBA 3UO8B 5CF3A 1HNGA 1SOQA 3V2AR 2C3HA 4JFEB 3RG1C 2LTQB 4CADA 4XNUL 5L88H 4ODWA 1S7VB 3D3VE 5I6PA 1HXYB 4ZFOA 3RKDD 5T3ZD 1KCWA 1G5GA 3H54A 3OL2A 3CIQA 1PG7H 1JK8A 1HL9A 4N6RB 1N12A 4TUUA 4PGDA 1KXVC 4ZTPL 4TQEL 4XO5A 3SE8H 2HFEB 1NKOA 1R1CA 3O8XA 4AYFA 4OVUA 5IHZB 1G4MA 3K3QA 2ZT9C 2VM9A 3BKMH 2A38A 1SXZA 4APQD 3TA3B 3E1ZA 4FG4A 4M6NH 4CSPA 2PXYC 3C60A 3QCTH 1QO3B 2ZJSL 4DZ8B 3KR3H 3RVXC 3JTSB 5HHVL 4N68A 1QW8A 2KPWA 2KQNA 5D6DC 4HULB 3ETBJ 5FLUA 3ZE2F 3FUKA 5AVWB 3L54A 1BIIB 4Z3GA 3L9BA 2FAUA 2WXLA 4G8GA 3GGWA 3KL0A 4NJAH 2AEQL 3IPFA 4KO7A 4L3FA 4Z7UE 5D72L 3RI5F 3WHE1 1AC0A 1OSZB 3KPOA 2AAAA 3O3BA 1LO2L 3OJ2C 3HZ3A 1E9OB 1KJMB 4UIMA 3N0PB 4OI8A 4EVNA 1RZ7L 2BP8B 3OJVC 2B1OA 1USQA 3S36X 2PCPB 4OM0H 1EBAA 3N43F 5C08A 3QZOA 3Q6FA 2DM3A 3N42F 3U7WL 4AYEC 5J1AA 3LIZH 4ETQB 1JPTH 3CZFA 2O6DA 3MUJA 1WIUA 1UKSA 1FAIL 1FIGH 4ODSH 1HAWA 2ZYRA 1DUZB 3IFNL 1EZLA 1MHCB 1C7TA 4E42A 2G2RA 4PV8A 5JA8B 3ESUF 3EIFA 3FMGL 2X88A 3QI9A 1N3NA 3SYAA 2QR0B 4QRSB 4H25A 3E8UH 1JWMA 4JGUA 4P4KB 4ZQKB 5MI0C 3TBYB 1KPUA 2C9XA 5AL8A 1UM6H 3RRQA 3RWGA 5KBDA 2E7LC 2X4QB 5MEOB 1T83C 3BZ5A 1LO5B 2OULB 1JNHB 4ZS6C 2GBTA 3QB7C 4ODHL 4P3WA 1O6SB 3F12A 3T6QC 2VQTA 4UMGA 1MUJA 5EIIB 3VXMB 4Y5YB 4UT6H 4OZFA 1RK0A 1RP8A 2CO6A 3T65A 2W65B 2JTDA 5F7EL 4XWOD 5EG6C 4HALA 2WP3O 4YSRA 2H1PH 4UYPA 3UBXG 2RIKA 4F58H 2CLRA 4PP2A 4RMUA 2VC2B 4KU1A 3WFDL 2EDWA 5FDWA 4Q6IC 2XZCH 2FO1A 1JTOA 2VXQA 1FNEB 1Q90A 3KYAA 2W65A 3EO0B 4R4NC 4EXPX 1OCRB 2GIYA 4LCWD 1JF1A 3VRJB 4Y16C 1XGTA 3GMPB 1SDAB 3SSGA 2RB8A 1KT2B 2AKRB 2DMCA 1Z6JT 4PIBA 1VRSA 4JQXA 1MXGA 4LNVA 4BFFA 1JK9A 2YBRB 1QRNA 3NCYP 2X4QA 2OK0H 1HOCB 1IX2A 5C0FA 1NUNB 3LKPB 5T1KB 2WO4A 1BMGA 4ATTA 5J11C 1F4WL 2ZOOA 1YLBB 1YMMB 1BGXH 3TBYA 4LGRB 4Y88A 2EIMB 3TBVB 4GQPH 3DURA 3O3DA 1EAJA 1MAML 2DS4A 3S0PA 4ZMNA 3D5OF 1KTDB 3H2WA 4JO1H 3VXQA 3WXVH 4UOJA 4AVHA 2TSAA 2J8UE 4XVUC 1EJOL 4MA8H 5DCCA 3FTZA 3VACA 1AP2A 1HNYA 4RISL 3T2NL 1MHHB 3C75A 4ZUSB 4J6IA 5KVGE 2UZIH 2HAZA 4A6YH 1GGCH 3C12A 3K46A 4APXB 2WTRA 1KBBA 1JCKA 1GC1C 2P5WB 3W82A 2AK1H 2Z35A 43C9A 5GRZA 1AZBA 1SDDA 3R4DA 5JNYB 2FL5B 3G6AB 1JJUA 5BRZA 3NSFA 5E0QA 1AHWC 1NAML 4ZS7L 3MLTB 4U31A 4H8WH 2VQ1A 1OSZA 5C0RL 1GCFA 1CLYH 4HISA 1U42A 1CT8A 3ZL4H 5GGRB 2EIEA 5SWSB 4WUUD 5MEPB 2BVOB 3UCRA 4OD3L 1IM3D 2ICEA 3UERA 3HNSL 4LBEA 3MOBH 2FX9L 2NCMA 3HUJE 4H8PA 5C0JB 7PAZA 4PRHB 2FJHB 4MDIA 4RDQG 5GS0H 2NY1C 3MRHA 4QHNB 2QGDA 3UYRH 3ZE0E 2X4UB 2V8MA 2FQFA 5IMMB 5B39B 2CDFA 4M6ML 4AJWA 2CIIB 2ED6A 2PXYA 2WINA 1MWAB 4MA7H 4HUCA 5KN5A 2WQRA 5B39G 1CD1B 1COBA 4Z76B 4HT1H 1BJ1H 4YR6B 5HYSA 1W0WB 1ZAGA 2AZAA 2XXGA 3TPKA 3X3FL 1XEDA 3ATFA 3DO7B 4UILH 3T4YA 3D1MC 5E2WL 5FIEA 3C5XA 3UFIA 4D9LH 2YXVA 5LAXA 3QO0A 3U25A 4DFIA 5MENB 2E74C 2P5ED 1QLEB 2H8PB 4APQC 1EAOA 1U21A 2YPLB 1ND0A 5HHVH 4CBPA 4OZIA 2Q7YA 1ZLSL 3QORB 4LGPB 3ARYA 4KROD 1D6EA 1QRND 1OANA 1K4DA 2ZOKA 3VXPB 1G6RB 1YQVL 3STZA 3QIWB 1EX0A 4BRVA 1N5YL 4AT6A 2XWTB 1QPKA 4ZTEA 1T0OA 3GK8H 4EN3B 2VMEA 4HPYL 1XGPA 2YOAA 3NVQA 1V7MH 4DCQA 4XN9A 4XZUB 3PGFL 3VXUD 4HEME 3KGTA 3OKKA 1NGZB 4BXSV 1QVOA 3VNZA 3FS9A 7TAAA 4N4YB 1OP9A 3O11B 3VWKC 5E6SB 1R3LA 1EDHA 4JQIH 1PZBA 1E4JA 1IFHH 2WUCH 2CUIA 3MRFA 4OY9A 4U3CA 5DQDH 2FQEA 4HKZA 4JGNA 2YMTA 3DI3B 2Q2EB 4ZUVA 4ABWA 1IKFH 1ZTMA 2D7OA 2B8OT 4G3YL 5FWQA 3QUMA 4JMXA 3VFWA 1PW3A 1YEKL 2FLBT 3CV5A 1K2DB 4S10A 3ZYOA 2X4SA 5LHDA 5DMJB 2YAQA 1IC7L 4MBRA 1CTMA 4PRPD 3AGWA 3PHSA 4G9FA 3FT4A 2BSCA 3IDYB 4QXGH 5IJKA 4J1UB 1QFWI 1JV2A 3MUHL 4RFOL 4J3OF 5K9QI 3CFEA 3FUDA 3N91A 1H15B 5I1GH 3KS0J 1IBDA 3WFEL 1A4KA 5GZND 4NRZB 2GAZA 4WO4B 4W9FC 4CJ1A 2C3VB 1PSKH 1S7QB 4B3EA 2IANE 4D8PB 4Z95L 5BJTB 1H8OA 3AS1A 2Y7OA 4Y4HD 1JGVH 4PRPA 3ARGB 2HXAA 4TLSA 4DF9A 4O2EA 3ML9A 4XN8A 5TE4L 5BVJA 1B4JL 2HFFB 1T3FB 1ZVSB 2MQ0A 1H6TA 4W4NA 5KG9A 1WBYB 2O6CA 4RMWA 4QRPD 2F53A 1O5PA 2BX5A 5GZNA 1UADC 5DUMH 3O6FB 5FECA 1S9YB 1OW0A 2FZ3B 1VDGA 3ZE2B 4DGUA 2QKIA 2VL5A 1J8KA 3EJCA 4MRBA 1ZT1A 1I53A 2R83A 1CT8B 5JW5B 1KIQB 1YEDA 3NEXA 2OPCA 1RIVH 4TMPA 3SBRA 3EOBA 1F4AA 1NM4A 3H53A 4FNQA 3RUGE 3WSQH 3T3ME 3LQZB 4QOKA 4LSSL 2R1XB 2VO8A 3QDJD 3FB5B 3DMMC 1NFAA 3C5ZA 2CRZA 3BH9B 5KYWA 4NP4L 4X4YA 3L5IA 1S3KL 2DKMA 1TJHH 3BCFA 1YNLL 4IBYA 4PJ9C 2NY6C 4RX4A 5JLZB 1MHHA 3BPLB 2R29A 4S1DD 1OTUD 2NY0D 2OMVB 3T4AC 3Q2CA 4FMFA 4GG8A 1HC1A 4R90H 5L2JA 3DJZA 3VGBA 1OE2A 2NUPA 1BAGA 2W07B 1RUML 3GSWA 1MCPL 2UZXA 1P69B 3B7SA 2Q86B 2HVJA 1HXKA 5HPMB 4ZQTA 1AD9A 2A83A 2JQZA 2WKLA 2OMBA 1U4EA 3J07A 5CILL 1GOHA 2C4FT 2R29L 2YBRA 3G5XB 2QADD 3QQDA 4PWHA 2X9YA 3IJ8A 1RUQL 1BZOA 3L3KB 1U2HA 3ZDZE 4AW7A 2XY2A 1KY6A 1FV1B 3ARDC 3IXTB 2R0WL 1TXKA 3QNXA 5L4FA 4GH7B 1G0DA 3LHPH 4X9BA 1H3GA 2K6WA 2WIIA 3RZCA 5IQ7H 3F6LA 2CXGA 3ARQA 4FAAB 3OPZL 5FDWB 1A1OB 2GK2A 1MRFH 2F54B 1INEL 3E80A 1FVCB 1ET8A 2ZPKL 2EUXA 2Q86A 1JG9A 2G60L 1YY9D 2OJEA 3QDAA 4M7KH 2VH5L 4XP1H 4B6ZA 2VDOL 5CIPA 1IGCL 1K3IA 3TV3H 4WDIA 2NMSA 3K2KA 4E9QA 5E6RB 1UACH 4JFQA 2V5SA 2FJGA 5C9KA 3RZCD 1H9DA 3RL2B 3H9HB 2LOEA 4U6HA 4N2BA 1LO4L 4N0CC 4PVNA 4K7PY 5H4YA 1CXKA 1U3HC 1FG9C 1TQBB 1KYAA 4WI7A 4HGKC 4BGDA 1NJ9B 4UILL 5GS0D 1QBLH 1D6VL 4E0RB 1KYOJ 3U1SL 1DBBH 5LBVA 4JO4H 3QPQC 3HRPA 1O9WA 3DX0A 2DQGH 2B20A 1P7QB 4LVNC 3VYOA 1Z3GL 1I3UA 3GIZL 2I7OA 5D7JA 4BEIA 3MRIA 3IKKA 1RULH 1K8IB 4P9HC 1Z9MA 3ZTJH 3JYBA 5CNHA 2C9AA 3W1ZA 3AADB 2R0ZL 4UOW1 1PAMA 5C0AE 4LLVB 4EUPA 3BVDB 3VB9A 3LIUA 1LEGB 3FU8A 1B0RB 4X6CB 3RWHA 2QBWA 4R4FH 3OGCB 1O9ZA 5E4AA 3BE1H 3QQXA 3QJVB 2CKBB 4AGPA 5J1SC 3IE4A 4RNRA 4XVOA 2D0FA 1FSKC 3PWNA 2ZG3A 4WNQB 3UJTL 1WA1X 4JFFB 2VLME 1MCNA 1VKXB 1QYGL 2H32A 2NY3C 4C58B 1IJ9A 2WGXA 3D07A 3TFBA 4EZJA 5IVXA 1L3NA 5ADOH 3CFEB 5SWSD 2JKRM 3DETC 3VSTA 2GI7A 4KNSA 3ZIYA 3LXCA 5I1GL 4UQCA 4WFGE 1YC8A 3DPBB 1AZNA 1SY6A 3H3PL 2IMNA 2VR7A 3PUUA 3AS3A 4LCWB 2X09A 4BA8A 3RFZB 4YGVA 1K8IA 4GT0A 1ODUA 1MCWW 5B38G 3QQ9C 5DK0A 1F1GA 4N2MA 5F3FA 3ZUCA 5I1LA 2ZUQC 4JO3L 3UAJD 1NKRA 5I1IL 4JFFD 1PY4A 4ENED 2NTFB 4K9EL 4NWTL 3PJNA 2WYZA 3KZ8A 4PJHE 1F3DH 4K3JH 2OSXA 3KWVA 3ISRA 4XXCC 4YDIL 5DQJB 2JE8A 4HZAA 4JRXE 3WJLC 1X5KA 5DJCA 1OPOA 1HSAA 2XPZA 5EBWB 3QJUB 5AVYB 5B1JA 1A4AA 1CL7H 1HT6A 2Y7QA 4L05A 4QRTB 1LQSR 2VR9A 3I9GH 2H1LM 3O0RL 3P2TA 4BJLA 3UAJA 3K2IA 5K93A 1NIDA 2ITCA 1LK2A 3KBHE 4JG1H 1T6BX 5DF0A 5E2JA 5GRVK 5JORB 3BISA 4FQ2L 5IWLA 5ICXB 1N26A 5F89A 3UTSD 3GSUA 1KV7A 4LRNL 2NTSP 3TJHD 1MW2A 1N5AB 3VXPA 2HPOA 1D6EB 3BD5A 2Q3ZA 5I66B 2F54A 1TZHB 3SY0A 1A1OA 4U1KA 3B8YA 3QIBC 1E4XI 2GTZA 3MXVH 3P0YL 1HEJC 1ASPA 3MA9L 4TSCH 1NGYA 4XHJC 4KK8C 1FYTE 1Z9NA 5DVLA 3THML 4ALAL 3GM8A 4RRPM 3T4YB 1R0AH 2BZ7A 3HG1B 3JV0A 3VNYA 5D96B 2FO4A 1G6VK 4KHXH 5KN5B 2HN7A 3NJGA 4IJ3C 2P3YA 1CL7I 2A6JB 4I0PB 3KDPB 3GZKA 5FPIA 4X7DC 3LXBA 3QFDB 4PRHA 2WW8A 5IJDC 3BP5A 3GSWB 1NAMB 5A2FA 4UU9A 4PJGF 2N0MA 3OZ9L 4P46D 3U9PL 4G43B 1TTGA 1XFPA 1SF5A 4HEPG 3RB7A 4W6WB 2X0VA 1KTLA 3FYEB 1IGML 2F1AA 1PZDA 4L4TE 1Y07A 3CDGA 4LSTL 4K07A 3KCPB 2Y9RT 3OPZH 3GXMA 1V7ML 5HYFA 3BOVA 3C6LC 1KENL 4PY7B 2D9QB 2O1AA 1L7TH 1SPDA 2DQCL 2IDSA 3LQZA 4QOKB 1UT1A 1L9OA 1QYGH 1YUKB 3D12B 3FQRA 3G6JA 5HBBA 2NSQA 4R3SB 3ZR5A 1GY2A 3LCYA 3KW7A 3L3DB 2VDLH 1BZEA 3BP6A 4FXTA 5J57B 3S3PA 3UC0H 2FSEA 2KZBA 4FXKB 4FXKA 3DUUB 5JTWA 4P48A 3VD4A 3MCKB 1OY3B 4I89A 3MCG1 3W37A 1S9XA 3D39E 3CN1A 3ZHLA 3O41A 1AZCA 3S5ZA 4H26B 4NZRL 3A0OA 4NAQA 3QJFA 4ELKB 1W2KT 5IB4B 4XAWL 3U4AA 4JDEB 1L7IL 2RJMA 1RK1B 5T3ZH 4J27A 5J4MA 5FWRA 4F5CA 4XNQA 1RULL 1S5HA 1YN6A 2DWXA 3CFCH 3O9WD 1UD4A 1NC4D 4LSTH 1HHJA 4FQHA 4N0UB 4ONHA 5DD1H 3OSKA 5HY9B 3DDGA 4R0LB 4FFTA 4NKDB 1FN4B 4JCWA 4KMTL 1XGTB 4LVHB 2N4IA 2E9IA 3DSNA 4WFGD 4I9WD 3E0GA 2VSMB 3ZHDA 4QAMB 1V5JA 3H42L 4FMVA 2I5YH 4HG4J 3DTXA 3HMXL 4LSUH 5CEYA 3TJEH 1Q9LB 3P4NB 2EIDA 4NIKB 4M7ZC 2CXKA 1HL5A 4XN4A 1JFHA 3TC9A 2Q20A 1ETB1 4ZJ9A 3FXIC 3NG5A 1M1SA 3IN0A 4LCVA 3SDAD 3SDCA 4Y1AD 5EFIB 5DEZA 4H13C 3SQOH 5B38A 1TTAA 2GCYB 1FLTX 1NPUA 4AZUA 1ZOXA 1P7BA 3BAJA 1E6JL 3HKZA 4YLQT 5I8OH 2A77L 2VZ3A 3DOHA 2NY5H 1RURL 1KULA 4KWUA 4OFKA 3RWGB 3T2LA 4IK6A 5FO8B 2MTPA 4MJ6B 4HJJL 4OLZL 4CJ0A 1KFAH 2M2DA 1VGEH 3KLDA 3NACL 2OMYB 4P46C 1IT9L 2QR0A 3HB3D 4QRSA 1X9LA 2Q7YB 4LEXH 2AQQA 2NY2B 2BHYA 4N8UA 1WITA 3MMEB 3NZ8A 5DRWA 5JZ7D 4UB0L 3KW8A 4ABQA 4HG4K 3F7YA 1LL1A 1U93A 4HV8A 2H2PD 2A73A 5E2TH 4FXGA 3OB8A 5DRZB 3WMQA 4MKMA 3ZTDC 3QDMB 5TJWK 1AR1B 1Z2KA 2BOBA 2AJZB 5IB2A 2JIXB 1RVFH 3FB8A 2DMKA 3VRLF 4NQVA 4GQRA 5HSFA 4FQIH 5B1AB 5B39A 3AXLA 4WVRA 3TO4D 4NENA 1MSPA 4G5ZH 4RQQA 2CGRH 2O30A 4HGMA 3RFZA 2ZCLH 2C9SA 4ZMPA 4N25A 3OM3B 3GJFH 3ZTNL 1JGDA 4JFYB 3UC0L 2CRIA 3RIAK 3GK8L 1HVXA 1N6VA 5J3HC 4K8RH 2H32H 1QWHA 5E4OA 2YS4A 5KTEL 2YK1H 4Z7VE 2J4WH 4HK3J 1A7QH 3BIKA 3S35H 5IFHL 3KEHA 4F9PC 2J5WA 3VXMD 3LZFL 1S9WB 3MV7E 5TK4A 4OLXH 1TJXA 2NZ1A 1ZEAH 3FB8B 3PP4L 4ZW6A 4KKNA 3TPUB 1OGAB 2JIXA 1DL7L 4NQCA 3U30B 4PJ5A 3V9CA 3VWKD 1TSHA 5HYJB 1ZLEA 2CM6A 1PZ5A 2EH7L 2GQHA 1X5MA 5GRUL 4KKCC 1TZGH 5AVZB 1FCGA 5C0CE 3G7TA 4GS7B 1NBQA 2AQTA 3ZGIA 1SJVA 3IETA 4IHBA 1TENA 1XGZA 1W72L 3MRGB 4IOFC 3K8MA 1R5VB 1SY6L 1ZV9A 2H3NB 2VN3A 5TF1L 1LEIA 4LLDA 1IE5A 2EEAA 3V8CA 2PABA 2IBZX 1U3ZA 4JPSA 1FI8C 3A6CH 1T22A 1A6PA 4F7EB 4EEEA 5EEWA 2V7HB 3RILA 3MRBB 2W0LA 4KUCF 1UXWA 2V7NB 4GY4A 4L9LA 5HYJD 1QNIA 3VW3H 4PJHF 4QEGA 2AEPH 1MJUL 1WZKA 2PW2B 2Y1YA 4JRWA 4OT1H 1A14H 3HZYA 1BMZA 1H0DA 3L45A 4H2AA 5F9OH 5HGDA 1N67A 1J8HB 3CSBA 3M17A 1KT2A 2AKRA 4LKCB 3D0LB 4RWYH 1QRNE 2UWEF 3OKKB 5IMLA 4LSVH 1KNOA 5DURD 3KHQA 2ICWB 3K74B 1LK3L 3N40F 2O5ZL 1JXDA 3F7RA 2VSCA 2WXRA 3UACA 3MJ7A 5D7IA 1THAA 1BVNP 3M8OH 1XF2B 4H8VA 4J39A 1ERNA 1CF1A 2APBA 3WSQL 4TVPD 3HE7C 2LAGB 5EH1A 3G5YB 4FHJA 4PVBA 4YEFA 5B3JE 2X4OB 4HD9A 1W91A 1GZPB 3RTQC 3VXSE 4PB0L 2ENSA 3BWAA 5MENA 5LAXB 3IBEA 1A4CA 2GKIA 4HWNA 2QPDB 4Q9BA 4WW2F 5G4OA 5GGUB 4BK5A 5DMIH 5AOMA 2Y7SA 5ALBL 1DSFL 3ABGA 3MYJB 4NKMA 4B9FA 1RERA 2K6YA 1W0WA 4MCYA 3PWUA 3UO1H 7PCYA 4HF5H 2BLFA 5D4QA 5AUMB 1CS6A 1CR9L 1S7WA 3HMXH 3M1BB 4LSUL 2BHZA 4U1GC 3AROA 4M4RA 3S34H 4AH2A 3GI9L 1ZLUK 3QC6X 2NZIA 2YD2A 2J8UB 1ZA3A 3CFJB 1DN2A 3DVNA 5CGYD 4FN0A 1UQSB 4XBPB 5HP5A 4YGAB 1J9QA 1PAZA 3QQ3A 2WBKA 1R3IH 3OKYA 4Y9FA 4HHAA 4L2YA 2OV0A 4JNXA 3R8QA 4PS7A 3VQMA 1NAKH 1M57B 5FYKU 2XKNA 5IK3B 2O5NA 4GKZB 1IV8A 5E51A 4GBXA 4TNGA 5H2BA 1I8IB 3UOAB 3QNZB 4M03A 2WB7A 5LO7A 1DHKA 2PCPA 3VYPA 5KBKA 2QADC 4JR9H 2VGLM 4DP1X 4HU8A 3MNVB 3OXRA 4N2GA 2JK5A 3CC1A 2EVFA 4LDEB 1I4FA 2YMXL 2D7PA 3AQDA 5GJTH 4XE0A 3UO1L 2BCMA 1S7RB 2A9DA 2IDUA 4O58L 5CWSB 2R39A 1ZT1B 3MU3A 1BIIA 2VZOA 5C6TH 4E9WA 4FRWA 3INUL 2B5IB 1U3YA 1E67A 4PW9A 2AXFB 4ZW8A 4H20H 3CLEL 1S9YA 5E8EA 4N3UA 4LP8A 3GIVA 4RRPG 2DI7A 2HFFA 1DJYA 1WAAF 5E8PB 5IHZA 3QUXD 4PGCB 5E2TL 3DJ9A 1BMWA 3ME0B 4BFIB 1AQHA 4HIEA 4XE5B 5GGVL 1W9XA 1NC4B 3V4VL 1S7QA 1A6WL 3EJZD 1JK8B 1JWSB 3NN8A 2X6VA 3CFQA 1WAAA 1OTTD 3P4MB 4JFVA 4NO3A 1JZIA 3QNFA 2XN9D 5BUGA 1U8PB 1A64A 1J88A 2HYMA 3GKZA 3M46A 5IROA 2VR3A 3C87A 3S3BB 5FLVA 2BVTA 2FGWL 1E2ZA 2X4NA 4QOKE 4LQFL 4P2OC 3CSYB 4U1HA 3WTUA 3DSFH 4RGNE 1A6AB 3QIBA 2AANA 4MA7L 1CZ8H 3S37L 3RTQD 3UYRL 4EDXA 3KLKA 4IRSD 4JQIA 1DQIA 1M1XB 5AALA 3SE4A 4D9QD 2EH7H 5GRUH 3F7PC 5E5UB 4XCEA 2WQSA 2AGJL 2XYBA 1Z9SA 3KWWA 5DO2C 4OZFB 4OLEA 1T89A 5LG6A 3ZQWA 4L8SA 2VERA 3BDXA 3QUGA 2Y24A 1RUPL 2L7JA 2JELL 4I4WB 1IAIL 5GGQH 1QLFA 3BHBB 3RY5A 2XZAL 5MEOA 4IHOB 1R24A 4LLUA 3HFML 4PRAA 1UEYA 3IJ9A 4I48A 2X44D 2ZNWA 3P2DA 4D8OA 1OHZA 1VADB 3NCWA 3OQ3B 5DZVA 1P7KB 4H8HA 2O6EA 1ZGLB 1HE8A 2I9LB 2KYIA 5I1LB 4KZEL 4ANUA 2VXVH 1CFNA 1V54B 5MERB 4YBHA 2J71A 1FZKB 2FNBA 5IV2A 1UZ6E 3HW7A 3O3EA 1NWOA 2X9ZA 5HI4D 1OE3A 3ULVC 3A4EA 3NDZE 1FNGB 1KTBA 4OZGF 4RMQA 4E9XA 3E8UL 4OF3A 1O6TA 3RY4A 1IKNC 5I6OA 3QAQA 3F7VB 2VSDA 4GUCA 3GDCA 4LZKA 4O51A 4XPAL 1PZ5B 4XMPH 5KW9H 2R1YA 3KLAA 3DYMA 2VN4A 4J2QA 5C08B 1VKXA 1VACB 1NL0L 3PFQA 2V37A 4NP4H 4LSSH 2ZXBA 2ZOLA 4G8GE 4P59H 3TPUA 3S48A 1H9VA 4QRRE 2ZUUA 3VU2A 4FQLL 5IUSA 1OK0A 1T80A 2GK0B 3H3KA 1BQHB 4GB9A 4NKIL 1YECL 3UPCA 1I1AC 1AXTH 4JHWH 3NUKA 3B1TA 2OR7A 4X83A 3WGUB 3BN9D 3SDXB 1B0RA 5K59F 5ADPL 1Z5YD 3II1A 3VFRB 1MFCL 5ALBH 3KPSB 2XN9A 1I1RA 4JK0D 4KDVA 4XP4H 2VKWA 1Q9OB 4M7LL 4JEGB 3IFOA 1N6QL 2CIKA 1S7XA 1MCCA 2V17L 4JQVA 5DO8A 3D39A 1E90A 5IMKA 4FABH 1UB6B 2WSDA 2ZAGA 1GGYA 1JP5A 3CU1A 2P8PA 3Q3GB 1IC1A 2YAFA 1BXAA 1JMXA 1A4BA 1FYTD 1SLWA 5DEFB 4YK4B 3V4PB 3US0A 3D87B 1B4JH 1DR9A 3BUBA 4P2RA 3RVTD 4X4ZA 4JUTA 2IC2A 3AQYA 2DWYA 4KXCA 1LWJA 2WPGA 3TEUA 2DIEA 4O02A 3B2UC 43C9B 5CEZH 2EC9T 5F7WC 5A1AA 1RPUA 1QFWM 1T5WB 4PP1D 2C9QA 4FLQA 1G9ML 3B9KD 1F58L 3D18B 3GJFK 1UOWA 3E9UA 3QG7L 4JFWA 4JM2A 4NI3A 5IW1B 2Q76B 1NIEA 4M00A 5LN4A 2E8YA 3AREC 2NXZB 2UUDK 3LKQA 3S8FB 3DSFL 3U9UB 2ZKHH 1KJ2H 2XBTA 5EU3B 3ZO9A 2YFNA 3K6OA 1RZFL 4YK4C 3WKQA 4AZ8A 3L9RB 5JPMA 3Q3GA 4G70B 3OMNB 1AY1H 1CGYA 3H7LA 4N1EA 4OGYH 3WUWB 5J06A 3E6FB 3MZGB 5BW7C 2CKNA 5B7MA 3A67H 1S9VB 4N1HB 1JVKA 2ICES 3SZ6A 1WWCA 1NINA 4K7PX 3QJOA 3SQRA 3W39A 3FQUA 3MTRA 4QKXB 4ZMYA 4PRID 4DO4A 2LGNA 3NCJH 1AXSA 3EOAB 4MWFB 3ZZ1A 4JO4L 2XTLA 4UQ3B 1QATA 1BJ8A 3GMPA 4JHAL 2K45A 2AJVH 3NJVA 5DJ0A 3UTTE 3DHUA 1OTSC 1MCKA 1CE6B 3ZU8A 2JCWA 3BVWA 3LS4L 4X6DF 4BSJA 4Z7AA 2NY4D 3ARSA 2GSGA 4G8GD 3IMBA 1BW8A 2IDTA 2YEQA 4LVOC 1IQWL 3QIWD 3PHQA 4MXWL 4NZRH 1DCLA 4UM9B 1ET7A 4Y4KB 2AFNA 5BS0D 2CJUH 1OARH 3F58L 1UKTA 3L1GA 2R69L 4ZD3H 1I85C 4M48H 3FSWA 1CK0H 1OGAD 5AKSA 3RX9A 1MCIA 4I2XE 1H3WM 1KBVA 2XPYA 3QK0A 4OAWA 1LMIA 3BSZH 3F01A 4PJDB 4Q2ZA 3CVIH 3SKNB 3V6BR 3BEWA 1MFUA 2FLMA 1J10A 2K3HA 4R4FL 4UWQB 5GS1B 1DJWA 4JKPH 1X9QA 1KCLA 2HKHH 4TULL 4XTRD 3PV6A 2ZKYA 3GXUB 4G9FE 3P3UA 2ZYHA 3ZT7A 4OH2A 3LH8A 3SZKC 1RVFL 5BZDB 1M6OB 2IDQA 4ZO7A 5JDJA 3M1OA 1B9ZA 2AJ3B 3KPNB 1WHOA 2HTKC 1WUZA 1UWFA 3S37H 3L7FA 2PN5A 4JKNA 2QKIB 2A6DB 4RDBA 3OMZA 3EDDA 1P0SE 3C08H 4WW2B 1QBML 4AGLA 2KERA 2RAMA 5J8OA 3MJ9L 4OCRL 1QBLL 2BNQD 1C16A 2OSLA 4EN3C 1MLCA 1X7QA 2W9DL 1LEKB 5JPNC 5DJ6B 1WWAX 1XTMA 4M7LT 4O2EB 5DHVB 4YX2L 4W9ZA 3V5KA 2XIIA 5BZZA 2BIHA 4MNHB 3IWVA 1XMEB 4N20A 3HAEA 4JFEE 1ED3B 3AB0C 2GSIA 4HJJH 1D7BA 4OLZH 1MKFA 5TGBB 5MHSE 3GBNL 3QI9D 3D85D 3DX8A 1CE1L 4GYBA 5LBSH 4LGSB 3OKEA 3ARWA 4DQOH 2UV3A 2F1BA 3GBDA 5CZXC 2I60L 1BJ1J 1TVBB 3VXNA 4G8IB 3ME0A 4BFIA 1CD0A 5HHOB 5TDOA 3UTTD 2YD1A 2KH2B 3FQYA 3RVVC 4H40A 1OAYH 1YO4A 4G8EB 4NQCD 2BY3A 3GIVB 4YSEA 3UJJL 3DJSA 1J1XH 1Y7VA 1CLCA 2DBLH 5T1DH 3VQ1C 2VZSA 5E7BA 1TVBA 2MCAA 4MMZC 5CD5D 3DIFA 1DLHB 4H1LA 4ZUTA 3TU6A 3ULUH 5GSVA 1A7PH 3P3YA 2W9DH 4P99A 3RL1A 4G1MA 3CH1B 3MA7B 4JFHE 5C97A 3LEXA 2MSPA 4NCDA 4PN6A 1QLRB 2LABA 2K1MA 4Z95H 5AENA 2R1WB 1S7VA 2BINA 1T20A 4FQXD 5FO2A 1WZ1H 5C0DB 3N41F 4TL4A 3OMAB 5BO0D 1IC5L 2NR6A 3MV8A 3BN9C 4L29B 5F1KC 2WLLA 4L37B 4X9IA 3WL9A 5DLML 2H41A 1LEKA 1HEHC 2QV2A 1I8UA 4L3AA 4WWKB 4XHQA 5E0FA 5IBTH 2DJ4A 3KGSA 2GHZA 5BUAA 1B0GB 1G7QA 1MELA 4HIJB 3TT3H 4BWUA 1E4XH 1JPGA 2AI0L 2DEXX 1IBGH 4ZAKA 2ZUXA 4JFFE 5DA0B 3RDJA 1H19A 5IIEA 5E8DL 4HJUA 3K2UL 2OYMA 1WJ3A 1N0LA 4YPGA 2R7EA 4M1GH 3ZKXC 3FK3A 5HD8D 1L7TL 3EJQA 2IG2L 2QLVB 4OCYH 3FFDA 3FFCE 1KCKA 5T5NF 5EOTB 3UADA 3V55A 5DJXB 4POYA 1AQKH 3SKNA 4YLBA 3V7MA 4I1NB 5HDOA 2LFEA 4Q4IA 1XGQA 2GG1A 3HC3H 5KBLA 4KXZI 4GPVA 1MOEA 4X5XA 3T08A 4XNMA 4F20A 1MAJA 1RH8A 1E3XA 1UGKA 3FMGH 2ICEB 4R7DB 1KIRB 5KVFE 2V4LA 3WFBH 4DVRL 1GOFA 4I7ZC 3C8KA 3MLZL 3OQRA 3WFCH 3VTAA 1JNNL 4AEFA 2RA1A 2IGFH 3P2BA 1BP3B 1G43A 3VI3E 9CGTA 2W0FA 3NH7L 2Y7NA 3LKOB 3P9MB 2E56A 5BV7C 5JIIA 3AWGA 3K80A 4G7VL 4KITB 3MRLA 4ZT1A 4IIQB 4HKBB 4Y1AA 2NXZD 4G3YH 4OZ4B 4S1SL 3X2QB 5CCJA 4PJAB 5I74B 3LV3A 5MENE 3LQMA 3BFQG 2DWTA 4HDIB 1UH3A 2NY1B 2DM4A 4Y2OA 5IOPA 5ITBL 2CJUL 4ZD3L 3UH8A 3U36B 1DUYA 4K3EL 4PS4H 2IV8A 3DI2B 2D9CA 1EO8L 4G7RB 4NQEE 2XDHA 1ZD6A 2A2QT 4PJAA 1T2QL 1U8KA 3BGMB 4YEEA 3SQOL 3VG9B 3SIKA 1ADWA 4A39A 3GINA 4JFDD 5LGJA 4IIQA 2BWDA 3TBTA 2P1YA 5D7KD 4N28A 3BRGC 4WV1A 5KYYB 3OG6B 2B9AA 3UX9B 5FX3A 3VRJA 4UINL 1MLBB 2NY2D 4WHTB 2PPDA 4D0DA 4ZMQA 4X6CF 3ECVA 3IDNA 2E76C 1JGIA 3OMIB 4LQFH 3NCXA 1ITCA 4MVBD 4HCRA 3L3JB 4KKQA 4RIRA 1EIBA 3T6WA 2JI2A 2ADFL 2IQ9L 4M1DH 4DQAA 5I5RA 3QULA 4U1MA 2MTAA 1FRGL 3IKCA 2JTYA 4OZHF 3EJYC 1O9VA 4CDGC 5T3XD 1JGDB 1T1WA 3GO1H 4CMHC 1J86A 3MJ8B 4AIZB 5CLYA 1G9NL 4HIPA 2BWQA 3ZDXB 1KG0A 1ROWA 2ITFA 1YQ2A 3GM0A 3B3IA 3GTTA 2CRMA 3BPOC 4IMKC 4IRZA 2DPKA 1QZNA 1FBIH 4UQIM 3VWKB 5CN3A 5JW4R 3WNOA 3S3JA 1E43A 1UGNA 5I5JA 5CEZL 3QZNA 2BOBB 4PFEA 3DJTA 2D7MA 1BREA 1T21B 2R7EB 4HS3A 3OXSA 4GKSA 2ESVD 2VW4A 2F08A 4Q9RL 1U93B 3QQ4A 5E00A 2WN3A 1GPOL 4ANWA 3G5VB 1QACA 4CKQA 1LE5A 1UCBL 2AXWA 5I17A 5C2BH 1J1XL 1ONQB 5T5FH 2YEZA 4OV6F 4EJ1C 2R56H 2YN3A 5SWZA 2WBJA 4R2GC 3V7AE 1ETJA 1MWAL 5AOLA 1GGBL 1XH3A 3TIEB 1XD0A 2GJ6B 2MPVA 3NEOA 4A2HA 4N8VB 4QYOA 2WLLB 3NRPA 1JL8A 4L37A 3O9WB 4PJ8D 1KB5A 3S4SB 4S2SB 4CILA 1AO7E 5IKCA 4I1RA 1UT2A 4W1TA 5HGAB 2Y23A 2X9WA 2R1WA 1I3GL 1QLFB 2BSEA 1J9TA 3BJ91 4XC3L 5I9QB 3JWNG 4DGYL 2D3VA 4JJ5A 1A9BA 1AKJA 2QQQA 3GGWB 1OPGH 1AG6A 1U3NA 3FDWA 3DLQR 2WBXA 3VRLE 5FGCB 4KKLC 4AUJA 2NCEA 1IGIH 3WIIL 5I16A 4HCFA 1E4HA 4YVNA 1JHKH 1NCCH 2RHEA 3X1GA 3TA3A 1HI6B 3CBRA 3DKHA 5KBPA 3OV6A 4FTVA 1A6AA 3QIBB 1F4HA 3AXIA 5TPWH 3ULUE 3CDCA 4LHUG 4O00A 1XSOA 5IF0B 1KPRB 5DMYA 4XB3A 4D9RD 1HYRC 1FN4A 2GAZB 4NRZA 1UD6A 2RFXB 1USZA 4Z5RB 3BRFA 2P5WD 3N42B 4Q0XL 3HIZA 1JV2B 5C0AA 4MQXC 3KBEA 4P5MA 4X7SH 4YHZH 4CADB 2VZVA 4YDJB 1TTRA 4WI4A 5HHOD 3RWDA 2GIXA 3JWNH 2UYLB 1RIUL 2QEJA 4JDEA 1FNFA 1UVQA 5F7KC 2GBAA 1XAKA 3H4HA 1MLCB 3BWSA 2OSLB 1WZMA 3K8KA 4ZFZB 1DFBH 3HLAA 1X5XA 5EUKA 3CFNA 4HLZH 4UT9H 1CDUA 5I16B 2HTLC 2CA3A 2D7QA 3HVDA 5CSBA 2AHIA 5LB1A 3B9KA 3WFHB 4HT1L 5JOPD 3Q2WA 1Z5LB 4NM8H 4FI8A 3FFCB 2HRGA 3MXWL 4JM4H 5ETUB 5B4MD 1N59A 4XPHL 2GTQA 1A9EA 1YEIL 3HRZC 1YCSA 4OFQA 5EOQL 3VXRB 4Z7OF 1WAPA 2CZNA 4Y4HC 4M3HA 5F88A 2BSRB 1HILB 2IXQA 3G6JB 1RPKA 2APSA 5E94A 1MFVA 4WKZB 4F2FA 1ZHKA 2WBWB 4JDZB 1AE6H 4JHAH 1AHMA 2CAKA 1TZIA 2PYED 4OGQC 4HUUA 4Y4FC 3T0VA 3U2IA 4EOWH 5AW8B 4XP6H 2HKFL 1OGTA 3FU9A 3WBDA 1BQ5A 1NMCC 3QCUL 4X9GA 2Z92A 3PQYB 4A04A 3O45A 4L4VB 4GKZA 1VZGA 3U9PH 2Y06L 1ECYA 4Y2LA 4AC2A 3BDYL 1YVLA 3SQBB 4P49A 5EN2B 4NO5B 5B21A 1DBKH 4GSUA 3PHAA 1VFOA 3Q44A 5CJQH 4P4RB 3ZDYB 3OKMA 3RGHA 3ATBA 5AKVA 2C9RA 5F96L 4XAKD 3VM5A 4AM0A 4DIXA 4X98B 3CBKB 4C83A 1H3PL 1BBDL 3CFJA 4P2QE 3PPEA 4AVIA 4TUJA 2NX5D 1AGDB 1NLBH 5ILTH 3GMOA 4JO8A 1MWAA 5I8CB 1PCSA 2NNXA 1A7RL 5FDYA 5BV7L 4MGXA 5F9WB 1UB5B 2KBGA 5FYLL 1JV5B 1PS3A 2FT6A 4PH8A 5E23A 4PCTA 2O26U 5MEQB 3K7UA 1AH1A 4PBWD 2B16A 5F0JB 3W39B 3RJOA 3T04D 2NUTB 4HETA 4OJAA 2BVOA 3WCYA 4U1MB 4ZOCA 5EIVA 4K71C 5JQ6L 3L3HA 1QA9B 3RGVB 4MCZA 5DZLA 2J88H 3GO1L 4NAJA 4G82A 1WBXA 2D8KA 3UTSE 5IT2H 2HH0H 4UOQA 5D2LB 2DV6A 3FOLB 1TQUA 5FKPB 3C6EA 3S9DB 2VQUA 1I31A 4HU2A 2Q76A 4PJ6A 4WHYH 5D6CA 2J12B 1H3VA 4RMVA 1FHNA 3X14B 4HMCA 5LXGL 4HZLA 5F88B 4LSQH 2XTJD 4ES9A 4APXA 3BUQA 4RAVA 5DJYA 5ISZE 5LGJB 1HQ4A 4J28A 4N0RA 3SGDI 4JY5H 5D1XA 4O02B 4M6NL 1R3IL 5HGHA 4X7SL 1N8ZB 4YHZL 2DQIH 1KTDA 2ZPKH 2D7NA 4K15A 3KWUA 4N3TA 5AW5B 1XIWD 5DEFA 2NNAB 2ZF8A 5AW9B 3TBVA 2PMZA 5FUCE 1BBJB 2R0LL 1JAEA 3QJQB 2IPUG 1NM9A 1NCTA 4M3JA 1UB6A 3T77B 2V5YA 4HBQA 3EHBC 4NN7B 1BZ7A 4JFZH 3S6CA 3WLWC 1JSYA 2WLMA 1HU8A 1DEEB 3P54A 4HGWB 5C9JA 1MVYA 3IJHA 4JKKA 1EFXA 1CDIA 5IVXB 3BYYA 2XC8A 1AD0A 2VXQH 2GJZA 3BZ4B 1IVLA 1G4RA 4DO5A 2XQBL 5F72S 4P46A 3BT0A 4Q6IB 2H3XC 4TOYH 3EO0A 4G83A 2F15A 5C3TA 1A6VL 5IB3B 3QUYA 4EI5C 4PRNA 4RNRB 3QCUH 5HHQA 4I3SL 5DEGB 5GJSH 3AU1A 4XCYA 4HS8H 3TBCA 4NQUA 1X4YA 4PIRF 2OMZA 1U3JA 3DHPA 3AGVA 5CR8A 1F6FB 4JO2L 4X6DA 1YYLH 4X5WB 3STBA 3ZUNC 4PRDB 5T1LA 3T1FB 1IM9D 1JPFA 3ARBA 1AFVH 4HLZG 5D1ZA 3QXWA 3DK0A 5JIKA 4I0CC 2WZ6A 1MUJB 5EIIA 2ZSWB 4LCIL 3RWEA 1NBZA 4JHUA 3U6XS 2WO3B 3LRSA 5KVEL 3D39D 4MMYB 4HKXB 2ZUSA 2EXSA 3GBEA 1W0VA 4XOCA 1TETH 4NHUB 1WEJL 3O3AA 1EV2E 2X6AA 4PD4K 3MNWA 1AS6A 5GS1A 1U8HB 2HRPH 4WU7B 3UYPB 5EZIL 1I1CA 3ZTCC 2BVUA 3AT8A 3Q7JA 4NHCH 3STLA 1GTNA 1FYTB 1SXAA 1N3NB 5I1KL 4F9PA 3I02A 2IH9A 1DBJH 5T3XL 3ARBB 1R3HB 2VDMB 5HVWA 2HX9A 2B59A 5K9KA 3I50L 4NQSA 2X3AA 2EDHA 3HR5A 4WO4C 3BPCB 3G5VA 2JKIS 1CYWA 5FM8A 5FCSH 4A68A 2AJSH 3MUUA 1ACYH 1NIBA 4LESA 4L8CA 3CK0H 2ATKB 2AERT 3IFLL 3SPVB 4Q14A 1B4LA 5B8CC 1F56A 5GZOD 4S1RH 2VXSH 4XCFL 1WPCA 3HZKA 3LZFH 4R97B 3IGKA 2OXHA 3PE9A 1KJMA 5GPRA 4F57L 5DJ0B 5FYKH 3NCCB 3D3VB 3V4PL 1IC5H 5LXGH 5H4ZA 2KLSA 3HMWH 1MW0A 1F90L 3QP3A 3T3PE 2WZPD 2CQVA 3MRPA 5CJ8A 3SPHA 4BFRA 4QJ5B 1JE6A 4UTCA 3QUKA 4BZ1L 2WVUA 1AR2A 3CZGA 4FEIA 4N2IA 1FGNL 5ID0B 1VA9A 2EO9A 4ORGA 1BF8A 3WE6A 5JHMA 2WWKT 3VXME 1UXSB 2LT9A 4IIQC 3VXRE 2VERN 3FQ1A 3LH2L 2K8QA 4TSCL 4WV1C 2VDPH 3RIFF 3J8F7 2DL9A 4D0DB 3OAYK 3NPZB 2FIRT 4ZMXA 2EE2A 3NGBC 2HFGH 2V3EA 2IALB 3MROA 5C07D 1NH6A 2MPAL 5FA3A 3LZRA 2F7IA 5IR1A 4HOMA 4LSPH 4WSKA 1LK3H 1JZFA 4R26H 2Q2LA 4WY7L 1X5LA 1TJIH 2WLKA 1BD2D 2C8NA 3HN8A 1OM3H 1S5HB 1YN6B 3SBPA 3NIGF 5DD0L 1KOAA 3VVVA 2R1XA 4JFEA 1J0ZA 3V5KB 3SE6A 1S9KC 3WIFA 4L5FL 5IFAH 4GEIA 4JVPA 4K3DH 1HXMB 3NA9H 3PDOA 1ROCA 1R5WA 2XHNA 3L4WA 3HMXA 5JUEL 2EP6A 5BRZD 3L3HB 1L5GA 2Q7AA 3HE6C 2IQ9H 2C5DC 2GJ6D 3NIFE 4PI2A 4JPKL 1MFDH 4YSTA 4DGVH 3LXUX 5D1XC 4MX7B 2B2XL 3QZBA 3QCVH 3NMEA 4LQ1A 2DD8L 4JANA 3ZMNA 4E41B 2ZAHA 4WEMB 3LNFA 1Q1PA 3B2DC 3RWJA 2A0LD 3FQWA 3CZSA 2AXGA 3PAUA 4XO8A 1MCFA 1J8RA 2VZTA 4U2ZA 1OB0A 4UTBL 1EZUA 1ZE3C 5D7LB 4YBLB 1KGJA 4N2OA 5GZOA 3FBQA 3ILQD 5B3SB 4Y5VA 4B9KC 4HMDA 3QUXB 1BA9A 2HMID 1OAQL 3W0WE 2FK9A 3QHFL 4ONFH 3IGAB 2XA8L 3DX6B 3O6ML 4LP5A 4YXHH 1M42A 1KCRL 4NXKA 1HZHL 4CL7A 1PD6A 4X99A 3P69A 1MAKA 4NO5A 3D09A 4WI6A 4C59B 4KX8A 1A6UH 4APQA 3QJHB 4DP9X 3KYOA 2X4SB 2IBGA 3ECBB 4JR9L 2WZPA 3THMH 2WXJA 3X1FA 2ID5A 3PF2A 1ZGLA 3VFMA 3C60C 4YBQD 5EDSA 3SDYL 1U9KA 1IQWH 3HNTL 1H5BC 4YXLL 5D4JA 3KG5A 1C8PA 5HJ3B 5EWIH 1AQMA 1BQLL 3UZEC 1AXSB 4MWFA 4PD4J 5F7DB 4KGLA 4URTB 4BFOA 1TUPA 4TN9A 4YE0A 3BFOA 2UVFA 1U41A 4UIKH 4A7UA 5K9JH 1R5IB 1BZ9B 3WNMA 4X7EC 1OCWH 4GMSH 4Z3TA 1NWPA 2BVQA 4L4VE 1M1XA 1QI4A 3JSSA 4Z7OB 1ZLDA 3AITA 1R19A 3LVEA 3IBOA 3DX9A 3WL9B 3I6KB 1A3LL 3TWCH 1D5MB 3EFDH 3U2SA 5A2BA 3GSOB 3LKQB 3OB0K 2V5TA 3ML8A 5DD5L 4JJOA 5E24E 4XPGL 2X4NB 4OGZA 5E5MB 3LS5L 4Q58C 2NY5L 2XWJB 5JDSA 1DANU 1A6TB 3MRJA 5FYJE 4QRUA 3VFSB 1E4KA 3QG6B 1INQB 3FSVA 1NUGA 4MXQD 1PZ2A 5LCVA 4GQ9H 4NQED 3PPSA 4F2MA 4HWZB 3VCLA 1EJFA 2UWEE 3VFTA 3EDKA 1GGBH 2ENPA 3HE6D 5C08D 4WI2A 1F2XK 1E4XL 2X05A 5AVRB 3SCMC 2ZKXA 3IDXH 4OD2B 2V8LA 3TT1L 4X5PA 2CIKB 1SJHB 4Y4HA 1MQ8A 3WG7B 4B9CA 2FVNA 3DYOA 3L3IA 3DPBA 1OOAA 1IT9H 2H2PC 3HPLB 2EDOA 5MEPA 1TMCB 1T1ZB 2OR9H 3BE1L 1P2CB 4LL1A 3BXNB 2Y6TE 4XXDA 3D3VA 1UEMA 4LEEA 4N8PA 1FA4A 5GRVL 3W2DH 1UHVA 2DYSB 1VACA 2VDNB 1QSVA 1KB5B 1AXTL 5JQIB 1A3ZA 1V3LA 3EYFB 3O0LA 2JV6A 3ZKMC 2DBLL 1ID5I 4N26A 5K39B 5T1DL 1I8IA 1XGYH 1X5GA 3SDDB 5KSBB 2DQIL 1OGAE 5FR3A 3KWTA 2BC4A 2BNRE 2MH4A 3JZ7A 3NZ8B 3LVTA 2VR8A 2ZUWA 3VXQB 4PYGA 4P23B 4XMPL 3S5LG 5BQ7B 2IDCA 5I1AA 3QWRA 5KYNA 1MRDL 1KACB 2G9KA 1QR1A 4JKLA 2VT0A 1LO3L 4UTAH 3ETTA 5DLLA 2PWEA 2X3CA 4MNGE 3E38A 2ICCA 3EJSA 1JMZA 3IWUA 4RESB 2NQDA 1ETA1 1A7QL 4LLQB 2WIMA 2X6CA 2OW6A 5KSVA 4XXWC 1S8DA 2SEBA 1AIZA 1D5IL 2XZQH 1IMHC 2MQGA 1I7UB 4HK0B 4NKOA 1C1EH 3JQOB 4ZFFA 4RCAA 1SF3A 1VB9A 2CPUA 4OSUL 4LSDA 4XNXL 4FF9A 5L4MA 3IKCB 4K3EH 4UM9A 2FD6H 2AP2A 1NEUA 3IYLW 2QELA 1WLHA 4R2GB 3AU1B 2EO7A 4J3VA 2D03L 3D0VB 4NO2A 2Y36H 4RIRB 3UBXB 5F6HI 5KYUA 3MJ7B 5D7IB 3MLRL 4U1HB 3ARDD 5F44A 5GS2H 3VXSD 4GXVL 1MLBA 4GP8B 2VLJA 5DT1H 1D6VH 1RU9H 5KYXA 1RK7A 1JPEA 4V1DB 3HI5L 3LS5H 4N2LA 4PJHA 2WVVA 4KV5F 3VI4E 1WO2A 3P4MA 1ZTXL 1UENA 2AMGA 3Q43A 4N0UA 4U3XA 1TPXB 3HRZB 5I1JL 3LN4A 3N85L 1BXXA 1F42A 5CO1A 3DX3A 4NC1C 3U83A 2P24B 1QI5A 1YNLH 5A2JH 1H5BA 3IMUA 5DU7A 1J8SA 4K94H 2E9WA 3U1QA 2FX7L 4D9RE 2OR8A 1V3JA 4FJYA 5I0ZA 3OKOA 1GGIL 1L9QA 2COQA 4N0CD 4AEEA 3VDBA 3PXHA 2DTML 3GI8H 3L4TA 4AL8H 5CINL 2G2NA 1FFPA 2YXMA 5GS1C 2VC2L 4O2CB 3B43A 3ARGC 5HYJE 3D30A 1XGRA 3IFLH 1KC5H 1RZGA 1YRKA 3EUUA 3GKWH 5JW3L 3IJEA 1DVSA 2WJ7A 3B5HA 3MRLB 1A0QH 4R3SA 3ZBMA 1WS8A 5EIQA 1ZRUA 3B9DA 3BUYA 4HA1A 4LF3A 4BHUI 1TO5A 3QO1A 5EC1A 1A21A 4G6KH 3EO9H 4YMPA 3VE0B 3FFOA 4MLIA 4BM7A 1E9OA 1ES0A 1GA2A 3CXDH 3EH3B 1GGCL 2WWOA 4IQHA 4M1CD 4HWEH 5CJ5A 5KVDE 1G9EA 2V2XB 2EILB 1CBVL 2VDLL 3LKNA 2BNQB 3I6LD 1M53A 3BGAA 5AYUH 3UZQB 4H2CA 5FF6A 2K0RA 2DICA 4MJIA 3O6LL 4K7PL 5DJ2B 3GD1C 5AB9A 2XFGB 2YPVH 4RSYA 1NOAA 2BJML 1MY7A 3NJJA 1RSYA 4X5XB 1V3MA 2G5BA 3AW5A 5J11B 4RQQB 4MJ5A 4OKDA 2ICWI 2N7SA 1OIOA 2DH3A 1SOSA 4U6VH 4YAQB 5AEAA 1JXJA 4QRPB 1QEWA 4AH2B 5AYTA 3EJPA 2FWUA 3OC8A 3RU8H 3WE1A 3AG1B 3OX8B 1MF2L 1UXLA 3AABA 1HINH 2ESVE 1XSIA 1A4KB 1HYSD 2ZKHL 4CC4C 1F3RB 2L0DA 4KKRA 5DI8B 4LNRA 3KLSA 2O72A 3CUPB 4NERA 2JLLA 2R9HC 3QBTB 4G6KL 1RZKH 2ADGB 2HLFD 3MBEC 1DYZA 1FL6B 2WUBH 1SNRA 3B9AA 4H88L 3VI3F 4UV7H 3ARTA 2F2HA 1QG3A 4MD0B 5CFAA 3UAJC 3G5YA 1AMXA 1B0GA 1G7QB 3ULVF 2YRZA 3HG3A 5DMIL 5DZOA 5LNDA 1JRHL 2X2YA 3CLFH 2A9BA 4L29A 1BF2A 4NXSA 4KK8D 1LNUB 3MTXA 4WKZA 1XMWA 2IBZY 4ZMVA 1QKZH 3DARA 4NN7C 2P80A 2QKIC 5AKTA 3SOTA 3GBNH 4PLKC 3HLKA 2Y1AA 2JB6A 5AW2B 3LZOA 5ETUA 4Y19E 5EA0H 1NGPL 3KWWB 1NBVL 1TTBA 3FO1B 3EYOB 3TJEL 4EI5D 3U0TB 3EO1A 3F5WB 5DHXB 3T0EC 4CW1A 5I19L 4YHML 1J5OL 4QXWA 5EB9A 5I8KL 3N04A 4L4TA 3QUZD 2X4RA 2DIJA 5IROC 4IRJB 3D9AL 1DBAL 1P5VB 1I7ZA 1PG7W 4G6JL 1Z66A 2MJWA 4MD0A 3D08A 1IZJA 3MRGA 2V2WA 3V79C 3QXTA 1ZDQA 3ES6B 2AXJA 5EDXA 1T7WA 4YJZL 2H5UA 2R4RL 1I85A 4PJBB 4RAUA 5DI8A 3C6LD 1IEHA 3HA0A 2VLJE 2WLNA 3QUXA 3FTGB 5F7HA 3JV4A 5TFSH 1Z32X 3FN0H 4LRIC 2OSYA 4C4UA 3K91A 3NSXA 3R18A 4RZCA 3INUH 1RI8A 1OGAA 4WHDA 3VG9C 1I7RB 3OSVA 3AG3B 4U0QB 1T6VN 4NLAA 4HIHA 1B2WH 3CJJA 1DBMH 4MB4A 3VD5A 4KZEH 3N40P 3RWJB 1ACYL 2BP0A 2W92A 3O0RH 1N9PA 3H3BC 3NAAL 3I9IA 3P9LA 1AGBA 3PHOB 3ZO0A 1CQYA 2H4EA 3BVNA 1XH0A 2GY7B 1KN4H 3DO4A 4ANVA 4PW3A 5SWSA 3IMRA 3BZEB 3MDJA 4FXKC 5FF6B 3SCMB 1S2EA 1U95A 4P2QA 3HBPA 2AVFA 4WUUB 1T6WA 3B34A 4JB9H 4YHYB 2VQ1B 1KGYE 4K3HA 1KB5H 3PU7A 4R9HA 4BK8A 3QEQA 5HGAA 3K5SA 1SQ2N 4TQHA 5CIPH 3A4AA 2VXUH 2FT7A 3R06B 3RDTC 4KXAA 5KANI 4M9OA 4X8JA 5T1LD 2FL5A 4MB3A 2GJ6A 4UCFA 1Q94A 2Z93A 4G1EA 1KGUA 5T5FA 1DQJB 5TFSL 3VX1A 2JKWA 5FB8B 3MV9A 2XV3A 5HI3D 4ZUSA 4E9SA 3A6BH 3AMLA 2XWEA 1I9RL 3VUAA 3FU7B 1P7QD 2FEDD 1C8QA 4R7NB 4J8RA 3HNSH 1G7PA 4HHAB 2QVFB 4P8QA 2P9RA 1PVHA 1MCEA 4NM8L 2YD4A 3QQ4B 5E00B 4Y2DB 5KSAD 5EC2B 3GHPA 1G7HB 5I2IA 1A7PL 3QA3B 1YMMA 4HQQH 3SBWA 2VABB 4NWUH 1E27A 2CNYA 5ID0A 1T21A 4GAAA 2X3BA 4DOHB 1E7VA 3TEWA 4ZNCD 1JNNH 5C0EB 1OM3L 1KF9B 1QRNB 1G9MH 2OP4L 1CGVA 4HEMA 2NW3A 2VR5A 4ZO6A 3NA9L 4PJ9D 1ZSDA 3V0VB 4EPSA 1J1PH 1OAXH 4AQAB 2DI9A 3MYJA 4FOMA 3KPRB 2P28B 2JFCA 3NTCH 1CFVH 4PJHB 1U91B 5HI5D 1QWUA 3AQXA 1WT5C 1T1WB 4M1CC 3G5XA 1LD9A 1MEXH 4WJG3 3PAZA 1TNMA 3D33A 4M8RA 5C0EA 4ZK8A 2KDYA 3W11D 4KK5D 4LRNH 1EDYA 4KAQH 3QULB 4MMXC 4F33A 5HPMA 2I26N 3D51A 3EBHA 2ITDB 4LLWB 4P57A 4RGOH 4CSZA 2MWCA 2CRYA 5KW9L 2ZWSA 1BM3L 2ATKA 3LPWA 3FTUA 4G6AD 3U9UA 2NR6D 4MZ3A 4GMTL 4KO5A 1F11A 2J1WA 4L8DB 3L4XA 1IGTA 1JGUH 4R0LC 2TAAA 5F3BB 1BWWA 1RJYA 4LLMA 4NX0A 2JKSA 3KM2A 3M17B 3MV9B 1I82A 3LPGA 3OKDB 1NC2A 1I7UA 1KLUB 1UH2A 3Q8EA 5E9DB 25C8L 2ESVB 2ZXAA 2LAAA 2C34A 5AG8A 2EYSA 5KYWB 1N0XH 2E7CA 4KFZC 3VWJD 3U6XA 1NGQH 5CP7A 4OF6A 1SLVA 3FSZA 3IDUA 4FLSA 3TZVA 1TLKA 5I71C 2YQGA 3FH5A 2R9HD 2D31B 4JZNB 5DQDL 3ZQ9A 2R2BA 5DDHB 2Y3NA 1KPUB 2JJWA 3ZT5A 4YFEA 1Q9WA 4YHPB 3ECWA 1N8OE 3O41B 5FGBC 1T5XB 5JW5A 3P4LA 2J8OA 1O5DT 1ZCRA 2G2RB 4PV8B 5DYOA 4IRZH 2KZ1B </