4G5AA

Crystal structure of a putative member of duf 3244 protein family (bt_1867) from bacteroides thetaiotaomicron vpi-5482 at 1.69 a resolution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'GKQHVKTKSDWVIQRTPVDPEWLKVYVDDESKRLCLNFKDSFAPITVEVKDIEKQIVFQSIIFPVAAGEYTLYLGDLSLGQYELYMYNASVKVVGNFTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Bacteroides thetaiotaomicron
publication title Crystal structure of a putative member of duf 3244 protein family (BT_1867) from Bacteroides thetaiotaomicron VPI-5482 at 1.69 A resolution
rcsb
total genus 14
structure length 99
sequence length 99
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4g5aA00
3D33A 4G5AA 3SD2A
chains in the Genus database with same CATH superfamily
4LHUG 5FCUH 1S5IH 1U8LA 4NENA 4BQ9A 1S7XA 1SYVA 4MCYB 3IDGB 1RUAL 2OR9H 4LVOC 4G42A 2P7TB 2EDKA 1VRSA 4C83B 2GTQA 4G9FD 1I3UA 5LAXA 3UG3A 4D9LH 3S8GB 4PVMA 4GUPB 2P5WB 2V3FA 2WVVB 3H8NA 3NK3A 1CXLA 2X3CA 4UINH 3L9RB 1H19A 2FZ3B 3K81A 5E7FA 1BX2B 2Y1YA 2B9AA 5C09B 4NPJA 1AJ7L 3HS8A 4TTDD 1NFIA 4LCUB 3VGGA 3QNYA 1BPVA 2K9UA 5T1DL 1ZGLM 4YL4A 1DDHB 4NNPL 2DIAA 4R5XA 4HPOL 1S3KL 1U8NA 4BINA 4L4TB 1L7TL 4YR6B 3BEWB 3JUYA 3P73A 5CLTA 4WI6A 4XOAA 1UHVA 3CFDA 4P2CG 2ZWKA 2YKLH 5DFWH 4O2FA 5I19H 3IGFA 1R4XA 4PWFA 2AJSH 4UAHA 5E2WH 5EZIL 2MTPA 3D8MA 4DKFL 1FNFA 2RHEA 3HB3B 4PJHA 1BQUA 5TH2B 1I1RA 1MHCB 3O0RH 4LSRL 2EUZA 3WS6C 2DKMA 4FDWA 2ITEA 1KIPA 2H1PL 4BKTC 3NFPB 4GT7A 5CBEB 4JG1L 1MJ7L 4MAUL 2GTWB 3KW8A 1ZTXE 3LH2L 2W8CA 2XWEA 1Q9WA 4M6MH 5BRZA 3L3DA 2AK4E 1TTCA 5H37H 5CGYD 5D7IA 5EF2A 2X4RB 4PI0A 3RUGB 2FLBT 5CD5D 2YD2A 5EZLA 5B1JA 3E8UL 4NFBA 3ZPDA 4OLEA 2P49B 4JG0H 2O61B 1FORH 1QD0A 2IPKA 3O3BA 5HYSA 4HS6B 4KRNA 1VDGA 3JVGC 5IFAH 4RSVA 1WDAA 5E56A 3X12A 4A1RA 3FTZA 4KU1A 1GYAA 3BZDA 4NYLA 4J39A 3GBML 2GCYA 1S9YB 3HG1E 2IV9A 1U6AH 4BM7A 1P7QA 4YEFA 5MEQB 2FHFA 4JO1L 2W5PA 1HWGB 1IBGH 1Y6MR 2OMTA 5DMJB 3IE9A 3VJ6A 1T1WB 3ZYIA 3VNYA 3SDDD 4RRPM 5ALBL 4OCYL 3B9KD 4HIJB 4OGAD 3SBPA 4LLUB 1KTLB 1A3ZA 5F3HA 3W56A 5AD0A 1KBPA 2A0LD 4XXWC 2MQ0A 1AC6A 3N42F 2ZJSL 2ESVE 4OLYL 4WU5A 4B0MM 3K91A 1NBZA 4LXFA 2BY0A 3V0AC 3NVQA 3IJHB 4NQVA 4FHKA 1DQKA 4R7XA 3SDAC 1W16A 4K9EH 2Q2EB 3ZHKA 5L4JA 4IBQA 3RFZC 1SJMA 5HBBA 2XOTA 3D08A 3WFCL 3SDAA 4DOHB 1NC2A 4OD2A 2WBJC 3RTQA 3D85B 4PJEA 5ACMA 1A2YB 5LBSL 1O9VA 4PFEA 1JPFB 2RALA 1PEZA 2A4ZA 5LG6A 2GITB 5EEWA 3ZDYB 3W0WD 3AXLB 2H32A 1EFQA 4IW4C 3BUTA 4K5PA 2OX5B 3ZY7A 3RNQB 4N6RB 1WBZA 2R15A 2JKJA 4U4BA 2IANA 1VF5C 5TDPA 3VFUB 4XPTL 4ZMQA 3QULA 4J3OH 3SE3C 1UD4A 4MD0A 1RL1A 3VVVA 5IHZA 4P5MB 3RURA 2OTWA 1FH5L 1W15A 2WTRA 3ZW3A 3MNZB 1OGAE 1AO7B 3QFJB 2Q87A 2BHZA 3D85D 1TFPA 3FO0L 1IC7L 2YFNA 5CLWA 4HUVA 5AW4B 1A02N 4OZHE 3Q2LA 3V4VA 3K7UA 4NQEB 4C59B 1IFGA 4PJIE 1RUMH 3LKPB 4ETQB 3ZQ9A 4K8RL 3KPMB 5D7IF 5ESVA 4C47A 4JZJC 4N2FA 4YBQC 2VRAA 5E0FA 5MENA 2DWSA 5L2KB 5C0IB 2V6HA 4ENZA 1JF6A 1EEQA 4WV1A 4FQLL 3V4PA 1J9RA 1L5GA 3B5TA 3WG7B 2VLKE 4F15B 3MYJA 1WP6A 1HZKA 1CICB 1HT6A 1LMKA 4S2SB 4PWJA 2F61A 3S5LB 2Z31C 5TDOA 1R3HA 1A14L 1E2VA 5EWIH 3ZDZF 3U4BL 2IQ9H 5AOMA 3TJHD 1N0XH 2XCMC 3KYAA 8FABA 3LH8A 2V0AA 1NPNA 4JRXD 2KHAA 5CILL 4F3FA 4PTUA 1EZUA 3ECBA 3OJDB 4S1SH 3OZKA 1JS4A 1T4KA 4X4MA 2BP8A 4WF7A 1RI8A 3AVEA 4E42A 3IVKA 4K2UH 5FM5O 3KS0J 2ADGA 1A5FH 4N1HB 1PLCA 2GAZB 2PTVA 3ZHDA 5F6HI 3VXRA 1CR9H 1HDMB 4PMEA 1UXWA 1Q0XH 3OC5A 4XAWH 1BZQK 1RJYB 5C6WH 4HJJH 1P9MA 2P4AB 2V2WA 4GG8A 4M9PA 4R2GD 3IFPB 4OLWH 4BWTA 2C1PA 3WDJA 4NJAH 1CE6B 2NY6B 2R29A 4HSAC 3QZOA 4OZFB 2HLAB 5C6TL 2DQFA 1M71B 2EDWA 4NLHA 5EFIB 3EYUL 2V4LA 2ZYHA 3VA6A 5CAYB 3O3BB 1ORQA 3UYRL 2BERA 4X7SH 4FCAA 4MTMA 4YGAB 1OF2B 2XQYK 3F12B 4GMSL 3BVVA 2V2TA 4HZLA 3ZDZB 4MBOA 3IMTA 3NJVA 5AOJA 4IGBC 4Z7UA 4L18A 1D9KA 2FBOJ 2HFFA 1OP3H 1XR8B 1DFXA 3CFUA 3VFRB 3VFGH 4YDJB 2CR3A 4G72B 1D5BB 3WU1A 5AVYB 1NEZB 5I8KL 1G94A 2X09A 2Z7YA 1KJ2L 5IEKB 2WZAA 1MCHA 2NX5A 5F88B 4HPYH 3GINA 3K0YA 4HV8A 4AEEA 1UKQA 1IGYA 4G1EB 1ZT1A 1QACA 1HWWA 3HG0A 4X5PA 4N24A 4OJYA 5DD6B 3TIDA 1F3JA 4F8QA 3DVGA 1AR1C 3V6OA 2P3YA 4OZIF 4LSQH 1IKFL 3PJNA 5FLUA 5I1HH 2C8NA 3D4CA 3UAAA 3ARDA 2ESVB 3QUMA 1LL1A 2MPAL 2PR9A 1TYRA 5BO1L 1RK1A 4K7PY 2IQAB 3HPLA 1MRDL 1O6TA 3PJLA 1J9QA 4JO3H 1CF8L 1INEH 1CLOL 3W9DA 3N9GH 2X4QA 3RU8H 3C8KA 3VGFA 4XNQA 1R3IH 2F5AL 4L3ED 5CZXC 5DS1A 2WMPB 1HH6A 2DQMA 2O6EA 1LDSA 4P2QD 5E7BA 5H4YA 3T0EB 3MJ9H 3MLXH 1FFPB 4IBZA 3CUPB 2BSEA 1QBMH 3EH3B 4K7PL 2CLZA 2UY7A 5LGJB 3UTSE 1E42A 3QEQE 4LEEA 5DJ0A 4KC3B 3NZSA 2XQYG 5I1AB 4X0NA 3L5IA 5GGTH 5AW2B 5HHQB 5DZVA 5INCB 4LFHD 4C4KT 4LHUA 4WFFE 4JY6B 1UUSA 5IMOA 3SQBB 3OXSA 2XRAL 2BOBA 1A8ZA 4OM0H 1WZMA 4L8BB 4AYDC 1RSYA 2IGFH 1NFAA 2GUOA 2J1ZA 5D2NB 2YXFA 2BC4A 1M57B 3SDDA 4APXA 5CEZL 3BKMH 3JTTA 1CFMA 1SFDA 3L9EA 4Y2DB 4EN3D 4Q4EA 3MLRL 1KELL 4C57C 5K69A 3RZCC 1AYRA 4AYMC 2CALA 3IMRA 2O1AA 5J6HA 1R34A 3QIWB 4UIKL 4X6CE 5LGYA 3LZLA 2XWJB 4CC0A 2PYFB 3QIBA 4IOIB 4GIAA 5DC9B 2EE3A 5LAPA 4PJAE 1YYML 4KXAA 5IVZB 1GMEA 4QRFA 1J5IA 2FO8A 3IRPX 3QZMA 1Z9SA 3B8SA 4ZFFB 2A6DB 4QEGA 2H7WA 4LL4A 3L3GB 3GM8A 1GRWA 3O4OC 1J1PL 1NC2B 3PGFH 3X1BA 1IM3B 5E9NA 3IGLA 2AQQA 3BPNB 3P0YH 3UZVB 1A2YA 3VI3A 3LXCA 3C60B 1HCVA 1DJZA 3QIWD 4S10A 4R7NA 1U33A 4L0ZA 2MMXA 5L4IA 5D1QD 5AVUB 5A16B 3S5LG 3QZNA 2YEZA 2VN6A 2M26A 4EBQL 1TZIB 4LGPB 4PJ9C 4AYID 1TXKA 5C0GA 2EDFA 4KQ4L 3QCVL 5CUSL 5I74C 2GAZA 3TEWA 3ZOAA 2O5XH 3VH8G 4N9GB 4PJHF 1G84A 3BP6A 1D6VL 4QUOA 1NDTA 1HJCA 3C6SB 1CYWA 5D7EA 1Q9LA 1SYSB 1Z9LA 1T1ZB 1TYJA 3EAKA 4KGLA 4OV6F 4BUGA 5DQDL 4CBZA 3PL6D 3EJUA 4FLRA 3CWGA 3HLKA 4KJQD 5I1IL 4NCC2 5BS0D 5DGRA 1X6NA 3I50H 3D50A 5JW4N 5A2AA 2C9QA 4U7KA 1KEGL 4P4KD 4D3CL 1P7QB 1GC1C 1XIWA 3L7FA 4S1QH 3ZDZE 3FN0H 1XCTB 3RUGF 4UTAA 3ZT5A 1GGIH 3OKMB 1R3HB 4JKPL 2J8UA 2WO4A 1IEBB 5MENB 4PJFA 1BECA 1NEZA 3BCDA 3C6LC 3MUZ1 1I9IH 2GY5A 3ILPB 4AQ1B 1S5HB 1YEGH 5C07A 3OPUA 3B9KC 4AQ8A 2JI3A 3MRQA 4LARL 1ONQA 3W3BA 1KIRA 1PBYA 4YDLC 3U1QA 4F7CA 5FF6B 3DO7B 5BVJA 1GAFL 3ETSA 4UBDD 3UJJH 4DEUA 4OIFA 1X9QA 3QE5A 1ZDSA 4JFZL 4MA3A 1XSIA 4F24A 1NOAA 4U3SA 3TNNA 1MFCH 4H7VA 3I2CH 4ZMOA 1UATA 4NNYA 2G5BB 1UCBH 2YSSB 4FFZA 1P5UB 4UTCA 4F9LC 4BFNA 1WV7T 1L9QA 3BD3A 3VFVB 5K5YA 1Z2KA 4NERA 1QI5A 2XPGB 5E4IA 4XP9L 4GXUN 2F5BL 5DEGA 2HTLD 1QEXA 1XCQB 4PGEA 3GPEA 1HNGA 4EMZA 2QELA 4QI3A 3GXTA 4NAMA 5D70H 3U4AA 3G5ZA 4Z7VA 4RH4A 4DQAA 4PJBB 1PLGL 1YQ2A 5JXEC 3CSPA 2VOTA 4KVNH 2YZ8A 4DETA 5HHQA 4ANKA 2H3XC 1BYNA 1CGTA 4L5FL 1CTOA 3GSVB 2WTOA 1WS7A 3FUEA 4TPRH 1HILA 2XSKA 2HJLB 2B77A 4CGTA 1FZOB 4UOW1 4PS4H 4TNFA 2FGZA 1TU2A 3G6JB 4HS3A 3D39B 4PLOB 3MMEB 2X42A 3UTTA 4N90E 1B4LA 3U36A 1HE8A 4ACTA 3LKPA 1QW9A 3DHUA 3RL1A 1WF5A 4M93B 5CCGE 1FC2D 1Y07A 2ARJB 4JG1H 4MAUH 1UACL 2YS4A 4L2LA 2B08A 3DLQR 4JRXB 2BNQA 2FX7H 4PMFA 3BI9X 1E7VA 2NTSP 3L3OA 3UGUA 4AJYV 1BQKA 1F41A 1HXMA 2C1OB 1BOGA 2YMXH 4NO5B 3HOGA 5C3IA 4Q9QL 1UVQB 2VISA 4G43A 1JWMB 5CJ5A 1AD0A 4IRZL 2X89A 4PJIB 2YUZA 1XGYH 1RZKL 3QPKA 4LGRB 4HJGA 4XBPB 3WFDL 2JJVA 3M1OA 1P9MC 2VLRE 3KVPA 3LQMA 4EI5A 4R0LA 1X5MA 5HGHB 2H2SC 4NPKA 2VITA 1DSWA 1K2DB 1SQ2N 1CPUA 3FCTA 5KS9F 2EDDA 1G6RH 5DJXB 1U91A 2FWOB 1OSYA 5E6SB 4XO9A 1F4YL 5SX4I 1GKOA 3LNHA 2GJRA 3BIAX 4GYBA 1DUYB 2F53B 4HZAA 5DHVA 4MB5A 1A7QL 1T5XA 4UTAL 4KI5C 4P9HC 3F8UB 3PAZA 2I60H 5AVVB 4HKXB 4AK1A 3IK2A 3RNKA 2O4EA 2ORBL 5E8PB 5LGKA 1MFDL 1HL9A 2HT3C 3KPLB 4OF5A 2DIEA 1M71A 1FVDB 4YSOA 3POHA 4PJGA 4JN2B 1WIUA 2PYFA 5HHOE 3R8QA 3EYFA 1CLZL 1UM6L 2YUWA 3MV9D 1BBJA 4M1GL 2KLSA 3OMAB 1MVYA 3KYKL 1B9ZA 1GJIA 1F97A 3SKJL 1GTFA 2EEBA 2CAKA 4BK4A 2DTML 2X4QB 4N86A 1RULL 4UOW0 1BWWA 1NEPA 2CDEB 2OZNA 4M29A 4QKXB 4ZTPL 3CHRA 5IW6A 5K59F 4NQCA 4QR7A 3HE6D 2A6JA 3PV6B 3H9SA 4N90D 3FRUB 3B2VL 4G83A 1M2OA 1HN1A 2ZOWA 3GJFA 5HJGA 1T03L 3AAZB 4TF4A 4IBWA 3MX0A 1TZIA 3FC8A 5GGSA 2PW1A 4I18A 3LXBA 1O6SB 3V4VH 2LU4A 1L7IH 3UPAA 5I8OH 5DJAB 3ZT7A 1KB5L 1HOCA 5FO9A 3BPCB 3MHZA 3U83A 5I6OA 2AJUL 4BZ1H 3PF2A 1IE5A 4QGTA 5DZJA 5HI5D 5F9DC 1LE5B 2NY7H 1JNNL 1WIOA 5AL8A 1WZ1H 1BSIA 4A7TA 5IMLA 4GLRH 4CN4A 3L4XA 3LZNA 1QLRB 4I2XE 4K9JA 4ZMVA 3LEYL 1JN6A 4AV4A 4JY4A 2WVUA 2AVFA 3E3QC 4WUUB 3HG2A 4CVZB 1F6FB 2NY1D 4X98B 2XPGA 5IBUG 4UOZA 2WLYA 3VQ2C 3X1GA 4TNWF 1Z0NA 3ASWA 3VXTA 1YVLA 2EE0A 2FBRA 3DDFA 4JM4L 3TPKA 2AMGA 3WIHA 1A6PA 3EHBC 1PDKA 4L9LC 1YEFL 5T1LA 1A22B 1YN7A 3MLYL 5EV7A 4XB8A 1I8LA 3GSUA 1FIGL 1KGIA 1WWWX 3JV6B 6FABL 3GIVA 4B9IA 1XGUB 5IEKA 1HQRA 4XN7A 4U33A 1I7ZB 1DSFH 4P9MH 3HI6H 2EO9A 2N1KA 2HKFH 3DO7A 2KDYA 5I71B 1UG9A 4R3SB 2A6IB 5LWYL 3ZX1A 1BG9A 2VSKB 2DQJL 2IOOA 1THAA 2WXPA 1EGJL 2Y7QA 1KB3A 2ZX8A 3MJ7A 3U2JA 1NOLA 2XQBL 2Z4QB 1FQ9C 4Y5VA 3D07A 2AXGA 5HGBB 3BVXA 4WI0A 4WW1A 4KJWC 4CBPA 4X4YB 1SXCA 3ARFA 3JUZA 4FG0A 1JWMA 1H5BC 2EEFA 5BPPA 3MRLA 1T89A 3U30C 5E00A 2C4FU 4O2CA 3EYSL 1L6PA 4NQDD 3O3UN 2WOBA 4G70B 3N85H 4MQ7A 3IMBA 4QHMB 1IEAA 1HOEA 3WTSA 1F18A 2XVGA 4KKLC 1I3GL 2YC1B 4KBPA 1X4XA 1P1VA 2YEZB 1I7UB 2CLRA 2P5WD 3DRTB 2AK4B 4ZD3L 4FOMA 1O7VA 4BQBA 3W2DH 5JQ6L 4P2RA 2X6AA 1A6ZB 1FFRA 3ZBMA 1OO2A 1JGEB 2YUVA 4HUMB 4C4KO 2WBJA 3TBWB 4JFSA 5F9OH 4DUVA 3W38A 3O2WL 3SZKC 4CVXA 4JM2B 1JZ4A 1KGWA 1YMHB 4NQSA 1UQSB 3DO3A 5FUOH 4NZJA 1IQWH 2L0DA 5JYLA 2JH2A 4LDOB 3N55A 3KBFA 2D4FA 1EAOA 3IFLH 3BO8B 2P8MB 3QNXB 5CZVH 3H4FA 4LCVA 3NABH 4TVPH 1JHTB 1TTFA 3MACH 3CX2A 4NDMA 1E2ZA 2IAMC 1UM4H 4JDZB 2X4NA 2R83A 1GS7A 1ICTA 2B1AH 4P4KC 2NR6A 2XWJA 4UV7L 4AI7A 4XPFH 3TN0B 2K45A 4B9KC 3LVTA 3O6MH 2BVUA 1OCWH 1P5UA 4FI7A 4EI5B 4LNVA 1XIWD 3ESPA 1I7TB 3F6JA 3L1GA 4ONHB 3DTXB 1IEHA 1XH3A 4LLAA 2HWZL 5CMAA 5F7YC 4XN5A 3VSVA 3ZLQC 3G5XB 2GEEA 1P4LB 2OMVA 2HJKA 1K72A 2PPFA 3JTSB 3PXJA 4N85A 3BDYH 3OG6B 5E0QA 5FHBL 1DJSA 4FXLA 5FYLE 4ZUUA 4L8DB 4IRJA 5AVXB 5IBLC 3JVGA 2V5TA 1MLCA 3EO0B 5BMFL 3T3MF 3II3A 2FT8A 2CO2A 2XN9B 3CZLA 3EJQA 1PAZA 5F7NC 4G9DA 4MJ2A 1YEKL 3NCFB 1FZOA 2VWEC 2B8OT 3EKCA 3TEYA 3BGMB 1NAML 4UQCA 2H45A 4MNGB 5DR5L 4OF6A 4C83A 3CZKA 4QRRA 1RZPA 2EYTA 2ZYRA 1QRNB 1V3KA 3CVHA 4WHDA 4BXSV 3RNKB 4AEIH 3EADA 5J4MA 2PXYB 5L7XH 3PFUA 4BHUA 2YPVH 1IJ9A 4K7FA 2GHWB 3J07A 1L6XA 2ZX6A 1RJZB 2LFEA 2GB2A 1NBCA 2VN3A 2Y6SD 5F93C 5CKGA 4XNZC 4AJWA 2VDKH 3GMOB 3NK4A 3RTLA 1HU8A 5F7DB 4NQCE 2YN3A 3LS5L 5T1LB 2RQEA 3EOBA 3K2KA 4CDHA 1JZEA 3N41B 2XTLA 4GUOA 1PLBA 1F4WL 4ANWA 5I1JH 3A22A 1S7TA 1RULH 1CDUA 2J56A 4O2EB 4PUBH 1TEFA 2FB4L 3VFOB 1URIA 1KB5B 2B2XL 5B7MA 4F20A 3VI4F 5TQ2H 2YAFA 4R6UA 4ODHL 1UWEH 2Y2TA 2VSCA 1UT2A 4IJTA 2Y1VA 4KI5E 4GG6F 1UM6H 1CFSB 4ISVB 1ZK5A 2DBLH 4JPSA 4MLSA 5GGSY 2B15A 4N8VG 1HZHH 4HG4K 2NNXA 3B7TA 2CWRA 7CGTA 3L3DB 4YWGL 1BYOA 4JRYB 1MFDH 2ICEC 2VLKA 3PS6A 1MCPL 3MVSA 4RDQF 4HXBL 4WI0B 5EIVA 4X4YA 1NKGA 4KO9A 4QY8B 2Y0SA 4POZD 3SKNB 4JKNA 4TQ8A 4OCMC 2DY2A 3IJYA 2PYEE 4L29A 3KYNA 3V9CA 5I5RA 2PYED 4J3XA 4OGQC 5F8RC 2BVYA 4DUXA 3NQIA 2VDQH 3AUVA 3MLYH 4Y16D 5SWZE 3CHOA 1MZZA 2J1XA 4KX8A 4NO3B 4OIIL 2HWZH 3CGTA 3R7RA 2AP2A 2CDEA 1MW0A 3SDXA 3AREC 2NCMA 4WI7A 4NKMB 2XWXA 4GG6B 2B1HH 1E6JL 4MA7L 1E4WH 1KJVA 1LO5B 3QUMH 1OCWL 5GS0L 4OTXL 1B9KA 4HIJA 3V6OE 3P9LA 4HOXA 4FLOA 2TRYA 2WINB 4Z7WE 3MOBL 3PP3K 1SHSA 5KS9E 4XPFL 4OCSL 4XZ4A 3BAEH 1PZ5B 3NTCH 2D73A 3O41B 1S9WA 1UACH 4NQEE 3HHSB 1XD0A 3MACL 2HT2D 4ZNEE 3BGAA 2L4OA 3MTXA 1GJWA 4HJ0C 5F89A 2ZX5A 4GW4B 2OKMA 4ZPVA 2GSGA 3O8XD 3WNKA 1G9MH 5EUKA 5DUBA 1U8KA 5H8DA 3HFFA 2W0FA 4JFFB 3WO4C 4PHXA 3TN0A 4PLNC 3C2AH 1P5VA 1JWSA 1T03H 1UH4A 3CVIH 4IRSD 2X4RA 5SX5H 3KH4A 4LHJB 4LVEA 2X4SA 2NY3C 2YAQA 3QR2A 4GW1A 2Y1AA 3GZPA 5CJ8A 4YL9A 4AE0A 1SY6A 4MJ4A 2Q1EA 4LPVA 5HDRA 3C9NB 4P2RB 3GTNA 3PUCA 5AYUH 2D2OA 1GIGL 1OAXH 1PD6A 1YUKB 4GSXA 1GKEA 4JPVH 3U2IA 1ASOA 4GO6B 1CBVL 4TTDC 2YD4A 2BJML 3BZ4B 3IDJA 3M7OA 2AV1A 4PRBA 2R69H 4HGKC 5D7LD 1U3ZA 1NGZB 1UD2A 5E2JA 4HKXA 3IDYB 1B3JA 1MPAL 4UF7C 3NP3A 2CO7A 1JN6B 4U3HA 3KPRD 1JHTA 3IFNH 2DQEH 3RPKA 4M3HA 5ID0A 3IXTA 1AO7E 1QABA 3QFJE 3ARPA 3QNZA 5JXEA 2I60L 3A4DA 4PIRF 4J5VA 1A4JB 1G9NH 1U42A 1ETA1 2ERJC 1XDTT 3DRQB 4HETA 1IGTA 3EW3B 4R96A 4LARH 3VFMB 4MZ2A 2YWYA 2CSPA 4Y7MA 5C0IA 2CK2A 4UDUB 1OPGL 4RGMC 4FLHA 5EOQL 5TD4A 4H88H 1QW8A 4UTBA 3DIFB 3ROLA 2CPUA 1ZT7B 4RFEB 5J8OA 4L1TA 3JV4A 4Q74A 3GSWA 4XMLH 2A6JB 3BDBA 4YFLF 4TQIA 1XGYL 4F57L 3BHBA 2BNRD 2YD1A 2X2UA 3D6GA 5F3HB 4AOFA 3BZEA 1WFTA 1T4KB 4TSAH 3WD5H 5JDJA 5JORA 2FX7L 1HXYB 4TOYL 5DQDH 3R0NA 1QSEE 1U8HA 2VAJA 2VLJD 3UL4A 3CPLA 1GW0A 4WEMB 3QQ3B 3PXHA 1T21A 3QIUA 3BIKB 1JHKH 4KRPB 3FSOA 2HTKC 5EIIA 1YUHB 3M1BA 4Y2LA 5FHAL 4RSYA 2Y7NA 4AH2B 2APSA 3JV0A 2ADFL 2X0VA 4NJ9H 5E1HB 3KE0A 3X12B 5DUJA 4DWHA 3O4LD 4E9YA 2YOAA 4HQQH 1V7NH 2D03L 5EZLB 4XWOD 1B4RA 5AOKA 3K2MC 4D9QE 5I8CB 3RIKA 5FUCE 2V2TB 3OGCB 4PV8B 2J43A 3OXRB 1EJ6A 2DMCA 2DEXX 4Z7UB 3HC4H 4W93A 4NX0A 2HVJA 3QB7C 5D2NC 2BHYA 1J0JA 3PL6B 2OTPA 4GSDH 4HBQA 3KEDA 4IOFC 2E46A 5A2BA 3M8OH 1X5IA 3V5DB 3QQ4A 4KI5F 4GG6E 3EJJX 1YNLL 1VCBC 1GGTA 4HEMA 1O75A 5TE4H 5F96L 3P9LB 2NR6C 4QRPE 3QI9C 3V52H 4GOSA 2ICWI 4UU9B 3I2CL 3RY5A 2RB8A 3WLBA 4FL4B 1VFOA 1CTMA 1U9KA 2R23A 3UGEA 4ZSOB 4RMUA 3OJDA 4FAAB 2WZ6A 1DN0B 4X7TA 3ZRFC 3LKNB 4DP6X 1OB1A 4FXGB 5ISZB 4CU6A 3U1SL 1I8LC 4BE5A 5B39G 3KLAB 3H0TA 3OMNB 3HIZA 4NQDA 3MRJB 3GMPB 4PGCB 1NQBA 1ADQA 3MPCA 1HHGB 5ENWA 4PJAB 4Y5VB 3D18B 2W0FB 2WZPD 3RG1C 5KOMC 4CVWA 2IGFL 3N40P 4IIQB 1M53A 3N91A 4J28A 3V6OC 2WP3O 5DMIH 1X4ZA 4WW1B 4PRDB 4LU5H 4DKEH 1IBBA 3CVHB 1YEGL 1QWUA 1CD0A 4HX1B 2NDGA 3BJ91 5DDHA 4CILA 3VYNA 1Q9OA 3QDGD 5I66A 4EIUA 2W38A 4OU3A 1U92A 1D6EA 4GW1B 2BCKB 4XTRD 3C5ZD 3QEQA 3V0JA 4PJFE 1UOWA 5E08H 4Y5YA 2DJSA 3EH2A 2V8LA 4N1EA 3OZ9L 4PJ7E 1MCOH 1X5GA 1C8QA 5C0CA 4HZLB 4JJ5A 5L0QC 2FT7A 2PXYD 1JL8A 4WHTB 1SLVA 4YHKL 2VXSH 1N5AA 1Y6KR 3HLAA 1LHZA 1QFWM 2XV0A 4O2EA 4H25B 5D4QA 2WJ7A 5TDNA 1KB5A 4L1DA 1QYGH 5INDA 5IHZB 3IKCA 4IK6A 5HHPB 4YMPA 1FBIH 2BNUA 4S0TD 1DEEB 5GS0H 5FB8B 1SHXA 2OMYB 5MEOB 4LLYB 4PWIA 2G3MA 4GKNB 4GS7C 3P77B 3HKZA 4JDZA 5B1KA 1KB9J 5F7DA 2BPBA 4JANB 2VDQL 5EU6E 5GZNA 4ZMAT 1XR8A 3EYVB 1THCA 4JMXA 3ABGA 3ULVE 2X12A 3CZFB 4Z78A 1F2XK 4AV0A 1SEQH 3MBEA 4XC1H 5DMGC 1SPDA 3I6GB 4PGBA 5IBTH 3TONA 5FWQA 5C0BE 3PDGA 3RWIA 3GXMA 2XT1B 3MBEC 4UI2A 2PCPA 2VR7A 1GPOL 2XZAL 1TSRA 3MBWA 3MLUL 2OTUB 4EE2A 2N3JA 4KJPC 3IDMA 4FYQA 4UNVA 3HNSL 4WTZA 2WBXA 5DHEA 5A7EA 2K8MA 1WVZA 4ZOBA 2FEEL 3GTVA 3IS0X 4F58H 2AABL 3WKNA 4MYWB 2W9DL 1RHFA 1TFHA 2A77L 3T4AC 5SWSB 1Q0XL 3FSWA 1IC1A 5E8DL 4TRPH 3BZ4A 3P11H 3GBEA 4PRBB 4PUBL 3RDTC 1G7IA 3SGJA 5KANI 3QUYC 1H15B 3TZVD 5CP7B 4RBPK 1MFEL 5J57B 1A7OL 4MZRA 3OPZL 3SE3A 3Q5OA 1JV2A 3U4EB 5IIEA 5B21A 2UY7B 3ZSSA 5LGJA 5E94A 3PWJB 4H8WH 4FJYA 1P84J 4C56B 1IGYB 5F1OB 1XB3A 2YPVL 4QCIA 1HHHB 1RURL 3ARED 1HEJC 2BVOB 3MR9B 2OULB 2VDOB 3HBQA 1S5HA 3BPLB 1WAAA 3IGAA 5MENE 1EDQA 1JGLH 1KCUL 3U79A 1QLEB 5KN5A 5C8JB 8PAZA 5FDYA 1UEMA 2ZXGA 4DOHE 4OJFL 3LOWA 5JIHA 4G11A 3PNWB 1INEL 3QDJB 4NHCL 1NC4A 2QPEB 5T3ZD 4IJ3C 1RZKC 3JWNC 4GW4A 5BMFH 4B41A 5T3ZE 5MP6L 5KSAD 3FMGH 4H1LB 3FT4A 5C70A 4K3JH 3BD4A 5FFGA 3VXRB 4TUJA 1T0NA 4X8JA 5JORB 3WIFA 2F2HA 1GS6X 1U3YA 3GZKA 4FQXC 5CU9A 1CXKA 1AGFA 2X88A 3MGOB 1I8AA 3KPSE 1EFXB 1MVUB 5E95B 5IOPA 4RIRA 2AQTA 1C9SA 4IRSC 3W9DB 3MCKB 5B38B 3BGFC 4ONFH 4TS6A 1X9UA 5LBGA 5GZOC 2IOIA 1LQBC 5INCA 1I1FB 2X6CA 5I66B 3X11A 5I1GL 3I6LD 2BVTA 3D05A 4ORGB 3S0PA 3QHZH 4AKQA 5IKCB 2FH6A 1NCOA 1LTXA 1FL5A 2NOYA 3BEVA 3OHXB 1DCLA 5AW3B 4DCQA 4YHLH 1Q0YL 3LN4B 1LEIA 3MJ8A 4GO8A 1J1PH 2VDLL 1PMYA 1KCRH 1M05B 2VTFA 3ARGA 3V9FA 4JDTL 4XP1L 3D0VA 5CXPA 1YPZE 2NX5B 3ZDYF 2YD9A 2WWMC 5CNHA 5I6MA 1BMGA 4HIHA 1I3VA 1R3JA 3HN5A 4KQ0A 5KVGE 5DC2A 3O2DA 3C6LA 4ZJ9A 4BA0A 4KKRA 4YHPB 4Y2NA 1G6VK 5IHWA 3FQWB 1IGCL 3OGOE 4MJ6A 4F37F 4LCWE 2ZOKB 5FA4A 5ISZA 1CR9L 4YHYB 2ESVA 4ZUVA 2VQ4A 3KNBA 4OZIA 5F72S 5J1TC 5JQ6H 1A6WH 1RK1B 4LLYA 3NIFE 5B1AB 1WC7A 4HK0B 4MQXC 4M8VA 1CS6A 3MLRH 3ARBB 2GK0A 3MV11 5C0AE 3KPNB 5GRUL 4ABQA 2VXUH 3GXNA 2G2RB 3RVTD 3QS2A 3NSFA 4BK5C 1SF5A 2CRYA 3OKNB 5J3HD 1BJ1J 4PJIF 3IEAA 4UT7H 3L5XH 5HGAB 2D4DA 4Z78B 2DMHA 4W9ZA 3BZEB 4OJAA 5AB0A 1G7HA 1LILA 2WGNB 1JPGB 3V0WH 5C0CB 4YHZH 3QXDA 3U9UB 3AY4A 1T04A 1UXMA 3PGCB 5B1CA 3FCTB 2GUYA 3SBWA 1HIMH 2ZG2A 3PCYA 2J88L 1DBJL 4PU2A 1Q38A 1J8RA 1QSVA 2Q7YA 3QEQB 3FUNA 3WEXA 3AU0A 1E9PB 2OTUA 4K8RH 2XX1A 3MKGA 3BWZA 2NDFA 1K9TA 1M7UA 1YEHL 1DQLL 2PTTA 2NY4C 3PP3H 5ICYB 4XMZA 1BJMA 2F5AH 4UOQA 4X80H 1LO2H 5CWSB 5E8OA 5T5FA 5CM1A 5I30H 5CLYA 4Y4FC 4Y19B 2LFGA 3IDXL 3B2XA 3N9GL 4PM1A 5EIIG 2R1XA 2FIKB 4FA7B 3GYRA 2VWEE 4MCYA 1NMBH 1P6FA 3LH2H 5H2BA 4KK6D 3KYOA 4LNRA 1XF3A 2VAAA 5ANMA 4A2GA 4LRIA 1FIGH 4HK3J 3NRQA 6FABH 4PJHE 1OAUH 3ABLB 3NIGF 5CCHE 3TX4A 4GFXA 4BFIB 5FLVA 3L5WB 5KBLA 4LHUD 1IKFH 1TMCB 4DERA 4FFVC 2YQBA 2ZCHH 2DEWX 4GT0A 1CLCA 5I75C 3IF1A 3GS7A 3CFCL 2DH3A 5HYEA 4UDUA 2QMKA 3D69A 5KVMC 3NSCA 5B1JC 4YXKL 3AABA 2WWKO 1RIVH 2E76C 3MXWH 4FNUA 4HT1H 1E4KA 1MHPL 4NNPH 5D7HA 3DSFL 5J1AA 3X2QB 5I6XC 1V7ML 4XP6H 5HHMD 5FYLD 4HISA 4P57A 4WU7B 4LLWB 4NZUH 4AUUA 3ZL4L 4YAQB 3BWUF 3ULVL 5JO5B 3UDWC 1U8JA 3ARZA 3PRZA 2G0LA 3TA3A 5IEHA 1KDIA 3NSXA 4KFMA 3V10A 4G8FA 3S96B 2Q7NA 4Q2ZB 1BQHA 2ZJSH 5GGRY 4PJ5B 2BK8A 3NIGE 1DANU 5D7IB 3OKDA 4D9QD 1QFUL 3FU8A 2BNUB 2J8OA 2L04A 3MBXH 1B6DA 3QW9A 1GY2A 4H44C 1LP9F 5MEOA 1KIUB 5K39A 4NO0B 1U93B 1EXHA 4N0YH 4AZ8A 1RH8A 1NIDA 1T7ZA 3PP4L 4WFFD 4KXCA 5JMRA 1N6UA 4NC2B 5F7WC 1ESOA 1AYOA 1ODAA 5JZ7D 3SKJH 4J3VA 1NWOA 3JXAA 3FUIA 4PAZA 3FT9A 3T3ME 5LGHL 1A3LH 4M62L 2V9QA 4LSUH 4UNTA 5F7BA 4MKMA 2EC9T 3RWEB 2B14A 2AHIA 3RVWD 4RETB 2Q8AL 3MMEA 2YD6A 5D72H 5LG1A 3U48A 4B95C 2WWNA 1UD6A 3ECUA 1E4XH 3DIDA 3B2UC 4E0RA 4ICWA 1BEYL 1ZVYA 2UZXB 2IGTA 1SMOA 2P24B 3HE6B 3QIBC 1TVBB 3T2QA 1TU2B 3G6JA 4M6ML 1BQHG 1I8KB 2FUQA 4W81A 4QTHB 4ZX4A 3PHQA 4JFXB 2Z34A 3LD8B 3E2HB 4UZUA 2H8PB 2XZCH 2JKIS 3MRBB 4TVSa 4RMTA 1XGTA 5DVPA 1YJDC 4XMTA 4JFEA 1OARH 4NENB 2E7DA 3IPEA 3NJMA 4JEGB 4ZDHA 4JRXA 4WNQB 5I19L 5AVRB 3MV8D 1W72H 4J8QA 3WFDH 2VDRB 3WIFB 3RKDD 1IE4A 1P84K 2H0JA 3MGOA 1TJHL 2VDLB 1N6VA 2CO4A 1P6AB 4JQXC 4IRZH 3QUXB 3GSNB 5FK9B 3QUYA 4KJYA 3SDCD 1G0YR 2X4PB 2QADC 5E51A 2JCCB 4AEHH 3T2OA 3MOAH 1J87A 1XBDA 1A7PL 1Z9OA 1YHPA 4I3GA 2JIXD 2QR0B 3MV7A 1VFBA 3L48A 3KPOB 1QSED 2IADA 3EJRA 5B22A 1JOIA 2JKRM 2PLTA 4L4VD 4EDWH 1FLTX 1H6EA 1USQA 4WHTA 4EZKA 5ACZA 1FGVL 3UJIH 4BRJA 3IGAB 1RAMA 5L6YL 3WIAA 1NPJA 2GJZB 3QVAA 1RHHA 2AI0H 4KKAD 3EDFA 5DT1L 1T5XB 1TMQA 1WT5C 2J6EH 2V7NA 3KW7A 5TPWH 1BAGA 4PS4L 3STLB 5HDBF 1QVOA 3QUYD 1S5IL 2RGSA 1N68A 4BH8B 4APQA 1VPOH 2VABB 1P7BA 3ATFA 3QXTA 1BCIA 3ARDC 4IRJD 3SPCA 5F7HA 4XNXH 3NZUA 3DHPA 4KVNL 3T65B 3GQFA 3OWRA 3GUFA 5JDSA 3VXRD 4QXGH 2CDGB 3QNFA 4QRQA 4BZ2H 4CGUB 1ES0B 3VXTB 1F0LA 4D0BA 1UVQA 2VISB 3T0XA 4J3WA 4D8OA 2VC2L 4WUUE 5EOCL 4MD5A 3VD0A 4L4TA 4YR6A 1EO8H 4A2LA 4D2NA 3ZT6A 3D69B 4DPBX 1L0XA 4CADA 1ZV9A 2VDRL 1JE6A 1TLKA 4JO5A 3AM8A 3GLAA 3H4HA 1FG9C 5HXMA 1NGYA 3PWPA 3D33A 4IOSA 2NY1C 5E5LA 3A3YB 2G0KA 5E4EB 1CK0H 3VH8A 2SEBA 3ZKMC 1FO0A 1TQBC 4Q89A 2Y2YA 3KHOA 4S0SD 5B4MD 2Y06H 2CXGA 2XWDA 3K6DA 1A1OB 1DL7L 2FX8L 4AG4L 1I75A 5JW3L 3ZO0A 1VGKA 3ARYA 3T0VA 2R56H 1JXFA 1J10A 2YQ2A 4XX1E 1ZDQA 5D7SL 4BH7A 1MJ7H 3ALPA 1WE5A 3LKOA 3L17A 4M4RB 4YXKH 4WO4D 3UG5A 1HSAA 3V4LA 4FQHA 3PWVB 4M48L 4YSAA 2J1YA 4PP1C 1D2OA 1TQVA 2I25N 3PWJA 4U2YA 4YXHH 1WUNT 3D0AA 2WXKA 1N0LB 1OZTG 4W6YB 2FX9H 1DBKL 4QRUA 5ETUB 5JUEH 3POCA 4GRWE 3GMRA 1BBDH 3NSYA 4ZMPA 5F1IA 5D2NE 1RQ5A 3I9GL 3FB5B 4HFWA 5CJQL 5CJXC 4ZMWA 2Y23A 4L4TE 3QZWG 2AXHA 1KGXA 4H0HB 4KTGA 4Q52A 4WIQA 1ZT1B 1R5VB 5IQ7L 4HJIA 4RESB 9PCYA 1RUQL 4HJTA 3QEGL 1LO2L 3WL9A 3RVUD 3NZHH 2EECA 1PIGA 4AT6A 3SPHA 1LO0H 1CG9B 3G5YB 1CT8A 3O3EB 3H6AA 5DZOA 1OK8A 3BWUC 3F5WB 3NIDE 4MVBC 4JK0D 5KSVB 2J88H 2PKDA 2FNBA 1V10A 3MODH 4ODVH 3WE6B 3A0OA 1DBML 4HHGA 3KYMB 2DQFB 1NCAH 3BGMA 1UENA 5LCVL 3FH7A 2LW3A 1E8XA 5KJRH 1Y1UA 5EF0A 5JHAA 1CDHA 2R8SL 2J6WA 3MNWB 2WAHA 3E38A 3MRCB 2XTSA 4G1MB 2DIJA 2N0KA 1I7UA 3B3IA 4FZ8H 5LKNA 5AG9A 3L5WA 3LQAC 4IKIA 3C12A 4HUCA 1FF5A 3TJHC 5GRUH 2NY3B 1JXJA 5E1QA 5BW7C 1ERNA 1JRHI 1MCSA 3RZWA 3T2PA 1NBQA 5AAWA 1IT9L 2NNCA 4NQTA 1E4XI 4ERSL 4IBVA 3OLEA 3C60C 1I3RB 2V5YA 4GINA 4RFNC 2EE9A 4EQ3A 2VKWA 4BWUA 4FFWC 4AW7A 2OBGA 1IC0A 1XEUA 3C5ZB 4MNQA 4F9PC 3VCLA 3DGGB 4XXCC 1AFVL 1OD7A 5D2LF 4N6QA 2FEDD 1I8KA 4URTB 2XPYA 5KYXA 5JOFB 4TKWA 1OZUA 2XN9E 2K6YA 2CJUL 2YD3A 4XMWA 1UKSA 4E0RB 4MWFB 3P3TA 2EILB 4JREC 4RGMB 1NCHA 4NQCD 1Z6JT 4UM8A 4JUTA 4GQRA 3VXSD 1VB9A 1J8HB 3EBAA 3GHEH 4FQIH 4FZEL 4FFYL 4A6YB 3VXSE 3ZZSA 2Y24A 4KKQA 3P30L 2H1XA 3FYEB 1JAEA 2G4GA 4XVUC 4YEEA 4Z7UF 1YEJH 3EZJB 1MJ8H 4CVUA 2E9JA 3KPPA 2BP5M 4I48B 2IBBA 5D6CB 3KPRE 4ZUTB 1ZWIB 4W4NA 5D1ZI 4A7SA 2OMWB 1JZ3A 3PGDA 3D9AH 3OKEB 1NMAH 5DF0A 5AWNL 4BFFA 1AG6A 4M93C 2B4CC 4I13B 1I8MA 1FNEA 2LV4A 2W0PA 4HUWA 5C3LD 4BFOA 1VEOA 5I1CH 3MROA 4FERA 1JPEA 3H2WA 3B4NA 4H5SA 4OJFH 3SDCB 5A40E 4NKMA 4GG6A 4PREA 5D5MF 4LLVB 5DI8A 4F8OA 2HPTA 5C97A 2FR4A 3O11B 3K1KC 2CRZA 2YPLB 3LAFA 1UA3A 4LNRB 3N5AA 4M3JA 3KWWA 5EO1B 4DPAX 2E7CA 4LSVL 5I6KA 1O7DC 3LEXB 5TE7L 4GUCA 2PO6C 4P2YA 1JFQH 3VFMA 1RLWA 1EUTA 3REVA 1XF4B 3SKUD 4PJ7F 1AD9B 3BKJH 4X4KA 3VSTA 1MWAH 2PYEB 3H6JA 3PJSA 1V55B 4GMSH 5FGBA 2A6DA 1B0IA 3IF1B 1CL7H 4Z18A 5IW3A 3TVMB 3L2NA 1TVHA 3WSQH 3LPPA 5LVEA 4EI6B 5IF0A 1MXDA 1XR9A 5EZJA 1AFVH 3VYPA 1FFTB 4M6AA 2FYYA 4LCIL 1M6OA 3FPYA 3N04A 1R5VA 4YDMA 1SMDA 1XMWA 1B0GB 2WQRA 2MCMA 4B53A 4F33B 3LY6A 1JV5B 4UILH 1EEYB 5D1XC 1MIML 1AHWC 3S8WA 1YEWA 4XN8A 3S3PA 3LS4H 2KI6A 2AJXL 1J7VR 4OT1L 3QWQB 4TSCL 5DC4B 3X14A 2I5YH 4BFEA 2C5DC 1VCAA 2NXZC 3MRKA 1HSAB 4ANXA 1UJTA 2WLIA 1SN5A 2MQCA 3RKDC 4MNHB 1DVZA 3ESMA 4YXLL 3GO1H 1LK2B 4PJ5D 3W37A 1BJ1H 3SO5A 2ARWA 2K3TA 5CFAA 2X70B 2H0FA 5MEPB 3LZOA 2KUTA 1A6TA 4AIEA 1CYXA 3PABB 4KZDL 2VDKB 4HJ0D 1EAQA 3QWNA 3D0LB 3GJFH 4I5BB 4EVNB 3F7KA 3P4OB 3MRRA 4QT5A 2D31A 3H3KA 4QHNA 4L2YA 3QEGH 3APNA 1XGQB 3VTTA 4OGXH 4RGNC 1OV8A 3JTTB 3LSOA 3KDPB 5A2CA 2XXGA 3S3SA 4KVCL 3BKCL 3CBKB 1QG3A 2Y9RT 2ISDA 5DJ2B 3UO1L 2CHZA 3UOAB 4E5XA 3UTTB 4IBSA 2AJ3A 2WXGA 2CIKB 3IMSA 4G6MH 1K8IB 1RZIB 4P99A 5JDSB 2CJSA 4G6KL 2DL9A 4D9RD 3FQXB 4LEOB 4NZRL 3SY0B 1IGTB 3EHBB 3OB8A 4NNXB 15C8H 4QRTB 1UC6A 1X5AA 1ETZA 2EXTA 3IJ7A 4NPYB 4PRDA 3SDXF 3VFSB 1KY6A 3QIUD 4PVLA 4MDIB 3IJYB 4YHNA 3RVVC 1DSYA 1YNTF 5AW6B 4ZMNA 2R56L 1YJDL 4DTGL 5D8JH 4Q4IA 1N8ZB 1QFWI 2F58L 2IVFC 3TN0D 2HJFB 1PGRB 4GAAA 3VFTA 2O5YL 5T1KA 4HULB 4YDKL 5IJBC 2AQ3A 2Z31A 3QJVB 2VITB 4A2MA 3GLDA 1U30A 4PV9A 3QUKA 1QRNE 1KXVA 4DN3H 2NNRA 3UTOA 2P8PB 3T3PE 4AV5A 3ZTJH 4NLAA 3BSZA 4WFHD 3VCLB 2XDHA 4XCYA 3RWHB 4E41D 3FB5A 3CPLB 1DVSA 1U95A 2VXTH 2Q6WA 4AC4A 2YWZA 2OL3L 2XTJE 3P0VL 3RIAF 1AIZA 4KROC 2C9PA 5C0CD 3BIKA 3QQ4B 1MI5E 5EIIB 4X9BA 5DWUH 1NDGB 4NRXA 4I3RL 5A6MA 4U1GC 4N0FA 2B4CL 3ZIMA 1TLMA 4Y5XB 1LJMA 2IEPA 3CN1A 2JCWA 1UD3A 2OI9B 3WFBH 1CFVL 4P3DA 5LQBH 4EN2A 5EF3A 1UXSA 2HRGA 4I0PA 4Z0XA 5JXED 5DUBB 1U6AL 5C0AD 3WJLA 1XF1A 2DI8A 3VXSA 3GSRA 4TUKH 4C56E 1FFNA 3JV4B 2PYEA 4ZO9A 1KNOA 3K3QA 1UZGA 4O9HH 3IPBA 2IIJA 3D48R 2YRBA 1BXVA 2EDLA 4AIZB 3H9SB 3GRGA 3B9KB 3WAKA 1JZ2A 4M7ZC 3PWLB 3WGUB 2D7OA 3EXLA 3SO3B 2HB0A 4P5RA 3GJFB 2CLVA 3BUYA 3UTZB 3VH8B 4ZNCD 1ZVNA 2QEJA 4IDJH 1KJMA 2AV1B 2YMOA 1A7PH 4L3FA 4LSRH 4MVBD 2JJTC 3NAAL 4Y0GA 2HT4D 1OT4A 4ZS7L 1VFAA 4EIGB 5B3SB 5C0GB 3HUJA 1G87A 1EJ8A 2Y3NA 1ZJAA 4UDTB 3VFWA 4XXDB 1BM3L 1K6QL 2XBZA 4LPUA 4HS3B 1S9KC 2YO3A 4XMLL 1CIDA 2BOLA 4LCWA 5ISZE 5F1NB 5ABZA 2JK5A 1S3KH 2XI9A 1QA9A 4FYTA 2FT6A 1OCCB 2RQ8A 1PY9A 3B9EA 3F58L 4G8EA 1E3FA 5K33A 1J8HA 3VGAB 3I6LE 1J9TA 2VNCA 1QTYT 3MXVH 4PJ8A 4PV8A 1YRKA 4ZFOA 3CZSA 5LXVA 3EH1A 1WYJA 1M9SA 4QRRE 3FB6A 5DXWA 2X3AA 2R1YB 2QHRL 3HAEH 1IEBA 5GS2D 1FN4B 4TUOB 1PY4A 2E74C 1OD9A 4L3EA 2VDPB 3IFNL 4JE0A 1CIUA 5LDSA 3SQOH 5KYXB 2WXIA 4H8QA 2WLMA 3QDMB 1HL8A 2VM4A 1KN4L 2JKNA 3L9YA 5FUZL 1KV7A 2UXGA 2R69L 2L3BA 1S8DB 5DK3A 3H0TB 2WLHA 3JQOB 4G7QB 3TTSA 4OZGE 4OI9A 5GRVL 1U8HB 1GIGH 4C56D 1MNUL 1J0KA 1DANT 3MROB 5G4MA 1BOGB 4R4BA 2IH1A 2VDML 4NHUB 3KGTA 1QLRA 3ARWA 2C9SA 4MD4B 2G75A 1YY8A 2VN7A 3BP5A 3F65A 4RGNE 1KN2L 1QFOA 2V33A 4KDWA 1AOHA 2WYHA 4K7PX 2EE6A 3GMQA 4QRAA 5D6CA 3KWWB 5EO1A 5A1AA 1I1YB 1SBSH 1LK3L 1QBLH 4X6EB 3EXJA 4Q9RH 2ZF8A 5C0CE 3L4ZA 4JFYB 2ZUYA 2AEIT 4MJ5B 4PJ7A 5ESQB 1D5IL 3DBSA 3FQ1A 3IETB 5KOVC 4P2OA 1JVKA 1L0QA 4UT6L 1BFOA 2WOYA 2XWZA 4UAOC 4M7LL 1QFHA 2X38A 3DPBA 5FYLH 1CD1A 1SJEB 1WUZA 2IWEA 4LLDB 4XNYH 2WTPA 5CO1A 3T3PB 1X7TA 4PJFF 1D9KC 2FQDA 4W9KC 5I73C 2DWDA 2W65A 4L1BA 1W9XA 4U7MA 5KW9L 3CSYB 4IMKC 1ADQH 2P80A 2Z65C 3ULUF 3P4MB 3HG1B 1ZS2A 4JDVA 1U3JA 2XN1A 3OD3A 5IQNA 1MHPH 2JTDA 4OTXH 3UJTH 1MWOA 2NY2B 2NQCA 2VN5A 4GKNA 2R2BB 3AJ7A 3VW3L 5KYWA 1NCCH 3TT1L 3RL2B 3QUZC 3RDJA 1KC5L 4PJHB 5HHPA 1JPTL 5JHLA 5HP5A 5FB8A 1HCFX 4X83A 5EEVA 2GJ6B 2QKSA 3EHBD 1L3WA 4JQVC 4AQEB 4HH9B 4KJPD 4YSTA 1U8IA 1RZIA 3DJZA 3QQDA 5CGYC 3L3OB 2CRIA 5FFLA 1HH9A 1VGEH 4YNYB 2Q8BH 1CTNA 3DKHA 1MJJB 3DIVA 4MBRA 4Y7OC 5GJTH 3TV8A 2WANA 2OJEB 1YN6A 3ZIYA 1UM5L 3P73B 2O61A 1TTAA 5C0BA 1WK0A 3UGXA 1Z5LA 3KS0H 1MEXL 3UAJA 4OD1H 32C2B 4I18B 5T3ZL 2L8AA 1NIFA 5F0LB 2BIMA 5CZKA 4JL2A 3SGDI 3QT2A 4HC1H 2VLLB 2MOGA 4XCFH 1M05A 3I3DA 3G9AB 4QGYA 4X50A 1G7IB 1YA5A 2Q86A 2GYSA 1RZFH 2R4RL 1FE8H 2WXOA 1RCYA 3O3AB 4E41E 2MWCA 3OBAA 3SDCA 3B3BA 1F45A 1KYUA 2JB5L 3K72A 1ZE3H 3L5XL 4RIRB 2C4XA 3FW6A 4DGIH 3WKML 1T0PB 4G2AA 2HX7A 5MERA 3S88H 1MAKA 2DMGA 1WCBA 3MRNA 1RXLA 5GS1A 4E5XG 3T6WA 4BD4A 4OI7A 1LM8V 3D2UB 4AGNA 1WAEA 5C0DA 3NP4A 1BFVH 1SHWA 4M5ZH 4QXWA 2PWGA 3F7RA 4ODSL 5D6DC 1W72A 3SDAD 3WHE0 3C8HA 1MCFA 4QT5B 4WV1B 4ODWB 3CLFL 5L2JA 2V2XA 1O7SA 1CGSH 2ZXQA 1T22A 4P4RB 3LCYA 3CZFA 3EOBB 2K7QA 3O4LB 4OCWH 1CLYL 4PJ6A 3ORJA 1J05A 4PGJA 2QVTA 4O02B 3B6SB 1FA4A 3K4ZA 4L3EB 2WCPA 5T3XL 5TGBB 2DWTA 2I7SA 3MR9A 5HYIA 3L95A 2R0WH 2X1OA 2WK2A 2W60B 2VYRE 5JO5A 3NH7H 1BG1A 4JDTH 4HF5H 3TCLA 4CRPA 1FG2A 1NFDB 2EDMA 1KZQA 1SQMA 4ECNA 3BRDA 1YC7A 3WAJA 3GSQB 4OV5A 3BH4A 2D9CA 4PD4J 1ZLSL 5DUPH 4NFCA 2X6BA 5DD0L 1LO4H 1R1CA 4OCLC 4KI1A 4MNGA 3QULB 5FAAA 2IH9A 3BYTA 2DKSA 3DK2A 3OL2A 4NGHH 2OCJA 3FT4B 2JK5B 5F7EH 5HHNA 3JZYA 1FDLH 2XKSA 3B7SA 5CP7A 3U30B 2IC2A 1OP5K 2H47C 1RIHL 1HHJA 2VERA 1CI3M 2CA3A 3D5OF 3G7TA 4XXDA 3S37H 3WN5A 2E47A 3K8LA 4WWKB 4DVBA 4CMHC 1KTJA 5B38A 5C1MB 4PV9B 2BWIA 2OYKA 5JXAH 1AKJB 4NC1E 4I9XA 3AXLA 4JHAH 3WELA 2XICA 5I73B 1XX9C 1D9KB 4V11A 1FO0L 3BSZH 4WEEA 3NCCB 2V3DA 3EJZC 1UM4L 1OE3A 2YKKA 1BF5A 4N2GA 1CO1A 4TXVB 3D3VD 1R24A 3VXMD 3CFBB 2H9GB 3HZYB 3NZ8B 3ABMB 3VG0L 1L5GB 3S8FB 3QDMA 1NAMA 2NY6D 3CVCA 4NN6C 3MYJB 3D06A 1IQWL 3FFDB 4JR9H 5SX4H 2DAVA 1B2YA 1YEEH 5D9SB 4H20L 3S5LA 5HDQL 4JFDE 4DP1X 5C71A 1BQSA 1TVBA 4DZBB 3BYYA 4CC1A 4R3SA 3UROR 3LV3A 4YSUA 1AXTH 3MLPA 1OAYL 2WKOA 3ZE1E 1K8IA 5E2VH 5IROC 2A73B 4ZNEA 4AMKH 1G4MA 3HPLB 4DPRA 1ID2A 4GRWB 4ODSH 2CXKA 4H8HA 2H3KA 2Q5BA 1B6UA 2FSEB 3L6FA 5DEJA 3V0DA 4L8CA 4KV5E 4PY7A 2CJ3A 3DGCR 1EV2E 2XWBA 3ARGD 4HS8L 1A7OH 3PHOA 3S88L 3ARFB 1S7WA 3PDOB 4GRLC 3TBTA 3WOVA 1B3IA 1F4HA 1Q72H 1XMEB 2OZ4L 4PJCE 3S35H 3WHE1 5CR1A 5HY9B 1KMGA 5IESH 4A7GA 1B0RB 4XRCA 5C0JA 3QUXA 5ANME 1CL7I 2OX5A 4HMDA 4NQQA 2A77H 2WCSA 4IYKA 4QYOB 2R4RH 4BYHA 2DLFL 1MFNA 2WLLB 1FAKT 3QYMA 3Q5TA 4YVUA 4IGBD 4RMRA 4Z3JA 2JXMB 1NAKH 4GFTB 3FNKA 2P45B 4WY7L 2OMXB 3VMPA 2ZXCA 4YPGB 4ONOA 3MUHL 4X9GA 1FAIL 4YDJA 4YN3A 4P2RD 5IFHH 1S46A 3V4VB 2EH8L 1JGDB 2Y07L 2VDNB 1AR1D 3H53A 2XIBA 3L2MA 5I5MA 2CBTA 2PXYA 3RY4A 3V8CA 1PD1A 4OZFA 2B5IC 1CFQA 3CFJB 2HLAA 3B5HA 4PRHA 5BUAA 2EVJA 4JFOB 4HCRA 3DX8B 4I2XB 3L3KA 5L2KA 2CPCA 4PCKA 1LO3L 4H8VA 3LKSA 5D71H 1JNLH 4BFIA 2LLGA 1VERA 1T20A 3FQRA 2V3EA 5E6YA 1PLAA 5GHWL 3RPBA 2P5EB 1MAMH 4JFPA 1ILSA 1FBIL 2VDMB 3GGWB 2CO1A 1XT5A 3QRGH 1UT1A 1JCVA 4FG2A 3GSWB 3L4WA 2QSTA 2G30A 3O6FD 4F8LA 1G9NC 1ND0A 3DMMB 4HUNB 2ZNXA 5KSBB 5CSGA 2ZWZA 3FAWA 5D4JA 4R7NB 2FJFA 1BD2E 3IJSA 3U0PA 4XNYL 5A16A 5JOEA 4FKHA 1BD2D 1MREH 3MLTA 2YAOA 4XHJC 4NZDA 2YIHA 3U6XS 4KK5C 1V8HA 2NZ9C 3ESVF 4QF1B 3TA3B 1ZK9A 4U1SA 2CCVA 5IEHB 3APFA 4OJCA 4ZFZB 3RVWC 2EDYA 5BS0B 3NJIA 1Y7VA 3N6YA 4HZ1A 5TQ0L 4EN3C 1QNZH 4W9JC 4Y19E 4IIQC 2JJTA 3VDAA 2OMUA 1KN2H 5IJVB 2E86A 2VSMB 3BIBX 4JPIB 4KUCD 1QA9B 1HS6A 3GRWH 3SJVB 3IETA 5IGXL 3EDEA 4I85A 3NN8A 4KJYB 4TQHA 3G6DH 1E43A 3B1UA 3ARQA 3L7FB 3LZRA 4B3VA 1F8TH 5J56B 1IKOP 2AZUA 2WBKA 4DESA 1S9VA 1IFHH 4LT7A 2L7EA 4XH2B 1URLA 2APFA 2ZPKL 5F3BA 2IG2H 1CGXA 3KGUA 4MMZB 4OZ4B 3PL6A 3NJKA 3OAUH 4J3TA 1QFWL 3R1GL 1E65A 2ETWA 1R3LA 2P8LB 2R1YA 3W1ZA 4MA1C 2G3XA 5TE4L 1ZPLA 1N9PA 4XVSH 3ZSTA 3D87B 1MLBB 2HKAA 1SXBA 5TK2A 1VACA 4YK4B 5E8NA 1WBYA 1Z3GH 4OCRL 2H8PA 4MGXA 1IRAY 4U7SA 3TFKD 3QIWC 1U8JB 1UASA 5D1QA 3QUZD 4K71B 3OB0H 1HYSD 3HE6A 4KRMB 1WZKA 1OLLA 1G6RL 3FQUA 4LLMB 1OP9A 1B4JL 2C9VA 5CBAA 4UMSA 3K6SA 5F3FA 2X2YA 3HS0C 2DN7A 2DQ6A 4HUUA 3J7HA 2Y4SA 1KGCE 3KYMA 4GRLA 1FFPA 3PHAA 1DVYA 5GRVK 3MOQA 5ADOH 1T3FB 1PG7W 4R5TA 3IMWA 2LLLA 3BVNA 3OWEA 5I8CA 4NJ9L 1Q9LB 1RZKH 1SYSA 1AMXA 1BF2A 3I02A 3JWNH 4XPHH 4CA4A 5C3TA 4DO5A 5HPOA 4NSKA 4YDZA 5CD3A 3VMOA 1XD1A 1JI1A 1BZ7A 4IJ3B 4JQIH 5F0MB 4OCXL 3ME0B 5D7JA 4YSPA 5BZDA 1OIOA 1U21A 4DP8X 5CSBA 4OFYA 4PRID 2XVBA 4BH8A 4F15C 4DT2A 1F3JB 4F57H 3MRGB 3ULSA 4FQCL 5JHDD 1WFIA 5TDNB 2FL5A 4XNAA 3QGVA 3SGKC 3VTAA 4ZQTA 5HYJE 4MCZA 2J8UF 2EADA 4O9HL 3LPOA 3Q43A 2E56A 3K71A 3RL1B 4DQOH 4ZX3A 1FUNA 4H88L 4ABVA 1IGMH 5EEUA 1WHOA 2DM7A 2XHNA 4F27A 4NXSA 3MUGB 3SPVB 2AGJH 3KCWA 3IDNB 1TPXC 2ZKHL 3KH3A 3Q6FB 1DO6A 2NRDA 5IB5A 3WTUA 4ZUWB 4WWID 5AFAA 4GUQA 4K3EH 1S7VB 1AVAA 3TASA 4OLVH 3PAUA 1XCTA 1SJHA 5CCJA 4DN4L 4J3OF 5HHME 5CJXA 3ZKXC 4JY5L 4XP9H 1E7UA 2G5BA 4XBPA 2A83A 3ENEA 1L9RA 4HWUA 4RVBA 1KG0A 4P07A 3T8VA 1S7WB 1HCYA 1R5WB 2F54E 3PDOA 4FX5A 2BIIA 4MB4A 3TBTB 3R1GH 4PJCB 2VXTL 5JLZA 1AKJA 4OKDA 3I9IA 4YHMH 4WO4C 4PGEB 2ZPKH 3APDA 2Z93A 4F7CB 4Z77B 1A9BA 5BO0D 5DJYA 3DUUB 4PB0H 4B9FA 4JDEB 5LXGH 1VAHA 2ZUQC 4H0IA 1UJ3B 4R7LA 4OLVL 4P3WA 2WSKA 1GAFH 5D7JC 3JWOH 3C6SA 1LWHA 5F6IC 4YH6A 3EH4B 3MCG1 3GRWL 4KPHL 3FFDA 4R8WL 4EZLA 3KR3H 1F56A 4NO0D 3AADB 2WLJA 2DYRB 4LSSL 3GSXA 4P49A 5BS0E 4XB3A 5LCVA 1KGJA 3NIDB 1AGEB 1F3DH 3GKWL 5JNYA 1SOSA 2G60H 4AXWA 2OMUB 2XUWA 3CC5B 2EIBA 2VW7A 2R51A 1DHKA 2YD5A 2BS71 1A4JA 3KHQA 3UBXG 2ICCA 5FGSA 1ZRUA 1G9ML 1JGVL 4K5OA 4WK0B 4BKLB 3G5ZB 4Z7VB 5HI4D 2P5EA 5AYTA 5HDWA 4PI2A 4XODA 2P28B 5AENA 1YC8A 3I50L 3O3DA 3OAZH 3PQYA 4G6ML 3O2VL 3P02A 5TF1L 3TWCL 5FYKE 3LKSB 4IQHA 5EOTA 3WDHA 1C5BL 4YK4C 1I31A 1B0RA 4KVCH 1WA1X 4Y4FB 3LKRB 4JHAL 2YZ1A 3W5MA 3GMRB 2GEQA 1JYWA 4QYOA 4NS0A 2DQTH 4JQIA 1MAML 1E6JH 1FL6B 1XAKA 1CICD 1I4FA 3LNGA 1TJIL 4RGNB 4F33A 2X9YA 4E9SA 2X4UA 4JKMA 4G7VL 4U3SB 2J4WH 3L1OL 3OLGA 3BOVA 1JNLL 3WXWL 4FI6A 1RY7B 1GYCA 5I0WA 1KCSL 5KSBE 4N2NA 5HHOA 4YHYC 4ZFZA 2QQQA 4H2AA 5BNXD 1BD2B 1X3DA 3US0A 5DD0H 4WLCA 4X0KA 3QJFB 1ILUA 5F9JB 2Z91A 3BT0A 1AIFA 5DMGD 1F58H 4HF5L 1IM9A 1BGXH 3WTWA 2KZ1B 1ED3B 3CFJA 2Z7ZA 3HZVA 4OCRH 3GPSA 3F6IA 1PYWB 1FAIH 1S7UB 2NTFB 4GMTL 5T5FL 1KACB 2DB8A 4PWHA 1R6VA 4ZODA 5LNGA 1UH2A 2BVQB 2Y72A 3NIGB 2QVKA 2H1LM 2G9HB 2O6CA 3BEVB 3P0GB 4I3SH 3DUSB 5EEYA 1CGSL 1WCQA 1TNNA 1HAUA 4IU2B 4ZAKC 1QSEA 1S9XA 1HQ4B 2YRPA 3QJHA 4G7SB 1DQMH 1CXIA 4PJ8C 2Q0ZX 3O8XA 1SOKA 4LCIH 5KUKA 4GI8A 3LSOB 5EN2A 3NCBB 4MMZA 4OZ4A 4MB1A 4WFED 5GGUB 5CEZH 3EGSA 2AEWA 4KK8C 4LB8A 4PRAB 4ZZFA 2VLRD 1KEMH 5ITBH 5B39B 1LE9B 4HUKB 4OI8A 4DSYA 4EF3A 2VLJB 4JO2H 1B0GA 4MA3B 5B7FA 2AERT 2JQMA 2I7OA 2IMNA 5DYOB 1SMAA 1WC7B 5GGTL 2VXQL 1JFQL 3Q6FA 2N7AA 5IB5B 4NUGH 1M7XA 1IV8A 2OMZB 2FSEA 2ZXAA 4F7TA 5LBVA 4PLJC 1YY9C 1I1AC 3KAAA 5HYSB 2VE6A 5KWYC 4JFDA 4HHWA 3H7LA 3X14B 1A4KB 3FONA 4P8QA 2VO8A 2PPDA 3MRHA 3MJ6A 1K2DA 3MDJA 3WUWB 4KNQA 3SKOB 1ZA3B 2JB6B 2FWOA 1LWJA 1U91B 1ZTMA 3OLIA 3EOAA 4J23A 1ET8A 4U1JA 1TEGA 4NN7B 5E94B 1R5IB 3FTGA 3ARGB 4A7QA 2WLLA 4P3CH 2CR6A 5I1CL 3ME0A 5D7JB 2ZQKA 3NFSL 5D7LA 2Q3XA 1M42A 3GF8A 3ABKB 5IVNA 3D9AL 4LLVA 4M56A 4MNQB 4CKQA 5D71L 4BSWA 5JA8B 3P54A 4NUQA 1KBGH 4N22A 1A47A 3FQWA 2DTSA 1PKQE 4KUZH 2F74A 3R06B 3KNBB 3UADA 4PG9A 2WQAA 5A2IH 3KYOB 5JNYB 3FOLA 1PQZB 1PG7X 3L9RA 5B3JE 5A6IA 3PHSA 4EJ1C 4JFOA 4KRLB 4PY8J 3GHEL 3GK8L 1IAIL 3FQUB 1ZANH 4LLMA 2I24N 5SV3A 5KSAB 3NA9L 5DZLA 1KNOB 2APBA 2A1WH 4IMLA 4N8CL 4X7SL 3K1DA 4DGYL 4KZ0A 2A9AA 1DBAH 1EZVX 5ALCH 4ZYKB 5C6TH 4AL8C 2C26A 1ZT4A 3SGDH 4OLUH 3ULVD 5BV7H 1I1FA 1MF2H 1ZV2A 4GBXC 3X11B 4AENA 2HJKB 4UOJA 5A6LA 2WGXA 2E7LC 1KG0B 3BPOB 2J71A 5FYKU 1KCLA 3G5WA 3K6NA 4CJ0A 5I9QC 2XXCB 1A5FL 3QZWA 3B83A 4BQ8A 4PJCA 3AB0C 5JW4Q 2FTAA 3IU3A 3ZKQD 1I3GH 3ZN6A 3ZUNC 5J9PA 1MCKA 1SEBB 5I82A 3LD8C 2A99A 3CH1A 1SXSA 2UXTA 1U3HC 2YGPA 3GMLA 5AVZB 3UZEC 3V6FA 5G4OA 5IFJA 4JY4B 2R0ZH 3L4VA 3GMMA 3M88A 1E5YA 3VYOA 5EWIL 2EIMB 4A2DA 1OGAD 4X6FA 3KPQA 1TCRA 1Z9NA 2ZOKA 5FA4B 5C9KA 3K71B 4FMKA 1WLHA 2ZKXA 3MU3A 5AW5B 2F19H 2Q3ZA 3Q5YA 1N8ZA 3OMIB 3BP7A 3IDNA 2XTJD 5HDQH 4H20H 2GC4C 4UNUA 5T1KB 5G55A 2VCOA 5CLZA 4PJ8B 3CC5A 2FZ3A 2AQ1A 3VACA 3VE0A 4YBHA 2WXHA 3GIVB 3VI3E 3QK0A 3SDAB 1NUGA 1WIPA 5T3ZH 3Q13A 3T4YB 1YYCA 4ZXBC 3MXVL 1N3NB 1FZMB 4Z7VE 3S97C 5HYJA 1FO0H 3BSZL 4HLJA 4MDJB 1NINA 2WBJB 2NYZA 4ANVA 4MA8H 2P46B 1NCDL 1DSFL 4N8PA 3RVVD 4JN1L 4Z7NE 1XF2B 2J3SA 1IBYA 3CNKA 35C8L 7PCYA 3RWJB 3WNNA 4LCCA 4PRAA 1G5GA 1RIHH 4ZW3A 1L0YA 2IAMB 2CLVB 2AXFA 3BLBA 1FDLL 3TBSB 4AKPA 2GJ6E 4E5XB 2Y25A 1DP0A 2ID5A 4DVRL 3PL6C 4OFKA 1LE5A 4N8UA 5SWQA 1AGDA 3RGBA 4V1DD 5EBLA 5CBAB 1IM3D 1AHWA 2VIRA 4F7MA 4FTDA 4V2CB 3RWDA 3RTQB 1YNTB 1KIUA 5K39B 5D93B 2UVFA 4TVUA 4KROD 1RIUL 2BVPA 1AGEA 5LBSH 1PYWA 3V4UH 5HPMA 5D55A 1S7UA 4X98A 1IAOA 3IJEA 2WNKA 2R0WL 5I0VA 1ADQL 2IPKB 4GPVA 5KVDE 3SKOA 4HS6A 1OE2A 4R84A 1JNNH 2NY7L 2X70A 3AS3A 5T3XH 3VFRA 3ZKSD 4U1JB 4ORGA 4U1NB 4V1DB 5EBMA 3SCMA 3DJSA 3P4LA 1ETB1 2UY6A 5LDUA 3KL5A 3ZDXE 5KYYA 2YQ3A 4IRJB 3HE7B 2DM2A 2P52A 2J2ZA 2GC7C 4NP4L 1A6VL 1XGUA 1BZ9A 4Q9BA 2AEPH 1OAKH 3TNMA 1ECZA 1NMCC 3CPUA 2NSQA 2J6EA 1SUJA 2HFEA 1BFVL 4HUVB 1KTRL 1N2RB 2L7QA 4DAGH 4OB5H 3FHAA 3MRGA 2YQGA 4FMVA 4X9FA 3AT9A 3OB0K 5DURD 4F7PA 4TSBL 1EEUA 5IWLA 1E5CA 3IJ9A 3CFMA 1KGYE 2X5PA 4U1HA 1IBGL 4WU5B 4U6HA 4XPGH 2WPGA 2F8IA 4ZMLA 1SVBA 1HI6B 2YHGA 4OZGA 2IDSA 2NR6D 3DXAE 3PQYB 1X6LA 4ELMF 4R4BB 4Q0XH 1KBWA 1JZGA 4YDNA 5CEYB 2QSVA 2ZCLH 4MYPA 4EOWH 1GZHA 2HRPL 5FR3A 1QATA 3HRZA 4AQOA 4OZHB 2FH8A 4L3EE 4GH7B 4PJEB 2VDNH 1ZT4B 3CG8A 1BYPA 1WISA 4X8CA 4WI8A 4OUUA 4Y16C 2F58H 4LOUD 2RTTA 1F3DJ 3ZMEA 3VG9C 5ESQA 2Q10A 5C2BL 2DYPB 1BVKA 2R1WB 1N5YL 1J8KA 1HESA 3OZLA 3RWEA 4XR8C 3VXOB 2DQGH 4Z7AA 1MH5B 3A6CL 1VESA 2IH1B 3SJVE 3B2MA 5EN2B 2OA9A 4HAKA 2AJSL 3BP5B 2OSXA 2AS5M 2XTJB 4P2QB 5KVEE 3BCFA 2R1XB 4KKCD 1FI8C 1KPVB 4E2OA 4LBEA 3QORC 1NL0L 2VN4A 5FGCB 4JFXA 2YLKA 1EEZB 1LGVA 5FO8B 1P2CA 1UYWL 3S3JA 3O8XC 3V6BR 5CIPB 4UINL 4PJBE 2CGYA 5FOJA 3UBXI 4ZMXA 1N0LA 3QC5X 1LP9E 1E30A 1JWSB 4AENB 4A63A 1IM3A 5DFTA 4OSUL 1BEYH 1D5XB 5GRJL 1EXGA 2X4SB 2X10A 4HWEL 2J25A 4KK8D 4ZRGA 3L95B 1DVXA 4KDVA 4J3UA 4AYFA 4P57B 6PCYA 5GISH 4MJJA 2I9TA 3BAYA 4PGDB 4M62H 3N40F 4YAQA 5J9PB 4QDGA 1F4XL 1XCXA 2X4UB 3WEAA 2ZYIA 1UOLA 2ZKMX 1PY0A 1LEGA 4M7LT 2FQGA 3LMJL 2VMJA 3WFHB 5KYUA 3TBCA 3MBED 2VDMH 5DCCA 3WFBL 4BGLA 1I1AD 1MNUH 1Y6NR 4OR1A 5L88H 4Y1AB 3GDCA 3S4SB 5F7LB 1U4FA 2H2PD 1ZIBA 5GZND 2A2QT 4Y2DC 1KEGH 1KTDA 1PG7L 1UCBL 1NIEA 1OLZA 4P4KA 1TO4A 2DQUH 2FK9A 4NP4H 1J11A 3OAZK 4KTDL 5H94A 3SBWC 3K5RA 4JFZH 4LHUB 1W8EA 1QAWA 4FQ1L 1MELA 3CN4A 3T71A 4Z7NF 3U0TB 1ZGLB 3HHMA 4XCCH 1X5JA 2VLLA 2JMRA 5SV4A 1D2PA 4KHXH 2ZUVA 3MCLH 4JW3A 4LAJH 3ELQA 1BZ9B 3L3GA 4H8WC 4CN6A 5IB2A 3STLA 3ET9F 5J12C 4PG9B 3V4UL 5FF6A 4EUPH 3O6KH 2IALB 3VXQB 2EUVA 3BQUB 2IDFA 5IM7A 4KZEH 3H9SD 2XFXA 3IXTB 4ZBJA 1HINL 3CQPA 3L3HA 1M9WA 4M8QA 2F7RA 1DN0A 1I85C 1NCIA 4X7TB 4JFFA 1IIIA 2ZCHL 4U1HB 3F05A 25C8H 4XX1G 2ADYA 5K9JL 4D3CH 2DQCL 3GFUA 5C09E 3FCGA 1BDYA 3HMWL 3OX8A 3HJ0A 4QRPB 4RAVB 5E6UB 2NY5H 4ZS7H 3V6FB 1MFVA 3V0HA 4Z7IA 4TQEH 3HRZC 2R69A 3F84A 3HNTL 4HD9A 4NQXB 5KUMA 1YUHA 1BM7A 3HC0A 2J7LA 3X3FH 3VD5A 5T3XD 3T8XA 1C12A 1J18A 4WO4A 1JZ7A 3N06B 4MA8L 3VG9B 4IIZA 2MFNA 1A4AA 4U6VH 1Z0MA 4R97B 1V5JA 4DEPB 5JIIA 3NJJA 4P0DA 5CUSH 4GKSB 3M07A 3EO1B 3R19A 2CK0L 1DQLH 3SPGA 2J2ZB 2LVEA 1INQB 2PR4L 4EBQH 3VD9A 3WTVA 5JHDB 2ICWA 2WO2B 3ES6B 4FLSA 4LLDA 1MFAL 1ORSA 1KSRA 1AQKL 3IWUA 3RX7A 3KCPB 2RD0A 1DVUA 3HNVH 3QAZC 4JY6A 4M7JL 4PRIE 5HJ3A 3DX6B 4ORZC 3VQMA 2F19L 1MG3C 1X5XA 4X99B 3M1BB 3RE0A 4QJ3B 4AQ1C 5EO9B 1IARB 2NXYC 5LQBL 5K1JA 2R0ZL 3QDHA 1X7SA 2AJYH 3RFRA 1M1SA 1BOYA 4Z7QE 2NXZB 5EH1A 3RHWF 3BW9A 1KPUB 1PQZA 2R23B 1TQWA 1TKWB 4MJIB 1BXAA 3ECWA 3LKNA 2NSXA 4B7IA 4GKZA 5BZWA 4U6HB 1XGRA 4PS3A 6TAAA 2BNQE 2XZZA 3II1A 5E8EA 4LIQL 3CU7A 1HI6A 4OZGB 4ZI8A 5TE6L 1KELH 4ZYKA 2RJMA 1ACCA 1WPCA 4KNTA 3I6GA 4PGBB 1DJHA 4HOWA 1XF2A 4OLUL 3BAXA 4JZOA 2PP7A 4JCWA 3OMZA 3UTTE 1QO3B 4WWOA 2X1WL 4PJEF 3INUH 3N1QC 5ALCL 4FXKB 2CGRH 2AMUA 5D7KE 5KS9B 4PJEE 4XHQA 5J3HC 5KYYB 3GBNH 3NIFF 3E3QE 4X6DB 5CN2A 2MNUA 2W60A 5ECJE 6PAZA 3VMNA 2R7EB 3HS0A 4PJXB 2DL2A 1QBBA 2X9WA 3A21A 3VXUA 3C75A 2TAAA 1EHNA 5EU5B 1MFAH 1BQLH 4HIQA 3MJ9L 4YS4A 3L3IA 2QQNH 1OKEA 4MJID 3S34H 1VFUA 2VZ3A 2XYCA 4X6FB 5IOKA 1M1XB 1NPUA 3V5HA 1KJ3H 4WW2A 4L4VA 3G5VA 4U6VL 3SN6N 1FRGH 3GS4A 3E1F1 3TVMD 2YJQA 1WZLA 1KENH 3DARA 4K3JL 4LOFA 2MPAH 5KVEL 3IYLW 3N44F 4PS7A 3LTVA 5GGQL 4LP5A 2QKIA 4EI6A 3SDYH 4X42A 3Q8FA 1MG2C 5IJCC 1O6VA 2HRLA 3TZVB 5CSZB 3SQRA 4KFZC 5KVFE 1RZ8A 4WKZB 3VFNB 1HSBB 5BOPA 2DWXA 3GO1L 2F68X 3FZUD 4UTBL 3NSDA 2FATH 5C07E 5E5UB 2PO6D 1ZSDB 3VRJB 3DX9A 5AZUA 3GMPA 4PGCA 2FJFB 1SVZA 3H55A 4F7EB 1VLXA 5JW5B 4YHIA 2I5YL 5D7IE 3MCLL 5BRZE 2R4SL 2YN5A 3F5WA 3P3RA 4G3YH 3BWAA 2UX7A 3TWYA 2CZNA 5CEYA 4U6YA 1FZJB 1F13A 3EJSA 4PREB 5SWQB 1MCCA 1X9RA 3EYVA 4NBXB 4JQXA 1ZHKB 2GTZB 4WKXA 4MMYA 5HDOA 3DX0A 1JYXA 5T1JA 3W57A 2J5WA 3AROA 1SM3H 3HC0B 1OWRM 5FECA 3ARSA 4K5LA 4RLDA 5HGHA 4DGWC 4NKOB 1HHIA 5B3JF 4FGMA 1P2CB 4QHKI 3FQNA 3P4OA 3U6RA 2PCPB 3JZ7A 5D1XD 4LMQE 5EB9A 5FC9A 2C9UA 2ZOLB 2XQYA 1K3IA 3Q2NA 1MUJA 2JSFA 1B90A 3MLUH 5C0RH 4MLIA 3EBIA 1I3RA 3GLZA 3WFEL 2QFPA 2IH3A 1ZHNB 3TO4B 1D5XA 2NNAB 3ECQA 2WKLA 1CGVA 4AVKA 1NCUA 3C6LB 1CFNA 5IBTL 3V55A 2HX8A 1JDDA 4BSVB 3OM3B 4RQQA 2D0GA 2DLHA 4HIEA 4L1LA 4BELD 5ACLA 4IK7A 3BAWA 2BHUA 5BQDA 3JWNE 1RZ7L 3LEXA 2VKXA 4NBZB 5BJTB 1IAII 1JZIA 2QSCL 4XOEA 5TH2A 1A3QA 4NNXA 3EOTL 1JV2B 1PCSA 3TBYA 2HKHH 3U4EA 4N28A 1DLFL 5A3ID 4PJAA 4LKXB 3SPJA 3BUPA 3KPTA 1BA9A 2XWTA 4UT9L 3VXSB 1HXMB 3VGAC 1TDQA 1KF9B 2O30A 5KSUB 1GZHC 1UZ8A 3NESA 3T04D 3L1FA 5KVEH 4KRPC 2DM3A 4DEWA 2D0HA 2VLKD 3CE1A 2H6UA 4GKSA 3BVNB 4U6TA 1NGXB 3ZR5A 2H3NA 3AG3B 4LLQB 4D7BA 5IB3B 5JLZB 1BFTA 1M7DA 5DTFB 3HUJE 1KJ3L 5I1DA 3BESR 1KBVA 4KXBA 4XGZA 1IM9D 3OV6A 1MJ8L 4P48A 1DBKH 3BN3B 1XH2A 1KY7A 5JUEL 4LSPL 1S9YA 2Q3AA 5F7KC 1INDH 2Z1PA 2R1WA 4MD0B 1FVCA 2NLJB 3X13B 1OARL 5F9WC 5E6ZA 2P7TA 2N7SA 4BKSC 3LHPL 3INOA 1DFBH 3D3VB 2XZCL 3VWJD 2TSAA 3LRGA 3WCYA 5LUMA 5HJ3B 2FR4B 1XQ4A 1UZ6F 4AGOA 3INUL 3T2LA 4P05A 2ARJQ 2IBZY 43C9A 4X4XA 3WUWG 1X5LA 3J2PA 4ALAC 3WJMB 2NMSA 4BUHA 4K9EL 1E4XL 4YQXH 5SWSD 4OVUA 4KJQC 3TYGH 3HVDA 3CD4A 3U1SH 1HYSC 1HHHA 4MNQE 1P69B 5I1KL 1VSCA 4UM9D 3DTXA 3PWPE 3T77A 2YFOA 1YMMD 3ARDD 4Y4FA 1S9VB 2WYZA 4LO9A 2N59A 4NCC1 5E5MA 3QXAA 4DP0X 2LGNA 2F9BT 1H5BB 3KJ6L 4XPGL 2VDRH 3FO9A 3UH8A 2RFXA 1OVZA 3O6LH 5JIQA 2XFGB 1F1GA 1JYVA 1EO8L 4M9OA 2FBJL 4G5ZL 3BISA 2AJVL 4OF3A 2B59A 3VDCA 4FHBD 3VWJB 2ADGB 4ZO7A 4BZ2L 1LWRA 3RUGA 5DJAA 1OAKL 3LRSA 5JW5A 2AGJL 2PPEA 1VZHA 2YA0A 4KKBD 5T5NF 1E9QB 3D12B 5IFAL 1QPPA 5CWSA 5E8OB 4U31A 1ACXA 4WTWA 4RISH 3X3GL 1IM9B 1B0WA 4NAQA 3QG7L 2NW3B 4KK6C 1FFOB 3EUUA 1OW0A 3FUMA 3NZHL 1NKRA 5DT1H 5HDLA 4JNXA 4ABUA 1JFHA 3ECVA 4JKKA 4NOBA 3HJEA 1XL4A 3VI4B 3QPXL 4A68A 3IAPA 3UJIL 4UIMA 5DURB 1T04B 3DSFH 1RIUH 2F53D 2J12B 1ORSB 3P3YA 5DHMC 5T1MB 2BSTA 3C5XA 4G9FA 5HHOD 4Y1SA 4B60A 1TNMA 2GIXA 3CFCH 3ULSB 5G5DA 1MRFH 1T89C 2WIIB 2P8LA 1F90L 5HHXL 1JZ8A 3JV6A 3HE7D 4PP1D 1ZEAL 3HA0A 2WCGA 4N0FB 3TH2T 1MQ8A 3G04A 3Q7JA 5DQ9B 5DRXB 1W72L 4AQAA 4GSQA 1NZRA 4HK0A 4KZEL 2VRQA 4PSPA 4JO4L 3CK0L 2HRHA 1G0DA 4JN1H 3TT3L 1KLUB 1S7VA 4EDXA 2E7LA 5KYWB 3QJRB 4PJXA 3UTSD 5GGVY 4XC3L 2ATPA 2HX9A 2V9TA 3PWNB 1WFNA 1MY7A 3MUGA 3SPVA 5D7JD 5HGAA 2HFGL 4GBXB 1E6OH 3IBOA 4JFDB 3WXVH 4UQ2B 2J20A 3DJRA 4YZFF 3UEQA 3ROOB 1G7HB 3CHPA 4N20A 4QIRA 3VFSA 5C6PB 1HIML 1UOKA 1YDPA 4PJ7B 4E36A 3FQNB 1MSPA 3NMEA 1QLEL 3FRPG 4XZUB 1A64A 2ZNWA 3QUYB 2ED6A 4GY4A 2K70A 2WYTA 3QXWA 3CZNA 3U4KA 2R27A 3NPZB 4LOVA 1A3LL 2EIJB 5LGHH 3I6KB 1XSKA 4TMPA 3RIFF 1X5YA 1HHIB 3AQZA 1KJVB 1LO5A 5KBDA 5AYUL 3VD4A 1VFAB 1GA2A 3B37A 5DD3H 5FGCE 2IANE 4QOKD 2AQSA 1QSEB 1S9XB 3QJHB 3G6AA 2D3NA 2F18A 4JDEA 4XNMA 3GMNB 4YC2B 1AKJD 1Y0LA 1LQSR 3D3VE 3N0AA 4IM8A 4ZW7A 4L4VE 4XNXL 4YHPA 1QRNA 1FZKB 2X2JA 1DQQA 3GXDA 1RSFA 1XAUA 5GISL 1VPOL 3QPQC 4EKXA 2ATKA 3G5VB 3AQXA 1L9NA 4MSWA 5F89B 2P24A 1SDDB 4FABL 4F7EA 2R59A 2A4CA 1A3RH 4NM8H 5GRJH 4A2FA 3MCYA