4G5AA

Crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
GKQHVKTKSDWVIQRTPVDPEWLKVYVDDESKRLCLNFKDSFAPITVEVKDIEKQIVFQSIIFPVAAGEYTLYLGDLSLGQYELYMYNASVKVVGNFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a putative member of duf 3244 protein family (BT_1867) from Bacteroides thetaiotaomicron VPI-5482 at 1.69 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Structural genomics, unknown function
total genus 14
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g5aA00
3SD2A 4G5AA 3D33A
chains in the Genus database with same CATH superfamily
2DZEA 3BCFA 1RIHH 4NYLA 5MEPB 4Z7WF 4PCKA 1FYTD 4M93C 3LQZB 2CLZB 2K4AA 1JV5A 4F9LC 5JHLL 1A8ZA 3VXQA 3WNPA 3DX6B 3K6SA 1EMTH 1OARL 5CO1A 4L2LA 5HHPB 4ODXB 2D03H 1EFXA 1QSFA 5D1ZA 4P9MH 2XWRA 3H3PL 4MAYA 1PYWB 4F7PB 2XN2A 3BE1H 4D0DB 4HVBA 4NCDA 2VSCA 4JDTH 2WZ5A 1R5WA 1C8PA 1CU4L 2CJ3A 5JW5B 4OLWL 5CP7B 1F3JA 1F13A 2GUOA 3ZRFC 5IEHB 3K2UL 2WWMD 1T03H 4JM2A 4NZ8A 3F3HA 3T4AC 1ES0A 4OFDA 1D9KC 3S7GA 2XZCH 1A9BB 3QUYD 3VG9B 5I6KA 2E7LA 1CG9A 1T1YA 4XMLL 2BNRA 4QDGA 1RL1A 5EF2A 1DBJL 4QCIB 1IO4C 2X4NB 1JYNA 4N2KA 2X6AA 5K39A 4FADA 1CICB 3HMXL 4Q4EA 4TSBH 2OP4H 4P99A 4U1JA 3JUZA 2HFFA 4HHAB 3HG1E 2H0FA 1P7BA 4QRUB 2K70A 5ETUA 4NJ9H 3GGWA 4QHKI 4NO2A 4PJHE 5MENB 3KLSA 2AC0A 4LNVA 1FNAA 1L9MA 2FCBA 1J8HE 3IXTB 3IN0A 4LVNC 5DQDH 1TJMA 1DE4A 2Q8AH 3IMBA 1SDDA 2AV7B 4GG8B 3RWGB 1OALA 1S46A 2ILLA 3D69A 5CUSH 5AW7B 5JHLA 1M2VB 3L3KA 3F05A 4WW1A 5E6IC 3AC0A 3N0AA 1KNOA 1VEPA 1NMCC 3MBED 1Q9OB 4KH9A 2CPUA 2GBUA 1PSKL 1LWJA 1XCXA 1YMHA 4OGQC 1CFBA 4E5XG 1RFDL 3POHA 3PQYA 2JI3A 4QXUH 4IRJA 4DZ8B 5IVXF 4H44C 3QQNA 3EJPA 3JTTB 1GL4B 3GXIA 2AXJA 3OB0K 3PREA 1D6EA 4EI5D 2F8OA 5GGTL 2FAUA 2I7SA 3RJQB 3TBSA 2DKSA 2H3NA 3SZ6A 3S34L 3U9UB 3T0EA 1KG0B 1KTLA 2WVVA 3LYRA 1A7RL 2W59A 1RERA 2X4QB 4Q9BA 5LB1A 3U36A 2I9LB 1XHHA 3CXDL 4LPCA 1X5XA 3RL2A 3VH8A 3CDZB 5DHMC 4OZIA 5D2NA 5FUCE 3CFJA 3UTPD 3OWRA 5GQBA 4TQ8A 1KMGA 5GS3A 2ADFL 5L6YL 3MV8E 2BXYA 1PY4A 3UTTD 2EDKA 1RKRA 1ZWIB 3AM8C 4IJ3C 3PWPB 1EAPB 2J4WH 5HYJA 2LLNA 3O3DA 4RESB 4ZQKB 5IBUB 4RH4A 3TO2A 2WBJB 2QBWA 4MA8H 5INCA 3QRBA 3BCDA 3E6FB 1HYSC 2XVBA 4TL4A 2ZX8A 5HDBB 1C8QA 3VFUA 2V3FA 1FYTE 4R4ND 3EDKA 2ZWNA 4R8WL 4ZK8A 5BZWB 3LXAA 4QHLA 3RA7H 4M1CD 2FL5A 1J86A 2OL3B 3SDAC 1X5ZA 3EHBD 5DD5L 3Q1EA 2YWZA 2R0WH 3K6DA 1ZS8B 5AEAA 4ZNEA 4OLZL 5FHBL 4Y19A 3GRGA 3HI1B 1KPVB 1E3FA 1AIFB 4X8GA 3HW7A 5I76A 1MRCH 1U8PB 3ESMA 3WUWG 4CAGA 3CVDA 3I6LE 2WVUA 2YZ1A 1KBBA 2C3XA 1JXKA 2OZ4H 2AXFA 4RIRA 5D2LB 1FZMA 4HIEB 1DVUA 3I50L 2VDOH 2IQAB 4GYBA 3GJFK 3VE0B 1LM8V 4HH8A 5KBNC 3FU8A 2IH1B 2E7HA 4DKEH 4TVPL 2CKBB 2AANA 3CQPA 3AQDA 2Z93A 3O0LA 3GTNA 4XP6L 3NK3A 1JCVA 5CSGA 3RIAK 1EO7A 3L4CA 2HPOA 3N1MC 3OAZH 4R26H 4ZW5A 5I66B 2WJ5A 2X6UA 3VJ6A 2ZF8A 1JK9B 1YO4A 1UACL 2HH0L 4R7DA 5F72S 3VXRB 5I1KH 4NYLB 1HNFA 1QUNA 2QKSA 4MCMA 2G2NA 3GIZL 3L9EA 4U1MA 3V9EA 3WJJA 1JV5B 3M45A 3VXQB 3ZIMA 1RUKH 3K6SB 5AKRA 2IWFA 1EFXB 5C09D 1QSFB 1VLXA 5D1ZB 2HT2C 1YZZA 1KYFA 4MAYB 1F4XL 5EUOE 5C0IA 4BH8A 1JXDA 1VGEH 3DMMC 2EXWD 4I0PC 3EXLA 1R5WB 4IDLA 1F3JB 2C1PB 2GUOB 2DOCA 2EICA 4B9IA 4AGLA 2FHCA 4JPWH 1JFQL 4JM2B 1JF6A 3JWNE 1ES0B 2W65A 1Q9KB 1I3RA 1LO3L 4XCFL 4NQSA 2ETWA 1DUZB 3ULUC 2JB6A 1MFUA 1CG9B 1T1YB 2XTJE 4MFHA 4NKOA 2P3YA 4WWKA 1PG7L 3PJLA 3SQBB 3RX5A 2X4OA 4JQXC 1L9PA 3FPXA 5DZ9A 5AL0A 4OGYL 5K39B 1E65A 4QRSA 4U1JB 2EILB 3L17A 4W4NA 4BZ2H 4ES8A 1HK6A 1MG2C 1OTTC 2HFFB 1FAIH 5ETUB 1G0YR 3VI4F 3GGWB 4NO2B 4NHUB 3KD4A 4LSTH 5E5RB 3D0VA 4HJTA 1GGUA 3UTPE 3KMDA 1QHQA 2J44A 4PS3A 1T2JA 3V4VL 1EPFA 3ULSA 2GJZA 1HCYA 3JTSA 1RP8A 3RVWC 5LDUA 1DE4B 1SDDB 3F12A 3X1NA 3DVGA 3IDNA 3D69B 3SJVE 5L88H 2VZVA 3FTWA 1AR2A 2X4SB 3L3KB 2Z91A 1IRAY 4WW1B 3IBEA 4HS6A 4JO5A 4CMHB 4N87A 4PB0H 4XH2B 1JD9A 1KNOB 5DWUH 2ZCKH 2FEEI 3ZR6A 2JQAA 5TPWH 1TG8A 4ZS6C 1IGML 3DX7A 4C83A 3ZK0A 1YMHB 1KBKA 5FHAH 2JJUA 3G5VA 3GMPA 1G5AA 3MUZ1 4FXKA 4IRJB 4D0CA 3BRDA 3E38A 3MLSH 4XNDA 1IGFL 3VGAC 1BOYA 4S1RH 3NCFB 3MTRA 5IIEA 2GTZA 3V5KA 2EKSA 3T0EB 2H3NB 5HHME 2GB2A 5DVLA 4S2SB 4EEEA 2WVVB 2EADA 4UTAA 3C5ZD 5F71A 1GGCH 1V10A 4LARH 3J2PA 1OM9A 2HUEA 3RL2B 3K5RA 4M8UA 3VH8B 2GSIA 1JL8A 4ZUTA 4OZIB 1F6LL 3HE7C 4H0IA 5D2NB 4XN7A 5GGSA 2VDNB 4NZUH 3M7FB 1MCNA 5CJBA 5AVXB 1IM3D 4LPYA 5BO1L 5GJTH 5F7AA 4QXVA 3WS6A 3KJ6H 4LMQE 4ODVL 1W8EA 1XF2A 5TD4A 5IP4A 2IGFH 1GS8A 3FTVA 4NZDA 1KIRA 1L4IA 4AGOA 4B0MB 3KYMA 3QFGA 3O3DB 1OE1A 2VCOA 4GQPH 3KPNA 2WN3A 3TO2B 1HQRA 2F5BH 2K9UA 5DO8A 5INCB 1N4XH 4WUUB 3IU4H 1S4IA 1CT8A 4BYHA 1J9RA 1U36A 3BGAA 2DAVA 3HRZC 4U3SA 2GJPA 3BWUC 1CFNB 4KDVA 4QLRA 3VFUB 3GLZA 2LU4A 3CFQA 3LB6D 3SYQA 2CHNA 2R7EA 5IFAL 2BS8A 4QHLB 3CSFA 2WWOA 4KHTL 3OJ2C 1F86A 2RMNA 4FA8A 2DI9A 5C09E 4MWFA 5KSBE 4MNQA 4BA8A 4FNRA 4F8TA 2P8MA 4KITB 4X83A 4XHJC 4Y19B 4IDJH 2WUCH 5CFAA 4HU8A 4DEPC 5I76B 5FM4A 2WK2A 1BPLB 4HSQA 5IWLC 2YKKA 3TIDA 4DH2A 2XWDA 3VQMA 2AXFB 4K0OA 4RIRB 1FZMB 1LTXA 3CBKB 4PJ9C 4AUYA 1QATA 4N0YH 4NNXA 1QSVA 2Y23A 1KXVC 4GB9A 3WKPA 3PV6A 3WAKA 1MFDL 4G5AA 1JFHA 4QJ3B 4UT9H 2R4RH 2YSSA 3EZ8A 4O51B 1Y7VA 2Z93B 5KW9L 4QKTA 4C4BA 3LPPA 1DJIA 1JNLH 4J3OF 4R7DB 1FSKC 3T2LA 2IWKA 4KKAC 5F2FA 4ZW6A 5ES4B 1JG9A 1QUNB 3PGDA 4U1MB 4GW5A 2WB7A 2PP8A 4F7KA 2G9KA 2PYEA 1I8IA 1WQVT 3S5LA 4ATTA 5I1HH 3KCPA 5EORL 2EUXA 1GSKA 1OCZB 3GO1H 3O2WH 4J3OG 3U6XA 4WWID 1T1XA 4UOW0 5L2JA 5KVEH 5C0IB 3B2XA 1IM9D 3GF8A 4F37F 3QDMA 4BH8B 3VMPA 4FFYA 1DBKL 5MI0B 3TCXA 2CO6A 1HHHA 2D7OA 4P9HH 4UBDC 4YFDB 3S3CB 1KZQA 3WS3A 3EZJB 3OWEA 1V5JA 4G11A 4NQSB 1LO4H 1ZHBA 1IBFA 2JB6B 3B5GA 3WXWL 4LLYB 3DO4A 4NKOB 1VADA 4KKBC 3T9WA 3NIDB 4AQ1A 4WWKB 3LS4L 4AVHA 3O6FD 3IPFA 2X4OB 3KWWA 3II2A 1SJVA 1UASA 1XF5A 2QSVA 3B3IA 1QA9A 1BZ7B 2JLPA 4LRIC 2VGLM 2CBQA 3TBVA 1IBGH 4ENED 3CN0A 2R9HC 5AYQA 2IO5A 3D0VB 3X14A 3EYSL 2GJZB 3ULSB 3JTSB 4QJ4B 4POZC 1OL0A 1AD0A 1A3QA 3F12B 3DVGB 3GMRA 3IDNB 2E0PA 2ZKMX 3MYJA 1O9ZA 1T7YA 5E2WL 2P5WA 1BF8A 4QEGA 2Z91B 1PZ2A 4IW4C 2J1KA 4HS6B 4AG4H 3CZEA 2ZOKA 4X4ME 3PABA 3LH2L 2H6UA 4ZFOL 5I6XC 1YNLL 4Y7MA 2CALA 4XXCA 2EDNA 2GHWB 3GBDA 3SO3C 1Q8MA 3G5VB 3GMPB 4KOBA 4FXKB 4BFKA 2AJYH 4MA1C 2X4RA 4GUPA 1DFXA 1Q1JH 1B6UA 3BUBA 5IIEB 1Z9LA 2GTZB 2EKSB 3V5KB 5LWYH 2PWHA 3I6GB 1G7PA 2RHEA 4UV4H 1IMHC 2K7QA 1MW1A 4FG0A 3I02A 4GI8A 4TL5A 3UBGA 3VXMD 5DZNA 2DMKA 2MH4A 4KX8A 1CTOA 2YPVA 3AADB 3JWDL 2FATL 2GFBA 2GTQA 3TONA 2GSIB 4PJAE 2UZPA 3DSFH 4ZUTB 1BAGA 1DR9A 3FTXA 2C9RA 4G72B 5GGSB 1PLGL 5IOKA 2NXYD 3QJVB 4OU3A 4S0SD 1UM4H 4XWGL 2DQEH 1S5HA 3QJOA 2E6JA 1XF2B 3Q7JA 2B0SL 2XI9A 1JUFA 1KIRB 1F8TH 1MRDH 3N40F 3KYMB 3KYOA 4G80B 4LSQL 3ARGA 3DDGA 4GINA 3KPNB 4TNWK 1B0RA 1HQRB 1GCYA 4OB5L 4JG5A 4PY8J 3IF1A 2TRYA 4P8QA 4XMWA 5AVUB 1JZEA 4ZFOA 4G3YH 3DOHA 4U3SB 1EJFA 5ESVA 3VG9C 4TPRL 2J88L 3F84A 4XCCH 4WWNA 2R7EB 2VMCA 1BZQK 1FYHB 3O3AB 4GMTL 4UMGA 4G5ZH 5FDWA 3QI9D 4PWIA 3LPFA 3CN3A 4MNQB 1AOZA 2ZT9C 3RGVC 3NIFB 2EUWA 3VFGL 2W5PA 1USZA 2GSMB 4W93A 5IVZA 3KWUA 4L4JA 1JZ3A 3RVUC 3VRLE 5JR1L 3ARZA 4GP4B 4J23A 1MHCB 3TIDB 5K9OB 2BWIA 3L9RB 2Y7QA 4M7JH 2YLKA 2FRGP 4DUWA 1RD6A 4NNXB 4DK3A 3PV6B 1N6UA 3N43F 4AQOA 3VI3E 3PU7A 2OZNA 4PJDE 2YA2A 5JUEL 5HHXL 4UTBL 4CKVX 1ZXKA 3JV0A 1NAMH 3T6XA 3CVHL 1CLZL 4M8VA 3TFKC 2XBZA 4Z5RA 2X2JA 5EO0B 3ZDXB 4PLOB 1S9VA 1P1VA 3FUJA 4NQCD 5KVEE 3TVMA 3PGDB 4GW5B 4Q6KA 2CHWA 2PYEB 1I8IB 2KLTA 3S5LB 4YDNA 2WO4A 3KCPB 3Q9QA 3ARDA 2FIKA 2Z8WC 3KCWA 4ONOA 3L1OH 1NMBL 1T1XB 5DZPA 5FOJA 5L2JB 4CDHA 5CJOL 5FOBA 3VX1A 1I9RL 1ACYH 2X70A 5SWSD 3QDMB 4Y9EA 4O5LL 2CO6B 3QUZC 3LXCA 5KSVA 2UYLA 3O6MH 1UJTA 3WS3B 3BGMA 2HPTA 1TTAA 4FS0A 3QRGH 4M7LT 4ZX6A 3NRPA 2FX9L 1VADB 3S4SB 4AQ1B 3NJVA 2OSLA 4GT0A 4GKSA 3SKJH 5EO9A 1R3IL 3N6YA 4ZUWA 2RGSA 2DQHL 5F0MB 3VXME 3B3IB 4HIXL 1QA9B 4R5TA 3SPJA 4H2AA 1GGIL 2BW4A 4K4KA 2J73A 2R27A 3TBVB 2XNAA 1HVXA 1O0VA 5B4MD 2X28A 2RALA 3ZZ1A 3G3LA 1F3DH 2DQDH 3X14B 4W9DC 2CCLA 2QADB 4PJBF 4DAGL 1GYVA 3Q6FB 1D5ZB 1R5IA 2FX8L 1AD0B 2Y6SD 4Z76B 2DI8A 3OLEA 3DDFA 3GMRB 4NUPA 5CZRA 1X5KA 3MYJB 1RU9L 1OEZW 2P5WB 2YGVA 4XI5C 3VYPA 1YY9D 1TSRA 1QFUH 3KWVA 3PABB 3RB7A 2KLRA 2CHXA 1DN2A 4K9EH 3ZRCC 1GA2A 5E9NA 1A5FL 1OIOA 3N2JA 1KC5H 4XXDA 4GUPB 4GG6F 2BRRH 2ERJC 4HDIB 4N0UE 2P9RA 5F6IB 3GRWH 1G7PB 1X5JA 2FQGA 4N8UA 2MNUA 4GAYA 4GKOA 2BDNL 3U4KA 3L5XL 4GP8B 2GFBB 4IM8A 1T0NA 3U9PH 2DEWX 5E8EA 1ZT7B 1JWSA 4EF3A 1V8HA 3BW9A 5I24A 4WY7L 1R9FA 4ANKA 3FCSA 3ILPA 4B9YA 2CUMA 2BIHA 1S5HB 3HE6A 4NUMA 3NQKA 4FTVE 3K71B 3EF4A 1JUFB 5TJWK 2NZ9C 1M56B 2EC9U 3BZ4A 3KYOB 3ERXA 3EH3B 4FCAA 2F58H 3ARGB 3WFEH 3QXAB 2JH2A 2WXFA 3EJQA 3MUY1 4X6DE 4FEMA 5FCUH 3QIUA 4KTDH 5CBEA 5BNXD 3IF1B 4JRXA 5GRYA 2KMWA 3SBRA 4UZUA 1UWYA 4ZFOB 5ESVB 3WFHA 2E7LC 1FRGL 3A6CH 2H2PD 2HTLC 2DYPA 3IJEB 2HWZL 1TOXA 2NNRA 5ANHA 4PWFA 4BFNA 2C9VA 1ZANH 3MFFA 4K71C 4YSPA 3V4PH 3GDBA 1M71A 3AG1B 1HESA 2A2QT 4NBYB 4PRHA 4GW1A 1XTMA 2ZYIA 1B2YA 3V0EA 4NIYE 1XB8A 3K8KA 5FDWB 3BQVA 3A22A 3BVVA 3CHRA 4JHVA 4J4PC 4JW3A 3TASA 2E8ZA 4PJFE 5IVZB 2MCG1 4N1CA 4YZWA 4H7VA 5GZOD 1CXIA 5ALCH 3SGDH 5LG6A 4O2CA 4ZMOA 1R33A 2D8KA 4M62L 5ALBH 5F1KC 5DMIL 5DJXB 3QJQB 4U1IA 1R46A 2X44D 2Y7QB 3VA6A 3KH4A 3VXSA 4OUUA 1HL9A 1TO4A 1OT2A 3RG1C 5F70A 2HA1A 5FGBA 5FW8A 3FF7A 4M7ZB 4AVJA 4GNKB 4RLDA 3T0WA 2X4TA 1QEWA 3ZKMD 4E68A 4J27A 3PGFH 5E2VL 1FLRL 4XNBA 5C6WH 4IRJC 1J1XL 4FQCL 4Z5RB 2GBAA 3C5SA 3IGKA 1S9VB 2VT0A 4P5TD 2CZNA 4FQJL 3T0EC 2R0KL 2YD8A 3TVMB 2G9HA 1K3IA 4I2XB 5SV3A 4BFRA 1R5VA 2XU9A 1BFVL 3TEWA 1O7DE 4KVCL 3BN9C 3TJPA 4U0RB 4HW6A 2H0JA 3N1PC 4Y9FA 3ARDB 2Q0ZX 5EZOH 2FIKB 1M2OA 3W5MA 1CBVH 2HSIA 2FR4A 25C8H 3DTXA 4LASL 3B2PA 1TTRA 1FF5A 5FOBB 1EQWA 2X70B 3IFOB 5IB4A 2BVTA 5CSZB 5KSVB 2V8LA 5EWIH 4RFOL 3O3BA 4HUUA 3UMNA 1ZLEA 3ARFD 2XKSA 2XY1A 3BGMB 3ZZLA 3NZHH 2EXSA 2PPAA 5IW1A 3NA4A 4ZMPA 2VSKB 3W9EA 2OSLB 5DD3H 3CSGA 3GI8H 4GKSB 5EO9B 2O26U 1WCBA 3HFML 1LNUA 4ZUWB 2DQFA 3C75A 4NFBA 4GSUA 3QJSB 1OV8A 2XZQH 1N70A 1EA9C 1B4LA 2WAHA 1RK0A 2JB5L 1KY7A 2XNAB 2ZF9A 5I30L 2ZONA 2AF2A 2AJXH 5BZWA 4DTGH 2ZWKA 1JIBA 3AXHA 1L0PA 1R5IB 5C07E 4DP4X 4WEBL 4ZTPL 1DBBH 4E9YA 1YYLH 4NZTL 3BKMH 5DT1H 2DTML 4FQHA 3TV3H 2MRYA 2X12A 3GMLA 4RMBA 1KN4L 3PL6C 5C0AD 5GGQL 3O4OC 3C60C 3EADA 9PCYA 3BEWB 4Y9BA 5I1IH 1YJDH 2W0KA 4KO5A 4HJJL 4N2AA 3L9YA 5IROD 3C9NB 3UGUA 1EZSA 3BPNB 3QDJD 4O2EA 4ZMTA 2EEBA 5DJ8A 4XXDB 3ZQ9A 5AAMC 2VXTL 4N22A 4R4BA 2F7QA 2KQNA 3R0MA 2VDPB 5BZDA 3BUTA 5LN4A 2QFRA 3BVXA 3O11A 3S8FB 4YHNB 1NFIA 5LBVA 4GAYB 4LKCA 2OR8A 4HIJA 1UH4A 3MLUH 4OCLC 4A6YH 4Z6AT 4X9HA 1T0NB 5EF0A 2D0GA 4S0TD 3SY6A 3QCUL 3WJJC 3CSTA 5E8EB 3ZYIA 1JWSB 4JFSA 4LSSL 3BW9B 4GJTB 1AQKL 1D7DA 5ITBH 3FCSB 3ILPB 4NAMA 1JPTL 2H6PA 5AOJA 5HHQA 5BMFH 3EDFA 1CXEA 5EEZA 2IOOA 3QJTB 5KJ7E 2X1OA 3RB5A 3CCHA 4UB0L 3BZ4B 1KLFA 5DHDA 1KTDB 2YQGA 3HC4H 4NC1C 1A1NA 1LP9F 1BW8A 1XGUB 4ZUUA 4BJLA 1TJIH 3KYKH 3QIUB 5CBEB 4JRXB 2NZ1A 2V9TA 1MCRA 5L8KB 2ZCLH 2GIYA 4WHYG 3WFHB 3K6IA 2DYPB 1HE7A 1QSZA 2B1HL 5JA9A 3MFFB 2WJ7A 2YRBA 3JWNG 1M71B 5T3XL 4PRHB 4GW1B 4C83B 4KMQA 1HH9A 2H1LM 4Y16C 4HT1L 5DMGD 3AXIA 4M7KH 3MGTA 4OKVA 2CDFA 4MCYA 4ZOCA 1FGVH 4LQFL 2HN7A 2BY0A 4WGVB 5GISL 5DR5H 4PS4L 3EBIA 3DX4A 5E08H 4IRZH 1KB3A 4FQ2L 3U7AA 4KHXH 5BQ7A 1LO0L 5JHDD 4GUQA 1SXSA 4U1IB 3VXSB 4OUUB 2EVHA 1LMKA 2H5UA 1MPAH 5E2TH 4WJKB 2XT1B 5BOPA 5I2IA 4FZ8L 4KWUA 5I19L 4P23D 1QEWB 4YO0A 3EJUA 1KCUL 1TFHA 1TLKA 1KXQA 3APNA 3IN2A 5H37G 1B0GA 1ZLUH 1NBVL 4PJ7F 4DPCX 2YMXL 1OD7A 2QVIA 4TUKH 3EOTH 5T5FA 3UJJH 4ZMXA 3C5SB 4OZGF 2ICCA 1E5ZA 1V55B 2G9HB 3D3VD 1JXFA 5DRWA 2O6CA 5IHUL 2MTAA 2YUZA 3CSBA 1C08A 3NYKA 2O5XH 2R69H 4KROC 4RWYH 3NESA 1P4BH 2YRLA 1UWFA 2XHNA 4IBSA 2CR0A 2FR4B 2W0PA 2YAPA 2WD0A 3DTXB 5E4AA 4J3UA 4DQOH 2R29H 2UVFA 1LWRA 2XZAH 4YZFE 2WLNA 2APWA 5C0AE 4DGUA 5IB4B 1DBML 1JPSH 2NXZC 4N5ED 4S1DD 3GYRA 3BFQG 4DP6X 3C08H 3QNFA 4KRNA 3O3BB 4HUUB 4D0BA 4PJIA 4L37B 3IRCA 3VDAA 2CGYA 4Q0XH 1J5DA 4OQTA 2N0KA 1CGSL 1KEML 2EEFA 3ESOA 4KKLD 3H6AA 5IW1B 3EFDL 4LIQH 2FGWL 3CZFB 3SDCD 3TWCL 3NEOA 3W9EB 1GZHA 2CMRL 1WCBB 1LNUB 3GXTA 2DQFB 4UNUA 4MD5A 3NAAH 1JNNL 4U6XA 3D09A 3GK8H 4Z0XA 4ZO7A 3IVKA 3K1KC 3AS0A 1QYGL 2KQMA 2VAAA 4UV7L 4HAKA 2HRGA 4JQIL 3WTYA 1A3LH 5DEJA 4B3EA 1H3GA 2V6HA 4WW2B 4IBTA 5LAPA 2O6EA 5F7MC 3D51A 3FAWA 4KRPD 4NC0B 2P26A 1LDPH 3K0WA 4MDIA 2G5RA 1X6NA 5B8CA 5M7QA 2ED6A 4FQHB 1ETB1 1H3XA 3WFCH 3GMLB 4HWEL 5KS9E 3E8UL 1F6AB 3W5NA 4NCC2 2Y25A 1FIGH 2Q2LA 3N0PB 3GEWB 1TJHL 1OTUC 5C71A 1NGYA 1G9NL 4MHHI 1CN4A 4ANWA 3X11A 4O2EB 1KB5L 3W1ZA 1P69B 1BBDL 3K3QA 5DJ8B 5E99L 4R5XA 4C56A 1HWWA 4R4BB 1PJ9A 3HC3H 2UX7A 1VKXA 1TO5A 5BZDB 5EMYA 4XZ4A 2FSDA 4ODSH 2DQCH 3O11B 2PP7A 2EO1A 1NFIB 4YFLI 2LU7A 3V0WL 4M8RA 4LKCB 5H8DA 2QPUA 4HIJB 5SWZA 1OSYA 4FQQA 4I4WA 3D4ZA 3MLVL 4PJ8B 4KZEL 2H32A 2RAMA 2HRPL 3FO2A 2O72A 1J5HA 4B9CA 1GIGL 4JLRA 4YHIA 4OI8A 4M8QA 1Q0EA 5EBGA 3KPLA 2HLEB 1PKQE 1MIMH 2H6PB 1DQMH 3L5IA 4JQIA 5HHQB 2OMZA 2O5YH 4ZG1A 3CFDA 3D2TA 3AREA 4U1HA 2ICWI 2MKWA 1Z9SA 3B9KA 3CCHB 3NSFA 1BFSA 1C5BL 1T5WA 1KLFB 4ZD3H 5HYFA 1T83C 1CTMA 1EEZA 3O2DA 1A1NB 1B88A 4JPVL 4ZUUB 4TULL 2VN3A 2J5LC 4I48A 2VDQH 3BP6A 1HHKA 1S7RA 4A66A 4AQ1C 4JKWA 3BUPA 5TE4H 4V1DD 3WJLC 3D3VE 1BIIA 3LEYH 4AL8H 3BWAA 3K2IA 1BFTA 1A4AA 4JPSA 4M56A 5B38B 1NC4D 3T6ZA 3QIBD 2W9DH 1HH9B 2DH2A 5GGVL 3O8XA 4DKDC 4OKVB 3MGTB 3NCJL 1HAUA 1RZGA 2CDFB 3X17A 4MCYB 2A99A 2FTAA 5EU7E 4OR1A 2HN7B 4KOCA 2QADC 3T09A 4ZFFA 3FQWA 1AQMA 4OFPA 5IW6A 3L3HA 4G6JL 1OAXH 3EXJA 5BQ7B 3BP4B 4XPHL 4KI1A 3SKNA 2ZP0T 3VYOA 1K5NB 4GO6B 2WKOF 2WSDA 3CN2A 4A7UA 4MMYA 4R5VA 4BINA 5I2IB 3GTVA 4FLHA 2QLVB 3QQ3A 3KWTA 3QE5A 4XXCC 2MCAA 4YO0B 1NFKA 5IUSA 2FBJL 1BHGA 1IC5H 3UC0L 3FYEB 3X1BA 3HG5A 2NW2A 3RFZA 1LE9A 2DQMA 1K72A 1P9MA 2OJZL 3MZTA 3EJRA 5C70A 5DRWB 2X1WL 1FZKB 3ZOAA 3PRZA 3I84A 1C08B 3PXLA 1CFSA 3Q6GH 3IKKA 4K73A 1EHLL 2UUDK 5AD0A 2GAZA 4A04A 4IGBA 1SF3A 2D4FA 2ITEA 4TM9A 3D5OF 1T80A 2YD2A 4LIQE 3TPUA 5GGVY 3P4OA 3K1DA 5CD3A 1R1CA 3UZVA 3DI3B 5EOQL 3DO7A 4GS7B 3A23A 3U7WL 2D4DA 4D0BB 4PJIB 3OAUL 4B60A 2BSED 3KGSA 3BQUA 1OGAA 3MSPA 4Q2ZB 5EBMA 3EJZC 5CN2A 4DO6A 4G8EA 2WIIA 3B83A 1N8OE 5T3ZL 4XX1G 3WBDA 2CJUL 5GJSL 3FONA 3F64A 3IXAA 3ROOA 2Q5BA 2VABA 4U1KA 2Y0SA 2ZTBA 5HJGA 1V7NL 4MD5B 1FP5A 2PWDA 1OQOA 4Z0XB 3AABA 3LPGA 4FL4B 4YHYB 3O3EA 5DSCA 4F20A 5AWNH 5H2BA 4MYWB 3C09B 1NDMA 3LIZH 4NQDE 1P53A 2BNQD 5EEVA 4PVBA 1IT9H 4ONGH 1B3JA 4HEME 1QW8A 1W9XA 4G6KL 1IZJA 4MDIB 1UOLA 3H7LA 2H3KA 2A9NH 2CR3A 2WLIA 3CK0H 4K3DL 4KJWD 4K8RH 4OJFH 5DO2D 5B8CB 3FN3A 2AXGA 1UG9A 3EYFA 1RJYA 1U9KA 2NNFA 4HXBH 5EZPA 2C7UA 1GOHA 4LHUA 1AO7B 3HI5H 3NSXA 3WJMA 2VL5A 3IT8D 1NGYB 4JUSA 2JJTA 3GMNB 3NACL 2P1YA 3X11B 3FBKA 5D1QE 2BINA 3WE1A 3MTXA 4EQ3A 1NC2A 4U31A 1O75A 5CEZH 2XV2A 4C56B 2C4XA 1RHFA 3ZXAC 3HZMA 1VKXB 3ETBJ 1IEHA 1ADQL 1WTGT 4L1TA 4ZBJA 4IYKA 1HINL 2JK5A 3HNSL 5FK9A 1WDAA 5SWZB 2R8SL 4XVTL 4FQQB 4I4WB 4KVPA 3QQ4A 5JYMA 2H32B 5E4EB 2WQSA 4I3RL 1E3XA 3FO2B 4K8RD 3TVMC 1SEBA 3APDA 5CZVL 5H35A 4LT7A 3MLZH 5GHWL 4UZSA 4JGNA 3K74B 1I9IL 1CXLA 2NY6B 4JLRB 4YHIB 5DQJA 5TGBA 3VRJA 6PAZA 4U0RC 3JYBA 3KPLB 3FMGL 4PRIA 1I8KB 4MMZB 1J8SA 4GRLD 4Z7OB 3GMMA 5HPOA 2YAMA 2OMZB 1S2EA 2MEJB 5LO7A 1G7IA 3CFDB 3NJMA 1XMWA 2F53E 3AREB 4U1HB 5CEZD 3B9KB 4HPYL 1Z9SB 5KJ4A 4E2OA 2J12B 1JHKL 4P2QB 1T5WB 4QRPD 2VB5A 4F5CA 4UYQA 3TJHD 1EEZB 4WTZA 2J6EL 5DJCA 5CR8A 3FB5A 1MLCA 1JGVH 4PTTA 1UQSB 4I48B 3BP6B 3DRTB 3H9SA 3TPKA 4P46D 1HHKB 1S7RB 3FQXA 2HVBA 3NTCL 3CHPA 4UIKL 2YEVB 1QQDA 5T5NF 4KKPA 4WO4C 1E7UA 3H4HA 1BIIB 1WZ1L 1BD2D 1PD0A 2QQNH 3L4UA 5J89A 1WHOA 4NAJA 4ELMF 1EEYA 4YBQC 3HR6A 2CNYA 4KZ0A 3BDYL 3J8F7 4AKPA 1AGBA 1U92B 3KNBA 1RZGB 4TLKA 4QRAA 4PGJA 5T5NG 3VDCA 3DUUB 3EJYD 5E0FA 5L4IA 5KBPA 4ZFFB 2IMMA 3FQWB 4Y88A 1HFUA 4XNXL 3BAEL 4HFUH 3EGSA 1BOGA 1MG3C 3SKNB 1WEJH 4PR5A 1NBCA 3Q0HA 4PCTA 1N0XH 3WIFA 2XIDA 2VLJD 3CZGA 5IMOA 4F7TA 1NPUA 1INDH 4MMYB 2OYPA 3QQ3B 4NUGL 4DN4H 5HD8D 4RMUA 5CP3A 4GRMA 1GC1L 4AGNA 1A1MA 2NY3B 1U0QA 2GVYA 4JJHA 2VAJA 2NW2B 3MXVL 3QORD 1AJ7H 1UUNA 3RFZB 1LE9B 3DWTA 4UCFA 1XR8A 3NUKA 1DSWA 2NSMA 1N2RA 4FE9A 2BNQE 2IG2L 4BRJA 1NWPA 4OIIL 2WCGA 2WXLA 1CFSB 2QSCL 2BSSA 4CC1A 3DBXA 4IRSA 2ATPA 5AD0B 2L04A 1HE8A 2VXSH 4G6MH 3TN0D 2GAZB 1XH2A 1RZKL 4IGBB 4ELDA 1AGEA 3ULVC 2BP5M 2WNWA 4WI8A 1QBBA 3KPSA 5CHNA 3FQ1A 2VQ1A 3TPUB 3P4OB 5CD3B 3UZVB 4PW9A 3BFOA 2JKRM 4UT7H 3VGFA 4AI7A 5IQOA 4GAAA 3HE6C 3DO7B 4PUBH 4XOCA 2VLKE 3NZ8A 4FX5A 5F9AC 1TENA 4PRAB 3FOLA 1OGAB 2IWEA 4M1DH 3HG0A 5EBMB 3NJXA 4QKXB 5GS1C 4FFVC 4G8EB 2WIIB 2HVJA 1T1WA 3PP4L 1CICD 2OKMA 4RAUA 1AG6A 3GNMH 1P4LA 2JCCA 2LFGA 1T2QL 3LEXA 3FONB 2N01B 3IXAB 2PCXA 2X5PA 4JO3L 1BZEA 2VABB 1CLYH 2HX8A 3ATFA 4U1KB 3ROOB 3SYPA 3QXTA 5MEND 3DPDA 2EXYC 4HU2A 2VSDA 1MJUL 1P7KA 3G5WA 2ZKHL 3O3EB 2CLRA 4YJZL 5DSCB 1BM3H 1G7QA 5H2BB 5DMKB 3OJMB 1NDMB 5JZ7C 4P4RB 3ZMEA 4MQTB 3JWOH 3PUCA 1Q0XL 3ETBF 4Z7VF 2Q1EA 4MD4A 1SEQL 4KH2A 1PZUB 2ED9A 3BPOC 2WUBH 3P1VA 3HKZA 1T7VA 5JOEA 2Z8VC 3QULA 5KTEL 2M2DA 2ZG3A 4P3DA 5CEZE 2WLIB 2YWYA 4WDIA 2AXGB 5LGJB 2BIIA 3JV6A 1RJYB 1CMOA 4Y4KD 2W81C 4G8GA 3H8NA 3DYPA 1JPGA 1YEEL 2C7UB 3BKYH 1EBAA 1SLVA 4LHUB 4MB1A 4AW4A 4K9JA 3GXDA 2VL5B 3OLGA 5L2KA 3TCLA 5C0RL 4HK0A 3KLAA 5MEQA 4Z7NE 1NC2B 1XDTT 1LMIA 5EZJB 5FGBC 4K07A 4UU9A 4DKFH 4E36A 1O6TA 4ZX3A 1BD2E 5E70A 3QPQD 2BIQA 2Y06H 3OXRA 5IBTL 3VW3L 4OCRL 2JK5B 4F33A 4YVNA 1XCTB 5FK9B 1GVIA 3QQ4B 3T2PA 5EO1A 1OOWA 5D7SL 5AYTA 4TUUA 1SEBB 1UYWL 1OB0A 4N2DA 4YDKL 1BMWA 1QZNA 3CDGA 1FQ9C 4JB9L 4L4VA 4M48H 3VRJB 5DQJB 3ZE0F 4CNIA 1THCA 4AQZA 4PRIB 3X3GH 1U42A 5BJTA 2VR3A 2CA4A 3BGFB 3GMMB 4MASA 5DJ6A 3PWPD 3B2DC 3P4LA 1HSBA 1J9TA 5LBSA 4CVXA 4XO5A 2APBA 4F8NA 4G7YL 4S1SL 4YLCA 1CE6A 3PPEA 5IHBA 4MBOA 4IMLA 5DJCB 5BRZA 4XVOA 3FB5B 1MLCB 1E6OL 2WB1A 3MLRL 4IIQA 4PTTB 4QTIL 3PNWA 2WYZA 2DLIA 3CBJB 3S5ZA 2DM7A 1H8LA 3H9SB 1G7HA 2XFGB 2KL6A 4HCRL 5CS7A 4O58H 5D7IF 3FQXB 1OM3H 5I23A 1KPRA 1QQDB 1MZYA 1A7QH 2FJGB 2Z3FA 3NCXA 2CHDA 1FH2A 4PS7A 3CTTA 3FO0L 1QFOA 3QNZA 2XACC 4MJID 4MAUH 5FKPB 1NKRA 2CJSA 3ILQC 1AGBB 3PWJA 5B3JF 3VWJC 4U1SA 3FQYA 4I9WD 3FT0A 3E3QC 1BCIA 3FTGA 4P5KA 2IANB 2VXVH 4GXUM 4JG0L 1QHOA 3RKPA 4DPBX 1AKJA 1RZFH 3S3JA 1BOGB 1QKZH 4PR5B 3C8DA 4K7PL 1FFTB 1BQ5A 2EDBA 3WIFB 4KZDH 1CBJA 1SRDA 2BOLA 4FG4A 4F7TB 5IMOB 2FD6H 4TOYH 1E8XA 4RFEA 1FC2D 3V52L 5FDYA 1UD6A 1T66D 1E4XH 4S1QL 3U1SH 4MMXA 4AC2A 4YC2C 5IB3A 4TNVF 4YNYA 1E4HA 2C3WA 4GRMB 5MENE 3FUMA 1CDBA 4GMSL 1A1MB 1FA4A 4UDUA 4YDLB 1AIZA 3A47A 4I1RA 3ARBD 1J0YA 2WC7A 5JDSA 5C97A 1XR8B 1WZMA 3QEHA 3LRHA 4DW2L 1MW3A 5E9AA 3L7EA 4HCRA 1NGPL 3LKOA 4XBGA 1U3HD 1H8NA 2J72A 1IKNA 2BSSB 1UD2A 2NPLX 4IRSB 2ATPB 2RA1A 3V8OA 5AZ2L 2AEQH 4NQQA 4M1GL 2O93L 3DK0A 3L3GA 5CHNB 3ZE2F 1L9NA 2VQ1B 2K8QA 2VUOA 2BX5A 1CC3A 4HMEA 4WFFD 3ZX1A 4YBLB 5JHLH 1KBGL 1OARH 3UP6A 4JFFA 2J71A 4HAGA 1GTNA 1BVOA 2FX7L 5AKTA 2NDFA 1I8MA 3T8VA 2A77L 4F57L 3LZLA 1I3UA 2HVJB 1E9QA 1T1WB 3H3PH 1QWHA 4RAUB 5IQ7H 3OAZK 4RQQA 1P4LB 2JCCB 4K7PY 4OZGE 5H4YA 4BD4A 1QFWI 1ZVYA 1CU4H 3QYNA 4OLWH 1IC4L 3KM2A 4MDJA 4RGNB 3K2UH 2QZ5A 4WF7A 2CLRB 4QRRA 1G7QB 1MIEL 2XQ0A 4XMLH 1VSCA 4LAJH 4XN2A 5DWPA 1DBJH 2C9AA 4MX7A 4MD4B 3JVGA 3VDBA 3HMXH 1TZHA 3PWPE 4LCYA 1BX2A 2W9LA 5F6HI 3QULB 5I8EA 4KQ3L 3P4MA 4P3DB 4YHZL 4WDIB 3DARA 3DI2B 3JV6B 5HGDA 5J11C 1NFDA 4G8GB 4CDGC 1NLDL 5C0DA 3RWFA 1BPVA 3N41F 4S10A 4EN3A 1JPGB 3D4YA 3R7RA 3AACA 5HDBE 2J8UA 2XWJA 5AUMB 2ZUXA 4IOFD 5L2KB 2VISB 2X05A 3B43A 3TCLB 3ZL1A 4HK0B 4HZ1A 3DROA 5MEQB 4MS8D 1RSYA 4UU9B 3ZYOA 1EJ6A 2G60L 1UD5A 2E6QA 1KCRL 4KI5D 2IAMD 3OXRB 4L0YA 4AEEA 2CM6A 4XVUC 5CU9A 2H4EA 4MJIE 1JS4A 1QBML 2XVKA 1PSKH 1VFOA 3WOVA 2DMHA 5HYQA 1J5IA 4F33B 1RFDH 3IGLA 4A2EA 2CRZA 4RNRA 5ERWA 5GRZA 3S37X 4F8PA 5JMRA 2PXYA 4I9WE 3IDMB 3CDGB 4L4VB 3OKDA 3S2CA 1QRKA 3ZYJA 3MV7A 5D2LE 4CNIB 5GGTH 1IAII 5CM1A 3S34H 4OD1L 2AAAA 3ZQXA 5BJTB 1RJCA 1A7RH 1ZS2A 4HMCA 3TT3L 5DJ6B 2WSKA 5F21B 4TQPA 3X1GA 4TQHA 4CVXB 3EFFA 4M5YL 3HG1A 1T0MA 1CE6B 4WUUD 4IMLB 3ZTNL 2HLAA 5BRZB 5D7JA 1VERA 2MPAL 4IIQB 2EVGA 3PNWB 4OZHF 3VXRE 5LGHH 1TTUA 4R2GD 5F7UA 3B3BA 2ADFH 1YAZA 2WQRA 4UM9A 4B9KC 4ZW3A 1KPRB 1I75A 2ALWA 1RCYA 3D39A 1OGTA 2DWTA 1GZHC 2NY0C 4ZS7L 4KJYA 4RX4D 4PJEF 4D9RD 4KNQA 1NUDA 3GD1C 3QNZB 4A37A 4YR6A 4HWUA 1VRSA 3UACA 3B5TA 4B9ZA 4FL4C 1TNNA 5HSFA 2WXQA 3PWJB 5B22A 1HIMH 3Q8EA 3QR0A 5TQ0H 3WTTA 4U1SB 2CUAA 3RVTC 1KBWA 4L0ZA 3FTGB 3H54A 4P5KB 1MUJA 2GEEA 4UOZA 5E23A 4JREB 4R8WH 1LK3L 4PWJA 4XZUA 1AKJB 3QIWA 4OF3A 5E9DD 1FHGA 1NQBA 5B8CC 2ZQKA 4OLZH 3CU1A 4QHKJ 1B6DA 1UGNA 5DVNA 4RFEB 5E00B 4BSJA 4MJ6A 2FUTA 4OD3L 4KUZL 4MMXB 1KJ2A 1MCIA 4XWOD 4YNYB 4XVSL 1ODUA 2EXTA 5DVOA 1XH3A 4JL2A 4JCMA 5C0EA 1CD0A 4QUOA 2NZIA 4UDUB 4HWBH 5A2KH 1RIHL 3I50H 4W9KC 2UXGA 3QEHB 2XN1A 3L7EB 4NIKB 3LKOB 4XBGB 3CIAA 4TVPH 3ZKXC 5TK2A 3QR2A 4XP6H 1UXLA 2EE6A 4A7VA 3NJIA 1N7ML 2BY1A 5J7CC 3UAAA 4ONFL 1XX9C 1UZ6E 2HH0H 4PV8A 5FO7A 4M61A 3L3GB 2VYRE 2UWEF 4NP4L 1W8OA 3GIZH 4HUVB 1BMZA 4JY5L 1YRKA 1X7TA 3SE3A 1FYTA 4L9LA 4LCVA 4OFQA 1T03L 2ZKXA 1OTSD 1X9UA 4WO0A 4OZ4A 4G6AC 1W72H 1I8MB 4LDLB 4ZFZA 3RP1A 1JF5A 3ECVA 1F4XH 5DD1L 4KI5E 4RQQB 5J1AA 4TVPD 3S6CA 4PP2A 4PVMA 4JPIA 2C1OA 4TSBL 2DQUL 2OP4L 3MV01 5E5LA 3UAEA 5AB1A 4MDJB 5D2NE 5ID0A 2R2EA 1Z5HA 1JFQH 4YHML 2VN6A 1QFHA 1J12A 4QRRB 1LO3H 1TQSA 3GBEA 1KCKA 3I6KB 4JJ5A 3ZE1F 4EJ1C 1A6WL 1U3JA 2YHGA 1PG7H 2ODHA 2BXZA 3QUYA 4W9HC 2E7MA 3RILA 2OMTA 4MX7B 3O8XC 1YPZA 3IJ7A 4OCSL 4PJGA 3ZGIA 4OGYH 1JVOA 3T3MB 1TZHB 4LCYB 1BX2B 1E9OA 3P9MA 5BV7B 1KSRA 3P4MB 1X5GA 4JNXA 3BVWA 3I2CL 3UJTL 5EOCL 4MZ2A 5HGDB 4X5PA 1NFDB 3SCMC 4WUUE 1PW3A 2EIDA 4I77L 5C0DB 4EN3B 3V4VH 2Z7WA 3UYPA 2J8UB 2XWJB 4FLSA 3QGVA 5AOIA 3DROB 2V3DA 3E9UA 1ZXQA 3VWKB 4HLEA 3GDCA 4H8WL 3AT0A 4D9RE 4LLAA 2WOBA 3EO1A 1F1DA 1I3GH 4ZNEE 1PU0A 2FH8A 4Y19E 2OMNA 5EUOA 4BWWA 1IGMH 3L3IA 5HYQB 3GQFA 4HLZG 4NERA 3KEHA 1SN5A 3RFZC 3I9PA 1TJXA 1YN6A 4NZFA 4RNRB 5ERWB 3TBYA 5DMYA 1IGFH 4IU2A 4PLJD 2PXYB 3OKDB 5A7EA 3MV7B 3K72A 1L9OA 1AXIB 3F62A 3P69A 4KQ0A 4EI5A 4WFGE 2YA0A 3RX7A 4YE0A 5J12B 4IGBC 1JHLL 4LAQL 5D71L 3EFFB 3T8MA 2DBLL 2J4WL 5DVPA 3BP7A 3HG1B 1T0MB 1S7WA 3EOBA 3TLRA 1II4E 3ROLA 3ATBA 5D7JB 3GXMA 3D30A 4YOKA 5CGYD 2VLRD 3BQUC 2GCYA 4WU7B 2ZOLA 3ES6A 2J1WA 4ODVH 1WISA 3EO9L 2A6KA 4UM9B 4K3JL 3EJTA 3QZNA 5D1XA 3D39B 5JPNA 1OGTB 3N85L 1A6ZA 2YGPA 2CXGA 2FECI 4KJYB 3UTTA 1CE1H 2W1NA 4PCSA 1YNTA 1U41A 2R0WL 4YR6B 3VCLB 5HVFB 2AQQA 3EYUL 5HVGB 1Y18A 4LP8A 4L2YA 4P59L 5KSAC 2ZX6A 3UZEA 2EVJA 1NCAL 4NO5A 3ULUF 5IFAH 5FWRA 4HOZA 3T1FA 4XZUB 4KHTH 1BQSA 3QIWB 1M7UA 2IQ9H 1SM3L 1FZOB 4Z18A 5EUKB 3D33A 4LCIL 1DL7L 3LKPA 3CV5A 2VM3A 3B37A 3DJ9A 4MJ6B 2YEQA 4DK5A 4TVPE 1KJ2B 1OWRM 3D34A 1SDYA 5C0EB 3FAXA 4DP2X 1XH3B 4R6UA 4HALA 5I26A 5CFHA 4UQ2A 5IT2L 4KAQL 4FJZA 2KHAA 2XXFA 3NCYS 4HIPA 1MFDH 1P84J 1NCJA 3TF7C 4HA1A 4YDJA 5D93B 2MCMA 5KW9H 3HB3B 4FZEL 1FG2A 1JZ5A 3QDMD 4HD9A 4LL4A 4PV8B 4L29A 2PF6A 4M61B 1NANI 4AC4A 3QXVA 4EPSA 3BLBA 1VGEL 4KVNL 4XXWA 3DBSA 2CGZA 3HOGA 4FXTA 3BGFC 1FL6A 2ZOWA 4L9LB 2C5DC 4Y2NA 2WLJA 3PUUA 4BKLA 1ZEAL 1WS7A 2DLTA 4IHOA 5EORH 4OZ4B 1C7SA 5ABZA 2OZ4A 4Q6IA 3VQ1C 4ZFZB 1J1OL 5C09A 3S0PA 5KSBA 1QACA 1G6RH 3FRPG 4ISVA 3UIZA 2F74B 3MJ7A 1ONQA 4FNQA 1ZDSA 2KPNA 3EUDA 1JJUA 4PP2B 5J1AB 2B20A 1N19A 2C1OB 4JPIB 2JKWA 1WFTA 2X1XR 3H3KA 2E3VA 1NCWL 3S3BB 2R2EB 5FV2A 3UH8A 4PJXF 1A8JH 4F2FA 4JJ5B 5A2FA 4X7DC 4XPFL 4W6WB 1J48A 2WXRA 4FP8L 4LFHD 2X7LA 3LS4H 3QUYB 4G8AC 3OB0H 5DS8A 2OMTB 2ZP8A 3RBSA 1YPZB 4PJGB 3DETD 1KF9B 3PDDA 1E9OB 3P9MB 4H1LH 5I5JA 1MCQA 3ZDZB 1NPJA 2BP3A 2R56L 1G0XA 5KYYA 4YX2H 3AU1A 3KR3H 3U2SA 3BWUF 1AKPA 4KXAA 2X6BA 2GJ6A 1LYQA 3UYPB 4OI9A 3BDXA 1XIWC 5FHAL 2AQPA 4D3CL 2EE9A 2W92A 5I1CL 4ZMQA 4AJ0A 1M1XA 2WWKT 5C08A 3RTQD 2F7OA 2Z4QA 2NY2D 4AKOA 4S1RL 3FCBA 5E2WH 3DECA 1XSKA 4PRNB 2VWEC 2HRHA 4WHTA 4J6IA 4U7MA 4JFPA 2Z65C 1FFNB 2LLGA 3IGFA 4Z7IA 3VD0A 5SV4A 3EO1B 3LH2H 4MNQE 1JDCA 2PYFA 3NIFE 1WA2X 2QPEB 3L3IB 4JL1A 1ZGLM 5DUML 2Q9OA 3AVEA 3AS1A 4QLWA 1MJJA 2QKIA 5KVMC 2VW6A 1L3NA 2W0FA 3B6SA 1YN6B 3AWFA 5DFWH 3TBYB 3DK2A 4BZ2A 3OJVC 4IU2B 1NIBA 2VDLL 3F7KA 2JJSA 3KXFB 1WYJA 4HSCX 4HUXA 3K72B 4DESA 3FSVA 3AB0C 1EX0A 1XT5A 4EI5B 2FK9A 4AW7A 5D7KD 3FCGA 3WO4B 4ZTOL 1L0XA 4I87A 1X4ZA 3JWDH 2FATH 3C5ZA 1WFMA 3OL2A 3DC0A 3PJSA 1DSYA 1K8IA 1S7WB 1I3VA 5BUPA 3EOBB 4YBLC 3ROLB 1PLGH 3QT2A 1N4XL 3IS1X 3ZDXE 4XWGH 1ETZA 1OKEA 2ZOLB 3ES6B 2GSGA 1IM3A 3ZKQD 3GM8A 1MHPL 1NIAA 3CGTA 4ADGA 2A6KB 4Z7UF 2MPVA 2B0SH 2X10A 2PYEE 3LQMA 1KIUA 1WAEA 4PWKA 1INQB 4IIZA 1ZTXL 5D1XB 3QZWG 3PAUA 2BCMA 1RY7B 2UY7A 1A6ZB 3QCVH 4LSQH 3UTTB 3GI9L 2PPFA 3GJFH 3MMEA 2IBZY 1BVNP 4PI2A 2C8NA 4RGNC 5FKAA 1QBLH 4OB5H 4ESKA 3US1A 2XQYK 1Y18B 3L95A 3QDME 5JPMA 1SXZA 1HHJA 3SBQA 4JHWL 4TPRH 4HQQH 2J88H 3BUIA 5J3HC 5D7HA 4NO5B 1FNLA 3T1FB 3U0PA 4PAZA 4GMTH 1G9ML 3WKNA 1VACA 5AAWA 4XX5A 3TX4A 1NSNL 4N0YL 4R83A 1BJ1J 1X7QA 1WZLA 3EHBB 5LGKA 4U6YA 3VFGH 1U8LA 1U8CA 3WTXA 4UT9L 4OT1L 3LKPB 2YXFA 1WSST 4PJAA 5KBDA 3O2VL 4KFZC 4NX0A 4TXVB 3DNKA 1OAZL 1U8JA 1OHQA 5CKGA 1OXYA 2D9QB 4UQ2B 3VTMA 2FB4L 3WIAA 2LU5A 1A6PA 4JJOA 1KUMA 1J7VR 1OHZA 2JKSA 2ADGA 3TZVD 5FF6A 5JUEH 5HHXH 4YDJB 1JDAA 2P5WE 4UTBH 4AQEA 5HYSG 3DJRA 3GZQA 2Y5TA 4YE4L 3CVHH 1CLZH 3SHSA 1FG2B 2HFGL 4LCCA 43C9A 1UXMA 1WA0X 4L29B 1FVCB 5MEOA 4JZOA 2WNKA 3VQ2C 5LXGH 1Q0YL 1KYOJ 2P48B 2YJQA 2YJLA 1ZV5A 1FL6B 3F65A 4PY8I 3APCA 2CA3A 4BKLB 3MRCA 1CVSC 4IHOB 2BPBA 5K1JA 1J0ZA 3L4VA 3RNQA 3AXLA 4DVRL 1WK0A 5C09B 3VFPA 3HPJA 4ISVB 5CJOH 4XN1A 1I9RH 2VDOB 3F5WB 3MJ7B 1RJZA 5F7WC 1U3YA 4NEHB 4O5LH 4YGAB 5HJ3A 3RDTC 1NCIA 1IM9A 4UT9A 1O9VA 5AW4B 4NO3A 3GUFA 3DX1A 1AP2A 1IBGL 5AW1B 3ZTJG 3Q2VA 4H4NA 5JORA 4LP5A 2FX9H 2X7LB 1PVHA 3LRLA 5F9WC 5A2JH 1Q9WA 5DS8B 1BQHB 3BRGC 1R0AL 1R3IH 4NWUL 4PJDA 1WBZA 3O6FA 4KU1A 3SGEH 2AMGA 2X6MA 4HIXH 5HP5A 2V5SA 1GGIH 3IAPA 1WZAA 1R19A 1FNHA 2CDEA 2KKQA 2W95A 4J1UA 4NKQB 4AG4L 5KYYB 2RFXA 3AU1B 1RLWA 3U2SB 2AGJL 4Z3HA 2JIXD 3A24A 3KHOA 3N44F 4DAGH 2GJ6B 4FXLA 1AC0A 2ENQA 2P5PA 2XWEA 1GS6X 1RZPA 2FX8H 3DHMA 2ZKYA 3HNVL 2AJYL 1M1XB 5IOPB 5C08B 2Z4QB 3L4ZA 1RU9H 1JK8A 3BAYA 4WHTB 3T08A 4JFPB 4MMXC 3S2AA 3GMOA 2PYFB 4JPKL 2MQ0A 3R4RA 2FWUA 4XNAA 3FW6A 1MJJB 2QKIB 4HFWA 2W0FB 3B6SB 4NM8L 1OW0A 1A5FH 1N59A 1QFPA 1WAAF 3I74A 1D5IH 4HUXB 1HZHL 2HYMA 3EYOB 3MRPA 3T6WA 3VMOA 1UM4L 5IHLB 1IKNC 4KKNA 4NSKA 5B3NA 5AZEL 1HU8A 1I9EA 5EDXA 2J3SA 4Z7WA 3S35X 1MWAL 3RVXC 3VXMA 2J6WA 2H1XA 5EU4B 3QIUD 4A7SA 4MTMA 2QLYA 3UPRA 1ETZB 3MRBA 1XZWA 2GSGB 4I2XE 1VGKA 1GGTA 5DVKA 1IQWL 1KIUB 1YHPA 5EIVA 4ZMYA 4TNEA 3GB7A 2UY7B 5JXEC 1A02N 1RAMA 1U8HA 4GIOA 3MMEB 2BP0A 1G7LB 2AERT 2H1PL 5FKAB 4HOWA 5IJKA 1TQUA 2CIIA 1IVTA 3L95B 1NIFA 5JPMB 1E2WA 1FRGH 1HHJB 2G2PA 3CFCL 3P9LA 3UMTA 2HWZH 5E95B 5AVWB 2J25A 1BAFL 3NA9L 4K3EL 2OYLA 3U0PB 4RRPM 2CRYA 1BZDA 1VACB 4N0FA 4E9LA 4NOFA 2ZWLT 1HYSD 3MACL 4E9SA 4WUKL 1X7QB 3MC0A 5CWSB 1JD7A 1WPCA 3QI9A 3ZKNC 1U8LB 1AZCA 1U8CB 3LRKA 2QEJA 3F7QA 3BESR 6PCYA 4GP5B 4TF4A 1OAQL 4NP9A 4KO9A 1YEFL 2EDJA 3UO8B 5IBUG 5GGUA 4M62H 2OTUA 3WY1A 5DMIH 1E2VA 1U8JB 1JZ2A 3D50A 4M9PA 1HEJC 3OZKA 2NLJA 4NUJA 5AW2B 1ZD6A 4Q52A 3IE9A 3QZOA 2ADGB 2E74C 2VQ4A 1OCCB 1WITA 5DUJA 2IV8A 5FF6B 3WUZA 4FQIL 5IESL 4AQEB 4LLUB 5IVXA 5E2VH 2Y5TB 1FLRH 1J1XH 2BSTA 4FQCH 2YXMA 1FNFA 4LCCB 4RCAA 43C9B 2PXYC 7PAZA 5KYXA 2W91A 5AW0B 3NCBB 5MEOB 4FQJH 4JZOB 3TH4T 3NSDA 2R0KH 1ND0A 4KY1L 4N0CC 4NQCA 1BFVH 1D7CA 3EGDA 3OHMB 4JG1L 3DX0A 4KVCH 2P24A 4U6VL 3MRCB 1E4WH 2WYIA 3RNQB 4G1MB 4JO2L 2PCFA 2E27L 3AXLB 4IBVA 3GFUA 4LASH 3VFPB 4XP9L 2EVIA 3SDXF 3HPJB 1PEWA 3MLXL 2B3IA 5D7JC 1LD9A 1RJZB 4L8CA 2WVSA 4PJFA 3F04A 4MAZA 5HJ3B 2OW7A 2Z31C 5SWSA 4DF9A 4NO3B 5IQNA 5IJBC 2WLZA 1AP2B 4EI0A 3Q2LA 1NAMA 4KXBA 1K4DB 2BERA 1MI5A 4XN8A 3FQ2A 4GIAA 5HI5D 3DMMD 4I0PD 1FGNL 1H9VA 1QASA 4LPXA 4JFEA 1Q9WB 4PJDB 3LN9A 3HFMH 3O6FB 4XMKL 4N3UA 2D3NA 5CJ8A 2OAAA 5CCGE 2JB5H 2CDEB 4J1UB 5DHEA 5I30H 2RFXB 1TTGA 4HGWA 2L4OA 3U1QA 1IBZA 3MRNA 3B9AA 3Q44A 4K9EL 3STBA 5EC2A 4XAKD 4QD2E 2H6OA 32C2A 4WEBH 3WIIL 4ZTPH 1UOVA 2Z7YA 1AHMA 1KC5L 4X98A 4AYMC 3EDEA 4YSEA 5BS0B 1JK8B 2DTMH 1SVBA 2BVQA 3B8SA 1IARB 2EH8L 5J6GA 1JOIA 1KN4H 3C5JA 3KLQA 5FUCC 1CQKA 4A55A 5GGQH 4PJ8D 3TO4C 3INUH 1BYPA 3V4LA 2I07A 4HJJH 3RHWF 4HFWB 4DHLA 1N59B 3FSWA 4JMXA 1GMIA 4NENB 2E46A 1ZGLB 5D4JA 1B4JL 3JT2A 2VXTH 5FX3A 3LKNA 1MCFA 2VRAA 3MRPB 4HWZA 4DWHA 3VXSE 4XVJL 5D93C 1AZUA 5IM7A 3HB3C 3EYQD 4NSKB 1NGQH 4KGLA 2XWZA 4JY6A 2PO6C 4Z7WB 2EIKB 3C5XA 1OSEA 1JI2A 1K8DA 4LSRL 3WFEL 5IFJA 2AK4D 4LSSH 3UPRB 3DJZA 1AQKH 4IKNA 3CVIL 3UAJD 4AQ8C 1AI1L 2XKNA 3CFBA 2P8PA 4QGTA 1LQSR 1W0WA 2JKIS 1JPTH 1X5HA 2V17L 3A6CL 3I85A 3AITA 4LMQI 1QZ1A 1XO8A 4GY4A 3GB7B 4UB0H 1ZT4A 2LAAA 3EOAA 4OZIF 1U8HB 4MVBD 4HF5L 3GLDA 2BP0B 5CJ5A 1NCUA 4H8HA 4AYFA 3HTLX 4X0NA 4JRWA 3GRWA 3ARPA 2K6WA 3FXIC 3LZFL 2CIIB 1FO0L 4MRCA 4Y5VB 5BCAA 1NM4A 2R1WA 3P9LB 1LO5A 3DURB 5BZZA 2Z92A 3VH8G 4LCWD 2B1HH 3QUYC 2EIZB 4UZGA 2OSWA 4YAQA 5JOFB 4G7RB 4DUXA 1KIQA 5T3XH 2XQYA 4Z1PA 5FUOL 4HCFA 4KK8C 4N0FB 4YXKH 3U7YL 1A6AA 3LY6A 3BAKA 4HT1H 3BSZL 4GUCA 2QHRH 4BRVA 1GYWA 3QI9B 4RRPA 1G5GA 5GISH 4PS4H 2EH7L 1Q94A 3JZYA 4BV1A 4CU6A 3SQOL 4BGLA 4MZ3A 5D5MF 5GGUB 5GZOA 2OTUB 2FLRT 1REIA 4FQ2H 3QAQA 1E43A 5ESQB 7CGTA 1LO0H 3BEVA 5KBMA 1FCGA 3B7RL 3LSOA 2YPKB 4Y4FC 4F15B 5A16A 2NLJB 1NGXB 1NDTA 2DQTL 3E1ZA 4AJWA 2AJUL 2WXPA 1CFVL 5IW6B 4FZ8H 5T3XD 3MBEC 5EZOL 1NZRA 2PPDA 1KCUH 3AS2A 1KGCD 3Q48A 4PJ9D 3V4PA 5IVXB 2P8LA 25C8L 3GSQA 1NBVH 3KS0H 5AENA 3UTQA 1A4JA 2FDBP 2N1TE 3JWNC 3BSHA 4N6RA 2WANA 3RWEA 3GSNL 2NDGA 1ND0B 5F89A 2ZICA 4P5TA 2XTJC 4NQCB 1L9QA 2X1QA 3EGDB 1RVFH 2WLHA 2HMIC 2P24B 5IHUH 4J3XA 2FSEA 1GGYA 5LQBH 3W81A 3EBGA 2A6DA 3NZHL 3S3PA 3ZYZA 2PCFB 4WK2B 5FO9A 3VFVB 4J3VA 5FLVA 1JZGA 1G0DA 5C0FB 4C4KT 3ZL4L 1ZHKB 5FV1L 1A7PL 3LMJL 4L8CB 1DBMH 1XV8A 5SWSB 2KZBA 5BZXA 3RX8A 1TF4A 1NAMB 5JPNC 1MI5B 3ARFA 2GJJA 1ED3A 5SX4H 4DTGL 4CUCA 2OXGA 3LNDA 2FGWH 4FLOA 3TWCH 4RWHA 4JFEB 2F8IA 1YCSA 3IJ9A 4LCUA 4JPQA 3EFOA 2DMGA 3MRRA 4Y5YA 3BKML 1JNNH 1YNKH 4H2CA 1YYCA 1XL4A 1YYML 4CBPA 4WQOA 4DETA 3UZEC 3QP3A 1QYGH 1AO7D 4UV7H 5DC0A 1FH5L 4HGWB 5I71B 2AK4E 5EN2A 4LLQA 3CZNA 4JQIH 4R4NC 1YJDL 3SB3A 1WUNT 3BP5A 3GSNA 3EHBC 2PR4L 1ICTA 1WC7A 1KTJA 4K15A 2MMXA 2P80D 2Y1AA 4P06A 1CIDA 3C5JB 4WIQA 5HY9A 4L3CA 4G9DA 2OX5A 3MLUL 4TKWA 5C0AA 1TJHH 2I07B 5DEFA 4KDWA 4QNPE 1GJUA 1KB5H 4WFED 5IROA 1BBDH 5L7XH 5E99H 3D12B 4QIRA 1A2YA 1WIUA 1QNZH 2P42B 3QDJA 4NKDA 4WVRA 5F7HA 4AM0A 2Y5EA 4HWZB 1PLCA 3VFRA 4YEFA 3B9KD 3UGEA 4WI5A 5I1JL 2EDYA 4P2QD 3SKUD 1JZ8A 4PG9A 3GBNL 3MLVH 4KZEH 5FYLL 1YVLA 5AVRB 2HRPH 3UG4A 1K8DB 5IFJB 1IBYA 2F8VA 1F4HA 4ADIA 3ZT7A 3BKJL 5JXAL 2A0LD 2YK1L 4JZNA 4A2LA 1DVFC 2I24N 2XKNB 3CFBB 4X7SL 2P8PB 1W0WB 4Q6IC 3Q5TA 4FKEA 2CBMA 4MYPA 4EDXA 1BDYA 1G9HA 4JN1H 4YH6A 4JE0A 4L8BB 2VE6A 3C6LC 3RTLA 1C5BH 1ZT4B 3EOAB 3L5JA 5T3XE 2Q76B 2B9BA 4JPVH 4TULH 3FKUS 5KS9A 2DW5A 3F58L 3WNLA 1EUTA 2H26A 5F1SA 5DC4B 1C7TA 2R1WB 4A6YA 4EKJA 1LO5B 2Z92B 1N5AA 2VW4A 3V0AC 3CMOL 3W37A 4YAQB 4PJIE 4IRZL 1U3NA 3RGHA 1KIPA 1KIQB 4KHXL 1J11A 1JWMA 1Q72L 4JKKA 3UFIA 3B56A 5AB9A 3VI4B 1A6AB 5LNDA 5GGVH 1XGPA 2WLLA 3N1GC 1MPAL 5DJAA 5F3HA 1FE8L 1DQKA 1SPDA 3NN8A 1MCWM 1JZFA 4GKLA 4XNYH 2OSXA 3HI6H 1Q94B 2NY3D 2XG5A 4LVEA 4G6JH 1LJMA 1H19A 1I7ZA 3E0GA 2G3NA 1AYRA 1A25A 4XO8A 2OMWB 4XPHH 3CDYA 3LSOB 5HDQL 1SMOA 5A16B 3SGJA 5JHDA 1PKQA 4AZ8A 3MLTA 4WGKA 2VLLA 3OKNB 3NEEA 4LZKA 4OLXL 5AYUL 1TPXB 3QZLA 3V4PB 4UILL 2V2TA 4LVOC 2P8LB 3GSQB 4GO8A 3CXHK 2FBJH 2AZUA 4X6BB 3UC0H 4YUEL 1J9QA 1A4JB 1J10A 5FC9A 1AO7E 4N6RB 3RWEB 2OJZH 4FYRA 2BHFA 1FO0B 3JV4A 5A2AA 5F89B 4FCHA 4M6OL 4P5TB 3HLKA 3MRFB 1NCGA 2F1AA 3KYAA 1AVAA 3D3VA 1CDUA 4I13B 1QSED 3BPCA 4QT5A 4OV5A 4E0RA 2A6DB 4IRZA 1EHLH 4N2CA 5SX5H 5FO9B 1DFBL 3C5ZC 1MFEL 4I85A 5CN3A 1F41A 3R06B 5JW4M 3QQ9D 4XBEL 4GI9A 1CGYA 2ATKA 2L3BA 1ILUA 3OAUH 2VITA 1Z0NA 2EYSA 4WFEE 3SE4A 3ARFB 2CAKA 4FI6A 1ED3B 2BVUA 3QUZD 2OXGB 4Z7OE 1N6VA 1A3LL 3B7SA 4A2HA 2CJUH 3IRPX 3S9DB 1SFHA 1ZV2A 5GJSH 3SDCA 4LCUB 4XO3A 3EFOB 3S5LG 3MRRB 1LDPL 3HAEB 4P2QE 2VERA 5DJ2A 1V7NH 4ZJ9A 5IB3B 5JPMC 2R69A 5C6PB 3OZ9L 4BQ8A 1G87A 1VF5C 2R1XA 3WMQA 3MLYL 3IDGA 1E28A 4QHUB 3L48A 1I1RA 5EN2B 4LLQB 4GLRH 4FC3E 5FGCB 3N1QC 2R29A 4KO6A 3HHRB 3UCRA 5AAWC 3BP5B 3WFBL 3GSNB 4MZIA 4X4YB 3KPPA 3LQAL 5DJDA 1D5MA 4G6KH 1WC7B 1KGIA 1P1ZA 4PU2A 4K3DH 1U6AL 1DO6A 3ABGA 3HC3L 1PFCA 1OB1A 4U1LA 3S4SG 4ZX4A 3FPYA 3I75A 3QZBA 4ODSL 1T2XA 4BKSC 2D7PA 5EHFA 5HY9B 2GI0A 4L3CB 4WWOA 1EVUA 2OX5B 2HZHA 1JI1A 4JFHD 3X12A 3SDDC 3NACH 1EZLA 2AHIA 1TEGA 2HJLA 1A2YB 4NKDB 3QDJB 1X44A 5CLTA 4AM0B 2E4TA 1AY1L 2ZXWB 4EVNA 2J2ZA 1ADQH 1N18A 5IV2A 2LU3A 4NQEB 4BHUI 1G7JA 2O5YL 3L81A 1HINH 7PCYA 1G1OA 4LCCC 1PCXA 2XX0A 3HNSH 3MRDA 4PG9B 5DTFA 4XVTH 2WXMA 3FN0L 4FERA 2ZCZA 4I3RH 5DMJB 4ZD3L 4HZLA 5CZVH 2LE9A 4FFZH 2NR6A 4JKMA 5GHWH 3LEVH 1I9IH 2Z35A 2CM5A 1AXSA 2Q10A 4JZNB 2EJ1A 4A2MA 2VDQL 4XOEA 3FMGH 1MN4A 3H3BC 5GSVB 3WTUA 4HD5A 1UH3A 2AS5M 4EDXB 2HX9A 3C2SA 4KZCA 4HEMA 4LP4A 4QYAA 1MCEA 3LEYL 3WI9A 2VE6B 4HPYH 2Q87A 4AL8L 5I73C 4A1RA 1JHKH 1MVYA 4B7IA 3IU3A 2J6EH 3FH8A 3UYRL 2WO3B 4JGMA 3Q1SL 4L5FL 5I9QB 5KS9B 3CZUB 3RUGE 2NZ9D 2IAND 2H26B 5E5UB 4A6YB 2CH8A 3RWIA 4Y5XB 3NTCH 4UIKH 3CU7A 1WZ1H 4J3WA 4V1DA 3JUYA 1ACZA 1JWMB 1L9TA 4NKIL 1QSEE 3ZDWA 4S11A 1ZVNA 4D8PA 1R3HA 2WLLB 1NC4A 2HTLD 3BDYH 3KJ4B 5F3HB 1AHWA 1SHMA 3NN8B 3ECWA 3QIBA 1MCDA 4AJYV 1PBYA 4EIBA 5TF0A 3ARVA 3CFIC 3JTBA 1OPGL 1T21A 3U0TA 4XNXH 1I7ZB 2C3VA 2W8CA 1IC5L 3BAEH 2WP3T 1FNGA 1TR7A 4P9HC 4E41D 4YFLF 1OVZA 5JHDB 1PKQB 4AZ8B 3MLTB 2FE0A 3FRPA 3OG4B 4B9PA 2VLLB 4XB8A 4Q97A 1MQKL 4IRSD 4F80A 3P2TA 4JANA 1Y6MR 3Q6GL 5I74C 4J3SA 4LSDA 5J4MA 2V2TB 1JBJA 3NVQA 1OW0C 4AMWA 4GG6A 1RUML 3MXVH 2AEPL 4CN6A 5I1LA 1GS7A 3NOIA 5F0LB 5I0ZA 1O7SA 3JV4B 4KXCA 2NY5L 2IG2H 2FHBA 1IBHA 4OIIH 1N5YH 3D3VB 1BF2A 1YAIA 2VRQA 1TIUA 3BPCB 3QHZL 4QT5B 4OV5B 4E0RB 5LJYH 3RZCB 4A68A 4UUJA 2OFQA 5K9QG 1RZKH 1B2WH 5J1SC 1N8ZA 2B2XL 3T8XA 1UCTA 4AWJC 5T3ZE 5HYEA 5KUMA 2O1AA 2ATKB 2NXYC 4Z3IA 3G6JF 5LVEA 3UDWC 5FLUA 1ID5I 2VITB 3LD8C 3HC2A 2EYSB 4PRIE 2BSEA 5I15H 2WPGA 4MXVE 5CMAA 1GOGA 3KBHE 3PP4H 2VKXA 1J1PL 2HKAA 3OVUB 1T2QH 2BY3A 2Q86A 2NNXA 4GAJH 4JO3H 3SDCB 3LH8A 3K2MC 2Q7YA 3DIVA 5DJ2B 2A9NL 4F5CE 1EHXA 1MJUH 2DQGL 4MBRA 2QV4A 2R1XB 5FYKU 2VDKL 3GXFA 4LSVH 3CD4A 1TMCB 1E28B 3IDGB 3IFLH 3LHAA 5DI8A 3FTSA 4X50A 4DGIL 5C2BL 1ZSHA 3H9SE 1BXAA 2Z1PA 2BNQA 1MREL 3MRQA 2X3BA 3KPPB 5DJDB 1D5MB 2ZE0A 4FF9A 3H56A 1MNUH 1P1ZB 2ZYRA 3M1CA 5D6CA 4PQXA 1TYRA 4KRPB 2W07A 1C5DA 4U1LB 1OB1B 3I75B 2GABA 3ARUA 2K4WA 2ENPA 4HJIA 1NINA 3X1EA 2X9ZA 4P04A 4EN2A 4BKTC 3X12B 4F15C 1IL1B 5C0RH 3BVDB 2IANE 3N43B 4MSWA 3QZWA 3ZZSA 2HJLB 3SDYL 3WAJA 4ZZFA 3PL6D 4AE0A 3C60D 3CNKA 1ZLVK 5GZND 5IBTH 1HNYA 1AQDA 2XPZA 4PGDA 1EO8L 4XAWL 5IV2B 3VW3H 1G7JB 2Y7NA 4BFJA 3IDXL 1MLBA 3MRDB 5DTFB 5INDA 4X5XA 5D7SH 2ITFA 5BRZD 1RZJL 2E76C 4Y2DB 4PB9L 4Y8AA 1NCDL 1UYWH 4YDKH 4Z3FA 4JB9H 2Z35B 1AXSB 5DK2A 2LTQC 2FJUB 4GW4A 1I1FA 3PYCA 3FB7A 2QSQA 4OBRA 4GRLA 4P3CL 5I0YA 1DJWA 2WTOA 3L3OB 3RPIA 3NG5A 5FYJU 1CLOL 1OCWH 4G7YH 4S1SH 5E03A 4J8RA 3ULVF 2K3HA 3IU3B 3DOIA 2WQVA 3WEAA 4QRPA 4J2QA 3ABMB 5EZLA 1E6OH 3UPCA 5DVMA 3ZRSA 3FQUA 2JE8A 2WXIA 3NSCA 1FHNA 4HCRH 5TFSH 1FLTX 3RWIB 1TT6A 4P46A 1MVUA 2EO9A 1FN4A 1T7ZA 1AKJD 1JAEA 3KE0A 1OP5K 4YFEA 1P7QD 2V3EA 5HYSA 2BLFA 4V1DB 5ICYA 4BQ6A 4URTB 1BD2A 4HLJA 5LAXB 1R3HB 4X80L 1NC4B 2HT4D 3HBGA 1AHWB 2JCCE 1JVLA 1INDL 3QIBB 5I71C 4NQTA 4PJBB 2UUDH 5I8CA 4X5QA 2X9YA 1UATA 3ZL2A 3L5WA 1T21B 4M3JA 4RGNE 3U0TB 4Y16D 1O6VA 2WMPA 3SBPA 1O7DC 1VFBA 4JG0H 1FNGB 4M7LL 3K0YA 2Y6SC 1TQVA 1NAKL 5KVFL 1E7VA 4K7PH 1HJBC 2VDQB 2E7DA 3FRPB 4WI3A 2VLJA 3V52H 1F4YL 1WA1X 1KULA 4S1QH 4JANB 5FS5A 2YO3A 3EBHA 1J88A 4W9ZA 3QUXA 2VXSL 1XGTA 4GG6B 4GMSH 1KGXA 4G8GE 5JIKA 1I8LA 2JFCA 4E9QA 1VZHA 3NP3A 1NIEA 5I1LB 5EEUA 1T20B 3DX3A 2AJ3B 2AJVL 4DW2H 3QORA 3S48A 3X1FA 2QR0A 4OLVH 2FQEA 1NGPH 4X0KA 2LT9A 3OQRA 4OZFA 4PUBL 3WXVL 5IUCA 5F7NC 2LR4A 2ZPKL 4ODXA 5EIIB 3PFQA 1EDQA 5AZ2H 4UUJB 4M1GH 4AEIL 5D7LD 1N8ZB 4N90E 4F7PA 3T8XB 1E2ZA 3TN0A 4TSCL 1J0HA 1U8OA 1PZAA 3K6NA 1F1AA 3LKSA 1HOEA 4RGMB 4JZJA 5IJVB 3HN8A 4NNYB 2X40A 2B14A 4ANXA 1OF2A 4OFVA 3B2VL 4PHXA 1JCKA 2A77H 5D8JL 1I9JL 4F57H 1XB6A 3BOVA 3FC8A 5B1JA 2IH8A 2NXZD 3VYNA 5CMAB 1IJ9A 4A7GF 6CGTA 3JWOL 3WTWA 3HS8A 3A0OA 3MYZA 5DEZA 2WUBL 2Q86B 1CICA 3MNDA 3ZO0A 2A73A 3PIQA 2Q7YB 1IC4H 4X9FA 5A2LH 5BRZE 4EN3D 5MENA 2DLGA 5EU6B 3OSKA 1NCOA 5DI8B 5I5MA 4EZKA 1MIEH 4OM1L 3TBWA 1OZTG 2Y24A 1IGYB 2DLHA 4JEGB 5EZIH 3ZHFA 4WHCA 1H8OA 3CHOA 3MRQB 3RWGA 3VWKD 1CFQA 1JZ6A 4KQ3H 3TEXA 4YHZH 2W07B 5ISZD 1C5DB 2DM4A 5L4FA 1NLDH 5GZOC 4GSXA 2DWXA 5IMMA 4HCIA 4Y4KA 4ECNA 1V7ML 4FMVA 3ARQA 4AY0A 3R8BB 4MSWB 4DN3L 5DZLA 4CC4A 2A6JA 4RFNC 4U3CA 2C9UA 1FC1A 3OKOA 1TPXC 1KCRH 4PJ7A 1AQDB 3CH1A 4PGDB 2X4QA 3ZKMC 1ZOXA 4JFQA 2I9LA 4OZGA 4FMKA 3SKMA 2NOYA 3JV5A 5INDB 5J9PB 4X5XB 4AENA 2VN5A 2EC8A 3MXWL 4ZUVA 3OKKA 4P5TC 4NN6B 4MLSA 1H6FA 1MQ8A 4NN5B 3A3YB 1XMEB 3I9AA 1DVSA 5DK2B 3PP3K 4OD1H 4GW4B 2AITA 1I1FB 2Y3AA 3TT3H 4KNSA 2ZG1A 3FB7B 4BFBD 4JM4L 1CF8L 2YKLL 4GRLB 1LDSA 2Z0UA 1NEPA 2BZ7A 3GS7A 4PLKC 4PN6A 4M5YH 1UZ8B 4ANUA 2EINB 1VPOL 4JHZA 3ZTNH 4QRPB 3HHSB 4HJ0D 1MAJA 1PQZA 1IC1A 2MPAH 4GQRA 5KBLA 3P77B 3FFDA 2VN4A 3D4GA 2BFGA 3H7BB 1EHAA 4L05A 1MVUB 4P46B 1FN4B 3G08A 4ZI8A 1UD8A 4ZS7H 5ICYB 4Y5YC 1BD2B 1QKZL 3HJEA 1ZJAA 2WTPA 1PZCA 2CPCA 1HEHC 4MJIA 5H4ZA 4HETA 2DYRB 4FRWA 1NLBL 1HZLA 5I8CB 2TSAA 3GT6A 3CUPA 3NFNA 4HKJA 1BMGA 2N7BA 2NTFA 5F9DC 3B9DA 3L5WB 4APQC 2WMPB 3KZ8A 1LK3H 4FNTA 4QRRE 1VFBB 3BH8A 4EAEA 2H0EA 2ZJSH 3ZVVA 2JCWA 1CXFA 5TTRA 2VLJB 2B59A 3SY0A 3T3ME 4KJQC 4H26A 3B2UD 4HJUA 3TTSA 2ITDA 5B38G 4XVSH 1ULVA 3QUXB 3TV8A 1S7VA 1XGTB 1NFDE 2B15A 4BE5A 5IROC 1URZA 4PRPD 4PBDA 4ETQA 3HUJF 4AT6B 3NFPB 2J8UE 3QORB 3FT4A 2Q2EB 2QR0B 3ARBA 3ZHLA 3MZGB 4X0KB 4OZFB 2V33A 4YSCA 1JERA 1ETA1 2V37A 2IDCA 2GTWA 2IV9A 2RACA 2Z8SA 2ZSVA 3DGGA 3L8QA 1U3HA 1G84A 3SODB 1N7MH 2I25N 5FW6A 4ONFH 1RIUL 3TH2T 5ISZE 7TAAA 5IQ7L 2MNJB 3TN0B 5JIDA 1AFVH 2QDWA 2NY1D 4NP4H 1ZE3H 5HVHB 1U8OB 4RDQF 2FQFA 2C1PA 4FMFA 4JY5H 3NIGF 2FH6A 3LKSB 4JZJB 4OF6A 3MV7E 5K59E 1Q9KA 1OF2B 2J1YA 1DUZA 4LSUL 1B0IA 1JXJA 3K81A 4ODBD 1QI5A 3VFWA 1K9TA 3RPBA 3AQZA 3ML9A 5DD1H 3SQBA 3P3TA 4RDQG 1W91A 1YEIL 1TVDA 3CC1A 5B1AB 2A73B 2DQUH 3A67L 3PIQB 4UAOC 1RZ8A 4PV9A 4APXB 4A2FA 2X1PA 4R9HA 4YHMH 4NHUA 5DHVA 2LVCA 2DJ4A 5DHXB 4LOFA 3GSVA 4CMMA 4G9FD 3TBWB 4UWQB 5I0WA 4YL4A 1A6WH 1UM6H 3OBAA 2GBVA 2BNUB 1I8AA 5D4IA 4OCSH 1WLHA 3K2KA 3R7QA 3D39E 3HS9A 1S5IH 1N67A 1Z7JA 1CFQB 2X4SA 3OC8A 4JGUA 4XN4A 1NCCL 5ESAA 3I2CH 1UJ3C 2D9CA 2QPFA 3UJTH 1E4KC 5EOCH 3T5WA 4XH2A 1NEZA 3QDAA 4M00A 4I77H 4F7EA 3OGOE 3GPSA 5CLZA 4Y4KB 3KAAA 3FFCD 5IMMB 2V7NA 4TNVK 4X6FB 3KXFD 3SGJC 1AGFA 2WKOA 5BVJA 1XSIA 9CGTA 2CDGA 2WY3B 1OAUL 2A6JB 3GHEL 4GQQA 1UM5L 4KK5C 1LL1A 4H8WH 2H0PA 2WLMA 3EDJA 5E6YA 2NY4B 3OKOB 5F7DA 4S2SA 5F44A 4PJ7B 3ZSTA 4TNGA 1DP0A 3CH1B 2APSA 4P23C 3JSSA 4EOWL 5C9JB 2IAMA 4JFQB 4OZGB 3V95A 2IXQA 1UA7A 3SKMB 5JIIA 4Y1SA 4AENB 2YBRA 5TQ2H 3HMXA 4Z7QF 4F93B 5DCCA 3OKKB 2NCEA 4ZUVB 2COVD 2F7IA 1A3RL 3HLAB 5DJYA 5AG9A 2YQ2A 5LGHL 1YQ2A 2DIAA 2IDFA 2WGNB 3SPVA 5D1XD 3HBQA 2ADYA 4TLTA 1JHLH 5DJZA 4LAQH 1L6XA 3GKWL 4AH2A 3W38A 4RA0C 5D71H 4UANA 5HYIA 2DBLH 2IDUA 5EU7C 3TEZA 1S78D 4Z8FL 1EZVY 3GM0A 4XNZB 1NGZA 1PQZB 4N5EC 4XTRD 4WUUA 1PIGA 5TQ0L 1HIML 1BXVA 4GRWF 1DLFL 1T7XA 3SE4C 1CFNA 2IVFC 2PTTA 4LGSB 3FFDB 3EO9H 4PRPE 5HGBA 4U1GB 5LNGA 4K3JH 3G08B 3RDJA 3N85H 4KKLC 1BJMA 5GGTA 1HSAB 1R3KA 4RX4A 4K23L 4DERA 3VNZA 4N28A 3V0DA 4JX0A 4UIMB 5D96B 1KWKA 4PJ5D 3EYUH 2YN3A 4MJIB 1MKFA 4WO4D 4GAGL 4YSOA 4KO7A 2GY7B 4P59H 1EHNA 3CUPB 3NFNB 4HKJB 2NTFB 4KUCF 1CS6A 4YBQD 1NCAH 4Q74A 2A4EA 2B4CC 4HWBL 1N6QL 1E4JA 3BH8B 3FQTA 4HS3A 3QC5X 1SM3H 4KRPC 1TUPA 5E9DA 3HG2A 2A9ML 1YPZE 2AW2A 4PJGE 4LCIH 2B59B 2EUVA 3SY0B 1DL7H 4O51A 4H26B 2MOGA 2EECA 3ZDZE 2ITDB 5J5EA 3WTSA 1S7VB 2YC1A 2C9SA 2ZXQA 4LEEA 5IT2H 4ETQB 4KAQH 2Z7ZA 4WNQA 1AS7A 1FI8C 3FT4B 3ARBB 3U46A 1I7TA 3MRKB 5C3TA 3QJFA 4R97B 2J7LA 2R0LL 3C87A 4XB3A 2DBJA 2GTWB 2JMRA 1W72L 2ZSVB 3DGGB 4R0LB 4R7VA 1U3HB 4JFDA 4TTGA 1B9ZA 2ESVD 4FZEH 2VW7A 5E1GA 5I6MA 1GOFA 2DWYA 3CLEL 3F7YB 4KVNH 1PLAA 3ZQWA 1QWUA 3K4AA 1CFTA 1SGKA 5DD6A 1H3UA 3VACA 5CBAA 3IPBA 1JTTA 3KXFE 4P2CG 3WFZA 1ZEAH 2VN7A 1H0DA 2COQA 4LLYA 3Q8BA 2BSBA 2OBGA 4HWBA 5AKSA 1J1OH 3VFWB 4UQBA 1MCLA 4ZMNA 5J1TC 1CD8A 3WYRA 1BVKA 2ICEA 2ISDA 1CDIA 4PJCE 1EEQA 1RZ8B 4PV9B 1BZ7A 1NCWH 1T0PB 2VJ8A 4FFVD 2YZ8A 4LO9A 4HBCL 4G83A 5DHVB 1F1GA 5D1QC 2GJ6D 3ZDYE 3GSVB 2X87A 5L0QB 4CMMB 3P11L 5DLML 4XPFH 3GXUB 4A2GA 4ELMA 4FP8H 5C08D 2R1YA 2EXYD 2PUQT 4F1ZA 3WMPA 4UNVA 3INOA 2V9UA 5D1XE 4EMZA 3MRMA 2P45B 2OCJ